2OU6A

Crystal structure of a putative metalloenzyme of the duf664 family (dr_1065) from deinococcus radiodurans at 1.80 a resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
183
structure length
183
Chain Sequence
PTFNPELHAQTLNSERAYFVQPDADPAFTPHIGALVEMLTYARLTTLQAVEGLPEDQLWATAPGFANSIGTLLAHIAAVERVYHVLSFQGRDVTPEDDGAAYWGLTMGKEGTAPARLPTLDELRAELADARAETLRVFAAKDDAWLAEPLGPGWANQHWAWFHVMEDEVNHRGQLRLLRQVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hypothetical protein (NP_294789.1) from Deinococcus radiodurans at 1.80 A resolution
rcsb
source organism Deinococcus radiodurans
molecule tags Metal binding protein
molecule keywords Hypothetical protein
total genus 63
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04978 DUF664 Protein of unknown function (DUF664)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 2ou6A00
2P1AA 3DI5A 2QE9A 3DKAA 5COGA 5COFA 2RD9A 4N6CA 2HKVA 5COMA 2OQMA 5CIVA 3QTHA 1RXQA 3CEXA 2NSFA 3GORA 2OU6A 2QNLA 2NSGA 2YQYA 2F22A
chains in the Genus database with same CATH superfamily
3TULA 1MNDA 4Z9JA 1XWJA 4U5GA 1M57C 1VYIA 3ZSUA 5JS5A 2ZXPA 3DAGA 3EGXB 2CGEA 4W8PA 4U5FE 3A9CA 3LS0A 3SXMA 1BR1A 3IHUA 3U8VA 1FAPB 5KYWA 2OOCA 2YLIA 2PNOA 3ZQVA 4MW8A 3S27A 3B29A 3KH2A 1D0XA 5FCLA 4E7SA 3K1HA 3G50A 1G4WR 1OCRC 2Y3BA 4O7GA 4O6YA 3VYWA 4DBQA 1Z5ZA 3NG1A 3N24A 1R5ID 4IB4A 1VLTA 5A69A 4FWVA 3PMRA 1A7EA 5JP7A 2XLWA 5B1AC 5AC4A 1XZQA 2Q3TA 3V5YA 2XLDA 2R7VA 3ZTMA 1LS1A 1Y4CA 4LDRA 1ZHYA 3TOMA 5A6AA 2A6HF 2A69F 2HV6A 4E0IA 1NLXA 3SXZA 2E87A 3AGUA 4CS7A 2R7UA 1U0BB 4N6CA 3OA1A 5B3SC 4JJGA 1HE9A 5BQGA 3HNJA 2P7VA 5L0FA 4Q5SF 1Z23A 4IAQA 3ZQYA 2IXMA 2V3CC 2NUTB 1TQGA 2KYHA 2J9BA 3EGDB 1PD0A 3KMIA 1MMAA 2A6EF 2L81A 4OD4A 3SZRA 2ZD9A 4O79A 1YLMA 3ECSA 3NKEA 1F1MA 2HMQA 3U5SA 4PJNA 3GEEA 2Q9AA 2J8WA 4JC7A 1MMNA 3T4RA 4YT2A 3DJNB 1MMGA 3RW0A 2YQYA 4KBLA 3M15A 4MTOA 3ZTZA 3EH2A 4MVZA 3PCVA 2X0CA 4BJ1A 4YT8A 3AJMA 5JT4A 1FNTc 2IM8A 1NFOA 2IOQA 3PHF2 3DZAA 5E3CA 2RD9A 4XPWA 2KJGA 4EBBA 1A7DA 2NG1A 4UDVA 4WJ0A 1SMYF 3B0UX 2Q00A 5COMA 3ZVRA 2PF4E 1A41A 1C03A 4I44A 3EZIA 3X2QC 5JUAA 1WASA 1OCZC 1RKCA 1XZPA 2QUPA 3B71A 3G4ZA 3W4YA 2BC5A 2PX0A 4JVSA 5L3VA 2ASRA 1E86A 3LESA 3POVA 2DGJA 3LUTB 3ATPA 2OG2A 3LS1A 3N0TA 4BEJA 1ZHWA 4XWJA 2XM4A 3Q6NA 4XPYA 2P0NA 2W9YA 4JRZA 2IBFA 3SXKA 1FFHA 2R03A 4FESA 3VAYA 1D1BA 1IW7F 3DE9A 4ONSA 2J0WA 2OJED 3IEEA 5A6KA 3L8IA 3S90A 1D0ZA 1APCA 4H54A 3W8IA 3H2UA 1HW1A 1ZZPA 2JX0A 3CAXA 2M4EA 3DKAA 2LD6A 3HNKA 3EHNA 4RBNA 4CS9A 1U89A 3HNLA 3Q6MA 2P61A 1ST6A 5CI8A 5IY5C 2HJMA 3C63A 3E9VA 5BQHA 3NKDA 3MYFA 1LE2A 4NTAA 3KPHA 3TOLA 3C8GA 2B0HA 1V55C 2W4MA 2GFHA 4G0HA 3V5XA 3RVZA 3QZCA 1YDIA 1JR8A 1UFBA 4PFPA 2AWCA 4O6MA 2TMVP 3H2VA 3B0PA 4BJ5A 3QVZA 2C04A 2OCCC 3DXJF 3HTKC 2KC3A 2EPMX 2AP3A 2CYDA 2H7OA 4YT5A 1K05A 3EZHA 4DRJB 2J9VA 3OWTA 5DS5A 3GEIA 2WL8A 1CPRA 1EA8A 2A0UA 2Y39A 3KL4A 1LKXA 5JLIA 4G7ZF 2P1AA 3J06A 1YYJA 3ASOC 2WVNA 3VRCA 2YKZA 2IXPA 1I4ZA 4H4KC 1O3UA 2R7WA 3OEOA 5B1BC 4C3EA 3TJ6A 4YL1A 4QI0A 3U2MA 1LIHA 4PACA 3DMDA 1JMWA 2MYSA 2YHSA 4EBJA 1H7IA 3EFOB 4CIHA 1A0BA 2LSEA 1M2VA 1QKRA 3HKKA 4NTBA 2D5RB 4GEHA 3RVYA 4JE9A 3S29A 3K66A 4Q4ZF 3JRTA 1AVOB 1M6TA 2A0BA 4L6RA 1H6GA 1M2VB 2EPOA 3JSEO 3U2LA 5T3TA 4DBRA 3QW1A 1J8MF 5B3IA 3C62A 3RYLA 5D91A 1V74B 4PJLA 1ZHZA 3UMHA 3TD7A 4LACB 2KSFA 3NDBB 1SZIA 4XEFA 1ZW2A 4C3DA 2HSQA 4OIOF 1QPUA 1FMWA 1LI5A 4LLCA 4M63A 1OR2A 2KW3C 2GDCA 3GODA 4AK9A 2KGOA 1Q0KA 3T6JA 5EHHA 4BJTA 1ORSC 3G4XA 2UUHA 4W8KA 4AL1A 3B9QA 3ZDLA 5DQTA 2CW0F 4DVZA 5HSWA 3R7CA 5KYWB 2OEVA 4NTFA 3IQ6A 4E18A 3EQLF 4EHPA 3KYJA 3PDMP 1VB5A 1DOVA 2YLGA 2EIJC 4PR9A 3M1CB 4XLNF 3AG4C 3FDQA 4XQ1A 2A68F 1BZ4A 3AQBA 4DJ9A 2ZXRA 2XLOA 3HNIA 4U9DA 1O87A 4JTAB 4BJ6C 4MS2A 1MNEA 2W45A 2NSFA 3NMJA 4C7OA 4RDAA 5DVWA 3RQFA 3C7JA 4U9EA 3RQEA 2AVKA 4CDVA 1CGME 4XEVA 4DXWA 1CGNA 3UNGC 2L9JA 2VASA 3SEOA 1G5ZA 1NU9C 1Q0GA 1TFKB 3AQCA 1ZW3A 3FAJA 4X0RA 4AE4A 2FGYA 3AOUA 4J32B 4MNDA 4PJMA 5JSLA 1BBHA 4CIPA 1HW2A 4G7HF 5AC5A 3ZG1A 2NPUA 3SNHA 4DRHB 3NYLA 5E2QA 4CS8A 3MX3A 3O55A 3UGPA 3SP1A 2KQ9A 3O6XA 2HV7A 1OCCC 2G3KA 2LFDA 3JYHA 3O10A 1FMVA 2EPLX 2ICWG 3LNRA 5T1DB 4CS8C 2JD3A 1E85A 4ANJA 2PFDA 1A7VA 1IZMA 2X51A 4MVUA 4FAPB 5L0JA 2R7XA 2AU5A 2XSEA 3DD7A 3GORA 1WTYA 1OXBA 2MHRA 4FX5A 3FOOA 1G4US 2ZPAA 3JT1A 4JEBA 1MMDA 3JZ0A 1TWGA 2F22A 1QSPA 4HE8D 1WN0A 5EK0A 1TWAA 1T6IA 2WZGA 5L0GA 4CJOA 3F47A 1NSGB 3GEHA 1T5OA 4I3MA 5TJ5E 4JCZA 1W2WA 3TQOA 5DS4A 5JVEA 1SR2A 2Y3GA 1TR2A 3DWWA 4OIPF 2DI3A 4YN0B 1T6UA 2IXOA 3WHNA 4KI2A 4JKVA 2QY9A 2VCBA 2VB6A 2NUTA 3QTHA 2CNWD 3WODF 3QW0A 1QQ3A 2XS1A 4BPMA 1Z6AA 5KYUB 3EGDA 5L0DA 1VMAA 5KYNA 1CPQA 1D1AA 5D92A 2J9WA 3EHMA 3U0CA 2WZFA 4E17A 1GM5A 3CZ6A 3CSKA 4WGZA 3RIPA 2M64A 4C7OB 5KYYB 1UG7A 4KNWA 1O5HA 4JTCB 1Q0FA 1ZU4A 4YWQA 1H9GA 4XTKA 2XL8A 2B0JA 3IPMO 1TWHA 1OW8A 2AWYA 4DVYP 1ORYA 4CBEA 2Q4FA 2Y69C 4HEAJ 1OQCA 1D1CA 2HFIA 2R05A 1ORJA 3MLGA 2RSEB 3T6BA 3TJ5A 2DYSC 4BJ6A 2R7RA 2YL3A 2R7SA 3F46A 5KYXB 4CSAA 4PJJA 4J7TA 3U8PA 2Q9BA 2YWAA 2G62A 4JCHA 4MVSA 2PX3A 3DJUB 3M4BA 4K1OA 4JZAA 4YL3A 2HMZA 2H8AA 3NMKA 3RKOF 3U3FA 2QE9A 3N2ZB 4ULWA 3V5ZA 2R02A 1OKKD 3K7DA 2NUPA 3SXYA 3CQZA 4U5HA 2OJQA 1WOLA 2G3VA 2HSBA 1T01A 2J9UA 2Z15A 3C8GB 5KYUA 4HFKB 1Q0DA 2EIKC 3ABMC 5K0IA 3VF0A 4B6IA 1FFTC 3I5PA 3R2PA 1M56C 1I5NA 2ZXWC 5GPGB 3EFOA 3H65A 1YZAA 2L7AA 2WB7A 4WGYA 1NBBA 3W8HA 3FXHA 1Y6DA 3W2VA 3QVYA 3Q7LA 1RXQA 3NRHA 4OINF 4A2NB 1AEPA 1EQ1A 4EIYA 3U9MA 2BL2A 1H9TA 3E70C 1NFNA 4D4NA 2NSGA 3WG7C 1C17M 1QVXA 1LM3B 2QTVA 5EGYA 5F5HA 4C3BA 1Z7Qc 3S28A 5DS6A 1TKNA 3LAYA 3NYJA 5L0IA 5L0CA 4MVOA 3EJNA 1V54C 2V26A 2CDQA 2XLVA 1JPNA 4OIRF 2GA0A 3RH3A 3T9OA 5DQZA 4CSAC 4EUKB 1LI7A 3EPVA 4P9TA 2XL4A 4N6HA 2YRFA 1OCOC 1V4AA 1YA7O 3FMSA 2EINC 1HE1A 2FFHA 2YZSA 4AX2A 4ER9A 3LLKA 1S7ZA 4QDLA 3UR3C 4E7ZA 1HY5A 2GWWA 4QI2A 2OKUA 1ZVZA 3S0XA 1R4TA 4BJ5C 1SYQA 2MWQA 3DAFA 1FTSA 3EH1A 4MW3A 2DYRC 1LE4A 2EIMC 4BG0A 4U5BE 1E84A 1J8YF 1QLEC 4JW1A 1FR0A 2QLAA 4R32A 4YT4A 1L3PA 2VH3A 1VK5A 1WWPA 3AG3C 4CJGA 1SF8A 3I5QA 1PD1A 3KKBA 4MVRA 1NZEA 2DB4A 4PK4A 3FOPA 2I8BA 3AG1C 4CS9C 1E2XA 2PP4A 5JRAA 4P9FA 3M4CA 2YVKA 5KYXA 3K6BA 1KU2A 2Y3DA 3L1MA 4OD5A 3K1IA 2OQMA 1BR4A 4MVMA 1T9KA 4WABA 1JRAA 3K1IC 4YL0A 5CIVA 3I4UA 1OKKA 1ZHXA 2XS8A 3CEXA 3UMIA 2PBEA 3LEOA 4Q7CA 3US6A 4XEKA 4Z9IA 2OU6A 4CDAA 1RJ9B 1GGQA 3GWLA 1RKEA 5FZTA 4I1OB 2YL0A 4EKWA 2WZLA 2H7VC 4EWCA 2HJ3A 1C02A 1LS4A 3IQTA 2OEXA 4ZLDA 2ZXOA 5A6BD 5COFA 1OW6A 3FAPB 3NYMA 3ITFA 4G78A 4NCQA 2XLHA 3FVYA 4DRIB 4IRUA 3MFNA 1JAFA 4LDKA 3W2WA 1QZXA 1U6HA 2A1DD 2UUIA 4RD9A 3VM6A 1VTMP 5F5FA 4BEMJ 4OIQF 1DOWA 2WVOA 1Z3IX 3GM1A 3EGXA 1E83A 3ZIBA 2P6VA 3EG9B 2VC9A 4KNVA 3UGOA 5HV9A 3GM3A 4ZLCA 5L0HA 2GAQA 1YVIA 3S84A 2XXAB 1Q0MA 3L0IA 2L6HA 4IJJA 1RJ9A 4U5EE 1PCXA 2ETSA 4JTDB 3UMKA 5AGFA 1KNYA 4DOZA 3ABLC 2J7PD 3WAQA 3ZWIA 1G8XA 1EI7A 2LIGA 2YL7A 3U9JA 3HLZA 2BE5F 2R25A 2LP4A 2R7QA 1VYKA 3S9OA 4MQ9F 4KC9A 2HS5A 3BRJA 1OXKA 1YZCA 3C8GD 2EILC 4JEAA 2IXNA 1WGWA 2W4BA 2XM0A 1BR2A 1LPEA 3LNMB 4U5CE 4IWBA 1YA9A 4LLEA 4Z9HA 3SYNA 3DE8A 3IQCA 3C18A 1T6QA 3RFYA 3K33A 1YJGA 2L6FA 4PFOA 4YK5A 1AUEA 4A4AA 4MTFA 2FAPB 1GQAA 1RMVA 2YLDA 4ULVA 2Q9CA 3EG9A 4JURI 1JPJA 3BEHA 2J45A 4EBKA 2VCCA 1OW7A 2LQGA 4G7OF 3JRMO 1YAUO 3AG2C 1JOGA 1LVKA 3DM9B 3MYIA 4XLPF 4XPXA 1TFOB 1YYXA 4CDYA 3T6GB 5BUOA 2LCHA 3KYIA 5F28E 1S05A 1ZHTA 5E3AA 5L3QA 5CI9A 3LJBA 4D4XA 1HMOA 4MTGA 2NUPB 2YEVA 1Z63A 2JPUA 1HMDA 2YL1A 3JCUQ 2XXAA 1K04A 3ASNC 4K0DA 1OR3A 2XRHA 1YARO 3GM2A 4IGGA 2D4UA 4GYTA 2HKVA 3C8ZA 2H7BA 3X1OA 2O9XA 4CX9A 3ABKC 3HJCA 5BQIA 5E33A 3M79A 1EKYA 3Q7GA 1ZYRF 2EPNA 3LLIA 2CNWA 3A11A 3GWNA 3MBGA 4GQHA 4O6NA 3ZC4A 1RKEB 2R9RB 1I4YA 3V7OA 4IAOA 4AE4B 5A6JA 1M2OA 4JJFA 1GS9A 2C03A 5A6BA 2EPKX 2I15A 1B68A 1MQVA 4I1MA 4NQFA 3FHDA 3AGTA 3GANA 3O39A 3L8JA 4J7YA 2IYLD 4MVQA 4E0HA 1CGOA 1VOMA 2R7TA 1KTMA 3LEVA 4N4WA 3JSZA 3QMKA 2KK1A 3DI5A 3TK0A 2HZ8A 2J46A 4LDQA 4N06A 5COGA 3DM5A 1ZU5A 4IARA 1NG1A 2L6GA 1PV3A 4NY3A 4U5DE 2WVQA 1VLSA 1D0YA 2J7PA 3U3BA 1NU7D 4J30B 4AL0A 2LK4A 2R7OA 1WATA 2CCYA 2Q7RA 1L7CA 2Y3HA 2XLMA 5KYYA 3RQGA 2LFFA 4HFFB 2XL6A 256BA 3IQ5A 3JTLO 4NC3A 4F4BA 1BDJB 5T3WA 3JYYA 1TWCA 2HUJA 4K7BA 3RF3A 2VCAA 5DLJA 1RCPA 2XLEA 3NMIA 4JIOA 4LERA 1K40A 2KNHA 1N1CA 2J0XA 2QNLA 3L34A 4P6IC 3B0VC 4YJWA
chains in the Genus database with same CATH topology
2P1AA 3DI5A 2QE9A 3DKAA 5COGA 5COFA 2RD9A 4N6CA 2HKVA 5COMA 2OQMA 5CIVA 3QTHA 1RXQA 3CEXA 2NSFA 3GORA 2OU6A 2QNLA 2NSGA 2YQYA 2F22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P1A A;  3DI5 A;  2QE9 A;  3DKA A;  5COG A;  5COF A;  2RD9 A;  4N6C A;  2HKV A;  5COM A;  2OQM A;  5CIV A;  3QTH A;  1RXQ A;  3CEX A;  2NSF A;  3GOR A;  2OU6 A;  2QNL A;  2NSG A;  2YQY A;  2F22 A; 
#chains in the Genus database with same CATH topology
 3TUL A;  1MND A;  4Z9J A;  1XWJ A;  4U5G A;  1M57 C;  1VYI A;  3ZSU A;  5JS5 A;  2ZXP A;  3DAG A;  3EGX B;  2CGE A;  4W8P A;  4U5F E;  3A9C A;  3LS0 A;  3SXM A;  1BR1 A;  3IHU A;  3U8V A;  1FAP B;  5KYW A;  2OOC A;  2YLI A;  2PNO A;  3ZQV A;  4MW8 A;  3S27 A;  3B29 A;  3KH2 A;  1D0X A;  5FCL A;  4E7S A;  3K1H A;  3G50 A;  1G4W R;  1OCR C;  2Y3B A;  4O7G A;  4O6Y A;  3VYW A;  4DBQ A;  1Z5Z A;  3NG1 A;  3N24 A;  1R5I D;  4IB4 A;  1VLT A;  5A69 A;  4FWV A;  3PMR A;  1A7E A;  5JP7 A;  2XLW A;  5B1A C;  5AC4 A;  1XZQ A;  2Q3T A;  3V5Y A;  2XLD A;  2R7V A;  3ZTM A;  1LS1 A;  1Y4C A;  4LDR A;  1ZHY A;  3TOM A;  5A6A A;  2A6H F;  2A69 F;  2HV6 A;  4E0I A;  1NLX A;  3SXZ A;  2E87 A;  3AGU A;  4CS7 A;  2R7U A;  1U0B B;  4N6C A;  3OA1 A;  5B3S C;  4JJG A;  1HE9 A;  5BQG A;  3HNJ A;  2P7V A;  5L0F A;  4Q5S F;  1Z23 A;  4IAQ A;  3ZQY A;  2IXM A;  2V3C C;  2NUT B;  1TQG A;  2KYH A;  2J9B A;  3EGD B;  1PD0 A;  3KMI A;  1MMA A;  2A6E F;  2L81 A;  4OD4 A;  3SZR A;  2ZD9 A;  4O79 A;  1YLM A;  3ECS A;  3NKE A;  1F1M A;  2HMQ A;  3U5S A;  4PJN A;  3GEE A;  2Q9A A;  2J8W A;  4JC7 A;  1MMN A;  3T4R A;  4YT2 A;  3DJN B;  1MMG A;  3RW0 A;  2YQY A;  4KBL A;  3M15 A;  4MTO A;  3ZTZ A;  3EH2 A;  4MVZ A;  3PCV A;  2X0C A;  4BJ1 A;  4YT8 A;  3AJM A;  5JT4 A;  1FNT c;  2IM8 A;  1NFO A;  2IOQ A;  3PHF 2;  3DZA A;  5E3C A;  2RD9 A;  4XPW A;  2KJG A;  4EBB A;  1A7D A;  2NG1 A;  4UDV A;  4WJ0 A;  1SMY F;  3B0U X;  2Q00 A;  5COM A;  3ZVR A;  2PF4 E;  1A41 A;  1C03 A;  4I44 A;  3EZI A;  3X2Q C;  5JUA A;  1WAS A;  1OCZ C;  1RKC A;  1XZP A;  2QUP A;  3B71 A;  3G4Z A;  3W4Y A;  2BC5 A;  2PX0 A;  4JVS A;  5L3V A;  2ASR A;  1E86 A;  3LES A;  3POV A;  2DGJ A;  3LUT B;  3ATP A;  2OG2 A;  3LS1 A;  3N0T A;  4BEJ A;  1ZHW A;  4XWJ A;  2XM4 A;  3Q6N A;  4XPY A;  2P0N A;  2W9Y A;  4JRZ A;  2IBF A;  3SXK A;  1FFH A;  2R03 A;  4FES A;  3VAY A;  1D1B A;  1IW7 F;  3DE9 A;  4ONS A;  2J0W A;  2OJE D;  3IEE A;  5A6K A;  3L8I A;  3S90 A;  1D0Z A;  1APC A;  4H54 A;  3W8I A;  3H2U A;  1HW1 A;  1ZZP A;  2JX0 A;  3CAX A;  2M4E A;  3DKA A;  2LD6 A;  3HNK A;  3EHN A;  4RBN A;  4CS9 A;  1U89 A;  3HNL A;  3Q6M A;  2P61 A;  1ST6 A;  5CI8 A;  5IY5 C;  2HJM A;  3C63 A;  3E9V A;  5BQH A;  3NKD A;  3MYF A;  1LE2 A;  4NTA A;  3KPH A;  3TOL A;  3C8G A;  2B0H A;  1V55 C;  2W4M A;  2GFH A;  4G0H A;  3V5X A;  3RVZ A;  3QZC A;  1YDI A;  1JR8 A;  1UFB A;  4PFP A;  2AWC A;  4O6M A;  2TMV P;  3H2V A;  3B0P A;  4BJ5 A;  3QVZ A;  2C04 A;  2OCC C;  3DXJ F;  3HTK C;  2KC3 A;  2EPM X;  2AP3 A;  2CYD A;  2H7O A;  4YT5 A;  1K05 A;  3EZH A;  4DRJ B;  2J9V A;  3OWT A;  5DS5 A;  3GEI A;  2WL8 A;  1CPR A;  1EA8 A;  2A0U A;  2Y39 A;  3KL4 A;  1LKX A;  5JLI A;  4G7Z F;  2P1A A;  3J06 A;  1YYJ A;  3ASO C;  2WVN A;  3VRC A;  2YKZ A;  2IXP A;  1I4Z A;  4H4K C;  1O3U A;  2R7W A;  3OEO A;  5B1B C;  4C3E A;  3TJ6 A;  4YL1 A;  4QI0 A;  3U2M A;  1LIH A;  4PAC A;  3DMD A;  1JMW A;  2MYS A;  2YHS A;  4EBJ A;  1H7I A;  3EFO B;  4CIH A;  1A0B A;  2LSE A;  1M2V A;  1QKR A;  3HKK A;  4NTB A;  2D5R B;  4GEH A;  3RVY A;  4JE9 A;  3S29 A;  3K66 A;  4Q4Z F;  3JRT A;  1AVO B;  1M6T A;  2A0B A;  4L6R A;  1H6G A;  1M2V B;  2EPO A;  3JSE O;  3U2L A;  5T3T A;  4DBR A;  3QW1 A;  1J8M F;  5B3I A;  3C62 A;  3RYL A;  5D91 A;  1V74 B;  4PJL A;  1ZHZ A;  3UMH A;  3TD7 A;  4LAC B;  2KSF A;  3NDB B;  1SZI A;  4XEF A;  1ZW2 A;  4C3D A;  2HSQ A;  4OIO F;  1QPU A;  1FMW A;  1LI5 A;  4LLC A;  4M63 A;  1OR2 A;  2KW3 C;  2GDC A;  3GOD A;  4AK9 A;  2KGO A;  1Q0K A;  3T6J A;  5EHH A;  4BJT A;  1ORS C;  3G4X A;  2UUH A;  4W8K A;  4AL1 A;  3B9Q A;  3ZDL A;  5DQT A;  2CW0 F;  4DVZ A;  5HSW A;  3R7C A;  5KYW B;  2OEV A;  4NTF A;  3IQ6 A;  4E18 A;  3EQL F;  4EHP A;  3KYJ A;  3PDM P;  1VB5 A;  1DOV A;  2YLG A;  2EIJ C;  4PR9 A;  3M1C B;  4XLN F;  3AG4 C;  3FDQ A;  4XQ1 A;  2A68 F;  1BZ4 A;  3AQB A;  4DJ9 A;  2ZXR A;  2XLO A;  3HNI A;  4U9D A;  1O87 A;  4JTA B;  4BJ6 C;  4MS2 A;  1MNE A;  2W45 A;  2NSF A;  3NMJ A;  4C7O A;  4RDA A;  5DVW A;  3RQF A;  3C7J A;  4U9E A;  3RQE A;  2AVK A;  4CDV A;  1CGM E;  4XEV A;  4DXW A;  1CGN A;  3UNG C;  2L9J A;  2VAS A;  3SEO A;  1G5Z A;  1NU9 C;  1Q0G A;  1TFK B;  3AQC A;  1ZW3 A;  3FAJ A;  4X0R A;  4AE4 A;  2FGY A;  3AOU A;  4J32 B;  4MND A;  4PJM A;  5JSL A;  1BBH A;  4CIP A;  1HW2 A;  4G7H F;  5AC5 A;  3ZG1 A;  2NPU A;  3SNH A;  4DRH B;  3NYL A;  5E2Q A;  4CS8 A;  3MX3 A;  3O55 A;  3UGP A;  3SP1 A;  2KQ9 A;  3O6X A;  2HV7 A;  1OCC C;  2G3K A;  2LFD A;  3JYH A;  3O10 A;  1FMV A;  2EPL X;  2ICW G;  3LNR A;  5T1D B;  4CS8 C;  2JD3 A;  1E85 A;  4ANJ A;  2PFD A;  1A7V A;  1IZM A;  2X51 A;  4MVU A;  4FAP B;  5L0J A;  2R7X A;  2AU5 A;  2XSE A;  3DD7 A;  3GOR A;  1WTY A;  1OXB A;  2MHR A;  4FX5 A;  3FOO A;  1G4U S;  2ZPA A;  3JT1 A;  4JEB A;  1MMD A;  3JZ0 A;  1TWG A;  2F22 A;  1QSP A;  4HE8 D;  1WN0 A;  5EK0 A;  1TWA A;  1T6I A;  2WZG A;  5L0G A;  4CJO A;  3F47 A;  1NSG B;  3GEH A;  1T5O A;  4I3M A;  5TJ5 E;  4JCZ A;  1W2W A;  3TQO A;  5DS4 A;  5JVE A;  1SR2 A;  2Y3G A;  1TR2 A;  3DWW A;  4OIP F;  2DI3 A;  4YN0 B;  1T6U A;  2IXO A;  3WHN A;  4KI2 A;  4JKV A;  2QY9 A;  2VCB A;  2VB6 A;  2NUT A;  3QTH A;  2CNW D;  3WOD F;  3QW0 A;  1QQ3 A;  2XS1 A;  4BPM A;  1Z6A A;  5KYU B;  3EGD A;  5L0D A;  1VMA A;  5KYN A;  1CPQ A;  1D1A A;  5D92 A;  2J9W A;  3EHM A;  3U0C A;  2WZF A;  4E17 A;  1GM5 A;  3CZ6 A;  3CSK A;  4WGZ A;  3RIP A;  2M64 A;  4C7O B;  5KYY B;  1UG7 A;  4KNW A;  1O5H A;  4JTC B;  1Q0F A;  1ZU4 A;  4YWQ A;  1H9G A;  4XTK A;  2XL8 A;  2B0J A;  3IPM O;  1TWH A;  1OW8 A;  2AWY A;  4DVY P;  1ORY A;  4CBE A;  2Q4F A;  2Y69 C;  4HEA J;  1OQC A;  1D1C A;  2HFI A;  2R05 A;  1ORJ A;  3MLG A;  2RSE B;  3T6B A;  3TJ5 A;  2DYS C;  4BJ6 A;  2R7R A;  2YL3 A;  2R7S A;  3F46 A;  5KYX B;  4CSA A;  4PJJ A;  4J7T A;  3U8P A;  2Q9B A;  2YWA A;  2G62 A;  4JCH A;  4MVS A;  2PX3 A;  3DJU B;  3M4B A;  4K1O A;  4JZA A;  4YL3 A;  2HMZ A;  2H8A A;  3NMK A;  3RKO F;  3U3F A;  2QE9 A;  3N2Z B;  4ULW A;  3V5Z A;  2R02 A;  1OKK D;  3K7D A;  2NUP A;  3SXY A;  3CQZ A;  4U5H A;  2OJQ A;  1WOL A;  2G3V A;  2HSB A;  1T01 A;  2J9U A;  2Z15 A;  3C8G B;  5KYU A;  4HFK B;  1Q0D A;  2EIK C;  3ABM C;  5K0I A;  3VF0 A;  4B6I A;  1FFT C;  3I5P A;  3R2P A;  1M56 C;  1I5N A;  2ZXW C;  5GPG B;  3EFO A;  3H65 A;  1YZA A;  2L7A A;  2WB7 A;  4WGY A;  1NBB A;  3W8H A;  3FXH A;  1Y6D A;  3W2V A;  3QVY A;  3Q7L A;  1RXQ A;  3NRH A;  4OIN F;  4A2N B;  1AEP A;  1EQ1 A;  4EIY A;  3U9M A;  2BL2 A;  1H9T A;  3E70 C;  1NFN A;  4D4N A;  2NSG A;  3WG7 C;  1C17 M;  1QVX A;  1LM3 B;  2QTV A;  5EGY A;  5F5H A;  4C3B A;  1Z7Q c;  3S28 A;  5DS6 A;  1TKN A;  3LAY A;  3NYJ A;  5L0I A;  5L0C A;  4MVO A;  3EJN A;  1V54 C;  2V26 A;  2CDQ A;  2XLV A;  1JPN A;  4OIR F;  2GA0 A;  3RH3 A;  3T9O A;  5DQZ A;  4CSA C;  4EUK B;  1LI7 A;  3EPV A;  4P9T A;  2XL4 A;  4N6H A;  2YRF A;  1OCO C;  1V4A A;  1YA7 O;  3FMS A;  2EIN C;  1HE1 A;  2FFH A;  2YZS A;  4AX2 A;  4ER9 A;  3LLK A;  1S7Z A;  4QDL A;  3UR3 C;  4E7Z A;  1HY5 A;  2GWW A;  4QI2 A;  2OKU A;  1ZVZ A;  3S0X A;  1R4T A;  4BJ5 C;  1SYQ A;  2MWQ A;  3DAF A;  1FTS A;  3EH1 A;  4MW3 A;  2DYR C;  1LE4 A;  2EIM C;  4BG0 A;  4U5B E;  1E84 A;  1J8Y F;  1QLE C;  4JW1 A;  1FR0 A;  2QLA A;  4R32 A;  4YT4 A;  1L3P A;  2VH3 A;  1VK5 A;  1WWP A;  3AG3 C;  4CJG A;  1SF8 A;  3I5Q A;  1PD1 A;  3KKB A;  4MVR A;  1NZE A;  2DB4 A;  4PK4 A;  3FOP A;  2I8B A;  3AG1 C;  4CS9 C;  1E2X A;  2PP4 A;  5JRA A;  4P9F A;  3M4C A;  2YVK A;  5KYX A;  3K6B A;  1KU2 A;  2Y3D A;  3L1M A;  4OD5 A;  3K1I A;  2OQM A;  1BR4 A;  4MVM A;  1T9K A;  4WAB A;  1JRA A;  3K1I C;  4YL0 A;  5CIV A;  3I4U A;  1OKK A;  1ZHX A;  2XS8 A;  3CEX A;  3UMI A;  2PBE A;  3LEO A;  4Q7C A;  3US6 A;  4XEK A;  4Z9I A;  2OU6 A;  4CDA A;  1RJ9 B;  1GGQ A;  3GWL A;  1RKE A;  5FZT A;  4I1O B;  2YL0 A;  4EKW A;  2WZL A;  2H7V C;  4EWC A;  2HJ3 A;  1C02 A;  1LS4 A;  3IQT A;  2OEX A;  4ZLD A;  2ZXO A;  5A6B D;  5COF A;  1OW6 A;  3FAP B;  3NYM A;  3ITF A;  4G78 A;  4NCQ A;  2XLH A;  3FVY A;  4DRI B;  4IRU A;  3MFN A;  1JAF A;  4LDK A;  3W2W A;  1QZX A;  1U6H A;  2A1D D;  2UUI A;  4RD9 A;  3VM6 A;  1VTM P;  5F5F A;  4BEM J;  4OIQ F;  1DOW A;  2WVO A;  1Z3I X;  3GM1 A;  3EGX A;  1E83 A;  3ZIB A;  2P6V A;  3EG9 B;  2VC9 A;  4KNV A;  3UGO A;  5HV9 A;  3GM3 A;  4ZLC A;  5L0H A;  2GAQ A;  1YVI A;  3S84 A;  2XXA B;  1Q0M A;  3L0I A;  2L6H A;  4IJJ A;  1RJ9 A;  4U5E E;  1PCX A;  2ETS A;  4JTD B;  3UMK A;  5AGF A;  1KNY A;  4DOZ A;  3ABL C;  2J7P D;  3WAQ A;  3ZWI A;  1G8X A;  1EI7 A;  2LIG A;  2YL7 A;  3U9J A;  3HLZ A;  2BE5 F;  2R25 A;  2LP4 A;  2R7Q A;  1VYK A;  3S9O A;  4MQ9 F;  4KC9 A;  2HS5 A;  3BRJ A;  1OXK A;  1YZC A;  3C8G D;  2EIL C;  4JEA A;  2IXN A;  1WGW A;  2W4B A;  2XM0 A;  1BR2 A;  1LPE A;  3LNM B;  4U5C E;  4IWB A;  1YA9 A;  4LLE A;  4Z9H A;  3SYN A;  3DE8 A;  3IQC A;  3C18 A;  1T6Q A;  3RFY A;  3K33 A;  1YJG A;  2L6F A;  4PFO A;  4YK5 A;  1AUE A;  4A4A A;  4MTF A;  2FAP B;  1GQA A;  1RMV A;  2YLD A;  4ULV A;  2Q9C A;  3EG9 A;  4JUR I;  1JPJ A;  3BEH A;  2J45 A;  4EBK A;  2VCC A;  1OW7 A;  2LQG A;  4G7O F;  3JRM O;  1YAU O;  3AG2 C;  1JOG A;  1LVK A;  3DM9 B;  3MYI A;  4XLP F;  4XPX A;  1TFO B;  1YYX A;  4CDY A;  3T6G B;  5BUO A;  2LCH A;  3KYI A;  5F28 E;  1S05 A;  1ZHT A;  5E3A A;  5L3Q A;  5CI9 A;  3LJB A;  4D4X A;  1HMO A;  4MTG A;  2NUP B;  2YEV A;  1Z63 A;  2JPU A;  1HMD A;  2YL1 A;  3JCU Q;  2XXA A;  1K04 A;  3ASN C;  4K0D A;  1OR3 A;  2XRH A;  1YAR O;  3GM2 A;  4IGG A;  2D4U A;  4GYT A;  2HKV A;  3C8Z A;  2H7B A;  3X1O A;  2O9X A;  4CX9 A;  3ABK C;  3HJC A;  5BQI A;  5E33 A;  3M79 A;  1EKY A;  3Q7G A;  1ZYR F;  2EPN A;  3LLI A;  2CNW A;  3A11 A;  3GWN A;  3MBG A;  4GQH A;  4O6N A;  3ZC4 A;  1RKE B;  2R9R B;  1I4Y A;  3V7O A;  4IAO A;  4AE4 B;  5A6J A;  1M2O A;  4JJF A;  1GS9 A;  2C03 A;  5A6B A;  2EPK X;  2I15 A;  1B68 A;  1MQV A;  4I1M A;  4NQF A;  3FHD A;  3AGT A;  3GAN A;  3O39 A;  3L8J A;  4J7Y A;  2IYL D;  4MVQ A;  4E0H A;  1CGO A;  1VOM A;  2R7T A;  1KTM A;  3LEV A;  4N4W A;  3JSZ A;  3QMK A;  2KK1 A;  3DI5 A;  3TK0 A;  2HZ8 A;  2J46 A;  4LDQ A;  4N06 A;  5COG A;  3DM5 A;  1ZU5 A;  4IAR A;  1NG1 A;  2L6G A;  1PV3 A;  4NY3 A;  4U5D E;  2WVQ A;  1VLS A;  1D0Y A;  2J7P A;  3U3B A;  1NU7 D;  4J30 B;  4AL0 A;  2LK4 A;  2R7O A;  1WAT A;  2CCY A;  2Q7R A;  1L7C A;  2Y3H A;  2XLM A;  5KYY A;  3RQG A;  2LFF A;  4HFF B;  2XL6 A;  256B A;  3IQ5 A;  3JTL O;  4NC3 A;  4F4B A;  1BDJ B;  5T3W A;  3JYY A;  1TWC A;  2HUJ A;  4K7B A;  3RF3 A;  2VCA A;  5DLJ A;  1RCP A;  2XLE A;  3NMI A;  4JIO A;  4LER A;  1K40 A;  2KNH A;  1N1C A;  2J0X A;  2QNL A;  3L34 A;  4P6I C;  3B0V C;  4YJW A; 
#chains in the Genus database with same CATH homology
 2P1A A;  3DI5 A;  2QE9 A;  3DKA A;  5COG A;  5COF A;  2RD9 A;  4N6C A;  2HKV A;  5COM A;  2OQM A;  5CIV A;  3QTH A;  1RXQ A;  3CEX A;  2NSF A;  3GOR A;  2OU6 A;  2QNL A;  2NSG A;  2YQY A;  2F22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...