2OU6A

Crystal structure of a putative metalloenzyme of the duf664 family (dr_1065) from deinococcus radiodurans at 1.80 a resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
183
structure length
183
Chain Sequence
PTFNPELHAQTLNSERAYFVQPDADPAFTPHIGALVEMLTYARLTTLQAVEGLPEDQLWATAPGFANSIGTLLAHIAAVERVYHVLSFQGRDVTPEDDGAAYWGLTMGKEGTAPARLPTLDELRAELADARAETLRVFAAKDDAWLAEPLGPGWANQHWAWFHVMEDEVNHRGQLRLLRQVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Hypothetical protein
publication title Crystal structure of hypothetical protein (NP_294789.1) from Deinococcus radiodurans at 1.80 A resolution
rcsb
source organism Deinococcus radiodurans
total genus 63
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04978 DUF664 Protein of unknown function (DUF664)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 2ou6A00
5COMA 2OQMA 3GORA 5COGA 5CIVA 3QTHA 2NSGA 2QE9A 1RXQA 2P1AA 5COFA 2OU6A 3DKAA 4N6CA 3DI5A 2HKVA 2YQYA 2NSFA 2RD9A 2F22A 2QNLA 3CEXA
chains in the Genus database with same CATH superfamily
2LQGA 5COMA 2DYSC 4MVQA 1Q0GA 2YWAA 1Q0MA 4PFPA 4CBEA 2ASRA 2NUPB 3WAQA 2ZXPA 1H9TA 4Q5SF 2XXAA 3NYLA 2HZ8A 1OW8A 3MLGA 4EUKB 4KBLA 4G78A 1YAUO 3AGTA 2VB6A 4DJ9A 2KK1A 4O6YA 5TJ5E 5JLIA 4JRZA 2V3CC 3ASOC 3ABLC 5T3WA 3AOUA 1LPEA 2VH3A 5F28E 4YL0A 1WOLA 3M79A 2EPLX 5DS6A 1H6GA 1EA8A 2YEVA 3J06A 3NYMA 1JR8A 2YQYA 3DD7A 4EWCA 3RQGA 2EIJC 2HJ3A 4U9DA 2M4EA 1PD0A 1E86A 1EI7A 3U9MA 3N24A 4K7BA 3DM5A 4JW1A 2DB4A 1FAPB 1FTSA 1RMVA 2M64A 5KYNA 3E9VA 2L6GA 1NU7D 2BE5F 4A2NB 1FNTc 4JJGA 3KKBA 2L7AA 3MX3A 2W45A 3ZIBA 2YL1A 2XLDA 3IQCA 1KU2A 3LLIA 4F4BA 1ZW2A 3KYIA 1D0YA 3UMKA 3W4YA 3ZTZA 4OIQF 2EILC 2LD6A 4NC3A 3E70C 1EQ1A 2IM8A 4YT8A 5KYXB 1V55C 4CSAC 3V5XA 2A0BA 3FAJA 4OD4A 5BUOA 3EZHA 4G7OF 2YVKA 4LDKA 1I5NA 2J7PA 1V54C 3UR3C 2FGYA 3EGXB 1G4US 3K1HA 4KI2A 2J9VA 3JTLO 4DVZA 1HE1A 4MVZA 2OEVA 3RFYA 3X2QC 2J7PD 1QKRA 1G8XA 1VMAA 5L3VA 2DYRC 2WZGA 4CJGA 4DBRA 1C17M 1Z6AA 2XS1A 4MVOA 4O6NA 5E2QA 2P61A 1PD1A 1RKCA 4YT2A 5A6KA 2Y3BA 5JUAA 1OKKA 3CSKA 3DZAA 1OQCA 2KW3C 5L0JA 4C7OA 3SXZA 4DVYP 2L6FA 1OCOC 3F47A 4DRIB 5BQGA 4JC7A 1LVKA 2R7RA 1OKKD 1ZU4A 2VASA 4RDAA 1AEPA 4HEAJ 4OIRF 3UGOA 1OR2A 1SMYF 3HKKA 1NSGB 1YA7O 1TFKB 4BJ6C 1ZW3A 3DAGA 1CPQA 2HSBA 3EH2A 1G5ZA 4EBBA 2E87A 2LP4A 3ZSUA 2ZXRA 3TOMA 3T6JA 1T6IA 1TQGA 2L9JA 2UUHA 1JMWA 4JVSA 5E3CA 1YA9A 5CI9A 2H7VC 4ULVA 2X51A 3A9CA 4CS7A 1TKNA 1LI7A 1BDJB 1K05A 4PFOA 3UGPA 4IB4A 2YKZA 4Z9JA 5AGFA 4QI2A 2CW0F 1SZIA 3EQLF 4YL1A 2NUPA 2R03A 2R7QA 3LNRA 4FESA 3IQ6A 3ZG1A 3EPVA 3RKOF 4DRHB 3S0XA 3O55A 2JX0A 3KYJA 3B0UX 3AG4C 1IZMA 256BA 2IXPA 2XL8A 2YRFA 3DKAA 4IGGA 1D1CA 3H2VA 1MMNA 2XRHA 4G7ZF 4E18A 3K1IC 1FFTC 1YJGA 2CDQA 2G3VA 2NSFA 3VYWA 1WWPA 3CZ6A 2J8WA 1LKXA 1TWHA 1BZ4A 3JYYA 3JSEO 3UNGC 3LEVA 3ZQVA 1M2VB 1RKEA 4MS2A 2Y3DA 4NY3A 1GGQA 3GEIA 4XQ1A 3EJNA 4O79A 4PR9A 5B1BC 5DS4A 2LK4A 2XLEA 3TJ5A 2XS8A 3FVYA 4E0IA 4N4WA 2HJMA 2MWQA 3G50A 1ZHTA 2XLWA 1HMDA 3AG2C 2VCBA 3O39A 1M57C 3RH3A 5BQIA 5KYWB 3DM9B 2J45A 2O9XA 3B71A 4XWJA 5KYXA 3RVZA 1CGOA 1UFBA 1VB5A 4JTCB 4PK4A 3DI5A 5EK0A 1JPNA 2G62A 3C8GA 3G4XA 3M15A 4GQHA 3W2WA 4CS9A 5CI8A 3FOPA 4JZAA 4I1MA 4IAOA 4MVMA 4U5EE 1NFOA 3U3FA 5T1DB 5BQHA 3C8GD 3NMKA 3EGXA 3B29A 1MMDA 2EPMX 1A7EA 1NBBA 3PCVA 4GYTA 1GQAA 4RBNA 5T3TA 2OQMA 3ZC4A 4WABA 4LERA 3IPMO 4FWVA 3VAYA 3RF3A 4EHPA 2XL6A 5A6AA 3TD7A 2R7UA 1YLMA 3C62A 1BR1A 2EINC 4U5CE 3HNKA 4K0DA 4XEKA 3RYLA 4MVSA 4AE4B 5JVEA 2P1AA 2EPNA 3KMIA 1GM5A 1ZU5A 1R4TA 1U89A 5JP7A 3S90A 1Q0FA 1RCPA 2KJGA 4L6RA 3W8IA 3GODA 3QMKA 3Q6NA 2A6EF 5L0HA 3QZCA 1OCCC 4K1OA 1E2XA 2GWWA 3LLKA 1E85A 2OJED 2XL4A 3FHDA 2KNHA 2YLIA 1RKEB 1A7VA 2CYDA 4XPXA 3DE8A 1LIHA 3Q6MA 2UUIA 5COGA 3QVYA 4C3EA 4ZLDA 1ZHYA 1I4YA 3C18A 2VCCA 4XTKA 1Z23A 2AWYA 4YK5A 2C03A 3T9OA 4CDAA 1SF8A 3DJNB 1WASA 2FFHA 2CNWA 2WB7A 4Q7CA 2Q7RA 2WVOA 3EHNA 3IEEA 3ASNC 1ZYRF 4IAQA 1Y6DA 2VCAA 4X0RA 4ANJA 4A4AA 5FCLA 2Z15A 4JEAA 1A7DA 5DQTA 3C8GB 3N2ZB 2CNWD 5E33A 4R32A 4JTDB 1M56C 4N6CA 2R7SA 5AC4A 2OG2A 3BRJA 1DOWA 2JPUA 3NRHA 2IXOA 3M4CA 4MTFA 4I3MA 3DAFA 3IHUA 3U8PA 4NCQA 3CEXA 5L0DA 1HW1A 3VF0A 2Q4FA 3EHMA 3SXKA 1MMGA 4O6MA 2GDCA 5L0CA 3K33A 2HV7A 4CJOA 5JSLA 4ER9A 1OW6A 2R05A 2J9WA 1E83A 3S84A 3JRTA 1T5OA 2ZXOA 3X1OA 3ZQYA 1M2VA 1YZAA 2BL2A 2PNOA 4QI0A 2PBEA 1JPJA 2DGJA 3HJCA 4BEJA 2IBFA 3NMJA 2HV6A 4JKVA 4MVRA 4WJ0A 2KQ9A 2OU6A 2BC5A 3GM1A 3JYHA 3T6GB 4LLEA 1NZEA 2CCYA 3H65A 3ITFA 3US6A 3L0IA 4J32B 5KYWA 2YLDA 1S05A 2H7OA 1H7IA 1WGWA 2NG1A 2Y69C 4CX9A 1NG1A 3MYIA 3HNJA 1L7CA 3LS1A 2B0JA 3K6BA 2QUPA 2ZXWC 5DVWA 1VK5A 2WZLA 3GORA 4CIPA 4QDLA 3Q7LA 4M63A 1Q0KA 1RJ9B 3KPHA 4LACB 1YARO 2MHRA 4E7SA 1ZHZA 3LUTB 3TOLA 2EPOA 3OA1A 2OCCC 4NTBA 1LE2A 2YL7A 3U8VA 3M1CB 1YVIA 2XLVA 4E7ZA 2IXMA 3NMIA 3S29A 4PJNA 2NUTA 2KSFA 3RW0A 4C3DA 1N1CA 4AE4A 4U5HA 2PX0A 1NLXA 4ULWA 1M2OA 3V7OA 4DRJB 2MYSA 1AUEA 5JT4A 3S27A 3RQEA 1QSPA 1SR2A 1TFOB 2IYLD 3WODF 4CS8A 4DBQA 1QVXA 2A6HF 3LJBA 1O3UA 4YN0B 1JAFA 1D1BA 1V74B 2A68F 5D91A 3DXJF 4XPYA 2GA0A 1QPUA 1VYKA 3GM2A 1APCA 3W8HA 3H2UA 3FOOA 1WTYA 2ETSA 3BEHA 2HMZA 5K0IA 2W4MA 4Q4ZF 4J30B 3U3BA 3F46A 4PJJA 1PV3A 3JT1A 1F1MA 3TJ6A 2L81A 1W2WA 1YYJA 4IWBA 4OD5A 5B3IA 3ZVRA 4I1OB 5L0FA 2PF4E 2X0CA 2R9RB 4ZLCA 1YYXA 3O6XA 1U6HA 1XZQA 3B0VC 4KNWA 1TWAA 1QZXA 2WVQA 2XM0A 3L1MA 2Q3TA 1FMWA 1V4AA 1C03A 5A69A 1HW2A 2PP4A 3MBGA 2I8BA 2XSEA 3AG3C 2J0WA 3U9JA 4MVUA 4NQFA 4BJ5A 4IJJA 3LESA 4IARA 4U5FE 5A6BA 2P0NA 5EHHA 3ATPA 3ABMC 4AX2A 2J46A 4CDYA 3EZIA 4JCHA 3IQTA 4GEHA 1T01A 5A6BD 1HY5A 4JCZA 4WGYA 3V5ZA 3VM6A 3JRMO 4UDVA 2YHSA 5JS5A 2QY9A 1LM3B 2LCHA 4PACA 5HV9A 1FFHA 1LE4A 3GANA 2A1DD 3WG7C 2PFDA 1TR2A 3GWLA 3FDQA 1ORYA 4LDQA 1WATA 2JD3A 4W8PA 3UMHA 2NUTB 4CS9C 2YL3A 2Q9AA 1D0ZA 5B1AC 1OCZC 4U5BE 3LS0A 2QTVA 1TWGA 1K40A 1ZHXA 3GM3A 3O10A 2OJQA 3ABKC 1CGME 4LLCA 2LFFA 5KYUA 5F5HA 4YJWA 3JSZA 4HFFB 2VC9A 2ICWG 1BBHA 2NPUA 2R25A 3RIPA 2R7TA 4ONSA 2P7VA 3PDMP 3SXYA 1A41A 1EKYA 1VOMA 3AQCA 1K04A 1ORSC 1XZPA 4BJ1A 3SZRA 1GS9A 2A69F 5KYYA 4W8KA 3AQBA 4E0HA 1ST6A 1SYQA 1QQ3A 1MQVA 1M6TA 1VLSA 3NKEA 4AK9A 3GEHA 2R7XA 3EGDA 4D4XA 5AC5A 2P6VA 3SP1A 2XLOA 3RQFA 1L3PA 1RJ9A 4H4KC 2R7OA 1NFNA 3JCUQ 4WGZA 1T6UA 3SXMA 5F5FA 3SYNA 2XLMA 1AVOB 3R2PA 1Q0DA 3I5PA 3ECSA 4MQ9F 4XLNF 2Q9BA 2H7BA 3SEOA 3TK0A 1J8YF 1OR3A 3W2VA 3DMDA 3HTKC 5A6JA 5B3SC 2ZPAA 3EG9B 4N6HA 4P9TA 4BPMA 1NU9C 2F22A 3QW0A 3ZTMA 5DS5A 2Q9CA 1O5HA 2J0XA 4CSAA 4JIOA 1E84A 3SNHA 2OEXA 3GWNA 5DQZA 3MYFA 3CQZA 1CPRA 3C8ZA 3L8IA 4H54A 4C3BA 1DOVA 2WZFA 4MTOA 5FZTA 4JEBA 2DI3A 2YL0A 4DXWA 2D4UA 2KC3A 3V5YA 3C63A 1MNDA 3LAYA 1Z63A 1RXQA 3KL4A 4NTAA 2QLAA 5KYUB 2WL8A 3HNIA 3U5SA 3JZ0A 4J7YA 4EBJA 4MW8A 3AJMA 4E17A 3NG1A 2B0HA 4Z9HA 4YT5A 1Z5ZA 3EH1A 3GEEA 4P6IC 4XEFA 2OKUA 2LFDA 3U2MA 3EFOB 4CDVA 3R7CA 4OINF 2EPKX 3I4UA 2RD9A 5L3QA 1VLTA 4HE8D 2HS5A 5KYYB 4BG0A 4DOZA 2XXAB 2IOQA 3NKDA 3S28A 4YWQA 1T9KA 3IQ5A 4BJ6A 1OCRC 2GFHA 4U5DE 3DE9A 5D92A 1H9GA 3AG1C 2KYHA 2L6HA 3EGDB 4D4NA 2I15A 3DWWA 3NDBB 3KH2A 1ZVZA 2AP3A 3C7JA 3NYJA 4JURI 4B6IA 4OIOF 4MTGA 3B0PA 4AL1A 3QTHA 4FAPB 2W4BA 1VYIA 4FX5A 4AL0A 3B9QA 3G4ZA 3LEOA 3LNMB 1G4WR 1KNYA 1I4ZA 3HNLA 1WN0A 4G0HA 1JRAA 2PX3A 2AWCA 5COFA 3FMSA 3UMIA 3ZDLA 2RSEB 2XLHA 3QW1A 3K66A 3CAXA 1A0BA 1HMOA 4PJMA 3U2LA 1MNEA 3DJUB 2HKVA 3K7DA 3TQOA 3U0CA 3L8JA 1B68A 1HE9A 5E3AA 1PCXA 3MFNA 2GAQA 4MNDA 3M4BA 4U5GA 1BR2A 2Y39A 3S9OA 3T6BA 4LDRA 5JRAA 1J8MF 2J9UA 3QVZA 2IXNA 3TULA 1ORJA 1D0XA 2LSEA 1D1AA 3VRCA 5L0IA 5CIVA 3K1IA 3OWTA 4Z9IA 3Q7GA 4XLPF 2Y3HA 2NSGA 2OOCA 2QE9A 4O7GA 1IW7F 1T6QA 2ZD9A 2A0UA 4CS8C 1BR4A 2H8AA 4CIHA 1ZHWA 1OXBA 2HUJA 2R7WA 3POVA 5GPGB 1TWCA 1S7ZA 1XWJA 3HLZA 2AVKA 2XM4A 3OEOA 1VTMP 1YDIA 1JOGA 1Z3IX 3N0TA 4NTFA 1C02A 4EBKA 4N06A 2AU5A 5IY5C 2D5RB 3FXHA 3PMRA 2EIKC 2HMQA 4J7TA 5HSWA 1FR0A 1ZZPA 2C04A 1FMVA 1MMAA 1LI5A 1Z7Qc 2Q00A 5DLJA 4KNVA 3FAPB 4MW3A 4XEVA 2J9BA 5L0GA 4C7OB 4YT4A 4OIPF 2G3KA 4BEMJ 3EG9A 2TMVP 4P9FA 1Y4CA 2KGOA 2R02A 4I44A 4RD9A 5EGYA 4KC9A 3ZWIA 2HSQA 4BJ5C 3PHF2 1OXKA 3L34A 1OW7A 4YL3A 4BJTA 1LS1A 3T4RA 4G7HF 2R7VA 1KTMA 4EKWA 4XPWA 4HFKB 2EIMC 1CGNA 3A11A 2HFIA 3AGUA 2WVNA 3I5QA 4IRUA 1YZCA 4EIYA 1UG7A 1LS4A 1R5ID 4PJLA 2W9YA 4JE9A 3RVYA 4JJFA 4U9EA 1QLEC 3WHNA 1U0BB 2YLGA 1O87A 2FAPB 2QNLA 2V26A 2LIGA 2YZSA 2CGEA 3EFOA 4JTAB 2Y3GA
chains in the Genus database with same CATH topology
5COMA 2OQMA 3GORA 5COGA 5CIVA 3QTHA 2NSGA 2QE9A 1RXQA 2P1AA 5COFA 2OU6A 3DKAA 4N6CA 3DI5A 2HKVA 2YQYA 2NSFA 2RD9A 2F22A 2QNLA 3CEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5COM A;  2OQM A;  3GOR A;  5COG A;  5CIV A;  3QTH A;  2NSG A;  2QE9 A;  1RXQ A;  2P1A A;  5COF A;  2OU6 A;  3DKA A;  4N6C A;  3DI5 A;  2HKV A;  2YQY A;  2NSF A;  2RD9 A;  2F22 A;  2QNL A;  3CEX A; 
#chains in the Genus database with same CATH topology
 2LQG A;  5COM A;  2DYS C;  4MVQ A;  1Q0G A;  2YWA A;  1Q0M A;  4PFP A;  4CBE A;  2ASR A;  2NUP B;  3WAQ A;  2ZXP A;  1H9T A;  4Q5S F;  2XXA A;  3NYL A;  2HZ8 A;  1OW8 A;  3MLG A;  4EUK B;  4KBL A;  4G78 A;  1YAU O;  3AGT A;  2VB6 A;  4DJ9 A;  2KK1 A;  4O6Y A;  5TJ5 E;  5JLI A;  4JRZ A;  2V3C C;  3ASO C;  3ABL C;  5T3W A;  3AOU A;  1LPE A;  2VH3 A;  5F28 E;  4YL0 A;  1WOL A;  3M79 A;  2EPL X;  5DS6 A;  1H6G A;  1EA8 A;  2YEV A;  3J06 A;  3NYM A;  1JR8 A;  2YQY A;  3DD7 A;  4EWC A;  3RQG A;  2EIJ C;  2HJ3 A;  4U9D A;  2M4E A;  1PD0 A;  1E86 A;  1EI7 A;  3U9M A;  3N24 A;  4K7B A;  3DM5 A;  4JW1 A;  2DB4 A;  1FAP B;  1FTS A;  1RMV A;  2M64 A;  5KYN A;  3E9V A;  2L6G A;  1NU7 D;  2BE5 F;  4A2N B;  1FNT c;  4JJG A;  3KKB A;  2L7A A;  3MX3 A;  2W45 A;  3ZIB A;  2YL1 A;  2XLD A;  3IQC A;  1KU2 A;  3LLI A;  4F4B A;  1ZW2 A;  3KYI A;  1D0Y A;  3UMK A;  3W4Y A;  3ZTZ A;  4OIQ F;  2EIL C;  2LD6 A;  4NC3 A;  3E70 C;  1EQ1 A;  2IM8 A;  4YT8 A;  5KYX B;  1V55 C;  4CSA C;  3V5X A;  2A0B A;  3FAJ A;  4OD4 A;  5BUO A;  3EZH A;  4G7O F;  2YVK A;  4LDK A;  1I5N A;  2J7P A;  1V54 C;  3UR3 C;  2FGY A;  3EGX B;  1G4U S;  3K1H A;  4KI2 A;  2J9V A;  3JTL O;  4DVZ A;  1HE1 A;  4MVZ A;  2OEV A;  3RFY A;  3X2Q C;  2J7P D;  1QKR A;  1G8X A;  1VMA A;  5L3V A;  2DYR C;  2WZG A;  4CJG A;  4DBR A;  1C17 M;  1Z6A A;  2XS1 A;  4MVO A;  4O6N A;  5E2Q A;  2P61 A;  1PD1 A;  1RKC A;  4YT2 A;  5A6K A;  2Y3B A;  5JUA A;  1OKK A;  3CSK A;  3DZA A;  1OQC A;  2KW3 C;  5L0J A;  4C7O A;  3SXZ A;  4DVY P;  2L6F A;  1OCO C;  3F47 A;  4DRI B;  5BQG A;  4JC7 A;  1LVK A;  2R7R A;  1OKK D;  1ZU4 A;  2VAS A;  4RDA A;  1AEP A;  4HEA J;  4OIR F;  3UGO A;  1OR2 A;  1SMY F;  3HKK A;  1NSG B;  1YA7 O;  1TFK B;  4BJ6 C;  1ZW3 A;  3DAG A;  1CPQ A;  2HSB A;  3EH2 A;  1G5Z A;  4EBB A;  2E87 A;  2LP4 A;  3ZSU A;  2ZXR A;  3TOM A;  3T6J A;  1T6I A;  1TQG A;  2L9J A;  2UUH A;  1JMW A;  4JVS A;  5E3C A;  1YA9 A;  5CI9 A;  2H7V C;  4ULV A;  2X51 A;  3A9C A;  4CS7 A;  1TKN A;  1LI7 A;  1BDJ B;  1K05 A;  4PFO A;  3UGP A;  4IB4 A;  2YKZ A;  4Z9J A;  5AGF A;  4QI2 A;  2CW0 F;  1SZI A;  3EQL F;  4YL1 A;  2NUP A;  2R03 A;  2R7Q A;  3LNR A;  4FES A;  3IQ6 A;  3ZG1 A;  3EPV A;  3RKO F;  4DRH B;  3S0X A;  3O55 A;  2JX0 A;  3KYJ A;  3B0U X;  3AG4 C;  1IZM A;  256B A;  2IXP A;  2XL8 A;  2YRF A;  3DKA A;  4IGG A;  1D1C A;  3H2V A;  1MMN A;  2XRH A;  4G7Z F;  4E18 A;  3K1I C;  1FFT C;  1YJG A;  2CDQ A;  2G3V A;  2NSF A;  3VYW A;  1WWP A;  3CZ6 A;  2J8W A;  1LKX A;  1TWH A;  1BZ4 A;  3JYY A;  3JSE O;  3UNG C;  3LEV A;  3ZQV A;  1M2V B;  1RKE A;  4MS2 A;  2Y3D A;  4NY3 A;  1GGQ A;  3GEI A;  4XQ1 A;  3EJN A;  4O79 A;  4PR9 A;  5B1B C;  5DS4 A;  2LK4 A;  2XLE A;  3TJ5 A;  2XS8 A;  3FVY A;  4E0I A;  4N4W A;  2HJM A;  2MWQ A;  3G50 A;  1ZHT A;  2XLW A;  1HMD A;  3AG2 C;  2VCB A;  3O39 A;  1M57 C;  3RH3 A;  5BQI A;  5KYW B;  3DM9 B;  2J45 A;  2O9X A;  3B71 A;  4XWJ A;  5KYX A;  3RVZ A;  1CGO A;  1UFB A;  1VB5 A;  4JTC B;  4PK4 A;  3DI5 A;  5EK0 A;  1JPN A;  2G62 A;  3C8G A;  3G4X A;  3M15 A;  4GQH A;  3W2W A;  4CS9 A;  5CI8 A;  3FOP A;  4JZA A;  4I1M A;  4IAO A;  4MVM A;  4U5E E;  1NFO A;  3U3F A;  5T1D B;  5BQH A;  3C8G D;  3NMK A;  3EGX A;  3B29 A;  1MMD A;  2EPM X;  1A7E A;  1NBB A;  3PCV A;  4GYT A;  1GQA A;  4RBN A;  5T3T A;  2OQM A;  3ZC4 A;  4WAB A;  4LER A;  3IPM O;  4FWV A;  3VAY A;  3RF3 A;  4EHP A;  2XL6 A;  5A6A A;  3TD7 A;  2R7U A;  1YLM A;  3C62 A;  1BR1 A;  2EIN C;  4U5C E;  3HNK A;  4K0D A;  4XEK A;  3RYL A;  4MVS A;  4AE4 B;  5JVE A;  2P1A A;  2EPN A;  3KMI A;  1GM5 A;  1ZU5 A;  1R4T A;  1U89 A;  5JP7 A;  3S90 A;  1Q0F A;  1RCP A;  2KJG A;  4L6R A;  3W8I A;  3GOD A;  3QMK A;  3Q6N A;  2A6E F;  5L0H A;  3QZC A;  1OCC C;  4K1O A;  1E2X A;  2GWW A;  3LLK A;  1E85 A;  2OJE D;  2XL4 A;  3FHD A;  2KNH A;  2YLI A;  1RKE B;  1A7V A;  2CYD A;  4XPX A;  3DE8 A;  1LIH A;  3Q6M A;  2UUI A;  5COG A;  3QVY A;  4C3E A;  4ZLD A;  1ZHY A;  1I4Y A;  3C18 A;  2VCC A;  4XTK A;  1Z23 A;  2AWY A;  4YK5 A;  2C03 A;  3T9O A;  4CDA A;  1SF8 A;  3DJN B;  1WAS A;  2FFH A;  2CNW A;  2WB7 A;  4Q7C A;  2Q7R A;  2WVO A;  3EHN A;  3IEE A;  3ASN C;  1ZYR F;  4IAQ A;  1Y6D A;  2VCA A;  4X0R A;  4ANJ A;  4A4A A;  5FCL A;  2Z15 A;  4JEA A;  1A7D A;  5DQT A;  3C8G B;  3N2Z B;  2CNW D;  5E33 A;  4R32 A;  4JTD B;  1M56 C;  4N6C A;  2R7S A;  5AC4 A;  2OG2 A;  3BRJ A;  1DOW A;  2JPU A;  3NRH A;  2IXO A;  3M4C A;  4MTF A;  4I3M A;  3DAF A;  3IHU A;  3U8P A;  4NCQ A;  3CEX A;  5L0D A;  1HW1 A;  3VF0 A;  2Q4F A;  3EHM A;  3SXK A;  1MMG A;  4O6M A;  2GDC A;  5L0C A;  3K33 A;  2HV7 A;  4CJO A;  5JSL A;  4ER9 A;  1OW6 A;  2R05 A;  2J9W A;  1E83 A;  3S84 A;  3JRT A;  1T5O A;  2ZXO A;  3X1O A;  3ZQY A;  1M2V A;  1YZA A;  2BL2 A;  2PNO A;  4QI0 A;  2PBE A;  1JPJ A;  2DGJ A;  3HJC A;  4BEJ A;  2IBF A;  3NMJ A;  2HV6 A;  4JKV A;  4MVR A;  4WJ0 A;  2KQ9 A;  2OU6 A;  2BC5 A;  3GM1 A;  3JYH A;  3T6G B;  4LLE A;  1NZE A;  2CCY A;  3H65 A;  3ITF A;  3US6 A;  3L0I A;  4J32 B;  5KYW A;  2YLD A;  1S05 A;  2H7O A;  1H7I A;  1WGW A;  2NG1 A;  2Y69 C;  4CX9 A;  1NG1 A;  3MYI A;  3HNJ A;  1L7C A;  3LS1 A;  2B0J A;  3K6B A;  2QUP A;  2ZXW C;  5DVW A;  1VK5 A;  2WZL A;  3GOR A;  4CIP A;  4QDL A;  3Q7L A;  4M63 A;  1Q0K A;  1RJ9 B;  3KPH A;  4LAC B;  1YAR O;  2MHR A;  4E7S A;  1ZHZ A;  3LUT B;  3TOL A;  2EPO A;  3OA1 A;  2OCC C;  4NTB A;  1LE2 A;  2YL7 A;  3U8V A;  3M1C B;  1YVI A;  2XLV A;  4E7Z A;  2IXM A;  3NMI A;  3S29 A;  4PJN A;  2NUT A;  2KSF A;  3RW0 A;  4C3D A;  1N1C A;  4AE4 A;  4U5H A;  2PX0 A;  1NLX A;  4ULW A;  1M2O A;  3V7O A;  4DRJ B;  2MYS A;  1AUE A;  5JT4 A;  3S27 A;  3RQE A;  1QSP A;  1SR2 A;  1TFO B;  2IYL D;  3WOD F;  4CS8 A;  4DBQ A;  1QVX A;  2A6H F;  3LJB A;  1O3U A;  4YN0 B;  1JAF A;  1D1B A;  1V74 B;  2A68 F;  5D91 A;  3DXJ F;  4XPY A;  2GA0 A;  1QPU A;  1VYK A;  3GM2 A;  1APC A;  3W8H A;  3H2U A;  3FOO A;  1WTY A;  2ETS A;  3BEH A;  2HMZ A;  5K0I A;  2W4M A;  4Q4Z F;  4J30 B;  3U3B A;  3F46 A;  4PJJ A;  1PV3 A;  3JT1 A;  1F1M A;  3TJ6 A;  2L81 A;  1W2W A;  1YYJ A;  4IWB A;  4OD5 A;  5B3I A;  3ZVR A;  4I1O B;  5L0F A;  2PF4 E;  2X0C A;  2R9R B;  4ZLC A;  1YYX A;  3O6X A;  1U6H A;  1XZQ A;  3B0V C;  4KNW A;  1TWA A;  1QZX A;  2WVQ A;  2XM0 A;  3L1M A;  2Q3T A;  1FMW A;  1V4A A;  1C03 A;  5A69 A;  1HW2 A;  2PP4 A;  3MBG A;  2I8B A;  2XSE A;  3AG3 C;  2J0W A;  3U9J A;  4MVU A;  4NQF A;  4BJ5 A;  4IJJ A;  3LES A;  4IAR A;  4U5F E;  5A6B A;  2P0N A;  5EHH A;  3ATP A;  3ABM C;  4AX2 A;  2J46 A;  4CDY A;  3EZI A;  4JCH A;  3IQT A;  4GEH A;  1T01 A;  5A6B D;  1HY5 A;  4JCZ A;  4WGY A;  3V5Z A;  3VM6 A;  3JRM O;  4UDV A;  2YHS A;  5JS5 A;  2QY9 A;  1LM3 B;  2LCH A;  4PAC A;  5HV9 A;  1FFH A;  1LE4 A;  3GAN A;  2A1D D;  3WG7 C;  2PFD A;  1TR2 A;  3GWL A;  3FDQ A;  1ORY A;  4LDQ A;  1WAT A;  2JD3 A;  4W8P A;  3UMH A;  2NUT B;  4CS9 C;  2YL3 A;  2Q9A A;  1D0Z A;  5B1A C;  1OCZ C;  4U5B E;  3LS0 A;  2QTV A;  1TWG A;  1K40 A;  1ZHX A;  3GM3 A;  3O10 A;  2OJQ A;  3ABK C;  1CGM E;  4LLC A;  2LFF A;  5KYU A;  5F5H A;  4YJW A;  3JSZ A;  4HFF B;  2VC9 A;  2ICW G;  1BBH A;  2NPU A;  2R25 A;  3RIP A;  2R7T A;  4ONS A;  2P7V A;  3PDM P;  3SXY A;  1A41 A;  1EKY A;  1VOM A;  3AQC A;  1K04 A;  1ORS C;  1XZP A;  4BJ1 A;  3SZR A;  1GS9 A;  2A69 F;  5KYY A;  4W8K A;  3AQB A;  4E0H A;  1ST6 A;  1SYQ A;  1QQ3 A;  1MQV A;  1M6T A;  1VLS A;  3NKE A;  4AK9 A;  3GEH A;  2R7X A;  3EGD A;  4D4X A;  5AC5 A;  2P6V A;  3SP1 A;  2XLO A;  3RQF A;  1L3P A;  1RJ9 A;  4H4K C;  2R7O A;  1NFN A;  3JCU Q;  4WGZ A;  1T6U A;  3SXM A;  5F5F A;  3SYN A;  2XLM A;  1AVO B;  3R2P A;  1Q0D A;  3I5P A;  3ECS A;  4MQ9 F;  4XLN F;  2Q9B A;  2H7B A;  3SEO A;  3TK0 A;  1J8Y F;  1OR3 A;  3W2V A;  3DMD A;  3HTK C;  5A6J A;  5B3S C;  2ZPA A;  3EG9 B;  4N6H A;  4P9T A;  4BPM A;  1NU9 C;  2F22 A;  3QW0 A;  3ZTM A;  5DS5 A;  2Q9C A;  1O5H A;  2J0X A;  4CSA A;  4JIO A;  1E84 A;  3SNH A;  2OEX A;  3GWN A;  5DQZ A;  3MYF A;  3CQZ A;  1CPR A;  3C8Z A;  3L8I A;  4H54 A;  4C3B A;  1DOV A;  2WZF A;  4MTO A;  5FZT A;  4JEB A;  2DI3 A;  2YL0 A;  4DXW A;  2D4U A;  2KC3 A;  3V5Y A;  3C63 A;  1MND A;  3LAY A;  1Z63 A;  1RXQ A;  3KL4 A;  4NTA A;  2QLA A;  5KYU B;  2WL8 A;  3HNI A;  3U5S A;  3JZ0 A;  4J7Y A;  4EBJ A;  4MW8 A;  3AJM A;  4E17 A;  3NG1 A;  2B0H A;  4Z9H A;  4YT5 A;  1Z5Z A;  3EH1 A;  3GEE A;  4P6I C;  4XEF A;  2OKU A;  2LFD A;  3U2M A;  3EFO B;  4CDV A;  3R7C A;  4OIN F;  2EPK X;  3I4U A;  2RD9 A;  5L3Q A;  1VLT A;  4HE8 D;  2HS5 A;  5KYY B;  4BG0 A;  4DOZ A;  2XXA B;  2IOQ A;  3NKD A;  3S28 A;  4YWQ A;  1T9K A;  3IQ5 A;  4BJ6 A;  1OCR C;  2GFH A;  4U5D E;  3DE9 A;  5D92 A;  1H9G A;  3AG1 C;  2KYH A;  2L6H A;  3EGD B;  4D4N A;  2I15 A;  3DWW A;  3NDB B;  3KH2 A;  1ZVZ A;  2AP3 A;  3C7J A;  3NYJ A;  4JUR I;  4B6I A;  4OIO F;  4MTG A;  3B0P A;  4AL1 A;  3QTH A;  4FAP B;  2W4B A;  1VYI A;  4FX5 A;  4AL0 A;  3B9Q A;  3G4Z A;  3LEO A;  3LNM B;  1G4W R;  1KNY A;  1I4Z A;  3HNL A;  1WN0 A;  4G0H A;  1JRA A;  2PX3 A;  2AWC A;  5COF A;  3FMS A;  3UMI A;  3ZDL A;  2RSE B;  2XLH A;  3QW1 A;  3K66 A;  3CAX A;  1A0B A;  1HMO A;  4PJM A;  3U2L A;  1MNE A;  3DJU B;  2HKV A;  3K7D A;  3TQO A;  3U0C A;  3L8J A;  1B68 A;  1HE9 A;  5E3A A;  1PCX A;  3MFN A;  2GAQ A;  4MND A;  3M4B A;  4U5G A;  1BR2 A;  2Y39 A;  3S9O A;  3T6B A;  4LDR A;  5JRA A;  1J8M F;  2J9U A;  3QVZ A;  2IXN A;  3TUL A;  1ORJ A;  1D0X A;  2LSE A;  1D1A A;  3VRC A;  5L0I A;  5CIV A;  3K1I A;  3OWT A;  4Z9I A;  3Q7G A;  4XLP F;  2Y3H A;  2NSG A;  2OOC A;  2QE9 A;  4O7G A;  1IW7 F;  1T6Q A;  2ZD9 A;  2A0U A;  4CS8 C;  1BR4 A;  2H8A A;  4CIH A;  1ZHW A;  1OXB A;  2HUJ A;  2R7W A;  3POV A;  5GPG B;  1TWC A;  1S7Z A;  1XWJ A;  3HLZ A;  2AVK A;  2XM4 A;  3OEO A;  1VTM P;  1YDI A;  1JOG A;  1Z3I X;  3N0T A;  4NTF A;  1C02 A;  4EBK A;  4N06 A;  2AU5 A;  5IY5 C;  2D5R B;  3FXH A;  3PMR A;  2EIK C;  2HMQ A;  4J7T A;  5HSW A;  1FR0 A;  1ZZP A;  2C04 A;  1FMV A;  1MMA A;  1LI5 A;  1Z7Q c;  2Q00 A;  5DLJ A;  4KNV A;  3FAP B;  4MW3 A;  4XEV A;  2J9B A;  5L0G A;  4C7O B;  4YT4 A;  4OIP F;  2G3K A;  4BEM J;  3EG9 A;  2TMV P;  4P9F A;  1Y4C A;  2KGO A;  2R02 A;  4I44 A;  4RD9 A;  5EGY A;  4KC9 A;  3ZWI A;  2HSQ A;  4BJ5 C;  3PHF 2;  1OXK A;  3L34 A;  1OW7 A;  4YL3 A;  4BJT A;  1LS1 A;  3T4R A;  4G7H F;  2R7V A;  1KTM A;  4EKW A;  4XPW A;  4HFK B;  2EIM C;  1CGN A;  3A11 A;  2HFI A;  3AGU A;  2WVN A;  3I5Q A;  4IRU A;  1YZC A;  4EIY A;  1UG7 A;  1LS4 A;  1R5I D;  4PJL A;  2W9Y A;  4JE9 A;  3RVY A;  4JJF A;  4U9E A;  1QLE C;  3WHN A;  1U0B B;  2YLG A;  1O87 A;  2FAP B;  2QNL A;  2V26 A;  2LIG A;  2YZS A;  2CGE A;  3EFO A;  4JTA B;  2Y3G A; 
#chains in the Genus database with same CATH homology
 5COM A;  2OQM A;  3GOR A;  5COG A;  5CIV A;  3QTH A;  2NSG A;  2QE9 A;  1RXQ A;  2P1A A;  5COF A;  2OU6 A;  3DKA A;  4N6C A;  3DI5 A;  2HKV A;  2YQY A;  2NSF A;  2RD9 A;  2F22 A;  2QNL A;  3CEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...