2OU6A

Crystal structure of a putative metalloenzyme of the duf664 family (dr_1065) from deinococcus radiodurans at 1.80 a resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
183
structure length
183
Chain Sequence
PTFNPELHAQTLNSERAYFVQPDADPAFTPHIGALVEMLTYARLTTLQAVEGLPEDQLWATAPGFANSIGTLLAHIAAVERVYHVLSFQGRDVTPEDDGAAYWGLTMGKEGTAPARLPTLDELRAELADARAETLRVFAAKDDAWLAEPLGPGWANQHWAWFHVMEDEVNHRGQLRLLRQVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title Crystal structure of hypothetical protein (NP_294789.1) from Deinococcus radiodurans at 1.80 A resolution
rcsb
source organism Deinococcus radiodurans
molecule tags Metal binding protein
total genus 63
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04978 DUF664 Protein of unknown function (DUF664)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 2ou6A00
3CEXA 3DI5A 3DKAA 2HKVA 2F22A 2NSGA 2YQYA 2QE9A 1RXQA 5COGA 2OU6A 2RD9A 5COFA 5CIVA 2NSFA 3GORA 5COMA 3QTHA 2P1AA 2OQMA 4N6CA 2QNLA
chains in the Genus database with same CATH superfamily
3JCUQ 4B6IA 4DXWA 2LD6A 2HFIA 2VCAA 1NSGB 2QTVA 4D4XA 2OCCC 4GEHA 3I5QA 1M2VA 1FTSA 2OJQA 3O39A 4LLEA 4MW8A 2KNHA 1ZHTA 1C02A 2OKUA 5E2QA 1LPEA 4ULVA 1ST6A 1YYXA 3C63A 2PX0A 3NG1A 2QE9A 2UUIA 5L0IA 2R7UA 4LLCA 3PHF2 3JT1A 4JTCB 4K7BA 4X0RA 3GEIA 2WVQA 1ZHXA 2Q9AA 1Z23A 1QKRA 4IGGA 2PX3A 1O5HA 2EILC 3EZIA 3VM6A 1OCRC 1ZYRF 1OR2A 3EPVA 4JJGA 3OA1A 2HSQA 1D1BA 1HE1A 2LFDA 4CDAA 5COMA 1K40A 2OQMA 1FMVA 3L0IA 4MVQA 1S7ZA 2UUHA 1PV3A 4L6RA 4MVOA 3AG3C 2E87A 2R05A 3FOOA 3UR3C 4CJGA 3JYYA 1M6TA 3AGUA 3FVYA 1ORJA 2EIKC 3LJBA 4KNVA 4BG0A 3H65A 4YT4A 4H4KC 2CCYA 3CAXA 4YT2A 4OINF 3QVZA 1PCXA 4J30B 4XEFA 3AG2C 1D0XA 3HNJA 3UGOA 4XWJA 4JC7A 3DZAA 2WL8A 5KYNA 4PK4A 5A6BA 4ZLDA 4E7ZA 1JPJA 1BZ4A 1TFKB 1WASA 3ABMC 2R7OA 3V5YA 2OOCA 2EPMX 2HJ3A 5COFA 2ZXOA 1CGNA 1OXKA 1Q0DA 2CGEA 3F47A 1FFTC 3QVYA 1XZPA 2B0HA 2J8WA 5KYUA 3TD7A 2CYDA 3DD7A 3LESA 2Q7RA 3O6XA 4YL3A 2VASA 2VB6A 5B1BC 4KI2A 1KTMA 2PF4E 1HW2A 2Y3HA 3NYMA 1OW7A 3C7JA 3K66A 1EKYA 2HUJA 4Q5SF 1MNDA 1RKEB 3DM5A 4BEMJ 1C17M 4LACB 2Y69C 2CW0F 2YL0A 2W4BA 4HFFB 5AGFA 4AK9A 4JJFA 3DM9B 3SYNA 2WZGA 1GQAA 2ICWG 1LKXA 2XM4A 1I4ZA 5JSLA 5JLIA 3U0CA 5E3CA 3K6BA 3RFYA 4W8KA 3SXZA 1E85A 2R7RA 3EFOB 2YVKA 4RDAA 4NTFA 5T1DB 3W2WA 5KYWA 1FMWA 1ZU5A 1LS1A 1SR2A 3ABLC 4DVZA 5DS6A 3O55A 2OU6A 1OQCA 4XLPF 1TWCA 3IHUA 3NKEA 5KYYA 3NMKA 4BJ6A 4HFKB 2LCHA 1NZEA 3C8GA 4D4NA 1ZHZA 4EIYA 4FAPB 1Q0FA 1DOVA 4C3BA 1GM5A 2R7TA 2LIGA 3UNGC 2EINC 4FESA 3ZC4A 3IQ6A 5L0CA 3IEEA 4U9EA 2Y3DA 3B0PA 3M4CA 5JRAA 2HKVA 3A11A 3PCVA 4JW1A 3SZRA 4BJ5A 4JEAA 2R7VA 1ZW2A 3GM2A 1NG1A 3WG7C 3EG9B 1FR0A 3M79A 1HW1A 1WWPA 2LP4A 3JTLO 4KC9A 4A2NB 2W9YA 3U2LA 1O87A 2AVKA 4DRJB 1WTYA 5E33A 1OR3A 3X2QC 2ZPAA 2EPKX 1Y6DA 3JSZA 4CS8A 3TK0A 1TR2A 3Q6NA 3PDMP 1A7EA 2P1AA 3B9QA 4G78A 3W8HA 1J8MF 4IAQA 2A0UA 3S0XA 1B68A 3IQ5A 1VOMA 1LI5A 5F28E 1UFBA 4AL1A 2AP3A 1FAPB 1E84A 4OD4A 2YLIA 4PR9A 3OEOA 4U5FE 3LUTB 2Z15A 1Z63A 3ZSUA 2LK4A 3U9MA 5D92A 5JVEA 2W4MA 2IXMA 1OCZC 2B0JA 3FOPA 4ONSA 4DBQA 1OKKD 3FDQA 1NLXA 1A7VA 2HZ8A 2XLWA 2YQYA 3ZVRA 1KNYA 1QPUA 1Q0GA 3ASNC 3HNKA 4IB4A 5L3VA 1D1AA 3FXHA 4KNWA 2HMZA 3TOMA 3W2VA 3C8ZA 4W8PA 1R5ID 1VK5A 4AL0A 4U5BE 4GQHA 2XXAB 2WVNA 4IRUA 3S28A 4EWCA 1JRAA 4JVSA 1CGME 2J46A 2KC3A 1YYJA 2M4EA 3RQEA 5IY5C 4UDVA 4G7ZF 1HMDA 4Q7CA 5TJ5E 5B3IA 2WB7A 4BJ6C 5EK0A 2C04A 2J9WA 2XLEA 4CS9A 2ZD9A 3EHMA 3PMRA 3LNMB 3ECSA 4U5EE 2A0BA 3AQCA 2J45A 4QDLA 3U9JA 4N06A 2KK1A 3U8VA 3V5XA 4EBJA 3G4ZA 2KW3C 3MLGA 4NCQA 1VLTA 5L0GA 1CPRA 4E0HA 2JX0A 2Q00A 3EZHA 3EFOA 4IAOA 4JKVA 4GYTA 4EKWA 4BJ5C 3US6A 3UGPA 4XEVA 2JPUA 4U5HA 3HTKC 2IXPA 1YA9A 3T4RA 1BR4A 2VC9A 1U0BB 2P61A 3DAGA 1I4YA 2DGJA 2J9VA 3JZ0A 4PJNA 3RYLA 3KPHA 2EPOA 1OW8A 1TWAA 1YA7O 4WGYA 4JE9A 2YWAA 4AX2A 3DXJF 4OIPF 3C62A 3R7CA 3K1HA 3LS0A 3RQGA 1OW6A 1RJ9A 4LDKA 3DI5A 3VF0A 3TJ6A 4CS8C 5A6KA 2R7WA 2XS8A 2I15A 1V54C 1T6QA 2W45A 1G8XA 4CS7A 3IPMO 4F4BA 1VMAA 3K33A 1HY5A 3EH2A 4PJJA 1LE4A 4JCZA 4JTDB 4Z9JA 4XLNF 2YRFA 3VAYA 2QUPA 2NSGA 3RKOF 1IW7F 2ZXRA 4JZAA 2YLDA 2J0XA 1G4US 2GFHA 4EUKB 5JS5A 1W2WA 1YZCA 3MBGA 4YT5A 3UMIA 1MNEA 1HMOA 5CIVA 1SF8A 3Q7GA 4WGZA 3LS1A 5CI9A 1NU9C 4JCHA 3CQZA 2XL4A 4MW3A 3SXMA 3TOLA 3L8JA 4AE4A 5FCLA 3QW1A 1V55C 2XLOA 4EBBA 2PP4A 3K1IC 2KQ9A 2P6VA 1TWGA 4MTGA 1M56C 4HE8D 3LEVA 3SEOA 1SMYF 2IXNA 1LM3B 4G0HA 2BL2A 3CEXA 3QMKA 5L0HA 1KU2A 1RKCA 4BJ1A 1RCPA 4CDYA 5KYXB 2LFFA 1I5NA 2NUTB 2OG2A 3GM1A 1ORYA 1G5ZA 3M4BA 5DS4A 2GAQA 2XL8A 3HJCA 3QW0A 4PFOA 4CS9C 2NUPB 2ZXWC 1E2XA 1T01A 3MFNA 3Q6MA 3W4YA 4OIRF 1NBBA 4FX5A 4MVSA 1BDJB 1DOWA 4ANJA 2DI3A 2DYRC 3LNRA 2H8AA 1RMVA 3ASOC 2CNWA 3ATPA 5DS5A 3M1CB 1VLSA 2J7PA 4MS2A 4OIQF 3G50A 4C7OA 2CDQA 2XLMA 5F5HA 2YL3A 4U9DA 3HLZA 1A0BA 1YLMA 4BPMA 1UG7A 5JT4A 3BRJA 4OIOF 3J06A 2P0NA 1EA8A 2Y39A 1OCOC 3S27A 1Z3IX 2XS1A 2IYLD 1AEPA 1N1CA 3DJUB 2JD3A 4G7OF 1M2VB 4E18A 1ZU4A 3W8IA 3EGDB 1TKNA 2A6EF 1XWJA 2XLVA 2D4UA 2H7OA 3N24A 1V74B 3MYFA 1APCA 4JTAB 2VCBA 3EHNA 4CJOA 2R7QA 2L6GA 3SP1A 4DBRA 3VYWA 5A6JA 4ULWA 5DVWA 3TQOA 4NY3A 3RVZA 5BUOA 2X51A 5B3SC 3AOUA 3KKBA 2DYSC 1XZQA 4ZLCA 5KYYB 4CSAC 2Y3BA 2HS5A 3AQBA 5L0JA 2KSFA 1VTMP 3F46A 3H2UA 4YJWA 3JYHA 4I44A 2XLDA 4A4AA 2QLAA 1E83A 1ZHYA 2ETSA 4I3MA 3JSEO 4J32B 1YARO 5A69A 3POVA 3QZCA 5F5FA 4LDQA 2G3KA 3V7OA 3ZG1A 5DQTA 4MVUA 1JMWA 2NPUA 4E17A 1LE2A 1YAUO 3HNIA 4QI0A 4DOZA 5A6BD 2F22A 3AGTA 4QI2A 2IXOA 2L81A 1T6IA 3DE9A 4IWBA 4YT8A 1K04A 4U5CE 5DLJA 4E0IA 4KBLA 5COGA 3A9CA 2HMQA 1Q0MA 2HSBA 4JIOA 2NSFA 3KH2A 4YWQA 3K1IA 4YL0A 2IBFA 1OCCC 3ZIBA 2LQGA 3EH1A 5EGYA 1T6UA 2OEVA 3FHDA 1YVIA 3NMIA 4XQ1A 2AWCA 4CX9A 4Z9HA 4C3EA 4E7SA 3JRMO 1K05A 2HV7A 3VRCA 3T6BA 4NC3A 4DJ9A 1RKEA 2WVOA 3SXYA 1GGQA 3H2VA 3GEEA 3Q7LA 3CZ6A 3NKDA 1A7DA 1Y4CA 1MMGA 3S90A 1Z7Qc 5AC4A 1YJGA 3TULA 1VYKA 2PBEA 1WN0A 3DJNB 5KYWB 1AVOB 4M63A 3RH3A 1IZMA 2R7SA 3U2MA 2TMVP 3FAPB 2XM0A 5T3WA 4ER9A 3NYLA 3S9OA 2J7PD 4HEAJ 2R9RB 2YKZA 4O6YA 1MQVA 2Y3GA 1QSPA 4YL1A 3ZTZA 4J7YA 2BC5A 4PFPA 2V3CC 4C3DA 3FAJA 3C8GB 3C8GD 1H9GA 4JEBA 4U5GA 2GWWA 4NTBA 4U5DE 4H54A 1ZHWA 2H7BA 3T9OA 2A68F 4MVRA 2WZLA 4RD9A 2BE5F 3WODF 3LEOA 5HSWA 3UMKA 4PJMA 3B71A 3X1OA 1A41A 3DE8A 1ZVZA 1T9KA 3EGXB 3B0UX 3AG4C 4NTAA 2Q3TA 2Q9CA 2G62A 1CGOA 1D1CA 2YLGA 2XSEA 1WGWA 3EGDA 1V4AA 2MYSA 3OWTA 4XPXA 1U6HA 2RSEB 2YL7A 2EIMC 5JUAA 1H9TA 3GWLA 3ITFA 4DRIB 1LS4A 3EG9A 4MNDA 5GPGB 2V26A 1LI7A 1RXQA 2QY9A 1JR8A 4JRZA 2EPNA 1O3UA 2XLHA 3ZQYA 4CSAA 1MMDA 4G7HF 4MTOA 2R7XA 2L6FA 3U8PA 3DAFA 3UMHA 1ORSC 1OXBA 1BR2A 2XL6A 4N6HA 3U3FA 3RIPA 3RVYA 2HJMA 3N2ZB 4Q4ZF 4CBEA 2MWQA 5JP7A 2FFHA 1TQGA 3MYIA 3NYJA 4PJLA 3KMIA 5DQZA 2AWYA 1WOLA 1VYIA 2PNOA 2YEVA 4OD5A 4DRHB 3B0VC 1QQ3A 2EPLX 2FAPB 3E70C 1LIHA 2YHSA 3EQLF 1S05A 1AUEA 4BEJA 1PD1A 2EIJC 4IARA 1OKKA 5FZTA 4LDRA 4I1OB 4K0DA 3NMJA 2GA0A 4JURI 4P9FA 1Z5ZA 2WZFA 1FNTc 3SXKA 3NDBB 1SYQA 4I1MA 4FWVA 2A69F 3T6JA 1VB5A 4RBNA 4DVYP 1WATA 4R32A 2XXAA 1ZW3A 2M64A 3GORA 4O6NA 3SNHA 3L34A 4N6CA 1T5OA 1YDIA 3NRHA 4MVMA 3WAQA 5EHHA 5L3QA 3EJNA 1FFHA 2NG1A 3S29A 5HV9A 1MMAA 4MQ9F 3ZWIA 1PD0A 1QLEC 1G4WR 2O9XA 2YL1A 4WJ0A 4CDVA 1M57C 2KYHA 1EI7A 2ZXPA 3L8IA 3ZDLA 4CIPA 5L0FA 4YN0B 2D5RB 3BEHA 2OEXA 1H7IA 1F1MA 1L3PA 2HV6A 2VH3A 3KL4A 1JPNA 2J9BA 3M15A 3N0TA 1JOGA 4K1OA 1GS9A 3DMDA 4XPYA 3RQFA 2FGYA 3TJ5A 1LVKA 5CI8A 1NU7D 3GANA 1SZIA 2L6HA 3ZQVA 3U5SA 3I4UA 4N4WA 5BQGA 1L7CA 3R2PA 4MVZA 3JRTA 5L0DA 1RJ9B 3LLKA 5K0IA 3RW0A 2G3VA 3GEHA 1NFNA 2L7AA 3RF3A 3EGXA 4LERA 2IM8A 3LLIA 2R03A 3L1MA 4MTFA 2LSEA 5B1AC 3DKAA 1CPQA 1BBHA 3GWNA 4XPWA 3AJMA 5D91A 5T3TA 1EQ1A 4Z9IA 1H6GA 2H7VC 5A6AA 2PFDA 5E3AA 3CSKA 2A6HF 1D0ZA 3V5ZA 4O7GA 2MHRA 5BQIA 2ASRA 4O6MA 5AC5A 2OJED 3GODA 1J8YF 1TWHA 3G4XA 4XEKA 2YZSA 4IJJA 2IOQA 4YK5A 3O10A 4EBKA 2R25A 4AE4B 5KYUB 2GDCA 1HE9A 1JAFA 4J7TA 3KYIA 1U89A 4P6IC 256BA 3LAYA 2XRHA 3I5PA 1M2OA 1QZXA 3E9VA 2C03A 1NFOA 3K7DA 1E86A 1ZZPA 1YZAA 3IQCA 2L9JA 3IQTA 4WABA 2Q9BA 3MX3A 1Q0KA 5KYXA 2NUTA 4P9TA 1MMNA 2R02A 3S84A 1QVXA 2I8BA 4EHPA 1C03A 2DB4A 2P7VA 2NUPA 1D0YA 3ABKC 1BR1A 3B29A 2KJGA 3AG1C 3WHNA 3U3BA 2AU5A 3HKKA 4NQFA 4O79A 1R4TA 2CNWD 2KGOA 2Q4FA 2RD9A 3GM3A 3KYJA 2A1DD 2X0CA 3C18A 4BJTA 4C7OB 2VCCA 5BQHA 3ZTMA 3FMSA 3T6GB 2J9UA 3HNLA 4XTKA 3QTHA 4PACA 4CIHA 1TFOB 3DWWA 1Z6AA 2J0WA 2QNLA
chains in the Genus database with same CATH topology
3CEXA 3DI5A 3DKAA 2HKVA 2F22A 2NSGA 2YQYA 2QE9A 1RXQA 5COGA 2OU6A 2RD9A 5COFA 5CIVA 2NSFA 3GORA 5COMA 3QTHA 2P1AA 2OQMA 4N6CA 2QNLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CEX A;  3DI5 A;  3DKA A;  2HKV A;  2F22 A;  2NSG A;  2YQY A;  2QE9 A;  1RXQ A;  5COG A;  2OU6 A;  2RD9 A;  5COF A;  5CIV A;  2NSF A;  3GOR A;  5COM A;  3QTH A;  2P1A A;  2OQM A;  4N6C A;  2QNL A; 
#chains in the Genus database with same CATH topology
 3JCU Q;  4B6I A;  4DXW A;  2LD6 A;  2HFI A;  2VCA A;  1NSG B;  2QTV A;  4D4X A;  2OCC C;  4GEH A;  3I5Q A;  1M2V A;  1FTS A;  2OJQ A;  3O39 A;  4LLE A;  4MW8 A;  2KNH A;  1ZHT A;  1C02 A;  2OKU A;  5E2Q A;  1LPE A;  4ULV A;  1ST6 A;  1YYX A;  3C63 A;  2PX0 A;  3NG1 A;  2QE9 A;  2UUI A;  5L0I A;  2R7U A;  4LLC A;  3PHF 2;  3JT1 A;  4JTC B;  4K7B A;  4X0R A;  3GEI A;  2WVQ A;  1ZHX A;  2Q9A A;  1Z23 A;  1QKR A;  4IGG A;  2PX3 A;  1O5H A;  2EIL C;  3EZI A;  3VM6 A;  1OCR C;  1ZYR F;  1OR2 A;  3EPV A;  4JJG A;  3OA1 A;  2HSQ A;  1D1B A;  1HE1 A;  2LFD A;  4CDA A;  5COM A;  1K40 A;  2OQM A;  1FMV A;  3L0I A;  4MVQ A;  1S7Z A;  2UUH A;  1PV3 A;  4L6R A;  4MVO A;  3AG3 C;  2E87 A;  2R05 A;  3FOO A;  3UR3 C;  4CJG A;  3JYY A;  1M6T A;  3AGU A;  3FVY A;  1ORJ A;  2EIK C;  3LJB A;  4KNV A;  4BG0 A;  3H65 A;  4YT4 A;  4H4K C;  2CCY A;  3CAX A;  4YT2 A;  4OIN F;  3QVZ A;  1PCX A;  4J30 B;  4XEF A;  3AG2 C;  1D0X A;  3HNJ A;  3UGO A;  4XWJ A;  4JC7 A;  3DZA A;  2WL8 A;  5KYN A;  4PK4 A;  5A6B A;  4ZLD A;  4E7Z A;  1JPJ A;  1BZ4 A;  1TFK B;  1WAS A;  3ABM C;  2R7O A;  3V5Y A;  2OOC A;  2EPM X;  2HJ3 A;  5COF A;  2ZXO A;  1CGN A;  1OXK A;  1Q0D A;  2CGE A;  3F47 A;  1FFT C;  3QVY A;  1XZP A;  2B0H A;  2J8W A;  5KYU A;  3TD7 A;  2CYD A;  3DD7 A;  3LES A;  2Q7R A;  3O6X A;  4YL3 A;  2VAS A;  2VB6 A;  5B1B C;  4KI2 A;  1KTM A;  2PF4 E;  1HW2 A;  2Y3H A;  3NYM A;  1OW7 A;  3C7J A;  3K66 A;  1EKY A;  2HUJ A;  4Q5S F;  1MND A;  1RKE B;  3DM5 A;  4BEM J;  1C17 M;  4LAC B;  2Y69 C;  2CW0 F;  2YL0 A;  2W4B A;  4HFF B;  5AGF A;  4AK9 A;  4JJF A;  3DM9 B;  3SYN A;  2WZG A;  1GQA A;  2ICW G;  1LKX A;  2XM4 A;  1I4Z A;  5JSL A;  5JLI A;  3U0C A;  5E3C A;  3K6B A;  3RFY A;  4W8K A;  3SXZ A;  1E85 A;  2R7R A;  3EFO B;  2YVK A;  4RDA A;  4NTF A;  5T1D B;  3W2W A;  5KYW A;  1FMW A;  1ZU5 A;  1LS1 A;  1SR2 A;  3ABL C;  4DVZ A;  5DS6 A;  3O55 A;  2OU6 A;  1OQC A;  4XLP F;  1TWC A;  3IHU A;  3NKE A;  5KYY A;  3NMK A;  4BJ6 A;  4HFK B;  2LCH A;  1NZE A;  3C8G A;  4D4N A;  1ZHZ A;  4EIY A;  4FAP B;  1Q0F A;  1DOV A;  4C3B A;  1GM5 A;  2R7T A;  2LIG A;  3UNG C;  2EIN C;  4FES A;  3ZC4 A;  3IQ6 A;  5L0C A;  3IEE A;  4U9E A;  2Y3D A;  3B0P A;  3M4C A;  5JRA A;  2HKV A;  3A11 A;  3PCV A;  4JW1 A;  3SZR A;  4BJ5 A;  4JEA A;  2R7V A;  1ZW2 A;  3GM2 A;  1NG1 A;  3WG7 C;  3EG9 B;  1FR0 A;  3M79 A;  1HW1 A;  1WWP A;  2LP4 A;  3JTL O;  4KC9 A;  4A2N B;  2W9Y A;  3U2L A;  1O87 A;  2AVK A;  4DRJ B;  1WTY A;  5E33 A;  1OR3 A;  3X2Q C;  2ZPA A;  2EPK X;  1Y6D A;  3JSZ A;  4CS8 A;  3TK0 A;  1TR2 A;  3Q6N A;  3PDM P;  1A7E A;  2P1A A;  3B9Q A;  4G78 A;  3W8H A;  1J8M F;  4IAQ A;  2A0U A;  3S0X A;  1B68 A;  3IQ5 A;  1VOM A;  1LI5 A;  5F28 E;  1UFB A;  4AL1 A;  2AP3 A;  1FAP B;  1E84 A;  4OD4 A;  2YLI A;  4PR9 A;  3OEO A;  4U5F E;  3LUT B;  2Z15 A;  1Z63 A;  3ZSU A;  2LK4 A;  3U9M A;  5D92 A;  5JVE A;  2W4M A;  2IXM A;  1OCZ C;  2B0J A;  3FOP A;  4ONS A;  4DBQ A;  1OKK D;  3FDQ A;  1NLX A;  1A7V A;  2HZ8 A;  2XLW A;  2YQY A;  3ZVR A;  1KNY A;  1QPU A;  1Q0G A;  3ASN C;  3HNK A;  4IB4 A;  5L3V A;  1D1A A;  3FXH A;  4KNW A;  2HMZ A;  3TOM A;  3W2V A;  3C8Z A;  4W8P A;  1R5I D;  1VK5 A;  4AL0 A;  4U5B E;  4GQH A;  2XXA B;  2WVN A;  4IRU A;  3S28 A;  4EWC A;  1JRA A;  4JVS A;  1CGM E;  2J46 A;  2KC3 A;  1YYJ A;  2M4E A;  3RQE A;  5IY5 C;  4UDV A;  4G7Z F;  1HMD A;  4Q7C A;  5TJ5 E;  5B3I A;  2WB7 A;  4BJ6 C;  5EK0 A;  2C04 A;  2J9W A;  2XLE A;  4CS9 A;  2ZD9 A;  3EHM A;  3PMR A;  3LNM B;  3ECS A;  4U5E E;  2A0B A;  3AQC A;  2J45 A;  4QDL A;  3U9J A;  4N06 A;  2KK1 A;  3U8V A;  3V5X A;  4EBJ A;  3G4Z A;  2KW3 C;  3MLG A;  4NCQ A;  1VLT A;  5L0G A;  1CPR A;  4E0H A;  2JX0 A;  2Q00 A;  3EZH A;  3EFO A;  4IAO A;  4JKV A;  4GYT A;  4EKW A;  4BJ5 C;  3US6 A;  3UGP A;  4XEV A;  2JPU A;  4U5H A;  3HTK C;  2IXP A;  1YA9 A;  3T4R A;  1BR4 A;  2VC9 A;  1U0B B;  2P61 A;  3DAG A;  1I4Y A;  2DGJ A;  2J9V A;  3JZ0 A;  4PJN A;  3RYL A;  3KPH A;  2EPO A;  1OW8 A;  1TWA A;  1YA7 O;  4WGY A;  4JE9 A;  2YWA A;  4AX2 A;  3DXJ F;  4OIP F;  3C62 A;  3R7C A;  3K1H A;  3LS0 A;  3RQG A;  1OW6 A;  1RJ9 A;  4LDK A;  3DI5 A;  3VF0 A;  3TJ6 A;  4CS8 C;  5A6K A;  2R7W A;  2XS8 A;  2I15 A;  1V54 C;  1T6Q A;  2W45 A;  1G8X A;  4CS7 A;  3IPM O;  4F4B A;  1VMA A;  3K33 A;  1HY5 A;  3EH2 A;  4PJJ A;  1LE4 A;  4JCZ A;  4JTD B;  4Z9J A;  4XLN F;  2YRF A;  3VAY A;  2QUP A;  2NSG A;  3RKO F;  1IW7 F;  2ZXR A;  4JZA A;  2YLD A;  2J0X A;  1G4U S;  2GFH A;  4EUK B;  5JS5 A;  1W2W A;  1YZC A;  3MBG A;  4YT5 A;  3UMI A;  1MNE A;  1HMO A;  5CIV A;  1SF8 A;  3Q7G A;  4WGZ A;  3LS1 A;  5CI9 A;  1NU9 C;  4JCH A;  3CQZ A;  2XL4 A;  4MW3 A;  3SXM A;  3TOL A;  3L8J A;  4AE4 A;  5FCL A;  3QW1 A;  1V55 C;  2XLO A;  4EBB A;  2PP4 A;  3K1I C;  2KQ9 A;  2P6V A;  1TWG A;  4MTG A;  1M56 C;  4HE8 D;  3LEV A;  3SEO A;  1SMY F;  2IXN A;  1LM3 B;  4G0H A;  2BL2 A;  3CEX A;  3QMK A;  5L0H A;  1KU2 A;  1RKC A;  4BJ1 A;  1RCP A;  4CDY A;  5KYX B;  2LFF A;  1I5N A;  2NUT B;  2OG2 A;  3GM1 A;  1ORY A;  1G5Z A;  3M4B A;  5DS4 A;  2GAQ A;  2XL8 A;  3HJC A;  3QW0 A;  4PFO A;  4CS9 C;  2NUP B;  2ZXW C;  1E2X A;  1T01 A;  3MFN A;  3Q6M A;  3W4Y A;  4OIR F;  1NBB A;  4FX5 A;  4MVS A;  1BDJ B;  1DOW A;  4ANJ A;  2DI3 A;  2DYR C;  3LNR A;  2H8A A;  1RMV A;  3ASO C;  2CNW A;  3ATP A;  5DS5 A;  3M1C B;  1VLS A;  2J7P A;  4MS2 A;  4OIQ F;  3G50 A;  4C7O A;  2CDQ A;  2XLM A;  5F5H A;  2YL3 A;  4U9D A;  3HLZ A;  1A0B A;  1YLM A;  4BPM A;  1UG7 A;  5JT4 A;  3BRJ A;  4OIO F;  3J06 A;  2P0N A;  1EA8 A;  2Y39 A;  1OCO C;  3S27 A;  1Z3I X;  2XS1 A;  2IYL D;  1AEP A;  1N1C A;  3DJU B;  2JD3 A;  4G7O F;  1M2V B;  4E18 A;  1ZU4 A;  3W8I A;  3EGD B;  1TKN A;  2A6E F;  1XWJ A;  2XLV A;  2D4U A;  2H7O A;  3N24 A;  1V74 B;  3MYF A;  1APC A;  4JTA B;  2VCB A;  3EHN A;  4CJO A;  2R7Q A;  2L6G A;  3SP1 A;  4DBR A;  3VYW A;  5A6J A;  4ULW A;  5DVW A;  3TQO A;  4NY3 A;  3RVZ A;  5BUO A;  2X51 A;  5B3S C;  3AOU A;  3KKB A;  2DYS C;  1XZQ A;  4ZLC A;  5KYY B;  4CSA C;  2Y3B A;  2HS5 A;  3AQB A;  5L0J A;  2KSF A;  1VTM P;  3F46 A;  3H2U A;  4YJW A;  3JYH A;  4I44 A;  2XLD A;  4A4A A;  2QLA A;  1E83 A;  1ZHY A;  2ETS A;  4I3M A;  3JSE O;  4J32 B;  1YAR O;  5A69 A;  3POV A;  3QZC A;  5F5F A;  4LDQ A;  2G3K A;  3V7O A;  3ZG1 A;  5DQT A;  4MVU A;  1JMW A;  2NPU A;  4E17 A;  1LE2 A;  1YAU O;  3HNI A;  4QI0 A;  4DOZ A;  5A6B D;  2F22 A;  3AGT A;  4QI2 A;  2IXO A;  2L81 A;  1T6I A;  3DE9 A;  4IWB A;  4YT8 A;  1K04 A;  4U5C E;  5DLJ A;  4E0I A;  4KBL A;  5COG A;  3A9C A;  2HMQ A;  1Q0M A;  2HSB A;  4JIO A;  2NSF A;  3KH2 A;  4YWQ A;  3K1I A;  4YL0 A;  2IBF A;  1OCC C;  3ZIB A;  2LQG A;  3EH1 A;  5EGY A;  1T6U A;  2OEV A;  3FHD A;  1YVI A;  3NMI A;  4XQ1 A;  2AWC A;  4CX9 A;  4Z9H A;  4C3E A;  4E7S A;  3JRM O;  1K05 A;  2HV7 A;  3VRC A;  3T6B A;  4NC3 A;  4DJ9 A;  1RKE A;  2WVO A;  3SXY A;  1GGQ A;  3H2V A;  3GEE A;  3Q7L A;  3CZ6 A;  3NKD A;  1A7D A;  1Y4C A;  1MMG A;  3S90 A;  1Z7Q c;  5AC4 A;  1YJG A;  3TUL A;  1VYK A;  2PBE A;  1WN0 A;  3DJN B;  5KYW B;  1AVO B;  4M63 A;  3RH3 A;  1IZM A;  2R7S A;  3U2M A;  2TMV P;  3FAP B;  2XM0 A;  5T3W A;  4ER9 A;  3NYL A;  3S9O A;  2J7P D;  4HEA J;  2R9R B;  2YKZ A;  4O6Y A;  1MQV A;  2Y3G A;  1QSP A;  4YL1 A;  3ZTZ A;  4J7Y A;  2BC5 A;  4PFP A;  2V3C C;  4C3D A;  3FAJ A;  3C8G B;  3C8G D;  1H9G A;  4JEB A;  4U5G A;  2GWW A;  4NTB A;  4U5D E;  4H54 A;  1ZHW A;  2H7B A;  3T9O A;  2A68 F;  4MVR A;  2WZL A;  4RD9 A;  2BE5 F;  3WOD F;  3LEO A;  5HSW A;  3UMK A;  4PJM A;  3B71 A;  3X1O A;  1A41 A;  3DE8 A;  1ZVZ A;  1T9K A;  3EGX B;  3B0U X;  3AG4 C;  4NTA A;  2Q3T A;  2Q9C A;  2G62 A;  1CGO A;  1D1C A;  2YLG A;  2XSE A;  1WGW A;  3EGD A;  1V4A A;  2MYS A;  3OWT A;  4XPX A;  1U6H A;  2RSE B;  2YL7 A;  2EIM C;  5JUA A;  1H9T A;  3GWL A;  3ITF A;  4DRI B;  1LS4 A;  3EG9 A;  4MND A;  5GPG B;  2V26 A;  1LI7 A;  1RXQ A;  2QY9 A;  1JR8 A;  4JRZ A;  2EPN A;  1O3U A;  2XLH A;  3ZQY A;  4CSA A;  1MMD A;  4G7H F;  4MTO A;  2R7X A;  2L6F A;  3U8P A;  3DAF A;  3UMH A;  1ORS C;  1OXB A;  1BR2 A;  2XL6 A;  4N6H A;  3U3F A;  3RIP A;  3RVY A;  2HJM A;  3N2Z B;  4Q4Z F;  4CBE A;  2MWQ A;  5JP7 A;  2FFH A;  1TQG A;  3MYI A;  3NYJ A;  4PJL A;  3KMI A;  5DQZ A;  2AWY A;  1WOL A;  1VYI A;  2PNO A;  2YEV A;  4OD5 A;  4DRH B;  3B0V C;  1QQ3 A;  2EPL X;  2FAP B;  3E70 C;  1LIH A;  2YHS A;  3EQL F;  1S05 A;  1AUE A;  4BEJ A;  1PD1 A;  2EIJ C;  4IAR A;  1OKK A;  5FZT A;  4LDR A;  4I1O B;  4K0D A;  3NMJ A;  2GA0 A;  4JUR I;  4P9F A;  1Z5Z A;  2WZF A;  1FNT c;  3SXK A;  3NDB B;  1SYQ A;  4I1M A;  4FWV A;  2A69 F;  3T6J A;  1VB5 A;  4RBN A;  4DVY P;  1WAT A;  4R32 A;  2XXA A;  1ZW3 A;  2M64 A;  3GOR A;  4O6N A;  3SNH A;  3L34 A;  4N6C A;  1T5O A;  1YDI A;  3NRH A;  4MVM A;  3WAQ A;  5EHH A;  5L3Q A;  3EJN A;  1FFH A;  2NG1 A;  3S29 A;  5HV9 A;  1MMA A;  4MQ9 F;  3ZWI A;  1PD0 A;  1QLE C;  1G4W R;  2O9X A;  2YL1 A;  4WJ0 A;  4CDV A;  1M57 C;  2KYH A;  1EI7 A;  2ZXP A;  3L8I A;  3ZDL A;  4CIP A;  5L0F A;  4YN0 B;  2D5R B;  3BEH A;  2OEX A;  1H7I A;  1F1M A;  1L3P A;  2HV6 A;  2VH3 A;  3KL4 A;  1JPN A;  2J9B A;  3M15 A;  3N0T A;  1JOG A;  4K1O A;  1GS9 A;  3DMD A;  4XPY A;  3RQF A;  2FGY A;  3TJ5 A;  1LVK A;  5CI8 A;  1NU7 D;  3GAN A;  1SZI A;  2L6H A;  3ZQV A;  3U5S A;  3I4U A;  4N4W A;  5BQG A;  1L7C A;  3R2P A;  4MVZ A;  3JRT A;  5L0D A;  1RJ9 B;  3LLK A;  5K0I A;  3RW0 A;  2G3V A;  3GEH A;  1NFN A;  2L7A A;  3RF3 A;  3EGX A;  4LER A;  2IM8 A;  3LLI A;  2R03 A;  3L1M A;  4MTF A;  2LSE A;  5B1A C;  3DKA A;  1CPQ A;  1BBH A;  3GWN A;  4XPW A;  3AJM A;  5D91 A;  5T3T A;  1EQ1 A;  4Z9I A;  1H6G A;  2H7V C;  5A6A A;  2PFD A;  5E3A A;  3CSK A;  2A6H F;  1D0Z A;  3V5Z A;  4O7G A;  2MHR A;  5BQI A;  2ASR A;  4O6M A;  5AC5 A;  2OJE D;  3GOD A;  1J8Y F;  1TWH A;  3G4X A;  4XEK A;  2YZS A;  4IJJ A;  2IOQ A;  4YK5 A;  3O10 A;  4EBK A;  2R25 A;  4AE4 B;  5KYU B;  2GDC A;  1HE9 A;  1JAF A;  4J7T A;  3KYI A;  1U89 A;  4P6I C;  256B A;  3LAY A;  2XRH A;  3I5P A;  1M2O A;  1QZX A;  3E9V A;  2C03 A;  1NFO A;  3K7D A;  1E86 A;  1ZZP A;  1YZA A;  3IQC A;  2L9J A;  3IQT A;  4WAB A;  2Q9B A;  3MX3 A;  1Q0K A;  5KYX A;  2NUT A;  4P9T A;  1MMN A;  2R02 A;  3S84 A;  1QVX A;  2I8B A;  4EHP A;  1C03 A;  2DB4 A;  2P7V A;  2NUP A;  1D0Y A;  3ABK C;  1BR1 A;  3B29 A;  2KJG A;  3AG1 C;  3WHN A;  3U3B A;  2AU5 A;  3HKK A;  4NQF A;  4O79 A;  1R4T A;  2CNW D;  2KGO A;  2Q4F A;  2RD9 A;  3GM3 A;  3KYJ A;  2A1D D;  2X0C A;  3C18 A;  4BJT A;  4C7O B;  2VCC A;  5BQH A;  3ZTM A;  3FMS A;  3T6G B;  2J9U A;  3HNL A;  4XTK A;  3QTH A;  4PAC A;  4CIH A;  1TFO B;  3DWW A;  1Z6A A;  2J0W A;  2QNL A; 
#chains in the Genus database with same CATH homology
 3CEX A;  3DI5 A;  3DKA A;  2HKV A;  2F22 A;  2NSG A;  2YQY A;  2QE9 A;  1RXQ A;  5COG A;  2OU6 A;  2RD9 A;  5COF A;  5CIV A;  2NSF A;  3GOR A;  5COM A;  3QTH A;  2P1A A;  2OQM A;  4N6C A;  2QNL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...