2OU6A

Crystal structure of a putative metalloenzyme of the duf664 family (dr_1065) from deinococcus radiodurans at 1.80 a resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
183
structure length
183
Chain Sequence
b'PTFNPELHAQTLNSERAYFVQPDADPAFTPHIGALVEMLTYARLTTLQAVEGLPEDQLWATAPGFANSIGTLLAHIAAVERVYHVLSFQGRDVTPEDDGAAYWGLTMGKEGTAPARLPTLDELRAELADARAETLRVFAAKDDAWLAEPLGPGWANQHWAWFHVMEDEVNHRGQLRLLRQVLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title Crystal structure of hypothetical protein (NP_294789.1) from Deinococcus radiodurans at 1.80 A resolution
rcsb
source organism Deinococcus radiodurans
molecule tags Metal binding protein
total genus 63
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04978 DUF664 Protein of unknown function (DUF664)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 2ou6A00
2HKVA 2OQMA 2NSGA 3GORA 3QTHA 2F22A 3CEXA 2QE9A 2YQYA 5COFA 5COGA 1RXQA 3DKAA 5CIVA 5COMA 4N6CA 2OU6A 2NSFA 2QNLA 3DI5A 2P1AA 2RD9A
chains in the Genus database with same CATH superfamily
3S28A 4CJOA 3H2VA 5BUOA 4XEVA 3N0TA 3ITFA 4MNDA 3KMIA 4YJWA 2DGJA 3QTHA 5AC5A 5CI8A 4YT2A 3RH3A 1E86A 2B0JA 4K1OA 1TWGA 1QZXA 4BJ6C 3EJNA 4OIRF 2P0NA 1GQAA 3NYMA 3EPVA 1E83A 1QVXA 3ASNC 1YLMA 2KW3C 3KYIA 4FX5A 3LEOA 2LCHA 2P7VA 4J7TA 3AJMA 2WZFA 4JTCB 1YYXA 4BJ1A 2EIJC 1LE4A 2V26A 4OD4A 3O39A 1ORSC 1GGQA 4XPWA 2XLWA 4IGGA 4MVMA 2YLGA 3K33A 1RJ9B 2HS5A 1TWHA 1Y6DA 4CSAC 4E17A 2GFHA 5JRAA 1A7DA 1RJ9A 2CGEA 5L0GA 3MX3A 4BEJA 4D4NA 1HE9A 4XPYA 3QMKA 2XS1A 4PFOA 2PFDA 2W45A 4AX2A 5BQGA 5K0IA 2D4UA 4XEKA 3I5PA 2YZSA 4CS8C 4MVZA 4X0RA 1SR2A 2WVNA 2ZPAA 4MVSA 3ZTMA 3NDBB 4HFFB 4JURI 1O87A 3U9JA 2LFFA 3JTLO 1OR2A 2J46A 2HJMA 2L81A 4CJGA 3K66A 1UG7A 2P6VA 4YL3A 2ZXWC 4DBRA 5JS5A 1D1BA 1ZW2A 2KC3A 3F46A 3JRMO 4BJ5C 4BPMA 5JUAA 3MBGA 2A1DD 2L6GA 2OKUA 1UFBA 2L9JA 1MNDA 2PX0A 1Q0FA 2Z15A 4JTAB 1YVIA 1XWJA 2Y69C 3FAPB 4G7HF 2Q3TA 4JCHA 1YJGA 3M15A 3DJUB 3TJ5A 4HE8D 4JJFA 1R5ID 3MYIA 3ZWIA 2R7QA 3LS1A 2X0CA 3RQGA 1WATA 2ETSA 3O10A 5E33A 3S84A 3ZQYA 2C03A 3CZ6A 2PF4E 3GEHA 4P6IC 3SXKA 4FESA 3T6BA 4YL0A 4K0DA 5B3IA 3C8GD 5COFA 2O9XA 1YZAA 2LK4A 3B0UX 3B0PA 2Q9AA 2WZLA 3AGUA 2VH3A 2W4BA 2Y3DA 1PCXA 2ZXOA 3B0VC 3FXHA 2GDCA 2WVOA 3AGTA 5KYYB 4NQFA 5CIVA 3VRCA 5DS6A 3GEEA 2UUIA 4U5HA 4W8KA 5GPGB 2L7AA 2IXPA 2A69F 2FGYA 2J9BA 1TFOB 3ASOC 1M6TA 4LERA 4O79A 5TJ5E 3UMKA 4C3EA 1LIHA 5AC4A 3DM9B 5BQHA 3PMRA 1D0XA 2ICWG 2YHSA 1YA7O 4ULVA 3U2LA 1YYJA 3U8PA 1H9TA 1I4ZA 3L1MA 3LJBA 4I44A 4LDKA 4Z9JA 3NMIA 3SXZA 3ZIBA 5A69A 1C03A 2OQMA 1ORJA 4Q5SF 1H6GA 1EKYA 2PBEA 1MMDA 2J7PD 1Z5ZA 2IBFA 2PX3A 1VLSA 3LNMB 5DQZA 4YT8A 1FFHA 5FZTA 4E18A 3SP1A 5L0FA 1QQ3A 4GQHA 1ZU4A 3S0XA 2OG2A 1TFKB 5JT4A 2ZD9A 3FHDA 4EBKA 2DI3A 2QY9A 1ZYRF 3TJ6A 1NSGB 4RD9A 1D1CA 5T3TA 4K7BA 1ORYA 1HE1A 3ATPA 3R7CA 4ULWA 2G3KA 1BDJB 5L3QA 3QZCA 3ZDLA 4Q7CA 3LUTB 1MNEA 4MVRA 3ZQVA 3AG3C 2XM0A 1FNTc 1IW7F 1V55C 1ZU5A 3NMKA 1I4YA 2YLIA 5L3VA 3HTKC 2XL8A 1LPEA 2OEVA 2XRHA 1WWPA 3EHNA 1Y4CA 3GM2A 3X1OA 2VASA 4JTDB 2XM4A 1DOVA 2R05A 4CDYA 3EZIA 4NTFA 1YAUO 1WGWA 3UMIA 3PDMP 2R7XA 2XLVA 3U9MA 1GS9A 4CDVA 1H7IA 2IOQA 1BR4A 1NFOA 1ZHYA 2IXOA 3KL4A 4KC9A 4LACB 4DXWA 3HLZA 3LS0A 2XLEA 2VCAA 2LD6A 2EINC 3S9OA 2XXAB 3C8ZA 3L8IA 2A68F 3KKBA 5A6BA 1SF8A 2QNLA 1A7VA 1Z3IX 1CGOA 1OKKA 2EPKX 3BEHA 2PNOA 1Q0GA 2MWQA 2XXAA 2EIMC 1CPRA 5CI9A 4CIPA 1HW2A 2FAPB 3SXYA 3JSZA 3DWWA 4WGYA 2Q9CA 3V5YA 2XLHA 2AWYA 2HZ8A 2VB6A 4CS9C 4U9EA 3EFOB 3IQ5A 1G5ZA 3FAJA 3W8HA 4XPXA 4PR9A 3LNRA 2YWAA 3EFOA 3Q7GA 5COGA 1HW1A 4EIYA 2R7OA 1BZ4A 1J8MF 3GEIA 3V5ZA 4I1OB 5T3WA 1Z23A 4BG0A 4OINF 2I15A 3JSEO 2R03A 3UR3C 5L0IA 4D4XA 2I8BA 4HFKB 2H7OA 4M63A 2GAQA 3NG1A 2YKZA 1S05A 4O6MA 4DOZA 4YN0B 1B68A 3L8JA 5JLIA 3K1IC 3NKEA 4N06A 1VMAA 3JCUQ 4NC3A 3S90A 3RW0A 1FMWA 2D5RB 4DVYP 1OCOC 3U0CA 1OW8A 2F22A 3EH1A 4JC7A 3SYNA 3G4XA 3W4YA 4EUKB 1LKXA 1MMNA 3J06A 1T9KA 4G7ZF 4JZAA 1SZIA 1LS1A 5EGYA 1T6IA 1CGNA 3KH2A 3FVYA 2YL7A 3C63A 3CAXA 4MTGA 1V54C 4DRJB 4GEHA 2YL0A 3DKAA 3TK0A 1OW7A 1V74B 3FOOA 2EPLX 1TWCA 1T6QA 2CNWD 5COMA 3IEEA 1OXBA 3ZG1A 5HV9A 2AVKA 2LSEA 1RKCA 5JSLA 1O5HA 1A41A 4FWVA 4PFPA 2NPUA 4YWQA 3FDQA 2BE5F 3C18A 4G0HA 3DMDA 4BEMJ 1FAPB 3GM3A 2MHRA 4JW1A 1K05A 1FR0A 1VB5A 2LQGA 4CS7A 1E2XA 3NRHA 5EK0A 1DOWA 1JMWA 1G8XA 3C8GB 3MLGA 2H7BA 3C7JA 5E2QA 4KNWA 4QI2A 4IWBA 4JEAA 3GANA 1LS4A 1M57C 4IB4A 5KYNA 2YL3A 3POVA 3C8GA 2J8WA 1S7ZA 2IYLD 1HMOA 3NMJA 4WABA 1VTMP 4XEFA 3U3FA 3SXMA 3PCVA 3QVYA 1WASA 1YARO 5KYUB 2WVQA 1J8YF 3PHF2 1EI7A 2LFDA 5L0HA 3KPHA 5D91A 1QLEC 4ER9A 5KYUA 2E87A 2J0XA 4IARA 3O6XA 1AEPA 1SMYF 3JRTA 2JD3A 1T5OA 1ST6A 3SNHA 2BL2A 3I5QA 4IJJA 2NUPB 5HSWA 3RIPA 2ZXRA 4IAQA 3K1HA 4U5CE 4Z9HA 4A2NB 3LLKA 1VK5A 2NUPA 3OA1A 2BC5A 2DYSC 2J7PA 1EA8A 4CBEA 2R7VA 1WN0A 2YVKA 1I5NA 1OR3A 2XLDA 1YA9A 2WZGA 3E9VA 1APCA 4EWCA 4JIOA 5F28E 1NFNA 2H8AA 5DLJA 2YLDA 2Y3HA 3DAFA 5DVWA 3T6GB 2HUJA 1Z6AA 2XL4A 4I3MA 1OXKA 2EPOA 3U2MA 1Q0KA 4CDAA 4U5GA 4ONSA 3IQ6A 4FAPB 3DM5A 4XLPF 2PP4A 3EH2A 2Y3GA 1QKRA 1FFTC 1LM3B 2Q4FA 2Q9BA 3EGDA 4J30B 4XTKA 3VAYA 4E0HA 4E7SA 4MTOA 2NSGA 4DRHB 2DB4A 2CDQA 5DS5A 1Z63A 5DS4A 1ZHWA 3M79A 3HNLA 4NTBA 5T1DB 2EPNA 3RFYA 3ABKC 2V3CC 3W2VA 4U5BE 5E3CA 2CCYA 3AOUA 3S29A 3L0IA 1U89A 2KJGA 3AG1C 4Z9IA 1YZCA 4DRIB 4E0IA 4F4BA 2R7UA 4U5DE 1OCCC 1NLXA 3M1CB 1NBBA 4LDQA 4AL1A 2P61A 4QDLA 4OIQF 2FFHA 1CPQA 3LEVA 1JOGA 3L34A 1MQVA 4XLNF 5B3SC 2WB7A 2EILC 2J9WA 5A6KA 4HEAJ 4O6YA 4KI2A 3LAYA 4RBNA 4PJJA 4JJGA 1TR2A 3M4BA 3MYFA 4AK9A 3EHMA 1Q0DA 3DXJF 5B1AC 2MYSA 2Q00A 3CQZA 1U0BB 1RCPA 3TQOA 1G4US 3ZTZA 3C62A 4NCQA 1BBHA 1M56C 1M2OA 2IXMA 1QSPA 3QW0A 4CS9A 4AL0A 1HY5A 3IHUA 3MFNA 3GWLA 3O55A 1RXQA 1ZHZA 4MVUA 4MW8A 2VCCA 2XLMA 2YL1A 3B29A 4PACA 4U9DA 5B1BC 3QW1A 4C3BA 4E7ZA 2R7TA 3EQLF 5L0JA 3N24A 4RDAA 4MVOA 3NKDA 3RVYA 3BRJA 4BJ6A 2G3VA 2JX0A 1PD0A 4J7YA 4N4WA 2KSFA 4YL1A 4ANJA 1V4AA 2HMQA 3FOPA 1D0YA 2R02A 1RKEB 1IZMA 3B9QA 1M2VB 2RD9A 3ZSUA 4CX9A 4DBQA 2TMVP 1Q0MA 1NG1A 1JRAA 3GODA 4GYTA 1L7CA 1RKEA 3DE8A 1M2VA 3F47A 3NYJA 2B0HA 1NZEA 3M4CA 3CEXA 4OD5A 4CSAA 5KYYA 4YK5A 3IQTA 4NTAA 2YQYA 3K1IA 1HMDA 3K6BA 2XLOA 3JT1A 3JYHA 2AWCA 4H54A 4QI0A 1G4WR 3JYYA 5A6JA 1LE2A 1ZHXA 3TULA 2YRFA 3HNIA 1JPJA 4ZLDA 3DD7A 4JCZA 2LIGA 1JR8A 2KNHA 5BQIA 3OWTA 3NYLA 4J32B 4EHPA 2CNWA 3ECSA 3SZRA 2OJQA 2NSFA 1FMVA 3ABMC 3QVZA 4NY3A 5F5HA 4G78A 3X2QC 4LLEA 1AVOB 2R7SA 4CS8A 1TKNA 256BA 2HV7A 1XZPA 5L0DA 3DZAA 4LDRA 3AG2C 4BJ5A 1TQGA 2HKVA 4I1MA 3WHNA 3IPMO 2UUHA 4JRZA 1EQ1A 3T4RA 4BJTA 4OIOF 2HSBA 2L6FA 2R9RB 2RSEB 2W9YA 1OQCA 4JVSA 1H9GA 3HJCA 4U5FE 3FMSA 1MMGA 2QLAA 3RQFA 3RQEA 2QE9A 4MS2A 4EBBA 4U5EE 4G7OF 2J0WA 4JKVA 1VYIA 4ZLCA 1C17M 5JP7A 3UGPA 4IRUA 5AGFA 3RKOF 2J9VA 4MQ9F 2IM8A 1A7EA 2IXNA 2OOCA 4L6RA 2KK1A 1Z7Qc 1N1CA 4N6HA 4R32A 4UDVA 4C7OB 2EPMX 1RMVA 2M4EA 3RF3A 4WJ0A 1JAFA 3LESA 3ABLC 3DI5A 3EGXB 4P9FA 3V7OA 2XL6A 2GA0A 4C7OA 3G50A 4YT5A 3U5SA 3TOMA 1OW6A 3AG4C 3WAQA 3U8VA 5DQTA 1MMAA 4O6NA 3EGXA 2YEVA 3UNGC 5IY5C 4IAOA 4C3DA 2XSEA 2G62A 3OEOA 4W8PA 1KTMA 1W2WA 1XZQA 2VC9A 1T01A 2Q7RA 2M64A 2HJ3A 4PJNA 3R2PA 1VLTA 2AP3A 3N2ZB 2HMZA 4Q4ZF 3VF0A 5EHHA 1A0BA 4B6IA 1ZW3A 1BR1A 3A11A 3HNJA 2GWWA 2KYHA 1E85A 3DAGA 1K04A 2CYDA 4PJMA 4OIPF 3DJNB 3RVZA 3VYWA 3CSKA 3Q6NA 2A0BA 3EZHA 3LLIA 3T6JA 3WODF 2J45A 2JPUA 1QPUA 1ZHTA 2J9UA 4WGZA 3W2WA 3S27A 3EGDB 1ZZPA 2P1AA 1PD1A 1CGME 3TD7A 2R7WA 5E3AA 2DYRC 2Y3BA 3JZ0A 4AE4B 2HV6A 4DJ9A 1NU7D 2R7RA 2A6HF 3GM1A 3IQCA 4PK4A 3W8IA 1K40A 4AE4A 3GWNA 3UGOA 3US6A 3AQCA 3U3BA 2NG1A 4DVZA 4XWJA 3UMHA 2QTVA 2NUTB 1NU9C 2W4MA 1VYKA 2CW0F 3HKKA 3ZVRA 1YDIA 2A0UA 4YT4A 1D1AA 3Q6MA 2L6HA 3EG9B 2NUTA 3WG7C 5KYWB 3RYLA 5FCLA 4P9TA 4MW3A 5D92A 1JPNA 4CIHA 2OCCC 5KYWA 1L3PA 3EG9A 4PJLA 3V5XA 4EKWA 5JVEA 5KYXB 4XQ1A 2LP4A 2A6EF 3DE9A 1O3UA 1PV3A 4A4AA 2X51A 2Y39A 5KYXA 5A6AA 2XS8A 2VCBA 3E70C 1F1MA 4O7GA 1T6UA 3Q7LA 1KNYA 3GORA 1BR2A 4EBJA 5L0CA 4MVQA 1TWAA 2KGOA 4MTFA 2EIKC 4H4KC 1AUEA 2C04A 3KYJA 3T9OA 3ZC4A 2HFIA 3B71A 3H2UA 3A9CA 1LI7A 2AU5A 2KQ9A 3VM6A 2H7VC 1FTSA 2OEXA 1OCRC 3HNKA 4KBLA 3TOLA 1WOLA 2HSQA 1D0ZA 4JEBA 5F5FA 3SEOA 3I4UA 4KNVA 1WTYA 1ZVZA 1GM5A 5A6BD 1E84A 4LLCA 2OJED 2ASRA 3K7DA 4N6CA 2R25A 1C02A 2WL8A 2OU6A 1OKKD 1LVKA 2QUPA 1U6HA 1R4TA 3AQBA 1KU2A 3H65A 4JE9A 1OCZC 1VOMA 1LI5A 2ZXPA 3G4ZA 1SYQA
chains in the Genus database with same CATH topology
2HKVA 2OQMA 2NSGA 3GORA 3QTHA 2F22A 3CEXA 2QE9A 2YQYA 5COFA 5COGA 1RXQA 3DKAA 5CIVA 5COMA 4N6CA 2OU6A 2NSFA 2QNLA 3DI5A 2P1AA 2RD9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HKV A;  2OQM A;  2NSG A;  3GOR A;  3QTH A;  2F22 A;  3CEX A;  2QE9 A;  2YQY A;  5COF A;  5COG A;  1RXQ A;  3DKA A;  5CIV A;  5COM A;  4N6C A;  2OU6 A;  2NSF A;  2QNL A;  3DI5 A;  2P1A A;  2RD9 A; 
#chains in the Genus database with same CATH topology
 3S28 A;  4CJO A;  3H2V A;  5BUO A;  4XEV A;  3N0T A;  3ITF A;  4MND A;  3KMI A;  4YJW A;  2DGJ A;  3QTH A;  5AC5 A;  5CI8 A;  4YT2 A;  3RH3 A;  1E86 A;  2B0J A;  4K1O A;  1TWG A;  1QZX A;  4BJ6 C;  3EJN A;  4OIR F;  2P0N A;  1GQA A;  3NYM A;  3EPV A;  1E83 A;  1QVX A;  3ASN C;  1YLM A;  2KW3 C;  3KYI A;  4FX5 A;  3LEO A;  2LCH A;  2P7V A;  4J7T A;  3AJM A;  2WZF A;  4JTC B;  1YYX A;  4BJ1 A;  2EIJ C;  1LE4 A;  2V26 A;  4OD4 A;  3O39 A;  1ORS C;  1GGQ A;  4XPW A;  2XLW A;  4IGG A;  4MVM A;  2YLG A;  3K33 A;  1RJ9 B;  2HS5 A;  1TWH A;  1Y6D A;  4CSA C;  4E17 A;  2GFH A;  5JRA A;  1A7D A;  1RJ9 A;  2CGE A;  5L0G A;  3MX3 A;  4BEJ A;  4D4N A;  1HE9 A;  4XPY A;  3QMK A;  2XS1 A;  4PFO A;  2PFD A;  2W45 A;  4AX2 A;  5BQG A;  5K0I A;  2D4U A;  4XEK A;  3I5P A;  2YZS A;  4CS8 C;  4MVZ A;  4X0R A;  1SR2 A;  2WVN A;  2ZPA A;  4MVS A;  3ZTM A;  3NDB B;  4HFF B;  4JUR I;  1O87 A;  3U9J A;  2LFF A;  3JTL O;  1OR2 A;  2J46 A;  2HJM A;  2L81 A;  4CJG A;  3K66 A;  1UG7 A;  2P6V A;  4YL3 A;  2ZXW C;  4DBR A;  5JS5 A;  1D1B A;  1ZW2 A;  2KC3 A;  3F46 A;  3JRM O;  4BJ5 C;  4BPM A;  5JUA A;  3MBG A;  2A1D D;  2L6G A;  2OKU A;  1UFB A;  2L9J A;  1MND A;  2PX0 A;  1Q0F A;  2Z15 A;  4JTA B;  1YVI A;  1XWJ A;  2Y69 C;  3FAP B;  4G7H F;  2Q3T A;  4JCH A;  1YJG A;  3M15 A;  3DJU B;  3TJ5 A;  4HE8 D;  4JJF A;  1R5I D;  3MYI A;  3ZWI A;  2R7Q A;  3LS1 A;  2X0C A;  3RQG A;  1WAT A;  2ETS A;  3O10 A;  5E33 A;  3S84 A;  3ZQY A;  2C03 A;  3CZ6 A;  2PF4 E;  3GEH A;  4P6I C;  3SXK A;  4FES A;  3T6B A;  4YL0 A;  4K0D A;  5B3I A;  3C8G D;  5COF A;  2O9X A;  1YZA A;  2LK4 A;  3B0U X;  3B0P A;  2Q9A A;  2WZL A;  3AGU A;  2VH3 A;  2W4B A;  2Y3D A;  1PCX A;  2ZXO A;  3B0V C;  3FXH A;  2GDC A;  2WVO A;  3AGT A;  5KYY B;  4NQF A;  5CIV A;  3VRC A;  5DS6 A;  3GEE A;  2UUI A;  4U5H A;  4W8K A;  5GPG B;  2L7A A;  2IXP A;  2A69 F;  2FGY A;  2J9B A;  1TFO B;  3ASO C;  1M6T A;  4LER A;  4O79 A;  5TJ5 E;  3UMK A;  4C3E A;  1LIH A;  5AC4 A;  3DM9 B;  5BQH A;  3PMR A;  1D0X A;  2ICW G;  2YHS A;  1YA7 O;  4ULV A;  3U2L A;  1YYJ A;  3U8P A;  1H9T A;  1I4Z A;  3L1M A;  3LJB A;  4I44 A;  4LDK A;  4Z9J A;  3NMI A;  3SXZ A;  3ZIB A;  5A69 A;  1C03 A;  2OQM A;  1ORJ A;  4Q5S F;  1H6G A;  1EKY A;  2PBE A;  1MMD A;  2J7P D;  1Z5Z A;  2IBF A;  2PX3 A;  1VLS A;  3LNM B;  5DQZ A;  4YT8 A;  1FFH A;  5FZT A;  4E18 A;  3SP1 A;  5L0F A;  1QQ3 A;  4GQH A;  1ZU4 A;  3S0X A;  2OG2 A;  1TFK B;  5JT4 A;  2ZD9 A;  3FHD A;  4EBK A;  2DI3 A;  2QY9 A;  1ZYR F;  3TJ6 A;  1NSG B;  4RD9 A;  1D1C A;  5T3T A;  4K7B A;  1ORY A;  1HE1 A;  3ATP A;  3R7C A;  4ULW A;  2G3K A;  1BDJ B;  5L3Q A;  3QZC A;  3ZDL A;  4Q7C A;  3LUT B;  1MNE A;  4MVR A;  3ZQV A;  3AG3 C;  2XM0 A;  1FNT c;  1IW7 F;  1V55 C;  1ZU5 A;  3NMK A;  1I4Y A;  2YLI A;  5L3V A;  3HTK C;  2XL8 A;  1LPE A;  2OEV A;  2XRH A;  1WWP A;  3EHN A;  1Y4C A;  3GM2 A;  3X1O A;  2VAS A;  4JTD B;  2XM4 A;  1DOV A;  2R05 A;  4CDY A;  3EZI A;  4NTF A;  1YAU O;  1WGW A;  3UMI A;  3PDM P;  2R7X A;  2XLV A;  3U9M A;  1GS9 A;  4CDV A;  1H7I A;  2IOQ A;  1BR4 A;  1NFO A;  1ZHY A;  2IXO A;  3KL4 A;  4KC9 A;  4LAC B;  4DXW A;  3HLZ A;  3LS0 A;  2XLE A;  2VCA A;  2LD6 A;  2EIN C;  3S9O A;  2XXA B;  3C8Z A;  3L8I A;  2A68 F;  3KKB A;  5A6B A;  1SF8 A;  2QNL A;  1A7V A;  1Z3I X;  1CGO A;  1OKK A;  2EPK X;  3BEH A;  2PNO A;  1Q0G A;  2MWQ A;  2XXA A;  2EIM C;  1CPR A;  5CI9 A;  4CIP A;  1HW2 A;  2FAP B;  3SXY A;  3JSZ A;  3DWW A;  4WGY A;  2Q9C A;  3V5Y A;  2XLH A;  2AWY A;  2HZ8 A;  2VB6 A;  4CS9 C;  4U9E A;  3EFO B;  3IQ5 A;  1G5Z A;  3FAJ A;  3W8H A;  4XPX A;  4PR9 A;  3LNR A;  2YWA A;  3EFO A;  3Q7G A;  5COG A;  1HW1 A;  4EIY A;  2R7O A;  1BZ4 A;  1J8M F;  3GEI A;  3V5Z A;  4I1O B;  5T3W A;  1Z23 A;  4BG0 A;  4OIN F;  2I15 A;  3JSE O;  2R03 A;  3UR3 C;  5L0I A;  4D4X A;  2I8B A;  4HFK B;  2H7O A;  4M63 A;  2GAQ A;  3NG1 A;  2YKZ A;  1S05 A;  4O6M A;  4DOZ A;  4YN0 B;  1B68 A;  3L8J A;  5JLI A;  3K1I C;  3NKE A;  4N06 A;  1VMA A;  3JCU Q;  4NC3 A;  3S90 A;  3RW0 A;  1FMW A;  2D5R B;  4DVY P;  1OCO C;  3U0C A;  1OW8 A;  2F22 A;  3EH1 A;  4JC7 A;  3SYN A;  3G4X A;  3W4Y A;  4EUK B;  1LKX A;  1MMN A;  3J06 A;  1T9K A;  4G7Z F;  4JZA A;  1SZI A;  1LS1 A;  5EGY A;  1T6I A;  1CGN A;  3KH2 A;  3FVY A;  2YL7 A;  3C63 A;  3CAX A;  4MTG A;  1V54 C;  4DRJ B;  4GEH A;  2YL0 A;  3DKA A;  3TK0 A;  1OW7 A;  1V74 B;  3FOO A;  2EPL X;  1TWC A;  1T6Q A;  2CNW D;  5COM A;  3IEE A;  1OXB A;  3ZG1 A;  5HV9 A;  2AVK A;  2LSE A;  1RKC A;  5JSL A;  1O5H A;  1A41 A;  4FWV A;  4PFP A;  2NPU A;  4YWQ A;  3FDQ A;  2BE5 F;  3C18 A;  4G0H A;  3DMD A;  4BEM J;  1FAP B;  3GM3 A;  2MHR A;  4JW1 A;  1K05 A;  1FR0 A;  1VB5 A;  2LQG A;  4CS7 A;  1E2X A;  3NRH A;  5EK0 A;  1DOW A;  1JMW A;  1G8X A;  3C8G B;  3MLG A;  2H7B A;  3C7J A;  5E2Q A;  4KNW A;  4QI2 A;  4IWB A;  4JEA A;  3GAN A;  1LS4 A;  1M57 C;  4IB4 A;  5KYN A;  2YL3 A;  3POV A;  3C8G A;  2J8W A;  1S7Z A;  2IYL D;  1HMO A;  3NMJ A;  4WAB A;  1VTM P;  4XEF A;  3U3F A;  3SXM A;  3PCV A;  3QVY A;  1WAS A;  1YAR O;  5KYU B;  2WVQ A;  1J8Y F;  3PHF 2;  1EI7 A;  2LFD A;  5L0H A;  3KPH A;  5D91 A;  1QLE C;  4ER9 A;  5KYU A;  2E87 A;  2J0X A;  4IAR A;  3O6X A;  1AEP A;  1SMY F;  3JRT A;  2JD3 A;  1T5O A;  1ST6 A;  3SNH A;  2BL2 A;  3I5Q A;  4IJJ A;  2NUP B;  5HSW A;  3RIP A;  2ZXR A;  4IAQ A;  3K1H A;  4U5C E;  4Z9H A;  4A2N B;  3LLK A;  1VK5 A;  2NUP A;  3OA1 A;  2BC5 A;  2DYS C;  2J7P A;  1EA8 A;  4CBE A;  2R7V A;  1WN0 A;  2YVK A;  1I5N A;  1OR3 A;  2XLD A;  1YA9 A;  2WZG A;  3E9V A;  1APC A;  4EWC A;  4JIO A;  5F28 E;  1NFN A;  2H8A A;  5DLJ A;  2YLD A;  2Y3H A;  3DAF A;  5DVW A;  3T6G B;  2HUJ A;  1Z6A A;  2XL4 A;  4I3M A;  1OXK A;  2EPO A;  3U2M A;  1Q0K A;  4CDA A;  4U5G A;  4ONS A;  3IQ6 A;  4FAP B;  3DM5 A;  4XLP F;  2PP4 A;  3EH2 A;  2Y3G A;  1QKR A;  1FFT C;  1LM3 B;  2Q4F A;  2Q9B A;  3EGD A;  4J30 B;  4XTK A;  3VAY A;  4E0H A;  4E7S A;  4MTO A;  2NSG A;  4DRH B;  2DB4 A;  2CDQ A;  5DS5 A;  1Z63 A;  5DS4 A;  1ZHW A;  3M79 A;  3HNL A;  4NTB A;  5T1D B;  2EPN A;  3RFY A;  3ABK C;  2V3C C;  3W2V A;  4U5B E;  5E3C A;  2CCY A;  3AOU A;  3S29 A;  3L0I A;  1U89 A;  2KJG A;  3AG1 C;  4Z9I A;  1YZC A;  4DRI B;  4E0I A;  4F4B A;  2R7U A;  4U5D E;  1OCC C;  1NLX A;  3M1C B;  1NBB A;  4LDQ A;  4AL1 A;  2P61 A;  4QDL A;  4OIQ F;  2FFH A;  1CPQ A;  3LEV A;  1JOG A;  3L34 A;  1MQV A;  4XLN F;  5B3S C;  2WB7 A;  2EIL C;  2J9W A;  5A6K A;  4HEA J;  4O6Y A;  4KI2 A;  3LAY A;  4RBN A;  4PJJ A;  4JJG A;  1TR2 A;  3M4B A;  3MYF A;  4AK9 A;  3EHM A;  1Q0D A;  3DXJ F;  5B1A C;  2MYS A;  2Q00 A;  3CQZ A;  1U0B B;  1RCP A;  3TQO A;  1G4U S;  3ZTZ A;  3C62 A;  4NCQ A;  1BBH A;  1M56 C;  1M2O A;  2IXM A;  1QSP A;  3QW0 A;  4CS9 A;  4AL0 A;  1HY5 A;  3IHU A;  3MFN A;  3GWL A;  3O55 A;  1RXQ A;  1ZHZ A;  4MVU A;  4MW8 A;  2VCC A;  2XLM A;  2YL1 A;  3B29 A;  4PAC A;  4U9D A;  5B1B C;  3QW1 A;  4C3B A;  4E7Z A;  2R7T A;  3EQL F;  5L0J A;  3N24 A;  4RDA A;  4MVO A;  3NKD A;  3RVY A;  3BRJ A;  4BJ6 A;  2G3V A;  2JX0 A;  1PD0 A;  4J7Y A;  4N4W A;  2KSF A;  4YL1 A;  4ANJ A;  1V4A A;  2HMQ A;  3FOP A;  1D0Y A;  2R02 A;  1RKE B;  1IZM A;  3B9Q A;  1M2V B;  2RD9 A;  3ZSU A;  4CX9 A;  4DBQ A;  2TMV P;  1Q0M A;  1NG1 A;  1JRA A;  3GOD A;  4GYT A;  1L7C A;  1RKE A;  3DE8 A;  1M2V A;  3F47 A;  3NYJ A;  2B0H A;  1NZE A;  3M4C A;  3CEX A;  4OD5 A;  4CSA A;  5KYY A;  4YK5 A;  3IQT A;  4NTA A;  2YQY A;  3K1I A;  1HMD A;  3K6B A;  2XLO A;  3JT1 A;  3JYH A;  2AWC A;  4H54 A;  4QI0 A;  1G4W R;  3JYY A;  5A6J A;  1LE2 A;  1ZHX A;  3TUL A;  2YRF A;  3HNI A;  1JPJ A;  4ZLD A;  3DD7 A;  4JCZ A;  2LIG A;  1JR8 A;  2KNH A;  5BQI A;  3OWT A;  3NYL A;  4J32 B;  4EHP A;  2CNW A;  3ECS A;  3SZR A;  2OJQ A;  2NSF A;  1FMV A;  3ABM C;  3QVZ A;  4NY3 A;  5F5H A;  4G78 A;  3X2Q C;  4LLE A;  1AVO B;  2R7S A;  4CS8 A;  1TKN A;  256B A;  2HV7 A;  1XZP A;  5L0D A;  3DZA A;  4LDR A;  3AG2 C;  4BJ5 A;  1TQG A;  2HKV A;  4I1M A;  3WHN A;  3IPM O;  2UUH A;  4JRZ A;  1EQ1 A;  3T4R A;  4BJT A;  4OIO F;  2HSB A;  2L6F A;  2R9R B;  2RSE B;  2W9Y A;  1OQC A;  4JVS A;  1H9G A;  3HJC A;  4U5F E;  3FMS A;  1MMG A;  2QLA A;  3RQF A;  3RQE A;  2QE9 A;  4MS2 A;  4EBB A;  4U5E E;  4G7O F;  2J0W A;  4JKV A;  1VYI A;  4ZLC A;  1C17 M;  5JP7 A;  3UGP A;  4IRU A;  5AGF A;  3RKO F;  2J9V A;  4MQ9 F;  2IM8 A;  1A7E A;  2IXN A;  2OOC A;  4L6R A;  2KK1 A;  1Z7Q c;  1N1C A;  4N6H A;  4R32 A;  4UDV A;  4C7O B;  2EPM X;  1RMV A;  2M4E A;  3RF3 A;  4WJ0 A;  1JAF A;  3LES A;  3ABL C;  3DI5 A;  3EGX B;  4P9F A;  3V7O A;  2XL6 A;  2GA0 A;  4C7O A;  3G50 A;  4YT5 A;  3U5S A;  3TOM A;  1OW6 A;  3AG4 C;  3WAQ A;  3U8V A;  5DQT A;  1MMA A;  4O6N A;  3EGX A;  2YEV A;  3UNG C;  5IY5 C;  4IAO A;  4C3D A;  2XSE A;  2G62 A;  3OEO A;  4W8P A;  1KTM A;  1W2W A;  1XZQ A;  2VC9 A;  1T01 A;  2Q7R A;  2M64 A;  2HJ3 A;  4PJN A;  3R2P A;  1VLT A;  2AP3 A;  3N2Z B;  2HMZ A;  4Q4Z F;  3VF0 A;  5EHH A;  1A0B A;  4B6I A;  1ZW3 A;  1BR1 A;  3A11 A;  3HNJ A;  2GWW A;  2KYH A;  1E85 A;  3DAG A;  1K04 A;  2CYD A;  4PJM A;  4OIP F;  3DJN B;  3RVZ A;  3VYW A;  3CSK A;  3Q6N A;  2A0B A;  3EZH A;  3LLI A;  3T6J A;  3WOD F;  2J45 A;  2JPU A;  1QPU A;  1ZHT A;  2J9U A;  4WGZ A;  3W2W A;  3S27 A;  3EGD B;  1ZZP A;  2P1A A;  1PD1 A;  1CGM E;  3TD7 A;  2R7W A;  5E3A A;  2DYR C;  2Y3B A;  3JZ0 A;  4AE4 B;  2HV6 A;  4DJ9 A;  1NU7 D;  2R7R A;  2A6H F;  3GM1 A;  3IQC A;  4PK4 A;  3W8I A;  1K40 A;  4AE4 A;  3GWN A;  3UGO A;  3US6 A;  3AQC A;  3U3B A;  2NG1 A;  4DVZ A;  4XWJ A;  3UMH A;  2QTV A;  2NUT B;  1NU9 C;  2W4M A;  1VYK A;  2CW0 F;  3HKK A;  3ZVR A;  1YDI A;  2A0U A;  4YT4 A;  1D1A A;  3Q6M A;  2L6H A;  3EG9 B;  2NUT A;  3WG7 C;  5KYW B;  3RYL A;  5FCL A;  4P9T A;  4MW3 A;  5D92 A;  1JPN A;  4CIH A;  2OCC C;  5KYW A;  1L3P A;  3EG9 A;  4PJL A;  3V5X A;  4EKW A;  5JVE A;  5KYX B;  4XQ1 A;  2LP4 A;  2A6E F;  3DE9 A;  1O3U A;  1PV3 A;  4A4A A;  2X51 A;  2Y39 A;  5KYX A;  5A6A A;  2XS8 A;  2VCB A;  3E70 C;  1F1M A;  4O7G A;  1T6U A;  3Q7L A;  1KNY A;  3GOR A;  1BR2 A;  4EBJ A;  5L0C A;  4MVQ A;  1TWA A;  2KGO A;  4MTF A;  2EIK C;  4H4K C;  1AUE A;  2C04 A;  3KYJ A;  3T9O A;  3ZC4 A;  2HFI A;  3B71 A;  3H2U A;  3A9C A;  1LI7 A;  2AU5 A;  2KQ9 A;  3VM6 A;  2H7V C;  1FTS A;  2OEX A;  1OCR C;  3HNK A;  4KBL A;  3TOL A;  1WOL A;  2HSQ A;  1D0Z A;  4JEB A;  5F5F A;  3SEO A;  3I4U A;  4KNV A;  1WTY A;  1ZVZ A;  1GM5 A;  5A6B D;  1E84 A;  4LLC A;  2OJE D;  2ASR A;  3K7D A;  4N6C A;  2R25 A;  1C02 A;  2WL8 A;  2OU6 A;  1OKK D;  1LVK A;  2QUP A;  1U6H A;  1R4T A;  3AQB A;  1KU2 A;  3H65 A;  4JE9 A;  1OCZ C;  1VOM A;  1LI5 A;  2ZXP A;  3G4Z A;  1SYQ A; 
#chains in the Genus database with same CATH homology
 2HKV A;  2OQM A;  2NSG A;  3GOR A;  3QTH A;  2F22 A;  3CEX A;  2QE9 A;  2YQY A;  5COF A;  5COG A;  1RXQ A;  3DKA A;  5CIV A;  5COM A;  4N6C A;  2OU6 A;  2NSF A;  2QNL A;  3DI5 A;  2P1A A;  2RD9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...