2Q7RA

Crystal structure of human flap with an iodinated analog of mk-591
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
140
structure length
140
Chain Sequence
b'MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arachidonate 5-lipoxygenase-activating protein
molecule tags Membrane protein, lipid transport
source organism Homo sapiens
publication title Crystal structure of inhibitor-bound human 5-lipoxygenase-activating protein.
pubmed doi rcsb
total genus 45
structure length 140
sequence length 140
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 2q7rA00
4JRZA 4JC7A 5BQGA 3B29A 2H8AA 3HKKA 5HV9A 4AL0A 4J7YA 4YL3A 4WABA 4JCZA 3LEOA 2UUHA 4BPMA 2Q7RA 4NTBA 2UUIA 4AL1A 5BQIA 4NTAA 4YK5A 4YL0A 5BQHA 3DWWA 4J7TA 2PNOA 3PCVA 4YL1A 4NTFA 5K0IA
chains in the Genus database with same CATH superfamily
2WB7A 4C7OB 1M2VB 4BEMJ 4DVYP 2YHSA 3U0CA 1NU9C 3Q7LA 2OEXA 2NPUA 3MX3A 2OJQA 2HKVA 3EGDA 3SEOA 4HFKB 4MVMA 1ZU4A 4PFOA 3ASOC 3PMRA 4CS9A 4XLNF 3UMHA 4D4NA 1Z5ZA 5FZTA 3AOUA 1WGWA 2R25A 1ZU5A 4MVUA 3LEOA 1V54C 3SNHA 2DB4A 4LDRA 1EKYA 1RKCA 2XLDA 2HV7A 3DE8A 4JKVA 3RQEA 2YVKA 1MNEA 4YK5A 3L0IA 1TFOB 2R7VA 4NC3A 3S28A 4MW8A 4O6YA 2NUTB 5KYXA 3EGXB 1R5ID 5EK0A 5DQZA 2EPLX 4PJJA 3UMIA 4JURI 2CW0F 3LJBA 3U3FA 3SZRA 5A69A 3H65A 1ZHZA 3HNIA 1OW8A 4U5BE 3SXYA 3ZTMA 4D4XA 2EIKC 1D0YA 3F47A 2H8AA 3K1IA 2KJGA 3LS0A 4U5EE 3I5QA 2ZXWC 4BG0A 2XM4A 2YKZA 4J7YA 2AVKA 4JVSA 1O5HA 1S7ZA 3DMDA 3O10A 2J9UA 1E2XA 4YT4A 5L0IA 4ZLDA 1FAPB 1ZHXA 2UUHA 3ZC4A 3L34A 3KMIA 5DLJA 2A69F 4J30B 3TK0A 4H54A 2ASRA 4OIOF 4BJ1A 1H6GA 2M4EA 4OIQF 2PF4E 3QTHA 1K40A 1SZIA 4CS7A 4PJNA 1GS9A 2HMZA 3M79A 2EIJC 3T4RA 3NMJA 2J7PD 3G4ZA 1MMDA 1LS1A 4YJWA 1T5OA 1J8MF 4JC7A 3H2VA 5JS5A 2LSEA 2WVNA 1OKKA 1ORYA 3HKKA 4IJJA 4W8PA 3UNGC 1FFTC 4PJMA 4AL0A 1YYJA 2MYSA 2BC5A 3U2MA 1YAUO 2J9WA 2VB6A 3FDQA 3RW0A 4KBLA 4PJLA 2A6EF 3KYIA 4O79A 2QNLA 1H9TA 3EH2A 3TJ5A 1OR3A 2EPKX 3EGXA 4DBRA 3ZWIA 4NQFA 5L3QA 2A1DD 5JSLA 5DVWA 1G8XA 2OEVA 4MW3A 4Q4ZF 1CGME 4R32A 4G7HF 1AUEA 1SMYF 2XL4A 2OU6A 3W2VA 4MVSA 3TOLA 4PACA 2TMVP 1QZXA 1RKEA 2WZLA 3DAGA 2PNOA 3UR3C 4CJGA 4YT2A 4Z9HA 4I3MA 5KYWA 5A6BA 4AK9A 3X1OA 4JTCB 5A6AA 2PP4A 4DRIB 4DOZA 3NMIA 2NUPA 3E70C 4JZAA 1C17M 5BQGA 3WAQA 3T6JA 2F22A 1LVKA 2NSFA 3DJNB 3GANA 1BR2A 5T1DB 2R7OA 3CQZA 2R9RB 4C3DA 2EPOA 2W9YA 3IQTA 3FOPA 2X0CA 1L7CA 4CDVA 2Y3HA 4JW1A 1BZ4A 2KSFA 4B6IA 1YZAA 3EH1A 4P9FA 4W8KA 3MYFA 4E7SA 1ZW2A 2PX3A 1CGOA 3GM1A 3IHUA 4NTBA 4A2NB 5EGYA 2GWWA 4IARA 1LE2A 1FR0A 1RJ9A 3JZ0A 1D1BA 2G3VA 1WTYA 5BQHA 2HUJA 3BEHA 2P7VA 5EHHA 3KH2A 3ABKC 3PCVA 4LLCA 5TJ5E 1JPJA 4IGGA 3G4XA 3LUTB 2R7QA 1FFHA 2R7XA 4CS8A 3NG1A 3GWLA 2CGEA 2JD3A 2XLVA 4XLPF 2HSQA 1T6UA 3EJNA 4GQHA 4WGYA 4FX5A 2YEVA 5KYWB 2G62A 2HSBA 1PCXA 1O3UA 2JX0A 3RVYA 3TJ6A 5F28E 3OWTA 2NG1A 3IEEA 2KW3C 2XXAA 2YZSA 3WG7C 3AQBA 3SYNA 1YDIA 1KTMA 1KNYA 3RH3A 5AC4A 4AL1A 2L9JA 4LDKA 3VM6A 5BQIA 3U3BA 1VTMP 3AG4C 1A7EA 3S27A 3V5ZA 3C8ZA 2W4MA 4MNDA 3WHNA 2XS1A 3B71A 3UMKA 1NLXA 5K0IA 4JJGA 5F5FA 5CIVA 1Q0MA 2NUTA 1RXQA 1ZW3A 2VC9A 2FFHA 2HMQA 4H4KC 2A0UA 2I15A 4JIOA 3B0VC 2A0BA 3H2UA 2C04A 1G5ZA 1U0BB 2XM0A 3F46A 3BRJA 3Q6NA 2HFIA 2G3KA 1YA7O 3V5XA 2GFHA 1JPNA 2OG2A 2WL8A 4C3EA 3QVYA 1AEPA 2HJ3A 3DZAA 4A4AA 3VRCA 3EQLF 3DI5A 3MBGA 5AGFA 1E83A 4E0HA 2Y3BA 2LP4A 3A9CA 4YT5A 2LFDA 5JRAA 2I8BA 2Y39A 2YL3A 1H7IA 1RCPA 3RYLA 3M1CB 3ZDLA 1CPQA 4JTAB 3JTLO 1LPEA 1NSGB 3DJUB 2IOQA 3UGOA 4K7BA 1OQCA 4J7TA 3U5SA 1A7DA 2IYLD 2WZGA 3FOOA 1LIHA 4OIPF 1D1CA 5E33A 2V3CC 5CI9A 4DRHB 1EI7A 4EKWA 1G4WR 5COGA 3B29A 5DS6A 2XLHA 3L8JA 4FWVA 1E84A 3ITFA 5HV9A 1D0XA 3CSKA 4U5DE 3C62A 2VH3A 2IM8A 4XEFA 4WABA 1Z23A 3RVZA 2ZXRA 3HLZA 4G0HA 4QI0A 3Q6MA 4CX9A 3RFYA 2L6HA 1YJGA 3S29A 2LQGA 1APCA 5JLIA 2WVOA 4E7ZA 1IZMA 1ZHYA 1ZVZA 3C8GD 4Q7CA 2GDCA 2J0WA 1XZQA 2XRHA 4EBBA 3R7CA 2J9VA 4QDLA 3EZIA 1TQGA 2OCCC 3AQCA 4LERA 3MLGA 5L0GA 2HZ8A 3FAPB 4PR9A 4M63A 2Y3DA 2EIMC 1SF8A 4QI2A 4U5CE 2L7AA 1VLSA 2CCYA 2Q9CA 4N4WA 1OR2A 1LKXA 2QE9A 4EWCA 3RQGA 4C7OA 1OW7A 3ZQVA 4CS8C 2Q3TA 1M56C 1T01A 5B3IA 2D4UA 2XLEA 2FGYA 1QQ3A 3RQFA 3KYJA 1JOGA 2VCBA 1D0ZA 3FXHA 4BPMA 3LNRA 2PX0A 5JUAA 3AJMA 1I4ZA 2DYSC 3RIPA 4CBEA 2XXAB 1YVIA 3DM5A 3K66A 1C03A 4G7ZF 3AG3C 4AE4A 2J46A 2D5RB 4O6MA 1A41A 1GQAA 1OCOC 3S84A 1VK5A 3VAYA 2VASA 3NDBB 2YL0A 4JEBA 4RD9A 2IBFA 3GEEA 3W8HA 5L0DA 4YN0B 1ST6A 4GEHA 1JRAA 2CDQA 3IPMO 3ZIBA 4K0DA 4DJ9A 1HE1A 2BL2A 2ZXOA 4EBKA 2J8WA 2P1AA 3KKBA 4NCQA 4BEJA 5FCLA 1JMWA 1QVXA 4PFPA 4KC9A 3EPVA 1A7VA 1OXBA 2ICWG 4WJ0A 2YLGA 4MTGA 1VYKA 4ULWA 1YARO 3AG2C 4K1OA 4BJ6C 1ZZPA 1TWAA 1OCRC 4F4BA 1ZYRF 4OIRF 3AG1C 1Z7Qc 2ZXPA 4IAQA 4LDQA 3HNKA 2ZD9A 3NKEA 2J7PA 2YQYA 4DXWA 2J45A 4N6CA 4MVRA 2AWCA 4IWBA 5DS4A 2MWQA 1YYXA 1LE4A 2H7VC 2R7SA 3IQCA 3B0PA 3V5YA 3U8PA 1UFBA 3TQOA 4LACB 2P0NA 1QSPA 5A6KA 4OD5A 2DYRC 3QVZA 3HNJA 3NYJA 4HEAJ 3LNMB 3MYIA 2IXNA 4BJTA 2AP3A 5COFA 1MMNA 4JTDB 2W45A 1Q0KA 1M2VA 4U5FE 2X51A 1EA8A 3EFOB 2KK1A 3AGUA 3C63A 2ZPAA 1HMOA 3HTKC 1ZHTA 3SXZA 3QW1A 5JVEA 1Q0GA 2KNHA 3KL4A 4IRUA 3GEHA 3N2ZB 4FESA 1T6QA 4JJFA 1U89A 2B0JA 3U9MA 2LK4A 2L6GA 3HJCA 1HW1A 3NYMA 4YT8A 1L3PA 1HW2A 1A0BA 1QPUA 3V7OA 3DD7A 4O7GA 3L1MA 3I4UA 3OA1A 1TWCA 5KYNA 3DM9B 4YWQA 5L3VA 4XPWA 3T6GB 2A6HF 1W2WA 3W8IA 4MVZA 4U9EA 4ZLCA 1BR1A 3RKOF 3NRHA 256BA 2EILC 2NUPB 1Q0FA 3GM2A 1DOVA 5L0HA 3EG9B 4U5HA 1Z6AA 4ONSA 1LI5A 1CGNA 1ZHWA 3C18A 5DQTA 4N06A 2FAPB 4JCZA 2XLWA 2XL6A 3C8GB 1HY5A 4G78A 3W2WA 3ZG1A 4ER9A 1UG7A 3EHMA 3HNLA 4MVOA 4IAOA 4I1MA 5E3AA 1TWGA 2LD6A 2LIGA 3ZVRA 4Q5SF 2QLAA 3JYHA 1S05A 2LCHA 2VCCA 1FMWA 3U9JA 1T9KA 2Y3GA 1WWPA 3JCUQ 1NBBA 2EPNA 4CS9C 1E85A 2O9XA 2A68F 2VCAA 3IQ6A 4LLEA 2H7OA 4EUKB 5KYXB 1Z3IX 1MMGA 1VOMA 2IXMA 5E2QA 2R7WA 3SP1A 3AGTA 4CIHA 3K6BA 3T9OA 2Q4FA 2Q9BA 1OW6A 2LFFA 5L0FA 1T6IA 5D92A 1SR2A 3E9VA 3NKDA 4WGZA 1D1AA 2J9BA 4MTOA 4XPXA 4YL3A 4E0IA 3UGPA 3L8IA 2YLIA 3JRMO 4JEAA 5IY5C 2C03A 2WZFA 3TD7A 4CIPA 2Q7RA 4XWJA 2YL7A 4XQ1A 1R4TA 1WATA 2OQMA 5JP7A 1LS4A 4HE8D 1TWHA 1NFOA 3S90A 2OOCA 1OKKD 2W4BA 2Q9AA 3O39A 5D91A 4YL0A 4KNVA 3O55A 4P6IC 3K1HA 1I4YA 3ZQYA 2M64A 2OKUA 2HJMA 2MHRA 1ORJA 2Y69C 3OEOA 4U9DA 3ZSUA 1Z63A 3C7JA 4MTFA 5B1AC 2KGOA 4DBQA 3K7DA 2Z15A 2H7BA 3K33A 4FAPB 2AU5A 1IW7F 3N24A 3SXKA 5L0CA 3CEXA 3QMKA 2EPMX 1M2OA 2J0XA 1HMDA 3DE9A 2P61A 3JT1A 1Y6DA 4L6RA 4PK4A 1M6TA 3O6XA 3EFOA 3LLKA 1OCCC 3EZHA 3KPHA 3FHDA 2KC3A 4JE9A 1N1CA 3DAFA 3QW0A 4MS2A 2V26A 5A6JA 3CZ6A 1WASA 4NTAA 3DXJF 3GORA 2AWYA 1YA9A 1RKEB 1H9GA 2HS5A 3FAJA 4I1OB 1YLMA 4CJOA 3DWWA 4O6NA 2EINC 4YL1A 2R7TA 3GODA 4RBNA 5L0JA 1OCZC 2B0HA 1V55C 1B68A 1DOWA 3JSZA 1GM5A 1QKRA 3NYLA 4JRZA 4Z9JA 4OINF 4CSAC 2WVQA 2YWAA 3IQ5A 3WODF 1KU2A 5B3SC 1WOLA 2Q00A 5KYUA 3U8VA 3VYWA 2IXPA 2NSGA 1RJ9B 4JCHA 4EHPA 1G4US 1OXKA 4C3BA 2HV6A 2PFDA 4E17A 1MNDA 3PDMP 1CPRA 2ETSA 4E18A 2RSEB 3M4BA 1GGQA 2R03A 4UDVA 1E86A 1HE9A 2L81A 2XS8A 3POVA 5JT4A 2R05A 1XZPA 4CDYA 1J8YF 1F1MA 2UUIA 1EQ1A 1AVOB 1U6HA 3QZCA 4MVQA 4BJ6A 4DRJB 2QUPA 5DS5A 5COMA 3ECSA 2XLOA 1VYIA 3NMKA 4Z9IA 1PV3A 1WN0A 2E87A 4P9TA 4AX2A 4ANJA 3JYYA 2YLDA 3C8GA 5T3WA 3J06A 3ABLC 4NTFA 1M57C 5KYYB 1VB5A 5E3CA 2IXOA 1PD1A 2DGJA 3K1IC 3M15A 3DKAA 4DVZA 1BDJB 4XTKA 3S0XA 4CSAA 1K04A 1XWJA 4X0RA 5F5HA 1TR2A 1V74B 3ATPA 1NZEA 1FTSA 1VLTA 3CAXA 4GYTA 4CDAA 2R7UA 3EGDB 3R2PA 2QTVA 2GAQA 1FMVA 2XL8A 3LEVA 1PD0A 1JR8A 1O87A 1NU7D 3I5PA 1NG1A 2CNWD 5B1BC 4KI2A 4MQ9F 1SYQA 1TFKB 2XLMA 3B9QA 2L6FA 3LESA 1FNTc 3LLIA 1RMVA 2PBEA 1MQVA 3G50A 4IB4A 4EBJA 4EIYA 4N6HA 3N0TA 3LAYA 1K05A 3S9OA 1I5NA 2BE5F 3GM3A 5BUOA 3TULA 3JSEO 3LS1A 1V4AA 3FMSA 2YL1A 4J32B 2GA0A 3GEIA 3JRTA 3ABMC 5GPGB 3T6BA 1VMAA 1ORSC 4G7OF 2P6VA 1YZCA 2CYDA 2R02A 3MFNA 3SXMA 4I44A 4XEKA 5HSWA 3US6A 5KYYA 3GWNA 3VF0A 2KYHA 2CNWA 2OJED 4BJ5A 3X2QC 1QLEC 4NY3A 1LM3B 2QY9A 4KNWA 3TOMA 1TKNA 1C02A 2XSEA 3EG9A 1LI7A 4AE4B 3M4CA 3W4YA 1JAFA 4OD4A 2DI3A 4RDAA 4XEVA 5CI8A 3U2LA 5AC5A 2R7RA 3ASNC 3FVYA 5T3TA 2RD9A 3EHNA 3B0UX 5A6BD 1BR4A 4XPYA 4HFFB 3ZTZA 1Y4CA 3Q7GA 4U5GA 3PHF2 4ULVA 3A11A 1MMAA 1NFNA 3RF3A 2YRFA 2JPUA 4BJ5C 2KQ9A 5KYUB 1BBHA 1Q0DA
chains in the Genus database with same CATH topology
4JRZA 4JC7A 5BQGA 3B29A 2H8AA 3HKKA 5HV9A 4AL0A 4J7YA 4YL3A 4WABA 4JCZA 3LEOA 2UUHA 4BPMA 2Q7RA 4NTBA 2UUIA 4AL1A 5BQIA 4NTAA 4YK5A 4YL0A 5BQHA 3DWWA 4J7TA 2PNOA 3PCVA 4YL1A 4NTFA 5K0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JRZ A;  4JC7 A;  5BQG A;  3B29 A;  2H8A A;  3HKK A;  5HV9 A;  4AL0 A;  4J7Y A;  4YL3 A;  4WAB A;  4JCZ A;  3LEO A;  2UUH A;  4BPM A;  2Q7R A;  4NTB A;  2UUI A;  4AL1 A;  5BQI A;  4NTA A;  4YK5 A;  4YL0 A;  5BQH A;  3DWW A;  4J7T A;  2PNO A;  3PCV A;  4YL1 A;  4NTF A;  5K0I A; 
#chains in the Genus database with same CATH topology
 2WB7 A;  4C7O B;  1M2V B;  4BEM J;  4DVY P;  2YHS A;  3U0C A;  1NU9 C;  3Q7L A;  2OEX A;  2NPU A;  3MX3 A;  2OJQ A;  2HKV A;  3EGD A;  3SEO A;  4HFK B;  4MVM A;  1ZU4 A;  4PFO A;  3ASO C;  3PMR A;  4CS9 A;  4XLN F;  3UMH A;  4D4N A;  1Z5Z A;  5FZT A;  3AOU A;  1WGW A;  2R25 A;  1ZU5 A;  4MVU A;  3LEO A;  1V54 C;  3SNH A;  2DB4 A;  4LDR A;  1EKY A;  1RKC A;  2XLD A;  2HV7 A;  3DE8 A;  4JKV A;  3RQE A;  2YVK A;  1MNE A;  4YK5 A;  3L0I A;  1TFO B;  2R7V A;  4NC3 A;  3S28 A;  4MW8 A;  4O6Y A;  2NUT B;  5KYX A;  3EGX B;  1R5I D;  5EK0 A;  5DQZ A;  2EPL X;  4PJJ A;  3UMI A;  4JUR I;  2CW0 F;  3LJB A;  3U3F A;  3SZR A;  5A69 A;  3H65 A;  1ZHZ A;  3HNI A;  1OW8 A;  4U5B E;  3SXY A;  3ZTM A;  4D4X A;  2EIK C;  1D0Y A;  3F47 A;  2H8A A;  3K1I A;  2KJG A;  3LS0 A;  4U5E E;  3I5Q A;  2ZXW C;  4BG0 A;  2XM4 A;  2YKZ A;  4J7Y A;  2AVK A;  4JVS A;  1O5H A;  1S7Z A;  3DMD A;  3O10 A;  2J9U A;  1E2X A;  4YT4 A;  5L0I A;  4ZLD A;  1FAP B;  1ZHX A;  2UUH A;  3ZC4 A;  3L34 A;  3KMI A;  5DLJ A;  2A69 F;  4J30 B;  3TK0 A;  4H54 A;  2ASR A;  4OIO F;  4BJ1 A;  1H6G A;  2M4E A;  4OIQ F;  2PF4 E;  3QTH A;  1K40 A;  1SZI A;  4CS7 A;  4PJN A;  1GS9 A;  2HMZ A;  3M79 A;  2EIJ C;  3T4R A;  3NMJ A;  2J7P D;  3G4Z A;  1MMD A;  1LS1 A;  4YJW A;  1T5O A;  1J8M F;  4JC7 A;  3H2V A;  5JS5 A;  2LSE A;  2WVN A;  1OKK A;  1ORY A;  3HKK A;  4IJJ A;  4W8P A;  3UNG C;  1FFT C;  4PJM A;  4AL0 A;  1YYJ A;  2MYS A;  2BC5 A;  3U2M A;  1YAU O;  2J9W A;  2VB6 A;  3FDQ A;  3RW0 A;  4KBL A;  4PJL A;  2A6E F;  3KYI A;  4O79 A;  2QNL A;  1H9T A;  3EH2 A;  3TJ5 A;  1OR3 A;  2EPK X;  3EGX A;  4DBR A;  3ZWI A;  4NQF A;  5L3Q A;  2A1D D;  5JSL A;  5DVW A;  1G8X A;  2OEV A;  4MW3 A;  4Q4Z F;  1CGM E;  4R32 A;  4G7H F;  1AUE A;  1SMY F;  2XL4 A;  2OU6 A;  3W2V A;  4MVS A;  3TOL A;  4PAC A;  2TMV P;  1QZX A;  1RKE A;  2WZL A;  3DAG A;  2PNO A;  3UR3 C;  4CJG A;  4YT2 A;  4Z9H A;  4I3M A;  5KYW A;  5A6B A;  4AK9 A;  3X1O A;  4JTC B;  5A6A A;  2PP4 A;  4DRI B;  4DOZ A;  3NMI A;  2NUP A;  3E70 C;  4JZA A;  1C17 M;  5BQG A;  3WAQ A;  3T6J A;  2F22 A;  1LVK A;  2NSF A;  3DJN B;  3GAN A;  1BR2 A;  5T1D B;  2R7O A;  3CQZ A;  2R9R B;  4C3D A;  2EPO A;  2W9Y A;  3IQT A;  3FOP A;  2X0C A;  1L7C A;  4CDV A;  2Y3H A;  4JW1 A;  1BZ4 A;  2KSF A;  4B6I A;  1YZA A;  3EH1 A;  4P9F A;  4W8K A;  3MYF A;  4E7S A;  1ZW2 A;  2PX3 A;  1CGO A;  3GM1 A;  3IHU A;  4NTB A;  4A2N B;  5EGY A;  2GWW A;  4IAR A;  1LE2 A;  1FR0 A;  1RJ9 A;  3JZ0 A;  1D1B A;  2G3V A;  1WTY A;  5BQH A;  2HUJ A;  3BEH A;  2P7V A;  5EHH A;  3KH2 A;  3ABK C;  3PCV A;  4LLC A;  5TJ5 E;  1JPJ A;  4IGG A;  3G4X A;  3LUT B;  2R7Q A;  1FFH A;  2R7X A;  4CS8 A;  3NG1 A;  3GWL A;  2CGE A;  2JD3 A;  2XLV A;  4XLP F;  2HSQ A;  1T6U A;  3EJN A;  4GQH A;  4WGY A;  4FX5 A;  2YEV A;  5KYW B;  2G62 A;  2HSB A;  1PCX A;  1O3U A;  2JX0 A;  3RVY A;  3TJ6 A;  5F28 E;  3OWT A;  2NG1 A;  3IEE A;  2KW3 C;  2XXA A;  2YZS A;  3WG7 C;  3AQB A;  3SYN A;  1YDI A;  1KTM A;  1KNY A;  3RH3 A;  5AC4 A;  4AL1 A;  2L9J A;  4LDK A;  3VM6 A;  5BQI A;  3U3B A;  1VTM P;  3AG4 C;  1A7E A;  3S27 A;  3V5Z A;  3C8Z A;  2W4M A;  4MND A;  3WHN A;  2XS1 A;  3B71 A;  3UMK A;  1NLX A;  5K0I A;  4JJG A;  5F5F A;  5CIV A;  1Q0M A;  2NUT A;  1RXQ A;  1ZW3 A;  2VC9 A;  2FFH A;  2HMQ A;  4H4K C;  2A0U A;  2I15 A;  4JIO A;  3B0V C;  2A0B A;  3H2U A;  2C04 A;  1G5Z A;  1U0B B;  2XM0 A;  3F46 A;  3BRJ A;  3Q6N A;  2HFI A;  2G3K A;  1YA7 O;  3V5X A;  2GFH A;  1JPN A;  2OG2 A;  2WL8 A;  4C3E A;  3QVY A;  1AEP A;  2HJ3 A;  3DZA A;  4A4A A;  3VRC A;  3EQL F;  3DI5 A;  3MBG A;  5AGF A;  1E83 A;  4E0H A;  2Y3B A;  2LP4 A;  3A9C A;  4YT5 A;  2LFD A;  5JRA A;  2I8B A;  2Y39 A;  2YL3 A;  1H7I A;  1RCP A;  3RYL A;  3M1C B;  3ZDL A;  1CPQ A;  4JTA B;  3JTL O;  1LPE A;  1NSG B;  3DJU B;  2IOQ A;  3UGO A;  4K7B A;  1OQC A;  4J7T A;  3U5S A;  1A7D A;  2IYL D;  2WZG A;  3FOO A;  1LIH A;  4OIP F;  1D1C A;  5E33 A;  2V3C C;  5CI9 A;  4DRH B;  1EI7 A;  4EKW A;  1G4W R;  5COG A;  3B29 A;  5DS6 A;  2XLH A;  3L8J A;  4FWV A;  1E84 A;  3ITF A;  5HV9 A;  1D0X A;  3CSK A;  4U5D E;  3C62 A;  2VH3 A;  2IM8 A;  4XEF A;  4WAB A;  1Z23 A;  3RVZ A;  2ZXR A;  3HLZ A;  4G0H A;  4QI0 A;  3Q6M A;  4CX9 A;  3RFY A;  2L6H A;  1YJG A;  3S29 A;  2LQG A;  1APC A;  5JLI A;  2WVO A;  4E7Z A;  1IZM A;  1ZHY A;  1ZVZ A;  3C8G D;  4Q7C A;  2GDC A;  2J0W A;  1XZQ A;  2XRH A;  4EBB A;  3R7C A;  2J9V A;  4QDL A;  3EZI A;  1TQG A;  2OCC C;  3AQC A;  4LER A;  3MLG A;  5L0G A;  2HZ8 A;  3FAP B;  4PR9 A;  4M63 A;  2Y3D A;  2EIM C;  1SF8 A;  4QI2 A;  4U5C E;  2L7A A;  1VLS A;  2CCY A;  2Q9C A;  4N4W A;  1OR2 A;  1LKX A;  2QE9 A;  4EWC A;  3RQG A;  4C7O A;  1OW7 A;  3ZQV A;  4CS8 C;  2Q3T A;  1M56 C;  1T01 A;  5B3I A;  2D4U A;  2XLE A;  2FGY A;  1QQ3 A;  3RQF A;  3KYJ A;  1JOG A;  2VCB A;  1D0Z A;  3FXH A;  4BPM A;  3LNR A;  2PX0 A;  5JUA A;  3AJM A;  1I4Z A;  2DYS C;  3RIP A;  4CBE A;  2XXA B;  1YVI A;  3DM5 A;  3K66 A;  1C03 A;  4G7Z F;  3AG3 C;  4AE4 A;  2J46 A;  2D5R B;  4O6M A;  1A41 A;  1GQA A;  1OCO C;  3S84 A;  1VK5 A;  3VAY A;  2VAS A;  3NDB B;  2YL0 A;  4JEB A;  4RD9 A;  2IBF A;  3GEE A;  3W8H A;  5L0D A;  4YN0 B;  1ST6 A;  4GEH A;  1JRA A;  2CDQ A;  3IPM O;  3ZIB A;  4K0D A;  4DJ9 A;  1HE1 A;  2BL2 A;  2ZXO A;  4EBK A;  2J8W A;  2P1A A;  3KKB A;  4NCQ A;  4BEJ A;  5FCL A;  1JMW A;  1QVX A;  4PFP A;  4KC9 A;  3EPV A;  1A7V A;  1OXB A;  2ICW G;  4WJ0 A;  2YLG A;  4MTG A;  1VYK A;  4ULW A;  1YAR O;  3AG2 C;  4K1O A;  4BJ6 C;  1ZZP A;  1TWA A;  1OCR C;  4F4B A;  1ZYR F;  4OIR F;  3AG1 C;  1Z7Q c;  2ZXP A;  4IAQ A;  4LDQ A;  3HNK A;  2ZD9 A;  3NKE A;  2J7P A;  2YQY A;  4DXW A;  2J45 A;  4N6C A;  4MVR A;  2AWC A;  4IWB A;  5DS4 A;  2MWQ A;  1YYX A;  1LE4 A;  2H7V C;  2R7S A;  3IQC A;  3B0P A;  3V5Y A;  3U8P A;  1UFB A;  3TQO A;  4LAC B;  2P0N A;  1QSP A;  5A6K A;  4OD5 A;  2DYR C;  3QVZ A;  3HNJ A;  3NYJ A;  4HEA J;  3LNM B;  3MYI A;  2IXN A;  4BJT A;  2AP3 A;  5COF A;  1MMN A;  4JTD B;  2W45 A;  1Q0K A;  1M2V A;  4U5F E;  2X51 A;  1EA8 A;  3EFO B;  2KK1 A;  3AGU A;  3C63 A;  2ZPA A;  1HMO A;  3HTK C;  1ZHT A;  3SXZ A;  3QW1 A;  5JVE A;  1Q0G A;  2KNH A;  3KL4 A;  4IRU A;  3GEH A;  3N2Z B;  4FES A;  1T6Q A;  4JJF A;  1U89 A;  2B0J A;  3U9M A;  2LK4 A;  2L6G A;  3HJC A;  1HW1 A;  3NYM A;  4YT8 A;  1L3P A;  1HW2 A;  1A0B A;  1QPU A;  3V7O A;  3DD7 A;  4O7G A;  3L1M A;  3I4U A;  3OA1 A;  1TWC A;  5KYN A;  3DM9 B;  4YWQ A;  5L3V A;  4XPW A;  3T6G B;  2A6H F;  1W2W A;  3W8I A;  4MVZ A;  4U9E A;  4ZLC A;  1BR1 A;  3RKO F;  3NRH A;  256B A;  2EIL C;  2NUP B;  1Q0F A;  3GM2 A;  1DOV A;  5L0H A;  3EG9 B;  4U5H A;  1Z6A A;  4ONS A;  1LI5 A;  1CGN A;  1ZHW A;  3C18 A;  5DQT A;  4N06 A;  2FAP B;  4JCZ A;  2XLW A;  2XL6 A;  3C8G B;  1HY5 A;  4G78 A;  3W2W A;  3ZG1 A;  4ER9 A;  1UG7 A;  3EHM A;  3HNL A;  4MVO A;  4IAO A;  4I1M A;  5E3A A;  1TWG A;  2LD6 A;  2LIG A;  3ZVR A;  4Q5S F;  2QLA A;  3JYH A;  1S05 A;  2LCH A;  2VCC A;  1FMW A;  3U9J A;  1T9K A;  2Y3G A;  1WWP A;  3JCU Q;  1NBB A;  2EPN A;  4CS9 C;  1E85 A;  2O9X A;  2A68 F;  2VCA A;  3IQ6 A;  4LLE A;  2H7O A;  4EUK B;  5KYX B;  1Z3I X;  1MMG A;  1VOM A;  2IXM A;  5E2Q A;  2R7W A;  3SP1 A;  3AGT A;  4CIH A;  3K6B A;  3T9O A;  2Q4F A;  2Q9B A;  1OW6 A;  2LFF A;  5L0F A;  1T6I A;  5D92 A;  1SR2 A;  3E9V A;  3NKD A;  4WGZ A;  1D1A A;  2J9B A;  4MTO A;  4XPX A;  4YL3 A;  4E0I A;  3UGP A;  3L8I A;  2YLI A;  3JRM O;  4JEA A;  5IY5 C;  2C03 A;  2WZF A;  3TD7 A;  4CIP A;  2Q7R A;  4XWJ A;  2YL7 A;  4XQ1 A;  1R4T A;  1WAT A;  2OQM A;  5JP7 A;  1LS4 A;  4HE8 D;  1TWH A;  1NFO A;  3S90 A;  2OOC A;  1OKK D;  2W4B A;  2Q9A A;  3O39 A;  5D91 A;  4YL0 A;  4KNV A;  3O55 A;  4P6I C;  3K1H A;  1I4Y A;  3ZQY A;  2M64 A;  2OKU A;  2HJM A;  2MHR A;  1ORJ A;  2Y69 C;  3OEO A;  4U9D A;  3ZSU A;  1Z63 A;  3C7J A;  4MTF A;  5B1A C;  2KGO A;  4DBQ A;  3K7D A;  2Z15 A;  2H7B A;  3K33 A;  4FAP B;  2AU5 A;  1IW7 F;  3N24 A;  3SXK A;  5L0C A;  3CEX A;  3QMK A;  2EPM X;  1M2O A;  2J0X A;  1HMD A;  3DE9 A;  2P61 A;  3JT1 A;  1Y6D A;  4L6R A;  4PK4 A;  1M6T A;  3O6X A;  3EFO A;  3LLK A;  1OCC C;  3EZH A;  3KPH A;  3FHD A;  2KC3 A;  4JE9 A;  1N1C A;  3DAF A;  3QW0 A;  4MS2 A;  2V26 A;  5A6J A;  3CZ6 A;  1WAS A;  4NTA A;  3DXJ F;  3GOR A;  2AWY A;  1YA9 A;  1RKE B;  1H9G A;  2HS5 A;  3FAJ A;  4I1O B;  1YLM A;  4CJO A;  3DWW A;  4O6N A;  2EIN C;  4YL1 A;  2R7T A;  3GOD A;  4RBN A;  5L0J A;  1OCZ C;  2B0H A;  1V55 C;  1B68 A;  1DOW A;  3JSZ A;  1GM5 A;  1QKR A;  3NYL A;  4JRZ A;  4Z9J A;  4OIN F;  4CSA C;  2WVQ A;  2YWA A;  3IQ5 A;  3WOD F;  1KU2 A;  5B3S C;  1WOL A;  2Q00 A;  5KYU A;  3U8V A;  3VYW A;  2IXP A;  2NSG A;  1RJ9 B;  4JCH A;  4EHP A;  1G4U S;  1OXK A;  4C3B A;  2HV6 A;  2PFD A;  4E17 A;  1MND A;  3PDM P;  1CPR A;  2ETS A;  4E18 A;  2RSE B;  3M4B A;  1GGQ A;  2R03 A;  4UDV A;  1E86 A;  1HE9 A;  2L81 A;  2XS8 A;  3POV A;  5JT4 A;  2R05 A;  1XZP A;  4CDY A;  1J8Y F;  1F1M A;  2UUI A;  1EQ1 A;  1AVO B;  1U6H A;  3QZC A;  4MVQ A;  4BJ6 A;  4DRJ B;  2QUP A;  5DS5 A;  5COM A;  3ECS A;  2XLO A;  1VYI A;  3NMK A;  4Z9I A;  1PV3 A;  1WN0 A;  2E87 A;  4P9T A;  4AX2 A;  4ANJ A;  3JYY A;  2YLD A;  3C8G A;  5T3W A;  3J06 A;  3ABL C;  4NTF A;  1M57 C;  5KYY B;  1VB5 A;  5E3C A;  2IXO A;  1PD1 A;  2DGJ A;  3K1I C;  3M15 A;  3DKA A;  4DVZ A;  1BDJ B;  4XTK A;  3S0X A;  4CSA A;  1K04 A;  1XWJ A;  4X0R A;  5F5H A;  1TR2 A;  1V74 B;  3ATP A;  1NZE A;  1FTS A;  1VLT A;  3CAX A;  4GYT A;  4CDA A;  2R7U A;  3EGD B;  3R2P A;  2QTV A;  2GAQ A;  1FMV A;  2XL8 A;  3LEV A;  1PD0 A;  1JR8 A;  1O87 A;  1NU7 D;  3I5P A;  1NG1 A;  2CNW D;  5B1B C;  4KI2 A;  4MQ9 F;  1SYQ A;  1TFK B;  2XLM A;  3B9Q A;  2L6F A;  3LES A;  1FNT c;  3LLI A;  1RMV A;  2PBE A;  1MQV A;  3G50 A;  4IB4 A;  4EBJ A;  4EIY A;  4N6H A;  3N0T A;  3LAY A;  1K05 A;  3S9O A;  1I5N A;  2BE5 F;  3GM3 A;  5BUO A;  3TUL A;  3JSE O;  3LS1 A;  1V4A A;  3FMS A;  2YL1 A;  4J32 B;  2GA0 A;  3GEI A;  3JRT A;  3ABM C;  5GPG B;  3T6B A;  1VMA A;  1ORS C;  4G7O F;  2P6V A;  1YZC A;  2CYD A;  2R02 A;  3MFN A;  3SXM A;  4I44 A;  4XEK A;  5HSW A;  3US6 A;  5KYY A;  3GWN A;  3VF0 A;  2KYH A;  2CNW A;  2OJE D;  4BJ5 A;  3X2Q C;  1QLE C;  4NY3 A;  1LM3 B;  2QY9 A;  4KNW A;  3TOM A;  1TKN A;  1C02 A;  2XSE A;  3EG9 A;  1LI7 A;  4AE4 B;  3M4C A;  3W4Y A;  1JAF A;  4OD4 A;  2DI3 A;  4RDA A;  4XEV A;  5CI8 A;  3U2L A;  5AC5 A;  2R7R A;  3ASN C;  3FVY A;  5T3T A;  2RD9 A;  3EHN A;  3B0U X;  5A6B D;  1BR4 A;  4XPY A;  4HFF B;  3ZTZ A;  1Y4C A;  3Q7G A;  4U5G A;  3PHF 2;  4ULV A;  3A11 A;  1MMA A;  1NFN A;  3RF3 A;  2YRF A;  2JPU A;  4BJ5 C;  2KQ9 A;  5KYU B;  1BBH A;  1Q0D A; 
#chains in the Genus database with same CATH homology
 4JRZ A;  4JC7 A;  5BQG A;  3B29 A;  2H8A A;  3HKK A;  5HV9 A;  4AL0 A;  4J7Y A;  4YL3 A;  4WAB A;  4JCZ A;  3LEO A;  2UUH A;  4BPM A;  2Q7R A;  4NTB A;  2UUI A;  4AL1 A;  5BQI A;  4NTA A;  4YK5 A;  4YL0 A;  5BQH A;  3DWW A;  4J7T A;  2PNO A;  3PCV A;  4YL1 A;  4NTF A;  5K0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...