2Q7RA

Crystal structure of human flap with an iodinated analog of mk-591
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
140
structure length
140
Chain Sequence
b'MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arachidonate 5-lipoxygenase-activating protein
publication title Crystal structure of inhibitor-bound human 5-lipoxygenase-activating protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein, lipid transport
total genus 45
structure length 140
sequence length 140
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 2q7rA00
4YL1A 4BPMA 5HV9A 4AL1A 3B29A 4J7YA 4NTAA 3PCVA 5BQGA 2Q7RA 4J7TA 4JCZA 4YL3A 4YK5A 4JC7A 3DWWA 2UUHA 4WABA 3HKKA 2H8AA 4NTFA 4YL0A 2UUIA 5K0IA 2PNOA 5BQIA 3LEOA 5BQHA 4NTBA 4JRZA 4AL0A
chains in the Genus database with same CATH superfamily
2Y3BA 2YL7A 1QLEC 1KU2A 1WTYA 2Y69C 2P0NA 4G7OF 3LNRA 4OINF 1LI5A 1G4WR 5EK0A 1EI7A 3U5SA 3JRMO 3QMKA 5JLIA 2IXNA 3ATPA 4QI0A 3TULA 3Q7LA 4O6YA 3BEHA 2W9YA 2WVNA 2NPUA 1LS1A 5A69A 4CSAA 2VB6A 3TD7A 3OWTA 1YZCA 1XZQA 1TWAA 2XRHA 2YL3A 3EFOB 3NKDA 3AG2C 1BR1A 2OJED 5COMA 1T01A 1OQCA 4JTCB 2AP3A 3H2UA 4JTAB 4Q4ZF 1I5NA 3LS0A 1RJ9A 2PBEA 2YZSA 4IARA 2R7UA 1EQ1A 3G4ZA 3M15A 1D1BA 1DOWA 5HSWA 3RIPA 4BPMA 2EIMC 2LFDA 2CNWA 1YYJA 2Q3TA 3L1MA 2KGOA 4WJ0A 4W8PA 2A0UA 1BR2A 1MMDA 1TWCA 4PJLA 5KYWB 3E9VA 2ASRA 4WGZA 2XM0A 2HUJA 3AJMA 1PD0A 1YDIA 1JRAA 3DE8A 4JKVA 1Z7Qc 2CNWD 2YVKA 1HE1A 3ZQVA 4CDYA 3TJ6A 1FNTc 2ZPAA 3QVYA 3ZSUA 3RQEA 1D0ZA 1VB5A 3FOPA 4P6IC 4XPWA 4G0HA 3UR3C 1F1MA 3HKKA 1HE9A 2EPNA 2L9JA 3JTLO 1H6GA 2O9XA 2HFIA 3KL4A 1ST6A 2RD9A 4EBKA 5BQIA 3EHMA 1E83A 3UMIA 4YWQA 1ZZPA 5L0GA 1M57C 3UGOA 1LVKA 3JZ0A 4E0HA 4HFKB 4HFFB 1JOGA 3TOLA 1RXQA 4BG0A 3C63A 3V7OA 3HNKA 1ZHXA 2XSEA 3DMDA 2NSFA 3G4XA 2EPKX 2QTVA 2WVOA 3GWNA 3GODA 4GQHA 4J7YA 2L6FA 1T6UA 3AQBA 4MQ9F 5E3CA 1FFTC 3U9MA 1Q0MA 1O3UA 1RJ9B 4MVUA 1A7VA 1YAUO 3CZ6A 4N6HA 4AX2A 256BA 4MVSA 2W4BA 3VRCA 1T6QA 1A0BA 1L7CA 3EGDA 1VYIA 2XLWA 4JTDB 1E86A 1D0YA 5JSLA 1BDJB 4KNVA 3A11A 2AWCA 2X51A 3I5PA 2P1AA 4PR9A 4X0RA 5BQHA 4CSAC 4CX9A 3CQZA 4QI2A 1ZHWA 3ZWIA 1NFOA 2G3KA 1M56C 2OG2A 5KYNA 4YL1A 5T3TA 2J9BA 4JJGA 1OCCC 2Q9BA 1FFHA 4JCHA 2XL8A 3DM5A 4CJGA 4DRIB 2KW3C 2V26A 2HS5A 2NUTA 3EH2A 3SP1A 4CJOA 2WZFA 4BJ6A 3EPVA 4J7TA 1SR2A 5L0DA 4MTFA 1QZXA 1LI7A 1HY5A 3POVA 4BEJA 3IQ6A 5L0JA 1V4AA 2H7VC 3DWWA 3AGTA 1E2XA 1NG1A 1PV3A 1L3PA 2WL8A 2XLOA 3LAYA 3O6XA 1TWHA 1ZW3A 1OCZC 3S0XA 1U0BB 3CEXA 2A6EF 3FXHA 5IY5C 5L0IA 1QPUA 3AQCA 3RH3A 3JRTA 1W2WA 4I3MA 2J8WA 4C7OA 3KMIA 5L0HA 1CGNA 3T6BA 2DI3A 1YA9A 2R25A 5TJ5E 1E84A 2EPMX 2KSFA 2L6GA 3EGDB 3W2WA 3IQ5A 1TR2A 1WN0A 3EZHA 2YLIA 3W8HA 5F5FA 1RKCA 4BJ1A 3EG9A 5DS4A 1LPEA 1OW6A 1M2VA 1YZAA 2AVKA 2P61A 2YRFA 4JCZA 4PFPA 4Z9IA 3WHNA 4H4KC 3MLGA 3K1HA 1FTSA 4IGGA 2I15A 2JD3A 4XEFA 1OW7A 1R4TA 2HMQA 3B71A 4IB4A 4MW3A 4KC9A 3RVYA 3EGXA 4EHPA 1WATA 4DBRA 2AWYA 5AC4A 2AU5A 4XLPF 3VM6A 1D1AA 1JPNA 2LFFA 4P9TA 2R05A 4G78A 4YT2A 1H9TA 4JEAA 1HMOA 3VYWA 3MYIA 1FAPB 2XLHA 3C8GD 3L0IA 4XTKA 1QVXA 1NU7D 1JMWA 4PFOA 1M6TA 1NFNA 3IQTA 3ZTMA 3NDBB 1I4ZA 3LEVA 3B29A 3RF3A 4R32A 1NBBA 2YLGA 3ECSA 4YT5A 1VLSA 4IAOA 4E0IA 4NTAA 4F4BA 3AG4C 3F46A 1I4YA 3FAPB 4BJ5A 3O39A 1XWJA 4ANJA 4C3DA 3ZQYA 2IXPA 4C7OB 2YKZA 1VYKA 1C02A 4U5HA 3GM3A 3NMJA 3IQCA 3S27A 1RMVA 2DYRC 4FWVA 1QQ3A 2ZXOA 4MVMA 3EG9B 1ZU5A 5KYUA 2R7SA 3FVYA 4JE9A 1M2VB 2A6HF 3SZRA 3TOMA 1FMWA 2WZGA 3DKAA 4JRZA 5AGFA 3WAQA 4Q7CA 2EPLX 2KQ9A 5A6KA 5A6BA 5KYYA 1OXKA 4DOZA 4PK4A 4AE4A 4LLEA 3SXZA 2JX0A 3EGXB 2PF4E 3CAXA 3C8GB 4MVZA 1M2OA 2G3VA 3PCVA 4U5DE 1ZW2A 5A6BD 2A0BA 1ZHYA 2GA0A 2C04A 2XM4A 2J9WA 4JIOA 5E33A 4D4XA 1MNDA 2Q9CA 4M63A 4YK5A 1Z3IX 3JYYA 4GEHA 5L3VA 1UFBA 1A7DA 2IM8A 2IOQA 3G50A 5JUAA 2UUHA 2DB4A 5DQZA 2QY9A 2Y3HA 4EKWA 4OIPF 1TFOB 1VOMA 5K0IA 1J8YF 3E70C 2QNLA 2G62A 5JP7A 1MMNA 3K1IC 1T5OA 4IWBA 4LDRA 4LDQA 5GPGB 3MX3A 2R9RB 3AG3C 4HEAJ 3W8IA 4CBEA 2A69F 3QTHA 1LS4A 4AL0A 4ONSA 1YYXA 4CS8C 3DM9B 2ZXWC 1QSPA 2EINC 2X0CA 3A9CA 1BBHA 4XQ1A 5E2QA 3C8ZA 4E7SA 3BRJA 3DI5A 2WZLA 5KYUB 3DXJF 1V74B 4B6IA 4JJFA 2YLDA 3B9QA 5FZTA 4A4AA 1LIHA 1ORSC 2KYHA 1Y6DA 2CYDA 5A6JA 2J7PA 3W2VA 3ZDLA 2DYSC 2GWWA 4J32B 4WABA 4MW8A 3S84A 4O6MA 2OEXA 2M64A 3N2ZB 4U5CE 4AE4B 2NSGA 4BJ5C 5L0CA 3SEOA 1E85A 2BC5A 3RQGA 4AK9A 2IXOA 1RKEA 1YLMA 1ZHZA 5BUOA 1ZYRF 2LIGA 2EIKC 1ORJA 3U9JA 4MTGA 2XLVA 1LE4A 5T1DB 1S7ZA 4U5FE 3KKBA 2HV6A 4EUKB 1H9GA 4YT4A 3UMKA 4DVYP 4ULVA 1YVIA 4ZLDA 1NLXA 3ZVRA 2MWQA 1OCRC 3X1OA 2R7OA 3GM2A 1AUEA 5COFA 4C3BA 2WB7A 5JRAA 1YARO 2A1DD 4I1OB 3WG7C 1AVOB 1Z23A 3IHUA 3L8JA 5KYXA 4DVZA 4LACB 5CI9A 3LUTB 1ZVZA 3DAGA 4BJTA 2J46A 4EBJA 2KNHA 3MBGA 4XLNF 2C03A 5L3QA 3ZTZA 3B0PA 2KJGA 3Q7GA 3SYNA 3LESA 5DLJA 3NMKA 4NC3A 4RDAA 5D92A 3S9OA 1HW2A 3U3FA 4U9EA 1J8MF 1O5HA 1YJGA 2IYLD 3AGUA 4ZLCA 2VC9A 1OKKA 5EGYA 5T3WA 2CCYA 3NRHA 3MYFA 2LP4A 3SXKA 1H7IA 2WVQA 1C03A 3NKEA 1Y4CA 4MVQA 1WOLA 4Z9HA 5B1BC 1OKKD 4EBBA 4JW1A 3ITFA 3ABKC 3EQLF 3T6GB 3DD7A 2LK4A 3NYLA 4L6RA 5BQGA 3VF0A 5EHHA 4XEVA 2F22A 2OU6A 2LQGA 3AG1C 2R7XA 4EIYA 2KK1A 3RYLA 3PDMP 4A2NB 2IXMA 2IBFA 2W4MA 2Z15A 3K66A 1MQVA 4PJMA 3B0VC 3HNJA 5AC5A 4KI2A 1WASA 2YEVA 3ASNC 4YL0A 5DS6A 4D4NA 1TQGA 1LE2A 3UMHA 3U0CA 1ORYA 2NUTB 2P7VA 1XZPA 3FAJA 3GEIA 3K33A 1HMDA 2FFHA 4KNWA 4NTBA 2ICWG 5CI8A 3GM1A 5KYXB 3N24A 1C17M 2XLMA 1D0XA 1R5ID 3U8PA 5JS5A 4W8KA 3Q6NA 4DBQA 1SYQA 3JCUQ 4MNDA 1TWGA 5CIVA 3U8VA 3OEOA 1MNEA 4J30B 4JZAA 5DS5A 2V3CC 1VMAA 3OA1A 4CDAA 3I4UA 2OQMA 2E87A 4CS7A 1VLTA 3S90A 1GM5A 3LLIA 4CS9A 3SXYA 1K05A 1SZIA 3O10A 3KYIA 4CIHA 3DZAA 1U6HA 4FX5A 1T9KA 3DJNB 4BJ6C 1Z5ZA 5KYWA 4EWCA 4K1OA 3W4YA 2R7QA 1G8XA 1N1CA 5D91A 4K0DA 1FMVA 4ULWA 5DVWA 2A68F 3PHF2 2R03A 1IZMA 2OOCA 3KPHA 1NSGB 1BR4A 1G4US 1O87A 1OR3A 2LSEA 1MMAA 3GORA 4G7HF 2HJ3A 2XL4A 3C7JA 1TFKB 2XS8A 3M4CA 4MTOA 1RCPA 4OD4A 4XPXA 5B1AC 5HV9A 2R7VA 3FDQA 1SMYF 2R02A 2OKUA 4RBNA 4UDVA 3B0UX 2HJMA 2LD6A 3C18A 3EZIA 3GEHA 3I5QA 2D4UA 2Q7RA 4C3EA 4OIQF 2OCCC 4LERA 1OR2A 3J06A 1JPJA 2GAQA 4WGYA 1LKXA 1ZU4A 2H7OA 3U2LA 5FCLA 4I1MA 2CDQA 2XXAA 4JC7A 2L81A 1Q0DA 4P9FA 1UG7A 2GDCA 2Y3DA 3HTKC 3MFNA 3SNHA 3U3BA 3HNLA 3ZC4A 1GS9A 2R7RA 1Q0GA 4PJNA 1PCXA 4JURI 2XS1A 2ZD9A 3ASOC 1TKNA 1K40A 2MYSA 2W45A 3H2VA 4JVSA 1D1CA 3GEEA 3SXMA 4CDVA 2P6VA 3GWLA 3LLKA 2XL6A 2DGJA 1NZEA 1PD1A 2BL2A 2H7BA 2VH3A 3KYJA 4XPYA 4K7BA 3S28A 2GFHA 3EHNA 3NMIA 3NYJA 4Z9JA 5A6AA 4RD9A 4HE8D 2QLAA 1BZ4A 3R7CA 1KNYA 1EA8A 3C62A 2OJQA 3RVZA 2OEVA 4E7ZA 2VCAA 4N6CA 1B68A 3FMSA 3VAYA 4O6NA 3IEEA 4GYTA 3EH1A 4OD5A 3TK0A 4IAQA 4LLCA 1CPQA 3M79A 2NUPA 4ER9A 1QKRA 5B3IA 1K04A 2M4EA 3DJUB 3QZCA 1V55C 4CIPA 4MVOA 2PX0A 4U5BE 1EKYA 2HZ8A 5KYYB 2HMZA 4YN0B 4NTFA 2NG1A 3NYMA 3PMRA 1S05A 3O55A 4CS9C 3AOUA 2Y3GA 1DOVA 2J7PD 3LEOA 4E18A 1A41A 2J0WA 2PX3A 3JYHA 2J45A 2XLDA 3K6BA 4O79A 4OIOF 2LCHA 2VCBA 2VCCA 4PACA 2XXAB 4IJJA 3ABMC 2HSBA 2QE9A 4DRJB 1VK5A 2FAPB 3ABLC 3RKOF 3S29A 4AL1A 1SF8A 2BE5F 1CGOA 1YA7O 4U5GA 3DAFA 3V5YA 4DJ9A 1VTMP 4FESA 2KC3A 2L7AA 3HLZA 1CGME 4MVRA 2L6HA 3US6A 3RFYA 1ZHTA 2YWAA 4O7GA 2MHRA 3QW1A 3TJ5A 4XEKA 5JT4A 3Q6MA 1JAFA 3K7DA 4N06A 2PNOA 5JVEA 4U9DA 5L0FA 1WGWA 4NCQA 1GGQA 3DE9A 4KBLA 4OIRF 3WODF 2NUPB 2B0HA 4XWJA 4Q5SF 1APCA 2YL0A 3V5ZA 1Z63A 3F47A 3U2MA 3JSZA 2PFDA 1GQAA 3IPMO 4IRUA 4PJJA 4NQFA 3V5XA 2HKVA 4YJWA 3T6JA 5E3AA 1U89A 2J0XA 3H65A 2R7TA 3GANA 1MMGA 3LJBA 1RKEB 3FHDA 5F5HA 2B0JA 2PP4A 2QUPA 1A7EA 3QW0A 1Q0KA 3M1CB 2YQYA 4FAPB 3JSEO 1T6IA 2J9UA 4JEBA 4BEMJ 1Q0FA 2Q4FA 3LS1A 2H8AA 3TQOA 3L8IA 4NY3A 2CGEA 1AEPA 2HV7A 3ZG1A 1OW8A 2Q9AA 2I8BA 3CSKA 2YL1A 4U5EE 1KTMA 1HW1A 3R2PA 5DQTA 1OXBA 3L34A 3ZIBA 2EPOA 3RW0A 2Y39A 3KH2A 3M4BA 2EILC 2EIJC 4MS2A 2YHSA 3EJNA 1FR0A 1CPRA 1V54C 3JT1A 3N0TA 3EFOA 4E17A 3UGPA 2R7WA 3NG1A 2ZXRA 4N4WA 4LDKA 4YT8A 1NU9C 4DRHB 3X2QC 3RQFA 2ETSA 4H54A 1IW7F 2XLEA 4YL3A 3FOOA 5B3SC 3QVZA 3K1IA 3LNMB 2FGYA 5F28E 1G5ZA 2VASA 4CS8A 2CW0F 2J9VA 2D5RB 2RSEB 3C8GA 2UUIA 2ZXPA 4I44A 4QDLA 3T9OA 1JR8A 1Z6AA 2Q00A 2JPUA 1WWPA 4G7ZF 2HSQA 4DXWA 5COGA 3HJCA 2TMVP 3HNIA 3T4RA 1OCOC 3UNGC 1LM3B
chains in the Genus database with same CATH topology
4YL1A 4BPMA 5HV9A 4AL1A 3B29A 4J7YA 4NTAA 3PCVA 5BQGA 2Q7RA 4J7TA 4JCZA 4YL3A 4YK5A 4JC7A 3DWWA 2UUHA 4WABA 3HKKA 2H8AA 4NTFA 4YL0A 2UUIA 5K0IA 2PNOA 5BQIA 3LEOA 5BQHA 4NTBA 4JRZA 4AL0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YL1 A;  4BPM A;  5HV9 A;  4AL1 A;  3B29 A;  4J7Y A;  4NTA A;  3PCV A;  5BQG A;  2Q7R A;  4J7T A;  4JCZ A;  4YL3 A;  4YK5 A;  4JC7 A;  3DWW A;  2UUH A;  4WAB A;  3HKK A;  2H8A A;  4NTF A;  4YL0 A;  2UUI A;  5K0I A;  2PNO A;  5BQI A;  3LEO A;  5BQH A;  4NTB A;  4JRZ A;  4AL0 A; 
#chains in the Genus database with same CATH topology
 2Y3B A;  2YL7 A;  1QLE C;  1KU2 A;  1WTY A;  2Y69 C;  2P0N A;  4G7O F;  3LNR A;  4OIN F;  1LI5 A;  1G4W R;  5EK0 A;  1EI7 A;  3U5S A;  3JRM O;  3QMK A;  5JLI A;  2IXN A;  3ATP A;  4QI0 A;  3TUL A;  3Q7L A;  4O6Y A;  3BEH A;  2W9Y A;  2WVN A;  2NPU A;  1LS1 A;  5A69 A;  4CSA A;  2VB6 A;  3TD7 A;  3OWT A;  1YZC A;  1XZQ A;  1TWA A;  2XRH A;  2YL3 A;  3EFO B;  3NKD A;  3AG2 C;  1BR1 A;  2OJE D;  5COM A;  1T01 A;  1OQC A;  4JTC B;  2AP3 A;  3H2U A;  4JTA B;  4Q4Z F;  1I5N A;  3LS0 A;  1RJ9 A;  2PBE A;  2YZS A;  4IAR A;  2R7U A;  1EQ1 A;  3G4Z A;  3M15 A;  1D1B A;  1DOW A;  5HSW A;  3RIP A;  4BPM A;  2EIM C;  2LFD A;  2CNW A;  1YYJ A;  2Q3T A;  3L1M A;  2KGO A;  4WJ0 A;  4W8P A;  2A0U A;  1BR2 A;  1MMD A;  1TWC A;  4PJL A;  5KYW B;  3E9V A;  2ASR A;  4WGZ A;  2XM0 A;  2HUJ A;  3AJM A;  1PD0 A;  1YDI A;  1JRA A;  3DE8 A;  4JKV A;  1Z7Q c;  2CNW D;  2YVK A;  1HE1 A;  3ZQV A;  4CDY A;  3TJ6 A;  1FNT c;  2ZPA A;  3QVY A;  3ZSU A;  3RQE A;  1D0Z A;  1VB5 A;  3FOP A;  4P6I C;  4XPW A;  4G0H A;  3UR3 C;  1F1M A;  3HKK A;  1HE9 A;  2EPN A;  2L9J A;  3JTL O;  1H6G A;  2O9X A;  2HFI A;  3KL4 A;  1ST6 A;  2RD9 A;  4EBK A;  5BQI A;  3EHM A;  1E83 A;  3UMI A;  4YWQ A;  1ZZP A;  5L0G A;  1M57 C;  3UGO A;  1LVK A;  3JZ0 A;  4E0H A;  4HFK B;  4HFF B;  1JOG A;  3TOL A;  1RXQ A;  4BG0 A;  3C63 A;  3V7O A;  3HNK A;  1ZHX A;  2XSE A;  3DMD A;  2NSF A;  3G4X A;  2EPK X;  2QTV A;  2WVO A;  3GWN A;  3GOD A;  4GQH A;  4J7Y A;  2L6F A;  1T6U A;  3AQB A;  4MQ9 F;  5E3C A;  1FFT C;  3U9M A;  1Q0M A;  1O3U A;  1RJ9 B;  4MVU A;  1A7V A;  1YAU O;  3CZ6 A;  4N6H A;  4AX2 A;  256B A;  4MVS A;  2W4B A;  3VRC A;  1T6Q A;  1A0B A;  1L7C A;  3EGD A;  1VYI A;  2XLW A;  4JTD B;  1E86 A;  1D0Y A;  5JSL A;  1BDJ B;  4KNV A;  3A11 A;  2AWC A;  2X51 A;  3I5P A;  2P1A A;  4PR9 A;  4X0R A;  5BQH A;  4CSA C;  4CX9 A;  3CQZ A;  4QI2 A;  1ZHW A;  3ZWI A;  1NFO A;  2G3K A;  1M56 C;  2OG2 A;  5KYN A;  4YL1 A;  5T3T A;  2J9B A;  4JJG A;  1OCC C;  2Q9B A;  1FFH A;  4JCH A;  2XL8 A;  3DM5 A;  4CJG A;  4DRI B;  2KW3 C;  2V26 A;  2HS5 A;  2NUT A;  3EH2 A;  3SP1 A;  4CJO A;  2WZF A;  4BJ6 A;  3EPV A;  4J7T A;  1SR2 A;  5L0D A;  4MTF A;  1QZX A;  1LI7 A;  1HY5 A;  3POV A;  4BEJ A;  3IQ6 A;  5L0J A;  1V4A A;  2H7V C;  3DWW A;  3AGT A;  1E2X A;  1NG1 A;  1PV3 A;  1L3P A;  2WL8 A;  2XLO A;  3LAY A;  3O6X A;  1TWH A;  1ZW3 A;  1OCZ C;  3S0X A;  1U0B B;  3CEX A;  2A6E F;  3FXH A;  5IY5 C;  5L0I A;  1QPU A;  3AQC A;  3RH3 A;  3JRT A;  1W2W A;  4I3M A;  2J8W A;  4C7O A;  3KMI A;  5L0H A;  1CGN A;  3T6B A;  2DI3 A;  1YA9 A;  2R25 A;  5TJ5 E;  1E84 A;  2EPM X;  2KSF A;  2L6G A;  3EGD B;  3W2W A;  3IQ5 A;  1TR2 A;  1WN0 A;  3EZH A;  2YLI A;  3W8H A;  5F5F A;  1RKC A;  4BJ1 A;  3EG9 A;  5DS4 A;  1LPE A;  1OW6 A;  1M2V A;  1YZA A;  2AVK A;  2P61 A;  2YRF A;  4JCZ A;  4PFP A;  4Z9I A;  3WHN A;  4H4K C;  3MLG A;  3K1H A;  1FTS A;  4IGG A;  2I15 A;  2JD3 A;  4XEF A;  1OW7 A;  1R4T A;  2HMQ A;  3B71 A;  4IB4 A;  4MW3 A;  4KC9 A;  3RVY A;  3EGX A;  4EHP A;  1WAT A;  4DBR A;  2AWY A;  5AC4 A;  2AU5 A;  4XLP F;  3VM6 A;  1D1A A;  1JPN A;  2LFF A;  4P9T A;  2R05 A;  4G78 A;  4YT2 A;  1H9T A;  4JEA A;  1HMO A;  3VYW A;  3MYI A;  1FAP B;  2XLH A;  3C8G D;  3L0I A;  4XTK A;  1QVX A;  1NU7 D;  1JMW A;  4PFO A;  1M6T A;  1NFN A;  3IQT A;  3ZTM A;  3NDB B;  1I4Z A;  3LEV A;  3B29 A;  3RF3 A;  4R32 A;  1NBB A;  2YLG A;  3ECS A;  4YT5 A;  1VLS A;  4IAO A;  4E0I A;  4NTA A;  4F4B A;  3AG4 C;  3F46 A;  1I4Y A;  3FAP B;  4BJ5 A;  3O39 A;  1XWJ A;  4ANJ A;  4C3D A;  3ZQY A;  2IXP A;  4C7O B;  2YKZ A;  1VYK A;  1C02 A;  4U5H A;  3GM3 A;  3NMJ A;  3IQC A;  3S27 A;  1RMV A;  2DYR C;  4FWV A;  1QQ3 A;  2ZXO A;  4MVM A;  3EG9 B;  1ZU5 A;  5KYU A;  2R7S A;  3FVY A;  4JE9 A;  1M2V B;  2A6H F;  3SZR A;  3TOM A;  1FMW A;  2WZG A;  3DKA A;  4JRZ A;  5AGF A;  3WAQ A;  4Q7C A;  2EPL X;  2KQ9 A;  5A6K A;  5A6B A;  5KYY A;  1OXK A;  4DOZ A;  4PK4 A;  4AE4 A;  4LLE A;  3SXZ A;  2JX0 A;  3EGX B;  2PF4 E;  3CAX A;  3C8G B;  4MVZ A;  1M2O A;  2G3V A;  3PCV A;  4U5D E;  1ZW2 A;  5A6B D;  2A0B A;  1ZHY A;  2GA0 A;  2C04 A;  2XM4 A;  2J9W A;  4JIO A;  5E33 A;  4D4X A;  1MND A;  2Q9C A;  4M63 A;  4YK5 A;  1Z3I X;  3JYY A;  4GEH A;  5L3V A;  1UFB A;  1A7D A;  2IM8 A;  2IOQ A;  3G50 A;  5JUA A;  2UUH A;  2DB4 A;  5DQZ A;  2QY9 A;  2Y3H A;  4EKW A;  4OIP F;  1TFO B;  1VOM A;  5K0I A;  1J8Y F;  3E70 C;  2QNL A;  2G62 A;  5JP7 A;  1MMN A;  3K1I C;  1T5O A;  4IWB A;  4LDR A;  4LDQ A;  5GPG B;  3MX3 A;  2R9R B;  3AG3 C;  4HEA J;  3W8I A;  4CBE A;  2A69 F;  3QTH A;  1LS4 A;  4AL0 A;  4ONS A;  1YYX A;  4CS8 C;  3DM9 B;  2ZXW C;  1QSP A;  2EIN C;  2X0C A;  3A9C A;  1BBH A;  4XQ1 A;  5E2Q A;  3C8Z A;  4E7S A;  3BRJ A;  3DI5 A;  2WZL A;  5KYU B;  3DXJ F;  1V74 B;  4B6I A;  4JJF A;  2YLD A;  3B9Q A;  5FZT A;  4A4A A;  1LIH A;  1ORS C;  2KYH A;  1Y6D A;  2CYD A;  5A6J A;  2J7P A;  3W2V A;  3ZDL A;  2DYS C;  2GWW A;  4J32 B;  4WAB A;  4MW8 A;  3S84 A;  4O6M A;  2OEX A;  2M64 A;  3N2Z B;  4U5C E;  4AE4 B;  2NSG A;  4BJ5 C;  5L0C A;  3SEO A;  1E85 A;  2BC5 A;  3RQG A;  4AK9 A;  2IXO A;  1RKE A;  1YLM A;  1ZHZ A;  5BUO A;  1ZYR F;  2LIG A;  2EIK C;  1ORJ A;  3U9J A;  4MTG A;  2XLV A;  1LE4 A;  5T1D B;  1S7Z A;  4U5F E;  3KKB A;  2HV6 A;  4EUK B;  1H9G A;  4YT4 A;  3UMK A;  4DVY P;  4ULV A;  1YVI A;  4ZLD A;  1NLX A;  3ZVR A;  2MWQ A;  1OCR C;  3X1O A;  2R7O A;  3GM2 A;  1AUE A;  5COF A;  4C3B A;  2WB7 A;  5JRA A;  1YAR O;  2A1D D;  4I1O B;  3WG7 C;  1AVO B;  1Z23 A;  3IHU A;  3L8J A;  5KYX A;  4DVZ A;  4LAC B;  5CI9 A;  3LUT B;  1ZVZ A;  3DAG A;  4BJT A;  2J46 A;  4EBJ A;  2KNH A;  3MBG A;  4XLN F;  2C03 A;  5L3Q A;  3ZTZ A;  3B0P A;  2KJG A;  3Q7G A;  3SYN A;  3LES A;  5DLJ A;  3NMK A;  4NC3 A;  4RDA A;  5D92 A;  3S9O A;  1HW2 A;  3U3F A;  4U9E A;  1J8M F;  1O5H A;  1YJG A;  2IYL D;  3AGU A;  4ZLC A;  2VC9 A;  1OKK A;  5EGY A;  5T3W A;  2CCY A;  3NRH A;  3MYF A;  2LP4 A;  3SXK A;  1H7I A;  2WVQ A;  1C03 A;  3NKE A;  1Y4C A;  4MVQ A;  1WOL A;  4Z9H A;  5B1B C;  1OKK D;  4EBB A;  4JW1 A;  3ITF A;  3ABK C;  3EQL F;  3T6G B;  3DD7 A;  2LK4 A;  3NYL A;  4L6R A;  5BQG A;  3VF0 A;  5EHH A;  4XEV A;  2F22 A;  2OU6 A;  2LQG A;  3AG1 C;  2R7X A;  4EIY A;  2KK1 A;  3RYL A;  3PDM P;  4A2N B;  2IXM A;  2IBF A;  2W4M A;  2Z15 A;  3K66 A;  1MQV A;  4PJM A;  3B0V C;  3HNJ A;  5AC5 A;  4KI2 A;  1WAS A;  2YEV A;  3ASN C;  4YL0 A;  5DS6 A;  4D4N A;  1TQG A;  1LE2 A;  3UMH A;  3U0C A;  1ORY A;  2NUT B;  2P7V A;  1XZP A;  3FAJ A;  3GEI A;  3K33 A;  1HMD A;  2FFH A;  4KNW A;  4NTB A;  2ICW G;  5CI8 A;  3GM1 A;  5KYX B;  3N24 A;  1C17 M;  2XLM A;  1D0X A;  1R5I D;  3U8P A;  5JS5 A;  4W8K A;  3Q6N A;  4DBQ A;  1SYQ A;  3JCU Q;  4MND A;  1TWG A;  5CIV A;  3U8V A;  3OEO A;  1MNE A;  4J30 B;  4JZA A;  5DS5 A;  2V3C C;  1VMA A;  3OA1 A;  4CDA A;  3I4U A;  2OQM A;  2E87 A;  4CS7 A;  1VLT A;  3S90 A;  1GM5 A;  3LLI A;  4CS9 A;  3SXY A;  1K05 A;  1SZI A;  3O10 A;  3KYI A;  4CIH A;  3DZA A;  1U6H A;  4FX5 A;  1T9K A;  3DJN B;  4BJ6 C;  1Z5Z A;  5KYW A;  4EWC A;  4K1O A;  3W4Y A;  2R7Q A;  1G8X A;  1N1C A;  5D91 A;  4K0D A;  1FMV A;  4ULW A;  5DVW A;  2A68 F;  3PHF 2;  2R03 A;  1IZM A;  2OOC A;  3KPH A;  1NSG B;  1BR4 A;  1G4U S;  1O87 A;  1OR3 A;  2LSE A;  1MMA A;  3GOR A;  4G7H F;  2HJ3 A;  2XL4 A;  3C7J A;  1TFK B;  2XS8 A;  3M4C A;  4MTO A;  1RCP A;  4OD4 A;  4XPX A;  5B1A C;  5HV9 A;  2R7V A;  3FDQ A;  1SMY F;  2R02 A;  2OKU A;  4RBN A;  4UDV A;  3B0U X;  2HJM A;  2LD6 A;  3C18 A;  3EZI A;  3GEH A;  3I5Q A;  2D4U A;  2Q7R A;  4C3E A;  4OIQ F;  2OCC C;  4LER A;  1OR2 A;  3J06 A;  1JPJ A;  2GAQ A;  4WGY A;  1LKX A;  1ZU4 A;  2H7O A;  3U2L A;  5FCL A;  4I1M A;  2CDQ A;  2XXA A;  4JC7 A;  2L81 A;  1Q0D A;  4P9F A;  1UG7 A;  2GDC A;  2Y3D A;  3HTK C;  3MFN A;  3SNH A;  3U3B A;  3HNL A;  3ZC4 A;  1GS9 A;  2R7R A;  1Q0G A;  4PJN A;  1PCX A;  4JUR I;  2XS1 A;  2ZD9 A;  3ASO C;  1TKN A;  1K40 A;  2MYS A;  2W45 A;  3H2V A;  4JVS A;  1D1C A;  3GEE A;  3SXM A;  4CDV A;  2P6V A;  3GWL A;  3LLK A;  2XL6 A;  2DGJ A;  1NZE A;  1PD1 A;  2BL2 A;  2H7B A;  2VH3 A;  3KYJ A;  4XPY A;  4K7B A;  3S28 A;  2GFH A;  3EHN A;  3NMI A;  3NYJ A;  4Z9J A;  5A6A A;  4RD9 A;  4HE8 D;  2QLA A;  1BZ4 A;  3R7C A;  1KNY A;  1EA8 A;  3C62 A;  2OJQ A;  3RVZ A;  2OEV A;  4E7Z A;  2VCA A;  4N6C A;  1B68 A;  3FMS A;  3VAY A;  4O6N A;  3IEE A;  4GYT A;  3EH1 A;  4OD5 A;  3TK0 A;  4IAQ A;  4LLC A;  1CPQ A;  3M79 A;  2NUP A;  4ER9 A;  1QKR A;  5B3I A;  1K04 A;  2M4E A;  3DJU B;  3QZC A;  1V55 C;  4CIP A;  4MVO A;  2PX0 A;  4U5B E;  1EKY A;  2HZ8 A;  5KYY B;  2HMZ A;  4YN0 B;  4NTF A;  2NG1 A;  3NYM A;  3PMR A;  1S05 A;  3O55 A;  4CS9 C;  3AOU A;  2Y3G A;  1DOV A;  2J7P D;  3LEO A;  4E18 A;  1A41 A;  2J0W A;  2PX3 A;  3JYH A;  2J45 A;  2XLD A;  3K6B A;  4O79 A;  4OIO F;  2LCH A;  2VCB A;  2VCC A;  4PAC A;  2XXA B;  4IJJ A;  3ABM C;  2HSB A;  2QE9 A;  4DRJ B;  1VK5 A;  2FAP B;  3ABL C;  3RKO F;  3S29 A;  4AL1 A;  1SF8 A;  2BE5 F;  1CGO A;  1YA7 O;  4U5G A;  3DAF A;  3V5Y A;  4DJ9 A;  1VTM P;  4FES A;  2KC3 A;  2L7A A;  3HLZ A;  1CGM E;  4MVR A;  2L6H A;  3US6 A;  3RFY A;  1ZHT A;  2YWA A;  4O7G A;  2MHR A;  3QW1 A;  3TJ5 A;  4XEK A;  5JT4 A;  3Q6M A;  1JAF A;  3K7D A;  4N06 A;  2PNO A;  5JVE A;  4U9D A;  5L0F A;  1WGW A;  4NCQ A;  1GGQ A;  3DE9 A;  4KBL A;  4OIR F;  3WOD F;  2NUP B;  2B0H A;  4XWJ A;  4Q5S F;  1APC A;  2YL0 A;  3V5Z A;  1Z63 A;  3F47 A;  3U2M A;  3JSZ A;  2PFD A;  1GQA A;  3IPM O;  4IRU A;  4PJJ A;  4NQF A;  3V5X A;  2HKV A;  4YJW A;  3T6J A;  5E3A A;  1U89 A;  2J0X A;  3H65 A;  2R7T A;  3GAN A;  1MMG A;  3LJB A;  1RKE B;  3FHD A;  5F5H A;  2B0J A;  2PP4 A;  2QUP A;  1A7E A;  3QW0 A;  1Q0K A;  3M1C B;  2YQY A;  4FAP B;  3JSE O;  1T6I A;  2J9U A;  4JEB A;  4BEM J;  1Q0F A;  2Q4F A;  3LS1 A;  2H8A A;  3TQO A;  3L8I A;  4NY3 A;  2CGE A;  1AEP A;  2HV7 A;  3ZG1 A;  1OW8 A;  2Q9A A;  2I8B A;  3CSK A;  2YL1 A;  4U5E E;  1KTM A;  1HW1 A;  3R2P A;  5DQT A;  1OXB A;  3L34 A;  3ZIB A;  2EPO A;  3RW0 A;  2Y39 A;  3KH2 A;  3M4B A;  2EIL C;  2EIJ C;  4MS2 A;  2YHS A;  3EJN A;  1FR0 A;  1CPR A;  1V54 C;  3JT1 A;  3N0T A;  3EFO A;  4E17 A;  3UGP A;  2R7W A;  3NG1 A;  2ZXR A;  4N4W A;  4LDK A;  4YT8 A;  1NU9 C;  4DRH B;  3X2Q C;  3RQF A;  2ETS A;  4H54 A;  1IW7 F;  2XLE A;  4YL3 A;  3FOO A;  5B3S C;  3QVZ A;  3K1I A;  3LNM B;  2FGY A;  5F28 E;  1G5Z A;  2VAS A;  4CS8 A;  2CW0 F;  2J9V A;  2D5R B;  2RSE B;  3C8G A;  2UUI A;  2ZXP A;  4I44 A;  4QDL A;  3T9O A;  1JR8 A;  1Z6A A;  2Q00 A;  2JPU A;  1WWP A;  4G7Z F;  2HSQ A;  4DXW A;  5COG A;  3HJC A;  2TMV P;  3HNI A;  3T4R A;  1OCO C;  3UNG C;  1LM3 B; 
#chains in the Genus database with same CATH homology
 4YL1 A;  4BPM A;  5HV9 A;  4AL1 A;  3B29 A;  4J7Y A;  4NTA A;  3PCV A;  5BQG A;  2Q7R A;  4J7T A;  4JCZ A;  4YL3 A;  4YK5 A;  4JC7 A;  3DWW A;  2UUH A;  4WAB A;  3HKK A;  2H8A A;  4NTF A;  4YL0 A;  2UUI A;  5K0I A;  2PNO A;  5BQI A;  3LEO A;  5BQH A;  4NTB A;  4JRZ A;  4AL0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...