2Q7RA

Crystal structure of human flap with an iodinated analog of mk-591
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
140
structure length
140
Chain Sequence
MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein, lipid transport
molecule keywords Arachidonate 5-lipoxygenase-activating protein
publication title Crystal structure of inhibitor-bound human 5-lipoxygenase-activating protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 140
sequence length 140
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 2q7rA00
3LEOA 4YL1A 5BQGA 4JCZA 3DWWA 3PCVA 3HKKA 4AL0A 4J7TA 4WABA 4NTBA 3B29A 4YL0A 5BQIA 2H8AA 4NTFA 4YL3A 2UUHA 2UUIA 4NTAA 4J7YA 4YK5A 4JC7A 5BQHA 5HV9A 2PNOA 4AL1A 5K0IA 2Q7RA 4JRZA 4BPMA
chains in the Genus database with same CATH superfamily
3OEOA 2Q00A 3C62A 3HKKA 5CI9A 2L6HA 4KC9A 1NLXA 3EHNA 4N4WA 4WABA 3QW1A 4XEKA 2HMQA 1SZIA 3AJMA 3FAPB 3UR3C 1ZHYA 4HFKB 3ZQYA 4PJMA 2PBEA 3HNLA 3RVYA 2XXAB 1N1CA 1I5NA 4U5DE 3ASNC 3NMJA 3U8VA 1E85A 2J45A 2JX0A 4YK5A 1TWAA 1HMDA 2CGEA 3R2PA 1WASA 3DM9B 3S9OA 1F1MA 2IXOA 2PNOA 3K33A 3ZWIA 4IAQA 4U5GA 1G4WR 1R4TA 2CYDA 4MS2A 1RKCA 3DKAA 4QDLA 5JSLA 4BJ5C 4MVRA 4PACA 1T6UA 3NYJA 1YYXA 3A9CA 1RJ9A 2XS1A 4YL1A 2BE5F 4LERA 4JIOA 1MNEA 1O87A 2CCYA 4O79A 5JP7A 2RD9A 1OW7A 3QW0A 4JE9A 2Q3TA 1JR8A 3JZ0A 4G7HF 2XL6A 2DYRC 5COGA 2WZLA 2J9WA 3TOLA 4EIYA 1OCRC 3E70C 3TOMA 5KYXB 1ORSC 3O6XA 2EPNA 3CSKA 4CDAA 1YZCA 1DOWA 4CX9A 3G4XA 3IQCA 3W2WA 1UFBA 3GODA 4CS8C 3Q7LA 3JT1A 1YZAA 4N6CA 4AX2A 3EQLF 4HEAJ 4YT2A 4BG0A 4XEVA 2KQ9A 5JLIA 3NDBB 4AE4A 5COFA 3U3BA 2G3KA 1V4AA 3EPVA 3T6JA 5L3QA 2J8WA 4JTCB 3VAYA 3DXJF 4MVZA 1I4ZA 3O10A 1BR2A 4JURI 1PCXA 3A11A 2VB6A 3EG9B 2Q9CA 5B3SC 2GDCA 1T01A 2CNWA 2I8BA 3TK0A 3DE9A 1T6IA 2H7VC 3NKEA 2HSQA 4D4NA 4C7OA 1JMWA 4PJJA 4NTBA 1Z3IX 3V5ZA 3EFOB 3GWLA 1V54C 1FMWA 3ATPA 1U0BB 3NYMA 3FAJA 1OKKD 1V74B 1ORYA 2W9YA 2QTVA 4IWBA 1RKEB 4LLEA 4ULWA 3FDQA 4ULVA 1LE2A 2BL2A 2IYLD 4YJWA 2Y69C 2UUHA 2LCHA 1LIHA 2GA0A 3S28A 1MMGA 2XXAA 5L0IA 3DJNB 2KK1A 2Q9BA 4IARA 4IB4A 5JT4A 1M57C 2V3CC 3LAYA 2EILC 4EKWA 1H6GA 2NPUA 4DOZA 3U2MA 4DVZA 1XZPA 1D1CA 5L3VA 5D91A 1NG1A 3CQZA 2L6FA 4IGGA 3K1HA 2HZ8A 2AWCA 2Y3GA 1OCCC 3HNKA 3TJ5A 4XEFA 5E2QA 3F47A 1RMVA 5DQZA 2Z15A 2KNHA 3B9QA 1T5OA 2R7QA 1TR2A 2OEVA 4YL3A 5A6BA 1Z7Qc 3H65A 2GAQA 2NSGA 4K7BA 4HFFB 4PK4A 1YAUO 5KYWB 2X51A 2VCBA 4BEJA 1R5ID 3B0PA 4P6IC 3HLZA 3ZC4A 4CDYA 5AC4A 5COMA 2Y39A 1NZEA 2R9RB 4FX5A 2NG1A 1VLSA 1H9GA 2V26A 4U9DA 2PX3A 2XLMA 3QMKA 4MVSA 4U5CE 3LEOA 3LNMB 3M4CA 3SXMA 5F5HA 4G7ZF 3DWWA 3EH1A 2J46A 2XLDA 3EGXB 2LFDA 1G4US 1W2WA 3BEHA 5E3CA 3RQGA 4BJ5A 4G78A 4DJ9A 1VB5A 2YLDA 1YARO 4G0HA 4H54A 4E17A 1IW7F 2J9UA 2ASRA 1M6TA 1RXQA 2ZXPA 3VM6A 3EG9A 1FNTc 5DS5A 3I5QA 4KI2A 3KYJA 2YZSA 1E83A 3PHF2 1YYJA 1T9KA 5JRAA 3ZIBA 2DI3A 3EFOA 4FWVA 1WTYA 1ZW2A 4NTFA 3IPMO 4ER9A 3CZ6A 3DZAA 1SR2A 3IQTA 2EIJC 2G62A 2M64A 1Z6AA 3MX3A 1ZHZA 4U5HA 1RKEA 3ZTMA 3H2UA 3UMHA 1CGME 2NUPB 2XM4A 2XLWA 3KMIA 3C7JA 4U5EE 1QPUA 4BJ1A 2Q7RA 4CS8A 2ICWG 2YRFA 4Q5SF 2TMVP 3GANA 4R32A 2XLOA 2XL4A 2PF4E 3GM1A 3KPHA 1VTMP 4BEMJ 3U9JA 1E86A 3Q6NA 1B68A 4CJGA 3MFNA 2HUJA 5E33A 3SNHA 5L0FA 1JRAA 1D0ZA 2J9BA 1VK5A 4EBJA 1ZHXA 1JAFA 1AVOB 4XWJA 5JVEA 1SMYF 3FHDA 4DRHB 1EI7A 2R7RA 4OINF 1TWHA 1LI5A 2OG2A 4ZLCA 2DYSC 1I4YA 3ABLC 3MYFA 4E7ZA 1OW8A 5L0CA 2QUPA 5KYYB 1TFKB 4YT8A 4JEAA 1EQ1A 4JJFA 3EJNA 5B1BC 3UMKA 1D0XA 1ZZPA 2E87A 5CIVA 4FAPB 4J32B 4BJTA 3C8GD 4XTKA 3TULA 4Z9JA 5EGYA 2O9XA 2KGOA 3SXKA 4ONSA 5L0GA 2W45A 5KYWA 2IXNA 2P1AA 2EPLX 1A7VA 3L34A 2LFFA 2ZPAA 4XQ1A 4A4AA 2ZD9A 2YWAA 3HJCA 2W4BA 2WB7A 4O6MA 4QI0A 2KYHA 3POVA 2EPMX 2JD3A 4CSAC 1HY5A 1L7CA 1NU7D 2OOCA 3LS0A 4MVMA 1TQGA 2YL0A 3AQCA 3EGXA 4CIHA 4JJGA 4XPXA 1FFTC 1HW2A 3SP1A 1D1BA 1DOVA 1J8MF 1NBBA 5KYNA 4K0DA 2GFHA 4RDAA 4U5FE 2A68F 1O5HA 3R7CA 3FXHA 3S90A 1LPEA 2YL3A 4MVUA 2R7XA 4OIQF 3AG2C 2MYSA 4FESA 3U5SA 1MNDA 2NSFA 3WHNA 1Q0KA 2PP4A 4E0IA 3S0XA 3PMRA 1ZU5A 2NUPA 3O55A 4KNVA 4WJ0A 4DVYP 1BBHA 4I3MA 3ZVRA 1E2XA 3M4BA 3GEHA 1YDIA 3HTKC 1OXKA 1XWJA 2XLVA 3UMIA 4RD9A 3GWNA 1JPJA 2PFDA 3G50A 5B1AC 1MMNA 1CPQA 1H7IA 1GS9A 2HJ3A 1LVKA 1Z63A 1ZYRF 1HE1A 3WODF 3C8ZA 2C03A 3K7DA 3N24A 4OIRF 4PR9A 2AU5A 4I1MA 2I15A 4O6YA 3SXZA 1TKNA 2IXPA 4LDKA 4YT5A 2J7PA 4NY3A 3TJ6A 5DS6A 3QVYA 3WG7C 3EGDB 2HS5A 3AQBA 5KYYA 5BQHA 2J0WA 1EA8A 2H7OA 3SYNA 2AWYA 4IRUA 2OJQA 1VMAA 2LK4A 4IAOA 4OD4A 4ANJA 5DLJA 1GGQA 4U5BE 3KH2A 4I44A 3DAFA 5T3TA 3ITFA 3GORA 5A6JA 2XLHA 3DM5A 5BQGA 3RYLA 4CS9C 3DI5A 5A6KA 1LI7A 1IZMA 5IY5C 1JOGA 2HSBA 2WVQA 4B6IA 4IJJA 3LLKA 2VC9A 1ZHWA 2ZXOA 4KNWA 3QTHA 4LDRA 5T1DB 2EINC 3VRCA 5EHHA 1GM5A 1CGOA 3AGTA 3DJUB 4NCQA 5F28E 5KYUB 3X1OA 2FGYA 3AOUA 4GEHA 2XRHA 2P0NA 3ZTZA 4DRJB 4EHPA 1V55C 2VCAA 3U2LA 2LP4A 3Q7GA 1WGWA 3DD7A 2Y3DA 5FZTA 4QI2A 1QSPA 1M2VB 5HV9A 2OU6A 2PX0A 4MVOA 4ZLDA 3JTLO 3GM3A 3JRMO 3RF3A 3W2VA 2R7UA 3WAQA 2L81A 4DBRA 4F4BA 4EBKA 1VYIA 3KL4A 3EZIA 2IBFA 2A0UA 3PCVA 1Q0DA 1KNYA 4O7GA 1E84A 2QE9A 4H4KC 4MTFA 1YLMA 2L9JA 2G3VA 1OR2A 3Q6MA 1VLTA 4CSAA 4EBBA 5AC5A 3B29A 1BZ4A 1D1AA 3I4UA 2CNWD 3NG1A 4WGYA 3JRTA 1NFNA 5BUOA 5HSWA 3C18A 2XS8A 3DAGA 1TWCA 4WGZA 1G5ZA 5D92A 2DGJA 3U8PA 2UUIA 4U9EA 5JUAA 3OWTA 3V5XA 1FAPB 3JSZA 4CDVA 2JPUA 3QZCA 1HMOA 256BA 2FAPB 3M1CB 3V5YA 3F46A 3EGDA 1QZXA 2EPOA 4XPYA 4CS7A 4JCZA 4MQ9F 1OCOC 4UDVA 1OQCA 4MTOA 4JKVA 4MTGA 1SYQA 2IOQA 4GYTA 4HE8D 3ZQVA 1XZQA 4D4XA 3U9MA 1EKYA 1L3PA 3BRJA 4XLPF 1AEPA 4G7OF 4OD5A 2XSEA 2YKZA 5KYUA 1YA7O 2OCCC 3T6BA 2FFHA 2Q9AA 1M2OA 2X0CA 1NSGB 3K6BA 3VYWA 2VCCA 2R7VA 2LD6A 2XM0A 2WZGA 3E9VA 4I1OB 4LDQA 2WVOA 1C03A 1RCPA 3FOOA 1ST6A 2KJGA 1D0YA 5A6BD 1M2VA 3LLIA 3W8HA 2IXMA 2YHSA 5L0JA 3H2VA 3AG3C 2A6HF 2EIMC 1YJGA 2KW3C 3GEIA 3L0IA 4DRIB 3V7OA 1OKKA 1PD1A 4JTDB 4MNDA 3S29A 4AL0A 4CS9A 2R7TA 2WZFA 2KSFA 4MVQA 3CEXA 1Y6DA 3MYIA 2ETSA 4YT4A 2D4UA 3TD7A 3B0VC 1APCA 1S05A 1ZVZA 2ZXRA 5EK0A 4C7OB 3IEEA 3N0TA 3JCUQ 4W8PA 4N06A 2P6VA 4W8KA 4CIPA 1BDJB 2YL1A 2ZXWC 4MW8A 5A6AA 2HV7A 2VASA 3LNRA 1OCZC 1QVXA 2P7VA 3U0CA 3ABMC 2MHRA 4JVSA 2LQGA 4NTAA 3M15A 5AGFA 3NYLA 1C02A 5FCLA 4JW1A 3T4RA 3S84A 3ABKC 2HV6A 5E3AA 1O3UA 4GQHA 4AL1A 4JRZA 5DVWA 3TQOA 2B0HA 1PD0A 4EWCA 5JS5A 4Z9HA 1PV3A 1A41A 2A1DD 3RIPA 1BR1A 3LS1A 1Y4CA 4OIPF 2QLAA 3B71A 4J30B 4RBNA 5L0HA 4E0HA 1BR4A 1QKRA 2WVNA 1H9TA 3LJBA 5F5FA 3GM2A 4DXWA 3JSEO 4OIOF 3L1MA 2R7WA 4J7TA 3N2ZB 2NUTB 3C8GB 2DB4A 2J9VA 1MMDA 4BJ6C 2GWWA 3K1IC 2XLEA 3G4ZA 1FFHA 2R7OA 3ECSA 3NRHA 1HE9A 4P9FA 1LS1A 3X2QC 3UGPA 4Q7CA 2EPKX 2IM8A 1G8XA 2H8AA 2WL8A 3NKDA 4L6RA 4XLNF 4DBQA 1KTMA 2AP3A 4N6HA 1CPRA 4CJOA 4P9TA 2BC5A 4X0RA 2R05A 1WOLA 1OXBA 3J06A 1HW1A 1YVIA 5T3WA 2F22A 1SF8A 2RSEB 1C17M 4JZAA 1K05A 3DE8A 3S27A 5GPGB 4O6NA 3RKOF 1MQVA 1WN0A 1FMVA 2XL8A 3KKBA 1AUEA 3HNIA 3L8IA 1LKXA 2Y3HA 2Y3BA 5TJ5E 2YQYA 3NMIA 1LS4A 3UGOA 2C04A 4Q4ZF 3U3FA 3MLGA 4Z9IA 3VF0A 4E18A 3L8JA 3T6GB 2YLGA 3SZRA 2MWQA 3FOPA 1MMAA 2W4MA 1ZU4A 3AG4C 3AGUA 3JYYA 3UNGC 3KYIA 2M4EA 1VYKA 2YEVA 4YL0A 3SXYA 3K66A 1TFOB 2L6GA 2H7BA 4CBEA 2OJED 3MBGA 4AE4B 4PJLA 4E7SA 3HNJA 1Z5ZA 1FR0A 5K0IA 2A0BA 4C3BA 1A7DA 1JPNA 1WWPA 2OEXA 4BPMA 2R7SA 4PFOA 2J0XA 2A6EF 2YLIA 2YVKA 1LM3B 1Q0MA 3RFYA 1Q0FA 2YL7A 4YN0B 3JYHA 1K40A 5DQTA 1S7ZA 2HJMA 2OQMA 1ZHTA 2KC3A 3ZG1A 2QY9A 4YWQA 2R02A 4NC3A 2HMZA 4NQFA 3T9OA 1YA9A 3W8IA 2QNLA 2EIKC 3IQ6A 2NUTA 3C8GA 1Q0GA 4JEBA 4XPWA 1T6QA 3PDMP 2R25A 3IHUA 1U89A 1NU9C 5KYXA 3EHMA 4PJNA 2Q4FA 3RH3A 1ORJA 2HKVA 4M63A 1K04A 4EUKB 2L7AA 1A0BA 2AVKA 1CGNA 3RVZA 3OA1A 3RQEA 3ZSUA 3M79A 1KU2A 1RJ9B 5CI8A 3CAXA 4PFPA 2P61A 5B3IA 3RQFA 4LACB 2A69F 2J7PD 1OW6A 1WATA 3DMDA 3B0UX 4MW3A 3SEOA 1QLEC 4A2NB 1LE4A 1OR3A 3GEEA 4JTAB 1FTSA 3LUTB 3AG1C 3W4YA 1A7EA 3LESA 3EZHA 2B0JA 3I5PA 1ZW3A 2VH3A 3US6A 2CW0F 1J8YF 1U6HA 2D5RB 1GQAA 2OKUA 3K1IA 4BJ6A 4C3EA 5DS4A 5BQIA 5A69A 1Z23A 1VOMA 4K1OA 1TWGA 2LIGA 1QQ3A 3QVZA 2R03A 4C3DA 4KBLA 5L0DA 4J7YA 3RW0A 3C63A 3O39A 1M56C 4LLCA 3ASOC 3FVYA 2HFIA 3LEVA 4JC7A 3EH2A 2CDQA 3IQ5A 2LSEA 3NMKA 4JCHA 4AK9A 1NFOA 3FMSA 1UG7A 3ZDLA
chains in the Genus database with same CATH topology
3LEOA 4YL1A 5BQGA 4JCZA 3DWWA 3PCVA 3HKKA 4AL0A 4J7TA 4WABA 4NTBA 3B29A 4YL0A 5BQIA 2H8AA 4NTFA 4YL3A 2UUHA 2UUIA 4NTAA 4J7YA 4YK5A 4JC7A 5BQHA 5HV9A 2PNOA 4AL1A 5K0IA 2Q7RA 4JRZA 4BPMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LEO A;  4YL1 A;  5BQG A;  4JCZ A;  3DWW A;  3PCV A;  3HKK A;  4AL0 A;  4J7T A;  4WAB A;  4NTB A;  3B29 A;  4YL0 A;  5BQI A;  2H8A A;  4NTF A;  4YL3 A;  2UUH A;  2UUI A;  4NTA A;  4J7Y A;  4YK5 A;  4JC7 A;  5BQH A;  5HV9 A;  2PNO A;  4AL1 A;  5K0I A;  2Q7R A;  4JRZ A;  4BPM A; 
#chains in the Genus database with same CATH topology
 3OEO A;  2Q00 A;  3C62 A;  3HKK A;  5CI9 A;  2L6H A;  4KC9 A;  1NLX A;  3EHN A;  4N4W A;  4WAB A;  3QW1 A;  4XEK A;  2HMQ A;  1SZI A;  3AJM A;  3FAP B;  3UR3 C;  1ZHY A;  4HFK B;  3ZQY A;  4PJM A;  2PBE A;  3HNL A;  3RVY A;  2XXA B;  1N1C A;  1I5N A;  4U5D E;  3ASN C;  3NMJ A;  3U8V A;  1E85 A;  2J45 A;  2JX0 A;  4YK5 A;  1TWA A;  1HMD A;  2CGE A;  3R2P A;  1WAS A;  3DM9 B;  3S9O A;  1F1M A;  2IXO A;  2PNO A;  3K33 A;  3ZWI A;  4IAQ A;  4U5G A;  1G4W R;  1R4T A;  2CYD A;  4MS2 A;  1RKC A;  3DKA A;  4QDL A;  5JSL A;  4BJ5 C;  4MVR A;  4PAC A;  1T6U A;  3NYJ A;  1YYX A;  3A9C A;  1RJ9 A;  2XS1 A;  4YL1 A;  2BE5 F;  4LER A;  4JIO A;  1MNE A;  1O87 A;  2CCY A;  4O79 A;  5JP7 A;  2RD9 A;  1OW7 A;  3QW0 A;  4JE9 A;  2Q3T A;  1JR8 A;  3JZ0 A;  4G7H F;  2XL6 A;  2DYR C;  5COG A;  2WZL A;  2J9W A;  3TOL A;  4EIY A;  1OCR C;  3E70 C;  3TOM A;  5KYX B;  1ORS C;  3O6X A;  2EPN A;  3CSK A;  4CDA A;  1YZC A;  1DOW A;  4CX9 A;  3G4X A;  3IQC A;  3W2W A;  1UFB A;  3GOD A;  4CS8 C;  3Q7L A;  3JT1 A;  1YZA A;  4N6C A;  4AX2 A;  3EQL F;  4HEA J;  4YT2 A;  4BG0 A;  4XEV A;  2KQ9 A;  5JLI A;  3NDB B;  4AE4 A;  5COF A;  3U3B A;  2G3K A;  1V4A A;  3EPV A;  3T6J A;  5L3Q A;  2J8W A;  4JTC B;  3VAY A;  3DXJ F;  4MVZ A;  1I4Z A;  3O10 A;  1BR2 A;  4JUR I;  1PCX A;  3A11 A;  2VB6 A;  3EG9 B;  2Q9C A;  5B3S C;  2GDC A;  1T01 A;  2CNW A;  2I8B A;  3TK0 A;  3DE9 A;  1T6I A;  2H7V C;  3NKE A;  2HSQ A;  4D4N A;  4C7O A;  1JMW A;  4PJJ A;  4NTB A;  1Z3I X;  3V5Z A;  3EFO B;  3GWL A;  1V54 C;  1FMW A;  3ATP A;  1U0B B;  3NYM A;  3FAJ A;  1OKK D;  1V74 B;  1ORY A;  2W9Y A;  2QTV A;  4IWB A;  1RKE B;  4LLE A;  4ULW A;  3FDQ A;  4ULV A;  1LE2 A;  2BL2 A;  2IYL D;  4YJW A;  2Y69 C;  2UUH A;  2LCH A;  1LIH A;  2GA0 A;  3S28 A;  1MMG A;  2XXA A;  5L0I A;  3DJN B;  2KK1 A;  2Q9B A;  4IAR A;  4IB4 A;  5JT4 A;  1M57 C;  2V3C C;  3LAY A;  2EIL C;  4EKW A;  1H6G A;  2NPU A;  4DOZ A;  3U2M A;  4DVZ A;  1XZP A;  1D1C A;  5L3V A;  5D91 A;  1NG1 A;  3CQZ A;  2L6F A;  4IGG A;  3K1H A;  2HZ8 A;  2AWC A;  2Y3G A;  1OCC C;  3HNK A;  3TJ5 A;  4XEF A;  5E2Q A;  3F47 A;  1RMV A;  5DQZ A;  2Z15 A;  2KNH A;  3B9Q A;  1T5O A;  2R7Q A;  1TR2 A;  2OEV A;  4YL3 A;  5A6B A;  1Z7Q c;  3H65 A;  2GAQ A;  2NSG A;  4K7B A;  4HFF B;  4PK4 A;  1YAU O;  5KYW B;  2X51 A;  2VCB A;  4BEJ A;  1R5I D;  3B0P A;  4P6I C;  3HLZ A;  3ZC4 A;  4CDY A;  5AC4 A;  5COM A;  2Y39 A;  1NZE A;  2R9R B;  4FX5 A;  2NG1 A;  1VLS A;  1H9G A;  2V26 A;  4U9D A;  2PX3 A;  2XLM A;  3QMK A;  4MVS A;  4U5C E;  3LEO A;  3LNM B;  3M4C A;  3SXM A;  5F5H A;  4G7Z F;  3DWW A;  3EH1 A;  2J46 A;  2XLD A;  3EGX B;  2LFD A;  1G4U S;  1W2W A;  3BEH A;  5E3C A;  3RQG A;  4BJ5 A;  4G78 A;  4DJ9 A;  1VB5 A;  2YLD A;  1YAR O;  4G0H A;  4H54 A;  4E17 A;  1IW7 F;  2J9U A;  2ASR A;  1M6T A;  1RXQ A;  2ZXP A;  3VM6 A;  3EG9 A;  1FNT c;  5DS5 A;  3I5Q A;  4KI2 A;  3KYJ A;  2YZS A;  1E83 A;  3PHF 2;  1YYJ A;  1T9K A;  5JRA A;  3ZIB A;  2DI3 A;  3EFO A;  4FWV A;  1WTY A;  1ZW2 A;  4NTF A;  3IPM O;  4ER9 A;  3CZ6 A;  3DZA A;  1SR2 A;  3IQT A;  2EIJ C;  2G62 A;  2M64 A;  1Z6A A;  3MX3 A;  1ZHZ A;  4U5H A;  1RKE A;  3ZTM A;  3H2U A;  3UMH A;  1CGM E;  2NUP B;  2XM4 A;  2XLW A;  3KMI A;  3C7J A;  4U5E E;  1QPU A;  4BJ1 A;  2Q7R A;  4CS8 A;  2ICW G;  2YRF A;  4Q5S F;  2TMV P;  3GAN A;  4R32 A;  2XLO A;  2XL4 A;  2PF4 E;  3GM1 A;  3KPH A;  1VTM P;  4BEM J;  3U9J A;  1E86 A;  3Q6N A;  1B68 A;  4CJG A;  3MFN A;  2HUJ A;  5E33 A;  3SNH A;  5L0F A;  1JRA A;  1D0Z A;  2J9B A;  1VK5 A;  4EBJ A;  1ZHX A;  1JAF A;  1AVO B;  4XWJ A;  5JVE A;  1SMY F;  3FHD A;  4DRH B;  1EI7 A;  2R7R A;  4OIN F;  1TWH A;  1LI5 A;  2OG2 A;  4ZLC A;  2DYS C;  1I4Y A;  3ABL C;  3MYF A;  4E7Z A;  1OW8 A;  5L0C A;  2QUP A;  5KYY B;  1TFK B;  4YT8 A;  4JEA A;  1EQ1 A;  4JJF A;  3EJN A;  5B1B C;  3UMK A;  1D0X A;  1ZZP A;  2E87 A;  5CIV A;  4FAP B;  4J32 B;  4BJT A;  3C8G D;  4XTK A;  3TUL A;  4Z9J A;  5EGY A;  2O9X A;  2KGO A;  3SXK A;  4ONS A;  5L0G A;  2W45 A;  5KYW A;  2IXN A;  2P1A A;  2EPL X;  1A7V A;  3L34 A;  2LFF A;  2ZPA A;  4XQ1 A;  4A4A A;  2ZD9 A;  2YWA A;  3HJC A;  2W4B A;  2WB7 A;  4O6M A;  4QI0 A;  2KYH A;  3POV A;  2EPM X;  2JD3 A;  4CSA C;  1HY5 A;  1L7C A;  1NU7 D;  2OOC A;  3LS0 A;  4MVM A;  1TQG A;  2YL0 A;  3AQC A;  3EGX A;  4CIH A;  4JJG A;  4XPX A;  1FFT C;  1HW2 A;  3SP1 A;  1D1B A;  1DOV A;  1J8M F;  1NBB A;  5KYN A;  4K0D A;  2GFH A;  4RDA A;  4U5F E;  2A68 F;  1O5H A;  3R7C A;  3FXH A;  3S90 A;  1LPE A;  2YL3 A;  4MVU A;  2R7X A;  4OIQ F;  3AG2 C;  2MYS A;  4FES A;  3U5S A;  1MND A;  2NSF A;  3WHN A;  1Q0K A;  2PP4 A;  4E0I A;  3S0X A;  3PMR A;  1ZU5 A;  2NUP A;  3O55 A;  4KNV A;  4WJ0 A;  4DVY P;  1BBH A;  4I3M A;  3ZVR A;  1E2X A;  3M4B A;  3GEH A;  1YDI A;  3HTK C;  1OXK A;  1XWJ A;  2XLV A;  3UMI A;  4RD9 A;  3GWN A;  1JPJ A;  2PFD A;  3G50 A;  5B1A C;  1MMN A;  1CPQ A;  1H7I A;  1GS9 A;  2HJ3 A;  1LVK A;  1Z63 A;  1ZYR F;  1HE1 A;  3WOD F;  3C8Z A;  2C03 A;  3K7D A;  3N24 A;  4OIR F;  4PR9 A;  2AU5 A;  4I1M A;  2I15 A;  4O6Y A;  3SXZ A;  1TKN A;  2IXP A;  4LDK A;  4YT5 A;  2J7P A;  4NY3 A;  3TJ6 A;  5DS6 A;  3QVY A;  3WG7 C;  3EGD B;  2HS5 A;  3AQB A;  5KYY A;  5BQH A;  2J0W A;  1EA8 A;  2H7O A;  3SYN A;  2AWY A;  4IRU A;  2OJQ A;  1VMA A;  2LK4 A;  4IAO A;  4OD4 A;  4ANJ A;  5DLJ A;  1GGQ A;  4U5B E;  3KH2 A;  4I44 A;  3DAF A;  5T3T A;  3ITF A;  3GOR A;  5A6J A;  2XLH A;  3DM5 A;  5BQG A;  3RYL A;  4CS9 C;  3DI5 A;  5A6K A;  1LI7 A;  1IZM A;  5IY5 C;  1JOG A;  2HSB A;  2WVQ A;  4B6I A;  4IJJ A;  3LLK A;  2VC9 A;  1ZHW A;  2ZXO A;  4KNW A;  3QTH A;  4LDR A;  5T1D B;  2EIN C;  3VRC A;  5EHH A;  1GM5 A;  1CGO A;  3AGT A;  3DJU B;  4NCQ A;  5F28 E;  5KYU B;  3X1O A;  2FGY A;  3AOU A;  4GEH A;  2XRH A;  2P0N A;  3ZTZ A;  4DRJ B;  4EHP A;  1V55 C;  2VCA A;  3U2L A;  2LP4 A;  3Q7G A;  1WGW A;  3DD7 A;  2Y3D A;  5FZT A;  4QI2 A;  1QSP A;  1M2V B;  5HV9 A;  2OU6 A;  2PX0 A;  4MVO A;  4ZLD A;  3JTL O;  3GM3 A;  3JRM O;  3RF3 A;  3W2V A;  2R7U A;  3WAQ A;  2L81 A;  4DBR A;  4F4B A;  4EBK A;  1VYI A;  3KL4 A;  3EZI A;  2IBF A;  2A0U A;  3PCV A;  1Q0D A;  1KNY A;  4O7G A;  1E84 A;  2QE9 A;  4H4K C;  4MTF A;  1YLM A;  2L9J A;  2G3V A;  1OR2 A;  3Q6M A;  1VLT A;  4CSA A;  4EBB A;  5AC5 A;  3B29 A;  1BZ4 A;  1D1A A;  3I4U A;  2CNW D;  3NG1 A;  4WGY A;  3JRT A;  1NFN A;  5BUO A;  5HSW A;  3C18 A;  2XS8 A;  3DAG A;  1TWC A;  4WGZ A;  1G5Z A;  5D92 A;  2DGJ A;  3U8P A;  2UUI A;  4U9E A;  5JUA A;  3OWT A;  3V5X A;  1FAP B;  3JSZ A;  4CDV A;  2JPU A;  3QZC A;  1HMO A;  256B A;  2FAP B;  3M1C B;  3V5Y A;  3F46 A;  3EGD A;  1QZX A;  2EPO A;  4XPY A;  4CS7 A;  4JCZ A;  4MQ9 F;  1OCO C;  4UDV A;  1OQC A;  4MTO A;  4JKV A;  4MTG A;  1SYQ A;  2IOQ A;  4GYT A;  4HE8 D;  3ZQV A;  1XZQ A;  4D4X A;  3U9M A;  1EKY A;  1L3P A;  3BRJ A;  4XLP F;  1AEP A;  4G7O F;  4OD5 A;  2XSE A;  2YKZ A;  5KYU A;  1YA7 O;  2OCC C;  3T6B A;  2FFH A;  2Q9A A;  1M2O A;  2X0C A;  1NSG B;  3K6B A;  3VYW A;  2VCC A;  2R7V A;  2LD6 A;  2XM0 A;  2WZG A;  3E9V A;  4I1O B;  4LDQ A;  2WVO A;  1C03 A;  1RCP A;  3FOO A;  1ST6 A;  2KJG A;  1D0Y A;  5A6B D;  1M2V A;  3LLI A;  3W8H A;  2IXM A;  2YHS A;  5L0J A;  3H2V A;  3AG3 C;  2A6H F;  2EIM C;  1YJG A;  2KW3 C;  3GEI A;  3L0I A;  4DRI B;  3V7O A;  1OKK A;  1PD1 A;  4JTD B;  4MND A;  3S29 A;  4AL0 A;  4CS9 A;  2R7T A;  2WZF A;  2KSF A;  4MVQ A;  3CEX A;  1Y6D A;  3MYI A;  2ETS A;  4YT4 A;  2D4U A;  3TD7 A;  3B0V C;  1APC A;  1S05 A;  1ZVZ A;  2ZXR A;  5EK0 A;  4C7O B;  3IEE A;  3N0T A;  3JCU Q;  4W8P A;  4N06 A;  2P6V A;  4W8K A;  4CIP A;  1BDJ B;  2YL1 A;  2ZXW C;  4MW8 A;  5A6A A;  2HV7 A;  2VAS A;  3LNR A;  1OCZ C;  1QVX A;  2P7V A;  3U0C A;  3ABM C;  2MHR A;  4JVS A;  2LQG A;  4NTA A;  3M15 A;  5AGF A;  3NYL A;  1C02 A;  5FCL A;  4JW1 A;  3T4R A;  3S84 A;  3ABK C;  2HV6 A;  5E3A A;  1O3U A;  4GQH A;  4AL1 A;  4JRZ A;  5DVW A;  3TQO A;  2B0H A;  1PD0 A;  4EWC A;  5JS5 A;  4Z9H A;  1PV3 A;  1A41 A;  2A1D D;  3RIP A;  1BR1 A;  3LS1 A;  1Y4C A;  4OIP F;  2QLA A;  3B71 A;  4J30 B;  4RBN A;  5L0H A;  4E0H A;  1BR4 A;  1QKR A;  2WVN A;  1H9T A;  3LJB A;  5F5F A;  3GM2 A;  4DXW A;  3JSE O;  4OIO F;  3L1M A;  2R7W A;  4J7T A;  3N2Z B;  2NUT B;  3C8G B;  2DB4 A;  2J9V A;  1MMD A;  4BJ6 C;  2GWW A;  3K1I C;  2XLE A;  3G4Z A;  1FFH A;  2R7O A;  3ECS A;  3NRH A;  1HE9 A;  4P9F A;  1LS1 A;  3X2Q C;  3UGP A;  4Q7C A;  2EPK X;  2IM8 A;  1G8X A;  2H8A A;  2WL8 A;  3NKD A;  4L6R A;  4XLN F;  4DBQ A;  1KTM A;  2AP3 A;  4N6H A;  1CPR A;  4CJO A;  4P9T A;  2BC5 A;  4X0R A;  2R05 A;  1WOL A;  1OXB A;  3J06 A;  1HW1 A;  1YVI A;  5T3W A;  2F22 A;  1SF8 A;  2RSE B;  1C17 M;  4JZA A;  1K05 A;  3DE8 A;  3S27 A;  5GPG B;  4O6N A;  3RKO F;  1MQV A;  1WN0 A;  1FMV A;  2XL8 A;  3KKB A;  1AUE A;  3HNI A;  3L8I A;  1LKX A;  2Y3H A;  2Y3B A;  5TJ5 E;  2YQY A;  3NMI A;  1LS4 A;  3UGO A;  2C04 A;  4Q4Z F;  3U3F A;  3MLG A;  4Z9I A;  3VF0 A;  4E18 A;  3L8J A;  3T6G B;  2YLG A;  3SZR A;  2MWQ A;  3FOP A;  1MMA A;  2W4M A;  1ZU4 A;  3AG4 C;  3AGU A;  3JYY A;  3UNG C;  3KYI A;  2M4E A;  1VYK A;  2YEV A;  4YL0 A;  3SXY A;  3K66 A;  1TFO B;  2L6G A;  2H7B A;  4CBE A;  2OJE D;  3MBG A;  4AE4 B;  4PJL A;  4E7S A;  3HNJ A;  1Z5Z A;  1FR0 A;  5K0I A;  2A0B A;  4C3B A;  1A7D A;  1JPN A;  1WWP A;  2OEX A;  4BPM A;  2R7S A;  4PFO A;  2J0X A;  2A6E F;  2YLI A;  2YVK A;  1LM3 B;  1Q0M A;  3RFY A;  1Q0F A;  2YL7 A;  4YN0 B;  3JYH A;  1K40 A;  5DQT A;  1S7Z A;  2HJM A;  2OQM A;  1ZHT A;  2KC3 A;  3ZG1 A;  2QY9 A;  4YWQ A;  2R02 A;  4NC3 A;  2HMZ A;  4NQF A;  3T9O A;  1YA9 A;  3W8I A;  2QNL A;  2EIK C;  3IQ6 A;  2NUT A;  3C8G A;  1Q0G A;  4JEB A;  4XPW A;  1T6Q A;  3PDM P;  2R25 A;  3IHU A;  1U89 A;  1NU9 C;  5KYX A;  3EHM A;  4PJN A;  2Q4F A;  3RH3 A;  1ORJ A;  2HKV A;  4M63 A;  1K04 A;  4EUK B;  2L7A A;  1A0B A;  2AVK A;  1CGN A;  3RVZ A;  3OA1 A;  3RQE A;  3ZSU A;  3M79 A;  1KU2 A;  1RJ9 B;  5CI8 A;  3CAX A;  4PFP A;  2P61 A;  5B3I A;  3RQF A;  4LAC B;  2A69 F;  2J7P D;  1OW6 A;  1WAT A;  3DMD A;  3B0U X;  4MW3 A;  3SEO A;  1QLE C;  4A2N B;  1LE4 A;  1OR3 A;  3GEE A;  4JTA B;  1FTS A;  3LUT B;  3AG1 C;  3W4Y A;  1A7E A;  3LES A;  3EZH A;  2B0J A;  3I5P A;  1ZW3 A;  2VH3 A;  3US6 A;  2CW0 F;  1J8Y F;  1U6H A;  2D5R B;  1GQA A;  2OKU A;  3K1I A;  4BJ6 A;  4C3E A;  5DS4 A;  5BQI A;  5A69 A;  1Z23 A;  1VOM A;  4K1O A;  1TWG A;  2LIG A;  1QQ3 A;  3QVZ A;  2R03 A;  4C3D A;  4KBL A;  5L0D A;  4J7Y A;  3RW0 A;  3C63 A;  3O39 A;  1M56 C;  4LLC A;  3ASO C;  3FVY A;  2HFI A;  3LEV A;  4JC7 A;  3EH2 A;  2CDQ A;  3IQ5 A;  2LSE A;  3NMK A;  4JCH A;  4AK9 A;  1NFO A;  3FMS A;  1UG7 A;  3ZDL A; 
#chains in the Genus database with same CATH homology
 3LEO A;  4YL1 A;  5BQG A;  4JCZ A;  3DWW A;  3PCV A;  3HKK A;  4AL0 A;  4J7T A;  4WAB A;  4NTB A;  3B29 A;  4YL0 A;  5BQI A;  2H8A A;  4NTF A;  4YL3 A;  2UUH A;  2UUI A;  4NTA A;  4J7Y A;  4YK5 A;  4JC7 A;  5BQH A;  5HV9 A;  2PNO A;  4AL1 A;  5K0I A;  2Q7R A;  4JRZ A;  4BPM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...