2Q7RA

Crystal structure of human flap with an iodinated analog of mk-591
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
140
structure length
140
Chain Sequence
MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of inhibitor-bound human 5-lipoxygenase-activating protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein, lipid transport
molecule keywords Arachidonate 5-lipoxygenase-activating protein
total genus 45
structure length 140
sequence length 140
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 2q7rA00
4YK5A 3HKKA 5K0IA 4WABA 5HV9A 5BQGA 4J7TA 4JCZA 4NTAA 2UUHA 4JC7A 4AL0A 2H8AA 4YL0A 3LEOA 2Q7RA 4NTBA 2PNOA 4NTFA 4JRZA 3B29A 4AL1A 4BPMA 5BQIA 4YL3A 2UUIA 4YL1A 3PCVA 3DWWA 4J7YA 5BQHA
chains in the Genus database with same CATH superfamily
2L9JA 4CS9A 1PV3A 1M2VA 3J06A 4G7OF 3B0UX 3SYNA 4LLCA 2MYSA 3LLIA 2Q3TA 4MVRA 3AG3C 2PX3A 2R7XA 5F5FA 4BJ6C 3B0VC 1K05A 2J45A 3UNGC 2H8AA 3L0IA 4G0HA 1YVIA 2J9UA 2EINC 3IQCA 2NUTA 2J0XA 4AE4A 5KYXA 3C8GA 1LI7A 3TK0A 2XL6A 4A2NB 4U5EE 2KK1A 3KYJA 3ZTMA 2QLAA 1T6IA 1G8XA 1WASA 3I5QA 1F1MA 5KYXB 2LP4A 4DBQA 1J8MF 4YWQA 1K04A 2EPNA 3DE8A 1U0BB 2I15A 3C8ZA 1BBHA 1S05A 1OKKA 2EPMX 2HV6A 2J7PA 1LIHA 4N4WA 4XEFA 2CGEA 2P6VA 3K1IA 3WAQA 1T5OA 4DVYP 5JLIA 5L3QA 5L3VA 4YT8A 4LACB 1VLSA 1ZHTA 4ER9A 4GYTA 3K7DA 2WZGA 1JPJA 1PD0A 1HW2A 1OCCC 4K1OA 2YL1A 5B3IA 2NG1A 2YRFA 3L8JA 2Q7RA 1E86A 3JTLO 3GM3A 2Q9CA 3NYLA 2VC9A 1O87A 1VYIA 1LM3B 3H2UA 3WHNA 3ZSUA 4LDKA 1UG7A 3DM5A 3SXKA 3W2VA 2YL0A 1J8YF 2WZFA 4DXWA 1WTYA 2AWYA 1ZVZA 4CDYA 1JAFA 2UUIA 2YLDA 4W8KA 4E18A 3DM9B 3S0XA 4G7ZF 4BJTA 1D1BA 2QTVA 2KC3A 4JTDB 2L7AA 2LFDA 2O9XA 1VYKA 2NUPA 1LPEA 4NC3A 3T6JA 2L6GA 4CDAA 1MMAA 3NRHA 1Z23A 1RJ9A 3EQLF 5EHHA 1HE9A 2EILC 2IXNA 2HJ3A 4J32B 5COMA 2WZLA 2IXPA 4BEJA 3UMKA 4DRHB 1M2OA 3C63A 1TFKB 3GEEA 3SP1A 1EI7A 3JYYA 3ATPA 5JS5A 2R7VA 3M15A 1GM5A 5T3WA 3B0PA 1ZHXA 1RXQA 4NTFA 3NDBB 3IQTA 1N1CA 3ZDLA 3KH2A 4YJWA 4PACA 4BEMJ 1LVKA 1NU9C 2Q4FA 4CS8A 2KNHA 1C17M 3CEXA 4JJFA 2HZ8A 3QW0A 1OXKA 3E70C 2PBEA 3EZIA 4KC9A 3WG7C 5CI8A 4C3DA 4CS7A 1RMVA 2XM4A 3C18A 3N0TA 3DWWA 4BJ1A 1T9KA 4XLPF 4KNWA 5FCLA 4IAOA 1FMWA 3DMDA 2KQ9A 1VLTA 5F28E 3DAGA 4J30B 4J7TA 2ICWG 2HKVA 2VH3A 2LCHA 2CW0F 4PJMA 3U8PA 1CPQA 2QY9A 3FVYA 4AL0A 3L8IA 2VCCA 3EPVA 4IGGA 5KYWB 3PHF2 1H9TA 5CI9A 1H7IA 4ULVA 1A0BA 1XWJA 5F5HA 1ZHZA 2YHSA 2LQGA 4EIYA 2LD6A 2XSEA 3ABMC 1JRAA 3TQOA 4BJ5C 5DS4A 1QSPA 1NSGB 3ECSA 4I1MA 5B1AC 2LIGA 2BE5F 3E9VA 4PJJA 4YL3A 4DRIB 3KKBA 2XLDA 4QI0A 2J9BA 1E83A 3CZ6A 1E2XA 1TWAA 4U5DE 1Q0DA 4NQFA 1YYXA 4O7GA 4DVZA 5L0GA 3IQ5A 2W4MA 4MVOA 4PJLA 5L0DA 4MVZA 2KSFA 3CSKA 5K0IA 4A4AA 1G4US 3AJMA 3EGDB 4JTAB 4GQHA 4JCZA 2EIMC 4PFOA 4W8PA 1DOWA 4JEBA 4JIOA 4U9EA 3ZG1A 4DRJB 4CIHA 2XL4A 2R25A 2CNWD 2DYSC 4MQ9F 4CIPA 1YYJA 2WVNA 1OXBA 3LESA 4O6MA 4H4KC 4OIOF 1YA9A 3G4ZA 2R03A 3RVYA 3SXZA 4C3EA 1WGWA 5KYNA 2R7TA 3JYHA 1M2VB 2A69F 2ETSA 4Z9HA 3US6A 5KYYA 2R7QA 3O10A 4NCQA 3ZQYA 4WGZA 3U2LA 1RKEA 1Z3IX 2XLOA 4OINF 4E0HA 3UMIA 2OJED 1ZZPA 1ORJA 4OIRF 1S7ZA 4OIPF 4ANJA 3HKKA 3MX3A 4EBBA 2GDCA 1WATA 2XS1A 1A41A 2YL7A 2YLIA 3AGUA 3EG9A 3HNJA 4LDQA 4WABA 3H2VA 3R7CA 1ORSC 5JRAA 3NKDA 4F4BA 2AU5A 1E85A 2CDQA 2CCYA 1K40A 4JCHA 3GODA 4N6CA 3I5PA 4RD9A 4ULWA 1EA8A 1Z6AA 2ZXRA 1PD1A 1TR2A 2H7BA 1ZYRF 2XLWA 3EH1A 1Q0MA 1DOVA 2JX0A 2QNLA 4YL0A 3VM6A 3NMIA 4E17A 2ZXPA 1ZHWA 2V26A 1QQ3A 2KYHA 1NG1A 3JSEO 3F47A 3K33A 3RH3A 2GWWA 2C04A 3W2WA 4E7SA 4IJJA 5BQIA 2P61A 3EG9B 3S84A 5L0HA 2HUJA 4Z9JA 3T6BA 3DI5A 1G4WR 4N6HA 2XL8A 2C03A 4JJGA 4CDVA 4I3MA 3U2MA 3U5SA 4XPYA 2Y3HA 2R7WA 1FR0A 5BQGA 4MVMA 3NMKA 1C02A 3EGDA 2KJGA 2HSQA 2XS8A 2ZPAA 2IM8A 3DXJF 3KMIA 3HNIA 1YA7O 2KGOA 2VCBA 3VF0A 2R7UA 2BC5A 5A6KA 4OIQF 3DJUB 1FTSA 5DQZA 1SYQA 2IYLD 4YT2A 4MW3A 1U89A 3GANA 4MVSA 4DOZA 1A7EA 2I8BA 3LJBA 5DQTA 5JUAA 3Q7GA 2TMVP 3I4UA 2DI3A 2EIJC 3QTHA 4ONSA 5A6BA 3RF3A 2BL2A 1KU2A 2M64A 3AQBA 2P1AA 4XWJA 3X2QC 4EUKB 5KYWA 3VAYA 2ZXWC 2HJMA 1L7CA 1FAPB 3ASNC 3TOMA 1AVOB 3UGOA 2LSEA 3LEVA 5E2QA 5JP7A 1NLXA 1TKNA 4JE9A 3UGPA 4PFPA 1ZU4A 3MFNA 1GQAA 2ZXOA 5A6JA 4I1OB 2X51A 1LE4A 1AUEA 1YARO 2IBFA 3DKAA 4AX2A 5JT4A 1LI5A 3WODF 2L81A 2Q9BA 3Q7LA 4EKWA 1V55C 4XEKA 1UFBA 1OR2A 4QI2A 1HMOA 3EZHA 4CJOA 2J46A 4Q7CA 2YQYA 2XLEA 4P9FA 4EWCA 1HE1A 1C03A 2EPOA 3HNLA 3PCVA 4MW8A 3VRCA 5BQHA 3RFYA 3CQZA 3FDQA 3O6XA 5COFA 3S90A 2G3VA 3GEIA 2NPUA 3NYMA 1WOLA 2W45A 4CS9C 4U5CE 3LNRA 2QUPA 4MS2A 1LS4A 4ZLCA 3C8GD 4WJ0A 5GPGB 2HSBA 4XQ1A 1YDIA 3MBGA 4U5HA 3ZQVA 5L0FA 3EHMA 3TJ5A 1TWCA 1OQCA 4HE8D 1I5NA 3QVYA 3O39A 4IRUA 3JRMO 2FGYA 2WL8A 4D4NA 3GWLA 1M56C 3JSZA 2J0WA 4H54A 2A0UA 1CGNA 4EHPA 3U3FA 3RW0A 4L6RA 4N06A 2EPLX 3S27A 4C7OA 2PF4E 3V5YA 5CIVA 1FMVA 1GGQA 1YZAA 2Q00A 1RJ9B 2FFHA 2J9WA 3M4CA 5L0JA 1Q0KA 1V74B 2CNWA 1FFHA 2OJQA 2XRHA 2OG2A 2A0BA 2NUPB 3K6BA 4FWVA 4O6YA 5T3TA 4IARA 5KYUB 2YKZA 2V3CC 4XEVA 2XM0A 1I4ZA 1SF8A 1JPNA 4XPXA 2YVKA 3V5ZA 4E7ZA 5BUOA 2Y39A 1FNTc 2MWQA 1NFNA 2YLGA 4E0IA 1OCOC 3QZCA 5A69A 5A6BD 2J7PD 2VASA 3U3BA 3SXYA 1D0XA 3KPHA 4JW1A 4M63A 2EIKC 3RVZA 3HNKA 3NYJA 4YT4A 4O79A 3FOOA 4BJ5A 1A7VA 3B9QA 1Z5ZA 3EH2A 1OR3A 1OCZC 5COGA 5AC5A 4U5BE 256BA 3S29A 3AG4C 1KTMA 4YT5A 3QW1A 3EFOB 4GEHA 1M57C 3FAPB 3VYWA 1VB5A 2F22A 2NSGA 3U9MA 3DE9A 2Y3DA 3LUTB 3NKEA 4MVQA 4KI2A 2Y69C 4J7YA 1AEPA 1D0ZA 3EJNA 4JVSA 5FZTA 3W8HA 4IAQA 5EK0A 3G4XA 5DS5A 3FHDA 2G3KA 3FOPA 1VMAA 1OKKD 1QPUA 1T01A 3FMSA 4JURI 3RQEA 3CAXA 4YN0B 3T9OA 3RYLA 3SZRA 1TWHA 2WB7A 2DYRC 4P9TA 4CSAA 4LLEA 3HTKC 4HFKB 2GAQA 1OCRC 1SR2A 2Q9AA 2XLHA 4OD4A 1ZW3A 2XLVA 5DVWA 4U9DA 1ZHYA 4HFFB 2NSFA 4ZLDA 3EGXA 5E3CA 3F46A 3ZIBA 3ABLC 1NZEA 1Q0FA 1YZCA 3L1MA 2WVOA 4MTGA 4U5GA 2ZD9A 3NG1A 5JSLA 3ASOC 4BG0A 3M79A 5DS6A 5A6AA 1NU7D 1QLEC 1ZU5A 4XPWA 2B0JA 3OEOA 3GEHA 4CSAC 2OU6A 3OWTA 2P0NA 2JPUA 4U5FE 3O55A 1TFOB 4JEAA 4K7BA 4CX9A 1BR1A 3ZTZA 3GM2A 3QVZA 4MNDA 3ZVRA 3C8GB 2J8WA 1JMWA 2A6EF 5HV9A 3KYIA 2XXAB 2HFIA 3G50A 3QMKA 4WGYA 1XZQA 5B1BC 3T6GB 5KYUA 2W4BA 1A7DA 2IXMA 5JVEA 2UUHA 1H6GA 2YZSA 3DZAA 1JR8A 4DBRA 2HS5A 4Z9IA 2Y3BA 3C7JA 2XLMA 4CBEA 1IZMA 1RKEB 3TULA 1OW8A 3HLZA 1I4YA 3DJNB 1KNYA 2E87A 1B68A 4KNVA 3W4YA 3ZC4A 4AL1A 4IB4A 1U6HA 1CGME 2LFFA 1R5ID 3RQFA 3K66A 2LK4A 4FESA 2AVKA 3SNHA 1HW1A 3AG1C 2MHRA 1V54C 1M6TA 3GM1A 3LNMB 2L6FA 4G78A 1D1CA 2OQMA 4LDRA 3RQGA 3X1OA 5B3SC 5HSWA 1HMDA 2R7RA 5E33A 1NBBA 1RCPA 4QDLA 1YAUO 3DAFA 1WN0A 1FFTC 3R2PA 3SEOA 1YLMA 2KW3C 3TOLA 5L0IA 4D4XA 3LEOA 1BDJB 3U8VA 1MQVA 2PFDA 4LERA 2PNOA 3RKOF 3ABKC 1BR2A 3GWNA 4AE4B 4FX5A 5DLJA 2CYDA 5TJ5E 3HJCA 1TWGA 1VK5A 2B0HA 2HMZA 2W9YA 3TJ6A 2OEXA 3ITFA 2DGJA 1ZW2A 2DB4A 3AGTA 4Q4ZF 4YL1A 3T4RA 3LAYA 5D92A 3AOUA 1MNDA 1APCA 1CPRA 3LS1A 1CGOA 4FAPB 1O3UA 2ASRA 1D1AA 2OEVA 5AGFA 1MMNA 2GA0A 2G62A 1PCXA 3FAJA 3PDMP 2J9VA 1QZXA 1JOGA 1RKCA 1T6QA 1Y6DA 3AG2C 1E84A 3BEHA 4OD5A 3UMHA 4B6IA 3N24A 2Z15A 3AQCA 4CS8C 2H7OA 5IY5C 2XXAA 2L6HA 1HY5A 1Z7Qc 3K1HA 1H9GA 1YJGA 3M1CB 1VTMP 2D5RB 3UR3C 3NMJA 3H65A 4JRZA 1Y4CA 4MTFA 4PR9A 2PX0A 3B29A 3JRTA 4PJNA 4UDVA 3L34A 3MYFA 3RIPA 1MMGA 3W8IA 2GFHA 1OW7A 2AP3A 2YEVA 3BRJA 1EKYA 1WWPA 3LLKA 4JZAA 2A68F 2YWAA 4AK9A 4I44A 4EBJA 3S28A 2IXOA 4JKVA 1Q0GA 3N2ZB 1LKXA 4HEAJ 1L3PA 1NFOA 3V7OA 1QKRA 4PK4A 2R02A 4CJGA 5KYYB 3A11A 4X0RA 5EGYA 2OCCC 4EBKA 5D91A 1QVXA 3B71A 2A6HF 4RBNA 3S9OA 1V4AA 3JCUQ 3FXHA 2Y3GA 2IOQA 4RDAA 3C62A 1D0YA 2AWCA 3OA1A 3PMRA 2OOCA 1SMYF 1LS1A 4MVUA 2P7VA 2HMQA 5AC4A 3Q6MA 2VB6A 2A1DD 1EQ1A 2D4UA 3KL4A 3Q6NA 5L0CA 2EPKX 2R9RB 2RSEB 2R05A 2QE9A 3JZ0A 3V5XA 1BZ4A 3JT1A 3U0CA 4BPMA 3IHUA 4P6IC 1MMDA 4YK5A 3K1IC 3LS0A 1ORYA 4DJ9A 2FAPB 3MYIA 1ST6A 1W2WA 2RD9A 4O6NA 2R7SA 1Z63A 3EGXB 2PP4A 4NTAA 5T1DB 3M4BA 2M4EA 1VOMA 4XTKA 3A9CA 4JC7A 4JTCB 4KBLA 4NY3A 1BR4A 4C7OB 5E3AA 2OKUA 4G7HF 3ZWIA 4C3BA 4MTOA 2JD3A 3DD7A 3IPMO 4NTBA 3IEEA 1O5HA 4Q5SF 1LE2A 4K0DA 4XLNF 2NUTB 3TD7A 3U9JA 3MLGA 1SZIA 2R7OA 2YL3A 3IQ6A 1G5ZA 1MNEA 1R4TA 1IW7F 2WVQA 4IWBA 4R32A 1XZPA 3EHNA 3SXMA 1T6UA 2X0CA 1OW6A 2VCAA 4BJ6A 2H7VC 2HV7A 3POVA 1TQGA 1GS9A 3GORA 3EFOA
chains in the Genus database with same CATH topology
4YK5A 3HKKA 5K0IA 4WABA 5HV9A 5BQGA 4J7TA 4JCZA 4NTAA 2UUHA 4JC7A 4AL0A 2H8AA 4YL0A 3LEOA 2Q7RA 4NTBA 2PNOA 4NTFA 4JRZA 3B29A 4AL1A 4BPMA 5BQIA 4YL3A 2UUIA 4YL1A 3PCVA 3DWWA 4J7YA 5BQHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YK5 A;  3HKK A;  5K0I A;  4WAB A;  5HV9 A;  5BQG A;  4J7T A;  4JCZ A;  4NTA A;  2UUH A;  4JC7 A;  4AL0 A;  2H8A A;  4YL0 A;  3LEO A;  2Q7R A;  4NTB A;  2PNO A;  4NTF A;  4JRZ A;  3B29 A;  4AL1 A;  4BPM A;  5BQI A;  4YL3 A;  2UUI A;  4YL1 A;  3PCV A;  3DWW A;  4J7Y A;  5BQH A; 
#chains in the Genus database with same CATH topology
 2L9J A;  4CS9 A;  1PV3 A;  1M2V A;  3J06 A;  4G7O F;  3B0U X;  3SYN A;  4LLC A;  2MYS A;  3LLI A;  2Q3T A;  4MVR A;  3AG3 C;  2PX3 A;  2R7X A;  5F5F A;  4BJ6 C;  3B0V C;  1K05 A;  2J45 A;  3UNG C;  2H8A A;  3L0I A;  4G0H A;  1YVI A;  2J9U A;  2EIN C;  3IQC A;  2NUT A;  2J0X A;  4AE4 A;  5KYX A;  3C8G A;  1LI7 A;  3TK0 A;  2XL6 A;  4A2N B;  4U5E E;  2KK1 A;  3KYJ A;  3ZTM A;  2QLA A;  1T6I A;  1G8X A;  1WAS A;  3I5Q A;  1F1M A;  5KYX B;  2LP4 A;  4DBQ A;  1J8M F;  4YWQ A;  1K04 A;  2EPN A;  3DE8 A;  1U0B B;  2I15 A;  3C8Z A;  1BBH A;  1S05 A;  1OKK A;  2EPM X;  2HV6 A;  2J7P A;  1LIH A;  4N4W A;  4XEF A;  2CGE A;  2P6V A;  3K1I A;  3WAQ A;  1T5O A;  4DVY P;  5JLI A;  5L3Q A;  5L3V A;  4YT8 A;  4LAC B;  1VLS A;  1ZHT A;  4ER9 A;  4GYT A;  3K7D A;  2WZG A;  1JPJ A;  1PD0 A;  1HW2 A;  1OCC C;  4K1O A;  2YL1 A;  5B3I A;  2NG1 A;  2YRF A;  3L8J A;  2Q7R A;  1E86 A;  3JTL O;  3GM3 A;  2Q9C A;  3NYL A;  2VC9 A;  1O87 A;  1VYI A;  1LM3 B;  3H2U A;  3WHN A;  3ZSU A;  4LDK A;  1UG7 A;  3DM5 A;  3SXK A;  3W2V A;  2YL0 A;  1J8Y F;  2WZF A;  4DXW A;  1WTY A;  2AWY A;  1ZVZ A;  4CDY A;  1JAF A;  2UUI A;  2YLD A;  4W8K A;  4E18 A;  3DM9 B;  3S0X A;  4G7Z F;  4BJT A;  1D1B A;  2QTV A;  2KC3 A;  4JTD B;  2L7A A;  2LFD A;  2O9X A;  1VYK A;  2NUP A;  1LPE A;  4NC3 A;  3T6J A;  2L6G A;  4CDA A;  1MMA A;  3NRH A;  1Z23 A;  1RJ9 A;  3EQL F;  5EHH A;  1HE9 A;  2EIL C;  2IXN A;  2HJ3 A;  4J32 B;  5COM A;  2WZL A;  2IXP A;  4BEJ A;  3UMK A;  4DRH B;  1M2O A;  3C63 A;  1TFK B;  3GEE A;  3SP1 A;  1EI7 A;  3JYY A;  3ATP A;  5JS5 A;  2R7V A;  3M15 A;  1GM5 A;  5T3W A;  3B0P A;  1ZHX A;  1RXQ A;  4NTF A;  3NDB B;  3IQT A;  1N1C A;  3ZDL A;  3KH2 A;  4YJW A;  4PAC A;  4BEM J;  1LVK A;  1NU9 C;  2Q4F A;  4CS8 A;  2KNH A;  1C17 M;  3CEX A;  4JJF A;  2HZ8 A;  3QW0 A;  1OXK A;  3E70 C;  2PBE A;  3EZI A;  4KC9 A;  3WG7 C;  5CI8 A;  4C3D A;  4CS7 A;  1RMV A;  2XM4 A;  3C18 A;  3N0T A;  3DWW A;  4BJ1 A;  1T9K A;  4XLP F;  4KNW A;  5FCL A;  4IAO A;  1FMW A;  3DMD A;  2KQ9 A;  1VLT A;  5F28 E;  3DAG A;  4J30 B;  4J7T A;  2ICW G;  2HKV A;  2VH3 A;  2LCH A;  2CW0 F;  4PJM A;  3U8P A;  1CPQ A;  2QY9 A;  3FVY A;  4AL0 A;  3L8I A;  2VCC A;  3EPV A;  4IGG A;  5KYW B;  3PHF 2;  1H9T A;  5CI9 A;  1H7I A;  4ULV A;  1A0B A;  1XWJ A;  5F5H A;  1ZHZ A;  2YHS A;  2LQG A;  4EIY A;  2LD6 A;  2XSE A;  3ABM C;  1JRA A;  3TQO A;  4BJ5 C;  5DS4 A;  1QSP A;  1NSG B;  3ECS A;  4I1M A;  5B1A C;  2LIG A;  2BE5 F;  3E9V A;  4PJJ A;  4YL3 A;  4DRI B;  3KKB A;  2XLD A;  4QI0 A;  2J9B A;  1E83 A;  3CZ6 A;  1E2X A;  1TWA A;  4U5D E;  1Q0D A;  4NQF A;  1YYX A;  4O7G A;  4DVZ A;  5L0G A;  3IQ5 A;  2W4M A;  4MVO A;  4PJL A;  5L0D A;  4MVZ A;  2KSF A;  3CSK A;  5K0I A;  4A4A A;  1G4U S;  3AJM A;  3EGD B;  4JTA B;  4GQH A;  4JCZ A;  2EIM C;  4PFO A;  4W8P A;  1DOW A;  4JEB A;  4JIO A;  4U9E A;  3ZG1 A;  4DRJ B;  4CIH A;  2XL4 A;  2R25 A;  2CNW D;  2DYS C;  4MQ9 F;  4CIP A;  1YYJ A;  2WVN A;  1OXB A;  3LES A;  4O6M A;  4H4K C;  4OIO F;  1YA9 A;  3G4Z A;  2R03 A;  3RVY A;  3SXZ A;  4C3E A;  1WGW A;  5KYN A;  2R7T A;  3JYH A;  1M2V B;  2A69 F;  2ETS A;  4Z9H A;  3US6 A;  5KYY A;  2R7Q A;  3O10 A;  4NCQ A;  3ZQY A;  4WGZ A;  3U2L A;  1RKE A;  1Z3I X;  2XLO A;  4OIN F;  4E0H A;  3UMI A;  2OJE D;  1ZZP A;  1ORJ A;  4OIR F;  1S7Z A;  4OIP F;  4ANJ A;  3HKK A;  3MX3 A;  4EBB A;  2GDC A;  1WAT A;  2XS1 A;  1A41 A;  2YL7 A;  2YLI A;  3AGU A;  3EG9 A;  3HNJ A;  4LDQ A;  4WAB A;  3H2V A;  3R7C A;  1ORS C;  5JRA A;  3NKD A;  4F4B A;  2AU5 A;  1E85 A;  2CDQ A;  2CCY A;  1K40 A;  4JCH A;  3GOD A;  4N6C A;  3I5P A;  4RD9 A;  4ULW A;  1EA8 A;  1Z6A A;  2ZXR A;  1PD1 A;  1TR2 A;  2H7B A;  1ZYR F;  2XLW A;  3EH1 A;  1Q0M A;  1DOV A;  2JX0 A;  2QNL A;  4YL0 A;  3VM6 A;  3NMI A;  4E17 A;  2ZXP A;  1ZHW A;  2V26 A;  1QQ3 A;  2KYH A;  1NG1 A;  3JSE O;  3F47 A;  3K33 A;  3RH3 A;  2GWW A;  2C04 A;  3W2W A;  4E7S A;  4IJJ A;  5BQI A;  2P61 A;  3EG9 B;  3S84 A;  5L0H A;  2HUJ A;  4Z9J A;  3T6B A;  3DI5 A;  1G4W R;  4N6H A;  2XL8 A;  2C03 A;  4JJG A;  4CDV A;  4I3M A;  3U2M A;  3U5S A;  4XPY A;  2Y3H A;  2R7W A;  1FR0 A;  5BQG A;  4MVM A;  3NMK A;  1C02 A;  3EGD A;  2KJG A;  2HSQ A;  2XS8 A;  2ZPA A;  2IM8 A;  3DXJ F;  3KMI A;  3HNI A;  1YA7 O;  2KGO A;  2VCB A;  3VF0 A;  2R7U A;  2BC5 A;  5A6K A;  4OIQ F;  3DJU B;  1FTS A;  5DQZ A;  1SYQ A;  2IYL D;  4YT2 A;  4MW3 A;  1U89 A;  3GAN A;  4MVS A;  4DOZ A;  1A7E A;  2I8B A;  3LJB A;  5DQT A;  5JUA A;  3Q7G A;  2TMV P;  3I4U A;  2DI3 A;  2EIJ C;  3QTH A;  4ONS A;  5A6B A;  3RF3 A;  2BL2 A;  1KU2 A;  2M64 A;  3AQB A;  2P1A A;  4XWJ A;  3X2Q C;  4EUK B;  5KYW A;  3VAY A;  2ZXW C;  2HJM A;  1L7C A;  1FAP B;  3ASN C;  3TOM A;  1AVO B;  3UGO A;  2LSE A;  3LEV A;  5E2Q A;  5JP7 A;  1NLX A;  1TKN A;  4JE9 A;  3UGP A;  4PFP A;  1ZU4 A;  3MFN A;  1GQA A;  2ZXO A;  5A6J A;  4I1O B;  2X51 A;  1LE4 A;  1AUE A;  1YAR O;  2IBF A;  3DKA A;  4AX2 A;  5JT4 A;  1LI5 A;  3WOD F;  2L81 A;  2Q9B A;  3Q7L A;  4EKW A;  1V55 C;  4XEK A;  1UFB A;  1OR2 A;  4QI2 A;  1HMO A;  3EZH A;  4CJO A;  2J46 A;  4Q7C A;  2YQY A;  2XLE A;  4P9F A;  4EWC A;  1HE1 A;  1C03 A;  2EPO A;  3HNL A;  3PCV A;  4MW8 A;  3VRC A;  5BQH A;  3RFY A;  3CQZ A;  3FDQ A;  3O6X A;  5COF A;  3S90 A;  2G3V A;  3GEI A;  2NPU A;  3NYM A;  1WOL A;  2W45 A;  4CS9 C;  4U5C E;  3LNR A;  2QUP A;  4MS2 A;  1LS4 A;  4ZLC A;  3C8G D;  4WJ0 A;  5GPG B;  2HSB A;  4XQ1 A;  1YDI A;  3MBG A;  4U5H A;  3ZQV A;  5L0F A;  3EHM A;  3TJ5 A;  1TWC A;  1OQC A;  4HE8 D;  1I5N A;  3QVY A;  3O39 A;  4IRU A;  3JRM O;  2FGY A;  2WL8 A;  4D4N A;  3GWL A;  1M56 C;  3JSZ A;  2J0W A;  4H54 A;  2A0U A;  1CGN A;  4EHP A;  3U3F A;  3RW0 A;  4L6R A;  4N06 A;  2EPL X;  3S27 A;  4C7O A;  2PF4 E;  3V5Y A;  5CIV A;  1FMV A;  1GGQ A;  1YZA A;  2Q00 A;  1RJ9 B;  2FFH A;  2J9W A;  3M4C A;  5L0J A;  1Q0K A;  1V74 B;  2CNW A;  1FFH A;  2OJQ A;  2XRH A;  2OG2 A;  2A0B A;  2NUP B;  3K6B A;  4FWV A;  4O6Y A;  5T3T A;  4IAR A;  5KYU B;  2YKZ A;  2V3C C;  4XEV A;  2XM0 A;  1I4Z A;  1SF8 A;  1JPN A;  4XPX A;  2YVK A;  3V5Z A;  4E7Z A;  5BUO A;  2Y39 A;  1FNT c;  2MWQ A;  1NFN A;  2YLG A;  4E0I A;  1OCO C;  3QZC A;  5A69 A;  5A6B D;  2J7P D;  2VAS A;  3U3B A;  3SXY A;  1D0X A;  3KPH A;  4JW1 A;  4M63 A;  2EIK C;  3RVZ A;  3HNK A;  3NYJ A;  4YT4 A;  4O79 A;  3FOO A;  4BJ5 A;  1A7V A;  3B9Q A;  1Z5Z A;  3EH2 A;  1OR3 A;  1OCZ C;  5COG A;  5AC5 A;  4U5B E;  256B A;  3S29 A;  3AG4 C;  1KTM A;  4YT5 A;  3QW1 A;  3EFO B;  4GEH A;  1M57 C;  3FAP B;  3VYW A;  1VB5 A;  2F22 A;  2NSG A;  3U9M A;  3DE9 A;  2Y3D A;  3LUT B;  3NKE A;  4MVQ A;  4KI2 A;  2Y69 C;  4J7Y A;  1AEP A;  1D0Z A;  3EJN A;  4JVS A;  5FZT A;  3W8H A;  4IAQ A;  5EK0 A;  3G4X A;  5DS5 A;  3FHD A;  2G3K A;  3FOP A;  1VMA A;  1OKK D;  1QPU A;  1T01 A;  3FMS A;  4JUR I;  3RQE A;  3CAX A;  4YN0 B;  3T9O A;  3RYL A;  3SZR A;  1TWH A;  2WB7 A;  2DYR C;  4P9T A;  4CSA A;  4LLE A;  3HTK C;  4HFK B;  2GAQ A;  1OCR C;  1SR2 A;  2Q9A A;  2XLH A;  4OD4 A;  1ZW3 A;  2XLV A;  5DVW A;  4U9D A;  1ZHY A;  4HFF B;  2NSF A;  4ZLD A;  3EGX A;  5E3C A;  3F46 A;  3ZIB A;  3ABL C;  1NZE A;  1Q0F A;  1YZC A;  3L1M A;  2WVO A;  4MTG A;  4U5G A;  2ZD9 A;  3NG1 A;  5JSL A;  3ASO C;  4BG0 A;  3M79 A;  5DS6 A;  5A6A A;  1NU7 D;  1QLE C;  1ZU5 A;  4XPW A;  2B0J A;  3OEO A;  3GEH A;  4CSA C;  2OU6 A;  3OWT A;  2P0N A;  2JPU A;  4U5F E;  3O55 A;  1TFO B;  4JEA A;  4K7B A;  4CX9 A;  1BR1 A;  3ZTZ A;  3GM2 A;  3QVZ A;  4MND A;  3ZVR A;  3C8G B;  2J8W A;  1JMW A;  2A6E F;  5HV9 A;  3KYI A;  2XXA B;  2HFI A;  3G50 A;  3QMK A;  4WGY A;  1XZQ A;  5B1B C;  3T6G B;  5KYU A;  2W4B A;  1A7D A;  2IXM A;  5JVE A;  2UUH A;  1H6G A;  2YZS A;  3DZA A;  1JR8 A;  4DBR A;  2HS5 A;  4Z9I A;  2Y3B A;  3C7J A;  2XLM A;  4CBE A;  1IZM A;  1RKE B;  3TUL A;  1OW8 A;  3HLZ A;  1I4Y A;  3DJN B;  1KNY A;  2E87 A;  1B68 A;  4KNV A;  3W4Y A;  3ZC4 A;  4AL1 A;  4IB4 A;  1U6H A;  1CGM E;  2LFF A;  1R5I D;  3RQF A;  3K66 A;  2LK4 A;  4FES A;  2AVK A;  3SNH A;  1HW1 A;  3AG1 C;  2MHR A;  1V54 C;  1M6T A;  3GM1 A;  3LNM B;  2L6F A;  4G78 A;  1D1C A;  2OQM A;  4LDR A;  3RQG A;  3X1O A;  5B3S C;  5HSW A;  1HMD A;  2R7R A;  5E33 A;  1NBB A;  1RCP A;  4QDL A;  1YAU O;  3DAF A;  1WN0 A;  1FFT C;  3R2P A;  3SEO A;  1YLM A;  2KW3 C;  3TOL A;  5L0I A;  4D4X A;  3LEO A;  1BDJ B;  3U8V A;  1MQV A;  2PFD A;  4LER A;  2PNO A;  3RKO F;  3ABK C;  1BR2 A;  3GWN A;  4AE4 B;  4FX5 A;  5DLJ A;  2CYD A;  5TJ5 E;  3HJC A;  1TWG A;  1VK5 A;  2B0H A;  2HMZ A;  2W9Y A;  3TJ6 A;  2OEX A;  3ITF A;  2DGJ A;  1ZW2 A;  2DB4 A;  3AGT A;  4Q4Z F;  4YL1 A;  3T4R A;  3LAY A;  5D92 A;  3AOU A;  1MND A;  1APC A;  1CPR A;  3LS1 A;  1CGO A;  4FAP B;  1O3U A;  2ASR A;  1D1A A;  2OEV A;  5AGF A;  1MMN A;  2GA0 A;  2G62 A;  1PCX A;  3FAJ A;  3PDM P;  2J9V A;  1QZX A;  1JOG A;  1RKC A;  1T6Q A;  1Y6D A;  3AG2 C;  1E84 A;  3BEH A;  4OD5 A;  3UMH A;  4B6I A;  3N24 A;  2Z15 A;  3AQC A;  4CS8 C;  2H7O A;  5IY5 C;  2XXA A;  2L6H A;  1HY5 A;  1Z7Q c;  3K1H A;  1H9G A;  1YJG A;  3M1C B;  1VTM P;  2D5R B;  3UR3 C;  3NMJ A;  3H65 A;  4JRZ A;  1Y4C A;  4MTF A;  4PR9 A;  2PX0 A;  3B29 A;  3JRT A;  4PJN A;  4UDV A;  3L34 A;  3MYF A;  3RIP A;  1MMG A;  3W8I A;  2GFH A;  1OW7 A;  2AP3 A;  2YEV A;  3BRJ A;  1EKY A;  1WWP A;  3LLK A;  4JZA A;  2A68 F;  2YWA A;  4AK9 A;  4I44 A;  4EBJ A;  3S28 A;  2IXO A;  4JKV A;  1Q0G A;  3N2Z B;  1LKX A;  4HEA J;  1L3P A;  1NFO A;  3V7O A;  1QKR A;  4PK4 A;  2R02 A;  4CJG A;  5KYY B;  3A11 A;  4X0R A;  5EGY A;  2OCC C;  4EBK A;  5D91 A;  1QVX A;  3B71 A;  2A6H F;  4RBN A;  3S9O A;  1V4A A;  3JCU Q;  3FXH A;  2Y3G A;  2IOQ A;  4RDA A;  3C62 A;  1D0Y A;  2AWC A;  3OA1 A;  3PMR A;  2OOC A;  1SMY F;  1LS1 A;  4MVU A;  2P7V A;  2HMQ A;  5AC4 A;  3Q6M A;  2VB6 A;  2A1D D;  1EQ1 A;  2D4U A;  3KL4 A;  3Q6N A;  5L0C A;  2EPK X;  2R9R B;  2RSE B;  2R05 A;  2QE9 A;  3JZ0 A;  3V5X A;  1BZ4 A;  3JT1 A;  3U0C A;  4BPM A;  3IHU A;  4P6I C;  1MMD A;  4YK5 A;  3K1I C;  3LS0 A;  1ORY A;  4DJ9 A;  2FAP B;  3MYI A;  1ST6 A;  1W2W A;  2RD9 A;  4O6N A;  2R7S A;  1Z63 A;  3EGX B;  2PP4 A;  4NTA A;  5T1D B;  3M4B A;  2M4E A;  1VOM A;  4XTK A;  3A9C A;  4JC7 A;  4JTC B;  4KBL A;  4NY3 A;  1BR4 A;  4C7O B;  5E3A A;  2OKU A;  4G7H F;  3ZWI A;  4C3B A;  4MTO A;  2JD3 A;  3DD7 A;  3IPM O;  4NTB A;  3IEE A;  1O5H A;  4Q5S F;  1LE2 A;  4K0D A;  4XLN F;  2NUT B;  3TD7 A;  3U9J A;  3MLG A;  1SZI A;  2R7O A;  2YL3 A;  3IQ6 A;  1G5Z A;  1MNE A;  1R4T A;  1IW7 F;  2WVQ A;  4IWB A;  4R32 A;  1XZP A;  3EHN A;  3SXM A;  1T6U A;  2X0C A;  1OW6 A;  2VCA A;  4BJ6 A;  2H7V C;  2HV7 A;  3POV A;  1TQG A;  1GS9 A;  3GOR A;  3EFO A; 
#chains in the Genus database with same CATH homology
 4YK5 A;  3HKK A;  5K0I A;  4WAB A;  5HV9 A;  5BQG A;  4J7T A;  4JCZ A;  4NTA A;  2UUH A;  4JC7 A;  4AL0 A;  2H8A A;  4YL0 A;  3LEO A;  2Q7R A;  4NTB A;  2PNO A;  4NTF A;  4JRZ A;  3B29 A;  4AL1 A;  4BPM A;  5BQI A;  4YL3 A;  2UUI A;  4YL1 A;  3PCV A;  3DWW A;  4J7Y A;  5BQH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...