1Q0FA

Crystal structure of ni-containing superoxide dismutase with ni-ligation corresponding to the state after partial x-ray-induced reduction
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
117
structure length
117
Chain Sequence
HCDLPCGVYDPAQARIEAESVKAIQEKMAANDDLHFQIRATVIKEQRAELAKHHLDVLWSDYFKPPHFESYPELHTLVNEAVKALSAAKASTDPATGQKALDYIAQIDKIFWETKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Ni]
publication title Crystal structure of nickel-containing superoxide dismutase reveals another type of active site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 51
structure length 117
sequence length 117
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2003-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.400 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nickel-containing superoxide dismutase 1q0fA00
3G4XA 1Q0MA 1Q0FA 1Q0GA 1T6IA 1Q0DA 1T6UA 3G50A 1Q0KA 4NCQA 1T6QA 3G4ZA
chains in the Genus database with same CATH superfamily
3A11A 3KYIA 2GFHA 2Z15A 1NLXA 3DZAA 4MVSA 1NSGB 3AG3C 3H2UA 3L8IA 3T6GB 5KYWB 1LVKA 1GM5A 3AQCA 2XL4A 1KU2A 3GWLA 3IPMO 3H2VA 4U9EA 4IRUA 1Q0DA 3SXYA 3MLGA 4JJFA 1TKNA 3HNJA 3WAQA 3C62A 4IARA 4U5GA 4PFPA 2QLAA 1NBBA 2UUIA 4G78A 1C02A 3QZCA 3WODF 4BPMA 4Q5SF 1FR0A 3PHF2 4E0IA 4XPXA 1H9TA 3JZ0A 3CSKA 2R7SA 1AVOB 2QE9A 4BEMJ 4YJWA 4JTCB 3HKKA 2L6GA 3AG1C 3QTHA 3GM2A 1OCRC 4WGYA 1Z63A 5L0JA 2M64A 2NG1A 2OEVA 3LS0A 2I15A 2X0CA 4DOZA 3W8IA 4U5BE 1IW7F 1EA8A 1ORJA 2YL1A 2KNHA 2LSEA 3PDMP 5L0DA 4JEBA 1OCOC 1T6UA 2NUPA 1VYKA 3GWNA 4MQ9F 3LEVA 4O7GA 1SYQA 5F28E 2KJGA 1G5ZA 1Q0MA 5DQTA 2R05A 1WWPA 2H7BA 2A0BA 2Y39A 2QY9A 3K7DA 3VF0A 3LNRA 3UMHA 1DOVA 1WOLA 3EG9B 4BJ1A 1ST6A 3GEHA 2J0WA 1QPUA 4PJLA 4YL0A 3DKAA 4CS8C 5KYYB 2WZFA 1G4US 2GDCA 2XXAB 2VB6A 4IJJA 3B71A 1TWCA 4O6MA 2A6EF 4EWCA 4OIPF 5IY5C 3GANA 3EFOA 3KH2A 2EINC 1RCPA 1MNEA 4OINF 5E3AA 2WL8A 2BL2A 2OKUA 2RD9A 3E9VA 3FHDA 3GODA 4NTAA 3FOOA 3R7CA 4PJNA 3HTKC 4YN0B 4Q7CA 5KYUB 3CQZA 4XPYA 1QZXA 3VRCA 5JLIA 3IHUA 3TJ5A 3SXMA 1YDIA 3UMKA 2EILC 1LS1A 1QKRA 3OEOA 3OWTA 1M2VB 2R03A 3ZC4A 4EBJA 4YT2A 2EPNA 3ITFA 1CPQA 5A6JA 2VCCA 3EHMA 2YQYA 1FFTC 1T6IA 3RF3A 3UGOA 3B0UX 1E85A 4O6NA 4K1OA 3TK0A 1TQGA 2AVKA 2E87A 2W45A 4AE4A 3B29A 2ZXPA 3PCVA 4Z9HA 3VM6A 3W2VA 2WVQA 3S84A 1JPNA 1FMWA 2A0UA 1H7IA 4N6HA 1T5OA 2FGYA 3NMKA 2W4BA 3RKOF 5K0IA 1JOGA 1D0ZA 1Z5ZA 1RKEA 1Z6AA 2CW0F 1Q0GA 4IGGA 4MNDA 2NUTA 4EBBA 5L0FA 2J9WA 4OIQF 5FCLA 2XS8A 1E2XA 2DI3A 5F5FA 2LQGA 2YRFA 4JC7A 1ZU5A 2EPLX 4XEKA 3M4CA 3M79A 2HS5A 5FZTA 3ZG1A 5AC5A 2R7XA 2WVNA 3EGXB 2R7OA 1V4AA 1ZVZA 4Z9IA 1TFOB 2VC9A 3JYYA 3B0VC 1ORSC 3U8PA 2B0JA 2XL8A 5JRAA 4QDLA 2J46A 1WGWA 4CBEA 3GM3A 1YZCA 4E7SA 1WATA 2YEVA 4ONSA 3DI5A 4OIOF 4U5EE 4I3MA 1H6GA 1OW6A 2L7AA 2O9XA 2EPOA 2PP4A 3V7OA 3ZQYA 3ZSUA 5L0CA 2PX0A 1FMVA 5CIVA 1SMYF 1WN0A 1YAUO 3JYHA 3CZ6A 4CJGA 2R9RB 3RVZA 2BC5A 4LDKA 2J7PD 2ETSA 2GA0A 5GPGB 3RQFA 3T9OA 2ZXWC 4HFFB 4C7OA 3ZTMA 4ANJA 3EZHA 3S9OA 4JW1A 1ZW3A 1BZ4A 2FFHA 3FAPB 4J32B 3C8GA 1XWJA 1G8XA 1LKXA 4I44A 4G7ZF 1BDJB 2XL6A 3ASOC 4G0HA 4JVSA 4KNWA 4FX5A 2Y3GA 3RVYA 4H4KC 4YT8A 3HNKA 1YVIA 2LD6A 3RQGA 1AEPA 4WABA 3IQ6A 1PCXA 4G7OF 1M57C 1S05A 3SXKA 4ULVA 3JT1A 4CDYA 3S27A 1FNTc 1RXQA 3NMIA 3K66A 3KPHA 2OCCC 1K40A 3T4RA 3W4YA 2EPKX 1SF8A 3AOUA 4JIOA 1NG1A 5AC4A 3T6BA 5DQZA 2XLHA 2LFDA 3NKEA 2R7QA 2HMZA 2J7PA 5BUOA 2XM4A 4BJ6C 2F22A 5T3TA 5DS4A 4IAOA 4ZLDA 4G7HF 4ZLCA 3MYFA 3EH1A 2H7VC 4IAQA 2AU5A 5L0HA 3EGDA 4N6CA 2NSGA 1F1MA 4MVZA 1B68A 3QVZA 4JURI 3SYNA 2C04A 2J8WA 3WHNA 4CX9A 2R7UA 1JPJA 1LI7A 2P7VA 2YKZA 4PACA 1CGNA 2KSFA 2G62A 1V55C 2A69F 3SXZA 3FXHA 4L6RA 1G4WR 1I4YA 4U5CE 4YWQA 4NTFA 1FFHA 2IBFA 2Q4FA 3ATPA 4RDAA 1OQCA 2HSQA 3US6A 2QUPA 4C3EA 3NG1A 2XLEA 3Q6MA 2HV7A 1QQ3A 2IXNA 4OD4A 1TWAA 4BEJA 4CS8A 2QNLA 1ZW2A 2L6FA 2CGEA 1YYXA 3DD7A 3L0IA 3LJBA 4XTKA 2XLOA 2JX0A 1XZPA 2P6VA 1VYIA 4YL3A 3U3FA 5CI8A 1AUEA 1TWHA 3KL4A 4E18A 1U6HA 2DGJA 4JE9A 3G50A 3SEOA 3M1CB 1Z3IX 3FDQA 4DRIB 1KNYA 3JTLO 1SR2A 2AWYA 2YL0A 3CAXA 1OW8A 1QSPA 3BEHA 3T6JA 4JZAA 1YYJA 3O39A 4CS7A 4D4NA 5B3SC 4A2NB 5T3WA 4CS9C 2OJQA 3U2MA 2R7TA 2PNOA 1XZQA 4WGZA 2EIKC 4EBKA 4CSAC 2R7VA 3LUTB 2EIMC 1QLEC 1OW7A 2PFDA 3GEEA 4KNVA 5F5HA 4EIYA 2KK1A 1HW2A 2XRHA 4RD9A 1LI5A 1MMGA 3LEOA 2OEXA 4JTDB 2HUJA 3QW0A 2OQMA 3FOPA 3ASNC 3RYLA 4DXWA 3AG4C 3EG9A 3OA1A 4P9FA 5KYYA 2XLDA 1CPRA 2XS1A 3K1IC 4XLPF 3TULA 2ZXRA 1PD0A 3JRMO 4DVYP 3O10A 1M56C 2D4UA 1OCZC 1YLMA 2OU6A 3EHNA 3K6BA 4PR9A 3VYWA 4BG0A 1RKEB 3MYIA 5A6BD 4JEAA 2Q00A 1HMOA 5HSWA 2W9YA 1VLTA 4PFOA 2DB4A 3NRHA 1EKYA 3C8GD 1DOWA 1R5ID 4P6IC 4W8KA 2J9UA 4XEFA 2YVKA 3FVYA 2ZPAA 4XPWA 3RW0A 3AG2C 2KW3C 3VAYA 4JJGA 5BQIA 4LACB 2G3KA 4FAPB 1S7ZA 5KYUA 2LFFA 1E86A 3TD7A 1E84A 1TWGA 1ORYA 2P0NA 1NU7D 1ZYRF 2W4MA 3QW1A 2LIGA 4CDAA 5L3VA 1J8MF 2Y3HA 5A6KA 1L3PA 3LS1A 3N24A 1OR2A 3M4BA 3DXJF 1C17M 1VMAA 4I1MA 2J9BA 2P1AA 4JCZA 3ABLC 5E33A 1ZHZA 5T1DB 1L7CA 5B1AC 1WASA 1YZAA 2R25A 4MVOA 4XQ1A 4K0DA 5AGFA 2IYLD 4MTGA 2KQ9A 2NSFA 3NKDA 1KTMA 2XLWA 4QI2A 2CNWA 5KYXB 1ZU4A 4A4AA 4FESA 2DYSC 2IXOA 3LESA 3NYLA 5A6BA 5HV9A 1GQAA 1D1BA 3HNIA 3DMDA 3EZIA 4DRJB 2HSBA 3DAFA 3IQCA 3GEIA 3POVA 1D0XA 3L34A 4O79A 2H8AA 4U5FE 4EKWA 3EGXA 2MWQA 4K7BA 3ZQVA 4MS2A 5DS6A 3NDBB 4KBLA 3RQEA 4JRZA 1LM3B 3ZVRA 4MVRA 3DJUB 2BE5F 3B0PA 4IB4A 3I5PA 3NYJA 2VCBA 4GEHA 4CDVA 3AJMA 1Q0FA 2L9JA 2VH3A 3EH2A 3ZDLA 2M4EA 3X1OA 1O87A 2KC3A 3IQTA 5JT4A 2LK4A 3L8JA 4BJ6A 3G4XA 1LIHA 4DRHB 1ZHYA 1R4TA 3V5ZA 2Y3BA 4DJ9A 1E83A 4PK4A 2PX3A 3EPVA 4LDQA 3N0TA 1I5NA 3F46A 3I5QA 2IOQA 4YK5A 5A6AA 4PJJA 2CCYA 3NYMA 2ZD9A 3E70C 2Q3TA 3X2QC 5JVEA 2ZXOA 2WZGA 3DE8A 1VB5A 2WVOA 1Z7Qc 1RJ9A 3EJNA 2HMQA 5COMA 1RKCA 2ICWG 3U8VA 5COGA 3ZWIA 5DS5A 1BR4A 1LE2A 4GQHA 4IWBA 3K1HA 4KC9A 3U9JA 3ZIBA 4BJ5C 1HW1A 3ECSA 3SNHA 2R02A 2YZSA 4QI0A 1MMNA 2J45A 1NFNA 3Q7GA 2KGOA 1NZEA 256BA 3N2ZB 4HFKB 4M63A 4E17A 1NU9C 1YA7O 5KYWA 3B9QA 2GWWA 2D5RB 2NUPB 3O55A 1LS4A 1EI7A 4Z9JA 1A41A 1VLSA 4D4XA 3O6XA 1HE1A 3I4UA 3U9MA 3ABKC 4CIPA 3QMKA 1U89A 2P61A 3LLKA 3JCUQ 1YJGA 2WB7A 2I8BA 3S90A 1RMVA 5D91A 2TMVP 4H54A 4O6YA 2OJED 2XLVA 1VOMA 4GYTA 3KMIA 1GGQA 4CIHA 5L0IA 5A69A 3TOMA 1CGME 2JPUA 3K33A 1OXKA 2G3VA 2DYRC 4LERA 1LPEA 3Q7LA 3TQOA 4CS9A 3G4ZA 1HMDA 3Q6NA 5TJ5E 3RIPA 2VCAA 3UMIA 2CYDA 1ZZPA 3MBGA 3QVYA 4KI2A 1IZMA 4B6IA 4AK9A 2PBEA 3EFOB 5JSLA 4CSAA 4X0RA 4MW3A 5L0GA 1PV3A 3W8HA 3J06A 4ULWA 1T01A 1EQ1A 1WTYA 4DBQA 2X51A 4N06A 1UFBA 3C7JA 2LP4A 3C8ZA 3DM9B 2HJ3A 3S28A 4N4WA 1GS9A 5BQHA 4Q4ZF 3U3BA 1D0YA 3M15A 1UG7A 1VK5A 2A68F 2ASRA 1ZHWA 2IM8A 3AGUA 1K05A 4FWVA 3JSZA 4MW8A 3K1IA 4NC3A 4YL1A 4YT5A 5D92A 3MX3A 2V3CC 2HFIA 3C63A 3JSEO 5BQGA 2A6HF 4MTFA 2YWAA 4MVQA 4C3DA 2YL3A 3HNLA 1Y6DA 1MMAA 1J8YF 1O5HA 2UUHA 3FAJA 4AE4B 2EIJC 5JS5A 1O3UA 1ZHTA 3LLIA 1SZIA 3F47A 5E3CA 2IXMA 3RH3A 2CNWD 3V5YA 1TR2A 2EPMX 2IXPA 3GORA 2XXAA 4P9TA 4J7TA 2YLDA 4OIRF 1I4ZA 4JTAB 2HJMA 2H7OA 2QTVA 4MVUA 2YHSA 3DM5A 2OG2A 4PJMA 2YL7A 4MTOA 2NUTB 1YARO 3CEXA 1OR3A 3DAGA 1JAFA 1JR8A 2Q9BA 3KYJA 2RSEB 4U9DA 3SZRA 1QVXA 2AP3A 3HLZA 1C03A 3KKBA 3LNMB 4WJ0A 4AL1A 1Y4CA 3ABMC 3TOLA 4R32A 3UR3C 3UGPA 1FAPB 2C03A 1OKKD 3PMRA 4HEAJ 3AQBA 4E0HA 5JP7A 4YT4A 1T9KA 1YA9A 3DJNB 1M2VA 1PD1A 1W2WA 4JKVA 3S29A 2L81A 3WG7C 2Q7RA 1K04A 1A7EA 1BBHA 1FTSA 2Q9AA 3AGTA 4NY3A 1BR2A 2MYSA 3UNGC 5E2QA 5JUAA 4J30B 3RFYA 2Q9CA 4C3BA 1MNDA 1V54C 1H9GA 3MFNA 4NQFA 1V74B 2AWCA 1A7DA 1BR1A 3U5SA 4ER9A 4C7OB 2YLGA 2XLMA 4U5HA 5CI9A 1D1CA 2HV6A 5B1BC 4XWJA 1MMDA 2L6HA 3C8GB 3DWWA 3IEEA 2YLIA 4J7YA 5L3QA 4CJOA 5EK0A 4LLCA 3S0XA 1D1AA 3A9CA 4LLEA 4DVZA 1JRAA 3L1MA 3U2LA 2OOCA 2PF4E 1OCCC 1TFKB 3V5XA 1M2OA 4MVMA 3SP1A 1A0BA 5DLJA 1CGOA 1NFOA 1OKKA 3DE9A 2WZLA 3C18A 3HJCA 2A1DD 3FMSA 3ZTZA 4E7ZA 2XM0A 5B3IA 4XEVA 2B0HA 4U5DE 4NTBA 4UDVA 4RBNA 2GAQA 4AX2A 1N1CA 4HE8D 1LE4A 4OD5A 1JMWA 2XSEA 4DBRA 4NCQA 1HY5A 1T6QA 2FAPB 2Y69C 2J0XA 4W8PA 3H65A 5KYNA 2VASA 3NMJA 5KYXA 3W2WA 3GM1A 1U0BB 2V26A 2R7RA 1Q0KA 3R2PA 4BJTA 1HE9A 2J9VA 4F4BA 2CDQA 2JD3A 5DVWA 2NPUA 3U0CA 2HKVA 1M6TA 4JCHA 3JRTA 1VTMP 1A7VA 4BJ5A 3BRJA 1ZHXA 1RJ9B 2KYHA 2HZ8A 4LDRA 5COFA 4EUKB 2LCHA 3IQ5A 5EGYA 1APCA 2Y3DA 3EQLF 3EGDB 4I1OB 2R7WA 1MQVA 5EHHA 3TJ6A 4AL0A 3LAYA 1OXBA 4EHPA 1Z23A 4XLNF 2MHRA
chains in the Genus database with same CATH topology
3G4XA 1Q0MA 1Q0FA 1Q0GA 1T6IA 1Q0DA 1T6UA 3G50A 1Q0KA 4NCQA 1T6QA 3G4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4X A;  1Q0M A;  1Q0F A;  1Q0G A;  1T6I A;  1Q0D A;  1T6U A;  3G50 A;  1Q0K A;  4NCQ A;  1T6Q A;  3G4Z A; 
#chains in the Genus database with same CATH topology
 3A11 A;  3KYI A;  2GFH A;  2Z15 A;  1NLX A;  3DZA A;  4MVS A;  1NSG B;  3AG3 C;  3H2U A;  3L8I A;  3T6G B;  5KYW B;  1LVK A;  1GM5 A;  3AQC A;  2XL4 A;  1KU2 A;  3GWL A;  3IPM O;  3H2V A;  4U9E A;  4IRU A;  1Q0D A;  3SXY A;  3MLG A;  4JJF A;  1TKN A;  3HNJ A;  3WAQ A;  3C62 A;  4IAR A;  4U5G A;  4PFP A;  2QLA A;  1NBB A;  2UUI A;  4G78 A;  1C02 A;  3QZC A;  3WOD F;  4BPM A;  4Q5S F;  1FR0 A;  3PHF 2;  4E0I A;  4XPX A;  1H9T A;  3JZ0 A;  3CSK A;  2R7S A;  1AVO B;  2QE9 A;  4BEM J;  4YJW A;  4JTC B;  3HKK A;  2L6G A;  3AG1 C;  3QTH A;  3GM2 A;  1OCR C;  4WGY A;  1Z63 A;  5L0J A;  2M64 A;  2NG1 A;  2OEV A;  3LS0 A;  2I15 A;  2X0C A;  4DOZ A;  3W8I A;  4U5B E;  1IW7 F;  1EA8 A;  1ORJ A;  2YL1 A;  2KNH A;  2LSE A;  3PDM P;  5L0D A;  4JEB A;  1OCO C;  1T6U A;  2NUP A;  1VYK A;  3GWN A;  4MQ9 F;  3LEV A;  4O7G A;  1SYQ A;  5F28 E;  2KJG A;  1G5Z A;  1Q0M A;  5DQT A;  2R05 A;  1WWP A;  2H7B A;  2A0B A;  2Y39 A;  2QY9 A;  3K7D A;  3VF0 A;  3LNR A;  3UMH A;  1DOV A;  1WOL A;  3EG9 B;  4BJ1 A;  1ST6 A;  3GEH A;  2J0W A;  1QPU A;  4PJL A;  4YL0 A;  3DKA A;  4CS8 C;  5KYY B;  2WZF A;  1G4U S;  2GDC A;  2XXA B;  2VB6 A;  4IJJ A;  3B71 A;  1TWC A;  4O6M A;  2A6E F;  4EWC A;  4OIP F;  5IY5 C;  3GAN A;  3EFO A;  3KH2 A;  2EIN C;  1RCP A;  1MNE A;  4OIN F;  5E3A A;  2WL8 A;  2BL2 A;  2OKU A;  2RD9 A;  3E9V A;  3FHD A;  3GOD A;  4NTA A;  3FOO A;  3R7C A;  4PJN A;  3HTK C;  4YN0 B;  4Q7C A;  5KYU B;  3CQZ A;  4XPY A;  1QZX A;  3VRC A;  5JLI A;  3IHU A;  3TJ5 A;  3SXM A;  1YDI A;  3UMK A;  2EIL C;  1LS1 A;  1QKR A;  3OEO A;  3OWT A;  1M2V B;  2R03 A;  3ZC4 A;  4EBJ A;  4YT2 A;  2EPN A;  3ITF A;  1CPQ A;  5A6J A;  2VCC A;  3EHM A;  2YQY A;  1FFT C;  1T6I A;  3RF3 A;  3UGO A;  3B0U X;  1E85 A;  4O6N A;  4K1O A;  3TK0 A;  1TQG A;  2AVK A;  2E87 A;  2W45 A;  4AE4 A;  3B29 A;  2ZXP A;  3PCV A;  4Z9H A;  3VM6 A;  3W2V A;  2WVQ A;  3S84 A;  1JPN A;  1FMW A;  2A0U A;  1H7I A;  4N6H A;  1T5O A;  2FGY A;  3NMK A;  2W4B A;  3RKO F;  5K0I A;  1JOG A;  1D0Z A;  1Z5Z A;  1RKE A;  1Z6A A;  2CW0 F;  1Q0G A;  4IGG A;  4MND A;  2NUT A;  4EBB A;  5L0F A;  2J9W A;  4OIQ F;  5FCL A;  2XS8 A;  1E2X A;  2DI3 A;  5F5F A;  2LQG A;  2YRF A;  4JC7 A;  1ZU5 A;  2EPL X;  4XEK A;  3M4C A;  3M79 A;  2HS5 A;  5FZT A;  3ZG1 A;  5AC5 A;  2R7X A;  2WVN A;  3EGX B;  2R7O A;  1V4A A;  1ZVZ A;  4Z9I A;  1TFO B;  2VC9 A;  3JYY A;  3B0V C;  1ORS C;  3U8P A;  2B0J A;  2XL8 A;  5JRA A;  4QDL A;  2J46 A;  1WGW A;  4CBE A;  3GM3 A;  1YZC A;  4E7S A;  1WAT A;  2YEV A;  4ONS A;  3DI5 A;  4OIO F;  4U5E E;  4I3M A;  1H6G A;  1OW6 A;  2L7A A;  2O9X A;  2EPO A;  2PP4 A;  3V7O A;  3ZQY A;  3ZSU A;  5L0C A;  2PX0 A;  1FMV A;  5CIV A;  1SMY F;  1WN0 A;  1YAU O;  3JYH A;  3CZ6 A;  4CJG A;  2R9R B;  3RVZ A;  2BC5 A;  4LDK A;  2J7P D;  2ETS A;  2GA0 A;  5GPG B;  3RQF A;  3T9O A;  2ZXW C;  4HFF B;  4C7O A;  3ZTM A;  4ANJ A;  3EZH A;  3S9O A;  4JW1 A;  1ZW3 A;  1BZ4 A;  2FFH A;  3FAP B;  4J32 B;  3C8G A;  1XWJ A;  1G8X A;  1LKX A;  4I44 A;  4G7Z F;  1BDJ B;  2XL6 A;  3ASO C;  4G0H A;  4JVS A;  4KNW A;  4FX5 A;  2Y3G A;  3RVY A;  4H4K C;  4YT8 A;  3HNK A;  1YVI A;  2LD6 A;  3RQG A;  1AEP A;  4WAB A;  3IQ6 A;  1PCX A;  4G7O F;  1M57 C;  1S05 A;  3SXK A;  4ULV A;  3JT1 A;  4CDY A;  3S27 A;  1FNT c;  1RXQ A;  3NMI A;  3K66 A;  3KPH A;  2OCC C;  1K40 A;  3T4R A;  3W4Y A;  2EPK X;  1SF8 A;  3AOU A;  4JIO A;  1NG1 A;  5AC4 A;  3T6B A;  5DQZ A;  2XLH A;  2LFD A;  3NKE A;  2R7Q A;  2HMZ A;  2J7P A;  5BUO A;  2XM4 A;  4BJ6 C;  2F22 A;  5T3T A;  5DS4 A;  4IAO A;  4ZLD A;  4G7H F;  4ZLC A;  3MYF A;  3EH1 A;  2H7V C;  4IAQ A;  2AU5 A;  5L0H A;  3EGD A;  4N6C A;  2NSG A;  1F1M A;  4MVZ A;  1B68 A;  3QVZ A;  4JUR I;  3SYN A;  2C04 A;  2J8W A;  3WHN A;  4CX9 A;  2R7U A;  1JPJ A;  1LI7 A;  2P7V A;  2YKZ A;  4PAC A;  1CGN A;  2KSF A;  2G62 A;  1V55 C;  2A69 F;  3SXZ A;  3FXH A;  4L6R A;  1G4W R;  1I4Y A;  4U5C E;  4YWQ A;  4NTF A;  1FFH A;  2IBF A;  2Q4F A;  3ATP A;  4RDA A;  1OQC A;  2HSQ A;  3US6 A;  2QUP A;  4C3E A;  3NG1 A;  2XLE A;  3Q6M A;  2HV7 A;  1QQ3 A;  2IXN A;  4OD4 A;  1TWA A;  4BEJ A;  4CS8 A;  2QNL A;  1ZW2 A;  2L6F A;  2CGE A;  1YYX A;  3DD7 A;  3L0I A;  3LJB A;  4XTK A;  2XLO A;  2JX0 A;  1XZP A;  2P6V A;  1VYI A;  4YL3 A;  3U3F A;  5CI8 A;  1AUE A;  1TWH A;  3KL4 A;  4E18 A;  1U6H A;  2DGJ A;  4JE9 A;  3G50 A;  3SEO A;  3M1C B;  1Z3I X;  3FDQ A;  4DRI B;  1KNY A;  3JTL O;  1SR2 A;  2AWY A;  2YL0 A;  3CAX A;  1OW8 A;  1QSP A;  3BEH A;  3T6J A;  4JZA A;  1YYJ A;  3O39 A;  4CS7 A;  4D4N A;  5B3S C;  4A2N B;  5T3W A;  4CS9 C;  2OJQ A;  3U2M A;  2R7T A;  2PNO A;  1XZQ A;  4WGZ A;  2EIK C;  4EBK A;  4CSA C;  2R7V A;  3LUT B;  2EIM C;  1QLE C;  1OW7 A;  2PFD A;  3GEE A;  4KNV A;  5F5H A;  4EIY A;  2KK1 A;  1HW2 A;  2XRH A;  4RD9 A;  1LI5 A;  1MMG A;  3LEO A;  2OEX A;  4JTD B;  2HUJ A;  3QW0 A;  2OQM A;  3FOP A;  3ASN C;  3RYL A;  4DXW A;  3AG4 C;  3EG9 A;  3OA1 A;  4P9F A;  5KYY A;  2XLD A;  1CPR A;  2XS1 A;  3K1I C;  4XLP F;  3TUL A;  2ZXR A;  1PD0 A;  3JRM O;  4DVY P;  3O10 A;  1M56 C;  2D4U A;  1OCZ C;  1YLM A;  2OU6 A;  3EHN A;  3K6B A;  4PR9 A;  3VYW A;  4BG0 A;  1RKE B;  3MYI A;  5A6B D;  4JEA A;  2Q00 A;  1HMO A;  5HSW A;  2W9Y A;  1VLT A;  4PFO A;  2DB4 A;  3NRH A;  1EKY A;  3C8G D;  1DOW A;  1R5I D;  4P6I C;  4W8K A;  2J9U A;  4XEF A;  2YVK A;  3FVY A;  2ZPA A;  4XPW A;  3RW0 A;  3AG2 C;  2KW3 C;  3VAY A;  4JJG A;  5BQI A;  4LAC B;  2G3K A;  4FAP B;  1S7Z A;  5KYU A;  2LFF A;  1E86 A;  3TD7 A;  1E84 A;  1TWG A;  1ORY A;  2P0N A;  1NU7 D;  1ZYR F;  2W4M A;  3QW1 A;  2LIG A;  4CDA A;  5L3V A;  1J8M F;  2Y3H A;  5A6K A;  1L3P A;  3LS1 A;  3N24 A;  1OR2 A;  3M4B A;  3DXJ F;  1C17 M;  1VMA A;  4I1M A;  2J9B A;  2P1A A;  4JCZ A;  3ABL C;  5E33 A;  1ZHZ A;  5T1D B;  1L7C A;  5B1A C;  1WAS A;  1YZA A;  2R25 A;  4MVO A;  4XQ1 A;  4K0D A;  5AGF A;  2IYL D;  4MTG A;  2KQ9 A;  2NSF A;  3NKD A;  1KTM A;  2XLW A;  4QI2 A;  2CNW A;  5KYX B;  1ZU4 A;  4A4A A;  4FES A;  2DYS C;  2IXO A;  3LES A;  3NYL A;  5A6B A;  5HV9 A;  1GQA A;  1D1B A;  3HNI A;  3DMD A;  3EZI A;  4DRJ B;  2HSB A;  3DAF A;  3IQC A;  3GEI A;  3POV A;  1D0X A;  3L34 A;  4O79 A;  2H8A A;  4U5F E;  4EKW A;  3EGX A;  2MWQ A;  4K7B A;  3ZQV A;  4MS2 A;  5DS6 A;  3NDB B;  4KBL A;  3RQE A;  4JRZ A;  1LM3 B;  3ZVR A;  4MVR A;  3DJU B;  2BE5 F;  3B0P A;  4IB4 A;  3I5P A;  3NYJ A;  2VCB A;  4GEH A;  4CDV A;  3AJM A;  1Q0F A;  2L9J A;  2VH3 A;  3EH2 A;  3ZDL A;  2M4E A;  3X1O A;  1O87 A;  2KC3 A;  3IQT A;  5JT4 A;  2LK4 A;  3L8J A;  4BJ6 A;  3G4X A;  1LIH A;  4DRH B;  1ZHY A;  1R4T A;  3V5Z A;  2Y3B A;  4DJ9 A;  1E83 A;  4PK4 A;  2PX3 A;  3EPV A;  4LDQ A;  3N0T A;  1I5N A;  3F46 A;  3I5Q A;  2IOQ A;  4YK5 A;  5A6A A;  4PJJ A;  2CCY A;  3NYM A;  2ZD9 A;  3E70 C;  2Q3T A;  3X2Q C;  5JVE A;  2ZXO A;  2WZG A;  3DE8 A;  1VB5 A;  2WVO A;  1Z7Q c;  1RJ9 A;  3EJN A;  2HMQ A;  5COM A;  1RKC A;  2ICW G;  3U8V A;  5COG A;  3ZWI A;  5DS5 A;  1BR4 A;  1LE2 A;  4GQH A;  4IWB A;  3K1H A;  4KC9 A;  3U9J A;  3ZIB A;  4BJ5 C;  1HW1 A;  3ECS A;  3SNH A;  2R02 A;  2YZS A;  4QI0 A;  1MMN A;  2J45 A;  1NFN A;  3Q7G A;  2KGO A;  1NZE A;  256B A;  3N2Z B;  4HFK B;  4M63 A;  4E17 A;  1NU9 C;  1YA7 O;  5KYW A;  3B9Q A;  2GWW A;  2D5R B;  2NUP B;  3O55 A;  1LS4 A;  1EI7 A;  4Z9J A;  1A41 A;  1VLS A;  4D4X A;  3O6X A;  1HE1 A;  3I4U A;  3U9M A;  3ABK C;  4CIP A;  3QMK A;  1U89 A;  2P61 A;  3LLK A;  3JCU Q;  1YJG A;  2WB7 A;  2I8B A;  3S90 A;  1RMV A;  5D91 A;  2TMV P;  4H54 A;  4O6Y A;  2OJE D;  2XLV A;  1VOM A;  4GYT A;  3KMI A;  1GGQ A;  4CIH A;  5L0I A;  5A69 A;  3TOM A;  1CGM E;  2JPU A;  3K33 A;  1OXK A;  2G3V A;  2DYR C;  4LER A;  1LPE A;  3Q7L A;  3TQO A;  4CS9 A;  3G4Z A;  1HMD A;  3Q6N A;  5TJ5 E;  3RIP A;  2VCA A;  3UMI A;  2CYD A;  1ZZP A;  3MBG A;  3QVY A;  4KI2 A;  1IZM A;  4B6I A;  4AK9 A;  2PBE A;  3EFO B;  5JSL A;  4CSA A;  4X0R A;  4MW3 A;  5L0G A;  1PV3 A;  3W8H A;  3J06 A;  4ULW A;  1T01 A;  1EQ1 A;  1WTY A;  4DBQ A;  2X51 A;  4N06 A;  1UFB A;  3C7J A;  2LP4 A;  3C8Z A;  3DM9 B;  2HJ3 A;  3S28 A;  4N4W A;  1GS9 A;  5BQH A;  4Q4Z F;  3U3B A;  1D0Y A;  3M15 A;  1UG7 A;  1VK5 A;  2A68 F;  2ASR A;  1ZHW A;  2IM8 A;  3AGU A;  1K05 A;  4FWV A;  3JSZ A;  4MW8 A;  3K1I A;  4NC3 A;  4YL1 A;  4YT5 A;  5D92 A;  3MX3 A;  2V3C C;  2HFI A;  3C63 A;  3JSE O;  5BQG A;  2A6H F;  4MTF A;  2YWA A;  4MVQ A;  4C3D A;  2YL3 A;  3HNL A;  1Y6D A;  1MMA A;  1J8Y F;  1O5H A;  2UUH A;  3FAJ A;  4AE4 B;  2EIJ C;  5JS5 A;  1O3U A;  1ZHT A;  3LLI A;  1SZI A;  3F47 A;  5E3C A;  2IXM A;  3RH3 A;  2CNW D;  3V5Y A;  1TR2 A;  2EPM X;  2IXP A;  3GOR A;  2XXA A;  4P9T A;  4J7T A;  2YLD A;  4OIR F;  1I4Z A;  4JTA B;  2HJM A;  2H7O A;  2QTV A;  4MVU A;  2YHS A;  3DM5 A;  2OG2 A;  4PJM A;  2YL7 A;  4MTO A;  2NUT B;  1YAR O;  3CEX A;  1OR3 A;  3DAG A;  1JAF A;  1JR8 A;  2Q9B A;  3KYJ A;  2RSE B;  4U9D A;  3SZR A;  1QVX A;  2AP3 A;  3HLZ A;  1C03 A;  3KKB A;  3LNM B;  4WJ0 A;  4AL1 A;  1Y4C A;  3ABM C;  3TOL A;  4R32 A;  3UR3 C;  3UGP A;  1FAP B;  2C03 A;  1OKK D;  3PMR A;  4HEA J;  3AQB A;  4E0H A;  5JP7 A;  4YT4 A;  1T9K A;  1YA9 A;  3DJN B;  1M2V A;  1PD1 A;  1W2W A;  4JKV A;  3S29 A;  2L81 A;  3WG7 C;  2Q7R A;  1K04 A;  1A7E A;  1BBH A;  1FTS A;  2Q9A A;  3AGT A;  4NY3 A;  1BR2 A;  2MYS A;  3UNG C;  5E2Q A;  5JUA A;  4J30 B;  3RFY A;  2Q9C A;  4C3B A;  1MND A;  1V54 C;  1H9G A;  3MFN A;  4NQF A;  1V74 B;  2AWC A;  1A7D A;  1BR1 A;  3U5S A;  4ER9 A;  4C7O B;  2YLG A;  2XLM A;  4U5H A;  5CI9 A;  1D1C A;  2HV6 A;  5B1B C;  4XWJ A;  1MMD A;  2L6H A;  3C8G B;  3DWW A;  3IEE A;  2YLI A;  4J7Y A;  5L3Q A;  4CJO A;  5EK0 A;  4LLC A;  3S0X A;  1D1A A;  3A9C A;  4LLE A;  4DVZ A;  1JRA A;  3L1M A;  3U2L A;  2OOC A;  2PF4 E;  1OCC C;  1TFK B;  3V5X A;  1M2O A;  4MVM A;  3SP1 A;  1A0B A;  5DLJ A;  1CGO A;  1NFO A;  1OKK A;  3DE9 A;  2WZL A;  3C18 A;  3HJC A;  2A1D D;  3FMS A;  3ZTZ A;  4E7Z A;  2XM0 A;  5B3I A;  4XEV A;  2B0H A;  4U5D E;  4NTB A;  4UDV A;  4RBN A;  2GAQ A;  4AX2 A;  1N1C A;  4HE8 D;  1LE4 A;  4OD5 A;  1JMW A;  2XSE A;  4DBR A;  4NCQ A;  1HY5 A;  1T6Q A;  2FAP B;  2Y69 C;  2J0X A;  4W8P A;  3H65 A;  5KYN A;  2VAS A;  3NMJ A;  5KYX A;  3W2W A;  3GM1 A;  1U0B B;  2V26 A;  2R7R A;  1Q0K A;  3R2P A;  4BJT A;  1HE9 A;  2J9V A;  4F4B A;  2CDQ A;  2JD3 A;  5DVW A;  2NPU A;  3U0C A;  2HKV A;  1M6T A;  4JCH A;  3JRT A;  1VTM P;  1A7V A;  4BJ5 A;  3BRJ A;  1ZHX A;  1RJ9 B;  2KYH A;  2HZ8 A;  4LDR A;  5COF A;  4EUK B;  2LCH A;  3IQ5 A;  5EGY A;  1APC A;  2Y3D A;  3EQL F;  3EGD B;  4I1O B;  2R7W A;  1MQV A;  5EHH A;  3TJ6 A;  4AL0 A;  3LAY A;  1OXB A;  4EHP A;  1Z23 A;  4XLN F;  2MHR A; 
#chains in the Genus database with same CATH homology
 3G4X A;  1Q0M A;  1Q0F A;  1Q0G A;  1T6I A;  1Q0D A;  1T6U A;  3G50 A;  1Q0K A;  4NCQ A;  1T6Q A;  3G4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...