1Q0FA

Crystal structure of ni-containing superoxide dismutase with ni-ligation corresponding to the state after partial x-ray-induced reduction
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
117
structure length
117
Chain Sequence
HCDLPCGVYDPAQARIEAESVKAIQEKMAANDDLHFQIRATVIKEQRAELAKHHLDVLWSDYFKPPHFESYPELHTLVNEAVKALSAAKASTDPATGQKALDYIAQIDKIFWETKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Ni]
publication title Crystal structure of nickel-containing superoxide dismutase reveals another type of active site
pubmed doi rcsb
total genus 51
structure length 117
sequence length 117
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2003-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.400 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nickel-containing superoxide dismutase 1q0fA00
1Q0FA 1T6UA 1Q0KA 1T6QA 3G4XA 4NCQA 3G4ZA 1T6IA 3G50A 1Q0GA 1Q0DA 1Q0MA
chains in the Genus database with same CATH superfamily
2R03A 3H2VA 1YYXA 2H7BA 3KL4A 4MQ9F 4N6HA 4IGGA 2R05A 1QKRA 4CS8A 1TFKB 2KK1A 3AG2C 5CIVA 2B0HA 3FHDA 1HE1A 2QUPA 3DAGA 1H7IA 2VCCA 4J7TA 256BA 2AU5A 2HJMA 4MVQA 2AVKA 3AOUA 3AJMA 4U5FE 4LDKA 3TK0A 3TOLA 3M15A 4CIHA 3TQOA 2R7TA 3ATPA 4NC3A 3K1IC 4PJNA 5BQHA 4LDQA 2W4BA 4E18A 3FAJA 2R7QA 3AQBA 3C7JA 1MQVA 5JVEA 3TOMA 4YWQA 2YLDA 3DXJF 4QDLA 4CSAC 2A1DD 1OKKD 4XTKA 1ZZPA 1M2OA 2R7UA 2QLAA 2KJGA 1C17M 2RSEB 4WGYA 2P1AA 3JRMO 5L0JA 1Z23A 4MNDA 2J0WA 4IRUA 1BBHA 3K6BA 5BQIA 4YT4A 3EG9B 3RVYA 3U3BA 4RDAA 1QZXA 2YL7A 1M2VB 3DWWA 1VMAA 2F22A 3Q6MA 4YT8A 2NPUA 2CDQA 3MYFA 2GFHA 3QW1A 1K05A 1U6HA 1UFBA 4CS8C 1YYJA 2YLGA 3Q7LA 4G78A 3GORA 2YL1A 3DZAA 4OINF 1K04A 4XEKA 3ITFA 1JPJA 1MMAA 3W8HA 5IY5C 5K0IA 4HFKB 4LLEA 3B0VC 2H8AA 3DM5A 3K33A 3GWLA 2YLIA 3I4UA 2NSGA 2VCBA 3S0XA 3UMHA 3EGXB 3WG7C 4UDVA 2OJED 2MWQA 4E7SA 3L0IA 2J45A 3KMIA 5A6KA 1RMVA 4XLPF 2J9BA 2BL2A 5DS4A 1MMDA 1TWAA 2PF4E 4XPYA 4OD5A 3LLKA 1O5HA 2OU6A 2Y3HA 3DJUB 3JT1A 1YLMA 2ZXPA 2OQMA 2P7VA 4XWJA 1OW7A 1XZPA 4CS9A 3PHF2 2CNWD 3LUTB 1E85A 3ZWIA 5JUAA 1HY5A 1NZEA 4ANJA 2OEXA 3K66A 3QMKA 4K7BA 2YVKA 1OQCA 4E0HA 3WODF 4PFOA 3W2VA 3FOOA 3W8IA 3E70C 2IXMA 4A2NB 5EGYA 2KNHA 1I4ZA 3EH2A 4IWBA 1V74B 4C3DA 3ZQVA 1E2XA 2NSFA 1CPQA 4CS7A 1HE9A 3ZIBA 3X1OA 3X2QC 1V54C 4M63A 3LS1A 2OOCA 2HUJA 1YZAA 2EINC 3GWNA 1LM3B 1UG7A 3U3FA 2KSFA 3KYJA 4MVZA 3C8ZA 4HEAJ 2JX0A 3EHNA 4OIRF 2LFDA 2R02A 3SNHA 3UMKA 2ZPAA 3QVZA 5E3CA 2J7PA 2R7WA 5DQTA 1F1MA 4CBEA 2HV6A 1JAFA 1XZQA 4P9FA 3VRCA 5L3QA 3FMSA 3BEHA 3HNKA 2XXAA 4NTFA 1AEPA 3JYYA 2IM8A 4WABA 1SYQA 3U9JA 4EBBA 2E87A 3OEOA 3HJCA 4W8KA 5AC4A 5L0GA 1PV3A 3LJBA 1WATA 3KH2A 4CS9C 1M6TA 2HKVA 3EGDA 3NKEA 3QW0A 1VOMA 4AE4B 4NTAA 1APCA 3WHNA 1D0ZA 2NUPA 4NY3A 1E83A 3HTKC 5KYNA 1D0YA 2B0JA 3A11A 3SXKA 1QVXA 1V4AA 2VCAA 4BJ5A 2LP4A 1W2WA 2XL8A 1K40A 3EZIA 5AGFA 4YL3A 4ZLDA 1LVKA 1H6GA 3ASNC 4G7OF 4XQ1A 1MNDA 3AQCA 3SXYA 4L6RA 1O87A 1VYIA 2AP3A 3UMIA 1ZHYA 2CGEA 4YT2A 5A69A 5A6BA 3B0PA 1GS9A 2FFHA 4JURI 3GANA 1VTMP 2XRHA 3IQ5A 4MVSA 2Q00A 3RW0A 2KGOA 3SXZA 5COMA 2A69F 3LNRA 4JTAB 3RFYA 3TD7A 1ZVZA 3E9VA 1GM5A 3LNMB 3NDBB 4FWVA 4JKVA 3N0TA 5HV9A 1M57C 2FAPB 1A0BA 2Y3BA 2YL3A 3IQ6A 3LEOA 4YT5A 3AG3C 4EBKA 1I5NA 4MTOA 2ICWG 2YQYA 4MW3A 4G7ZF 3OWTA 2D4UA 2WVNA 3F47A 4DOZA 1OCCC 2M4EA 4EBJA 2ZXRA 1LE2A 2ETSA 2HV7A 2LFFA 3CSKA 3T6GB 4KI2A 4P6IC 3MX3A 4JC7A 3B0UX 1GGQA 3DD7A 2NG1A 4BJ5C 5KYUA 1ORYA 3JRTA 2XSEA 1MNEA 1NFOA 4JCHA 4BJ6C 1ZHXA 1EA8A 3EFOA 3H2UA 4DJ9A 3M4BA 1Z3IX 4ULWA 1NLXA 3EQLF 3GEIA 4AL1A 4ONSA 3JTLO 1Z6AA 2LSEA 2XS8A 2R9RB 3DJNB 3ABKC 2OJQA 1D1AA 2L81A 1A41A 1G5ZA 4N4WA 4U5EE 4EHPA 5L0HA 5L0CA 3MFNA 3W4YA 1ORSC 2C04A 3I5PA 4OD4A 4CX9A 4DBRA 1EI7A 5DS5A 4K0DA 3US6A 3AGTA 4KNWA 2Q3TA 2R7RA 1YJGA 1PD0A 3HNLA 3IQTA 1SF8A 3HNJA 4H4KC 1B68A 1Z7Qc 2LQGA 1T6QA 3SZRA 4AK9A 3IEEA 2KYHA 3L8IA 3N24A 3V7OA 1NBBA 4JE9A 3SXMA 4H54A 4JJGA 2EPOA 2YHSA 4GQHA 3MYIA 1CGOA 4MVOA 4U9DA 3RF3A 2L7AA 4Z9IA 4EWCA 1H9GA 2A0UA 1E86A 1EKYA 3GM3A 3GM1A 4JZAA 3N2ZB 3W2WA 4I1OB 3VM6A 4MVUA 4BEJA 2EPNA 2LIGA 1YVIA 1RKEA 2XLVA 4IJJA 4F4BA 5E2QA 4RBNA 1C03A 1HMDA 2L6FA 1JMWA 1T6IA 2OCCC 2Y39A 1BZ4A 4JRZA 3SYNA 2P61A 2G3VA 3QTHA 2CW0F 1FMVA 1NU9C 2EPKX 3FVYA 1WOLA 2WL8A 5JT4A 3OA1A 1DOVA 1A7DA 4DRIB 4U5DE 3KYIA 2MYSA 4KC9A 2A6EF 1DOWA 1LE4A 2A6HF 3S27A 3ZSUA 1SR2A 4YL0A 1NU7D 1J8MF 1OXKA 1J8YF 1Y4CA 3L8JA 4OIQF 3IQCA 4B6IA 5L0DA 4O6MA 5KYXA 1T01A 2M64A 4CJOA 3S9OA 3UGPA 5F5FA 2IYLD 4WJ0A 1D1CA 2DGJA 1Y6DA 2XL6A 1CGNA 2W9YA 3GM2A 3RVZA 1G4US 2A0BA 1EQ1A 4Z9HA 1U89A 1L7CA 1JRAA 1LKXA 2Z15A 4C7OB 3UR3C 4DXWA 4CJGA 4NTBA 5AC5A 2J9WA 3U5SA 2MHRA 1QLEC 1ORJA 1YAUO 3VYWA 3WAQA 3DE9A 1FAPB 5COFA 2YEVA 2P6VA 4MVMA 1ZW2A 3T6BA 4EUKB 3DE8A 4J32B 1ZHWA 4DBQA 3NYLA 1Q0MA 4QI2A 2TMVP 3TULA 3C62A 2H7VC 1ZW3A 1VLSA 1LI5A 1KU2A 1GQAA 2G3KA 2VC9A 2XLWA 4IAOA 4O6NA 1PD1A 4PR9A 1N1CA 1D1BA 4BPMA 3O6XA 3JCUQ 5T3WA 2EILC 2X51A 4IARA 4MS2A 3T4RA 3U0CA 5D91A 3U2MA 4GEHA 3V5YA 3EGDB 4JW1A 4CDYA 3EHMA 2DYRC 3EPVA 4HFFB 5KYYA 1NFNA 4C3EA 2R25A 3ZC4A 3FDQA 4AX2A 1HMOA 4Q5SF 4ULVA 2AWCA 1ZHTA 2J7PD 3EJNA 3PCVA 4JEBA 1FTSA 5BUOA 1RJ9B 4JCZA 5EHHA 3K1HA 2PP4A 4DRJB 4YK5A 4PJMA 4BJTA 4G7HF 1JPNA 2V26A 5CI8A 5HSWA 3G50A 3NMJA 1A7VA 3LAYA 4D4XA 3CZ6A 1WN0A 4LLCA 3QVYA 2R7XA 4BEMJ 1YZCA 2QNLA 3V5XA 4XEVA 2JD3A 4XLNF 5B3IA 3S90A 2UUIA 2PX0A 2YL0A 1O3UA 3SP1A 1FNTc 1RXQA 4N6CA 3VAYA 2BC5A 4O6YA 2IXNA 2NUTA 1YA9A 3IPMO 1G4WR 2KC3A 4MTFA 3ZVRA 4Q7CA 4YJWA 2XLHA 1KNYA 3NMIA 4BJ1A 1PCXA 3U2LA 4PFPA 1FR0A 1YDIA 5KYWA 5A6BD 2WVOA 2XS1A 1I4YA 3C8GA 3K1IA 2G62A 3JSEO 5JSLA 2VASA 1OCZC 2Y3DA 3DMDA 3RQFA 5D92A 1OR2A 4MTGA 1TFOB 3ZTMA 4QI0A 1LI7A 3BRJA 3FAPB 4P9TA 5KYUB 4CSAA 3K7DA 1L3PA 3LLIA 5EK0A 2W4MA 2L9JA 3MBGA 3MLGA 3EFOB 4MVRA 3NKDA 5B1BC 1AVOB 3B29A 2WB7A 4FESA 4A4AA 3M1CB 1T5OA 4DRHB 2A68F 1HW2A 3S29A 1OW6A 2LD6A 1XWJA 5DVWA 3FXHA 5A6AA 4LDRA 2EPMX 2HMZA 3Q6NA 4I44A 1OKKA 4RD9A 3TJ6A 2PBEA 3ZTZA 1LS4A 2J9UA 5E3AA 1LPEA 3H65A 1H9TA 2L6GA 4PK4A 1HW1A 1LIHA 2KW3C 1NSGB 1VLTA 5F5HA 4GYTA 2HZ8A 1FMWA 2XM4A 3POVA 1TQGA 3KPHA 4KNVA 1TR2A 1YARO 4EKWA 2EIKC 3JSZA 3NYMA 2HFIA 2J8WA 3R2PA 3T6JA 4PACA 2WZLA 3M4CA 2R7SA 3A9CA 2Y3GA 1WGWA 3S28A 2CYDA 2YWAA 1BR4A 2O9XA 4I1MA 4LACB 2PNOA 5E33A 3ZG1A 5JLIA 3HKKA 4YN0B 5A6JA 1WTYA 3DKAA 5T3TA 3RKOF 3ABMC 1U0BB 2IXOA 1S7ZA 2QE9A 3ZQYA 3FOPA 2LK4A 2XLEA 2AWYA 1RKEB 4PJLA 4DVYP 4IB4A 4OIPF 1Q0FA 3EG9A 3QZCA 4MW8A 4Q4ZF 4U5BE 4YL1A 2YZSA 1M2VA 3LEVA 4JEAA 1TWCA 2UUHA 2Y69C 5F28E 1E84A 5COGA 3V5ZA 4C3BA 3TJ5A 3O39A 4ER9A 3RQGA 3NMKA 3ABLC 1R5ID 3C18A 3U8PA 1OW8A 4O79A 4CDAA 2CNWA 3CAXA 2WZGA 3DAFA 4DVZA 2W45A 2XL4A 4JVSA 3JZ0A 4JTCB 5DQZA 5JRAA 5L3VA 2GAQA 2H7OA 3EGXA 2CCYA 5KYXB 2QY9A 2JPUA 4PJJA 2P0NA 5DS6A 1IZMA 1VB5A 3LS0A 3SEOA 2WVQA 3ASOC 2PFDA 3DM9B 3HNIA 4N06A 5T1DB 3U8VA 2Q7RA 3Q7GA 4E0IA 3UGOA 1WASA 3AGUA 1KTMA 4JTDB 3ZDLA 3I5QA 2Q9CA 1MMGA 2J0XA 3JYHA 2OG2A 4FAPB 2OEVA 2Q9AA 1RKCA 3UNGC 4R32A 1T9KA 2XM0A 5BQGA 1AUEA 5JS5A 5B3SC 3RQEA 2XXAB 3T9OA 4JJFA 4E7ZA 3CEXA 4U5CE 1IW7F 4J7YA 4NCQA 1M56C 4EIYA 1SZIA 3L34A 1TKNA 3G4ZA 4U5GA 4X0RA 3F46A 2R7VA 1ST6A 4Z9JA 4G0HA 3J06A 4C7OA 1BR2A 3ECSA 2EIMC 1JR8A 4XPXA 2NUPB 5KYYB 2YKZA 4WGZA 3CQZA 1VYKA 1RCPA 1BDJB 3U9MA 1FFHA 2RD9A 3AG1C 2ZXWC 2C03A 1QQ3A 1Z5ZA 2GDCA 5L0IA 1QPUA 2KQ9A 3NG1A 1OCOC 2VB6A 4IAQA 2DYSC 1QSPA 2ZXOA 5GPGB 5TJ5E 2IOQA 3C63A 1D0XA 3O10A 3RIPA 1FFTC 2YRFA 2ZD9A 5CI9A 2VH3A 1CPRA 2EIJC 2LCHA 2HMQA 2PX3A 2XLMA 4NQFA 1R4TA 2ASRA 3B71A 3LESA 5JP7A 4HE8D 4KBLA 4AL0A 4AE4A 4CDVA 4OIOF 4BG0A 1A7EA 2EPLX 1TWHA 1MMNA 2DI3A 5FZTA 1OCRC 2XLOA 1JOGA 5B1AC 1G8XA 2HSBA 5L0FA 2BE5F 2V3CC 2D5RB 2I15A 2OKUA 3HLZA 2XLDA 3AG4C 1Q0DA 2GWWA 1T6UA 3R7CA 5DLJA 4ZLCA 1RJ9A 2NUTB 1TWGA 2X0CA 1Z63A 3L1MA 4LERA 1NG1A 2DB4A 3NYJA 4U9EA 3RYLA 1VK5A 4BJ6A 4D4NA 1ZU5A 2HSQA 4FX5A 4U5HA 3O55A 1ZHZA 4JIOA 3B9QA 4W8PA 1OXBA 2HJ3A 3IHUA 1SMYF 3NRHA 5KYWB 1Q0GA 3S84A 3C8GB 2WZFA 4K1OA 3PDMP 4XPWA 1Q0KA 2IXPA 1LS1A 2I8BA 5FCLA 1C02A 1YA7O 2HS5A 1V55C 1ZYRF 1OR3A 2J9VA 2Q9BA 4O7GA 3VF0A 4I3MA 4E17A 3EZHA 1BR1A 2FGYA 3DI5A 1S05A 2J46A 3M79A 3G4XA 3GEHA 1CGME 2Q4FA 3GODA 1ZU4A 2IBFA 3EH1A 3GEEA 2L6HA 2R7OA 3KKBA 2GA0A 4CIPA 4J30B 1WWPA 3RH3A 3C8GD 4XEFA 3PMRA 2QTVA
chains in the Genus database with same CATH topology
1Q0FA 1T6UA 1Q0KA 1T6QA 3G4XA 4NCQA 3G4ZA 1T6IA 3G50A 1Q0GA 1Q0DA 1Q0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q0F A;  1T6U A;  1Q0K A;  1T6Q A;  3G4X A;  4NCQ A;  3G4Z A;  1T6I A;  3G50 A;  1Q0G A;  1Q0D A;  1Q0M A; 
#chains in the Genus database with same CATH topology
 2R03 A;  3H2V A;  1YYX A;  2H7B A;  3KL4 A;  4MQ9 F;  4N6H A;  4IGG A;  2R05 A;  1QKR A;  4CS8 A;  1TFK B;  2KK1 A;  3AG2 C;  5CIV A;  2B0H A;  3FHD A;  1HE1 A;  2QUP A;  3DAG A;  1H7I A;  2VCC A;  4J7T A;  256B A;  2AU5 A;  2HJM A;  4MVQ A;  2AVK A;  3AOU A;  3AJM A;  4U5F E;  4LDK A;  3TK0 A;  3TOL A;  3M15 A;  4CIH A;  3TQO A;  2R7T A;  3ATP A;  4NC3 A;  3K1I C;  4PJN A;  5BQH A;  4LDQ A;  2W4B A;  4E18 A;  3FAJ A;  2R7Q A;  3AQB A;  3C7J A;  1MQV A;  5JVE A;  3TOM A;  4YWQ A;  2YLD A;  3DXJ F;  4QDL A;  4CSA C;  2A1D D;  1OKK D;  4XTK A;  1ZZP A;  1M2O A;  2R7U A;  2QLA A;  2KJG A;  1C17 M;  2RSE B;  4WGY A;  2P1A A;  3JRM O;  5L0J A;  1Z23 A;  4MND A;  2J0W A;  4IRU A;  1BBH A;  3K6B A;  5BQI A;  4YT4 A;  3EG9 B;  3RVY A;  3U3B A;  4RDA A;  1QZX A;  2YL7 A;  1M2V B;  3DWW A;  1VMA A;  2F22 A;  3Q6M A;  4YT8 A;  2NPU A;  2CDQ A;  3MYF A;  2GFH A;  3QW1 A;  1K05 A;  1U6H A;  1UFB A;  4CS8 C;  1YYJ A;  2YLG A;  3Q7L A;  4G78 A;  3GOR A;  2YL1 A;  3DZA A;  4OIN F;  1K04 A;  4XEK A;  3ITF A;  1JPJ A;  1MMA A;  3W8H A;  5IY5 C;  5K0I A;  4HFK B;  4LLE A;  3B0V C;  2H8A A;  3DM5 A;  3K33 A;  3GWL A;  2YLI A;  3I4U A;  2NSG A;  2VCB A;  3S0X A;  3UMH A;  3EGX B;  3WG7 C;  4UDV A;  2OJE D;  2MWQ A;  4E7S A;  3L0I A;  2J45 A;  3KMI A;  5A6K A;  1RMV A;  4XLP F;  2J9B A;  2BL2 A;  5DS4 A;  1MMD A;  1TWA A;  2PF4 E;  4XPY A;  4OD5 A;  3LLK A;  1O5H A;  2OU6 A;  2Y3H A;  3DJU B;  3JT1 A;  1YLM A;  2ZXP A;  2OQM A;  2P7V A;  4XWJ A;  1OW7 A;  1XZP A;  4CS9 A;  3PHF 2;  2CNW D;  3LUT B;  1E85 A;  3ZWI A;  5JUA A;  1HY5 A;  1NZE A;  4ANJ A;  2OEX A;  3K66 A;  3QMK A;  4K7B A;  2YVK A;  1OQC A;  4E0H A;  3WOD F;  4PFO A;  3W2V A;  3FOO A;  3W8I A;  3E70 C;  2IXM A;  4A2N B;  5EGY A;  2KNH A;  1I4Z A;  3EH2 A;  4IWB A;  1V74 B;  4C3D A;  3ZQV A;  1E2X A;  2NSF A;  1CPQ A;  4CS7 A;  1HE9 A;  3ZIB A;  3X1O A;  3X2Q C;  1V54 C;  4M63 A;  3LS1 A;  2OOC A;  2HUJ A;  1YZA A;  2EIN C;  3GWN A;  1LM3 B;  1UG7 A;  3U3F A;  2KSF A;  3KYJ A;  4MVZ A;  3C8Z A;  4HEA J;  2JX0 A;  3EHN A;  4OIR F;  2LFD A;  2R02 A;  3SNH A;  3UMK A;  2ZPA A;  3QVZ A;  5E3C A;  2J7P A;  2R7W A;  5DQT A;  1F1M A;  4CBE A;  2HV6 A;  1JAF A;  1XZQ A;  4P9F A;  3VRC A;  5L3Q A;  3FMS A;  3BEH A;  3HNK A;  2XXA A;  4NTF A;  1AEP A;  3JYY A;  2IM8 A;  4WAB A;  1SYQ A;  3U9J A;  4EBB A;  2E87 A;  3OEO A;  3HJC A;  4W8K A;  5AC4 A;  5L0G A;  1PV3 A;  3LJB A;  1WAT A;  3KH2 A;  4CS9 C;  1M6T A;  2HKV A;  3EGD A;  3NKE A;  3QW0 A;  1VOM A;  4AE4 B;  4NTA A;  1APC A;  3WHN A;  1D0Z A;  2NUP A;  4NY3 A;  1E83 A;  3HTK C;  5KYN A;  1D0Y A;  2B0J A;  3A11 A;  3SXK A;  1QVX A;  1V4A A;  2VCA A;  4BJ5 A;  2LP4 A;  1W2W A;  2XL8 A;  1K40 A;  3EZI A;  5AGF A;  4YL3 A;  4ZLD A;  1LVK A;  1H6G A;  3ASN C;  4G7O F;  4XQ1 A;  1MND A;  3AQC A;  3SXY A;  4L6R A;  1O87 A;  1VYI A;  2AP3 A;  3UMI A;  1ZHY A;  2CGE A;  4YT2 A;  5A69 A;  5A6B A;  3B0P A;  1GS9 A;  2FFH A;  4JUR I;  3GAN A;  1VTM P;  2XRH A;  3IQ5 A;  4MVS A;  2Q00 A;  3RW0 A;  2KGO A;  3SXZ A;  5COM A;  2A69 F;  3LNR A;  4JTA B;  3RFY A;  3TD7 A;  1ZVZ A;  3E9V A;  1GM5 A;  3LNM B;  3NDB B;  4FWV A;  4JKV A;  3N0T A;  5HV9 A;  1M57 C;  2FAP B;  1A0B A;  2Y3B A;  2YL3 A;  3IQ6 A;  3LEO A;  4YT5 A;  3AG3 C;  4EBK A;  1I5N A;  4MTO A;  2ICW G;  2YQY A;  4MW3 A;  4G7Z F;  3OWT A;  2D4U A;  2WVN A;  3F47 A;  4DOZ A;  1OCC C;  2M4E A;  4EBJ A;  2ZXR A;  1LE2 A;  2ETS A;  2HV7 A;  2LFF A;  3CSK A;  3T6G B;  4KI2 A;  4P6I C;  3MX3 A;  4JC7 A;  3B0U X;  1GGQ A;  3DD7 A;  2NG1 A;  4BJ5 C;  5KYU A;  1ORY A;  3JRT A;  2XSE A;  1MNE A;  1NFO A;  4JCH A;  4BJ6 C;  1ZHX A;  1EA8 A;  3EFO A;  3H2U A;  4DJ9 A;  3M4B A;  1Z3I X;  4ULW A;  1NLX A;  3EQL F;  3GEI A;  4AL1 A;  4ONS A;  3JTL O;  1Z6A A;  2LSE A;  2XS8 A;  2R9R B;  3DJN B;  3ABK C;  2OJQ A;  1D1A A;  2L81 A;  1A41 A;  1G5Z A;  4N4W A;  4U5E E;  4EHP A;  5L0H A;  5L0C A;  3MFN A;  3W4Y A;  1ORS C;  2C04 A;  3I5P A;  4OD4 A;  4CX9 A;  4DBR A;  1EI7 A;  5DS5 A;  4K0D A;  3US6 A;  3AGT A;  4KNW A;  2Q3T A;  2R7R A;  1YJG A;  1PD0 A;  3HNL A;  3IQT A;  1SF8 A;  3HNJ A;  4H4K C;  1B68 A;  1Z7Q c;  2LQG A;  1T6Q A;  3SZR A;  4AK9 A;  3IEE A;  2KYH A;  3L8I A;  3N24 A;  3V7O A;  1NBB A;  4JE9 A;  3SXM A;  4H54 A;  4JJG A;  2EPO A;  2YHS A;  4GQH A;  3MYI A;  1CGO A;  4MVO A;  4U9D A;  3RF3 A;  2L7A A;  4Z9I A;  4EWC A;  1H9G A;  2A0U A;  1E86 A;  1EKY A;  3GM3 A;  3GM1 A;  4JZA A;  3N2Z B;  3W2W A;  4I1O B;  3VM6 A;  4MVU A;  4BEJ A;  2EPN A;  2LIG A;  1YVI A;  1RKE A;  2XLV A;  4IJJ A;  4F4B A;  5E2Q A;  4RBN A;  1C03 A;  1HMD A;  2L6F A;  1JMW A;  1T6I A;  2OCC C;  2Y39 A;  1BZ4 A;  4JRZ A;  3SYN A;  2P61 A;  2G3V A;  3QTH A;  2CW0 F;  1FMV A;  1NU9 C;  2EPK X;  3FVY A;  1WOL A;  2WL8 A;  5JT4 A;  3OA1 A;  1DOV A;  1A7D A;  4DRI B;  4U5D E;  3KYI A;  2MYS A;  4KC9 A;  2A6E F;  1DOW A;  1LE4 A;  2A6H F;  3S27 A;  3ZSU A;  1SR2 A;  4YL0 A;  1NU7 D;  1J8M F;  1OXK A;  1J8Y F;  1Y4C A;  3L8J A;  4OIQ F;  3IQC A;  4B6I A;  5L0D A;  4O6M A;  5KYX A;  1T01 A;  2M64 A;  4CJO A;  3S9O A;  3UGP A;  5F5F A;  2IYL D;  4WJ0 A;  1D1C A;  2DGJ A;  1Y6D A;  2XL6 A;  1CGN A;  2W9Y A;  3GM2 A;  3RVZ A;  1G4U S;  2A0B A;  1EQ1 A;  4Z9H A;  1U89 A;  1L7C A;  1JRA A;  1LKX A;  2Z15 A;  4C7O B;  3UR3 C;  4DXW A;  4CJG A;  4NTB A;  5AC5 A;  2J9W A;  3U5S A;  2MHR A;  1QLE C;  1ORJ A;  1YAU O;  3VYW A;  3WAQ A;  3DE9 A;  1FAP B;  5COF A;  2YEV A;  2P6V A;  4MVM A;  1ZW2 A;  3T6B A;  4EUK B;  3DE8 A;  4J32 B;  1ZHW A;  4DBQ A;  3NYL A;  1Q0M A;  4QI2 A;  2TMV P;  3TUL A;  3C62 A;  2H7V C;  1ZW3 A;  1VLS A;  1LI5 A;  1KU2 A;  1GQA A;  2G3K A;  2VC9 A;  2XLW A;  4IAO A;  4O6N A;  1PD1 A;  4PR9 A;  1N1C A;  1D1B A;  4BPM A;  3O6X A;  3JCU Q;  5T3W A;  2EIL C;  2X51 A;  4IAR A;  4MS2 A;  3T4R A;  3U0C A;  5D91 A;  3U2M A;  4GEH A;  3V5Y A;  3EGD B;  4JW1 A;  4CDY A;  3EHM A;  2DYR C;  3EPV A;  4HFF B;  5KYY A;  1NFN A;  4C3E A;  2R25 A;  3ZC4 A;  3FDQ A;  4AX2 A;  1HMO A;  4Q5S F;  4ULV A;  2AWC A;  1ZHT A;  2J7P D;  3EJN A;  3PCV A;  4JEB A;  1FTS A;  5BUO A;  1RJ9 B;  4JCZ A;  5EHH A;  3K1H A;  2PP4 A;  4DRJ B;  4YK5 A;  4PJM A;  4BJT A;  4G7H F;  1JPN A;  2V26 A;  5CI8 A;  5HSW A;  3G50 A;  3NMJ A;  1A7V A;  3LAY A;  4D4X A;  3CZ6 A;  1WN0 A;  4LLC A;  3QVY A;  2R7X A;  4BEM J;  1YZC A;  2QNL A;  3V5X A;  4XEV A;  2JD3 A;  4XLN F;  5B3I A;  3S90 A;  2UUI A;  2PX0 A;  2YL0 A;  1O3U A;  3SP1 A;  1FNT c;  1RXQ A;  4N6C A;  3VAY A;  2BC5 A;  4O6Y A;  2IXN A;  2NUT A;  1YA9 A;  3IPM O;  1G4W R;  2KC3 A;  4MTF A;  3ZVR A;  4Q7C A;  4YJW A;  2XLH A;  1KNY A;  3NMI A;  4BJ1 A;  1PCX A;  3U2L A;  4PFP A;  1FR0 A;  1YDI A;  5KYW A;  5A6B D;  2WVO A;  2XS1 A;  1I4Y A;  3C8G A;  3K1I A;  2G62 A;  3JSE O;  5JSL A;  2VAS A;  1OCZ C;  2Y3D A;  3DMD A;  3RQF A;  5D92 A;  1OR2 A;  4MTG A;  1TFO B;  3ZTM A;  4QI0 A;  1LI7 A;  3BRJ A;  3FAP B;  4P9T A;  5KYU B;  4CSA A;  3K7D A;  1L3P A;  3LLI A;  5EK0 A;  2W4M A;  2L9J A;  3MBG A;  3MLG A;  3EFO B;  4MVR A;  3NKD A;  5B1B C;  1AVO B;  3B29 A;  2WB7 A;  4FES A;  4A4A A;  3M1C B;  1T5O A;  4DRH B;  2A68 F;  1HW2 A;  3S29 A;  1OW6 A;  2LD6 A;  1XWJ A;  5DVW A;  3FXH A;  5A6A A;  4LDR A;  2EPM X;  2HMZ A;  3Q6N A;  4I44 A;  1OKK A;  4RD9 A;  3TJ6 A;  2PBE A;  3ZTZ A;  1LS4 A;  2J9U A;  5E3A A;  1LPE A;  3H65 A;  1H9T A;  2L6G A;  4PK4 A;  1HW1 A;  1LIH A;  2KW3 C;  1NSG B;  1VLT A;  5F5H A;  4GYT A;  2HZ8 A;  1FMW A;  2XM4 A;  3POV A;  1TQG A;  3KPH A;  4KNV A;  1TR2 A;  1YAR O;  4EKW A;  2EIK C;  3JSZ A;  3NYM A;  2HFI A;  2J8W A;  3R2P A;  3T6J A;  4PAC A;  2WZL A;  3M4C A;  2R7S A;  3A9C A;  2Y3G A;  1WGW A;  3S28 A;  2CYD A;  2YWA A;  1BR4 A;  2O9X A;  4I1M A;  4LAC B;  2PNO A;  5E33 A;  3ZG1 A;  5JLI A;  3HKK A;  4YN0 B;  5A6J A;  1WTY A;  3DKA A;  5T3T A;  3RKO F;  3ABM C;  1U0B B;  2IXO A;  1S7Z A;  2QE9 A;  3ZQY A;  3FOP A;  2LK4 A;  2XLE A;  2AWY A;  1RKE B;  4PJL A;  4DVY P;  4IB4 A;  4OIP F;  1Q0F A;  3EG9 A;  3QZC A;  4MW8 A;  4Q4Z F;  4U5B E;  4YL1 A;  2YZS A;  1M2V A;  3LEV A;  4JEA A;  1TWC A;  2UUH A;  2Y69 C;  5F28 E;  1E84 A;  5COG A;  3V5Z A;  4C3B A;  3TJ5 A;  3O39 A;  4ER9 A;  3RQG A;  3NMK A;  3ABL C;  1R5I D;  3C18 A;  3U8P A;  1OW8 A;  4O79 A;  4CDA A;  2CNW A;  3CAX A;  2WZG A;  3DAF A;  4DVZ A;  2W45 A;  2XL4 A;  4JVS A;  3JZ0 A;  4JTC B;  5DQZ A;  5JRA A;  5L3V A;  2GAQ A;  2H7O A;  3EGX A;  2CCY A;  5KYX B;  2QY9 A;  2JPU A;  4PJJ A;  2P0N A;  5DS6 A;  1IZM A;  1VB5 A;  3LS0 A;  3SEO A;  2WVQ A;  3ASO C;  2PFD A;  3DM9 B;  3HNI A;  4N06 A;  5T1D B;  3U8V A;  2Q7R A;  3Q7G A;  4E0I A;  3UGO A;  1WAS A;  3AGU A;  1KTM A;  4JTD B;  3ZDL A;  3I5Q A;  2Q9C A;  1MMG A;  2J0X A;  3JYH A;  2OG2 A;  4FAP B;  2OEV A;  2Q9A A;  1RKC A;  3UNG C;  4R32 A;  1T9K A;  2XM0 A;  5BQG A;  1AUE A;  5JS5 A;  5B3S C;  3RQE A;  2XXA B;  3T9O A;  4JJF A;  4E7Z A;  3CEX A;  4U5C E;  1IW7 F;  4J7Y A;  4NCQ A;  1M56 C;  4EIY A;  1SZI A;  3L34 A;  1TKN A;  3G4Z A;  4U5G A;  4X0R A;  3F46 A;  2R7V A;  1ST6 A;  4Z9J A;  4G0H A;  3J06 A;  4C7O A;  1BR2 A;  3ECS A;  2EIM C;  1JR8 A;  4XPX A;  2NUP B;  5KYY B;  2YKZ A;  4WGZ A;  3CQZ A;  1VYK A;  1RCP A;  1BDJ B;  3U9M A;  1FFH A;  2RD9 A;  3AG1 C;  2ZXW C;  2C03 A;  1QQ3 A;  1Z5Z A;  2GDC A;  5L0I A;  1QPU A;  2KQ9 A;  3NG1 A;  1OCO C;  2VB6 A;  4IAQ A;  2DYS C;  1QSP A;  2ZXO A;  5GPG B;  5TJ5 E;  2IOQ A;  3C63 A;  1D0X A;  3O10 A;  3RIP A;  1FFT C;  2YRF A;  2ZD9 A;  5CI9 A;  2VH3 A;  1CPR A;  2EIJ C;  2LCH A;  2HMQ A;  2PX3 A;  2XLM A;  4NQF A;  1R4T A;  2ASR A;  3B71 A;  3LES A;  5JP7 A;  4HE8 D;  4KBL A;  4AL0 A;  4AE4 A;  4CDV A;  4OIO F;  4BG0 A;  1A7E A;  2EPL X;  1TWH A;  1MMN A;  2DI3 A;  5FZT A;  1OCR C;  2XLO A;  1JOG A;  5B1A C;  1G8X A;  2HSB A;  5L0F A;  2BE5 F;  2V3C C;  2D5R B;  2I15 A;  2OKU A;  3HLZ A;  2XLD A;  3AG4 C;  1Q0D A;  2GWW A;  1T6U A;  3R7C A;  5DLJ A;  4ZLC A;  1RJ9 A;  2NUT B;  1TWG A;  2X0C A;  1Z63 A;  3L1M A;  4LER A;  1NG1 A;  2DB4 A;  3NYJ A;  4U9E A;  3RYL A;  1VK5 A;  4BJ6 A;  4D4N A;  1ZU5 A;  2HSQ A;  4FX5 A;  4U5H A;  3O55 A;  1ZHZ A;  4JIO A;  3B9Q A;  4W8P A;  1OXB A;  2HJ3 A;  3IHU A;  1SMY F;  3NRH A;  5KYW B;  1Q0G A;  3S84 A;  3C8G B;  2WZF A;  4K1O A;  3PDM P;  4XPW A;  1Q0K A;  2IXP A;  1LS1 A;  2I8B A;  5FCL A;  1C02 A;  1YA7 O;  2HS5 A;  1V55 C;  1ZYR F;  1OR3 A;  2J9V A;  2Q9B A;  4O7G A;  3VF0 A;  4I3M A;  4E17 A;  3EZH A;  1BR1 A;  2FGY A;  3DI5 A;  1S05 A;  2J46 A;  3M79 A;  3G4X A;  3GEH A;  1CGM E;  2Q4F A;  3GOD A;  1ZU4 A;  2IBF A;  3EH1 A;  3GEE A;  2L6H A;  2R7O A;  3KKB A;  2GA0 A;  4CIP A;  4J30 B;  1WWP A;  3RH3 A;  3C8G D;  4XEF A;  3PMR A;  2QTV A; 
#chains in the Genus database with same CATH homology
 1Q0F A;  1T6U A;  1Q0K A;  1T6Q A;  3G4X A;  4NCQ A;  3G4Z A;  1T6I A;  3G50 A;  1Q0G A;  1Q0D A;  1Q0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...