1Q0FA

Crystal structure of ni-containing superoxide dismutase with ni-ligation corresponding to the state after partial x-ray-induced reduction
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
117
structure length
117
Chain Sequence
HCDLPCGVYDPAQARIEAESVKAIQEKMAANDDLHFQIRATVIKEQRAELAKHHLDVLWSDYFKPPHFESYPELHTLVNEAVKALSAAKASTDPATGQKALDYIAQIDKIFWETKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of nickel-containing superoxide dismutase reveals another type of active site
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Ni]
total genus 51
structure length 117
sequence length 117
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2003-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.400 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nickel-containing superoxide dismutase 1q0fA00
1Q0KA 4NCQA 3G50A 3G4XA 1T6IA 1T6QA 1Q0FA 1T6UA 3G4ZA 1Q0DA 1Q0GA 1Q0MA
chains in the Genus database with same CATH superfamily
1YVIA 4OD5A 3ZVRA 3HTKC 2WZGA 3M4BA 4P9FA 4YK5A 3T6GB 2PBEA 2Y39A 5DQZA 3X1OA 4IAQA 4BG0A 1V4AA 3AG3C 3SNHA 3H65A 3JSEO 4CJGA 2Q4FA 1ORSC 1AVOB 1SMYF 3LEOA 1VLTA 1NSGB 1H6GA 3S9OA 4MTFA 5A6KA 3KMIA 2G3KA 1KNYA 2LFDA 3PMRA 3QW1A 3ECSA 5BQIA 1M2OA 1V55C 4C3EA 2WVOA 3QVYA 4CS9C 3KH2A 1M6TA 4M63A 3U3FA 5HV9A 2D4UA 3S27A 1WASA 2EPKX 1CGNA 5T3TA 4EHPA 1ZHXA 2ZXWC 4GYTA 5L0FA 3DM9B 3AQBA 1VMAA 1YLMA 4I44A 2Y3DA 5L0JA 2HV7A 3IQTA 1VLSA 4WABA 2ASRA 3ATPA 2B0HA 2J9VA 1QVXA 1K40A 2Y3GA 1XWJA 4U5FE 1LE4A 2J9BA 5F5HA 2Q9CA 1SZIA 1W2WA 2F22A 5KYXB 4XQ1A 1H9GA 3S28A 3EHNA 2R7SA 2OJQA 4XLNF 4K7BA 2R7RA 3M1CB 5COMA 2NUTA 4ULVA 3AOUA 2OCCC 1MQVA 2NUPB 3LS1A 1YARO 4MTGA 1HY5A 2QUPA 2AWYA 1UG7A 2VH3A 5A6BA 1T9KA 3U3BA 3Q7LA 3M15A 3RIPA 1Y4CA 1D0ZA 3CSKA 5T3WA 3ZDLA 2O9XA 4BJ1A 1YZAA 4J32B 1RKEA 2R7TA 2NSFA 2A0BA 3N24A 3TJ6A 1JOGA 3VYWA 5KYNA 4LACB 4CS8A 1WGWA 3L1MA 2R7QA 5CI9A 3UMHA 4BEMJ 3JYHA 3ABLC 3ZG1A 3IQCA 4NC3A 2L7AA 2WZLA 2CCYA 3EHMA 3AG4C 3N0TA 1ZU4A 1RJ9B 2OU6A 1UFBA 2MYSA 2P6VA 2ZXOA 3HNJA 4JCHA 5E2QA 4PJLA 2CNWD 3POVA 3QMKA 2YVKA 4RBNA 3W2VA 1E86A 5AC4A 3W4YA 1FAPB 2IOQA 3LAYA 1VYKA 4QI0A 3FHDA 4U9EA 1HW2A 2R02A 4YWQA 1PCXA 5B1AC 1TKNA 3MBGA 1PD1A 2XLHA 3ZQYA 4IARA 4YT2A 4EKWA 2JPUA 2A68F 2CYDA 3RQFA 2PP4A 4XPWA 1M2VB 2LCHA 1R5ID 3GM2A 3HLZA 5DLJA 5JT4A 3F46A 2XXAB 1TQGA 2FAPB 2HKVA 2J8WA 2KYHA 3KYIA 4HEAJ 4RD9A 5D91A 2OJED 1Q0FA 4U5BE 3KYJA 3NYJA 4P9TA 4YJWA 1NU9C 4MVQA 3W8IA 4BJ5A 2Y69C 2YLIA 3MLGA 2DB4A 4B6IA 4KC9A 1O87A 5A6BD 2KQ9A 3EFOB 2QLAA 3JT1A 1EA8A 1LM3B 1OW7A 3HNKA 4DRIB 1Q0MA 4HFFB 2BL2A 3EZHA 3NMKA 4XPXA 4XEKA 3GEEA 5B3SC 4DBQA 2V26A 1D0YA 1OKKD 4YT5A 2OG2A 3TK0A 4O79A 2QE9A 2YLGA 1ORYA 1YYXA 2PX3A 3NG1A 1WTYA 4XPYA 2W45A 4DOZA 2YKZA 4JIOA 2XXAA 1Q0KA 2J46A 1JR8A 3AG2C 3DWWA 3QTHA 3A9CA 1WWPA 2Q9BA 2VCCA 2WZFA 1H7IA 2IXPA 3I5QA 3LLKA 2H7OA 4EWCA 2E87A 1NG1A 1U89A 2FGYA 2J0WA 3RVZA 3RYLA 2PNOA 1WN0A 1OQCA 3KPHA 3Q7GA 3GM3A 1JPJA 1FFHA 1MMDA 1S7ZA 2EIMC 1PV3A 3EZIA 2DYSC 2KK1A 3GEHA 4IRUA 4NY3A 4EBKA 2IXMA 4JVSA 3O6XA 2M4EA 4XWJA 3DJUB 5KYXA 4PR9A 1C17M 1ORJA 2QTVA 4I1MA 2X0CA 3FVYA 5KYWB 3SXMA 3M4CA 3OEOA 2LFFA 2XLOA 4NCQA 5JP7A 5COGA 2L6HA 4O6YA 2J7PA 3JSZA 3SYNA 1ZW2A 2ZPAA 2CGEA 4O6NA 4JJFA 4Z9IA 3RH3A 1VB5A 3US6A 1Z3IX 4C3DA 2Q00A 1NLXA 3UR3C 2CNWA 3EG9A 4WJ0A 3EH1A 3V7OA 2A69F 1G5ZA 3S29A 3ASNC 3DM5A 1BDJB 3L34A 4KI2A 1JRAA 1YA7O 2LSEA 3LLIA 2P1AA 4IJJA 4O7GA 2R7UA 2XL6A 2YWAA 4MS2A 3EGXB 3G4ZA 3KKBA 2GWWA 1FTSA 2P0NA 4N4WA 3C63A 4FAPB 4CJOA 1NBBA 2R7OA 4EUKB 2W9YA 4H4KC 3ZSUA 1XZQA 4JJGA 3E9VA 1OR2A 2HS5A 3ZTMA 3DMDA 3LESA 256BA 4PFOA 3V5YA 1QKRA 3FOPA 1VYIA 4NTBA 4W8PA 2IXNA 3IHUA 1MMNA 1T6QA 3CZ6A 3DJNB 4U5DE 5E3AA 4AL0A 1OR3A 5DVWA 5DS6A 3U2LA 1OW8A 5L0CA 5JRAA 3C18A 1E84A 3ITFA 1NZEA 3RVYA 5HSWA 3C62A 4PJMA 5A6JA 1JMWA 1AEPA 1QLEC 2FFHA 5KYUA 5IY5C 3PHF2 2LIGA 2AWCA 3LS0A 4WGZA 5A69A 1BR2A 3L0IA 4C3BA 2J7PD 1D1BA 1JPNA 3LUTB 4YN0B 1V54C 3K33A 4F4BA 3W8HA 3TULA 4JCZA 1N1CA 5E3CA 1Z23A 2RSEB 1T5OA 3GEIA 5L0DA 1SYQA 1TFKB 2R03A 5T1DB 4CIHA 1LE2A 3SEOA 3LNMB 1LIHA 2ZD9A 4XEFA 4CIPA 3U8PA 1QZXA 2V3CC 2WB7A 4C7OB 1FR0A 2GDCA 5L3VA 2CDQA 1ZW3A 1K05A 3U9JA 4BJ5C 3I5PA 4FX5A 3DZAA 4H54A 3DI5A 3JRMO 3M79A 1SR2A 3C8GD 1C02A 1J8YF 1G4US 2HV6A 4G0HA 4I3MA 5AGFA 3K1IC 3RQEA 2ICWG 3UNGC 4ANJA 5L3QA 1ZYRF 1YAUO 3SZRA 3QZCA 1GM5A 2KSFA 2YLDA 3GORA 1L3PA 2HSQA 3R2PA 2LD6A 2OEVA 1TFOB 4YT8A 2EILC 2OKUA 3MYIA 4LDRA 1YA9A 2W4BA 1BBHA 1CPRA 2YL3A 5COFA 3J06A 1ZHWA 1HE9A 1OCCC 3I4UA 3V5ZA 4CDYA 2HJ3A 3WG7C 5F28E 4D4XA 4OIQF 5DS4A 4BJTA 2EPNA 2XRHA 1LS4A 2NUTB 4KBLA 2EPMX 2UUHA 3SXYA 3OA1A 3JZ0A 3NDBB 3AJMA 3FOOA 1A0BA 4MVSA 4Q7CA 3T6JA 3U2MA 2XLWA 1GGQA 1MMAA 2A6HF 3NYLA 1HE1A 5JVEA 1T01A 4KNVA 4YL0A 4IWBA 4U5CE 4QI2A 2VC9A 5CI8A 3ZIBA 2M64A 4A4AA 3RKOF 4P6IC 3FDQA 3LEVA 1Z5ZA 3VM6A 3ZWIA 2ETSA 2IXOA 2LK4A 5CIVA 1CPQA 3ZC4A 4GEHA 1CGME 3LJBA 4PACA 4NTAA 3TD7A 1M2VA 5B1BC 4E18A 2A1DD 4DVZA 1BR1A 5JS5A 1DOWA 4JRZA 1G8XA 2YZSA 2HSBA 3O39A 1IW7F 2A6EF 2KC3A 4AX2A 3CEXA 4IAOA 2R25A 5JLIA 2XSEA 2RD9A 3EQLF 3EGXA 3GODA 3ZQVA 4Q4ZF 1O3UA 1LVKA 2XLDA 2XLEA 4MW8A 4EBBA 4GQHA 5DQTA 4EIYA 4XLPF 4JTDB 2XM0A 3BRJA 2B0JA 1NFNA 2EPOA 2Q7RA 2QY9A 1TWAA 4MVUA 2XLVA 4JC7A 1IZMA 3TQOA 3T4RA 1RMVA 3U5SA 1JAFA 3PCVA 4N06A 3T9OA 4AL1A 1TWHA 1HMDA 1OCZC 4EBJA 4C7OA 4IGGA 2DI3A 1WOLA 1OW6A 2JX0A 2R7XA 2TMVP 1VTMP 4OINF 5BQHA 5KYYA 3DE8A 3DXJF 1YYJA 5L0IA 2EIKC 3NYMA 4U9DA 1V74B 3MFNA 2XS1A 3CQZA 1KTMA 4CDAA 4J7YA 4E7ZA 3VRCA 3X2QC 4LLEA 2LP4A 3TJ5A 2KW3C 3B29A 1E2XA 1OKKA 4U5GA 1M57C 2PF4E 5E33A 3SXZA 3NMIA 4MW3A 3RW0A 1AUEA 1Y6DA 1L7CA 4PFPA 1RXQA 1ZVZA 2P7VA 1D1AA 4NTFA 4CS9A 1MNDA 1Z7Qc 3L8IA 4DRHB 2YL7A 1HMOA 1T6IA 2YL1A 1Q0DA 1ZHYA 4LERA 4D4NA 1FFTC 4U5EE 2I15A 4PJNA 1OXBA 3H2VA 3G4XA 3UMKA 1APCA 4FESA 4JTCB 2P61A 3IEEA 3GWNA 4NQFA 4XTKA 4G78A 2AVKA 3U8VA 2BC5A 1TWGA 3JTLO 1DOVA 1QPUA 3RFYA 1WATA 1CGOA 1T6UA 2I8BA 2L81A 3S90A 2H7BA 2R7VA 4O6MA 1B68A 3QW0A 4CS8C 1U6HA 1XZPA 3IPMO 5FZTA 1M56C 2VB6A 3B71A 3DD7A 3MX3A 3OWTA 4PK4A 2DYRC 2HJMA 1MMGA 3TOLA 3WHNA 4DVYP 2IYLD 1EKYA 5KYYB 2HMZA 2EIJC 3DE9A 1GQAA 1RCPA 3IQ6A 2G3VA 1D0XA 2D5RB 4R32A 1D1CA 3KL4A 3WAQA 1MNEA 3FXHA 4JEBA 2Q9AA 2YQYA 5L0GA 1YDIA 3EFOA 4JURI 4MVOA 3DAGA 4CSAA 2DGJA 4J30B 4JE9A 2HZ8A 2MHRA 2Z15A 3L8JA 3O55A 5EGYA 1FNTc 4RDAA 4OIRF 1S05A 3UGOA 1U0BB 1PD0A 2J9UA 3LNRA 1QSPA 4LLCA 2CW0F 5K0IA 2ZXPA 3AQCA 2A0UA 2XL8A 2AP3A 3T6BA 4KNWA 3R7CA 1EQ1A 3C8GB 1LKXA 1RKEB 3K1HA 1C03A 1TR2A 4J7TA 5GPGB 5L0HA 1ZU5A 3QVZA 4ER9A 4A2NB 5BUOA 3FAPB 2PFDA 4QDLA 1BR4A 3V5XA 1Z6AA 4K1OA 1K04A 2R05A 4MNDA 2GFHA 1I4ZA 1ST6A 1A41A 2EINC 2QNLA 3C8GA 3JCUQ 4E0IA 3S0XA 2YEVA 3GM1A 1I4YA 2BE5F 4BJ6A 3RF3A 4BJ6C 4UDVA 3NRHA 1O5HA 2L6FA 2IBFA 2VASA 2WVQA 3DAFA 4MVMA 4ZLCA 5B3IA 1TWCA 4HFKB 4Z9HA 2HUJA 5DS5A 3BEHA 1ZHTA 1YZCA 4AE4A 5TJ5E 2J0XA 4W8KA 1KU2A 3F47A 4K0DA 4CDVA 1ZZPA 3GANA 2WVNA 2L6GA 4YL1A 1H9TA 5JUAA 4MVRA 5BQGA 3W2WA 4BEJA 4N6CA 4PJJA 4DRJB 4Z9JA 1EI7A 3NMJA 4E7SA 4ZLDA 4MQ9F 1G4WR 4LDKA 2C03A 2VCAA 2IM8A 1ZHZA 2XLMA 3C7JA 4E17A 1Q0GA 3HKKA 1YJGA 2Y3BA 1R4TA 4ONSA 3CAXA 2NG1A 2KGOA 2Y3HA 2ZXRA 3U0CA 5EHHA 2NPUA 4JZAA 1A7EA 1FMWA 1E83A 2H8AA 2KNHA 5JSLA 3B0UX 4G7OF 1RKCA 2NUPA 3AGUA 3GWLA 4E0HA 1LS1A 3AGTA 3JRTA 2KJGA 3K66A 2EPLX 4I1OB 2AU5A 1NU7D 2GAQA 3DKAA 4G7HF 1A7DA 1J8MF 2R7WA 4ULWA 3RQGA 4G7ZF 2C04A 2WL8A 3UMIA 3HNIA 4OD4A 4AK9A 4DXWA 2X51A 3SP1A 4MTOA 2HFIA 2G62A 3B9QA 3WODF 4AE4B 1VK5A 3C8ZA 1RJ9A 1OCOC 2GA0A 1QQ3A 1I5NA 4CSAC 3EGDA 4IB4A 3ZTZA 3S84A 2HMQA 1LPEA 2J9WA 3ABKC 5FCLA 4FWVA 3AG1C 2XM4A 3Q6NA 3FMSA 3N2ZB 4WGYA 3A11A 4JW1A 4L6RA 4CS7A 1E85A 3PDMP 5A6AA 2MWQA 3IQ5A 4OIOF 3U9MA 2R9RB 3EH2A 1LI5A 1F1MA 2LQGA 3K1IA 4MVZA 3VAYA 4CBEA 3Q6MA 3MYFA 2OQMA 3E70C 3B0PA 3O10A 3VF0A 3B0VC 1LI7A 3EPVA 3ABMC 3JYYA 1Z63A 2H7VC 2Q3TA 3EJNA 1BZ4A 2YRFA 3G50A 3HNLA 4JKVA 4N6HA 2XL4A 5KYUB 4LDQA 1GS9A 3NKDA 5EK0A 2NSGA 4JEAA 3UGPA 1A7VA 3ASOC 3EG9B 3SXKA 4CX9A 1NFOA 2VCBA 1SF8A 2OOCA 2YHSA 3K6BA 4YT4A 1OCRC 1VOMA 1OXKA 2UUIA 4YL3A 4DJ9A 5F5FA 4U5HA 4XEVA 2L9JA 2W4MA 2J45A 4JTAB 4Q5SF 5D92A 2OEXA 4BPMA 3HJCA 2PX0A 3TOMA 3K7DA 2XS8A 3FAJA 5KYWA 4OIPF 2YL0A 4HE8D 1FMVA 2JD3A 3EGDB 3H2UA 3NKEA 4X0RA 4DBRA 5AC5A 1HW1A
chains in the Genus database with same CATH topology
1Q0KA 4NCQA 3G50A 3G4XA 1T6IA 1T6QA 1Q0FA 1T6UA 3G4ZA 1Q0DA 1Q0GA 1Q0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q0K A;  4NCQ A;  3G50 A;  3G4X A;  1T6I A;  1T6Q A;  1Q0F A;  1T6U A;  3G4Z A;  1Q0D A;  1Q0G A;  1Q0M A; 
#chains in the Genus database with same CATH topology
 1YVI A;  4OD5 A;  3ZVR A;  3HTK C;  2WZG A;  3M4B A;  4P9F A;  4YK5 A;  3T6G B;  2PBE A;  2Y39 A;  5DQZ A;  3X1O A;  4IAQ A;  4BG0 A;  1V4A A;  3AG3 C;  3SNH A;  3H65 A;  3JSE O;  4CJG A;  2Q4F A;  1ORS C;  1AVO B;  1SMY F;  3LEO A;  1VLT A;  1NSG B;  1H6G A;  3S9O A;  4MTF A;  5A6K A;  3KMI A;  2G3K A;  1KNY A;  2LFD A;  3PMR A;  3QW1 A;  3ECS A;  5BQI A;  1M2O A;  1V55 C;  4C3E A;  2WVO A;  3QVY A;  4CS9 C;  3KH2 A;  1M6T A;  4M63 A;  3U3F A;  5HV9 A;  2D4U A;  3S27 A;  1WAS A;  2EPK X;  1CGN A;  5T3T A;  4EHP A;  1ZHX A;  2ZXW C;  4GYT A;  5L0F A;  3DM9 B;  3AQB A;  1VMA A;  1YLM A;  4I44 A;  2Y3D A;  5L0J A;  2HV7 A;  3IQT A;  1VLS A;  4WAB A;  2ASR A;  3ATP A;  2B0H A;  2J9V A;  1QVX A;  1K40 A;  2Y3G A;  1XWJ A;  4U5F E;  1LE4 A;  2J9B A;  5F5H A;  2Q9C A;  1SZI A;  1W2W A;  2F22 A;  5KYX B;  4XQ1 A;  1H9G A;  3S28 A;  3EHN A;  2R7S A;  2OJQ A;  4XLN F;  4K7B A;  2R7R A;  3M1C B;  5COM A;  2NUT A;  4ULV A;  3AOU A;  2OCC C;  1MQV A;  2NUP B;  3LS1 A;  1YAR O;  4MTG A;  1HY5 A;  2QUP A;  2AWY A;  1UG7 A;  2VH3 A;  5A6B A;  1T9K A;  3U3B A;  3Q7L A;  3M15 A;  3RIP A;  1Y4C A;  1D0Z A;  3CSK A;  5T3W A;  3ZDL A;  2O9X A;  4BJ1 A;  1YZA A;  4J32 B;  1RKE A;  2R7T A;  2NSF A;  2A0B A;  3N24 A;  3TJ6 A;  1JOG A;  3VYW A;  5KYN A;  4LAC B;  4CS8 A;  1WGW A;  3L1M A;  2R7Q A;  5CI9 A;  3UMH A;  4BEM J;  3JYH A;  3ABL C;  3ZG1 A;  3IQC A;  4NC3 A;  2L7A A;  2WZL A;  2CCY A;  3EHM A;  3AG4 C;  3N0T A;  1ZU4 A;  1RJ9 B;  2OU6 A;  1UFB A;  2MYS A;  2P6V A;  2ZXO A;  3HNJ A;  4JCH A;  5E2Q A;  4PJL A;  2CNW D;  3POV A;  3QMK A;  2YVK A;  4RBN A;  3W2V A;  1E86 A;  5AC4 A;  3W4Y A;  1FAP B;  2IOQ A;  3LAY A;  1VYK A;  4QI0 A;  3FHD A;  4U9E A;  1HW2 A;  2R02 A;  4YWQ A;  1PCX A;  5B1A C;  1TKN A;  3MBG A;  1PD1 A;  2XLH A;  3ZQY A;  4IAR A;  4YT2 A;  4EKW A;  2JPU A;  2A68 F;  2CYD A;  3RQF A;  2PP4 A;  4XPW A;  1M2V B;  2LCH A;  1R5I D;  3GM2 A;  3HLZ A;  5DLJ A;  5JT4 A;  3F46 A;  2XXA B;  1TQG A;  2FAP B;  2HKV A;  2J8W A;  2KYH A;  3KYI A;  4HEA J;  4RD9 A;  5D91 A;  2OJE D;  1Q0F A;  4U5B E;  3KYJ A;  3NYJ A;  4P9T A;  4YJW A;  1NU9 C;  4MVQ A;  3W8I A;  4BJ5 A;  2Y69 C;  2YLI A;  3MLG A;  2DB4 A;  4B6I A;  4KC9 A;  1O87 A;  5A6B D;  2KQ9 A;  3EFO B;  2QLA A;  3JT1 A;  1EA8 A;  1LM3 B;  1OW7 A;  3HNK A;  4DRI B;  1Q0M A;  4HFF B;  2BL2 A;  3EZH A;  3NMK A;  4XPX A;  4XEK A;  3GEE A;  5B3S C;  4DBQ A;  2V26 A;  1D0Y A;  1OKK D;  4YT5 A;  2OG2 A;  3TK0 A;  4O79 A;  2QE9 A;  2YLG A;  1ORY A;  1YYX A;  2PX3 A;  3NG1 A;  1WTY A;  4XPY A;  2W45 A;  4DOZ A;  2YKZ A;  4JIO A;  2XXA A;  1Q0K A;  2J46 A;  1JR8 A;  3AG2 C;  3DWW A;  3QTH A;  3A9C A;  1WWP A;  2Q9B A;  2VCC A;  2WZF A;  1H7I A;  2IXP A;  3I5Q A;  3LLK A;  2H7O A;  4EWC A;  2E87 A;  1NG1 A;  1U89 A;  2FGY A;  2J0W A;  3RVZ A;  3RYL A;  2PNO A;  1WN0 A;  1OQC A;  3KPH A;  3Q7G A;  3GM3 A;  1JPJ A;  1FFH A;  1MMD A;  1S7Z A;  2EIM C;  1PV3 A;  3EZI A;  2DYS C;  2KK1 A;  3GEH A;  4IRU A;  4NY3 A;  4EBK A;  2IXM A;  4JVS A;  3O6X A;  2M4E A;  4XWJ A;  3DJU B;  5KYX A;  4PR9 A;  1C17 M;  1ORJ A;  2QTV A;  4I1M A;  2X0C A;  3FVY A;  5KYW B;  3SXM A;  3M4C A;  3OEO A;  2LFF A;  2XLO A;  4NCQ A;  5JP7 A;  5COG A;  2L6H A;  4O6Y A;  2J7P A;  3JSZ A;  3SYN A;  1ZW2 A;  2ZPA A;  2CGE A;  4O6N A;  4JJF A;  4Z9I A;  3RH3 A;  1VB5 A;  3US6 A;  1Z3I X;  4C3D A;  2Q00 A;  1NLX A;  3UR3 C;  2CNW A;  3EG9 A;  4WJ0 A;  3EH1 A;  3V7O A;  2A69 F;  1G5Z A;  3S29 A;  3ASN C;  3DM5 A;  1BDJ B;  3L34 A;  4KI2 A;  1JRA A;  1YA7 O;  2LSE A;  3LLI A;  2P1A A;  4IJJ A;  4O7G A;  2R7U A;  2XL6 A;  2YWA A;  4MS2 A;  3EGX B;  3G4Z A;  3KKB A;  2GWW A;  1FTS A;  2P0N A;  4N4W A;  3C63 A;  4FAP B;  4CJO A;  1NBB A;  2R7O A;  4EUK B;  2W9Y A;  4H4K C;  3ZSU A;  1XZQ A;  4JJG A;  3E9V A;  1OR2 A;  2HS5 A;  3ZTM A;  3DMD A;  3LES A;  256B A;  4PFO A;  3V5Y A;  1QKR A;  3FOP A;  1VYI A;  4NTB A;  4W8P A;  2IXN A;  3IHU A;  1MMN A;  1T6Q A;  3CZ6 A;  3DJN B;  4U5D E;  5E3A A;  4AL0 A;  1OR3 A;  5DVW A;  5DS6 A;  3U2L A;  1OW8 A;  5L0C A;  5JRA A;  3C18 A;  1E84 A;  3ITF A;  1NZE A;  3RVY A;  5HSW A;  3C62 A;  4PJM A;  5A6J A;  1JMW A;  1AEP A;  1QLE C;  2FFH A;  5KYU A;  5IY5 C;  3PHF 2;  2LIG A;  2AWC A;  3LS0 A;  4WGZ A;  5A69 A;  1BR2 A;  3L0I A;  4C3B A;  2J7P D;  1D1B A;  1JPN A;  3LUT B;  4YN0 B;  1V54 C;  3K33 A;  4F4B A;  3W8H A;  3TUL A;  4JCZ A;  1N1C A;  5E3C A;  1Z23 A;  2RSE B;  1T5O A;  3GEI A;  5L0D A;  1SYQ A;  1TFK B;  2R03 A;  5T1D B;  4CIH A;  1LE2 A;  3SEO A;  3LNM B;  1LIH A;  2ZD9 A;  4XEF A;  4CIP A;  3U8P A;  1QZX A;  2V3C C;  2WB7 A;  4C7O B;  1FR0 A;  2GDC A;  5L3V A;  2CDQ A;  1ZW3 A;  1K05 A;  3U9J A;  4BJ5 C;  3I5P A;  4FX5 A;  3DZA A;  4H54 A;  3DI5 A;  3JRM O;  3M79 A;  1SR2 A;  3C8G D;  1C02 A;  1J8Y F;  1G4U S;  2HV6 A;  4G0H A;  4I3M A;  5AGF A;  3K1I C;  3RQE A;  2ICW G;  3UNG C;  4ANJ A;  5L3Q A;  1ZYR F;  1YAU O;  3SZR A;  3QZC A;  1GM5 A;  2KSF A;  2YLD A;  3GOR A;  1L3P A;  2HSQ A;  3R2P A;  2LD6 A;  2OEV A;  1TFO B;  4YT8 A;  2EIL C;  2OKU A;  3MYI A;  4LDR A;  1YA9 A;  2W4B A;  1BBH A;  1CPR A;  2YL3 A;  5COF A;  3J06 A;  1ZHW A;  1HE9 A;  1OCC C;  3I4U A;  3V5Z A;  4CDY A;  2HJ3 A;  3WG7 C;  5F28 E;  4D4X A;  4OIQ F;  5DS4 A;  4BJT A;  2EPN A;  2XRH A;  1LS4 A;  2NUT B;  4KBL A;  2EPM X;  2UUH A;  3SXY A;  3OA1 A;  3JZ0 A;  3NDB B;  3AJM A;  3FOO A;  1A0B A;  4MVS A;  4Q7C A;  3T6J A;  3U2M A;  2XLW A;  1GGQ A;  1MMA A;  2A6H F;  3NYL A;  1HE1 A;  5JVE A;  1T01 A;  4KNV A;  4YL0 A;  4IWB A;  4U5C E;  4QI2 A;  2VC9 A;  5CI8 A;  3ZIB A;  2M64 A;  4A4A A;  3RKO F;  4P6I C;  3FDQ A;  3LEV A;  1Z5Z A;  3VM6 A;  3ZWI A;  2ETS A;  2IXO A;  2LK4 A;  5CIV A;  1CPQ A;  3ZC4 A;  4GEH A;  1CGM E;  3LJB A;  4PAC A;  4NTA A;  3TD7 A;  1M2V A;  5B1B C;  4E18 A;  2A1D D;  4DVZ A;  1BR1 A;  5JS5 A;  1DOW A;  4JRZ A;  1G8X A;  2YZS A;  2HSB A;  3O39 A;  1IW7 F;  2A6E F;  2KC3 A;  4AX2 A;  3CEX A;  4IAO A;  2R25 A;  5JLI A;  2XSE A;  2RD9 A;  3EQL F;  3EGX A;  3GOD A;  3ZQV A;  4Q4Z F;  1O3U A;  1LVK A;  2XLD A;  2XLE A;  4MW8 A;  4EBB A;  4GQH A;  5DQT A;  4EIY A;  4XLP F;  4JTD B;  2XM0 A;  3BRJ A;  2B0J A;  1NFN A;  2EPO A;  2Q7R A;  2QY9 A;  1TWA A;  4MVU A;  2XLV A;  4JC7 A;  1IZM A;  3TQO A;  3T4R A;  1RMV A;  3U5S A;  1JAF A;  3PCV A;  4N06 A;  3T9O A;  4AL1 A;  1TWH A;  1HMD A;  1OCZ C;  4EBJ A;  4C7O A;  4IGG A;  2DI3 A;  1WOL A;  1OW6 A;  2JX0 A;  2R7X A;  2TMV P;  1VTM P;  4OIN F;  5BQH A;  5KYY A;  3DE8 A;  3DXJ F;  1YYJ A;  5L0I A;  2EIK C;  3NYM A;  4U9D A;  1V74 B;  3MFN A;  2XS1 A;  3CQZ A;  1KTM A;  4CDA A;  4J7Y A;  4E7Z A;  3VRC A;  3X2Q C;  4LLE A;  2LP4 A;  3TJ5 A;  2KW3 C;  3B29 A;  1E2X A;  1OKK A;  4U5G A;  1M57 C;  2PF4 E;  5E33 A;  3SXZ A;  3NMI A;  4MW3 A;  3RW0 A;  1AUE A;  1Y6D A;  1L7C A;  4PFP A;  1RXQ A;  1ZVZ A;  2P7V A;  1D1A A;  4NTF A;  4CS9 A;  1MND A;  1Z7Q c;  3L8I A;  4DRH B;  2YL7 A;  1HMO A;  1T6I A;  2YL1 A;  1Q0D A;  1ZHY A;  4LER A;  4D4N A;  1FFT C;  4U5E E;  2I15 A;  4PJN A;  1OXB A;  3H2V A;  3G4X A;  3UMK A;  1APC A;  4FES A;  4JTC B;  2P61 A;  3IEE A;  3GWN A;  4NQF A;  4XTK A;  4G78 A;  2AVK A;  3U8V A;  2BC5 A;  1TWG A;  3JTL O;  1DOV A;  1QPU A;  3RFY A;  1WAT A;  1CGO A;  1T6U A;  2I8B A;  2L81 A;  3S90 A;  2H7B A;  2R7V A;  4O6M A;  1B68 A;  3QW0 A;  4CS8 C;  1U6H A;  1XZP A;  3IPM O;  5FZT A;  1M56 C;  2VB6 A;  3B71 A;  3DD7 A;  3MX3 A;  3OWT A;  4PK4 A;  2DYR C;  2HJM A;  1MMG A;  3TOL A;  3WHN A;  4DVY P;  2IYL D;  1EKY A;  5KYY B;  2HMZ A;  2EIJ C;  3DE9 A;  1GQA A;  1RCP A;  3IQ6 A;  2G3V A;  1D0X A;  2D5R B;  4R32 A;  1D1C A;  3KL4 A;  3WAQ A;  1MNE A;  3FXH A;  4JEB A;  2Q9A A;  2YQY A;  5L0G A;  1YDI A;  3EFO A;  4JUR I;  4MVO A;  3DAG A;  4CSA A;  2DGJ A;  4J30 B;  4JE9 A;  2HZ8 A;  2MHR A;  2Z15 A;  3L8J A;  3O55 A;  5EGY A;  1FNT c;  4RDA A;  4OIR F;  1S05 A;  3UGO A;  1U0B B;  1PD0 A;  2J9U A;  3LNR A;  1QSP A;  4LLC A;  2CW0 F;  5K0I A;  2ZXP A;  3AQC A;  2A0U A;  2XL8 A;  2AP3 A;  3T6B A;  4KNW A;  3R7C A;  1EQ1 A;  3C8G B;  1LKX A;  1RKE B;  3K1H A;  1C03 A;  1TR2 A;  4J7T A;  5GPG B;  5L0H A;  1ZU5 A;  3QVZ A;  4ER9 A;  4A2N B;  5BUO A;  3FAP B;  2PFD A;  4QDL A;  1BR4 A;  3V5X A;  1Z6A A;  4K1O A;  1K04 A;  2R05 A;  4MND A;  2GFH A;  1I4Z A;  1ST6 A;  1A41 A;  2EIN C;  2QNL A;  3C8G A;  3JCU Q;  4E0I A;  3S0X A;  2YEV A;  3GM1 A;  1I4Y A;  2BE5 F;  4BJ6 A;  3RF3 A;  4BJ6 C;  4UDV A;  3NRH A;  1O5H A;  2L6F A;  2IBF A;  2VAS A;  2WVQ A;  3DAF A;  4MVM A;  4ZLC A;  5B3I A;  1TWC A;  4HFK B;  4Z9H A;  2HUJ A;  5DS5 A;  3BEH A;  1ZHT A;  1YZC A;  4AE4 A;  5TJ5 E;  2J0X A;  4W8K A;  1KU2 A;  3F47 A;  4K0D A;  4CDV A;  1ZZP A;  3GAN A;  2WVN A;  2L6G A;  4YL1 A;  1H9T A;  5JUA A;  4MVR A;  5BQG A;  3W2W A;  4BEJ A;  4N6C A;  4PJJ A;  4DRJ B;  4Z9J A;  1EI7 A;  3NMJ A;  4E7S A;  4ZLD A;  4MQ9 F;  1G4W R;  4LDK A;  2C03 A;  2VCA A;  2IM8 A;  1ZHZ A;  2XLM A;  3C7J A;  4E17 A;  1Q0G A;  3HKK A;  1YJG A;  2Y3B A;  1R4T A;  4ONS A;  3CAX A;  2NG1 A;  2KGO A;  2Y3H A;  2ZXR A;  3U0C A;  5EHH A;  2NPU A;  4JZA A;  1A7E A;  1FMW A;  1E83 A;  2H8A A;  2KNH A;  5JSL A;  3B0U X;  4G7O F;  1RKC A;  2NUP A;  3AGU A;  3GWL A;  4E0H A;  1LS1 A;  3AGT A;  3JRT A;  2KJG A;  3K66 A;  2EPL X;  4I1O B;  2AU5 A;  1NU7 D;  2GAQ A;  3DKA A;  4G7H F;  1A7D A;  1J8M F;  2R7W A;  4ULW A;  3RQG A;  4G7Z F;  2C04 A;  2WL8 A;  3UMI A;  3HNI A;  4OD4 A;  4AK9 A;  4DXW A;  2X51 A;  3SP1 A;  4MTO A;  2HFI A;  2G62 A;  3B9Q A;  3WOD F;  4AE4 B;  1VK5 A;  3C8Z A;  1RJ9 A;  1OCO C;  2GA0 A;  1QQ3 A;  1I5N A;  4CSA C;  3EGD A;  4IB4 A;  3ZTZ A;  3S84 A;  2HMQ A;  1LPE A;  2J9W A;  3ABK C;  5FCL A;  4FWV A;  3AG1 C;  2XM4 A;  3Q6N A;  3FMS A;  3N2Z B;  4WGY A;  3A11 A;  4JW1 A;  4L6R A;  4CS7 A;  1E85 A;  3PDM P;  5A6A A;  2MWQ A;  3IQ5 A;  4OIO F;  3U9M A;  2R9R B;  3EH2 A;  1LI5 A;  1F1M A;  2LQG A;  3K1I A;  4MVZ A;  3VAY A;  4CBE A;  3Q6M A;  3MYF A;  2OQM A;  3E70 C;  3B0P A;  3O10 A;  3VF0 A;  3B0V C;  1LI7 A;  3EPV A;  3ABM C;  3JYY A;  1Z63 A;  2H7V C;  2Q3T A;  3EJN A;  1BZ4 A;  2YRF A;  3G50 A;  3HNL A;  4JKV A;  4N6H A;  2XL4 A;  5KYU B;  4LDQ A;  1GS9 A;  3NKD A;  5EK0 A;  2NSG A;  4JEA A;  3UGP A;  1A7V A;  3ASO C;  3EG9 B;  3SXK A;  4CX9 A;  1NFO A;  2VCB A;  1SF8 A;  2OOC A;  2YHS A;  3K6B A;  4YT4 A;  1OCR C;  1VOM A;  1OXK A;  2UUI A;  4YL3 A;  4DJ9 A;  5F5F A;  4U5H A;  4XEV A;  2L9J A;  2W4M A;  2J45 A;  4JTA B;  4Q5S F;  5D92 A;  2OEX A;  4BPM A;  3HJC A;  2PX0 A;  3TOM A;  3K7D A;  2XS8 A;  3FAJ A;  5KYW A;  4OIP F;  2YL0 A;  4HE8 D;  1FMV A;  2JD3 A;  3EGD B;  3H2U A;  3NKE A;  4X0R A;  4DBR A;  5AC5 A;  1HW1 A; 
#chains in the Genus database with same CATH homology
 1Q0K A;  4NCQ A;  3G50 A;  3G4X A;  1T6I A;  1T6Q A;  1Q0F A;  1T6U A;  3G4Z A;  1Q0D A;  1Q0G A;  1Q0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...