1Q0FA

Crystal structure of ni-containing superoxide dismutase with ni-ligation corresponding to the state after partial x-ray-induced reduction
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
117
structure length
117
Chain Sequence
b'HCDLPCGVYDPAQARIEAESVKAIQEKMAANDDLHFQIRATVIKEQRAELAKHHLDVLWSDYFKPPHFESYPELHTLVNEAVKALSAAKASTDPATGQKALDYIAQIDKIFWETKKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Ni]
molecule tags Oxidoreductase
publication title Crystal structure of nickel-containing superoxide dismutase reveals another type of active site
pubmed doi rcsb
total genus 51
structure length 117
sequence length 117
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2003-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.400 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nickel-containing superoxide dismutase 1q0fA00
3G4XA 1Q0MA 1T6QA 3G4ZA 4NCQA 1Q0GA 1Q0KA 1Q0DA 1T6UA 1Q0FA 3G50A 1T6IA
chains in the Genus database with same CATH superfamily
1VMAA 2GFHA 1Y4CA 4PJJA 1ZYRF 1C17M 2YQYA 4DRJB 4U5CE 1ZW3A 1OW8A 2M4EA 2QTVA 1YA7O 2R7UA 3KPHA 1K05A 5A6BA 4AE4B 4I44A 3JT1A 2CDQA 4U5DE 5FZTA 3TK0A 3UMKA 4A2NB 5IY5C 1OCZC 1T5OA 4JC7A 1V4AA 1WWPA 3GODA 3L0IA 2QE9A 3AG1C 2OU6A 3JYHA 1FMVA 4GEHA 4LDQA 1H7IA 1KNYA 1Z23A 2P7VA 3BRJA 3MLGA 4MVRA 3IPMO 3ITFA 3LLIA 2UUHA 4K0DA 4AL0A 4C3DA 3OA1A 2QNLA 2AWYA 4CSAC 1SF8A 2A68F 4Z9JA 2ZXOA 3MFNA 4MNDA 2JX0A 3TOLA 4YT4A 2HSBA 2J9WA 2ZPAA 2XM0A 3KYJA 2G62A 1J8YF 1TFKB 2J8WA 3U3BA 1C02A 1J8MF 1QZXA 4HFFB 1FAPB 3S9OA 3VAYA 4CS9C 2J45A 5A6JA 4Q5SF 2YL3A 4BG0A 1Y6DA 1CPRA 3T9OA 3ZTMA 3NDBB 5HV9A 2R7OA 2IXOA 3LESA 5KYXB 1APCA 3ZG1A 1BR2A 1OXBA 4GYTA 1YA9A 3O39A 4IWBA 4YN0B 2HFIA 2YLGA 3W2WA 1UG7A 2ZXRA 1ZU5A 2OJED 4NTBA 3SYNA 1OW7A 4XWJA 2MWQA 3S27A 2UUIA 3EZHA 4Z9HA 4P9TA 5JP7A 1L3PA 4WGYA 3ZSUA 4MVQA 2P1AA 4Z9IA 2NG1A 3RKOF 3MYIA 2YL0A 3Q7GA 1MMDA 4OINF 2YWAA 4DBRA 3E9VA 256BA 1BBHA 3JZ0A 3W8IA 3HNIA 4ZLDA 1NFNA 4U5BE 1A7VA 3DKAA 4LLEA 2IBFA 4U9EA 2OEVA 3L8JA 3W8HA 2PX3A 5DQZA 4XQ1A 4YL0A 3HKKA 3RH3A 3TD7A 2XLWA 1ZVZA 2KC3A 5K0IA 1ZZPA 3ZQVA 3IQ6A 2EPKX 3T6JA 2R7RA 5KYXA 2XLDA 4G7OF 2IYLD 3U9MA 5KYNA 2VC9A 3EH1A 3V7OA 2ZXPA 3JRMO 4IAOA 1GM5A 4LDKA 2NUTB 2ZXWC 1T6UA 3SXKA 4MW8A 5CIVA 1AEPA 2LFFA 1G5ZA 1GS9A 3RW0A 4DXWA 4AX2A 3S90A 2ICWG 2NUPA 2NUPB 3RQFA 5KYWB 2HZ8A 4HEAJ 4RDAA 1RJ9B 4P9FA 5COMA 2NSFA 2Q4FA 2J0WA 1EI7A 1PV3A 2DGJA 4L6RA 1YYJA 3LNRA 2DI3A 3SNHA 1VYKA 3ABKC 4C3BA 3JTLO 2LP4A 3K1IA 1Q0MA 3K6BA 1EKYA 1LVKA 1U6HA 1ST6A 2WZFA 1LE2A 1RKCA 2Q3TA 3EPVA 5L0IA 2XL8A 1G4WR 5KYUA 4U5GA 4BJTA 2DYRC 5EK0A 4JKVA 3S29A 2AVKA 1DOWA 3HTKC 2XS1A 3DE9A 1YARO 1TWGA 2HKVA 4BJ1A 1LS1A 2Q9AA 1ORYA 3BEHA 3S0XA 2XM4A 5CI8A 3CQZA 4KI2A 5EHHA 3WHNA 3AQBA 3GORA 3QW1A 1RCPA 4M63A 4AE4A 1QPUA 3EQLF 1T6IA 3ECSA 2LQGA 3M4BA 3NYJA 2W9YA 4IARA 5A6KA 5GPGB 4JVSA 4HFKB 4MTFA 5DLJA 2XLHA 5A6AA 1BDJB 5JVEA 3B0PA 2KW3C 2OJQA 2PFDA 2HSQA 1VK5A 5KYYB 4KNVA 4O6MA 5FCLA 1CPQA 1I4ZA 5JLIA 2XLEA 2IOQA 2JPUA 3EJNA 2CNWD 3U8VA 1D1CA 3CAXA 2LFDA 3ZC4A 4EBJA 1ZHWA 2L6GA 1TWHA 3FMSA 3C8ZA 1QVXA 3RVYA 3FDQA 2J7PA 5F5FA 5T1DB 3IHUA 5B1AC 4I1MA 3RQGA 2HV6A 5D91A 1TWCA 2V26A 1V55C 3C63A 2XXAA 2L6HA 4C7OB 2YVKA 3AJMA 3UMHA 4CBEA 1SMYF 3EH2A 4JEAA 4ULVA 1NZEA 3ATPA 3KH2A 2J46A 3FOOA 2MYSA 4JTAB 3O6XA 1S05A 1LM3B 3CZ6A 4RBNA 4XEVA 1MNEA 1RJ9A 3L1MA 4P6IC 5BQHA 4IJJA 4IB4A 1NLXA 3KKBA 3U2MA 3N2ZB 4O6NA 4O79A 3RQEA 2XSEA 3ABLC 1S7ZA 3K33A 3Q7LA 4EIYA 2R7TA 4MTGA 4PJMA 4XEFA 3G4XA 4H4KC 2EPMX 4LERA 4YL3A 1EQ1A 3I4UA 4CIPA 1T01A 2QUPA 1RMVA 1V54C 3EGDB 1M56C 3LS0A 4WJ0A 3EHNA 3GEIA 2KSFA 4O6YA 3TQOA 1G4US 2EIKC 1JPJA 3SZRA 4EHPA 2PF4E 4D4NA 1NFOA 2R25A 2YL1A 4OIQF 2VH3A 3K7DA 3DE8A 1D0XA 1K04A 2XLOA 4RD9A 4D4XA 2P61A 3U5SA 1OW6A 3K66A 3L34A 2KGOA 3K1HA 4QI2A 4PJLA 1JOGA 2LK4A 2MHRA 1JPNA 3C8GA 3DM5A 4CS7A 1MMAA 5AGFA 4OIPF 2CW0F 3X1OA 1SZIA 3JSZA 4AK9A 2I8BA 2WVOA 2Y39A 2YEVA 3O10A 1SR2A 4G7ZF 4J32B 1T9KA 3DM9B 3UGPA 2PBEA 1VOMA 3H2UA 4E17A 4YT8A 2XS8A 3R7CA 1QSPA 2HJMA 4DBQA 3LAYA 3RFYA 1A7DA 1Z6AA 3NG1A 1V74B 2HV7A 3WG7C 1M2VB 5TJ5E 1FR0A 3ASNC 2R7XA 2XRHA 2R7WA 5T3TA 3MYFA 1EA8A 1G8XA 1BR1A 2EPLX 3EHMA 2E87A 1TQGA 2R02A 3JYYA 4J7TA 4QDLA 3T6GB 1Q0GA 2XL6A 2TMVP 1JAFA 3N0TA 1WOLA 1A7EA 2R05A 1FFTC 1ZHZA 3LJBA 3FAJA 3S28A 1F1MA 4U5HA 1H9TA 3M79A 3U8PA 2Z15A 1W2WA 3U0CA 4BJ6A 3EGXB 3GEEA 1XZQA 3NYLA 1PD0A 1MNDA 4IRUA 2L9JA 1KTMA 3S84A 2HUJA 2GDCA 5A69A 3GM3A 2H8AA 3SP1A 1M2OA 4F4BA 3J06A 1WGWA 4G0HA 3F47A 4LACB 3UR3C 5F28E 1XZPA 1JRAA 2L7AA 4CSAA 2YHSA 4PR9A 2YLDA 2Q00A 1YYXA 3PCVA 5E3CA 4CS9A 1E83A 1TWAA 3AG4C 2J7PD 2Q9CA 3Q6MA 5L0GA 2J9BA 4DRHB 3ZTZA 2RD9A 1WN0A 4PK4A 1TR2A 2GA0A 4CDVA 1YZCA 2BE5F 1YVIA 4J7YA 4MVMA 2J9VA 3WODF 3CEXA 3C8GB 2A1DD 4NTFA 3DJNB 3L8IA 4BEMJ 2YZSA 1MMNA 2HS5A 4E0HA 4X0RA 3US6A 4EUKB 3AGTA 2IM8A 3LS1A 4KC9A 3NMKA 3B71A 4ANJA 2YKZA 3DAFA 1I5NA 3ASOC 2QY9A 3LEOA 4BPMA 3POVA 3O55A 2WVNA 4GQHA 4MVZA 3IEEA 4YT5A 4BJ5C 2CNWA 2EINC 5HSWA 1PCXA 2CYDA 2BC5A 2Y69C 4PFOA 4CJGA 3GM2A 3KYIA 2AP3A 2GWWA 1A0BA 3HNJA 3DI5A 1O5HA 3HLZA 3SXMA 3C7JA 4U5EE 2J0XA 3WAQA 4JJFA 3ZQYA 1Z63A 4NQFA 2IXMA 3M1CB 3V5YA 3RVZA 1OKKA 5CI9A 1UFBA 2A6EF 1O3UA 2QLAA 3FHDA 4E7ZA 3G50A 3K1IC 4OD4A 2LD6A 4IGGA 1VLTA 4N4WA 3LEVA 3RYLA 2A0UA 1CGOA 3LLKA 3GWLA 5F5HA 3A11A 5KYUB 2FAPB 1XWJA 3QW0A 4PFPA 3HJCA 3ZVRA 2Y3GA 2LCHA 2O9XA 4XTKA 2G3VA 4YWQA 1E86A 4ER9A 2ASRA 1E2XA 1Z7Qc 5BQIA 3T6BA 3H65A 3F46A 3UMIA 5JRAA 1GGQA 5JT4A 3SXZA 3UGOA 1N1CA 2EIJC 5EGYA 3FXHA 5KYWA 2Y3DA 3TOMA 1LE4A 5KYYA 1LS4A 2P6VA 3QTHA 3B0VC 2OQMA 1ORSC 1YAUO 2KQ9A 3QZCA 1OCRC 4IAQA 2PP4A 3IQ5A 2WL8A 4A4AA 4QI0A 1OR2A 2IXPA 3H2VA 2C03A 4I3MA 4JJGA 1JR8A 3NMJA 3T4RA 4EBBA 5A6BD 5L0DA 3EG9A 3QMKA 2XL4A 1MQVA 4ULWA 3FAPB 2R7VA 2R03A 2B0HA 1PD1A 1RKEB 3C62A 3NRHA 2VCBA 1NG1A 1FTSA 3FOPA 3N24A 4ONSA 4PACA 4R32A 1YJGA 3DJUB 3W2VA 4EKWA 5B3SC 4JZAA 2F22A 3I5PA 4FESA 4I1OB 5E3AA 5DVWA 2DYSC 3FVYA 4EWCA 2CCYA 4J30B 4WABA 4XPYA 4CIHA 5L0JA 1M6TA 1Z5ZA 1LKXA 3KMIA 1NSGB 3QVZA 4W8PA 4E0IA 3NMIA 3JCUQ 1NBBA 5D92A 4BEJA 4OIOF 1M57C 3CSKA 3HNLA 1B68A 2HMQA 1U0BB 1NU7D 5L3VA 1H6GA 4O7GA 1ORJA 3G4ZA 1VTMP 4ZLCA 4MVOA 4NY3A 3X2QC 5DS5A 2WB7A 1WASA 1BR4A 2AWCA 3W4YA 5L3QA 4G7HF 2W4MA 4B6IA 4YJWA 3AGUA 4JIOA 3C18A 1ZHXA 3TJ5A 1HMDA 1L7CA 1M2VA 1RKEA 4YT2A 4OD5A 1H9GA 4CX9A 4XLNF 4CJOA 2LIGA 1HE1A 2H7OA 5B1BC 3NYMA 1ZU4A 2VB6A 4N6CA 1FNTc 3GEHA 4XLPF 1OKKD 2PX0A 3DWWA 2XXAB 4YL1A 1OR3A 1RXQA 2OG2A 1HY5A 1QKRA 1D0ZA 1HW1A 1MMGA 2EPNA 3DMDA 4JCHA 1D1AA 2PNOA 2WZGA 2B0JA 2D4UA 3AOUA 2A6HF 2RSEB 3LUTB 4H54A 4XPXA 2W4BA 5L0CA 4E7SA 4PJNA 3EGXA 5L0HA 5COGA 2ETSA 1IZMA 5JSLA 1DOVA 3HNKA 4MW3A 4XEKA 3UNGC 1QLEC 3AG2C 3ZWIA 4CS8C 3RIPA 2ZD9A 3JSEO 2Q7RA 2EIMC 5DS6A 3OWTA 1A41A 1QQ3A 1R5ID 4NCQA 3EZIA 2IXNA 3GM1A 5BUOA 3TJ6A 4G78A 4CDYA 1I4YA 2OOCA 3ABMC 3VRCA 4JRZA 5L0FA 1WTYA 1OCOC 3SXYA 3VYWA 4DVZA 2GAQA 4DJ9A 1LI7A 3TULA 1Q0FA 1HW2A 3NKDA 3LNMB 2LSEA 2WZLA 3NKEA 1VYIA 3GANA 1AUEA 2Y3HA 1YDIA 3C8GD 3PMRA 2KYHA 3Q6NA 4MS2A 2NUTA 2W45A 1O87A 2FGYA 2G3KA 1IW7F 2XLMA 4Q4ZF 1SYQA 1JMWA 4FX5A 2Y3BA 2KJGA 4Q7CA 1WATA 4JCZA 4C7OA 1BZ4A 4E18A 4UDVA 2VCAA 2D5RB 4LLCA 2BL2A 1LPEA 5B3IA 2C04A 1D0YA 2X51A 2OKUA 4JTDB 2A0BA 4EBKA 1CGNA 3M4CA 3V5ZA 3PDMP 2V3CC 2WVQA 3EFOB 1AVOB 2J9UA 4U5FE 1U89A 5DS4A 3AQCA 4NC3A 2EPOA 3DAGA 1E84A 2R9RB 4DOZA 4JTCB 4MQ9F 2OEXA 2R7QA 3IQTA 1ZHTA 4N6HA 4XPWA 4JW1A 3R2PA 3I5QA 1T6QA 1TKNA 3B0UX 2KNHA 3A9CA 2Q9BA 5AC4A 3B29A 4MTOA 4HE8D 1D1BA 4NTAA 4LDRA 1HE9A 2H7VC 3EG9B 4JE9A 2YLIA 1FMWA 2HMZA 3U3FA 4CDAA 4MVSA 1E85A 4YK5A 5BQGA 2CGEA 2L81A 1OXKA 3RF3A 3DXJF 1LIHA 4K7BA 4C3EA 3MX3A 1VLSA 3PHF2 1Q0KA 3JRTA 5AC5A 4AL1A 2FFHA 1OCCC 2XLVA 3IQCA 4FWVA 1ZW2A 2R7SA 2X0CA 2H7BA 4K1OA 1FFHA 1NU9C 1VB5A 3B9QA 4U9DA 4W8KA 5COFA 1CGME 5E2QA 3VF0A 3VM6A 3E70C 1KU2A 5T3WA 3U2LA 2AU5A 3EFOA 1Z3IX 4KBLA 4MVUA 3V5XA 2VASA 3MBGA 3DZAA 4N06A 4WGZA 1YLMA 3GWNA 3SEOA 2KK1A 1YZAA 2NSGA 4JEBA 3U9JA 1C03A 4DVYP 3AG3C 3EGDA 4OIRF 1LI5A 2JD3A 2YRFA 3ZIBA 2VCCA 5JS5A 2NPUA 2P0NA 1OQCA 3OEOA 1Q0DA 2EILC 1K40A 4BJ5A 5JUAA 2A69F 2M64A 5E33A 1TFOB 4DRIB 1ZHYA 3M15A 4KNWA 2HJ3A 2DB4A 3DD7A 1R4TA 2YL7A 3QVYA 2L6FA 3ZDLA 4BJ6C 1HMOA 5DQTA 4JURI 4FAPB 4CS8A 1GQAA 3KL4A 2I15A 2OCCC
chains in the Genus database with same CATH topology
3G4XA 1Q0MA 1T6QA 3G4ZA 4NCQA 1Q0GA 1Q0KA 1Q0DA 1T6UA 1Q0FA 3G50A 1T6IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4X A;  1Q0M A;  1T6Q A;  3G4Z A;  4NCQ A;  1Q0G A;  1Q0K A;  1Q0D A;  1T6U A;  1Q0F A;  3G50 A;  1T6I A; 
#chains in the Genus database with same CATH topology
 1VMA A;  2GFH A;  1Y4C A;  4PJJ A;  1ZYR F;  1C17 M;  2YQY A;  4DRJ B;  4U5C E;  1ZW3 A;  1OW8 A;  2M4E A;  2QTV A;  1YA7 O;  2R7U A;  3KPH A;  1K05 A;  5A6B A;  4AE4 B;  4I44 A;  3JT1 A;  2CDQ A;  4U5D E;  5FZT A;  3TK0 A;  3UMK A;  4A2N B;  5IY5 C;  1OCZ C;  1T5O A;  4JC7 A;  1V4A A;  1WWP A;  3GOD A;  3L0I A;  2QE9 A;  3AG1 C;  2OU6 A;  3JYH A;  1FMV A;  4GEH A;  4LDQ A;  1H7I A;  1KNY A;  1Z23 A;  2P7V A;  3BRJ A;  3MLG A;  4MVR A;  3IPM O;  3ITF A;  3LLI A;  2UUH A;  4K0D A;  4AL0 A;  4C3D A;  3OA1 A;  2QNL A;  2AWY A;  4CSA C;  1SF8 A;  2A68 F;  4Z9J A;  2ZXO A;  3MFN A;  4MND A;  2JX0 A;  3TOL A;  4YT4 A;  2HSB A;  2J9W A;  2ZPA A;  2XM0 A;  3KYJ A;  2G62 A;  1J8Y F;  1TFK B;  2J8W A;  3U3B A;  1C02 A;  1J8M F;  1QZX A;  4HFF B;  1FAP B;  3S9O A;  3VAY A;  4CS9 C;  2J45 A;  5A6J A;  4Q5S F;  2YL3 A;  4BG0 A;  1Y6D A;  1CPR A;  3T9O A;  3ZTM A;  3NDB B;  5HV9 A;  2R7O A;  2IXO A;  3LES A;  5KYX B;  1APC A;  3ZG1 A;  1BR2 A;  1OXB A;  4GYT A;  1YA9 A;  3O39 A;  4IWB A;  4YN0 B;  2HFI A;  2YLG A;  3W2W A;  1UG7 A;  2ZXR A;  1ZU5 A;  2OJE D;  4NTB A;  3SYN A;  1OW7 A;  4XWJ A;  2MWQ A;  3S27 A;  2UUI A;  3EZH A;  4Z9H A;  4P9T A;  5JP7 A;  1L3P A;  4WGY A;  3ZSU A;  4MVQ A;  2P1A A;  4Z9I A;  2NG1 A;  3RKO F;  3MYI A;  2YL0 A;  3Q7G A;  1MMD A;  4OIN F;  2YWA A;  4DBR A;  3E9V A;  256B A;  1BBH A;  3JZ0 A;  3W8I A;  3HNI A;  4ZLD A;  1NFN A;  4U5B E;  1A7V A;  3DKA A;  4LLE A;  2IBF A;  4U9E A;  2OEV A;  3L8J A;  3W8H A;  2PX3 A;  5DQZ A;  4XQ1 A;  4YL0 A;  3HKK A;  3RH3 A;  3TD7 A;  2XLW A;  1ZVZ A;  2KC3 A;  5K0I A;  1ZZP A;  3ZQV A;  3IQ6 A;  2EPK X;  3T6J A;  2R7R A;  5KYX A;  2XLD A;  4G7O F;  2IYL D;  3U9M A;  5KYN A;  2VC9 A;  3EH1 A;  3V7O A;  2ZXP A;  3JRM O;  4IAO A;  1GM5 A;  4LDK A;  2NUT B;  2ZXW C;  1T6U A;  3SXK A;  4MW8 A;  5CIV A;  1AEP A;  2LFF A;  1G5Z A;  1GS9 A;  3RW0 A;  4DXW A;  4AX2 A;  3S90 A;  2ICW G;  2NUP A;  2NUP B;  3RQF A;  5KYW B;  2HZ8 A;  4HEA J;  4RDA A;  1RJ9 B;  4P9F A;  5COM A;  2NSF A;  2Q4F A;  2J0W A;  1EI7 A;  1PV3 A;  2DGJ A;  4L6R A;  1YYJ A;  3LNR A;  2DI3 A;  3SNH A;  1VYK A;  3ABK C;  4C3B A;  3JTL O;  2LP4 A;  3K1I A;  1Q0M A;  3K6B A;  1EKY A;  1LVK A;  1U6H A;  1ST6 A;  2WZF A;  1LE2 A;  1RKC A;  2Q3T A;  3EPV A;  5L0I A;  2XL8 A;  1G4W R;  5KYU A;  4U5G A;  4BJT A;  2DYR C;  5EK0 A;  4JKV A;  3S29 A;  2AVK A;  1DOW A;  3HTK C;  2XS1 A;  3DE9 A;  1YAR O;  1TWG A;  2HKV A;  4BJ1 A;  1LS1 A;  2Q9A A;  1ORY A;  3BEH A;  3S0X A;  2XM4 A;  5CI8 A;  3CQZ A;  4KI2 A;  5EHH A;  3WHN A;  3AQB A;  3GOR A;  3QW1 A;  1RCP A;  4M63 A;  4AE4 A;  1QPU A;  3EQL F;  1T6I A;  3ECS A;  2LQG A;  3M4B A;  3NYJ A;  2W9Y A;  4IAR A;  5A6K A;  5GPG B;  4JVS A;  4HFK B;  4MTF A;  5DLJ A;  2XLH A;  5A6A A;  1BDJ B;  5JVE A;  3B0P A;  2KW3 C;  2OJQ A;  2PFD A;  2HSQ A;  1VK5 A;  5KYY B;  4KNV A;  4O6M A;  5FCL A;  1CPQ A;  1I4Z A;  5JLI A;  2XLE A;  2IOQ A;  2JPU A;  3EJN A;  2CNW D;  3U8V A;  1D1C A;  3CAX A;  2LFD A;  3ZC4 A;  4EBJ A;  1ZHW A;  2L6G A;  1TWH A;  3FMS A;  3C8Z A;  1QVX A;  3RVY A;  3FDQ A;  2J7P A;  5F5F A;  5T1D B;  3IHU A;  5B1A C;  4I1M A;  3RQG A;  2HV6 A;  5D91 A;  1TWC A;  2V26 A;  1V55 C;  3C63 A;  2XXA A;  2L6H A;  4C7O B;  2YVK A;  3AJM A;  3UMH A;  4CBE A;  1SMY F;  3EH2 A;  4JEA A;  4ULV A;  1NZE A;  3ATP A;  3KH2 A;  2J46 A;  3FOO A;  2MYS A;  4JTA B;  3O6X A;  1S05 A;  1LM3 B;  3CZ6 A;  4RBN A;  4XEV A;  1MNE A;  1RJ9 A;  3L1M A;  4P6I C;  5BQH A;  4IJJ A;  4IB4 A;  1NLX A;  3KKB A;  3U2M A;  3N2Z B;  4O6N A;  4O79 A;  3RQE A;  2XSE A;  3ABL C;  1S7Z A;  3K33 A;  3Q7L A;  4EIY A;  2R7T A;  4MTG A;  4PJM A;  4XEF A;  3G4X A;  4H4K C;  2EPM X;  4LER A;  4YL3 A;  1EQ1 A;  3I4U A;  4CIP A;  1T01 A;  2QUP A;  1RMV A;  1V54 C;  3EGD B;  1M56 C;  3LS0 A;  4WJ0 A;  3EHN A;  3GEI A;  2KSF A;  4O6Y A;  3TQO A;  1G4U S;  2EIK C;  1JPJ A;  3SZR A;  4EHP A;  2PF4 E;  4D4N A;  1NFO A;  2R25 A;  2YL1 A;  4OIQ F;  2VH3 A;  3K7D A;  3DE8 A;  1D0X A;  1K04 A;  2XLO A;  4RD9 A;  4D4X A;  2P61 A;  3U5S A;  1OW6 A;  3K66 A;  3L34 A;  2KGO A;  3K1H A;  4QI2 A;  4PJL A;  1JOG A;  2LK4 A;  2MHR A;  1JPN A;  3C8G A;  3DM5 A;  4CS7 A;  1MMA A;  5AGF A;  4OIP F;  2CW0 F;  3X1O A;  1SZI A;  3JSZ A;  4AK9 A;  2I8B A;  2WVO A;  2Y39 A;  2YEV A;  3O10 A;  1SR2 A;  4G7Z F;  4J32 B;  1T9K A;  3DM9 B;  3UGP A;  2PBE A;  1VOM A;  3H2U A;  4E17 A;  4YT8 A;  2XS8 A;  3R7C A;  1QSP A;  2HJM A;  4DBQ A;  3LAY A;  3RFY A;  1A7D A;  1Z6A A;  3NG1 A;  1V74 B;  2HV7 A;  3WG7 C;  1M2V B;  5TJ5 E;  1FR0 A;  3ASN C;  2R7X A;  2XRH A;  2R7W A;  5T3T A;  3MYF A;  1EA8 A;  1G8X A;  1BR1 A;  2EPL X;  3EHM A;  2E87 A;  1TQG A;  2R02 A;  3JYY A;  4J7T A;  4QDL A;  3T6G B;  1Q0G A;  2XL6 A;  2TMV P;  1JAF A;  3N0T A;  1WOL A;  1A7E A;  2R05 A;  1FFT C;  1ZHZ A;  3LJB A;  3FAJ A;  3S28 A;  1F1M A;  4U5H A;  1H9T A;  3M79 A;  3U8P A;  2Z15 A;  1W2W A;  3U0C A;  4BJ6 A;  3EGX B;  3GEE A;  1XZQ A;  3NYL A;  1PD0 A;  1MND A;  4IRU A;  2L9J A;  1KTM A;  3S84 A;  2HUJ A;  2GDC A;  5A69 A;  3GM3 A;  2H8A A;  3SP1 A;  1M2O A;  4F4B A;  3J06 A;  1WGW A;  4G0H A;  3F47 A;  4LAC B;  3UR3 C;  5F28 E;  1XZP A;  1JRA A;  2L7A A;  4CSA A;  2YHS A;  4PR9 A;  2YLD A;  2Q00 A;  1YYX A;  3PCV A;  5E3C A;  4CS9 A;  1E83 A;  1TWA A;  3AG4 C;  2J7P D;  2Q9C A;  3Q6M A;  5L0G A;  2J9B A;  4DRH B;  3ZTZ A;  2RD9 A;  1WN0 A;  4PK4 A;  1TR2 A;  2GA0 A;  4CDV A;  1YZC A;  2BE5 F;  1YVI A;  4J7Y A;  4MVM A;  2J9V A;  3WOD F;  3CEX A;  3C8G B;  2A1D D;  4NTF A;  3DJN B;  3L8I A;  4BEM J;  2YZS A;  1MMN A;  2HS5 A;  4E0H A;  4X0R A;  3US6 A;  4EUK B;  3AGT A;  2IM8 A;  3LS1 A;  4KC9 A;  3NMK A;  3B71 A;  4ANJ A;  2YKZ A;  3DAF A;  1I5N A;  3ASO C;  2QY9 A;  3LEO A;  4BPM A;  3POV A;  3O55 A;  2WVN A;  4GQH A;  4MVZ A;  3IEE A;  4YT5 A;  4BJ5 C;  2CNW A;  2EIN C;  5HSW A;  1PCX A;  2CYD A;  2BC5 A;  2Y69 C;  4PFO A;  4CJG A;  3GM2 A;  3KYI A;  2AP3 A;  2GWW A;  1A0B A;  3HNJ A;  3DI5 A;  1O5H A;  3HLZ A;  3SXM A;  3C7J A;  4U5E E;  2J0X A;  3WAQ A;  4JJF A;  3ZQY A;  1Z63 A;  4NQF A;  2IXM A;  3M1C B;  3V5Y A;  3RVZ A;  1OKK A;  5CI9 A;  1UFB A;  2A6E F;  1O3U A;  2QLA A;  3FHD A;  4E7Z A;  3G50 A;  3K1I C;  4OD4 A;  2LD6 A;  4IGG A;  1VLT A;  4N4W A;  3LEV A;  3RYL A;  2A0U A;  1CGO A;  3LLK A;  3GWL A;  5F5H A;  3A11 A;  5KYU B;  2FAP B;  1XWJ A;  3QW0 A;  4PFP A;  3HJC A;  3ZVR A;  2Y3G A;  2LCH A;  2O9X A;  4XTK A;  2G3V A;  4YWQ A;  1E86 A;  4ER9 A;  2ASR A;  1E2X A;  1Z7Q c;  5BQI A;  3T6B A;  3H65 A;  3F46 A;  3UMI A;  5JRA A;  1GGQ A;  5JT4 A;  3SXZ A;  3UGO A;  1N1C A;  2EIJ C;  5EGY A;  3FXH A;  5KYW A;  2Y3D A;  3TOM A;  1LE4 A;  5KYY A;  1LS4 A;  2P6V A;  3QTH A;  3B0V C;  2OQM A;  1ORS C;  1YAU O;  2KQ9 A;  3QZC A;  1OCR C;  4IAQ A;  2PP4 A;  3IQ5 A;  2WL8 A;  4A4A A;  4QI0 A;  1OR2 A;  2IXP A;  3H2V A;  2C03 A;  4I3M A;  4JJG A;  1JR8 A;  3NMJ A;  3T4R A;  4EBB A;  5A6B D;  5L0D A;  3EG9 A;  3QMK A;  2XL4 A;  1MQV A;  4ULW A;  3FAP B;  2R7V A;  2R03 A;  2B0H A;  1PD1 A;  1RKE B;  3C62 A;  3NRH A;  2VCB A;  1NG1 A;  1FTS A;  3FOP A;  3N24 A;  4ONS A;  4PAC A;  4R32 A;  1YJG A;  3DJU B;  3W2V A;  4EKW A;  5B3S C;  4JZA A;  2F22 A;  3I5P A;  4FES A;  4I1O B;  5E3A A;  5DVW A;  2DYS C;  3FVY A;  4EWC A;  2CCY A;  4J30 B;  4WAB A;  4XPY A;  4CIH A;  5L0J A;  1M6T A;  1Z5Z A;  1LKX A;  3KMI A;  1NSG B;  3QVZ A;  4W8P A;  4E0I A;  3NMI A;  3JCU Q;  1NBB A;  5D92 A;  4BEJ A;  4OIO F;  1M57 C;  3CSK A;  3HNL A;  1B68 A;  2HMQ A;  1U0B B;  1NU7 D;  5L3V A;  1H6G A;  4O7G A;  1ORJ A;  3G4Z A;  1VTM P;  4ZLC A;  4MVO A;  4NY3 A;  3X2Q C;  5DS5 A;  2WB7 A;  1WAS A;  1BR4 A;  2AWC A;  3W4Y A;  5L3Q A;  4G7H F;  2W4M A;  4B6I A;  4YJW A;  3AGU A;  4JIO A;  3C18 A;  1ZHX A;  3TJ5 A;  1HMD A;  1L7C A;  1M2V A;  1RKE A;  4YT2 A;  4OD5 A;  1H9G A;  4CX9 A;  4XLN F;  4CJO A;  2LIG A;  1HE1 A;  2H7O A;  5B1B C;  3NYM A;  1ZU4 A;  2VB6 A;  4N6C A;  1FNT c;  3GEH A;  4XLP F;  1OKK D;  2PX0 A;  3DWW A;  2XXA B;  4YL1 A;  1OR3 A;  1RXQ A;  2OG2 A;  1HY5 A;  1QKR A;  1D0Z A;  1HW1 A;  1MMG A;  2EPN A;  3DMD A;  4JCH A;  1D1A A;  2PNO A;  2WZG A;  2B0J A;  2D4U A;  3AOU A;  2A6H F;  2RSE B;  3LUT B;  4H54 A;  4XPX A;  2W4B A;  5L0C A;  4E7S A;  4PJN A;  3EGX A;  5L0H A;  5COG A;  2ETS A;  1IZM A;  5JSL A;  1DOV A;  3HNK A;  4MW3 A;  4XEK A;  3UNG C;  1QLE C;  3AG2 C;  3ZWI A;  4CS8 C;  3RIP A;  2ZD9 A;  3JSE O;  2Q7R A;  2EIM C;  5DS6 A;  3OWT A;  1A41 A;  1QQ3 A;  1R5I D;  4NCQ A;  3EZI A;  2IXN A;  3GM1 A;  5BUO A;  3TJ6 A;  4G78 A;  4CDY A;  1I4Y A;  2OOC A;  3ABM C;  3VRC A;  4JRZ A;  5L0F A;  1WTY A;  1OCO C;  3SXY A;  3VYW A;  4DVZ A;  2GAQ A;  4DJ9 A;  1LI7 A;  3TUL A;  1Q0F A;  1HW2 A;  3NKD A;  3LNM B;  2LSE A;  2WZL A;  3NKE A;  1VYI A;  3GAN A;  1AUE A;  2Y3H A;  1YDI A;  3C8G D;  3PMR A;  2KYH A;  3Q6N A;  4MS2 A;  2NUT A;  2W45 A;  1O87 A;  2FGY A;  2G3K A;  1IW7 F;  2XLM A;  4Q4Z F;  1SYQ A;  1JMW A;  4FX5 A;  2Y3B A;  2KJG A;  4Q7C A;  1WAT A;  4JCZ A;  4C7O A;  1BZ4 A;  4E18 A;  4UDV A;  2VCA A;  2D5R B;  4LLC A;  2BL2 A;  1LPE A;  5B3I A;  2C04 A;  1D0Y A;  2X51 A;  2OKU A;  4JTD B;  2A0B A;  4EBK A;  1CGN A;  3M4C A;  3V5Z A;  3PDM P;  2V3C C;  2WVQ A;  3EFO B;  1AVO B;  2J9U A;  4U5F E;  1U89 A;  5DS4 A;  3AQC A;  4NC3 A;  2EPO A;  3DAG A;  1E84 A;  2R9R B;  4DOZ A;  4JTC B;  4MQ9 F;  2OEX A;  2R7Q A;  3IQT A;  1ZHT A;  4N6H A;  4XPW A;  4JW1 A;  3R2P A;  3I5Q A;  1T6Q A;  1TKN A;  3B0U X;  2KNH A;  3A9C A;  2Q9B A;  5AC4 A;  3B29 A;  4MTO A;  4HE8 D;  1D1B A;  4NTA A;  4LDR A;  1HE9 A;  2H7V C;  3EG9 B;  4JE9 A;  2YLI A;  1FMW A;  2HMZ A;  3U3F A;  4CDA A;  4MVS A;  1E85 A;  4YK5 A;  5BQG A;  2CGE A;  2L81 A;  1OXK A;  3RF3 A;  3DXJ F;  1LIH A;  4K7B A;  4C3E A;  3MX3 A;  1VLS A;  3PHF 2;  1Q0K A;  3JRT A;  5AC5 A;  4AL1 A;  2FFH A;  1OCC C;  2XLV A;  3IQC A;  4FWV A;  1ZW2 A;  2R7S A;  2X0C A;  2H7B A;  4K1O A;  1FFH A;  1NU9 C;  1VB5 A;  3B9Q A;  4U9D A;  4W8K A;  5COF A;  1CGM E;  5E2Q A;  3VF0 A;  3VM6 A;  3E70 C;  1KU2 A;  5T3W A;  3U2L A;  2AU5 A;  3EFO A;  1Z3I X;  4KBL A;  4MVU A;  3V5X A;  2VAS A;  3MBG A;  3DZA A;  4N06 A;  4WGZ A;  1YLM A;  3GWN A;  3SEO A;  2KK1 A;  1YZA A;  2NSG A;  4JEB A;  3U9J A;  1C03 A;  4DVY P;  3AG3 C;  3EGD A;  4OIR F;  1LI5 A;  2JD3 A;  2YRF A;  3ZIB A;  2VCC A;  5JS5 A;  2NPU A;  2P0N A;  1OQC A;  3OEO A;  1Q0D A;  2EIL C;  1K40 A;  4BJ5 A;  5JUA A;  2A69 F;  2M64 A;  5E33 A;  1TFO B;  4DRI B;  1ZHY A;  3M15 A;  4KNW A;  2HJ3 A;  2DB4 A;  3DD7 A;  1R4T A;  2YL7 A;  3QVY A;  2L6F A;  3ZDL A;  4BJ6 C;  1HMO A;  5DQT A;  4JUR I;  4FAP B;  4CS8 A;  1GQA A;  3KL4 A;  2I15 A;  2OCC C; 
#chains in the Genus database with same CATH homology
 3G4X A;  1Q0M A;  1T6Q A;  3G4Z A;  4NCQ A;  1Q0G A;  1Q0K A;  1Q0D A;  1T6U A;  1Q0F A;  3G50 A;  1T6I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...