3MYFA

The crystal structure of the hpt domain from the hpt sensor hybrid histidine kinase from shewanella to 1.80a
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
117
structure length
117
Chain Sequence
DLHTLNWDLCLTQANHKSNLALEMLKMLLDSLPETVEKIQTALGQNDQATMLSTIHKLHGASCYCGVPTTQRLCQEIESALKRQTPVEDLEPEILELLDELTKVESAVKQVLSQLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor protein
publication title The Crystal Structure of the HPT domain from the Hpt Sensor Hybrid Histidine Kinase from Shewanella to 1.80A
rcsb
source organism Shewanella sp. w3-18-1
molecule tags Transferase
total genus 46
structure length 117
sequence length 117
chains with identical sequence B, C, D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2010-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 3myfA00
1WN0A 3IQTA 3MYFA 1OXKA 2OOCA 1C03A 2A0BA 1C02A 1TQGA 1SR2A 1FR0A 1QSPA 1YVIA 2LCHA 1Y6DA 1OXBA 1A0BA 2LP4A 1I5NA 4EUKB 4G78A 2LD6A 3KYIA 3US6A 3U3BA 1BDJB 2R25A 4PACA 3KYJA 2Q4FA
chains in the Genus database with same CATH superfamily
3RYLA 3T6BA 3ZWIA 4BG0A 4NCQA 4BJ1A 1YAUO 1E2XA 3KL4A 1CGOA 1WOLA 3EGXA 2PP4A 3GWNA 3U8PA 1M2VB 3SNHA 3M1CB 3IHUA 4NC3A 4ZLDA 2J46A 2HMZA 3VYWA 4A2NB 3I5PA 4U5FE 4NQFA 4DVYP 5E2QA 3NKEA 3B9QA 1A7EA 3VRCA 1FNTc 5L0CA 4NTFA 3G4XA 1UFBA 3I4UA 1U0BB 4JEAA 1G4US 1ORSC 2O9XA 3N0TA 4Z9HA 4EBJA 1A7DA 3O6XA 3U5SA 4G7HF 3B29A 1TFKB 1DOWA 5KYWA 2MWQA 3ZG1A 2R25A 4PACA 3ASOC 1R4TA 1Z23A 5JLIA 5KYUA 4CS8C 2H7OA 5IY5C 4G7OF 1LI7A 3DWWA 3SXZA 3EZIA 3I5QA 2G3VA 4CJOA 2XM0A 2R03A 3QW1A 2OU6A 4AL1A 3UGPA 1SR2A 1QVXA 1GQAA 1ZVZA 1D0YA 4YT4A 3WAQA 4U5GA 1YVIA 1T6IA 2XLHA 4J7TA 3ZTMA 2EILC 2KNHA 3QVZA 4KI2A 1RJ9B 2KQ9A 3K1HA 2J8WA 4KNWA 2FFHA 2WZLA 4PJJA 5CI9A 3X2QC 1R5ID 3ZQYA 4ZLCA 5DS6A 3EH2A 2YLDA 1RKEB 1VLTA 2H7BA 1FFHA 3EGDA 1OR2A 3EJNA 2KSFA 4G0HA 3ZQVA 3U3BA 3FOPA 1TR2A 1J8YF 3H2UA 5A6KA 2J9VA 4HEAJ 2QLAA 1MMDA 4AL0A 2A6HF 4XEVA 5AGFA 3HNLA 5JS5A 4U5DE 3Q7GA 2B0HA 2AU5A 5JP7A 3EFOB 2P7VA 3W8HA 3GEEA 1L3PA 2ZPAA 5T3TA 4Q4ZF 3MYIA 2F22A 2J45A 2XSEA 1LKXA 3DM5A 3PCVA 5JVEA 2GDCA 1VTMP 4OD4A 3TULA 2Z15A 3DM9B 3W8IA 4JTAB 3RF3A 5DLJA 3C8ZA 2WB7A 5KYXA 2NPUA 4CS8A 2CGEA 2L6FA 1I5NA 3ZSUA 1O3UA 1VB5A 3NYLA 1D1CA 2R7XA 1T6UA 2XXAB 4CX9A 1APCA 2R7VA 3KH2A 3H2VA 3POVA 1D1AA 5FZTA 1Z63A 1PD0A 3ZVRA 1OCCC 3ECSA 3W2WA 1JR8A 2LK4A 2ZXWC 2FGYA 3RQEA 5DVWA 4C3DA 2Q9CA 1OW8A 1OCZC 4UDVA 2ETSA 4YK5A 4U5HA 3M79A 3M4BA 5B1BC 1ZHZA 4G7ZF 3K6BA 4ANJA 1S7ZA 5E3AA 2R7QA 3DJUB 2LIGA 3G50A 1UG7A 2L6GA 4C7OA 4J32B 1KU2A 2C03A 2LCHA 4EBBA 1FTSA 3R7CA 1OCOC 2EPLX 1H6GA 3QTHA 4CDAA 4YL3A 4Z9IA 1IZMA 2PX0A 3FHDA 3ABLC 1XZPA 3RFYA 3HLZA 2H7VC 2VC9A 2CCYA 3K33A 5DS5A 3US6A 3RVYA 1TWGA 4IWBA 4MVUA 4CSAC 2BL2A 2HMQA 2WZGA 5KYYB 1HW1A 2IOQA 3JRMO 4IB4A 3JRTA 2XL4A 5D91A 2I8BA 5EGYA 5E3CA 4DRJB 4WJ0A 2R05A 3SXKA 1OQCA 1GGQA 4ER9A 2YWAA 1EQ1A 3VF0A 1T01A 2LQGA 3BRJA 3SP1A 2OOCA 5T1DB 3W4YA 5BQIA 2IXOA 1RJ9A 1ZU4A 4CDYA 2OQMA 2WZFA 1D1BA 1YLMA 3LEOA 4MTFA 2J9BA 1FFTC 3O10A 1WASA 1ZHTA 2YL0A 4MW8A 3K1IC 3T4RA 2Q00A 2EPKX 4M63A 1HW2A 2Y3HA 4H54A 2YEVA 1A0BA 2OEVA 1Y4CA 1G8XA 2J7PD 3AJMA 4U5EE 2R7TA 1SZIA 2LFDA 3SZRA 1FAPB 2WVOA 4JEBA 1OKKD 3UNGC 2RD9A 1GS9A 3NMJA 3TQOA 1YARO 1VYIA 3EPVA 4DJ9A 256BA 3V5XA 4OIOF 3GM3A 3HJCA 4RD9A 3VM6A 4WGZA 3VAYA 2R7RA 1RXQA 2E87A 1V4AA 3FXHA 1QPUA 4E0IA 5CIVA 2IXMA 2BC5A 3GODA 2NSFA 2YHSA 1SMYF 3GANA 3NG1A 1K05A 2XXAA 2R7SA 4CSAA 4O7GA 1CGNA 2EPMX 4PJNA 2R02A 1TFOB 3CAXA 3S27A 3MBGA 2Y3BA 5EHHA 1ZYRF 2EIKC 1SYQA 2LP4A 4MVMA 4W8PA 2ZXPA 4AE4B 4IARA 4E18A 3V5ZA 2AP3A 2YRFA 3E70C 2KW3C 1YDIA 1Z5ZA 5EK0A 1PV3A 4U5BE 2VASA 1OCRC 2XLEA 3GORA 3O39A 4U5CE 2HSQA 2DI3A 2R7WA 1W2WA 3K1IA 4NY3A 3S29A 4D4NA 1H9TA 1LIHA 1TWHA 1VK5A 4NTAA 3C8GB 3WG7C 2QY9A 4JTDB 3F47A 3FOOA 3LAYA 2BE5F 2XM4A 3LUTB 1HMOA 2J7PA 2VCBA 3AQBA 1FR0A 1Q0DA 1VOMA 4LACB 3ZC4A 4DRIB 1OKKA 3HNKA 3JSZA 1AVOB 1ZHYA 2VCAA 4I1MA 2XL6A 1Y6DA 4J7YA 5DS4A 4GQHA 1VYKA 4JC7A 2TMVP 5HSWA 1ZW2A 2Y69C 4EWCA 2W45A 3LLKA 2YZSA 3HTKC 1LPEA 4XPYA 2JX0A 4EIYA 3EHNA 2R7UA 5AC5A 3DXJF 4C3EA 3EG9B 1G4WR 4O79A 5L0FA 3ASNC 1E85A 1LVKA 4L6RA 2Q4FA 1ORYA 1Z7Qc 3AOUA 1LS4A 3ZIBA 5F28E 2CNWD 5L0IA 1MQVA 3NDBB 2IM8A 4K1OA 1YZCA 2L7AA 1MMNA 3C8GD 1FMVA 2GFHA 2NG1A 3QW0A 3LLIA 3RQGA 1NU9C 2PX3A 1JMWA 3LESA 3KPHA 4JRZA 4MTGA 2G3KA 4FESA 4I1OB 1C17M 1YZAA 1LE2A 1LI5A 3C62A 1OXBA 3GM2A 4YN0B 4JJGA 4PJLA 4I3MA 4FAPB 4KNVA 5JUAA 4NTBA 1QZXA 4YT5A 3ABMC 4EKWA 4AX2A 5L3VA 4C3BA 2GAQA 2Q7RA 5DQTA 1TWCA 1E86A 2UUIA 1CGME 3JSEO 4JE9A 4MNDA 3DAGA 4WGYA 3U9MA 3LEVA 4QI2A 3C7JA 1YA7O 2EPNA 1NBBA 3U9JA 4BJTA 5TJ5E 1WWPA 1ZHWA 1M2VA 1M2OA 2NUPB 4LLEA 3LJBA 2A0UA 3FVYA 4YL1A 4EBKA 4YT2A 1I4ZA 1OR3A 2KGOA 4MW3A 4U9DA 2HZ8A 1F1MA 3DZAA 4LERA 1D0ZA 3FDQA 2JD3A 4IRUA 5A6BD 5JRAA 3S90A 4CS7A 2A0BA 4BJ5C 2YL3A 1AUEA 1TQGA 1EA8A 1HMDA 2HSBA 3HKKA 2QTVA 2XS1A 2Y3GA 3DE8A 1HE9A 2PBEA 3U2MA 4O6YA 4PFPA 1RMVA 1NLXA 3HNIA 3EGXB 1ZU5A 1J8MF 4JURI 2P6VA 1KNYA 2HJMA 2CNWA 3RKOF 3KKBA 4JCZA 3AGTA 4OD5A 2LD6A 5A69A 3C8GA 3PHF2 3S9OA 1MMGA 1QQ3A 5L0HA 3UGOA 3V7OA 3TK0A 2YKZA 1PD1A 1CPRA 1ZZPA 2QNLA 3L8IA 2HJ3A 3DE9A 2EINC 3N2ZB 4XLPF 3LS1A 4RDAA 3NKDA 4OIRF 4K7BA 3MLGA 2PF4E 2J0WA 1MNEA 2YQYA 2AVKA 4KBLA 5CI8A 5DQZA 3TD7A 1C02A 1KTMA 4XQ1A 2H8AA 2MYSA 4GEHA 3EHMA 5A6AA 2VB6A 3ABKC 3ITFA 2LSEA 2UUHA 4EHPA 1RKEA 1D0XA 2P61A 3DI5A 5B1AC 2J9WA 3EG9A 1LE4A 2XLDA 4XLNF 4BPMA 2M64A 1H7IA 3RVZA 4G78A 2QE9A 4JVSA 4PFOA 5A6BA 1ST6A 4N6CA 2V3CC 3AG4C 3N24A 4XEFA 4BJ5A 2HS5A 1NG1A 3C18A 2L9JA 4U9EA 2GA0A 3EFOA 2KK1A 1B68A 4DXWA 1HY5A 2ZD9A 5K0IA 3OWTA 2FAPB 3LNMB 4Z9JA 3E9VA 3JTLO 3S0XA 1YA9A 1OXKA 2IXPA 4MS2A 4PJMA 2ZXOA 3JCUQ 1OW7A 2XS8A 3QZCA 4W8KA 3T9OA 4FX5A 4AK9A 1QKRA 4DVZA 4HE8D 2I15A 2KJGA 3AG2C 5BQGA 3WHNA 4E7SA 1NU7D 1RKCA 3K66A 1IW7F 1S05A 1G5ZA 3ATPA 3DJNB 3F46A 2YLIA 3K7DA 2WVQA 4PK4A 1JOGA 3NMIA 3CEXA 3U3FA 2P1AA 3QVYA 4JIOA 2GWWA 3GEHA 4B6IA 2HV6A 5FCLA 4O6MA 1K40A 3O55A 2YLGA 1MNDA 2CDQA 4JJFA 1V55C 2NUTB 4RBNA 3U2LA 1U6HA 2HFIA 4D4XA 5KYXB 3T6JA 3Q7LA 4IGGA 1E84A 2C04A 3L1MA 3CSKA 1BR1A 3UMKA 2A68F 4CS9C 4OIPF 3CZ6A 3JZ0A 2HKVA 2IXNA 2IBFA 3DD7A 5BUOA 3NYMA 4DRHB 3L34A 5JT4A 5F5FA 1BZ4A 1Z3IX 2CYDA 1LM3B 4MVRA 4YT8A 5A6JA 2Q3TA 2W9YA 3SXMA 3AG1C 4QI0A 1QSPA 3RIPA 3U8VA 5JSLA 2J9UA 3Q6NA 5KYYA 2AWCA 4IAQA 3IQ5A 4O6NA 2IYLD 1Q0MA 3H65A 2WL8A 4LDQA 1LS1A 2YVKA 4X0RA 3ZTZA 5B3SC 4C7OB 2DB4A 3EZHA 1TKNA 2V26A 4JKVA 1A41A 4LDRA 2EIMC 1JPNA 1V74B 4QDLA 3RQFA 1BDJB 4ULWA 2QUPA 1AEPA 5COMA 3T6GB 4JCHA 2A6EF 4DBQA 3OA1A 4P9FA 2YL7A 4MQ9F 1V54C 4XEKA 2OCCC 4WABA 3SXYA 1PCXA 3GM1A 3FMSA 4E7ZA 1BR4A 3WODF 2WVNA 3UR3C 3DKAA 4E0HA 2OJQA 2AWYA 3PMRA 1Q0KA 4CS9A 4H4KC 2Y3DA 2X0CA 1NZEA 4ONSA 3QMKA 4P6IC 4R32A 3SEOA 3KYIA 3V5YA 3UMHA 3UMIA 2A1DD 3M15A 2W4BA 2VH3A 4N6HA 2D4UA 2W4MA 3AG3C 2L81A 1FMWA 3JT1A 3R2PA 4ULVA 3IQ6A 1O87A 5BQHA 5L0GA 1HE1A 5GPGB 1WTYA 3A11A 2EIJC 5AC4A 5L0JA 4N06A 4E17A 1BR2A 4XTKA 3IQTA 3MYFA 3EH1A 4LDKA 1YYXA 3LNRA 4OIQF 1C03A 3B0VC 1N1CA 4N4WA 4YWQA 1OW6A 3U0CA 1RCPA 4Q5SF 3IEEA 4FWVA 3NYJA 3HNJA 1K04A 1JRAA 4AE4A 1YJGA 3X1OA 4JW1A 2PNOA 2NUTA 1H9GA 3CQZA 3S28A 2P0NA 2Y39A 1NFNA 3KMIA 3JYYA 3SYNA 2X51A 5KYNA 3W2VA 1U89A 4BJ6C 2DYRC 2XLVA 3G4ZA 2L6HA 5T3WA 2R7OA 2Q9BA 3L8JA 1I4YA 1YYJA 4XPWA 2JPUA 4OINF 1GM5A 3FAPB 4GYTA 3Q6MA 4I44A 4CJGA 2YL1A 4MTOA 2LFFA 2ZXRA 3DMDA 3MFNA 3S84A 3AGUA 4MVSA 4PR9A 3C63A 3KYJA 3L0IA 4YJWA 5D92A 3TJ6A 5L3QA 1WN0A 4MVOA 3JYHA 3TOMA 5F5HA 2XL8A 1ORJA 2Q9AA 1T9KA 1O5HA 5KYWB 4P9TA 4KC9A 1M57C 3IPMO 1ZHXA 1Q0FA 5HV9A 3NMKA 4YL0A 1EI7A 2A69F 5KYUB 1M6TA 1NSGB 1ZW3A 2PFDA 1Z6AA 1M56C 1VLSA 3B71A 4JTCB 4A4AA 2XLWA 1XZQA 2OEXA 4IJJA 2OJED 4JZAA 4CDVA 4CIPA 2ASRA 4CIHA 1WATA 2DYSC 2XRHA 4J30B 3MX3A 1WGWA 1MMAA 4IAOA 3J06A 1DOVA 5E33A 2DGJA 3TOLA 1JPJA 2XLOA 1VMAA 1T5OA 1TWAA 1SF8A 3RW0A 3TJ5A 2G62A 2D5RB 4CBEA 1EKYA 1T6QA 1CPQA 2HV7A 4MVZA 2B0JA 1Q0GA 3AQCA 2OG2A 3EGDB 3ZDLA 4BJ6A 3DAFA 3LS0A 1NFOA 3GEIA 4XWJA 3B0PA 3M4CA 2M4EA 1QLEC 4HFKB 4DOZA 3BEHA 3NRHA 3PDMP 2MHRA 3IQCA 2EPOA 5COGA 2VCCA 2HUJA 2CW0F 2R9RB 2KC3A 2ICWG 2RSEB 4HFFB 4K0DA 1A7VA 4Q7CA 3FAJA 5L0DA 1BBHA 4EUKB 3RH3A 2NUPA 1JAFA 4MVQA 3EQLF 1E83A 2NSGA 3GWLA 4XPXA 1XWJA 1L7CA 2KYHA 4DBRA 2OKUA 4BEMJ 3B0UX 5COFA 4LLCA 2J0XA 3OEOA 5B3IA 3A9CA 4BEJA 4F4BA 2XLMA
chains in the Genus database with same CATH topology
1WN0A 3IQTA 3MYFA 1OXKA 2OOCA 1C03A 2A0BA 1C02A 1TQGA 1SR2A 1FR0A 1QSPA 1YVIA 2LCHA 1Y6DA 1OXBA 1A0BA 2LP4A 1I5NA 4EUKB 4G78A 2LD6A 3KYIA 3US6A 3U3BA 1BDJB 2R25A 4PACA 3KYJA 2Q4FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WN0 A;  3IQT A;  3MYF A;  1OXK A;  2OOC A;  1C03 A;  2A0B A;  1C02 A;  1TQG A;  1SR2 A;  1FR0 A;  1QSP A;  1YVI A;  2LCH A;  1Y6D A;  1OXB A;  1A0B A;  2LP4 A;  1I5N A;  4EUK B;  4G78 A;  2LD6 A;  3KYI A;  3US6 A;  3U3B A;  1BDJ B;  2R25 A;  4PAC A;  3KYJ A;  2Q4F A; 
#chains in the Genus database with same CATH topology
 3RYL A;  3T6B A;  3ZWI A;  4BG0 A;  4NCQ A;  4BJ1 A;  1YAU O;  1E2X A;  3KL4 A;  1CGO A;  1WOL A;  3EGX A;  2PP4 A;  3GWN A;  3U8P A;  1M2V B;  3SNH A;  3M1C B;  3IHU A;  4NC3 A;  4ZLD A;  2J46 A;  2HMZ A;  3VYW A;  4A2N B;  3I5P A;  4U5F E;  4NQF A;  4DVY P;  5E2Q A;  3NKE A;  3B9Q A;  1A7E A;  3VRC A;  1FNT c;  5L0C A;  4NTF A;  3G4X A;  1UFB A;  3I4U A;  1U0B B;  4JEA A;  1G4U S;  1ORS C;  2O9X A;  3N0T A;  4Z9H A;  4EBJ A;  1A7D A;  3O6X A;  3U5S A;  4G7H F;  3B29 A;  1TFK B;  1DOW A;  5KYW A;  2MWQ A;  3ZG1 A;  2R25 A;  4PAC A;  3ASO C;  1R4T A;  1Z23 A;  5JLI A;  5KYU A;  4CS8 C;  2H7O A;  5IY5 C;  4G7O F;  1LI7 A;  3DWW A;  3SXZ A;  3EZI A;  3I5Q A;  2G3V A;  4CJO A;  2XM0 A;  2R03 A;  3QW1 A;  2OU6 A;  4AL1 A;  3UGP A;  1SR2 A;  1QVX A;  1GQA A;  1ZVZ A;  1D0Y A;  4YT4 A;  3WAQ A;  4U5G A;  1YVI A;  1T6I A;  2XLH A;  4J7T A;  3ZTM A;  2EIL C;  2KNH A;  3QVZ A;  4KI2 A;  1RJ9 B;  2KQ9 A;  3K1H A;  2J8W A;  4KNW A;  2FFH A;  2WZL A;  4PJJ A;  5CI9 A;  3X2Q C;  1R5I D;  3ZQY A;  4ZLC A;  5DS6 A;  3EH2 A;  2YLD A;  1RKE B;  1VLT A;  2H7B A;  1FFH A;  3EGD A;  1OR2 A;  3EJN A;  2KSF A;  4G0H A;  3ZQV A;  3U3B A;  3FOP A;  1TR2 A;  1J8Y F;  3H2U A;  5A6K A;  2J9V A;  4HEA J;  2QLA A;  1MMD A;  4AL0 A;  2A6H F;  4XEV A;  5AGF A;  3HNL A;  5JS5 A;  4U5D E;  3Q7G A;  2B0H A;  2AU5 A;  5JP7 A;  3EFO B;  2P7V A;  3W8H A;  3GEE A;  1L3P A;  2ZPA A;  5T3T A;  4Q4Z F;  3MYI A;  2F22 A;  2J45 A;  2XSE A;  1LKX A;  3DM5 A;  3PCV A;  5JVE A;  2GDC A;  1VTM P;  4OD4 A;  3TUL A;  2Z15 A;  3DM9 B;  3W8I A;  4JTA B;  3RF3 A;  5DLJ A;  3C8Z A;  2WB7 A;  5KYX A;  2NPU A;  4CS8 A;  2CGE A;  2L6F A;  1I5N A;  3ZSU A;  1O3U A;  1VB5 A;  3NYL A;  1D1C A;  2R7X A;  1T6U A;  2XXA B;  4CX9 A;  1APC A;  2R7V A;  3KH2 A;  3H2V A;  3POV A;  1D1A A;  5FZT A;  1Z63 A;  1PD0 A;  3ZVR A;  1OCC C;  3ECS A;  3W2W A;  1JR8 A;  2LK4 A;  2ZXW C;  2FGY A;  3RQE A;  5DVW A;  4C3D A;  2Q9C A;  1OW8 A;  1OCZ C;  4UDV A;  2ETS A;  4YK5 A;  4U5H A;  3M79 A;  3M4B A;  5B1B C;  1ZHZ A;  4G7Z F;  3K6B A;  4ANJ A;  1S7Z A;  5E3A A;  2R7Q A;  3DJU B;  2LIG A;  3G50 A;  1UG7 A;  2L6G A;  4C7O A;  4J32 B;  1KU2 A;  2C03 A;  2LCH A;  4EBB A;  1FTS A;  3R7C A;  1OCO C;  2EPL X;  1H6G A;  3QTH A;  4CDA A;  4YL3 A;  4Z9I A;  1IZM A;  2PX0 A;  3FHD A;  3ABL C;  1XZP A;  3RFY A;  3HLZ A;  2H7V C;  2VC9 A;  2CCY A;  3K33 A;  5DS5 A;  3US6 A;  3RVY A;  1TWG A;  4IWB A;  4MVU A;  4CSA C;  2BL2 A;  2HMQ A;  2WZG A;  5KYY B;  1HW1 A;  2IOQ A;  3JRM O;  4IB4 A;  3JRT A;  2XL4 A;  5D91 A;  2I8B A;  5EGY A;  5E3C A;  4DRJ B;  4WJ0 A;  2R05 A;  3SXK A;  1OQC A;  1GGQ A;  4ER9 A;  2YWA A;  1EQ1 A;  3VF0 A;  1T01 A;  2LQG A;  3BRJ A;  3SP1 A;  2OOC A;  5T1D B;  3W4Y A;  5BQI A;  2IXO A;  1RJ9 A;  1ZU4 A;  4CDY A;  2OQM A;  2WZF A;  1D1B A;  1YLM A;  3LEO A;  4MTF A;  2J9B A;  1FFT C;  3O10 A;  1WAS A;  1ZHT A;  2YL0 A;  4MW8 A;  3K1I C;  3T4R A;  2Q00 A;  2EPK X;  4M63 A;  1HW2 A;  2Y3H A;  4H54 A;  2YEV A;  1A0B A;  2OEV A;  1Y4C A;  1G8X A;  2J7P D;  3AJM A;  4U5E E;  2R7T A;  1SZI A;  2LFD A;  3SZR A;  1FAP B;  2WVO A;  4JEB A;  1OKK D;  3UNG C;  2RD9 A;  1GS9 A;  3NMJ A;  3TQO A;  1YAR O;  1VYI A;  3EPV A;  4DJ9 A;  256B A;  3V5X A;  4OIO F;  3GM3 A;  3HJC A;  4RD9 A;  3VM6 A;  4WGZ A;  3VAY A;  2R7R A;  1RXQ A;  2E87 A;  1V4A A;  3FXH A;  1QPU A;  4E0I A;  5CIV A;  2IXM A;  2BC5 A;  3GOD A;  2NSF A;  2YHS A;  1SMY F;  3GAN A;  3NG1 A;  1K05 A;  2XXA A;  2R7S A;  4CSA A;  4O7G A;  1CGN A;  2EPM X;  4PJN A;  2R02 A;  1TFO B;  3CAX A;  3S27 A;  3MBG A;  2Y3B A;  5EHH A;  1ZYR F;  2EIK C;  1SYQ A;  2LP4 A;  4MVM A;  4W8P A;  2ZXP A;  4AE4 B;  4IAR A;  4E18 A;  3V5Z A;  2AP3 A;  2YRF A;  3E70 C;  2KW3 C;  1YDI A;  1Z5Z A;  5EK0 A;  1PV3 A;  4U5B E;  2VAS A;  1OCR C;  2XLE A;  3GOR A;  3O39 A;  4U5C E;  2HSQ A;  2DI3 A;  2R7W A;  1W2W A;  3K1I A;  4NY3 A;  3S29 A;  4D4N A;  1H9T A;  1LIH A;  1TWH A;  1VK5 A;  4NTA A;  3C8G B;  3WG7 C;  2QY9 A;  4JTD B;  3F47 A;  3FOO A;  3LAY A;  2BE5 F;  2XM4 A;  3LUT B;  1HMO A;  2J7P A;  2VCB A;  3AQB A;  1FR0 A;  1Q0D A;  1VOM A;  4LAC B;  3ZC4 A;  4DRI B;  1OKK A;  3HNK A;  3JSZ A;  1AVO B;  1ZHY A;  2VCA A;  4I1M A;  2XL6 A;  1Y6D A;  4J7Y A;  5DS4 A;  4GQH A;  1VYK A;  4JC7 A;  2TMV P;  5HSW A;  1ZW2 A;  2Y69 C;  4EWC A;  2W45 A;  3LLK A;  2YZS A;  3HTK C;  1LPE A;  4XPY A;  2JX0 A;  4EIY A;  3EHN A;  2R7U A;  5AC5 A;  3DXJ F;  4C3E A;  3EG9 B;  1G4W R;  4O79 A;  5L0F A;  3ASN C;  1E85 A;  1LVK A;  4L6R A;  2Q4F A;  1ORY A;  1Z7Q c;  3AOU A;  1LS4 A;  3ZIB A;  5F28 E;  2CNW D;  5L0I A;  1MQV A;  3NDB B;  2IM8 A;  4K1O A;  1YZC A;  2L7A A;  1MMN A;  3C8G D;  1FMV A;  2GFH A;  2NG1 A;  3QW0 A;  3LLI A;  3RQG A;  1NU9 C;  2PX3 A;  1JMW A;  3LES A;  3KPH A;  4JRZ A;  4MTG A;  2G3K A;  4FES A;  4I1O B;  1C17 M;  1YZA A;  1LE2 A;  1LI5 A;  3C62 A;  1OXB A;  3GM2 A;  4YN0 B;  4JJG A;  4PJL A;  4I3M A;  4FAP B;  4KNV A;  5JUA A;  4NTB A;  1QZX A;  4YT5 A;  3ABM C;  4EKW A;  4AX2 A;  5L3V A;  4C3B A;  2GAQ A;  2Q7R A;  5DQT A;  1TWC A;  1E86 A;  2UUI A;  1CGM E;  3JSE O;  4JE9 A;  4MND A;  3DAG A;  4WGY A;  3U9M A;  3LEV A;  4QI2 A;  3C7J A;  1YA7 O;  2EPN A;  1NBB A;  3U9J A;  4BJT A;  5TJ5 E;  1WWP A;  1ZHW A;  1M2V A;  1M2O A;  2NUP B;  4LLE A;  3LJB A;  2A0U A;  3FVY A;  4YL1 A;  4EBK A;  4YT2 A;  1I4Z A;  1OR3 A;  2KGO A;  4MW3 A;  4U9D A;  2HZ8 A;  1F1M A;  3DZA A;  4LER A;  1D0Z A;  3FDQ A;  2JD3 A;  4IRU A;  5A6B D;  5JRA A;  3S90 A;  4CS7 A;  2A0B A;  4BJ5 C;  2YL3 A;  1AUE A;  1TQG A;  1EA8 A;  1HMD A;  2HSB A;  3HKK A;  2QTV A;  2XS1 A;  2Y3G A;  3DE8 A;  1HE9 A;  2PBE A;  3U2M A;  4O6Y A;  4PFP A;  1RMV A;  1NLX A;  3HNI A;  3EGX B;  1ZU5 A;  1J8M F;  4JUR I;  2P6V A;  1KNY A;  2HJM A;  2CNW A;  3RKO F;  3KKB A;  4JCZ A;  3AGT A;  4OD5 A;  2LD6 A;  5A69 A;  3C8G A;  3PHF 2;  3S9O A;  1MMG A;  1QQ3 A;  5L0H A;  3UGO A;  3V7O A;  3TK0 A;  2YKZ A;  1PD1 A;  1CPR A;  1ZZP A;  2QNL A;  3L8I A;  2HJ3 A;  3DE9 A;  2EIN C;  3N2Z B;  4XLP F;  3LS1 A;  4RDA A;  3NKD A;  4OIR F;  4K7B A;  3MLG A;  2PF4 E;  2J0W A;  1MNE A;  2YQY A;  2AVK A;  4KBL A;  5CI8 A;  5DQZ A;  3TD7 A;  1C02 A;  1KTM A;  4XQ1 A;  2H8A A;  2MYS A;  4GEH A;  3EHM A;  5A6A A;  2VB6 A;  3ABK C;  3ITF A;  2LSE A;  2UUH A;  4EHP A;  1RKE A;  1D0X A;  2P61 A;  3DI5 A;  5B1A C;  2J9W A;  3EG9 A;  1LE4 A;  2XLD A;  4XLN F;  4BPM A;  2M64 A;  1H7I A;  3RVZ A;  4G78 A;  2QE9 A;  4JVS A;  4PFO A;  5A6B A;  1ST6 A;  4N6C A;  2V3C C;  3AG4 C;  3N24 A;  4XEF A;  4BJ5 A;  2HS5 A;  1NG1 A;  3C18 A;  2L9J A;  4U9E A;  2GA0 A;  3EFO A;  2KK1 A;  1B68 A;  4DXW A;  1HY5 A;  2ZD9 A;  5K0I A;  3OWT A;  2FAP B;  3LNM B;  4Z9J A;  3E9V A;  3JTL O;  3S0X A;  1YA9 A;  1OXK A;  2IXP A;  4MS2 A;  4PJM A;  2ZXO A;  3JCU Q;  1OW7 A;  2XS8 A;  3QZC A;  4W8K A;  3T9O A;  4FX5 A;  4AK9 A;  1QKR A;  4DVZ A;  4HE8 D;  2I15 A;  2KJG A;  3AG2 C;  5BQG A;  3WHN A;  4E7S A;  1NU7 D;  1RKC A;  3K66 A;  1IW7 F;  1S05 A;  1G5Z A;  3ATP A;  3DJN B;  3F46 A;  2YLI A;  3K7D A;  2WVQ A;  4PK4 A;  1JOG A;  3NMI A;  3CEX A;  3U3F A;  2P1A A;  3QVY A;  4JIO A;  2GWW A;  3GEH A;  4B6I A;  2HV6 A;  5FCL A;  4O6M A;  1K40 A;  3O55 A;  2YLG A;  1MND A;  2CDQ A;  4JJF A;  1V55 C;  2NUT B;  4RBN A;  3U2L A;  1U6H A;  2HFI A;  4D4X A;  5KYX B;  3T6J A;  3Q7L A;  4IGG A;  1E84 A;  2C04 A;  3L1M A;  3CSK A;  1BR1 A;  3UMK A;  2A68 F;  4CS9 C;  4OIP F;  3CZ6 A;  3JZ0 A;  2HKV A;  2IXN A;  2IBF A;  3DD7 A;  5BUO A;  3NYM A;  4DRH B;  3L34 A;  5JT4 A;  5F5F A;  1BZ4 A;  1Z3I X;  2CYD A;  1LM3 B;  4MVR A;  4YT8 A;  5A6J A;  2Q3T A;  2W9Y A;  3SXM A;  3AG1 C;  4QI0 A;  1QSP A;  3RIP A;  3U8V A;  5JSL A;  2J9U A;  3Q6N A;  5KYY A;  2AWC A;  4IAQ A;  3IQ5 A;  4O6N A;  2IYL D;  1Q0M A;  3H65 A;  2WL8 A;  4LDQ A;  1LS1 A;  2YVK A;  4X0R A;  3ZTZ A;  5B3S C;  4C7O B;  2DB4 A;  3EZH A;  1TKN A;  2V26 A;  4JKV A;  1A41 A;  4LDR A;  2EIM C;  1JPN A;  1V74 B;  4QDL A;  3RQF A;  1BDJ B;  4ULW A;  2QUP A;  1AEP A;  5COM A;  3T6G B;  4JCH A;  2A6E F;  4DBQ A;  3OA1 A;  4P9F A;  2YL7 A;  4MQ9 F;  1V54 C;  4XEK A;  2OCC C;  4WAB A;  3SXY A;  1PCX A;  3GM1 A;  3FMS A;  4E7Z A;  1BR4 A;  3WOD F;  2WVN A;  3UR3 C;  3DKA A;  4E0H A;  2OJQ A;  2AWY A;  3PMR A;  1Q0K A;  4CS9 A;  4H4K C;  2Y3D A;  2X0C A;  1NZE A;  4ONS A;  3QMK A;  4P6I C;  4R32 A;  3SEO A;  3KYI A;  3V5Y A;  3UMH A;  3UMI A;  2A1D D;  3M15 A;  2W4B A;  2VH3 A;  4N6H A;  2D4U A;  2W4M A;  3AG3 C;  2L81 A;  1FMW A;  3JT1 A;  3R2P A;  4ULV A;  3IQ6 A;  1O87 A;  5BQH A;  5L0G A;  1HE1 A;  5GPG B;  1WTY A;  3A11 A;  2EIJ C;  5AC4 A;  5L0J A;  4N06 A;  4E17 A;  1BR2 A;  4XTK A;  3IQT A;  3MYF A;  3EH1 A;  4LDK A;  1YYX A;  3LNR A;  4OIQ F;  1C03 A;  3B0V C;  1N1C A;  4N4W A;  4YWQ A;  1OW6 A;  3U0C A;  1RCP A;  4Q5S F;  3IEE A;  4FWV A;  3NYJ A;  3HNJ A;  1K04 A;  1JRA A;  4AE4 A;  1YJG A;  3X1O A;  4JW1 A;  2PNO A;  2NUT A;  1H9G A;  3CQZ A;  3S28 A;  2P0N A;  2Y39 A;  1NFN A;  3KMI A;  3JYY A;  3SYN A;  2X51 A;  5KYN A;  3W2V A;  1U89 A;  4BJ6 C;  2DYR C;  2XLV A;  3G4Z A;  2L6H A;  5T3W A;  2R7O A;  2Q9B A;  3L8J A;  1I4Y A;  1YYJ A;  4XPW A;  2JPU A;  4OIN F;  1GM5 A;  3FAP B;  4GYT A;  3Q6M A;  4I44 A;  4CJG A;  2YL1 A;  4MTO A;  2LFF A;  2ZXR A;  3DMD A;  3MFN A;  3S84 A;  3AGU A;  4MVS A;  4PR9 A;  3C63 A;  3KYJ A;  3L0I A;  4YJW A;  5D92 A;  3TJ6 A;  5L3Q A;  1WN0 A;  4MVO A;  3JYH A;  3TOM A;  5F5H A;  2XL8 A;  1ORJ A;  2Q9A A;  1T9K A;  1O5H A;  5KYW B;  4P9T A;  4KC9 A;  1M57 C;  3IPM O;  1ZHX A;  1Q0F A;  5HV9 A;  3NMK A;  4YL0 A;  1EI7 A;  2A69 F;  5KYU B;  1M6T A;  1NSG B;  1ZW3 A;  2PFD A;  1Z6A A;  1M56 C;  1VLS A;  3B71 A;  4JTC B;  4A4A A;  2XLW A;  1XZQ A;  2OEX A;  4IJJ A;  2OJE D;  4JZA A;  4CDV A;  4CIP A;  2ASR A;  4CIH A;  1WAT A;  2DYS C;  2XRH A;  4J30 B;  3MX3 A;  1WGW A;  1MMA A;  4IAO A;  3J06 A;  1DOV A;  5E33 A;  2DGJ A;  3TOL A;  1JPJ A;  2XLO A;  1VMA A;  1T5O A;  1TWA A;  1SF8 A;  3RW0 A;  3TJ5 A;  2G62 A;  2D5R B;  4CBE A;  1EKY A;  1T6Q A;  1CPQ A;  2HV7 A;  4MVZ A;  2B0J A;  1Q0G A;  3AQC A;  2OG2 A;  3EGD B;  3ZDL A;  4BJ6 A;  3DAF A;  3LS0 A;  1NFO A;  3GEI A;  4XWJ A;  3B0P A;  3M4C A;  2M4E A;  1QLE C;  4HFK B;  4DOZ A;  3BEH A;  3NRH A;  3PDM P;  2MHR A;  3IQC A;  2EPO A;  5COG A;  2VCC A;  2HUJ A;  2CW0 F;  2R9R B;  2KC3 A;  2ICW G;  2RSE B;  4HFF B;  4K0D A;  1A7V A;  4Q7C A;  3FAJ A;  5L0D A;  1BBH A;  4EUK B;  3RH3 A;  2NUP A;  1JAF A;  4MVQ A;  3EQL F;  1E83 A;  2NSG A;  3GWL A;  4XPX A;  1XWJ A;  1L7C A;  2KYH A;  4DBR A;  2OKU A;  4BEM J;  3B0U X;  5COF A;  4LLC A;  2J0X A;  3OEO A;  5B3I A;  3A9C A;  4BEJ A;  4F4B A;  2XLM A; 
#chains in the Genus database with same CATH homology
 1WN0 A;  3IQT A;  3MYF A;  1OXK A;  2OOC A;  1C03 A;  2A0B A;  1C02 A;  1TQG A;  1SR2 A;  1FR0 A;  1QSP A;  1YVI A;  2LCH A;  1Y6D A;  1OXB A;  1A0B A;  2LP4 A;  1I5N A;  4EUK B;  4G78 A;  2LD6 A;  3KYI A;  3US6 A;  3U3B A;  1BDJ B;  2R25 A;  4PAC A;  3KYJ A;  2Q4F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...