3MYFA

The crystal structure of the hpt domain from the hpt sensor hybrid histidine kinase from shewanella to 1.80a
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
117
structure length
117
Chain Sequence
DLHTLNWDLCLTQANHKSNLALEMLKMLLDSLPETVEKIQTALGQNDQATMLSTIHKLHGASCYCGVPTTQRLCQEIESALKRQTPVEDLEPEILELLDELTKVESAVKQVLSQLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor protein
publication title The Crystal Structure of the HPT domain from the Hpt Sensor Hybrid Histidine Kinase from Shewanella to 1.80A
rcsb
source organism Shewanella sp. w3-18-1
molecule tags Transferase
total genus 46
structure length 117
sequence length 117
chains with identical sequence B, C, D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2010-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 3myfA00
3IQTA 1C03A 1C02A 2R25A 1Y6DA 1FR0A 3KYIA 1WN0A 1QSPA 1TQGA 2A0BA 2LCHA 2LD6A 3U3BA 1YVIA 1BDJB 3KYJA 1OXBA 4PACA 3US6A 2LP4A 2Q4FA 1A0BA 1I5NA 4G78A 3MYFA 1SR2A 2OOCA 1OXKA 4EUKB
chains in the Genus database with same CATH superfamily
3TD7A 2XLHA 2VC9A 3TULA 2AVKA 3R7CA 3NDBB 2Y69C 3DM5A 3IEEA 1M2VB 1YJGA 2CNWD 3W2WA 2XL4A 4HEAJ 5DQZA 4DRJB 4DBRA 3L8JA 3SNHA 1QSPA 3LLKA 4I3MA 5KYNA 2FFHA 4N4WA 2OJED 4CSAA 4MVOA 3T6JA 1O5HA 3FOPA 3KYJA 2AP3A 4D4NA 4CIPA 3RVZA 3RW0A 1NSGB 1RJ9B 1YLMA 3DAFA 4IRUA 5L3QA 4QI0A 2VCCA 2Q9BA 3TJ6A 1R4TA 2KGOA 3EQLF 5D91A 1LI7A 2XXAB 2VH3A 3L1MA 3WHNA 2Q7RA 3EZHA 4P9FA 1FFHA 4ULWA 4G0HA 4Q4ZF 1A7EA 4WABA 2HUJA 2KYHA 1LE2A 3N0TA 3RVYA 3ZQYA 1E2XA 2AWCA 2WVOA 5GPGB 3QW1A 2OG2A 1FFTC 1WGWA 1PD0A 3NRHA 4MVRA 4YT5A 4JURI 4Z9JA 5B3IA 1YA9A 1CGOA 2J45A 3AG1C 3S9OA 4EBBA 2J0WA 2ZXOA 4PK4A 1T9KA 3ZG1A 1JAFA 256BA 3SZRA 1Q0DA 2P1AA 2XLDA 1TWAA 1APCA 3EGDB 3UMKA 2EPMX 3EG9B 5CI8A 1QPUA 4U5GA 3VF0A 5DVWA 2R7UA 2KK1A 2IM8A 3M79A 4PJMA 4FX5A 3BRJA 3NYMA 3OA1A 2PP4A 5T1DB 3W8IA 3KL4A 4G78A 3PCVA 3SXKA 5A6BD 1Z7Qc 3U8VA 2NG1A 2UUIA 3L34A 3NYJA 2J0XA 4LDRA 3GM2A 3C8GB 3K6BA 2Q00A 3U5SA 1NU7D 4DRHB 2QY9A 4JKVA 4MVSA 5F5HA 3PDMP 3DD7A 4GQHA 4H54A 1E85A 4O6NA 3B29A 3T4RA 2A6HF 4W8KA 2XLEA 3U3FA 5KYUA 1M2VA 3V7OA 2MYSA 3E9VA 5B1BC 2D5RB 4CS8C 2PBEA 3KH2A 4R32A 2NPUA 4YT8A 1EKYA 3CSKA 3JYYA 3DE9A 3U2MA 1JPNA 4KNWA 4ER9A 3LAYA 1G4WR 3GEEA 5E3AA 1SZIA 2A69F 5KYYB 1BDJB 1RCPA 1EQ1A 1NZEA 1RJ9A 4NTBA 5L0FA 1MNDA 5JS5A 4XPYA 5DS4A 1SYQA 2KJGA 2WL8A 1ZU5A 3T9OA 2XXAA 3WG7C 2OOCA 3G4ZA 3NMJA 4JE9A 3K33A 4AE4A 1ZHWA 1VOMA 1C03A 3VRCA 3RIPA 3VYWA 3O39A 3TK0A 1HE9A 4YL3A 4JVSA 3SEOA 3DJUB 4BJ5A 1OCRC 4MVMA 2KSFA 4X0RA 2LQGA 2P61A 2R7XA 2ASRA 2HJ3A 4C3BA 1A41A 3LS0A 3DJNB 5EHHA 1V4AA 4IAQA 1HW2A 4YK5A 3H2VA 4CS9A 3S0XA 3U3BA 1XZQA 1GS9A 1LM3B 3EGDA 4JTAB 1FNTc 4ZLDA 3GWLA 1LIHA 3NMKA 2XSEA 1HY5A 1LKXA 1L7CA 2EILC 2HSBA 1HE1A 1Z5ZA 1MMDA 4HE8D 2B0HA 3F47A 1UG7A 3LLIA 2EPLX 2R05A 4I1OB 1IW7F 4JTDB 4N6CA 4Q7CA 3SP1A 1ORJA 2NUTB 4CS7A 3K66A 5BUOA 5JP7A 2BC5A 3W4YA 3B0VC 3C63A 4E17A 1D1CA 4I44A 1B68A 4ANJA 2OCCC 2LIGA 4XLPF 4CIHA 2W9YA 4CBEA 4CS9C 3EFOB 4NY3A 3SYNA 1TWHA 3QW0A 4EKWA 2Y3GA 5DS5A 2H8AA 2R7RA 3ZQVA 1Y4CA 2MWQA 3K7DA 4O6MA 4CX9A 1M6TA 2DB4A 2ZD9A 1WOLA 1CPRA 2M4EA 3ASNC 3SXMA 4OIOF 4G7OF 1OKKD 1OXBA 3IQCA 2CGEA 5A6JA 3C62A 4JRZA 3C18A 1LS1A 5FCLA 1T6IA 2RSEB 3GEIA 4LDKA 3Q6NA 4J30B 3ZSUA 2NUPB 3DE8A 2H7BA 3DXJF 5A6BA 1CGME 2VB6A 3C8ZA 3GODA 1LVKA 3EZIA 2E87A 3MYIA 1OW7A 4FWVA 2J46A 4BPMA 3DZAA 2FGYA 2EINC 3EJNA 3TJ5A 4P9TA 4IB4A 2XL6A 1D0XA 1KTMA 5E3CA 2YL1A 4KBLA 5L0DA 5KYXB 1WN0A 3HTKC 3LEVA 1RMVA 3W8HA 3J06A 2R02A 1GQAA 2B0JA 5CI9A 2IOQA 2LSEA 5AC5A 4Z9IA 1EI7A 3NKEA 1OW6A 3O55A 2IXNA 1OCOC 1I5NA 3DAGA 2LK4A 4OINF 4PFPA 4C7OB 3RH3A 3RKOF 3FMSA 5DQTA 4QI2A 3H2UA 4C3DA 1HMOA 2BE5F 2XS8A 1DOWA 3M15A 2J9VA 4ULVA 3C8GD 1E86A 1H7IA 4O6YA 1G8XA 1D0YA 1QLEC 2IYLD 2IXOA 1H9GA 3AJMA 3ZWIA 2J9BA 3S29A 1YARO 1D1BA 4AE4B 1LPEA 2XS1A 2QNLA 2HMQA 3PMRA 3R2PA 1MMNA 4FESA 3RQFA 4N6HA 3I5QA 3DWWA 2Y3HA 4JJGA 2WB7A 1ST6A 4E7SA 3K1IC 1T6UA 2WZGA 1F1MA 3QMKA 1QQ3A 1ZZPA 3I5PA 4N06A 5F5FA 3B0PA 4CS8A 3JT1A 2HS5A 4U5FE 1ZHTA 2V3CC 1QVXA 2H7VC 4EHPA 2LFFA 2C03A 3G4XA 3AG4C 2L7AA 1G4US 1TFKB 4K7BA 4L6RA 4MW3A 4EIYA 3HNKA 2NUPA 2WVQA 2YKZA 3FAJA 3SXZA 3EPVA 3U0CA 2XLOA 1TWCA 4KC9A 4LLEA 5A6KA 1E84A 5A6AA 3POVA 1GGQA 2J9UA 3DI5A 3JCUQ 3ZC4A 2TMVP 3L8IA 4E0IA 3QVYA 4EBJA 5BQIA 1OW8A 1HMDA 1Q0GA 1T6QA 2XM0A 4XEKA 1BBHA 4YL1A 3X1OA 1OR3A 3UNGC 1WTYA 3FDQA 1O87A 5JVEA 3DKAA 3JYHA 1H9TA 2QE9A 4A4AA 4U9DA 3BEHA 4G7HF 3KPHA 4YL0A 1OKKA 1A7VA 1JPJA 3DMDA 4IAOA 1Z3IX 4AL0A 3UGOA 3QZCA 1M2OA 4U5DE 1ZHYA 3LS1A 5JUAA 4MVUA 3SXYA 4BJ6C 3Q7LA 1MQVA 2CCYA 2OJQA 2Y3BA 4QDLA 4CJOA 3O6XA 1J8MF 1OXKA 1O3UA 2HV6A 3B71A 2NSFA 2DI3A 4EUKB 4MS2A 1K05A 3HNIA 3TOLA 4YT4A 4KI2A 3UGPA 2OQMA 4O79A 1OQCA 3LJBA 4RDAA 3U2LA 1TR2A 1Y6DA 1RXQA 3C7JA 2XL8A 3M1CB 2ZPAA 4WGYA 4Z9HA 2WZLA 3VM6A 5COGA 1MMGA 1RKEB 1ZW2A 5BQGA 1MNEA 3MX3A 4PR9A 1Z63A 5CIVA 2HKVA 3JTLO 3NYLA 3W2VA 2HJMA 4PJLA 3ATPA 3GORA 3B9QA 2PX0A 3EHNA 3EG9A 5B3SC 1C17M 1Q0MA 5FZTA 3LNRA 1W2WA 4DRIB 1T5OA 3LUTB 4YWQA 2J7PD 4A2NB 5JT4A 1U0BB 5AC4A 4CDVA 4EBKA 3RFYA 4XWJA 3WAQA 2HMZA 4GYTA 2JD3A 4OD4A 4EWCA 3C8GA 5JRAA 2GAQA 2YLGA 2EPNA 1K40A 2ETSA 2PF4E 1WATA 1Z6AA 4LACB 3U9MA 4IARA 1JOGA 3K1HA 1SMYF 1VYIA 1VTMP 3PHF2 4HFKB 1LE4A 2YWAA 3HNLA 4J32B 3KYIA 2Q9CA 5L0HA 1Q0KA 2ZXPA 5D92A 1ZHZA 1ZW3A 3ECSA 5EK0A 3V5YA 1QZXA 4DVZA 3NG1A 2I15A 3HKKA 4AL1A 5KYYA 2AWYA 4O7GA 2R7SA 3UMIA 3IQ5A 2OEVA 1V74B 1VLTA 3T6GB 2GA0A 4JCZA 1SR2A 3JRMO 1OR2A 1NG1A 2L9JA 2L81A 2YL3A 2XLVA 3CAXA 3EH1A 4JC7A 4U5CE 3GWNA 5EGYA 1FAPB 3RF3A 1GM5A 2ZXRA 1N1CA 4YN0B 1BR4A 2PNOA 1KNYA 3S90A 1M57C 3FOOA 3L0IA 2R25A 4RD9A 3CQZA 5A69A 4MTFA 4NTAA 3GM1A 1TKNA 4P6IC 4RBNA 5E33A 2LCHA 4LERA 2IBFA 2L6GA 2LFDA 3NKDA 2LD6A 2W4MA 1L3PA 2M64A 1EA8A 1WWPA 5COFA 3CEXA 5E2QA 3AQBA 5B1AC 5L0JA 1DOVA 3HNJA 3US6A 2BL2A 3ZDLA 3IHUA 1XWJA 1PD1A 3K1IA 2EPOA 2GDCA 1A0BA 1WASA 4JJFA 3S27A 4ZLCA 3OEOA 3KMIA 4BEJA 3MYFA 1KU2A 2GWWA 3O10A 4E7ZA 3EH2A 1PCXA 1MMAA 4K0DA 2CDQA 4XEVA 2JX0A 2NUTA 1I4YA 1JR8A 3RQGA 1NLXA 2C04A 3Q6MA 1VK5A 1AUEA 5DLJA 4D4XA 3A9CA 3A11A 5KYUB 3VAYA 2YEVA 4KNVA 1YZAA 2UUHA 4JW1A 3EFOA 5L0GA 4BJ1A 4E18A 2HFIA 4DBQA 2YHSA 3T6BA 5L3VA 4IGGA 4DJ9A 2YQYA 4I1MA 3UR3C 1E83A 3H65A 3EGXB 2KW3C 1M56C 1BR2A 1V54C 2ICWG 4MVZA 2R9RB 2R7WA 3ABLC 4XEFA 2Q3TA 2Q4FA 2J7PA 3V5XA 3JSZA 5AGFA 2YRFA 2KQ9A 4BEMJ 3HLZA 4LLCA 4DOZA 4MW8A 4IWBA 5K0IA 4BJ6A 1YYXA 1VLSA 4CSAC 3FVYA 2YLIA 3CZ6A 3S84A 4G7ZF 1FMVA 3E70C 4JZAA 4K1OA 2NSGA 3EHMA 1BZ4A 3ZTZA 2JPUA 2O9XA 5JSLA 3LESA 1TQGA 1YDIA 2VCAA 1ZHXA 3AGUA 3MLGA 4U5HA 5KYXA 3B0UX 1U6HA 2I8BA 2Z15A 3HJCA 1AEPA 4PACA 4BG0A 2XLMA 1YAUO 2KNHA 5KYWB 2P7VA 2Y3DA 2G3VA 2EIMC 4C3EA 4PFOA 4JTCB 4XQ1A 2OEXA 2R7OA 3TOMA 3KKBA 4C7OA 2QTVA 2KC3A 2OU6A 1VMAA 4H4KC 4HFFB 2DGJA 2L6HA 4XPXA 4PJJA 3M4CA 2J8WA 1NU9C 1JMWA 2L6FA 2WVNA 5COMA 3N2ZB 4J7YA 4NCQA 3NMIA 3S28A 3ABKC 4MNDA 1Z23A 5TJ5E 3UMHA 1ZYRF 1ORYA 2DYRC 2IXPA 2A68F 4YJWA 3RYLA 1FR0A 3IQ6A 3ZIBA 2ZXWC 5BQHA 3QVZA 4NQFA 4U5EE 2YL0A 3F46A 1LI5A 2R7VA 1A7DA 3AGTA 2G62A 2R03A 1OCCC 1PV3A 1QKRA 3EGXA 3V5ZA 1FMWA 3MBGA 3AOUA 2PFDA 1V55C 2HSQA 4YT2A 3ASOC 1CPQA 4J7TA 3LEOA 1TFOB 2CW0F 2R7TA 2XRHA 3MFNA 3U8PA 3DM9B 4B6IA 2W4BA 3ZTMA 4XPWA 2EIJC 3AG2C 2A0UA 1YA7O 5IY5C 2G3KA 2HZ8A 3IQTA 1R5ID 4ONSA 5T3WA 5HSWA 4OIPF 1U89A 4U5BE 4WJ0A 3FXHA 1HW1A 3FHDA 1BR1A 2OKUA 3QTHA 4CDYA 1C02A 2A6EF 2CNWA 2J9WA 1RKCA 3JZ0A 4IJJA 1YYJA 4WGZA 1CGNA 1UFBA 4MTGA 1AVOB 1XZPA 3GEHA 1D0ZA 1LS4A 2A0BA 2WZFA 4M63A 2V26A 5L0IA 4JEBA 2X51A 3FAPB 1YVIA 3JSEO 2R7QA 1IZMA 2F22A 4LDQA 4MVQA 4NTFA 4CJGA 1VB5A 4FAPB 2LP4A 5KYWA 2YLDA 5T3TA 1YZCA 1FTSA 2QLAA 2PX3A 2RD9A 2W45A 3LNMB 3WODF 4JEAA 2P0NA 1K04A 4PJNA 4BJ5C 4F4BA 1H6GA 2Q9AA 3ABMC 4U9EA 2DYSC 3AG3C 4W8PA 4CDAA 4MQ9F 2EPKX 4GEHA 3GM3A 1G5ZA 3GANA 1OCZC 4OD5A 3ZVRA 4UDVA 3OWTA 3G50A 1Q0FA 2A1DD 2QUPA 2VCBA 3JRTA 3Q7GA 4OIQF 2HV7A 4DVYP 3N24A 2Y39A 2X0CA 3TQOA 4Q5SF 1T01A 2YL7A 2GFHA 5F28E 2XM4A 1NFNA 1RKEA 3M4BA 3ITFA 4XTKA 1J8YF 4MTOA 2MHRA 2XLWA 4AK9A 1D1AA 1SF8A 1JRAA 1ORSC 2EIKC 3AQCA 2YVKA 2H7OA 2AU5A 2VASA 3X2QC 1TWGA 4BJTA 4NC3A 2CYDA 2YZSA 4DXWA 5JLIA 4E0HA 2D4UA 3U9JA 2FAPB 4OIRF 3RQEA 4AX2A 4JIOA 5L0CA 1I4ZA 1NFOA 1ZVZA 2IXMA 2P6VA 1ZU4A 5DS6A 1VYKA 1S05A 5HV9A 1NBBA 1S7ZA 4XLNF 4JCHA 3IPMO 3I4UA
chains in the Genus database with same CATH topology
3IQTA 1C03A 1C02A 2R25A 1Y6DA 1FR0A 3KYIA 1WN0A 1QSPA 1TQGA 2A0BA 2LCHA 2LD6A 3U3BA 1YVIA 1BDJB 3KYJA 1OXBA 4PACA 3US6A 2LP4A 2Q4FA 1A0BA 1I5NA 4G78A 3MYFA 1SR2A 2OOCA 1OXKA 4EUKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IQT A;  1C03 A;  1C02 A;  2R25 A;  1Y6D A;  1FR0 A;  3KYI A;  1WN0 A;  1QSP A;  1TQG A;  2A0B A;  2LCH A;  2LD6 A;  3U3B A;  1YVI A;  1BDJ B;  3KYJ A;  1OXB A;  4PAC A;  3US6 A;  2LP4 A;  2Q4F A;  1A0B A;  1I5N A;  4G78 A;  3MYF A;  1SR2 A;  2OOC A;  1OXK A;  4EUK B; 
#chains in the Genus database with same CATH topology
 3TD7 A;  2XLH A;  2VC9 A;  3TUL A;  2AVK A;  3R7C A;  3NDB B;  2Y69 C;  3DM5 A;  3IEE A;  1M2V B;  1YJG A;  2CNW D;  3W2W A;  2XL4 A;  4HEA J;  5DQZ A;  4DRJ B;  4DBR A;  3L8J A;  3SNH A;  1QSP A;  3LLK A;  4I3M A;  5KYN A;  2FFH A;  4N4W A;  2OJE D;  4CSA A;  4MVO A;  3T6J A;  1O5H A;  3FOP A;  3KYJ A;  2AP3 A;  4D4N A;  4CIP A;  3RVZ A;  3RW0 A;  1NSG B;  1RJ9 B;  1YLM A;  3DAF A;  4IRU A;  5L3Q A;  4QI0 A;  2VCC A;  2Q9B A;  3TJ6 A;  1R4T A;  2KGO A;  3EQL F;  5D91 A;  1LI7 A;  2XXA B;  2VH3 A;  3L1M A;  3WHN A;  2Q7R A;  3EZH A;  4P9F A;  1FFH A;  4ULW A;  4G0H A;  4Q4Z F;  1A7E A;  4WAB A;  2HUJ A;  2KYH A;  1LE2 A;  3N0T A;  3RVY A;  3ZQY A;  1E2X A;  2AWC A;  2WVO A;  5GPG B;  3QW1 A;  2OG2 A;  1FFT C;  1WGW A;  1PD0 A;  3NRH A;  4MVR A;  4YT5 A;  4JUR I;  4Z9J A;  5B3I A;  1YA9 A;  1CGO A;  2J45 A;  3AG1 C;  3S9O A;  4EBB A;  2J0W A;  2ZXO A;  4PK4 A;  1T9K A;  3ZG1 A;  1JAF A;  256B A;  3SZR A;  1Q0D A;  2P1A A;  2XLD A;  1TWA A;  1APC A;  3EGD B;  3UMK A;  2EPM X;  3EG9 B;  5CI8 A;  1QPU A;  4U5G A;  3VF0 A;  5DVW A;  2R7U A;  2KK1 A;  2IM8 A;  3M79 A;  4PJM A;  4FX5 A;  3BRJ A;  3NYM A;  3OA1 A;  2PP4 A;  5T1D B;  3W8I A;  3KL4 A;  4G78 A;  3PCV A;  3SXK A;  5A6B D;  1Z7Q c;  3U8V A;  2NG1 A;  2UUI A;  3L34 A;  3NYJ A;  2J0X A;  4LDR A;  3GM2 A;  3C8G B;  3K6B A;  2Q00 A;  3U5S A;  1NU7 D;  4DRH B;  2QY9 A;  4JKV A;  4MVS A;  5F5H A;  3PDM P;  3DD7 A;  4GQH A;  4H54 A;  1E85 A;  4O6N A;  3B29 A;  3T4R A;  2A6H F;  4W8K A;  2XLE A;  3U3F A;  5KYU A;  1M2V A;  3V7O A;  2MYS A;  3E9V A;  5B1B C;  2D5R B;  4CS8 C;  2PBE A;  3KH2 A;  4R32 A;  2NPU A;  4YT8 A;  1EKY A;  3CSK A;  3JYY A;  3DE9 A;  3U2M A;  1JPN A;  4KNW A;  4ER9 A;  3LAY A;  1G4W R;  3GEE A;  5E3A A;  1SZI A;  2A69 F;  5KYY B;  1BDJ B;  1RCP A;  1EQ1 A;  1NZE A;  1RJ9 A;  4NTB A;  5L0F A;  1MND A;  5JS5 A;  4XPY A;  5DS4 A;  1SYQ A;  2KJG A;  2WL8 A;  1ZU5 A;  3T9O A;  2XXA A;  3WG7 C;  2OOC A;  3G4Z A;  3NMJ A;  4JE9 A;  3K33 A;  4AE4 A;  1ZHW A;  1VOM A;  1C03 A;  3VRC A;  3RIP A;  3VYW A;  3O39 A;  3TK0 A;  1HE9 A;  4YL3 A;  4JVS A;  3SEO A;  3DJU B;  4BJ5 A;  1OCR C;  4MVM A;  2KSF A;  4X0R A;  2LQG A;  2P61 A;  2R7X A;  2ASR A;  2HJ3 A;  4C3B A;  1A41 A;  3LS0 A;  3DJN B;  5EHH A;  1V4A A;  4IAQ A;  1HW2 A;  4YK5 A;  3H2V A;  4CS9 A;  3S0X A;  3U3B A;  1XZQ A;  1GS9 A;  1LM3 B;  3EGD A;  4JTA B;  1FNT c;  4ZLD A;  3GWL A;  1LIH A;  3NMK A;  2XSE A;  1HY5 A;  1LKX A;  1L7C A;  2EIL C;  2HSB A;  1HE1 A;  1Z5Z A;  1MMD A;  4HE8 D;  2B0H A;  3F47 A;  1UG7 A;  3LLI A;  2EPL X;  2R05 A;  4I1O B;  1IW7 F;  4JTD B;  4N6C A;  4Q7C A;  3SP1 A;  1ORJ A;  2NUT B;  4CS7 A;  3K66 A;  5BUO A;  5JP7 A;  2BC5 A;  3W4Y A;  3B0V C;  3C63 A;  4E17 A;  1D1C A;  4I44 A;  1B68 A;  4ANJ A;  2OCC C;  2LIG A;  4XLP F;  4CIH A;  2W9Y A;  4CBE A;  4CS9 C;  3EFO B;  4NY3 A;  3SYN A;  1TWH A;  3QW0 A;  4EKW A;  2Y3G A;  5DS5 A;  2H8A A;  2R7R A;  3ZQV A;  1Y4C A;  2MWQ A;  3K7D A;  4O6M A;  4CX9 A;  1M6T A;  2DB4 A;  2ZD9 A;  1WOL A;  1CPR A;  2M4E A;  3ASN C;  3SXM A;  4OIO F;  4G7O F;  1OKK D;  1OXB A;  3IQC A;  2CGE A;  5A6J A;  3C62 A;  4JRZ A;  3C18 A;  1LS1 A;  5FCL A;  1T6I A;  2RSE B;  3GEI A;  4LDK A;  3Q6N A;  4J30 B;  3ZSU A;  2NUP B;  3DE8 A;  2H7B A;  3DXJ F;  5A6B A;  1CGM E;  2VB6 A;  3C8Z A;  3GOD A;  1LVK A;  3EZI A;  2E87 A;  3MYI A;  1OW7 A;  4FWV A;  2J46 A;  4BPM A;  3DZA A;  2FGY A;  2EIN C;  3EJN A;  3TJ5 A;  4P9T A;  4IB4 A;  2XL6 A;  1D0X A;  1KTM A;  5E3C A;  2YL1 A;  4KBL A;  5L0D A;  5KYX B;  1WN0 A;  3HTK C;  3LEV A;  1RMV A;  3W8H A;  3J06 A;  2R02 A;  1GQA A;  2B0J A;  5CI9 A;  2IOQ A;  2LSE A;  5AC5 A;  4Z9I A;  1EI7 A;  3NKE A;  1OW6 A;  3O55 A;  2IXN A;  1OCO C;  1I5N A;  3DAG A;  2LK4 A;  4OIN F;  4PFP A;  4C7O B;  3RH3 A;  3RKO F;  3FMS A;  5DQT A;  4QI2 A;  3H2U A;  4C3D A;  1HMO A;  2BE5 F;  2XS8 A;  1DOW A;  3M15 A;  2J9V A;  4ULV A;  3C8G D;  1E86 A;  1H7I A;  4O6Y A;  1G8X A;  1D0Y A;  1QLE C;  2IYL D;  2IXO A;  1H9G A;  3AJM A;  3ZWI A;  2J9B A;  3S29 A;  1YAR O;  1D1B A;  4AE4 B;  1LPE A;  2XS1 A;  2QNL A;  2HMQ A;  3PMR A;  3R2P A;  1MMN A;  4FES A;  3RQF A;  4N6H A;  3I5Q A;  3DWW A;  2Y3H A;  4JJG A;  2WB7 A;  1ST6 A;  4E7S A;  3K1I C;  1T6U A;  2WZG A;  1F1M A;  3QMK A;  1QQ3 A;  1ZZP A;  3I5P A;  4N06 A;  5F5F A;  3B0P A;  4CS8 A;  3JT1 A;  2HS5 A;  4U5F E;  1ZHT A;  2V3C C;  1QVX A;  2H7V C;  4EHP A;  2LFF A;  2C03 A;  3G4X A;  3AG4 C;  2L7A A;  1G4U S;  1TFK B;  4K7B A;  4L6R A;  4MW3 A;  4EIY A;  3HNK A;  2NUP A;  2WVQ A;  2YKZ A;  3FAJ A;  3SXZ A;  3EPV A;  3U0C A;  2XLO A;  1TWC A;  4KC9 A;  4LLE A;  5A6K A;  1E84 A;  5A6A A;  3POV A;  1GGQ A;  2J9U A;  3DI5 A;  3JCU Q;  3ZC4 A;  2TMV P;  3L8I A;  4E0I A;  3QVY A;  4EBJ A;  5BQI A;  1OW8 A;  1HMD A;  1Q0G A;  1T6Q A;  2XM0 A;  4XEK A;  1BBH A;  4YL1 A;  3X1O A;  1OR3 A;  3UNG C;  1WTY A;  3FDQ A;  1O87 A;  5JVE A;  3DKA A;  3JYH A;  1H9T A;  2QE9 A;  4A4A A;  4U9D A;  3BEH A;  4G7H F;  3KPH A;  4YL0 A;  1OKK A;  1A7V A;  1JPJ A;  3DMD A;  4IAO A;  1Z3I X;  4AL0 A;  3UGO A;  3QZC A;  1M2O A;  4U5D E;  1ZHY A;  3LS1 A;  5JUA A;  4MVU A;  3SXY A;  4BJ6 C;  3Q7L A;  1MQV A;  2CCY A;  2OJQ A;  2Y3B A;  4QDL A;  4CJO A;  3O6X A;  1J8M F;  1OXK A;  1O3U A;  2HV6 A;  3B71 A;  2NSF A;  2DI3 A;  4EUK B;  4MS2 A;  1K05 A;  3HNI A;  3TOL A;  4YT4 A;  4KI2 A;  3UGP A;  2OQM A;  4O79 A;  1OQC A;  3LJB A;  4RDA A;  3U2L A;  1TR2 A;  1Y6D A;  1RXQ A;  3C7J A;  2XL8 A;  3M1C B;  2ZPA A;  4WGY A;  4Z9H A;  2WZL A;  3VM6 A;  5COG A;  1MMG A;  1RKE B;  1ZW2 A;  5BQG A;  1MNE A;  3MX3 A;  4PR9 A;  1Z63 A;  5CIV A;  2HKV A;  3JTL O;  3NYL A;  3W2V A;  2HJM A;  4PJL A;  3ATP A;  3GOR A;  3B9Q A;  2PX0 A;  3EHN A;  3EG9 A;  5B3S C;  1C17 M;  1Q0M A;  5FZT A;  3LNR A;  1W2W A;  4DRI B;  1T5O A;  3LUT B;  4YWQ A;  2J7P D;  4A2N B;  5JT4 A;  1U0B B;  5AC4 A;  4CDV A;  4EBK A;  3RFY A;  4XWJ A;  3WAQ A;  2HMZ A;  4GYT A;  2JD3 A;  4OD4 A;  4EWC A;  3C8G A;  5JRA A;  2GAQ A;  2YLG A;  2EPN A;  1K40 A;  2ETS A;  2PF4 E;  1WAT A;  1Z6A A;  4LAC B;  3U9M A;  4IAR A;  1JOG A;  3K1H A;  1SMY F;  1VYI A;  1VTM P;  3PHF 2;  4HFK B;  1LE4 A;  2YWA A;  3HNL A;  4J32 B;  3KYI A;  2Q9C A;  5L0H A;  1Q0K A;  2ZXP A;  5D92 A;  1ZHZ A;  1ZW3 A;  3ECS A;  5EK0 A;  3V5Y A;  1QZX A;  4DVZ A;  3NG1 A;  2I15 A;  3HKK A;  4AL1 A;  5KYY A;  2AWY A;  4O7G A;  2R7S A;  3UMI A;  3IQ5 A;  2OEV A;  1V74 B;  1VLT A;  3T6G B;  2GA0 A;  4JCZ A;  1SR2 A;  3JRM O;  1OR2 A;  1NG1 A;  2L9J A;  2L81 A;  2YL3 A;  2XLV A;  3CAX A;  3EH1 A;  4JC7 A;  4U5C E;  3GWN A;  5EGY A;  1FAP B;  3RF3 A;  1GM5 A;  2ZXR A;  1N1C A;  4YN0 B;  1BR4 A;  2PNO A;  1KNY A;  3S90 A;  1M57 C;  3FOO A;  3L0I A;  2R25 A;  4RD9 A;  3CQZ A;  5A69 A;  4MTF A;  4NTA A;  3GM1 A;  1TKN A;  4P6I C;  4RBN A;  5E33 A;  2LCH A;  4LER A;  2IBF A;  2L6G A;  2LFD A;  3NKD A;  2LD6 A;  2W4M A;  1L3P A;  2M64 A;  1EA8 A;  1WWP A;  5COF A;  3CEX A;  5E2Q A;  3AQB A;  5B1A C;  5L0J A;  1DOV A;  3HNJ A;  3US6 A;  2BL2 A;  3ZDL A;  3IHU A;  1XWJ A;  1PD1 A;  3K1I A;  2EPO A;  2GDC A;  1A0B A;  1WAS A;  4JJF A;  3S27 A;  4ZLC A;  3OEO A;  3KMI A;  4BEJ A;  3MYF A;  1KU2 A;  2GWW A;  3O10 A;  4E7Z A;  3EH2 A;  1PCX A;  1MMA A;  4K0D A;  2CDQ A;  4XEV A;  2JX0 A;  2NUT A;  1I4Y A;  1JR8 A;  3RQG A;  1NLX A;  2C04 A;  3Q6M A;  1VK5 A;  1AUE A;  5DLJ A;  4D4X A;  3A9C A;  3A11 A;  5KYU B;  3VAY A;  2YEV A;  4KNV A;  1YZA A;  2UUH A;  4JW1 A;  3EFO A;  5L0G A;  4BJ1 A;  4E18 A;  2HFI A;  4DBQ A;  2YHS A;  3T6B A;  5L3V A;  4IGG A;  4DJ9 A;  2YQY A;  4I1M A;  3UR3 C;  1E83 A;  3H65 A;  3EGX B;  2KW3 C;  1M56 C;  1BR2 A;  1V54 C;  2ICW G;  4MVZ A;  2R9R B;  2R7W A;  3ABL C;  4XEF A;  2Q3T A;  2Q4F A;  2J7P A;  3V5X A;  3JSZ A;  5AGF A;  2YRF A;  2KQ9 A;  4BEM J;  3HLZ A;  4LLC A;  4DOZ A;  4MW8 A;  4IWB A;  5K0I A;  4BJ6 A;  1YYX A;  1VLS A;  4CSA C;  3FVY A;  2YLI A;  3CZ6 A;  3S84 A;  4G7Z F;  1FMV A;  3E70 C;  4JZA A;  4K1O A;  2NSG A;  3EHM A;  1BZ4 A;  3ZTZ A;  2JPU A;  2O9X A;  5JSL A;  3LES A;  1TQG A;  1YDI A;  2VCA A;  1ZHX A;  3AGU A;  3MLG A;  4U5H A;  5KYX A;  3B0U X;  1U6H A;  2I8B A;  2Z15 A;  3HJC A;  1AEP A;  4PAC A;  4BG0 A;  2XLM A;  1YAU O;  2KNH A;  5KYW B;  2P7V A;  2Y3D A;  2G3V A;  2EIM C;  4C3E A;  4PFO A;  4JTC B;  4XQ1 A;  2OEX A;  2R7O A;  3TOM A;  3KKB A;  4C7O A;  2QTV A;  2KC3 A;  2OU6 A;  1VMA A;  4H4K C;  4HFF B;  2DGJ A;  2L6H A;  4XPX A;  4PJJ A;  3M4C A;  2J8W A;  1NU9 C;  1JMW A;  2L6F A;  2WVN A;  5COM A;  3N2Z B;  4J7Y A;  4NCQ A;  3NMI A;  3S28 A;  3ABK C;  4MND A;  1Z23 A;  5TJ5 E;  3UMH A;  1ZYR F;  1ORY A;  2DYR C;  2IXP A;  2A68 F;  4YJW A;  3RYL A;  1FR0 A;  3IQ6 A;  3ZIB A;  2ZXW C;  5BQH A;  3QVZ A;  4NQF A;  4U5E E;  2YL0 A;  3F46 A;  1LI5 A;  2R7V A;  1A7D A;  3AGT A;  2G62 A;  2R03 A;  1OCC C;  1PV3 A;  1QKR A;  3EGX A;  3V5Z A;  1FMW A;  3MBG A;  3AOU A;  2PFD A;  1V55 C;  2HSQ A;  4YT2 A;  3ASO C;  1CPQ A;  4J7T A;  3LEO A;  1TFO B;  2CW0 F;  2R7T A;  2XRH A;  3MFN A;  3U8P A;  3DM9 B;  4B6I A;  2W4B A;  3ZTM A;  4XPW A;  2EIJ C;  3AG2 C;  2A0U A;  1YA7 O;  5IY5 C;  2G3K A;  2HZ8 A;  3IQT A;  1R5I D;  4ONS A;  5T3W A;  5HSW A;  4OIP F;  1U89 A;  4U5B E;  4WJ0 A;  3FXH A;  1HW1 A;  3FHD A;  1BR1 A;  2OKU A;  3QTH A;  4CDY A;  1C02 A;  2A6E F;  2CNW A;  2J9W A;  1RKC A;  3JZ0 A;  4IJJ A;  1YYJ A;  4WGZ A;  1CGN A;  1UFB A;  4MTG A;  1AVO B;  1XZP A;  3GEH A;  1D0Z A;  1LS4 A;  2A0B A;  2WZF A;  4M63 A;  2V26 A;  5L0I A;  4JEB A;  2X51 A;  3FAP B;  1YVI A;  3JSE O;  2R7Q A;  1IZM A;  2F22 A;  4LDQ A;  4MVQ A;  4NTF A;  4CJG A;  1VB5 A;  4FAP B;  2LP4 A;  5KYW A;  2YLD A;  5T3T A;  1YZC A;  1FTS A;  2QLA A;  2PX3 A;  2RD9 A;  2W45 A;  3LNM B;  3WOD F;  4JEA A;  2P0N A;  1K04 A;  4PJN A;  4BJ5 C;  4F4B A;  1H6G A;  2Q9A A;  3ABM C;  4U9E A;  2DYS C;  3AG3 C;  4W8P A;  4CDA A;  4MQ9 F;  2EPK X;  4GEH A;  3GM3 A;  1G5Z A;  3GAN A;  1OCZ C;  4OD5 A;  3ZVR A;  4UDV A;  3OWT A;  3G50 A;  1Q0F A;  2A1D D;  2QUP A;  2VCB A;  3JRT A;  3Q7G A;  4OIQ F;  2HV7 A;  4DVY P;  3N24 A;  2Y39 A;  2X0C A;  3TQO A;  4Q5S F;  1T01 A;  2YL7 A;  2GFH A;  5F28 E;  2XM4 A;  1NFN A;  1RKE A;  3M4B A;  3ITF A;  4XTK A;  1J8Y F;  4MTO A;  2MHR A;  2XLW A;  4AK9 A;  1D1A A;  1SF8 A;  1JRA A;  1ORS C;  2EIK C;  3AQC A;  2YVK A;  2H7O A;  2AU5 A;  2VAS A;  3X2Q C;  1TWG A;  4BJT A;  4NC3 A;  2CYD A;  2YZS A;  4DXW A;  5JLI A;  4E0H A;  2D4U A;  3U9J A;  2FAP B;  4OIR F;  3RQE A;  4AX2 A;  4JIO A;  5L0C A;  1I4Z A;  1NFO A;  1ZVZ A;  2IXM A;  2P6V A;  1ZU4 A;  5DS6 A;  1VYK A;  1S05 A;  5HV9 A;  1NBB A;  1S7Z A;  4XLN F;  4JCH A;  3IPM O;  3I4U A; 
#chains in the Genus database with same CATH homology
 3IQT A;  1C03 A;  1C02 A;  2R25 A;  1Y6D A;  1FR0 A;  3KYI A;  1WN0 A;  1QSP A;  1TQG A;  2A0B A;  2LCH A;  2LD6 A;  3U3B A;  1YVI A;  1BDJ B;  3KYJ A;  1OXB A;  4PAC A;  3US6 A;  2LP4 A;  2Q4F A;  1A0B A;  1I5N A;  4G78 A;  3MYF A;  1SR2 A;  2OOC A;  1OXK A;  4EUK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...