3MYFA

The crystal structure of the hpt domain from the hpt sensor hybrid histidine kinase from shewanella to 1.80a
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
117
structure length
117
Chain Sequence
DLHTLNWDLCLTQANHKSNLALEMLKMLLDSLPETVEKIQTALGQNDQATMLSTIHKLHGASCYCGVPTTQRLCQEIESALKRQTPVEDLEPEILELLDELTKVESAVKQVLSQLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Sensor protein
publication title The Crystal Structure of the HPT domain from the Hpt Sensor Hybrid Histidine Kinase from Shewanella to 1.80A
rcsb
source organism Shewanella sp. w3-18-1
total genus 46
structure length 117
sequence length 117
chains with identical sequence B, C, D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2010-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 3myfA00
3U3BA 3KYJA 1SR2A 3US6A 1FR0A 1C03A 1QSPA 1TQGA 3IQTA 4G78A 3KYIA 4EUKB 1OXBA 2OOCA 2LCHA 3MYFA 2LD6A 1BDJB 1A0BA 1YVIA 2Q4FA 1OXKA 4PACA 1I5NA 2LP4A 2R25A 1C02A 1Y6DA 1WN0A 2A0BA
chains in the Genus database with same CATH superfamily
3GM1A 4U9DA 1Z5ZA 2NUPA 3ECSA 4RBNA 3L8IA 4YK5A 1ZW2A 2X51A 1TWAA 3FAPB 1BR4A 5CI9A 3M79A 1MMGA 1YARO 4ULVA 3ZQVA 3FOPA 1ZHTA 3B0VC 1OQCA 1CGNA 1Z23A 1XZQA 1YLMA 3AOUA 2PFDA 3E9VA 3EPVA 3T6GB 3W8IA 2PNOA 1OKKD 2W9YA 2JX0A 2MHRA 1M56C 1LS1A 4YWQA 1Q0MA 3VF0A 3R2PA 4KC9A 5BQGA 2DI3A 2R9RB 3H65A 2LCHA 4MNDA 5DLJA 2CNWD 2J8WA 5COGA 3TD7A 3UMKA 2HSBA 2VB6A 4DBRA 5L0FA 4OINF 3EGDA 1OR2A 2L6GA 4E7ZA 2R02A 2OKUA 1RKEA 3HNIA 4IGGA 1C02A 3IEEA 4MS2A 2KC3A 1Q0KA 2G3KA 4JURI 2UUIA 2J9BA 3CEXA 3IQ6A 3ZG1A 1D1AA 1QVXA 4P9TA 2Y3DA 4BPMA 2R7RA 4HE8D 4ZLCA 2XM0A 3POVA 3DAGA 1ZYRF 3UR3C 2CYDA 5E3CA 4D4NA 1VB5A 4XEVA 1NZEA 3N24A 3LS1A 5B3SC 1ZU4A 1D1CA 3DKAA 1OW6A 4MVSA 3U8VA 3LLIA 3X1OA 3KKBA 3QTHA 3W4YA 3NMIA 2YRFA 5KYXB 3UGPA 2PX3A 3QW1A 3U9JA 1ST6A 2PF4E 4CS9C 1NFOA 5B3IA 1ZHXA 1A0BA 1BDJB 4IB4A 4JJGA 2ETSA 3DXJF 4CDYA 4CBEA 1RCPA 4CS8A 4XQ1A 4H54A 4HEAJ 2VH3A 5F28E 3RKOF 2CCYA 3A11A 4BJ6C 3SNHA 2HZ8A 1FFTC 1OCRC 1U89A 4XPXA 2GAQA 1YZCA 3FVYA 2FGYA 4J7TA 5L0DA 5E3AA 1L3PA 3EJNA 2YLDA 3JCUQ 3US6A 3C8GA 1MQVA 2KSFA 2WZFA 2DYSC 4LDKA 3VM6A 2TMVP 4FWVA 3TOLA 2QE9A 3GWNA 3JSEO 3M4BA 5A6BA 2F22A 2XRHA 3FOOA 1CGME 1MMNA 3G50A 2LSEA 2Z15A 3DE8A 4JTCB 5E33A 2Q9BA 2PX0A 1FNTc 4JCHA 4LLEA 4MTOA 1OR3A 2JD3A 5B1BC 3HTKC 2CGEA 3A9CA 4PACA 2C03A 4X0RA 3ZSUA 1JR8A 2ASRA 3LLKA 3BEHA 2LP4A 3DMDA 4A4AA 1NLXA 3W2VA 1FMVA 3F46A 1BBHA 3VYWA 3UMHA 2QLAA 4DRJB 3RVYA 1E84A 2W45A 5L0IA 2HJMA 1V74B 1JPJA 2AWCA 2LFDA 4XTKA 5L3QA 2NUTA 3FDQA 4U5BE 5DQZA 1FR0A 3NRHA 3ZVRA 4AL0A 1HY5A 1QSPA 3K1IA 4AE4B 2DYRC 2WVQA 3QVZA 1T6QA 4U5DE 3GEEA 1Y4CA 3KL4A 2V26A 1LI7A 2OEXA 4EKWA 2EPOA 5AC5A 5L0GA 3AQBA 1J8YF 2D5RB 3LEVA 3OA1A 1LKXA 2J7PA 1B68A 2AU5A 2P6VA 1VYIA 4O6MA 5BQHA 1BZ4A 1YVIA 2Q4FA 3S9OA 3AG2C 1VOMA 3EQLF 4C7OB 3T6BA 1RMVA 1VMAA 3CAXA 2HMZA 2KYHA 1LIHA 2YL0A 3EFOA 1OW7A 3ABLC 2KW3C 3EH2A 3Q6MA 2NG1A 3RQFA 4RD9A 4LLCA 1LE2A 1LPEA 4E0HA 4EWCA 4CIPA 2R7TA 2KGOA 3KYJA 1ZZPA 1VLSA 1A41A 1DOWA 3PCVA 3QMKA 3EHMA 4MVOA 2YWAA 3M4CA 4J30B 4JE9A 4QDLA 4DBQA 3KMIA 3T9OA 2EIMC 4PFOA 4XWJA 5L0CA 1OCCC 3S0XA 1QPUA 1I4ZA 1OKKA 4AX2A 2XS1A 5KYWA 4Q7CA 1YA7O 4PJLA 3E70C 2EPKX 3K33A 4O79A 2EILC 2HUJA 3DI5A 3AG1C 2CNWA 1TWGA 1OCZC 4FAPB 3C62A 1YZAA 3K1HA 1RJ9A 4EIYA 2XLHA 2XLOA 1I4YA 1M2VB 3MBGA 4D4XA 1EQ1A 1TWHA 5JS5A 3HLZA 4OIOF 3V5ZA 2EPLX 3U0CA 3UGOA 4CDAA 4YT4A 4EHPA 1A7VA 1YA9A 1RKEB 3HNKA 1ZHYA 4NC3A 5JVEA 2Q00A 4QI0A 2NPUA 2H7OA 3O6XA 4JZAA 4RDAA 3RVZA 3LUTB 4PFPA 3LNMB 2Q7RA 4XPWA 1RKCA 4CS8C 2HS5A 2HV7A 4G78A 2VCAA 1O87A 2J9WA 3VRCA 3IQ5A 3B0PA 5EK0A 4JKVA 4LACB 2XLMA 4P9FA 4B6IA 1R5ID 2H7VC 2YHSA 5COFA 3MYFA 3RW0A 2R7QA 2PP4A 4WGYA 3B29A 1T01A 1DOVA 2L81A 4O6YA 2I15A 3AQCA 4XLPF 4DVZA 2EPMX 1Z63A 2WB7A 3LJBA 1LS4A 4NTBA 4JTAB 2G3VA 4N6HA 2A0UA 3S28A 3S84A 1KNYA 3KH2A 2R7VA 1EKYA 1D1BA 3B71A 2J9UA 2L6FA 4WGZA 5AGFA 4U5CE 1W2WA 5B1AC 1J8MF 1H7IA 4U5FE 4CJOA 5CI8A 2ZXWC 1VLTA 3GEHA 3C8GB 3Q6NA 5DS6A 5KYNA 1CGOA 3UMIA 5KYUA 5DS4A 1V54C 1ORSC 2IXNA 3I5QA 3N0TA 3LEOA 1TFOB 3TJ5A 4N06A 4CSAC 3W8HA 2R05A 3J06A 3DZAA 2LD6A 2IOQA 1ORYA 2IM8A 2IBFA 2UUHA 4YL1A 2X0CA 3RH3A 5BQIA 1YDIA 4K0DA 4O6NA 5L0HA 2H8AA 3K1IC 3TOMA 3EG9B 3MLGA 5TJ5E 5EHHA 2P7VA 1NU7D 3JRMO 3ATPA 3EH1A 1T5OA 3GM2A 4K1OA 4LDRA 3U2LA 3O10A 1HW2A 2XXAB 4PJJA 2NSGA 2R7XA 4AL1A 2D4UA 2IYLD 2A6EF 3T4RA 4BJ6A 3NKEA 3MYIA 1E83A 4JTDB 3GWLA 1OW8A 1Q0DA 2Q3TA 5AC4A 1HE9A 4MTFA 1ZHZA 4CX9A 2Q9AA 4DRHB 3N2ZB 3NKDA 4G0HA 1Q0GA 3SXZA 2IXMA 3L8JA 3M15A 1OXBA 4JCZA 4CS7A 3MX3A 4DRIB 4G7HF 4YN0B 1FTSA 3C63A 1KU2A 1QQ3A 2G62A 2XL6A 1SYQA 3HKKA 1CPRA 2GFHA 1Z6AA 3NMKA 4BJ5C 3DJUB 1MNDA 3SXKA 4OIRF 4QI2A 3SEOA 5T3TA 4JEAA 3RFYA 1WATA 3PHF2 1A7DA 4YT5A 4F4BA 1CPQA 1JOGA 3SZRA 3EGXA 4WABA 1VK5A 4L6RA 1GM5A 2R03A 3ASOC 2L6HA 2ZXPA 3M1CB 2CDQA 5KYXA 2V3CC 3FAJA 4C3EA 2VC9A 2CW0F 4OIPF 3IQTA 1PCXA 3G4XA 4I1OB 4XEKA 3ZC4A 5FCLA 1YAUO 3I4UA 4KNVA 2YZSA 1MNEA 4MTGA 1GGQA 3C18A 1FAPB 3TULA 2OG2A 5KYYB 3LNRA 1LI5A 3KPHA 2A1DD 5K0IA 5DS5A 4K7BA 5T3WA 2Y69C 3RQGA 4OIQF 1FFHA 3B0UX 4CIHA 3CZ6A 3LAYA 2YKZA 2I8BA 2ZXRA 3FHDA 3K6BA 3GM3A 4ONSA 1Z3IX 4LERA 1RJ9B 4MVUA 1NU9C 5A6AA 2B0JA 2QTVA 1WN0A 2A0BA 3U3FA 2OQMA 3MFNA 2Y3BA 3HJCA 4ULWA 3T6JA 2WVOA 2GA0A 2DB4A 3DD7A 1C03A 3S27A 3ZTMA 1Q0FA 3LS0A 4E18A 1MMDA 3C8ZA 1L7CA 2OU6A 1YYXA 2NUPB 2XLEA 4JW1A 4N4WA 256BA 1O3UA 1WASA 2ZXOA 2QY9A 3ASNC 3FXHA 4IJJA 3U2MA 4I1MA 3K7DA 4G7ZF 1IW7F 2R7UA 4H4KC 5T1DB 1M2OA 3U8PA 4ZLDA 3I5PA 1AVOB 2A68F 4HFKB 4JC7A 2IXOA 1U6HA 5F5FA 1S7ZA 2P61A 2XLVA 4OD5A 4AE4A 3H2UA 3H2VA 5JP7A 1ZVZA 3EGDB 5JLIA 3QZCA 3S29A 1PV3A 2OCCC 3L1MA 1LVKA 3ITFA 3W2WA 5FZTA 4R32A 3JYHA 2J45A 2B0HA 4YJWA 4NQFA 1NFNA 1TQGA 1N1CA 4MW3A 1E85A 2HJ3A 4PR9A 1PD0A 4EBJA 4C7OA 1QLEC 2BC5A 3Q7LA 3X2QC 4Z9JA 2BE5F 1ZHWA 3AGUA 4MVQA 4E7SA 4GQHA 4UDVA 2QNLA 3CQZA 2WZLA 4EBBA 3AGTA 5KYUB 2RD9A 1K04A 4HFFB 5D92A 1I5NA 3C7JA 1BR1A 4ANJA 4Q4ZF 1WWPA 2WVNA 2ICWG 3B9QA 1JAFA 4E17A 1NSGB 3JZ0A 1OCOC 1Y6DA 3BRJA 4FX5A 3U3BA 3S90A 3NYMA 3WHNA 4CJGA 3NYLA 1SR2A 1E2XA 2E87A 1JPNA 2YVKA 3Q7GA 5BUOA 1EA8A 3TK0A 2L9JA 2KQ9A 2LFFA 4DVYP 3DWWA 3L34A 3JT1A 1TKNA 3NDBB 2EIJC 1D0YA 3PMRA 1RXQA 4C3DA 5L0JA 1M2VA 1ZU5A 2VCBA 4U9EA 4EBKA 3FMSA 1HW1A 3IHUA 3NYJA 4JEBA 3G4ZA 2P0NA 3JTLO 1T6IA 1GQAA 4Q5SF 3V5YA 5L3VA 1F1MA 2J9VA 4IAOA 2XL8A 1U0BB 1WGWA 5HSWA 2XXAA 2YQYA 4Z9HA 4U5HA 3DM9B 1APCA 1LE4A 3ZTZA 4A2NB 1VYKA 4MVRA 2A69F 3EHNA 4PJMA 2JPUA 3EZIA 2YL7A 4W8PA 3JSZA 1QKRA 2Y3GA 3RF3A 3RYLA 2EPNA 4NY3A 3VAYA 1MMAA 2OJQA 1NBBA 2DGJA 2PBEA 4NCQA 3NG1A 5A69A 1SF8A 4M63A 3EGXB 5F5HA 1XZPA 1V55C 2BL2A 2M4EA 2NSFA 2NUTB 1PD1A 1H9TA 4JJFA 4U5EE 4GEHA 5GPGB 4BJ1A 1G8XA 1G4WR 2RSEB 1AUEA 3AG3C 5EGYA 1VTMP 1EI7A 4MVZA 4MW8A 3SXYA 1KTMA 5JRAA 3GANA 2KJGA 4U5GA 3O55A 1YJGA 2Y39A 3OEOA 4E0IA 2XLDA 3O39A 3WODF 2QUPA 2LQGA 1AEPA 2P1AA 2YLGA 4N6CA 4JVSA 4DXWA 2R7OA 2YEVA 4WJ0A 1SMYF 5CIVA 3K66A 4BEMJ 3UNGC 2MWQA 2L7AA 3WG7C 1G4US 3EFOB 4CDVA 4Z9IA 2W4MA 1BR2A 3GORA 4ER9A 2XM4A 5IY5C 4MQ9F 2R7SA 2AP3A 4IARA 1M57C 2KK1A 3R7CA 2HV6A 1TR2A 4FESA 3SYNA 2HSQA 2XS8A 1T9KA 1WOLA 3EG9A 5A6KA 1IZMA 4KI2A 2GDCA 5HV9A 2HMQA 1K05A 4BG0A 5KYWB 4MVMA 3U5SA 3V5XA 4BEJA 2J0XA 2AWYA 3RQEA 3ZDLA 2YL3A 2YL1A 4OD4A 1XWJA 2M64A 3SP1A 5JT4A 4CSAA 3CSKA 1H9GA 4DJ9A 1QZXA 3ZQYA 4J32B 1T6UA 2O9XA 1C17M 2J46A 4CS9A 5DQTA 2KNHA 3OWTA 1H6GA 2MYSA 2EINC 2A6HF 1D0XA 3C8GD 2XLWA 2ZD9A 3U9MA 2HKVA 4PK4A 2J0WA 3ABMC 4YL0A 4XLNF 3JYYA 1TFKB 4LDQA 3WAQA 3DAFA 3L0IA 5JUAA 1FMWA 3IPMO 3LESA 2HFIA 4O7GA 2VASA 5DVWA 3TJ6A 1S05A 4IWBA 1NG1A 1SZIA 1R4TA 2H7BA 2IXPA 1UG7A 2WL8A 2XSEA 3DM5A 5A6BD 1Z7Qc 4G7OF 2LIGA 1K40A 3AJMA 2EIKC 4W8KA 1A7EA 5D91A 1OXKA 1WTYA 1O5HA 2VCCA 2R7WA 2W4BA 4IAQA 3GODA 4YT2A 4JRZA 2OJED 4PJNA 3V7OA 4DOZA 3TQOA 4XEFA 4KNWA 1LM3B 2ZPAA 1M6TA 4I44A 4NTAA 3DE9A 1V4AA 1HMDA 2AVKA 2XL4A 2YLIA 2WZGA 3F47A 3HNJA 1TWCA 4GYTA 1ZW3A 2FFHA 2FAPB 4BJ5A 1YYJA 1ORJA 5KYYA 1GS9A 2Y3HA 4JIOA 3ABKC 4NTFA 4XPYA 3SXMA 3AG4C 3QVYA 1HE1A 4YL3A 3JRTA 1G5ZA 3GEIA 1HMOA 2GWWA 3EZHA 3QW0A 4KBLA 3NMJA 4IRUA 4P6IC 5E2QA 4J7YA 5A6JA 5JSLA 3ZWIA 2OEVA 4BJTA 4EUKB 2OOCA 1E86A 2J7PD 2C04A 5COMA 1JRAA 4AK9A 4I3MA 3IQCA 1JMWA 1UFBA 3ZIBA 4YT8A 3PDMP 2Q9CA 2R25A 1D0ZA 3RIPA 3DJNB 2LK4A 3HNLA 3KYIA 4C3BA
chains in the Genus database with same CATH topology
3U3BA 3KYJA 1SR2A 3US6A 1FR0A 1C03A 1QSPA 1TQGA 3IQTA 4G78A 3KYIA 4EUKB 1OXBA 2OOCA 2LCHA 3MYFA 2LD6A 1BDJB 1A0BA 1YVIA 2Q4FA 1OXKA 4PACA 1I5NA 2LP4A 2R25A 1C02A 1Y6DA 1WN0A 2A0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U3B A;  3KYJ A;  1SR2 A;  3US6 A;  1FR0 A;  1C03 A;  1QSP A;  1TQG A;  3IQT A;  4G78 A;  3KYI A;  4EUK B;  1OXB A;  2OOC A;  2LCH A;  3MYF A;  2LD6 A;  1BDJ B;  1A0B A;  1YVI A;  2Q4F A;  1OXK A;  4PAC A;  1I5N A;  2LP4 A;  2R25 A;  1C02 A;  1Y6D A;  1WN0 A;  2A0B A; 
#chains in the Genus database with same CATH topology
 3GM1 A;  4U9D A;  1Z5Z A;  2NUP A;  3ECS A;  4RBN A;  3L8I A;  4YK5 A;  1ZW2 A;  2X51 A;  1TWA A;  3FAP B;  1BR4 A;  5CI9 A;  3M79 A;  1MMG A;  1YAR O;  4ULV A;  3ZQV A;  3FOP A;  1ZHT A;  3B0V C;  1OQC A;  1CGN A;  1Z23 A;  1XZQ A;  1YLM A;  3AOU A;  2PFD A;  3E9V A;  3EPV A;  3T6G B;  3W8I A;  2PNO A;  1OKK D;  2W9Y A;  2JX0 A;  2MHR A;  1M56 C;  1LS1 A;  4YWQ A;  1Q0M A;  3VF0 A;  3R2P A;  4KC9 A;  5BQG A;  2DI3 A;  2R9R B;  3H65 A;  2LCH A;  4MND A;  5DLJ A;  2CNW D;  2J8W A;  5COG A;  3TD7 A;  3UMK A;  2HSB A;  2VB6 A;  4DBR A;  5L0F A;  4OIN F;  3EGD A;  1OR2 A;  2L6G A;  4E7Z A;  2R02 A;  2OKU A;  1RKE A;  3HNI A;  4IGG A;  1C02 A;  3IEE A;  4MS2 A;  2KC3 A;  1Q0K A;  2G3K A;  4JUR I;  2UUI A;  2J9B A;  3CEX A;  3IQ6 A;  3ZG1 A;  1D1A A;  1QVX A;  4P9T A;  2Y3D A;  4BPM A;  2R7R A;  4HE8 D;  4ZLC A;  2XM0 A;  3POV A;  3DAG A;  1ZYR F;  3UR3 C;  2CYD A;  5E3C A;  4D4N A;  1VB5 A;  4XEV A;  1NZE A;  3N24 A;  3LS1 A;  5B3S C;  1ZU4 A;  1D1C A;  3DKA A;  1OW6 A;  4MVS A;  3U8V A;  3LLI A;  3X1O A;  3KKB A;  3QTH A;  3W4Y A;  3NMI A;  2YRF A;  5KYX B;  3UGP A;  2PX3 A;  3QW1 A;  3U9J A;  1ST6 A;  2PF4 E;  4CS9 C;  1NFO A;  5B3I A;  1ZHX A;  1A0B A;  1BDJ B;  4IB4 A;  4JJG A;  2ETS A;  3DXJ F;  4CDY A;  4CBE A;  1RCP A;  4CS8 A;  4XQ1 A;  4H54 A;  4HEA J;  2VH3 A;  5F28 E;  3RKO F;  2CCY A;  3A11 A;  4BJ6 C;  3SNH A;  2HZ8 A;  1FFT C;  1OCR C;  1U89 A;  4XPX A;  2GAQ A;  1YZC A;  3FVY A;  2FGY A;  4J7T A;  5L0D A;  5E3A A;  1L3P A;  3EJN A;  2YLD A;  3JCU Q;  3US6 A;  3C8G A;  1MQV A;  2KSF A;  2WZF A;  2DYS C;  4LDK A;  3VM6 A;  2TMV P;  4FWV A;  3TOL A;  2QE9 A;  3GWN A;  3JSE O;  3M4B A;  5A6B A;  2F22 A;  2XRH A;  3FOO A;  1CGM E;  1MMN A;  3G50 A;  2LSE A;  2Z15 A;  3DE8 A;  4JTC B;  5E33 A;  2Q9B A;  2PX0 A;  1FNT c;  4JCH A;  4LLE A;  4MTO A;  1OR3 A;  2JD3 A;  5B1B C;  3HTK C;  2CGE A;  3A9C A;  4PAC A;  2C03 A;  4X0R A;  3ZSU A;  1JR8 A;  2ASR A;  3LLK A;  3BEH A;  2LP4 A;  3DMD A;  4A4A A;  1NLX A;  3W2V A;  1FMV A;  3F46 A;  1BBH A;  3VYW A;  3UMH A;  2QLA A;  4DRJ B;  3RVY A;  1E84 A;  2W45 A;  5L0I A;  2HJM A;  1V74 B;  1JPJ A;  2AWC A;  2LFD A;  4XTK A;  5L3Q A;  2NUT A;  3FDQ A;  4U5B E;  5DQZ A;  1FR0 A;  3NRH A;  3ZVR A;  4AL0 A;  1HY5 A;  1QSP A;  3K1I A;  4AE4 B;  2DYR C;  2WVQ A;  3QVZ A;  1T6Q A;  4U5D E;  3GEE A;  1Y4C A;  3KL4 A;  2V26 A;  1LI7 A;  2OEX A;  4EKW A;  2EPO A;  5AC5 A;  5L0G A;  3AQB A;  1J8Y F;  2D5R B;  3LEV A;  3OA1 A;  1LKX A;  2J7P A;  1B68 A;  2AU5 A;  2P6V A;  1VYI A;  4O6M A;  5BQH A;  1BZ4 A;  1YVI A;  2Q4F A;  3S9O A;  3AG2 C;  1VOM A;  3EQL F;  4C7O B;  3T6B A;  1RMV A;  1VMA A;  3CAX A;  2HMZ A;  2KYH A;  1LIH A;  2YL0 A;  3EFO A;  1OW7 A;  3ABL C;  2KW3 C;  3EH2 A;  3Q6M A;  2NG1 A;  3RQF A;  4RD9 A;  4LLC A;  1LE2 A;  1LPE A;  4E0H A;  4EWC A;  4CIP A;  2R7T A;  2KGO A;  3KYJ A;  1ZZP A;  1VLS A;  1A41 A;  1DOW A;  3PCV A;  3QMK A;  3EHM A;  4MVO A;  2YWA A;  3M4C A;  4J30 B;  4JE9 A;  4QDL A;  4DBQ A;  3KMI A;  3T9O A;  2EIM C;  4PFO A;  4XWJ A;  5L0C A;  1OCC C;  3S0X A;  1QPU A;  1I4Z A;  1OKK A;  4AX2 A;  2XS1 A;  5KYW A;  4Q7C A;  1YA7 O;  4PJL A;  3E70 C;  2EPK X;  3K33 A;  4O79 A;  2EIL C;  2HUJ A;  3DI5 A;  3AG1 C;  2CNW A;  1TWG A;  1OCZ C;  4FAP B;  3C62 A;  1YZA A;  3K1H A;  1RJ9 A;  4EIY A;  2XLH A;  2XLO A;  1I4Y A;  1M2V B;  3MBG A;  4D4X A;  1EQ1 A;  1TWH A;  5JS5 A;  3HLZ A;  4OIO F;  3V5Z A;  2EPL X;  3U0C A;  3UGO A;  4CDA A;  4YT4 A;  4EHP A;  1A7V A;  1YA9 A;  1RKE B;  3HNK A;  1ZHY A;  4NC3 A;  5JVE A;  2Q00 A;  4QI0 A;  2NPU A;  2H7O A;  3O6X A;  4JZA A;  4RDA A;  3RVZ A;  3LUT B;  4PFP A;  3LNM B;  2Q7R A;  4XPW A;  1RKC A;  4CS8 C;  2HS5 A;  2HV7 A;  4G78 A;  2VCA A;  1O87 A;  2J9W A;  3VRC A;  3IQ5 A;  3B0P A;  5EK0 A;  4JKV A;  4LAC B;  2XLM A;  4P9F A;  4B6I A;  1R5I D;  2H7V C;  2YHS A;  5COF A;  3MYF A;  3RW0 A;  2R7Q A;  2PP4 A;  4WGY A;  3B29 A;  1T01 A;  1DOV A;  2L81 A;  4O6Y A;  2I15 A;  3AQC A;  4XLP F;  4DVZ A;  2EPM X;  1Z63 A;  2WB7 A;  3LJB A;  1LS4 A;  4NTB A;  4JTA B;  2G3V A;  4N6H A;  2A0U A;  3S28 A;  3S84 A;  1KNY A;  3KH2 A;  2R7V A;  1EKY A;  1D1B A;  3B71 A;  2J9U A;  2L6F A;  4WGZ A;  5AGF A;  4U5C E;  1W2W A;  5B1A C;  1J8M F;  1H7I A;  4U5F E;  4CJO A;  5CI8 A;  2ZXW C;  1VLT A;  3GEH A;  3C8G B;  3Q6N A;  5DS6 A;  5KYN A;  1CGO A;  3UMI A;  5KYU A;  5DS4 A;  1V54 C;  1ORS C;  2IXN A;  3I5Q A;  3N0T A;  3LEO A;  1TFO B;  3TJ5 A;  4N06 A;  4CSA C;  3W8H A;  2R05 A;  3J06 A;  3DZA A;  2LD6 A;  2IOQ A;  1ORY A;  2IM8 A;  2IBF A;  2UUH A;  4YL1 A;  2X0C A;  3RH3 A;  5BQI A;  1YDI A;  4K0D A;  4O6N A;  5L0H A;  2H8A A;  3K1I C;  3TOM A;  3EG9 B;  3MLG A;  5TJ5 E;  5EHH A;  2P7V A;  1NU7 D;  3JRM O;  3ATP A;  3EH1 A;  1T5O A;  3GM2 A;  4K1O A;  4LDR A;  3U2L A;  3O10 A;  1HW2 A;  2XXA B;  4PJJ A;  2NSG A;  2R7X A;  4AL1 A;  2D4U A;  2IYL D;  2A6E F;  3T4R A;  4BJ6 A;  3NKE A;  3MYI A;  1E83 A;  4JTD B;  3GWL A;  1OW8 A;  1Q0D A;  2Q3T A;  5AC4 A;  1HE9 A;  4MTF A;  1ZHZ A;  4CX9 A;  2Q9A A;  4DRH B;  3N2Z B;  3NKD A;  4G0H A;  1Q0G A;  3SXZ A;  2IXM A;  3L8J A;  3M15 A;  1OXB A;  4JCZ A;  4CS7 A;  3MX3 A;  4DRI B;  4G7H F;  4YN0 B;  1FTS A;  3C63 A;  1KU2 A;  1QQ3 A;  2G62 A;  2XL6 A;  1SYQ A;  3HKK A;  1CPR A;  2GFH A;  1Z6A A;  3NMK A;  4BJ5 C;  3DJU B;  1MND A;  3SXK A;  4OIR F;  4QI2 A;  3SEO A;  5T3T A;  4JEA A;  3RFY A;  1WAT A;  3PHF 2;  1A7D A;  4YT5 A;  4F4B A;  1CPQ A;  1JOG A;  3SZR A;  3EGX A;  4WAB A;  1VK5 A;  4L6R A;  1GM5 A;  2R03 A;  3ASO C;  2L6H A;  2ZXP A;  3M1C B;  2CDQ A;  5KYX A;  2V3C C;  3FAJ A;  4C3E A;  2VC9 A;  2CW0 F;  4OIP F;  3IQT A;  1PCX A;  3G4X A;  4I1O B;  4XEK A;  3ZC4 A;  5FCL A;  1YAU O;  3I4U A;  4KNV A;  2YZS A;  1MNE A;  4MTG A;  1GGQ A;  3C18 A;  1FAP B;  3TUL A;  2OG2 A;  5KYY B;  3LNR A;  1LI5 A;  3KPH A;  2A1D D;  5K0I A;  5DS5 A;  4K7B A;  5T3W A;  2Y69 C;  3RQG A;  4OIQ F;  1FFH A;  3B0U X;  4CIH A;  3CZ6 A;  3LAY A;  2YKZ A;  2I8B A;  2ZXR A;  3FHD A;  3K6B A;  3GM3 A;  4ONS A;  1Z3I X;  4LER A;  1RJ9 B;  4MVU A;  1NU9 C;  5A6A A;  2B0J A;  2QTV A;  1WN0 A;  2A0B A;  3U3F A;  2OQM A;  3MFN A;  2Y3B A;  3HJC A;  4ULW A;  3T6J A;  2WVO A;  2GA0 A;  2DB4 A;  3DD7 A;  1C03 A;  3S27 A;  3ZTM A;  1Q0F A;  3LS0 A;  4E18 A;  1MMD A;  3C8Z A;  1L7C A;  2OU6 A;  1YYX A;  2NUP B;  2XLE A;  4JW1 A;  4N4W A;  256B A;  1O3U A;  1WAS A;  2ZXO A;  2QY9 A;  3ASN C;  3FXH A;  4IJJ A;  3U2M A;  4I1M A;  3K7D A;  4G7Z F;  1IW7 F;  2R7U A;  4H4K C;  5T1D B;  1M2O A;  3U8P A;  4ZLD A;  3I5P A;  1AVO B;  2A68 F;  4HFK B;  4JC7 A;  2IXO A;  1U6H A;  5F5F A;  1S7Z A;  2P61 A;  2XLV A;  4OD5 A;  4AE4 A;  3H2U A;  3H2V A;  5JP7 A;  1ZVZ A;  3EGD B;  5JLI A;  3QZC A;  3S29 A;  1PV3 A;  2OCC C;  3L1M A;  1LVK A;  3ITF A;  3W2W A;  5FZT A;  4R32 A;  3JYH A;  2J45 A;  2B0H A;  4YJW A;  4NQF A;  1NFN A;  1TQG A;  1N1C A;  4MW3 A;  1E85 A;  2HJ3 A;  4PR9 A;  1PD0 A;  4EBJ A;  4C7O A;  1QLE C;  2BC5 A;  3Q7L A;  3X2Q C;  4Z9J A;  2BE5 F;  1ZHW A;  3AGU A;  4MVQ A;  4E7S A;  4GQH A;  4UDV A;  2QNL A;  3CQZ A;  2WZL A;  4EBB A;  3AGT A;  5KYU B;  2RD9 A;  1K04 A;  4HFF B;  5D92 A;  1I5N A;  3C7J A;  1BR1 A;  4ANJ A;  4Q4Z F;  1WWP A;  2WVN A;  2ICW G;  3B9Q A;  1JAF A;  4E17 A;  1NSG B;  3JZ0 A;  1OCO C;  1Y6D A;  3BRJ A;  4FX5 A;  3U3B A;  3S90 A;  3NYM A;  3WHN A;  4CJG A;  3NYL A;  1SR2 A;  1E2X A;  2E87 A;  1JPN A;  2YVK A;  3Q7G A;  5BUO A;  1EA8 A;  3TK0 A;  2L9J A;  2KQ9 A;  2LFF A;  4DVY P;  3DWW A;  3L34 A;  3JT1 A;  1TKN A;  3NDB B;  2EIJ C;  1D0Y A;  3PMR A;  1RXQ A;  4C3D A;  5L0J A;  1M2V A;  1ZU5 A;  2VCB A;  4U9E A;  4EBK A;  3FMS A;  1HW1 A;  3IHU A;  3NYJ A;  4JEB A;  3G4Z A;  2P0N A;  3JTL O;  1T6I A;  1GQA A;  4Q5S F;  3V5Y A;  5L3V A;  1F1M A;  2J9V A;  4IAO A;  2XL8 A;  1U0B B;  1WGW A;  5HSW A;  2XXA A;  2YQY A;  4Z9H A;  4U5H A;  3DM9 B;  1APC A;  1LE4 A;  3ZTZ A;  4A2N B;  1VYK A;  4MVR A;  2A69 F;  3EHN A;  4PJM A;  2JPU A;  3EZI A;  2YL7 A;  4W8P A;  3JSZ A;  1QKR A;  2Y3G A;  3RF3 A;  3RYL A;  2EPN A;  4NY3 A;  3VAY A;  1MMA A;  2OJQ A;  1NBB A;  2DGJ A;  2PBE A;  4NCQ A;  3NG1 A;  5A69 A;  1SF8 A;  4M63 A;  3EGX B;  5F5H A;  1XZP A;  1V55 C;  2BL2 A;  2M4E A;  2NSF A;  2NUT B;  1PD1 A;  1H9T A;  4JJF A;  4U5E E;  4GEH A;  5GPG B;  4BJ1 A;  1G8X A;  1G4W R;  2RSE B;  1AUE A;  3AG3 C;  5EGY A;  1VTM P;  1EI7 A;  4MVZ A;  4MW8 A;  3SXY A;  1KTM A;  5JRA A;  3GAN A;  2KJG A;  4U5G A;  3O55 A;  1YJG A;  2Y39 A;  3OEO A;  4E0I A;  2XLD A;  3O39 A;  3WOD F;  2QUP A;  2LQG A;  1AEP A;  2P1A A;  2YLG A;  4N6C A;  4JVS A;  4DXW A;  2R7O A;  2YEV A;  4WJ0 A;  1SMY F;  5CIV A;  3K66 A;  4BEM J;  3UNG C;  2MWQ A;  2L7A A;  3WG7 C;  1G4U S;  3EFO B;  4CDV A;  4Z9I A;  2W4M A;  1BR2 A;  3GOR A;  4ER9 A;  2XM4 A;  5IY5 C;  4MQ9 F;  2R7S A;  2AP3 A;  4IAR A;  1M57 C;  2KK1 A;  3R7C A;  2HV6 A;  1TR2 A;  4FES A;  3SYN A;  2HSQ A;  2XS8 A;  1T9K A;  1WOL A;  3EG9 A;  5A6K A;  1IZM A;  4KI2 A;  2GDC A;  5HV9 A;  2HMQ A;  1K05 A;  4BG0 A;  5KYW B;  4MVM A;  3U5S A;  3V5X A;  4BEJ A;  2J0X A;  2AWY A;  3RQE A;  3ZDL A;  2YL3 A;  2YL1 A;  4OD4 A;  1XWJ A;  2M64 A;  3SP1 A;  5JT4 A;  4CSA A;  3CSK A;  1H9G A;  4DJ9 A;  1QZX A;  3ZQY A;  4J32 B;  1T6U A;  2O9X A;  1C17 M;  2J46 A;  4CS9 A;  5DQT A;  2KNH A;  3OWT A;  1H6G A;  2MYS A;  2EIN C;  2A6H F;  1D0X A;  3C8G D;  2XLW A;  2ZD9 A;  3U9M A;  2HKV A;  4PK4 A;  2J0W A;  3ABM C;  4YL0 A;  4XLN F;  3JYY A;  1TFK B;  4LDQ A;  3WAQ A;  3DAF A;  3L0I A;  5JUA A;  1FMW A;  3IPM O;  3LES A;  2HFI A;  4O7G A;  2VAS A;  5DVW A;  3TJ6 A;  1S05 A;  4IWB A;  1NG1 A;  1SZI A;  1R4T A;  2H7B A;  2IXP A;  1UG7 A;  2WL8 A;  2XSE A;  3DM5 A;  5A6B D;  1Z7Q c;  4G7O F;  2LIG A;  1K40 A;  3AJM A;  2EIK C;  4W8K A;  1A7E A;  5D91 A;  1OXK A;  1WTY A;  1O5H A;  2VCC A;  2R7W A;  2W4B A;  4IAQ A;  3GOD A;  4YT2 A;  4JRZ A;  2OJE D;  4PJN A;  3V7O A;  4DOZ A;  3TQO A;  4XEF A;  4KNW A;  1LM3 B;  2ZPA A;  1M6T A;  4I44 A;  4NTA A;  3DE9 A;  1V4A A;  1HMD A;  2AVK A;  2XL4 A;  2YLI A;  2WZG A;  3F47 A;  3HNJ A;  1TWC A;  4GYT A;  1ZW3 A;  2FFH A;  2FAP B;  4BJ5 A;  1YYJ A;  1ORJ A;  5KYY A;  1GS9 A;  2Y3H A;  4JIO A;  3ABK C;  4NTF A;  4XPY A;  3SXM A;  3AG4 C;  3QVY A;  1HE1 A;  4YL3 A;  3JRT A;  1G5Z A;  3GEI A;  1HMO A;  2GWW A;  3EZH A;  3QW0 A;  4KBL A;  3NMJ A;  4IRU A;  4P6I C;  5E2Q A;  4J7Y A;  5A6J A;  5JSL A;  3ZWI A;  2OEV A;  4BJT A;  4EUK B;  2OOC A;  1E86 A;  2J7P D;  2C04 A;  5COM A;  1JRA A;  4AK9 A;  4I3M A;  3IQC A;  1JMW A;  1UFB A;  3ZIB A;  4YT8 A;  3PDM P;  2Q9C A;  2R25 A;  1D0Z A;  3RIP A;  3DJN B;  2LK4 A;  3HNL A;  3KYI A;  4C3B A; 
#chains in the Genus database with same CATH homology
 3U3B A;  3KYJ A;  1SR2 A;  3US6 A;  1FR0 A;  1C03 A;  1QSP A;  1TQG A;  3IQT A;  4G78 A;  3KYI A;  4EUK B;  1OXB A;  2OOC A;  2LCH A;  3MYF A;  2LD6 A;  1BDJ B;  1A0B A;  1YVI A;  2Q4F A;  1OXK A;  4PAC A;  1I5N A;  2LP4 A;  2R25 A;  1C02 A;  1Y6D A;  1WN0 A;  2A0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...