1R5ID

Crystal structure of the mam-mhc complex
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
214
structure length
214
Chain Sequence
b'SMKLRVENPKKAQKHFVQNLNNVVFTNKELEDIYNLSNKEETKEVLKLFKLKVNQFYRHAFGIVNDYNGLLEYKEIFNMMFLKLSVVFDTQRKEANNVEQIKRNIAILDEIMAKADNDLSYFISQNKNFQELWDKAVKLTKEMKIKLKGQKLDLRDGEVAINKVRELFGSDKNVKELWWFRSLLVKGVYLIKRYYEGDIELKTTSDFAKAVFED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
molecule tags Immune system
source organism Homo sapiens
publication title Crystal structure of Mycoplasma arthritidis mitogen complexed with HLA-DR1 reveals a novel superantigen fold and a dimerized superantigen-MHC complex.
pubmed doi rcsb
total genus 84
structure length 214
sequence length 214
chains with identical sequence H
ec nomenclature
pdb deposition date 2003-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.530 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A mam-mhc complex, Chain D, Domain 2 1r5iD02
1.20.120.390 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hla class ii histocompatibility antigen, dr alpha chain. Chain D, domain 1 1r5iD01
1R5ID 3KPHA 2ICWG 2OJED
chains in the Genus database with same CATH superfamily
4NHJA 3MZYA 5D4RA 2CUEA 1VQ8I 2BV6A 2EQRA 2HVQA 1Q0GA 2OZ6A 2EFPA 3MFNA 5FCLA 1MH3A 5CVRA 4ABZA 4ENNA 3DJUB 2NS0A 1B9NA 2XLOA 3K1PA 4MLOA 5FRMA 4XKCA 3K70D 3H3VK 2IGMA 2MD5A 3J06A 1F1ZA 4PJNA 4KJZA 4ENMA 2CYDA 3TK0A 2G7HA 1XZPA 4CDGA 1FTSA 4IQ4A 1B59A 3K6GA 1NG7A 4IF4A 2VOOA 3HTKC 3OYNA 2L0KA 2LLKA 5CKTA 2M4EA 2DOEA 3RJPA 1XGOA 4M6VA 1NK3P 4R8HA 2JA6J 2ESNA 1JKRC 1CGNA 5K0IA 5JLXA 1QPUA 3QW1A 1FIAA 1JE8A 1F5TA 2ZXWH 2BHZA 2DTZA 3BWGA 3CLQA 5HDGA 4EM1A 3PJRA 3BPXA 2ETSA 3DD7A 3IUOA 5A69A 1ZGAA 2XLVA 1ORKA 5E3CA 1RNLA 4HQMA 1C0WA 5JI6A 1QQ3A 1W7PD 5EGYA 2ZXOA 2ZJRF 1O3QA 1GXPA 3CJRB 3O8GA 3H2UA 3S1RJ 4XLNF 2LY1A 5TJJA 3PUBA 4QLCU 2FFHA 4H54A 1STZA 1RESA 3ZDLA 5DD4A 5L3GA 2ZKZA 3ZTZA 2JRTA 3BR5A 3S3OA 1L3PA 4RBNA 2L5QA 2HQRA 1KQ0A 2Y2ZA 2XLWA 3E0JB 3KEYA 3HOSA 3WTUC 2M7AA 5FB2A 3C8GA 5IOYA 4U0VA 4HV5A 4B43A 2A0BA 3EHNA 2PBEA 2YEVA 1OW7A 4RAYA 3U1DA 4CXFA 3EETA 4PGHA 3QVYA 3QTHA 3FXMA 2QNLA 3S16J 4GYTA 4DYQA 5AGFA 1R23A 1GDTA 3PHF2 1FYKA 4JW1A 3OMYA 3F23A 3LS1A 2X0CA 1M57C 3S29A 1VQ9I 3PSFA 2IS2A 5EGOA 4E18A 5D5UB 2RAEA 5LD2C 1K61A 2WAQN 2A07F 1HXDA 4I3MA 2Q1ZB 2JQ7A 1R4TA 1GVDA 1I1GA 1WJFA 1TTYA 2IVMA 5KHDA 2QF7A 3HOUJ 2FAPB 2TDXA 4IRHA 4GRIA 1T08B 4BJ1A 3GTLJ 1WSUA 4XLAA 2KL4A 3NMIA 4IB4A 5DTDA 3GTMJ 2OJED 2CFXA 4JCZA 5J3LA 1Q0MA 1TWHA 5CYVA 2JPBA 4J7TA 1RR7A 2OF7A 1KYWA 3A01A 4XEVA 3FK6A 2BY1A 3CJNA 3PFYA 1BR4A 3HL2A 1FEXA 3KP7A 3T1BA 3M07A 5B3SC 3KP3A 4WX9A 5DCMA 4GGGA 2EIMH 1WHUA 3IL2A 4BDZA 1IRGA 3NWSA 4XPXA 1FZPB 4P6IC 4A2NB 2NVUB 5GP9A 3LSPA 4IRIA 2ID6A 5ERIA 3G1LA 3IRRA 3GX4X 5EEHA 2DJIA 1VQ7I 4KT6A 1T6QA 3ZR8X 3GFIA 3TGNA 3AQBA 4XN3A 2LBFA 2DMTA 1ETOA 3EJNA 5L3BA 3C2HA 1LI7A 2NPUA 5LRRA 2LKPA 3V42A 2PX3A 1YYJA 2VUMJ 1ZHTA 3ZIBA 5HNFA 5DD8A 4A2UA 5EDNA 4JEAA 2HKVA 4E0HA 1FIPA 3PNVA 1CPRA 1WJCA 4YL3A 1CGPA 1RUNA 1TP4A 3S90A 4DZJA 2M87A 3VEPA 1ZH5A 2DT7B 1W4MA 2QWWA 2VLAA 3HJCA 5A2QZ 2LY2A 4Y33A 4BEMJ 1DUXC 2HZDA 1XD7A 4WXHA 1DOWA 1FLIA 1BOBA 1RZ4A 1ZRFA 3F3XA 3ZG1A 4N6HA 1XCVA 3A1YA 3GZNB 2H7OA 2HVSA 1MBKA 2FOKA 3VAYA 2LOOA 5IT9Z 1Z05A 1M2VB 2DMPA 4YIRX 2W9YA 2H09A 4Z9HA 3HNIA 3FWEA 3ZP5A 1QVTA 3JRBA 1IGNA 2HQNA 2W24A 2A05A 5KYUA 3W6JB 2HPMA 4PFOA 2VONA 1T33A 5E18F 1ZREA 3LWFA 1S7EA 4KC9A 3BLYA 3FMQA 3G71I 4YEJA 3DQVC 3H5NA 2M4GA 4BE0A 4ENJA 1XMAA 4X0RA 2QENA 1K78B 2X51A 3FHDA 4BXXJ 3DLAA 2YS9A 2HDWA 2AVKA 2L6FA 4BE1A 1PVEA 4HX7A 2ZO4A 4OD5A 4W1UA 3ZQLA 5CI9A 2HS5A 2MLGA 5CLSA 4YIFA 1GGQA 4QDLA 2P5LC 1HE1A 2O8XA 3BR1A 4LD5A 2O9LA 4G7ZF 1KYZA 3ECOA 4O6MA 1MBJA 1ONVA 4CYCA 1X1CA 2L3DA 3R2PA 3QPSA 1A0BA 1SD5A 4WWCA 2CWEA 1P9QC 5M5YJ 4Y4RA 2LFBA 4PJMA 1LM3B 2OA4A 2I10A 4MTEA 4O3MA 2EIJH 2JZYA 4UVCA 1X4PA 2DYRC 2CRGA 4HX8A 3VYTB 1G8XA 2CV1A 2NOJB 3ZQVA 1YLMA 3AG4C 2L9JA 4AC0A 1MNDA 1WJBA 4RAZA 3B02A 2OPTA 3KE2A 3NRHA 3BTCA 4B3AA 5KYUB 1MNEA 2JTVA 2PN6A 3K0LA 4IJAA 3MFKA 1S72I 3JSEO 2YKZA 1Z91A 2JA5J 2VBZA 2X48A 5M3MJ 2J9BA 2LSEA 2ZJ2A 1ODDA 1OJLA 1A04A 1FC3A 2BEOA 2UUZA 4OMZA 1RIOH 4WXCA 1Y56A 2TCTA 1AVOB 3CSKA 4KNWA 3ABKC 3WGHA 2EIJC 3DTEA 3G2BA 4JTAB 2KPMA 1A35A 4MW8A 4D7MA 3ZVRA 2HYJA 2E34A 1KU9A 3OIOA 1P7JA 5EJCA 3RKOF 2XPWA 3AG4H 5IYDJ 2IXSA 4BXUA 4P1WA 3DM9B 3AG2C 4XL9A 2CUZA 4OOIA 1B9MA 3S2HJ 1Y6IA 3OS2A 1RETA 1WI9A 5J4YA 1BR2A 2VQLA 3I64A 9ANTA 1BI2A 5J4VA 3PIPF 1SFUA 4NTBA 3NKDA 1M6TA 3A4CA 3KYDB 1TQGA 4UV8A 3AG1H 3KZIC 3X1OA 2L9SA 3R7CA 2KHMA 1QVUA 3CEXA 1R4MB 2DBBA 3BTIA 1TFOB 3R0AA 4EGYA 1CGME 3JCUQ 2Q7RA 3KP6A 2QLAA 2LFDA 1XDSA 2DA5A 1D8JA 2FF4A 4IJJA 4JX4A 1IDZA 1ZG3A 2XAUA 1BOAA 4Z2YA 3IH4A 5DS5A 2LQGA 1ZN2A 2DMNA 5FO5A 5JFRA 2P6VA 4TV7A 3SZGA 4H4KC 1C17M 2D1VA 3LLKA 4HDVA 3M9AA 3U9JA 4BHPA 1QZYA 3SFZA 1DPUA 4RAGA 4L9VA 1V5FA 3HXLA 1VQPI 3EZHA 4N4WA 3W6VA 2GAQA 3GTPJ 2ZFWA 1QHHD 3D5LA 3HSFA 1VYKA 1I50J 1TWAA 3MAJA 3TQOA 4Y3OA 1WTYA 5FKLA 2WBMA 3B0VC 3CC4I 3U8PA 1ZZPA 4IWBA 2LSOA 1QSPA 4L6RA 2EPMX 2W84A 5CVUA 1O7FA 3L1MA 3IPMO 3TL4X 3SJMA 2RQPA 5JRAA 2L9RA 2XF7A 4CO8A 3KYCB 1IZMA 2I8DA 4M3DA 4MVZA 2ZSIB 4LLGF 4BJ6A 1VTNC 1W5CC 1HOMA 4DRIB 4AYBN 3WHBA 1MW7A 1XSDA 2FQ3A 4IHXA 4CCOA 2XF6A 4K0DA 4F52A 4PCQA 5GAGJ 3LSRA 2DJNA 5TGTA 2R02A 2NNNA 4Q48A 2K9MA 3LSGA 1CF7B 2O03A 4PFPA 1K6YA 2ZXJA 2PJRB 1Z9CA 1JR8A 3LNRA 4LB5A 4IHWA 2EINC 2IGKA 3NEUA 2IGOA 3I4UA 1Z3XA 2JN6A 4EHPA 1WZ2A 3NQOA 1HF0A 1JI8A 1FWZA 1OCRH 1YITI 5M3FJ 4PZJA 3JRTA 2LYCA 4CZCA 4CSAA 2AHQA 2QGUA 3AG2H 2KQ9A 3OOPA 1EH6A 1IC8A 4I0AA 2R5YB 1SAUA 3SYTA 3OYFA 3OYBA 3BQYA 1D0XA 3I9V2 2EPOA 3WU0A 3ZN1A 1I39A 2JVGA 1IW7F 3O39A 3O2PE 5EG0A 1JGSA 3WTWC 1SVMA 3WG7C 2HVRA 5LGTA 2CS3A 2XPVA 5JHFA 2HOEA 1IUFA 1V3FA 5BPIA 3HNKA 2YU9J 1FSHA 4LLCA 4WXDA 2QSGX 4P9UA 1KONA 2LFFA 3K1NA 2XRLA 2R7WA 5GTIC 1RUOA 2G0EA 5FKNA 4EMSA 1B72A 4KA4A 4HDUA 1YFHA 2HFIA 1HLVA 2ICWG 3RF3A 1USSA 4ITVA 1HMDA 1AKHB 4U0WA 2VXZA 2KDZA 2BW3B 4RMNA 5HODA 1SANA 3BZKA 4ZDPA 4KICA 4KISA 2QQAA 3S14J 5BQTA 3B9QA 2D4UA 4W8KA 1ZHWA 3K1MA 4I6ZA 4MTFA 5A6KA 5A6JA 2LREA 2IS1A 5EHHA 2DOAA 3VM6A 1YW7A 5D6EA 3WODF 1JPNA 1MBHA 4M3FA 2L54A 3ZQFA 2V79A 2CUFA 3HOZJ 1HY5A 4RLFA 3FXKA 2LIGA 4MQVA 5K7HA 5JUAA 2G3VA 3MBGA 1UG2A 1WH5A 2X6XA 3B29A 1VYIA 2JPUA 2IGNA 3A01B 1DQUA 2FUG2 2EIKC 3HJEA 4KIBA 3T6BA 1OKRA 1U6HA 1MNMC 2A68F 3FBIB 3QYFA 4X6AJ 4BBRJ 2M9HA 5DVWA 1VQLI 3Q0UA 2BYVE 4A3CJ 1K40A 3C8GD 3PFIA 3UMKA 2IS4A 2MHRA 4Q7CA 4XPYA 3RVYA 3IP4B 2K3FA 4XLHA 4BL0B 1WH7A 3BR0A 3P9KA 5TRDA 4MFDA 4GFBA 2IBFA 3AFHA 3PNYA 1YZCA 2ECBA 2NXNB 1EKEA 4M6XA 5CPRB 3RZDJ 5DQTA 3I54A 2NOGA 3DKWA 4AM3A 4CYCB 4Z9JA 3W4YA 4K1OA 1MGTA 1WCMJ 4BEJA 4CDYA 4ETSA 3T6JA 5CIVA 1W7PA 2ID3A 2J5PA 3L00A 4XNFA 1H7IA 3AGUA 2JUCA 1H6GA 4M74A 3PL8A 2ZXRA 3V7CA 2J9UA 2OD5A 4A3KJ 3SZRA 1A7VA 4M73A 5FKMA 1U0BB 2Y9YA 5F5HA 3FK7A 3ZQQA 1R71A 3B0PA 1YG2A 2CW0F 4BU2A 3H0DA 1TWCJ 1SFOJ 3KKBA 3N05A 1YZAA 1TLHB 3WTYC 1E17A 2B0HA 2XRNA 2VPLA 2P1AA 2VCBA 5J8CA 2V9KA 6PAXA 4U9EA 3FXHA 2EA4A 3L09A 3QP5A 2WC2A 2HMQA 1VQKI 4UUTA 2C04A 2R25A 1TBXA 1QZXA 1QBJA 3DKAA 3IRQA 2R7VA 4G94A 1T0FA 4W8PA 2ZMEC 3QPHA 2HOAA 4YJWA 3MWMA 3GANA 3FIWA 3KP2A 1RKCA 4FETA 4A0ZA 5FROA 3HUGA 3RIRA 2VH3A 3U9MA 1ETXA 1KQ8A 1TT0A 2E35A 2DFIA 4E7IA 2I5UA 4NC6A 1X3WB 3JRFA 3OA1A 1DU0A 3G4XA 4N6CA 3ZN0A 3VWBA 1S7AA 3IAS2 3A2KA 1W0UA 4GEHA 1J5YA 3G1MA 3DZAA 2P81A 2DTRA 5ILUA 4PGGA 4L0YB 2OAZA 5DM6F 2J0XA 2ISYA 4A69C 3NMJA 3ZGKA 1OW8A 4HLYA 4CH7A 2Q9BA 2MH9A 4UXNA 4F55A 4Q4ZF 2K9SA 1G4WR 2HTSA 2YLDA 4S05A 2BL2A 1DP3A 1N77A 4AX2A 2RC4A 3PNTA 1J2XA 2L7KA 5JR3A 2QBYA 4A3IJ 4OD4A 2EH3A 4Y15A 1B72B 2KYHA 2XHKA 2EV0A 2ZMEA 5AC4A 1QA6A 3WGIA 3H36A 3S8PA 2J9VA 3PO3J 1YYXA 4U88A 3F9KA 4XM3A 4DBRA 2P6TA 4AU7A 1FBQA 2P5VA 3GFMA 3QMKA 4B6IA 1I6XA 3PSIA 4A3EJ 2KLOA 3HRTA 2HV7A 4LG0B 3EGXB 2CJJA 3VSLA 3LAPA 2LCHA 1OKKD 3IQ6A 1SFKA 3HGYA 2XDVA 2W7NA 4BNCA 2UUHA 3CUQC 3SXZA 3HC7A 2ACJA 1UB9A 3MZHA 3S1QJ 3A03A 1HA8A 4JRZA 2CFOA 4PJ0C 1NTCA 2GA1A 2RKHA 2Y9ZA 2R7RA 2HYGD 3V7RA 1DGRM 5ILVA 3MEXA 1NFNA 5B1BC 2H7BA 1S9HA 2XGDA 4QTRA 4KIFA 4ULWA 4EJTA 3ZQ7A 3ZMUA 3H92A 2XM4A 2Z33A 5L3CA 2V1UA 3VYWA 4XBFA 2OZUA 1D1CA 1JTXA 1ZYRF 3T8RA 3HDDA 1XZQA 2Q00A 5KAIC 1OLTA 3FXQA 3DBLB 3Q0WA 4JYKA 4IVNA 2M7BA 2PLYA 4WK8F 4RGXA 3MKZA 1YARO 4CBEA 3MD2A 3L7WA 4UVBA 2V3CC 2R5YA 3RQEA 2K85A 3I59A 1F43A 3Q6NA 4ASNA 1UELB 2A0UA 2R7OA 4U7DA 2EILH 4GXOA 1H0MA 3IKTA 5ICFA 2R7TA 3D5RC 4IPAA 1W2WA 4M63A 3CCRI 3EYIA 1I5ZA 1RR8C 2JX0A 3JT1A 1GUUA 3KZYA 2CV0A 2NVTJ 3PDMP 2XXAB 3LEVA 1VF9A 3QWLA 3O6XA 3UKGA 3GEHA 1HC8A 3AOUA 3ZC4A 1RKWA 1NU7D 1R5HA 4V19K 1C02A 4D5CA 3FAPB 4O5VA 2K02A 1R7JA 1N1CA 5KYWB 2KZGA 3OL4A 2RNJA 5LGNA 4L0ZB 1SMYF 3CQZJ 1DGWY 3ZMZA 3ASOH 3QOPA 3Q9SA 1VOMA 4FAPB 4BH9A 1VQ5I 2VE9A 3HKZA 2VJ5A 3K2ZA 4OU0A 4IHVA 1R49A 2IW5A 3O55A 1X1PA 1PD0A 1TWAJ 4KNYA 1BDJB 4IGGA 1J0RA 3RPQA 4B47A 1Z7UA 4OIPF 3LMMA 1ZRCA 3DAGA 2VN2A 2XIGA 3DAFA 1LJ9A 5H6QA 1AEPA 4UB8C 1VQNI 2MWQA 3M79A 4DZPA 1EF4A 1J8MF 5A2QK 1RCPA 3E97A 2OBPA 4EM0B 2E1MC 3ABMH 3VYUB 2GZWA 2WB7A 2AO9A 2UV1A 3A02A 4Y13A 5J6XA 3LA7A 3CJTB 2ECCA 1JJ8C 4O6NA 3HYIA 4P55A 4A0XA 3TKYA 2WL8A 1B6AA 1RI7A 2F5FA 4BYYA 4RBOA 2P7VB 3E6BA 4YIIA 2KW3C 2ZXIA 5L0CA 1H89C 3TO7A 3LL7A 2K27A 4NUBA 4R1HA 1T2KA 3R60A 1CGOA 3E1SA 2BY0A 3CCVI 1E86A 1NG1A 4IAQA 2DI3A 1IAWA 2Q9AA 2QTVA 2XXAA 2MABA 3TQNA 3LSMA 2O5RA 3FM5A 3F6OA 1SZIA 4F7ZA 4MVUA 3GF2A 4IHTA 2RGVA 2YUSA 5B1BH 2X1CA 4U87A 1R9TJ 1XS9A 3QYBA 4UUSA 2O6GE 5LHGA 1AOYA 1I1SA 1FMWA 1TC3C 3SXKA 5F08A 5C4JJ 2MA3A 3US6A 3B73A 1VQMI 1JOGA 2OOCA 1SMTA 4XLCA 3GM1A 4EKWA 5IYBJ 3ISPA 2YZSA 1AUEA 2VQGA 3ESWB 2KIUA 3MYIA 1VLTA 2HPIA 3HHGA 1BJAA 2DMQA 2RD9A 1G4DA 3ZTMA 4I02A 3CCJI 4U5GA 3RPUD 3TP0A 1OCPA 3RQ4A 3EZIA 1PP8F 2Y31A 3LFUA 4IL6C 4A3BJ 3L2WA 2JA7J 4MQ9F 5FKKA 2E19A 2B0LA 3DCFA 3KIOA 4LK0F 2YX4A 4RLQA 4HLXA 5E3AA 3S2WA 1NZEA 2GWRA 4LACB 5E3OA 1J7KA 1IV6A 1FNTc 2OKUA 2CQ7A 5BQGA 3GEIA 5D5XB 4X1EA 1BJZA 2P8TA 5EF6A 3AAFA 1ZR2A 1U9OA 2QQ8A 2A69F 5DCFA 4A5MA 1X1DA 3RDIA 4UUSB 2A5WA 4MS2A 4KMUX 2B63J 4LLEA 3DEWA 1LS4A 3TJ6A 3M15A 2BVLA 3MZ8A 5D8LB 2N8GA 4RB2C 1YE9A 4L9JA 1JKOC 2E5NA 1XG1A 1A36A 1LE4A 5C44J 1O3SA 2K40A 1BC7C 2MW8A 3UGOA 1GHCA 2NUTB 3D1NI 2Z3YA 2X9DA 1APLC 1BBYA 2XAQA 1FAPB 3RIPA 4E7HA 1FTZA 2R03A 1MBFA 1TQPA 3QYEA 4ZDLA 4QPQA 2EFOA 5M5XJ 1IJWC 2W4BA 4FX4A 4OAYA 1FBSA 2E1OA 3CZ6A 5AIQA 5A6BD 4HG2A 3F47A 1J09A 1Q1VA 1T01A 2M5WA 3WHNA 1X3UA 3FHZA 5HDKA 1QRYA 2MD0A 2VXDA 4A6DA 2M30A 1NU9C 2WV1A 3N97A 2E1CA 3QP6A 4HNUA 3JYYA 2LRDA 4P96A 3BCAA 3JRIA 1U78A 5T3TA 3RQIA 4F93B 1Z6AA 2XV4S 2L2OA 2MH2A 2FMLA 4EJWA 2X6YA 4G6DA 5L0JA 2EFNA 1BR1A 3L8IA 1ZVZA 4EJUA 2HTJA 4WGZA 1IN6A 2F4MB 4BGDA 2DDBA 4FCYA 5KYYB 3J81Z 4KN4X 2KMUA 2W4SA 1MMNA 3FX3A 3N2ZB 1L7CA 2NSFA 2EA2A 2IXOA 3EH1A 3LNQA 3KYLA 2YHSA 4NC3A 1SD7A 5L3QA 1UHSA 4MIMA 4YL1A 4HYEA 1R22A 5JVTA 4M71A 1R5GA 3ZWIA 3HRUA 2A3SA 3I53A 2GOMA 3K4BA 1UMQA 5BMZA 4HRIA 2A61A 4BY7J 3LSTA 3FF5A 1B4AA 5DCMB 2OU6A 5L3EA 3FXJA 3LA2A 2E7XA 4HNVA 5ICEA 2D5VA 4J7YA 3L2QA 3SDGA 1FP2A 3BG9A 1YJGA 1RMVA 1NG6A 2ZPAA 4NDLA 1R1VA 5LEKA 1M1EB 4I76A 3NDBB 1J9IA 2M64A 4U5EE 4DOZA 3IH3A 3CUQB 4MEYF 3JYHA 1Y0UA 3IQ5A 4LIUA 2V6CA 4KMFA 4J30B 3QQAA 2ME6A 4AK9A 3BROA 4XICA 3QRFF 2FBIA 1NK2P 3I5UA 3W2AA 3HOXJ 3UMHA 5T3WA 4QIWN 3ZQCA 2G3KA 3KEOA 1SR2A 5D4SA 1JKPC 4JK1X 2KNHA 5KYXB 3S0XA 2A1DD 3Q7LA 5KK1A 1RPWA 1VLSA 2QCOA 2HR3A 3LLIA 1IV8A 4XLFA 2Z9OA 3BTJA 2NS7A 3S15J 1HSTA 1U5TC 1OYWA 5HVQC 5GAEJ 1TL8A 2M34A 1P2FA 1G4US 1F4KA 4ON0A 3AKZA 2VQCA 4FTHA 2ADUA 3H1CA 3DI5A 4XLPF 1ZELA 2P5KA 2YL0A 3ZOBA 2EINH 3R0JA 2EB7A 2L81A 2DOFA 2MSYA 2DMUA 3AG3H 3EDPA 3DBHB 1GXQA 2BY2A 4C2MJ 3PCVA 3QAHA 4LGWA 3RCOA 3GUDA 1LFUP 3EHMA 1QVXA 2HOTA 1YYVA 2DQRA 3LQRA 5IPAA 3C2BA 1UHWA 4MNUA 1T8IA 2E7WA 4LB6B 3BY6A 1P6RA 2R3SA 1GS9A 5AC5A 2K3PA 4CGZA 1FPQA 2VQHA 2XKPA 2HFHA 4NQFA 4FISA 2MYSA 1WJEA 3W2VA 3I5QA 3BZ6A 2CO5A 3DKXA 3TD7A 3RW0A 4CYDA 4XWJA 1XPXA 3S1MJ 2WY8Q 3MVPA 3H3UA 3BCBA 3U9GA 5K7FA 4A3DJ 3JREA 2G9WA 1OYYA 3DF8A 2IYLD 3EG9A 1QGPA 1XWJA 2QA4I 2ELKA 1N25A 3MLGA 1V4RA 2WB1N 4LITA 5FD6A 1VQ4I 2XLDA 3K69A 4CCMA 4YN0B 3G3ZA 3F6VA 3CQZA 4FWVA 4MVRA 3ZSUA 1I27A 4BBSJ 3RH3A 1S6LA 4RDUA 2HWVA 1GV5A 2Z16A 3BJOA 1ORYA 5FRNA 2KC3A 4HF2A 4I44A 3HNLA 1F36A 4HV6A 5BPDA 4IEJA 2H27A 4E70A 4HEAJ 3L1PA 4ZTJA 4IXAA 3U2RA 1LQ1A 3NAUA 1O7LA 2CNWA 4BQQA 1JHHA 3V5ZA 1EI7A 4IOCF 1O87A 5B66C 1E83A 2XAGA 3BRJA 4DW6A 4MVMA 3EG9B 5JHUA 4L5EA 2V6EA 4NTFA 2VT2A 2NUPA 3FKIJ 3OL3A 3T8TA 5KCMA 3A9CA 5CJ9A 1IG7A 1Z7LA 2I8BA 3LNMB 3GVAA 3SXYA 5GPGB 3GLXA 1U5TB 1TNSA 2IA2A 1LUJB 2WTEA 2HKXA 1Z21A 1JUPA 2DYSH 4PK4A 4XLEA 4Y17A 1T39A 4Q5SF 5BUOA 4N4OB 2YRFA 4U9DA 3LA3A 1W36C 2WVNA 1YX5A 3E3VA 5HLGA 1OPCA 4JP0A 4NBQA 2ZMEB 2BVMA 2WAQA 3EFOB 4AD9A 3OYAA 3LQQA 1I4ZA 5F28E 2Z15A 2HOSA 3N4MA 4C2TA 2OCCH 4RM3A 1SAXA 1J8YF 2MLKA 3HOTA 1EJ9A 2IXMA 3GFJA 2P61A 5JP7A 2JJ7A 4ZC3A 4CDVA 1RJ9A 2XL6A 2L7FP 4CX9A 2LD5A 1WJDA 2BW3A 4I0BA 4PR9A 2OCEA 4GO1A 1Y4CA 5FZTA 2PX9A 1ORJA 2WAEA 3NARA 3E6DA 3ABKH 5F27A 4CSWA 2FGYA 2GA0A 5LHHA 2W57A 3S3MA 1OCZH 1W5TA 2DODA 2YX7A 3HKZN 4OIOF 2PFBA 2EJRA 4WF2A 2DA2A 5L3DA 3FISA 4WJ0A 1QQIA 2XLEA 4BJTA 1MD0A 4CCLA 2H94A 3GTQJ 1T95A 1NHAA 2WVOA 2L7ZA 2JT1A 5KYXA 2GDCA 4IOAF 4Y52J 4YT4A 1AWCA 4B4CA 3BPVA 3GWLA 4B09A 1JT6A 4AUXA 1WPKA 1O3RA 1NSGB 2W45A 1ENHA 2BE5F 5E2QA 1ETWA 4NB5A 2PBIA 1UFBA 3I0TA 5CVVA 2Q2EB 2M8GX 3BC8A 3SDBA 3CCMI 1PUFB 1SVOA 3WTXC 1X3ZB 1X1BA 4DYRA 3DU6A 2FA5A 2Y69H 3FM3A 3C18A 3U1KA 4E7SA 1V4AA 2IXPA 3LESA 2EFWA 3ERED 3BZCA 4A3MJ 1OCTC 2C03A 1SYQA 2GIZA 2HZTA 1HDPA 1WJAA 2FE3A 2P0WA 3GBGA 2Z99A 2DPUA 2QZ8A 4G7HF 3QPLA 2Y3DA 1LKXA 2M8EA 2NAZA 5HS7A 3HRSA 4ENKA 1MJ9A 3UGPA 3GTJJ 3FMSA 4B48A 4ZLDA 5HDNA 3S28A 2E5ZA 1JUSA 3CP8A 4B1RA 3CO6C 2CGPA 1T0FC 4BY1J 2CSOA 1TWGJ 4UB6C 3DKYA 5E8GA 1ST6A 4A3LJ 3HPHA 3VODA 2P0NA 2EV5A 5E33A 5GAHJ 4BQNA 1JTYA 3JRCA 5L0FA 3KMIA 2CQNA 2XGCA 1S7ZA 4D5FA 4AVPA 5K5OA 1A7EA 3SEOA 2RV8A 4B3XA 4BJ5A 3FXLA 1L3LA 2EK5A 3ZMSA 1YJ9I 4H0EA 1LEAA 2ZXHA 3EUHA 3R4KA 4FASD 2MC4A 5E20A 3WE3A 4Y7NJ 1MQVA 3HGGA 4KI2A 4MTGA 2Y0SA 2V1NA 1H8AC 3MN2A 4YFXF 1W0TA 1BN5A 1D3YA 3JSOA 3ASNC 1TT5B 4N9IA 2YLIA 1QKRA 3EGDA 4JJGA 1T98A 2L9VA 2KIQA 2CU7A 4A4AA 4N4NB 1BW6A 5E3MA 2QVOA 2KP6A 4B44A 4XKVA 2GLOA 2M0CA 2LF8A 3PO2J 4MVSA 2A6TA 4AL1A 3CMYA 3EGDB 3T4RA 4XKBA 2YL3A 3IAM2 2UXXA 5IP6A 2QKLB 2NVYJ 2WVQA 3T6GB 1X58A 2YLGA 2VC0A 1POGA 2NNYA 4HF1A 3MKYB 3E70C 1UZCA 4BHBA 4A3JJ 2XGXA 2PQ8A 3E5UA 1HKQA 3Q0VA 4XR6A 2GXGA 1A5JA 1ACIA 5F5FA 4F3QA 3VPRA 2CG4A 3TEDA 2DO7A 2V9PA 3M8EA 1DDNA 3OYEA 2XSEA 3F8NA 2A5YB 4ZJZA 1IUYA 2DFHA 2FOWA 2F6CA 2O0YA 3HPGA 3IC7A 3H5RA 4XORA 1FX7A 3OYMA 5M5WJ 1Z67A 4O7GA 4LJZF 4UHTA 2EIMC 5GTHC 5L0HA 4YRVA 2EIKH 4CSAC 2VJJA 3HHHA 3ITFA 1YDIA 4D1QA 2BHYA 1MZBA 4EATA 1NH3A 3FOPA 5AIPA 2KJGA 2PFDA 3C7JA 3DU5A 1B8IB 2TMVP 2J7PA 1E3OC 5K5QA 3CF5F 1HMOA 1ZU4A 1YA9A 2ESHA 2D5RB 4BPMA 1ON1A 2W82A 4WCGA 3GTOJ 2FRHA 1Q0FA 1LE8A 2YVKA 3Q5FA 1V55C 2QQBA 1IXRC 4AVZA 2CW7A 3HSRA 3JCUC 4YG2F 5E17F 3T5XA 5E8IA 2OQMA 3LUTB 2Y0MA 5TISC 2DXIA 1VQ6I 4C3HJ 4BAYA 4CCKA 2QY9A 3FDYA 3AQCA 1LB2A 4DXWA 2Q8KA 2W48A 2R7XA 2KRFA 1ZHYA 4M9SA 3D0SA 3B6AA 5EZGA 2HSBA 5K5RA 2DYRH 3CUOA 3TO9A 1KA8A 1LE8B 1SVLA 1ON2A 4F4BA 2HGCA 4DVYP 2GIVA 2H1LA 4XOPA 2K7LA 3SP1A 2LP0A 4MGRA 5LBQA 3B0UX 3W8HA 2ZXWC 2BGCA 4S04A 3GORA 3AL0C 2HJMA 3X2QH 3BG3A 4EM2A 1EH7A 4JE9A 1SD6A 4QSHA 2J46A 2G7UA 2WY7Q 1S8NA 3DV8A 3PIOF 2K4BA 3PMRA 5J8FA 1GV2A 2XROA 3QVZA 4YFNF 1I5NA 4RB3C 4U7BA 2ZNYA 2L02A 3WU1B 1QU3A 1OW6A 3G50A 2M1BA 2P4WA 2KT0A 3RQGA 3GM2A 1W36D 1NLXA 2ZJQF 1K78A 2GQQA 4D4XA 1WVRA 3CF2A 3L2VA 3VOEA 2R92J 1Q0KA 3NYLA 2J7PD 3ZQIA 2H7VC 3Q9VA 3FAJA 2XSDC 1Y1VJ 5B1AH 1WOLA 2ZB9A 1X2NA 2P7VA 1KTMA 3BG5A 3SEQA 4ZYDA 1QPIA 1WKMA 1ETYA 5F0CA 1Z5ZA 4IQJA 3K33A 2H8RA 2HXIA 4II2A 2X85A 1LNWA 3TDZC 3ZMTA 1M56C 4MVOA 4JTCB 3A0BC 1MBGA 1MMSA 1HE9A 2FXAA 3TOLA 1F1MA 2JA2A 1J59A 3JW4A 2HDDA 4BKXA 3ABLH 1R1TA 4PJJA 3DPUA 3K6BA 3RYPA 4DJAA 3I4MJ 3TJ5A 1QO0D 2F4OB 3NG1A 3ASOC 4MVQA 2COMA 2BXYA 4M3EA 2R7UA 1A6IA 4HAMA 4MHGA 4NTAA 4BQOA 3K1IA 4MNDA 2V1DA 4U5CE 3V7OA 1T38A 4E7LA 2FNPA 2HQAA 3DFGA 4P9TA 3K4CA 3FBNB 4RDAA 4CS8C 3JRGA 2J5OA 3K4MA 1IO2A 2PMZA 4X0GA 3I5PA 1HBXG 3BP8A 5KYWA 3L34A 1MSEC 2VCCA 4IKFA 1TNTA 4JOMA 2LC2A 4CS8A 2XB5A 3CMMA 2M0MA 3GXOA 4IARA 5CQEA 2QQ9A 4JURI 3DBRB 3K4NA 4BEHA 1XX5A 2VKHA 1YJWI 4U0YA 2QUPA 4YT8A 2VASA 1DOVA 3M4CA 4OAZA 2LTPA 3F8MA 2DQLA 1BL0A 2IOQA 2RQQA 4EBKA 1U9NA 3RSNA 2WADA 2YL1A 3K10A 2NYXA 2X6OA 5F0HA 1RC9A 1ZAOA 3EUHC 3KP5A 2ASRA 1LFBA 2KRHA 2QSHX 3X2QC 1BIAA 4HX4A 3H2VA 1YS7A 5FGMA 1WATA 4I01A 4EUKB 1ETQA 5E3LA 2X6WA 2E1MB 4XQ1A 4DIQA 2VBWA 3COAC 4XTKA 2NVXJ 3U3FA 3U21A 2KJBA 2RDPA 4I99C 2VKDA 3BJ6A 2DK5A 3SFIA 2VL8A 2XASA 1HQCA 3ML6A 2L4AA 3HBLA 4CS9A 2YWAA 3KPHA 3DEEA 1S3JA 1R1UA 3CCYA 1G3WA 5D5VB 4RGSA 2UWMA 4XIDA 2I15A 1T5OA 4XPWA 5ICGA 2IA1A 1BBHA 3CUQA 1RXQA 1X4OA 1UCRA 3ZMDA 1BW5A 3KYJA 2VC9A 5L0DA 3K4JA 5E1ZB 1XC5A 4YELA 1WWPA 3VB2A 2V4JC 3S84A 4XEFA 3VDXA 3J81K 1X1AA 2ETHA 1FY7A 1XGMA 3LSJA 4Q47A 2LBFB 3DPTA 4E7ZA 2AXTC 5LFAA 2GWWA 5JLIA 3J7ZI 2RVCA 3HKKA 4ZDOA 3BG6A 2LG4A 3F72A 2PMUA 5DQZA 1T9KA 2HNHA 3V8LA 4A12A 2FQ4A 4XRMA 5T1DB 3G73A 2RNGA 5D91A 1T56A 3WHCA 1HW5A 4EWCA 1K83J 3I3LA 2KISA 3ZRGA 4MEXF 2YQYA 4R79A 3M4OJ 3ATPA 5KYYA 1XB4A 3EUKL 4NQWB 1ZLJA 4ZH4F 1PD1A 2PNOA 3K1IC 1BI1A 3W2WA 1VNDA 4ZTFA 5L3VA 2DCEA 3VSKA 3V8KA 2Z2SB 2CGEA 3S2DJ 1IRZA 2Q3TA 3LFKA 1IN8A 3CC7I 2XB0X 2Y3BA 2EWNA 2PX0A 2VCAA 4YL0A 1XCBA 3REOA 3CTAA 2GXBA 4EIYA 3F8CA 5D8KB 1OQYA 1Y8QB 1VI0A 4AYBA 2HZ8A 1OCZC 5COGA 1K05A 4P5OA 3E9VA 3JRHA 1FTTA 2QBYB 2V26A 4BE2A 5J1RA 3GEZA 1B68A 2KDOA 5DLJA 2VI6A 2AS5F 1KU2A 2NS8A 2XAFA 2GA2A 3DXJF 2YSRA 1MBEA 4HBLA 4JQFA 4OINF 1FJLA 1E0EA 3K4LA 3C63A 1ORSC 4WGYA 2Y30A 2HI3A 1I4YA 2VKVA 3GMEA 2Y3HA 2HKOA 1OISA 3OYDA 3OSGA 1OR7A 3F8FA 2AQEA 2STTA 3AL0B 3C8GB 4AIDA 5EK0A 2MFZA 3M8FA 2V9VA 1AA7A 2XLMA 1KQ9A 4DGWB 1YX3A 3GCMA 1G6NA 3ECSA 2OG2A 2BXZA 2Y39A 3DLLF 2DA1A 4U5HA 2DFEA 4KT5C 2HJ3A 2FU4A 2LP4A 3K2AA 3SNHA 4HE8D 2Y48A 1P4XA 1LVAA 3VYRB 4JC7A 5CVIA 1TWHJ 5FKOA 3ELKA 2H6CA 4E17A 2GOXB 3L2UA 1ZG1A 4E6KG 3IKVA 3CAXA 3WAQA 5JS5A 1GM5A 2L01A 1UFMA 1XN7A 3CDIA 3EUAA 4L5JA 2FBKA 3ZCOA 5FLXZ 2Y75A 2F48A 1H9GA 1E3HA 2IAIA 4AL0A 1R4NB 1ZRDA 3KCCA 4YWQA 5KAFC 4OIQF 1G5ZA 1Z23A 5IP9J 3OYGA 2LH9A 3C3WA 3RI4A 1ERDA 4J32B 4FX5A 3E5QA 1A31A 5ED4A 2AWCA 3H35A 4G9YA 3LAJA 3HTSB 1VB5A 4HSTA 3BDDA 2YL7A 5DM7F 4CA0A 3S9OA 3V7SA 5FLXK 4ER9A 2KZVA 2XUBA 5HS9A 2E71A 2DT6A 3Q3SA 4EGZA 3KYIA 1IN7A 2OQRA 2DW4A 4LG3A 4RD9A 3V5XA 1O4XA 1WASA 3K1HA 1A7DA 4KBLA 5HNHA 3PM1A 2VKEA 3EH2A 4ZZLA 4J00A 2PEXA 3CLOA 5K7ZA 5IOZA 5DUKA 1MDMA 1O5HA 2IA0A 2Z5UA 4MFEA 3JRMO 4RGRA 5H20A 2QE9A 4ESFA 1JHFA 1FP1D 2HSQA 1E3PA 2F2EA 2CQQA 2IS6A 3UMIA 2KK1A 5JT4A 2VC1A 2LDUA 1YQAA 4PSXA 1Z6RA 1OFCX 3HRMA 1AHDP 1OQCA 3SEZA 3H5AA 1ZU5A 2R7FA 2K9LA 2UZKA 3OIPA 4LOCA 2B7EA 3GW2A 3FKJA 4C7OB 5H6RA 1QLEC 1VZ0A 2BZTA 4U5BE 4ZZDA 3WE2A 3LSHA 2BBYA 5LGUA 1M2OA 1XSVA 4MO7A 1LDJA 1R36A 2EZHA 4AE4A 2LK2A 3QW0A 3CP2A 1Y8RB 3EQLF 4IO9F 4FE4A 1U0JA 2XPUA 1ZHZA 3RZOJ 2OU2A 4C3BA 1Z0XA 2YR2A 2VB6A 3HOYJ 2DLLA 2NG1A 5B1AC 2K9QA 1SD4A 3RFYA 3G4SI 4UVAA 4ZYGA 1FYLA 4D0PA 2AU5A 4RGUA 3LJBA 1K04A 1N78A 4R32A 4CS9C 2K5CA 4NC8A 1Q0DA 5D92A 4MTDA 4CCNA 4E7KA 3JRDA 2COBA 2JVHA 3WTSC 1GLNA 1MMGA 1R6RA 3H9GA 2R7SA 1Z7Qc 5F1JA 3JAMK 2F5VA 3TP3A 2XSJC 3J80K 5DS9A 3SXMA 4QWQA 3FXUA 2D45A 1G2HA 4XEKA 2E2IJ 2R7QA 3GM3A 4FE7A 3U2MA 4QI2A 5HS8A 1Y1WJ 4CS7A 3JR9A 3DP7A 2P7CB 1S5LC 1HSJA 3ASNH 5AONA 4BACA 3KH2A 5A6BA 5BOXA 2GM4A 2KJCA 1W1WE 5GPCA 2RREA 1VFCA 4C3IJ 2QUFA 2QM3A 3KEQA 4BS9A 3J7YJ 1H88C 2E2JJ 3M1EA 4M3BA 4CCJA 5J1YA 2VIXA 1MSFC 4G0HA 5KYNA 2EBIA 4XRSG 3GODA 1OR2A 3RKWA 3I56I 1HCRA 4NC7A 3TDUC 3FXRA 2M3AA 2XKOA 3CCEI 1CF7A 3C2GA 2PJRA 3L0IA 2LY9A 1W5SA 4DRHB 4EJVA 1OCRC 2EZIA 3C1DA 3HTUA 4I2OA 4CICA 3OYCA 4YT2A 3F22A 1XMXA 3CCSI 1V54C 5LRSA 4N06A 2XS1A 1V74B 3N0TA 2IJLA 2DA3A 2M2EA 3P9CA 3QODA 2B0JA 4XRSA 5C3EJ 1PV3A 2VJIA 4ESBA 4QPOA 2STWA 3F21A 5IY5H 1F9NA 4XSZF 4XONA 4HF0A 5C4XJ 2F22A 3MKWB 3ABMC 4J19A 1MDMB 2XL8A 3FXOA 1G59A 3OYHA 4ZLCA 2WV0A 1U5TA 2CUJA 1D5YA 1SFEA 3GLLA 4JTDB 3QOEA 5HV9A 1P4WA 2DT5A 2JD3A 3V8JA 3U5SA 4L9NA 2OV7A 4FX0A 4GYGA 4G12A 3RTRA 3JRAA 2R93J 4JEBA 1CQTA 3SQNA 2ME0A 3VYSB 5DDGA 2LD6A 2YU3A 4UNOA 1IF1A 4DQ2A 2Q4FA 5CVJA 1PP7U 2HMZA 2IP2A 2PMZN 2W25A 4RB0A 1U8RA 4G8XA 4DVZA 3K4KA 3GZ6A 2OTJI 1OR3A 2P6SA 3OS1A 1LFPA 3OYJA 1OXKA 2H1KA 2DN0A 2BY3A 3VRCA 4NCQA 4CHUA 2DAOA 4C9YA 4OIRF 4CIPA 3K7DA 3TW6A 1GQAA 3AJMA 1DU6A 1D0ZA 1D1BA 3BQZA 3E5XA 2OQGA 3B6CA 5F6FA 3O6BB 1ITYA 2XF5A 4NY3A 2NSGA 1V55H 1XMKA 2KIFA 2DK8A 1C03A 2VPRA 1FT9A 2LKXA 1IXSB 5KVRA 2E60A 3I58A 3WTTC 2L4MA 1FYMA 4J01A 4Z6YA 1JGGA 5FFZA 4KDPA 5E1WA 4AIJA 1OXBA 2IEKA 3TBIA 5LHIA 3IEEA 4BQAA 1YW9A 4LLNA 4DJ9A 3IH2A 4KIGA 1A41A 2ZJPF 2G62A 3FMRA 4LDQA 5EYRA 1E84A 3KL4A 2XVCA 1UJ8A 4XQFA 2DB4A 3SYNA 2O3FA 2GXAA 1JMWA 4HPQA 3F46A 2LF7A 3RYRA 2AP3A 5J47A 3NMKA 1QNTA 4ZYEA 3E6CC 1YA7O 3V5YA 1D5VA 4ONSA 1JPJA 3T9OA 4B8XA 1ZKGA 2F5CA 2K86A 1L0OC 5KNLA 1I6HJ 3CC2I 3NRVA 4IRGA 1ZHFA 2RN7A 3HG9A 3OY9A 1TR2A 3DM5A 2LK4A 5TJ5E 4L18B 2JUGA 4A6EA 2GBYA 4OWRB 1FFTC 1HDDC 2EV6A 1WQ2A 3DE9A 3G6EI 3BR3A 3S93A 2J9WA 4LFUA 2FNAA 4IHSA 3W8IA 4C3JJ 4GQHA 1BI3A 2D2WA 3MMYB 3NYJA 3K7AJ 2JA8J 1USTA 2YPRA 3HM5A 4I1OB 1MKMA 2CW8A 2W85A 2CV2A 1JUMA 2H6BA 1ZQ3P 2PI0A 2V7FA 2MGQA 3OOUA 1LPEA 5J40A 2C6YA 1ZK8A 1PUEE 4N9HA 4IRUA 2R0QC 2Q0OA 3IHUA 5E3NA 2CNWD 3IQTA 4CJOA 2PMHA 3BEHA 2PG4A 1M2VA 3O8HA 2DA6A 2F5DA 4ZYAA 3QU3A 3NYMA 3JSPA 5DS6A 4IZZA 1UG0A 3BTLA 1JXSA 3IWZA 1VK5A 2L9NA 3ROUA 1FSEA 3SZTA 2Z1DA 3N24A 2M4KA 3UNGC 1DPRA 5BQHA 1RKTA 4JIOA 3M1CB 2E2HJ 3KFWX 4LLLA 3LEOA 1QPMA 3M1CA 4W97A 3HIFA 2LKSA 1S05A 4IX7A 4AWXB 4UDVA 4RA2A 4EVIA 2JK3A 3LAYA 1JAFA 4BDYA 4M6YA 5DV5A 3JTHA 1U8BA 4JX5A 1GVJA 1BZ4A 4KNVA 1FOWA 3VF0A 1Z77A 3ZQHA 2NUPB 1ZARA 2ZD9A 4V2FA 3CESA 4A93J 2CH0A 4AIHA 1Q1HA 4PDKA 4K7BA 4XN0A 1ULYA 3CMEI 2Y3GA 1AU7A 2OTLI 3RVZA 3WGGA 1U2WA 3GWZA 3PQJA 1Z3YA 4NNJA 3ULQB 1LPQA 4P9FA 1A6QA 4XMYA 5IYCJ 2DYSC 3H9QA 2VT3A 4KITB 2HU9A 1Z3IX 2HXOA 4EBJA 3NWTA 4EQQA 4GYIA 3OYKA 3DMDA 4RM2A 1WJ5A 2X0LA 1OMIA 1WI3A 4BJ6C 5DYMA 2CMPA 5JVGF 1XGSA 4PUSA 5E1XA 1SF8A 1WGWA 1YAUO 2L7MP 2XC7A 1E85A 4HZFA 3CCLI 5B5EC 2CCYA 1WWXA 2AXLA 5J1UA 1OCOC 2EPFA 3ZPLA 1MMDA 4XK4A 3GTKJ 4FHTA 1H9TA 4F92B 3ABTA 2NUTA 2E1NA 3SHFA 1YIJI 3E7LA 5JVEA 2JSCA 3BR6A 3HEFA 2WZGA 5FLMJ 5K1YA 4BG0A 4GCVA 3I4NJ 1ZGWA 4A3GJ 1WN0A 1ZG5A 4D9JA 1WFXA 3ECHA 3QPTA 5IT9K 3B71A 1TWCA 1R00A 1IZ1A 1YIOA 2DU9A 2OEXA 3JTGA 256BA 3U0CA 1YOVB 4M9ZA 1OCCH 2OCCC 2ELHA 2XAJA 1FOKA 5F1RA 1RRJA 2K9NA 4HOBA 4XKWA 3BJAA 2WWYA 5COMA 4Z9IA 3CD6I 2D1HA 3OYIA 1T6SA 1EH8A 1W7PB 1LE2A 3TMOA 1PUFA 2KSFA 1BA5A 4UY8I 2XRHA 2Q2EA 4XOTA 3G4ZA 3WG7H 5ILSA 2LNBA 4A0YA 3JSZA 2X1DA 3RYLA 3ABLC 3I71A 3F0CA 2HUJA 4EJOA 2ZXPA 5ICCA 1ETVA 2ELJA 3OV8A 2HV6A 3TOBA 1YS6A 4LMYA 1TW3A 5EEAA 2GFHA 2DFFA 4HW0A 3U3BA 1VMAA 2EILC 3S17J 1KU7A 3KLNA 2QKMB 4FESA 2QSFX 1JJ6C 1HW1A 2Y0SN 1IN5A 1V5GA 2LMDA 4I7HA 3DWWA 1T6IA 1X19A 1PYVA 4YK5A 2MG4A 4M3GA 4LDRA 1BIBA 5F04A 5IT3A 1JKQC 1FMVA 1J75A 5BS6A 1JT0A 4CDAA 1RJ9B 1HKSA 1PJRA 1WGXA 1MIJA 4RS8A 5HOOA 4FT8A 1XGNA 4RB1A 3CCQI 4GDFA 1T6UA 3P7NA 1LVKA 1V5EA 3EGXA 3HNJA 1XSXA 3HOVJ 1Z63A 5FJ8J 1P7IA 2XL4A 4BEHB 4XSXF 2KQRA 4ESJA 3EFOA 1XDUA 5B3SH 1BI0A 3ONQA 3OYLA 4C30A 2A6EF 3WU2C 4ZYHA 2FEZA 2F5EA 3CJQB 4A5NA 3MCZA 3WG9A 2L7AA 3Q6MA 4ULVA 2EZKA 4G6TB 4LK1F 3R6SA 1U3EM 1FOYA 4EBBA 1TWGA 3RKXA 5BNGA 2J0WA 1APCA 4JKVA 4G6QA 2VE8A 4II3A 3PUFA 4I98B 1TQIA 3ZQGA 1EQ1A 5LLQA 1LS1A 2R4GA 3V4GA 1Y39A 2J45A 1AKHA 3M7GA 4DYCA 2H8AA 2LR8A 5DS4A 3HB9A 1QZEA 3GFLA 1LDDA 5D5WB 4G7OF 1NBBA 4F91B 3A0HC 1KZHA 4BUPA 1YLFA 1OR7C 2O8KA 3U2LA 3ZMVA 3JZ0A 1OCCC 2WA0A 1VQOI 3AG3C 2EPLX 1FR0A 2X4HA 3OIQA 1TFKB 4M9XA 1FFHA 2OC6A 3DTIA 3HLZA 4HFKB 4E4HA 4I09A 3TOAA 2VJ4A 1K4SA 5B3IA 2FBHA 1YI2I 5L3FA 3PQKA 3D5SC 2DDAA 3DTKA 3GTGJ 2QEXI 4C3DA 2VBYA 1RKEA 5EG0B 2OJQA 2PJPA 3RKYA 2KIMA 1ZR4A 2VODA 3KX2A 1S29A 3KP4A 1X2MA 3OEOA 4OMYA 1G3YA 2X1EA 5DUIA 3AG1C 3I55I 3R61A 4EEFG 1TQMA 1CPQA 5HSWA 3S32A 2R7ZJ 2JRMA 1LEBA 3TW7A 3CDHA 3H3ZA 2HDCA 3L2RA 3OR1C 1YO5C 4LERA 2EPNA 3RPUA 1REPC 2O9XA 1P92A 5EEGA 5DEQA 1SFXA 4LDKA 4C3EA 4DRJB 2DGJA 4L5IA 2FJ1A 1B8IA 5IP7J 1G3SA 3I4PA 3A11A 3M4BA 2IRFG 5HLIA 1R58A 3TULA 4UV9A 5FD5A 2R5ZA 5D6FA 4YFKF 3I59B 2PP4A 3AGTA 2WB1A 5H2FC 2R05A 4JCHA 3GEEA 2CQKA 4U5DE 4WABA 3IWFA 1BC8C 5BQIA 1U6GA 2AWYA 5A6AA 5L0IA 2QLZA 1DP7P 3EPVA 1VTMP 3TO6A 3LOCA 1KGSA 4FQGA 2M45A 3NKEA 2HEOA 2XLHA 1TWFJ 3CDLA 4ANJA 3W3CA 2F4IA 3LSIA 3L2CA 2IPQX 1B1BA 1MH4A 1TW2A 2JSPA 4DBQA 2RSEB 2NVQJ 3J7AY 1O57A 1LI5A 2ZFUA 1O3UA 2KKOA 3FVYA 3JTLO 3LS0A 1YRNB 3F8BA 2CYYA 1EV7A 2DPDA 3C62A 5E79C 2FSWA 4C7OA 2CQXA 3MKLA 4KFCA 2E87A 2ZBKA 3W6KB 4O79A 1K6OA 3DE8A 3HZJA 2JPCA 2WAFA 4BJ5C 1QZZA 2EPKX 2UUIA 2OUMA 4BXFA 2DA7A 4CUGA 2W4MA 1IXCA 3KZZA 2O61A 3FOOA 2A6HF 4KYWA 3E6MA 2Q9CA 2IXNA 3DEUA 4JVSA 2KFDA 2H8WA 2HYFA 4JZAA 1LIHA 4U5FE 1MMAA 1TZLA 3H0GJ 3L9FA 2CDQA 2FX0A 1S7OA 5GADJ 2OEVA 3K9TA 2AQFA 3KLOA 4EV0A 2JWTA 3RQFA 1OCOH 1IN4A 1Z6TA 1HW2A 1HKTA 1KNYA 2BOLA 4MTOA 1R5ID 4D7NA 5F64A 2IT0A 2ZC2A 4JX6A 3WTVC 1UHMA 2R7DA 4YT5A 3BT9A 5JLWA 3U8VA 3ZXSA 1JRAA 3VFZA 1SEUA 3DWLE 3C8ZA 2DA4A 3G1OA 3GYHX 1WRJA 3IQCA 4MW3A 1EKYA 4I1MA 1I3QJ 1V54H 2UXNA 4S0HB 1K4TA 3S3NA 1ZLKA 1TKNA 4A3FJ 4IAOA 5L0GA 3P5JA 4BHCA 3ERMA 2QYOA 2ZSHB 3Q7GA 1IRFA 2W00A 4HNTA 5HLHA 1N75A 3CCUI 3UR3C 1IDYA 3SZPA 1YRNA 1UAAA 1YVIA 3GWNA 1XTAA 2JMWA 4CJGA 1E2XA 2VOPA 3TOMA 2MBFA 3FZVA 1IRXA 2V1XA 3EPZA 3FHNA 2ZNZA 3H9JA 4N0BA 1PDNC 4C2UA 2L6GA 2L6HA 1ZHXA 2EZLA 2EFQA 4PJLA 1D8KA 1ZW3A 3HUGB 3S27A 3JAMZ 4QI0A 4DNCA 1ETKA 1P4AA 3QZCA 3J80Z 3M8JA 3LSKA 2XGEA 4E0IA 4CIHA 3KETA 3GZ5A 1FBUA 3BR2A 1YW8A 1ZW2A 1NFOA 4IHYA 4L9TA 1BM9A 5LEJA 4E7JA 2FD5A 4O6JA 4M72A 1OYIA 1U89A 3MX3A 1SC7A 3T0YA 2IBDA 1YTYA 3EYYA 5FLVA 3CO7C 4K2EA 5COFA 3CMAI 3K66A 1O3TA 3ZQYA 3HSEA 1KU3A 5EZHA 2J8WA 3HOWJ 1MJAA 5JSLA 2BC5A 3ABUA 1ZGJA 1I3AA 2WZLA 3POVA 3L8JA 5EGOB 4LIVA 1YHQI 4JJFA 3BOQA 2B9SA 3DPLC 1MJBA 1QHGA 3O3KA 3OS0A 3S1NJ 2ZCWA 4XRFA 1UG7A 1OKKA 1EA8A 4HEA2 1D1AA 2LVSA 4V2GA 1RKEB 3MQ0A 2KGOA 2R9RB 1G3TA 1PCXA 2W1OA 1EA3A 3OWTA 4HFFB 3H65A 5F0FA 4O6YA 4D4NA 1Y0NA 3RKQA 2Y69C 3MYFA 3QU6A 1YJNI 2HQ5A 4CZZA 4PSWA 4AE4B 2MC3A 5CQGA 2IM8A 2VBXA 4RAFA 2GAUA 2KRCA 3GO5A 3WTZA 1Y6DA 2XM0A 1GT0C 5FFXA 2XS8A 1ZTRA 4AIKA 2NRAC 2WZFA 4HSRA 1Z1DA 4PACA 5IY5C 2ISZA 2XAHA 5CI8A 1K79A 5GPAA 3IV5A 1D0YA 3K70C 1FOXA 5HLTA 4KUMA 3J7AO 3M3YJ 4NQWA 2E36A 3OR2C 3BG7A 1LDKB 2R5ZB 1K7AA 3P9IA 3DJNB 3FDQA 4LG0A 2K4JA 3O10A 4KN7X 2O7OA 4JBAA 3OSFA 4UUVA 2FMYA 4HQEA 4HA8A 2PF4E 2TRTA 1FNNA 4G78A
chains in the Genus database with same CATH topology
1R5ID 3KPHA 2ICWG 2OJED
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R5I D;  3KPH A;  2ICW G;  2OJE D; 
#chains in the Genus database with same CATH topology
 4NHJ A;  3MZY A;  5D4R A;  2CUE A;  1VQ8 I;  2BV6 A;  2EQR A;  2HVQ A;  1Q0G A;  2OZ6 A;  2EFP A;  3MFN A;  5FCL A;  1MH3 A;  5CVR A;  4ABZ A;  4ENN A;  3DJU B;  2NS0 A;  1B9N A;  2XLO A;  3K1P A;  4MLO A;  5FRM A;  4XKC A;  3K70 D;  3H3V K;  2IGM A;  2MD5 A;  3J06 A;  1F1Z A;  4PJN A;  4KJZ A;  4ENM A;  2CYD A;  3TK0 A;  2G7H A;  1XZP A;  4CDG A;  1FTS A;  4IQ4 A;  1B59 A;  3K6G A;  1NG7 A;  4IF4 A;  2VOO A;  3HTK C;  3OYN A;  2L0K A;  2LLK A;  5CKT A;  2M4E A;  2DOE A;  3RJP A;  1XGO A;  4M6V A;  1NK3 P;  4R8H A;  2JA6 J;  2ESN A;  1JKR C;  1CGN A;  5K0I A;  5JLX A;  1QPU A;  3QW1 A;  1FIA A;  1JE8 A;  1F5T A;  2ZXW H;  2BHZ A;  2DTZ A;  3BWG A;  3CLQ A;  5HDG A;  4EM1 A;  3PJR A;  3BPX A;  2ETS A;  3DD7 A;  3IUO A;  5A69 A;  1ZGA A;  2XLV A;  1ORK A;  5E3C A;  1RNL A;  4HQM A;  1C0W A;  5JI6 A;  1QQ3 A;  1W7P D;  5EGY A;  2ZXO A;  2ZJR F;  1O3Q A;  1GXP A;  3CJR B;  3O8G A;  3H2U A;  3S1R J;  4XLN F;  2LY1 A;  5TJJ A;  3PUB A;  4QLC U;  2FFH A;  4H54 A;  1STZ A;  1RES A;  3ZDL A;  5DD4 A;  5L3G A;  2ZKZ A;  3ZTZ A;  2JRT A;  3BR5 A;  3S3O A;  1L3P A;  4RBN A;  2L5Q A;  2HQR A;  1KQ0 A;  2Y2Z A;  2XLW A;  3E0J B;  3KEY A;  3HOS A;  3WTU C;  2M7A A;  5FB2 A;  3C8G A;  5IOY A;  4U0V A;  4HV5 A;  4B43 A;  2A0B A;  3EHN A;  2PBE A;  2YEV A;  1OW7 A;  4RAY A;  3U1D A;  4CXF A;  3EET A;  4PGH A;  3QVY A;  3QTH A;  3FXM A;  2QNL A;  3S16 J;  4GYT A;  4DYQ A;  5AGF A;  1R23 A;  1GDT A;  3PHF 2;  1FYK A;  4JW1 A;  3OMY A;  3F23 A;  3LS1 A;  2X0C A;  1M57 C;  3S29 A;  1VQ9 I;  3PSF A;  2IS2 A;  5EGO A;  4E18 A;  5D5U B;  2RAE A;  5LD2 C;  1K61 A;  2WAQ N;  2A07 F;  1HXD A;  4I3M A;  2Q1Z B;  2JQ7 A;  1R4T A;  1GVD A;  1I1G A;  1WJF A;  1TTY A;  2IVM A;  5KHD A;  2QF7 A;  3HOU J;  2FAP B;  2TDX A;  4IRH A;  4GRI A;  1T08 B;  4BJ1 A;  3GTL J;  1WSU A;  4XLA A;  2KL4 A;  3NMI A;  4IB4 A;  5DTD A;  3GTM J;  2OJE D;  2CFX A;  4JCZ A;  5J3L A;  1Q0M A;  1TWH A;  5CYV A;  2JPB A;  4J7T A;  1RR7 A;  2OF7 A;  1KYW A;  3A01 A;  4XEV A;  3FK6 A;  2BY1 A;  3CJN A;  3PFY A;  1BR4 A;  3HL2 A;  1FEX A;  3KP7 A;  3T1B A;  3M07 A;  5B3S C;  3KP3 A;  4WX9 A;  5DCM A;  4GGG A;  2EIM H;  1WHU A;  3IL2 A;  4BDZ A;  1IRG A;  3NWS A;  4XPX A;  1FZP B;  4P6I C;  4A2N B;  2NVU B;  5GP9 A;  3LSP A;  4IRI A;  2ID6 A;  5ERI A;  3G1L A;  3IRR A;  3GX4 X;  5EEH A;  2DJI A;  1VQ7 I;  4KT6 A;  1T6Q A;  3ZR8 X;  3GFI A;  3TGN A;  3AQB A;  4XN3 A;  2LBF A;  2DMT A;  1ETO A;  3EJN A;  5L3B A;  3C2H A;  1LI7 A;  2NPU A;  5LRR A;  2LKP A;  3V42 A;  2PX3 A;  1YYJ A;  2VUM J;  1ZHT A;  3ZIB A;  5HNF A;  5DD8 A;  4A2U A;  5EDN A;  4JEA A;  2HKV A;  4E0H A;  1FIP A;  3PNV A;  1CPR A;  1WJC A;  4YL3 A;  1CGP A;  1RUN A;  1TP4 A;  3S90 A;  4DZJ A;  2M87 A;  3VEP A;  1ZH5 A;  2DT7 B;  1W4M A;  2QWW A;  2VLA A;  3HJC A;  5A2Q Z;  2LY2 A;  4Y33 A;  4BEM J;  1DUX C;  2HZD A;  1XD7 A;  4WXH A;  1DOW A;  1FLI A;  1BOB A;  1RZ4 A;  1ZRF A;  3F3X A;  3ZG1 A;  4N6H A;  1XCV A;  3A1Y A;  3GZN B;  2H7O A;  2HVS A;  1MBK A;  2FOK A;  3VAY A;  2LOO A;  5IT9 Z;  1Z05 A;  1M2V B;  2DMP A;  4YIR X;  2W9Y A;  2H09 A;  4Z9H A;  3HNI A;  3FWE A;  3ZP5 A;  1QVT A;  3JRB A;  1IGN A;  2HQN A;  2W24 A;  2A05 A;  5KYU A;  3W6J B;  2HPM A;  4PFO A;  2VON A;  1T33 A;  5E18 F;  1ZRE A;  3LWF A;  1S7E A;  4KC9 A;  3BLY A;  3FMQ A;  3G71 I;  4YEJ A;  3DQV C;  3H5N A;  2M4G A;  4BE0 A;  4ENJ A;  1XMA A;  4X0R A;  2QEN A;  1K78 B;  2X51 A;  3FHD A;  4BXX J;  3DLA A;  2YS9 A;  2HDW A;  2AVK A;  2L6F A;  4BE1 A;  1PVE A;  4HX7 A;  2ZO4 A;  4OD5 A;  4W1U A;  3ZQL A;  5CI9 A;  2HS5 A;  2MLG A;  5CLS A;  4YIF A;  1GGQ A;  4QDL A;  2P5L C;  1HE1 A;  2O8X A;  3BR1 A;  4LD5 A;  2O9L A;  4G7Z F;  1KYZ A;  3ECO A;  4O6M A;  1MBJ A;  1ONV A;  4CYC A;  1X1C A;  2L3D A;  3R2P A;  3QPS A;  1A0B A;  1SD5 A;  4WWC A;  2CWE A;  1P9Q C;  5M5Y J;  4Y4R A;  2LFB A;  4PJM A;  1LM3 B;  2OA4 A;  2I10 A;  4MTE A;  4O3M A;  2EIJ H;  2JZY A;  4UVC A;  1X4P A;  2DYR C;  2CRG A;  4HX8 A;  3VYT B;  1G8X A;  2CV1 A;  2NOJ B;  3ZQV A;  1YLM A;  3AG4 C;  2L9J A;  4AC0 A;  1MND A;  1WJB A;  4RAZ A;  3B02 A;  2OPT A;  3KE2 A;  3NRH A;  3BTC A;  4B3A A;  5KYU B;  1MNE A;  2JTV A;  2PN6 A;  3K0L A;  4IJA A;  3MFK A;  1S72 I;  3JSE O;  2YKZ A;  1Z91 A;  2JA5 J;  2VBZ A;  2X48 A;  5M3M J;  2J9B A;  2LSE A;  2ZJ2 A;  1ODD A;  1OJL A;  1A04 A;  1FC3 A;  2BEO A;  2UUZ A;  4OMZ A;  1RIO H;  4WXC A;  1Y56 A;  2TCT A;  1AVO B;  3CSK A;  4KNW A;  3ABK C;  3WGH A;  2EIJ C;  3DTE A;  3G2B A;  4JTA B;  2KPM A;  1A35 A;  4MW8 A;  4D7M A;  3ZVR A;  2HYJ A;  2E34 A;  1KU9 A;  3OIO A;  1P7J A;  5EJC A;  3RKO F;  2XPW A;  3AG4 H;  5IYD J;  2IXS A;  4BXU A;  4P1W A;  3DM9 B;  3AG2 C;  4XL9 A;  2CUZ A;  4OOI A;  1B9M A;  3S2H J;  1Y6I A;  3OS2 A;  1RET A;  1WI9 A;  5J4Y A;  1BR2 A;  2VQL A;  3I64 A;  9ANT A;  1BI2 A;  5J4V A;  3PIP F;  1SFU A;  4NTB A;  3NKD A;  1M6T A;  3A4C A;  3KYD B;  1TQG A;  4UV8 A;  3AG1 H;  3KZI C;  3X1O A;  2L9S A;  3R7C A;  2KHM A;  1QVU A;  3CEX A;  1R4M B;  2DBB A;  3BTI A;  1TFO B;  3R0A A;  4EGY A;  1CGM E;  3JCU Q;  2Q7R A;  3KP6 A;  2QLA A;  2LFD A;  1XDS A;  2DA5 A;  1D8J A;  2FF4 A;  4IJJ A;  4JX4 A;  1IDZ A;  1ZG3 A;  2XAU A;  1BOA A;  4Z2Y A;  3IH4 A;  5DS5 A;  2LQG A;  1ZN2 A;  2DMN A;  5FO5 A;  5JFR A;  2P6V A;  4TV7 A;  3SZG A;  4H4K C;  1C17 M;  2D1V A;  3LLK A;  4HDV A;  3M9A A;  3U9J A;  4BHP A;  1QZY A;  3SFZ A;  1DPU A;  4RAG A;  4L9V A;  1V5F A;  3HXL A;  1VQP I;  3EZH A;  4N4W A;  3W6V A;  2GAQ A;  3GTP J;  2ZFW A;  1QHH D;  3D5L A;  3HSF A;  1VYK A;  1I50 J;  1TWA A;  3MAJ A;  3TQO A;  4Y3O A;  1WTY A;  5FKL A;  2WBM A;  3B0V C;  3CC4 I;  3U8P A;  1ZZP A;  4IWB A;  2LSO A;  1QSP A;  4L6R A;  2EPM X;  2W84 A;  5CVU A;  1O7F A;  3L1M A;  3IPM O;  3TL4 X;  3SJM A;  2RQP A;  5JRA A;  2L9R A;  2XF7 A;  4CO8 A;  3KYC B;  1IZM A;  2I8D A;  4M3D A;  4MVZ A;  2ZSI B;  4LLG F;  4BJ6 A;  1VTN C;  1W5C C;  1HOM A;  4DRI B;  4AYB N;  3WHB A;  1MW7 A;  1XSD A;  2FQ3 A;  4IHX A;  4CCO A;  2XF6 A;  4K0D A;  4F52 A;  4PCQ A;  5GAG J;  3LSR A;  2DJN A;  5TGT A;  2R02 A;  2NNN A;  4Q48 A;  2K9M A;  3LSG A;  1CF7 B;  2O03 A;  4PFP A;  1K6Y A;  2ZXJ A;  2PJR B;  1Z9C A;  1JR8 A;  3LNR A;  4LB5 A;  4IHW A;  2EIN C;  2IGK A;  3NEU A;  2IGO A;  3I4U A;  1Z3X A;  2JN6 A;  4EHP A;  1WZ2 A;  3NQO A;  1HF0 A;  1JI8 A;  1FWZ A;  1OCR H;  1YIT I;  5M3F J;  4PZJ A;  3JRT A;  2LYC A;  4CZC A;  4CSA A;  2AHQ A;  2QGU A;  3AG2 H;  2KQ9 A;  3OOP A;  1EH6 A;  1IC8 A;  4I0A A;  2R5Y B;  1SAU A;  3SYT A;  3OYF A;  3OYB A;  3BQY A;  1D0X A;  3I9V 2;  2EPO A;  3WU0 A;  3ZN1 A;  1I39 A;  2JVG A;  1IW7 F;  3O39 A;  3O2P E;  5EG0 A;  1JGS A;  3WTW C;  1SVM A;  3WG7 C;  2HVR A;  5LGT A;  2CS3 A;  2XPV A;  5JHF A;  2HOE A;  1IUF A;  1V3F A;  5BPI A;  3HNK A;  2YU9 J;  1FSH A;  4LLC A;  4WXD A;  2QSG X;  4P9U A;  1KON A;  2LFF A;  3K1N A;  2XRL A;  2R7W A;  5GTI C;  1RUO A;  2G0E A;  5FKN A;  4EMS A;  1B72 A;  4KA4 A;  4HDU A;  1YFH A;  2HFI A;  1HLV A;  2ICW G;  3RF3 A;  1USS A;  4ITV A;  1HMD A;  1AKH B;  4U0W A;  2VXZ A;  2KDZ A;  2BW3 B;  4RMN A;  5HOD A;  1SAN A;  3BZK A;  4ZDP A;  4KIC A;  4KIS A;  2QQA A;  3S14 J;  5BQT A;  3B9Q A;  2D4U A;  4W8K A;  1ZHW A;  3K1M A;  4I6Z A;  4MTF A;  5A6K A;  5A6J A;  2LRE A;  2IS1 A;  5EHH A;  2DOA A;  3VM6 A;  1YW7 A;  5D6E A;  3WOD F;  1JPN A;  1MBH A;  4M3F A;  2L54 A;  3ZQF A;  2V79 A;  2CUF A;  3HOZ J;  1HY5 A;  4RLF A;  3FXK A;  2LIG A;  4MQV A;  5K7H A;  5JUA A;  2G3V A;  3MBG A;  1UG2 A;  1WH5 A;  2X6X A;  3B29 A;  1VYI A;  2JPU A;  2IGN A;  3A01 B;  1DQU A;  2FUG 2;  2EIK C;  3HJE A;  4KIB A;  3T6B A;  1OKR A;  1U6H A;  1MNM C;  2A68 F;  3FBI B;  3QYF A;  4X6A J;  4BBR J;  2M9H A;  5DVW A;  1VQL I;  3Q0U A;  2BYV E;  4A3C J;  1K40 A;  3C8G D;  3PFI A;  3UMK A;  2IS4 A;  2MHR A;  4Q7C A;  4XPY A;  3RVY A;  3IP4 B;  2K3F A;  4XLH A;  4BL0 B;  1WH7 A;  3BR0 A;  3P9K A;  5TRD A;  4MFD A;  4GFB A;  2IBF A;  3AFH A;  3PNY A;  1YZC A;  2ECB A;  2NXN B;  1EKE A;  4M6X A;  5CPR B;  3RZD J;  5DQT A;  3I54 A;  2NOG A;  3DKW A;  4AM3 A;  4CYC B;  4Z9J A;  3W4Y A;  4K1O A;  1MGT A;  1WCM J;  4BEJ A;  4CDY A;  4ETS A;  3T6J A;  5CIV A;  1W7P A;  2ID3 A;  2J5P A;  3L00 A;  4XNF A;  1H7I A;  3AGU A;  2JUC A;  1H6G A;  4M74 A;  3PL8 A;  2ZXR A;  3V7C A;  2J9U A;  2OD5 A;  4A3K J;  3SZR A;  1A7V A;  4M73 A;  5FKM A;  1U0B B;  2Y9Y A;  5F5H A;  3FK7 A;  3ZQQ A;  1R71 A;  3B0P A;  1YG2 A;  2CW0 F;  4BU2 A;  3H0D A;  1TWC J;  1SFO J;  3KKB A;  3N05 A;  1YZA A;  1TLH B;  3WTY C;  1E17 A;  2B0H A;  2XRN A;  2VPL A;  2P1A A;  2VCB A;  5J8C A;  2V9K A;  6PAX A;  4U9E A;  3FXH A;  2EA4 A;  3L09 A;  3QP5 A;  2WC2 A;  2HMQ A;  1VQK I;  4UUT A;  2C04 A;  2R25 A;  1TBX A;  1QZX A;  1QBJ A;  3DKA A;  3IRQ A;  2R7V A;  4G94 A;  1T0F A;  4W8P A;  2ZME C;  3QPH A;  2HOA A;  4YJW A;  3MWM A;  3GAN A;  3FIW A;  3KP2 A;  1RKC A;  4FET A;  4A0Z A;  5FRO A;  3HUG A;  3RIR A;  2VH3 A;  3U9M A;  1ETX A;  1KQ8 A;  1TT0 A;  2E35 A;  2DFI A;  4E7I A;  2I5U A;  4NC6 A;  1X3W B;  3JRF A;  3OA1 A;  1DU0 A;  3G4X A;  4N6C A;  3ZN0 A;  3VWB A;  1S7A A;  3IAS 2;  3A2K A;  1W0U A;  4GEH A;  1J5Y A;  3G1M A;  3DZA A;  2P81 A;  2DTR A;  5ILU A;  4PGG A;  4L0Y B;  2OAZ A;  5DM6 F;  2J0X A;  2ISY A;  4A69 C;  3NMJ A;  3ZGK A;  1OW8 A;  4HLY A;  4CH7 A;  2Q9B A;  2MH9 A;  4UXN A;  4F55 A;  4Q4Z F;  2K9S A;  1G4W R;  2HTS A;  2YLD A;  4S05 A;  2BL2 A;  1DP3 A;  1N77 A;  4AX2 A;  2RC4 A;  3PNT A;  1J2X A;  2L7K A;  5JR3 A;  2QBY A;  4A3I J;  4OD4 A;  2EH3 A;  4Y15 A;  1B72 B;  2KYH A;  2XHK A;  2EV0 A;  2ZME A;  5AC4 A;  1QA6 A;  3WGI A;  3H36 A;  3S8P A;  2J9V A;  3PO3 J;  1YYX A;  4U88 A;  3F9K A;  4XM3 A;  4DBR A;  2P6T A;  4AU7 A;  1FBQ A;  2P5V A;  3GFM A;  3QMK A;  4B6I A;  1I6X A;  3PSI A;  4A3E J;  2KLO A;  3HRT A;  2HV7 A;  4LG0 B;  3EGX B;  2CJJ A;  3VSL A;  3LAP A;  2LCH A;  1OKK D;  3IQ6 A;  1SFK A;  3HGY A;  2XDV A;  2W7N A;  4BNC A;  2UUH A;  3CUQ C;  3SXZ A;  3HC7 A;  2ACJ A;  1UB9 A;  3MZH A;  3S1Q J;  3A03 A;  1HA8 A;  4JRZ A;  2CFO A;  4PJ0 C;  1NTC A;  2GA1 A;  2RKH A;  2Y9Z A;  2R7R A;  2HYG D;  3V7R A;  1DGR M;  5ILV A;  3MEX A;  1NFN A;  5B1B C;  2H7B A;  1S9H A;  2XGD A;  4QTR A;  4KIF A;  4ULW A;  4EJT A;  3ZQ7 A;  3ZMU A;  3H92 A;  2XM4 A;  2Z33 A;  5L3C A;  2V1U A;  3VYW A;  4XBF A;  2OZU A;  1D1C A;  1JTX A;  1ZYR F;  3T8R A;  3HDD A;  1XZQ A;  2Q00 A;  5KAI C;  1OLT A;  3FXQ A;  3DBL B;  3Q0W A;  4JYK A;  4IVN A;  2M7B A;  2PLY A;  4WK8 F;  4RGX A;  3MKZ A;  1YAR O;  4CBE A;  3MD2 A;  3L7W A;  4UVB A;  2V3C C;  2R5Y A;  3RQE A;  2K85 A;  3I59 A;  1F43 A;  3Q6N A;  4ASN A;  1UEL B;  2A0U A;  2R7O A;  4U7D A;  2EIL H;  4GXO A;  1H0M A;  3IKT A;  5ICF A;  2R7T A;  3D5R C;  4IPA A;  1W2W A;  4M63 A;  3CCR I;  3EYI A;  1I5Z A;  1RR8 C;  2JX0 A;  3JT1 A;  1GUU A;  3KZY A;  2CV0 A;  2NVT J;  3PDM P;  2XXA B;  3LEV A;  1VF9 A;  3QWL A;  3O6X A;  3UKG A;  3GEH A;  1HC8 A;  3AOU A;  3ZC4 A;  1RKW A;  1NU7 D;  1R5H A;  4V19 K;  1C02 A;  4D5C A;  3FAP B;  4O5V A;  2K02 A;  1R7J A;  1N1C A;  5KYW B;  2KZG A;  3OL4 A;  2RNJ A;  5LGN A;  4L0Z B;  1SMY F;  3CQZ J;  1DGW Y;  3ZMZ A;  3ASO H;  3QOP A;  3Q9S A;  1VOM A;  4FAP B;  4BH9 A;  1VQ5 I;  2VE9 A;  3HKZ A;  2VJ5 A;  3K2Z A;  4OU0 A;  4IHV A;  1R49 A;  2IW5 A;  3O55 A;  1X1P A;  1PD0 A;  1TWA J;  4KNY A;  1BDJ B;  4IGG A;  1J0R A;  3RPQ A;  4B47 A;  1Z7U A;  4OIP F;  3LMM A;  1ZRC A;  3DAG A;  2VN2 A;  2XIG A;  3DAF A;  1LJ9 A;  5H6Q A;  1AEP A;  4UB8 C;  1VQN I;  2MWQ A;  3M79 A;  4DZP A;  1EF4 A;  1J8M F;  5A2Q K;  1RCP A;  3E97 A;  2OBP A;  4EM0 B;  2E1M C;  3ABM H;  3VYU B;  2GZW A;  2WB7 A;  2AO9 A;  2UV1 A;  3A02 A;  4Y13 A;  5J6X A;  3LA7 A;  3CJT B;  2ECC A;  1JJ8 C;  4O6N A;  3HYI A;  4P55 A;  4A0X A;  3TKY A;  2WL8 A;  1B6A A;  1RI7 A;  2F5F A;  4BYY A;  4RBO A;  2P7V B;  3E6B A;  4YII A;  2KW3 C;  2ZXI A;  5L0C A;  1H89 C;  3TO7 A;  3LL7 A;  2K27 A;  4NUB A;  4R1H A;  1T2K A;  3R60 A;  1CGO A;  3E1S A;  2BY0 A;  3CCV I;  1E86 A;  1NG1 A;  4IAQ A;  2DI3 A;  1IAW A;  2Q9A A;  2QTV A;  2XXA A;  2MAB A;  3TQN A;  3LSM A;  2O5R A;  3FM5 A;  3F6O A;  1SZI A;  4F7Z A;  4MVU A;  3GF2 A;  4IHT A;  2RGV A;  2YUS A;  5B1B H;  2X1C A;  4U87 A;  1R9T J;  1XS9 A;  3QYB A;  4UUS A;  2O6G E;  5LHG A;  1AOY A;  1I1S A;  1FMW A;  1TC3 C;  3SXK A;  5F08 A;  5C4J J;  2MA3 A;  3US6 A;  3B73 A;  1VQM I;  1JOG A;  2OOC A;  1SMT A;  4XLC A;  3GM1 A;  4EKW A;  5IYB J;  3ISP A;  2YZS A;  1AUE A;  2VQG A;  3ESW B;  2KIU A;  3MYI A;  1VLT A;  2HPI A;  3HHG A;  1BJA A;  2DMQ A;  2RD9 A;  1G4D A;  3ZTM A;  4I02 A;  3CCJ I;  4U5G A;  3RPU D;  3TP0 A;  1OCP A;  3RQ4 A;  3EZI A;  1PP8 F;  2Y31 A;  3LFU A;  4IL6 C;  4A3B J;  3L2W A;  2JA7 J;  4MQ9 F;  5FKK A;  2E19 A;  2B0L A;  3DCF A;  3KIO A;  4LK0 F;  2YX4 A;  4RLQ A;  4HLX A;  5E3A A;  3S2W A;  1NZE A;  2GWR A;  4LAC B;  5E3O A;  1J7K A;  1IV6 A;  1FNT c;  2OKU A;  2CQ7 A;  5BQG A;  3GEI A;  5D5X B;  4X1E A;  1BJZ A;  2P8T A;  5EF6 A;  3AAF A;  1ZR2 A;  1U9O A;  2QQ8 A;  2A69 F;  5DCF A;  4A5M A;  1X1D A;  3RDI A;  4UUS B;  2A5W A;  4MS2 A;  4KMU X;  2B63 J;  4LLE A;  3DEW A;  1LS4 A;  3TJ6 A;  3M15 A;  2BVL A;  3MZ8 A;  5D8L B;  2N8G A;  4RB2 C;  1YE9 A;  4L9J A;  1JKO C;  2E5N A;  1XG1 A;  1A36 A;  1LE4 A;  5C44 J;  1O3S A;  2K40 A;  1BC7 C;  2MW8 A;  3UGO A;  1GHC A;  2NUT B;  3D1N I;  2Z3Y A;  2X9D A;  1APL C;  1BBY A;  2XAQ A;  1FAP B;  3RIP A;  4E7H A;  1FTZ A;  2R03 A;  1MBF A;  1TQP A;  3QYE A;  4ZDL A;  4QPQ A;  2EFO A;  5M5X J;  1IJW C;  2W4B A;  4FX4 A;  4OAY A;  1FBS A;  2E1O A;  3CZ6 A;  5AIQ A;  5A6B D;  4HG2 A;  3F47 A;  1J09 A;  1Q1V A;  1T01 A;  2M5W A;  3WHN A;  1X3U A;  3FHZ A;  5HDK A;  1QRY A;  2MD0 A;  2VXD A;  4A6D A;  2M30 A;  1NU9 C;  2WV1 A;  3N97 A;  2E1C A;  3QP6 A;  4HNU A;  3JYY A;  2LRD A;  4P96 A;  3BCA A;  3JRI A;  1U78 A;  5T3T A;  3RQI A;  4F93 B;  1Z6A A;  2XV4 S;  2L2O A;  2MH2 A;  2FML A;  4EJW A;  2X6Y A;  4G6D A;  5L0J A;  2EFN A;  1BR1 A;  3L8I A;  1ZVZ A;  4EJU A;  2HTJ A;  4WGZ A;  1IN6 A;  2F4M B;  4BGD A;  2DDB A;  4FCY A;  5KYY B;  3J81 Z;  4KN4 X;  2KMU A;  2W4S A;  1MMN A;  3FX3 A;  3N2Z B;  1L7C A;  2NSF A;  2EA2 A;  2IXO A;  3EH1 A;  3LNQ A;  3KYL A;  2YHS A;  4NC3 A;  1SD7 A;  5L3Q A;  1UHS A;  4MIM A;  4YL1 A;  4HYE A;  1R22 A;  5JVT A;  4M71 A;  1R5G A;  3ZWI A;  3HRU A;  2A3S A;  3I53 A;  2GOM A;  3K4B A;  1UMQ A;  5BMZ A;  4HRI A;  2A61 A;  4BY7 J;  3LST A;  3FF5 A;  1B4A A;  5DCM B;  2OU6 A;  5L3E A;  3FXJ A;  3LA2 A;  2E7X A;  4HNV A;  5ICE A;  2D5V A;  4J7Y A;  3L2Q A;  3SDG A;  1FP2 A;  3BG9 A;  1YJG A;  1RMV A;  1NG6 A;  2ZPA A;  4NDL A;  1R1V A;  5LEK A;  1M1E B;  4I76 A;  3NDB B;  1J9I A;  2M64 A;  4U5E E;  4DOZ A;  3IH3 A;  3CUQ B;  4MEY F;  3JYH A;  1Y0U A;  3IQ5 A;  4LIU A;  2V6C A;  4KMF A;  4J30 B;  3QQA A;  2ME6 A;  4AK9 A;  3BRO A;  4XIC A;  3QRF F;  2FBI A;  1NK2 P;  3I5U A;  3W2A A;  3HOX J;  3UMH A;  5T3W A;  4QIW N;  3ZQC A;  2G3K A;  3KEO A;  1SR2 A;  5D4S A;  1JKP C;  4JK1 X;  2KNH A;  5KYX B;  3S0X A;  2A1D D;  3Q7L A;  5KK1 A;  1RPW A;  1VLS A;  2QCO A;  2HR3 A;  3LLI A;  1IV8 A;  4XLF A;  2Z9O A;  3BTJ A;  2NS7 A;  3S15 J;  1HST A;  1U5T C;  1OYW A;  5HVQ C;  5GAE J;  1TL8 A;  2M34 A;  1P2F A;  1G4U S;  1F4K A;  4ON0 A;  3AKZ A;  2VQC A;  4FTH A;  2ADU A;  3H1C A;  3DI5 A;  4XLP F;  1ZEL A;  2P5K A;  2YL0 A;  3ZOB A;  2EIN H;  3R0J A;  2EB7 A;  2L81 A;  2DOF A;  2MSY A;  2DMU A;  3AG3 H;  3EDP A;  3DBH B;  1GXQ A;  2BY2 A;  4C2M J;  3PCV A;  3QAH A;  4LGW A;  3RCO A;  3GUD A;  1LFU P;  3EHM A;  1QVX A;  2HOT A;  1YYV A;  2DQR A;  3LQR A;  5IPA A;  3C2B A;  1UHW A;  4MNU A;  1T8I A;  2E7W A;  4LB6 B;  3BY6 A;  1P6R A;  2R3S A;  1GS9 A;  5AC5 A;  2K3P A;  4CGZ A;  1FPQ A;  2VQH A;  2XKP A;  2HFH A;  4NQF A;  4FIS A;  2MYS A;  1WJE A;  3W2V A;  3I5Q A;  3BZ6 A;  2CO5 A;  3DKX A;  3TD7 A;  3RW0 A;  4CYD A;  4XWJ A;  1XPX A;  3S1M J;  2WY8 Q;  3MVP A;  3H3U A;  3BCB A;  3U9G A;  5K7F A;  4A3D J;  3JRE A;  2G9W A;  1OYY A;  3DF8 A;  2IYL D;  3EG9 A;  1QGP A;  1XWJ A;  2QA4 I;  2ELK A;  1N25 A;  3MLG A;  1V4R A;  2WB1 N;  4LIT A;  5FD6 A;  1VQ4 I;  2XLD A;  3K69 A;  4CCM A;  4YN0 B;  3G3Z A;  3F6V A;  3CQZ A;  4FWV A;  4MVR A;  3ZSU A;  1I27 A;  4BBS J;  3RH3 A;  1S6L A;  4RDU A;  2HWV A;  1GV5 A;  2Z16 A;  3BJO A;  1ORY A;  5FRN A;  2KC3 A;  4HF2 A;  4I44 A;  3HNL A;  1F36 A;  4HV6 A;  5BPD A;  4IEJ A;  2H27 A;  4E70 A;  4HEA J;  3L1P A;  4ZTJ A;  4IXA A;  3U2R A;  1LQ1 A;  3NAU A;  1O7L A;  2CNW A;  4BQQ A;  1JHH A;  3V5Z A;  1EI7 A;  4IOC F;  1O87 A;  5B66 C;  1E83 A;  2XAG A;  3BRJ A;  4DW6 A;  4MVM A;  3EG9 B;  5JHU A;  4L5E A;  2V6E A;  4NTF A;  2VT2 A;  2NUP A;  3FKI J;  3OL3 A;  3T8T A;  5KCM A;  3A9C A;  5CJ9 A;  1IG7 A;  1Z7L A;  2I8B A;  3LNM B;  3GVA A;  3SXY A;  5GPG B;  3GLX A;  1U5T B;  1TNS A;  2IA2 A;  1LUJ B;  2WTE A;  2HKX A;  1Z21 A;  1JUP A;  2DYS H;  4PK4 A;  4XLE A;  4Y17 A;  1T39 A;  4Q5S F;  5BUO A;  4N4O B;  2YRF A;  4U9D A;  3LA3 A;  1W36 C;  2WVN A;  1YX5 A;  3E3V A;  5HLG A;  1OPC A;  4JP0 A;  4NBQ A;  2ZME B;  2BVM A;  2WAQ A;  3EFO B;  4AD9 A;  3OYA A;  3LQQ A;  1I4Z A;  5F28 E;  2Z15 A;  2HOS A;  3N4M A;  4C2T A;  2OCC H;  4RM3 A;  1SAX A;  1J8Y F;  2MLK A;  3HOT A;  1EJ9 A;  2IXM A;  3GFJ A;  2P61 A;  5JP7 A;  2JJ7 A;  4ZC3 A;  4CDV A;  1RJ9 A;  2XL6 A;  2L7F P;  4CX9 A;  2LD5 A;  1WJD A;  2BW3 A;  4I0B A;  4PR9 A;  2OCE A;  4GO1 A;  1Y4C A;  5FZT A;  2PX9 A;  1ORJ A;  2WAE A;  3NAR A;  3E6D A;  3ABK H;  5F27 A;  4CSW A;  2FGY A;  2GA0 A;  5LHH A;  2W57 A;  3S3M A;  1OCZ H;  1W5T A;  2DOD A;  2YX7 A;  3HKZ N;  4OIO F;  2PFB A;  2EJR A;  4WF2 A;  2DA2 A;  5L3D A;  3FIS A;  4WJ0 A;  1QQI A;  2XLE A;  4BJT A;  1MD0 A;  4CCL A;  2H94 A;  3GTQ J;  1T95 A;  1NHA A;  2WVO A;  2L7Z A;  2JT1 A;  5KYX A;  2GDC A;  4IOA F;  4Y52 J;  4YT4 A;  1AWC A;  4B4C A;  3BPV A;  3GWL A;  4B09 A;  1JT6 A;  4AUX A;  1WPK A;  1O3R A;  1NSG B;  2W45 A;  1ENH A;  2BE5 F;  5E2Q A;  1ETW A;  4NB5 A;  2PBI A;  1UFB A;  3I0T A;  5CVV A;  2Q2E B;  2M8G X;  3BC8 A;  3SDB A;  3CCM I;  1PUF B;  1SVO A;  3WTX C;  1X3Z B;  1X1B A;  4DYR A;  3DU6 A;  2FA5 A;  2Y69 H;  3FM3 A;  3C18 A;  3U1K A;  4E7S A;  1V4A A;  2IXP A;  3LES A;  2EFW A;  3ERE D;  3BZC A;  4A3M J;  1OCT C;  2C03 A;  1SYQ A;  2GIZ A;  2HZT A;  1HDP A;  1WJA A;  2FE3 A;  2P0W A;  3GBG A;  2Z99 A;  2DPU A;  2QZ8 A;  4G7H F;  3QPL A;  2Y3D A;  1LKX A;  2M8E A;  2NAZ A;  5HS7 A;  3HRS A;  4ENK A;  1MJ9 A;  3UGP A;  3GTJ J;  3FMS A;  4B48 A;  4ZLD A;  5HDN A;  3S28 A;  2E5Z A;  1JUS A;  3CP8 A;  4B1R A;  3CO6 C;  2CGP A;  1T0F C;  4BY1 J;  2CSO A;  1TWG J;  4UB6 C;  3DKY A;  5E8G A;  1ST6 A;  4A3L J;  3HPH A;  3VOD A;  2P0N A;  2EV5 A;  5E33 A;  5GAH J;  4BQN A;  1JTY A;  3JRC A;  5L0F A;  3KMI A;  2CQN A;  2XGC A;  1S7Z A;  4D5F A;  4AVP A;  5K5O A;  1A7E A;  3SEO A;  2RV8 A;  4B3X A;  4BJ5 A;  3FXL A;  1L3L A;  2EK5 A;  3ZMS A;  1YJ9 I;  4H0E A;  1LEA A;  2ZXH A;  3EUH A;  3R4K A;  4FAS D;  2MC4 A;  5E20 A;  3WE3 A;  4Y7N J;  1MQV A;  3HGG A;  4KI2 A;  4MTG A;  2Y0S A;  2V1N A;  1H8A C;  3MN2 A;  4YFX F;  1W0T A;  1BN5 A;  1D3Y A;  3JSO A;  3ASN C;  1TT5 B;  4N9I A;  2YLI A;  1QKR A;  3EGD A;  4JJG A;  1T98 A;  2L9V A;  2KIQ A;  2CU7 A;  4A4A A;  4N4N B;  1BW6 A;  5E3M A;  2QVO A;  2KP6 A;  4B44 A;  4XKV A;  2GLO A;  2M0C A;  2LF8 A;  3PO2 J;  4MVS A;  2A6T A;  4AL1 A;  3CMY A;  3EGD B;  3T4R A;  4XKB A;  2YL3 A;  3IAM 2;  2UXX A;  5IP6 A;  2QKL B;  2NVY J;  2WVQ A;  3T6G B;  1X58 A;  2YLG A;  2VC0 A;  1POG A;  2NNY A;  4HF1 A;  3MKY B;  3E70 C;  1UZC A;  4BHB A;  4A3J J;  2XGX A;  2PQ8 A;  3E5U A;  1HKQ A;  3Q0V A;  4XR6 A;  2GXG A;  1A5J A;  1ACI A;  5F5F A;  4F3Q A;  3VPR A;  2CG4 A;  3TED A;  2DO7 A;  2V9P A;  3M8E A;  1DDN A;  3OYE A;  2XSE A;  3F8N A;  2A5Y B;  4ZJZ A;  1IUY A;  2DFH A;  2FOW A;  2F6C A;  2O0Y A;  3HPG A;  3IC7 A;  3H5R A;  4XOR A;  1FX7 A;  3OYM A;  5M5W J;  1Z67 A;  4O7G A;  4LJZ F;  4UHT A;  2EIM C;  5GTH C;  5L0H A;  4YRV A;  2EIK H;  4CSA C;  2VJJ A;  3HHH A;  3ITF A;  1YDI A;  4D1Q A;  2BHY A;  1MZB A;  4EAT A;  1NH3 A;  3FOP A;  5AIP A;  2KJG A;  2PFD A;  3C7J A;  3DU5 A;  1B8I B;  2TMV P;  2J7P A;  1E3O C;  5K5Q A;  3CF5 F;  1HMO A;  1ZU4 A;  1YA9 A;  2ESH A;  2D5R B;  4BPM A;  1ON1 A;  2W82 A;  4WCG A;  3GTO J;  2FRH A;  1Q0F A;  1LE8 A;  2YVK A;  3Q5F A;  1V55 C;  2QQB A;  1IXR C;  4AVZ A;  2CW7 A;  3HSR A;  3JCU C;  4YG2 F;  5E17 F;  3T5X A;  5E8I A;  2OQM A;  3LUT B;  2Y0M A;  5TIS C;  2DXI A;  1VQ6 I;  4C3H J;  4BAY A;  4CCK A;  2QY9 A;  3FDY A;  3AQC A;  1LB2 A;  4DXW A;  2Q8K A;  2W48 A;  2R7X A;  2KRF A;  1ZHY A;  4M9S A;  3D0S A;  3B6A A;  5EZG A;  2HSB A;  5K5R A;  2DYR H;  3CUO A;  3TO9 A;  1KA8 A;  1LE8 B;  1SVL A;  1ON2 A;  4F4B A;  2HGC A;  4DVY P;  2GIV A;  2H1L A;  4XOP A;  2K7L A;  3SP1 A;  2LP0 A;  4MGR A;  5LBQ A;  3B0U X;  3W8H A;  2ZXW C;  2BGC A;  4S04 A;  3GOR A;  3AL0 C;  2HJM A;  3X2Q H;  3BG3 A;  4EM2 A;  1EH7 A;  4JE9 A;  1SD6 A;  4QSH A;  2J46 A;  2G7U A;  2WY7 Q;  1S8N A;  3DV8 A;  3PIO F;  2K4B A;  3PMR A;  5J8F A;  1GV2 A;  2XRO A;  3QVZ A;  4YFN F;  1I5N A;  4RB3 C;  4U7B A;  2ZNY A;  2L02 A;  3WU1 B;  1QU3 A;  1OW6 A;  3G50 A;  2M1B A;  2P4W A;  2KT0 A;  3RQG A;  3GM2 A;  1W36 D;  1NLX A;  2ZJQ F;  1K78 A;  2GQQ A;  4D4X A;  1WVR A;  3CF2 A;  3L2V A;  3VOE A;  2R92 J;  1Q0K A;  3NYL A;  2J7P D;  3ZQI A;  2H7V C;  3Q9V A;  3FAJ A;  2XSD C;  1Y1V J;  5B1A H;  1WOL A;  2ZB9 A;  1X2N A;  2P7V A;  1KTM A;  3BG5 A;  3SEQ A;  4ZYD A;  1QPI A;  1WKM A;  1ETY A;  5F0C A;  1Z5Z A;  4IQJ A;  3K33 A;  2H8R A;  2HXI A;  4II2 A;  2X85 A;  1LNW A;  3TDZ C;  3ZMT A;  1M56 C;  4MVO A;  4JTC B;  3A0B C;  1MBG A;  1MMS A;  1HE9 A;  2FXA A;  3TOL A;  1F1M A;  2JA2 A;  1J59 A;  3JW4 A;  2HDD A;  4BKX A;  3ABL H;  1R1T A;  4PJJ A;  3DPU A;  3K6B A;  3RYP A;  4DJA A;  3I4M J;  3TJ5 A;  1QO0 D;  2F4O B;  3NG1 A;  3ASO C;  4MVQ A;  2COM A;  2BXY A;  4M3E A;  2R7U A;  1A6I A;  4HAM A;  4MHG A;  4NTA A;  4BQO A;  3K1I A;  4MND A;  2V1D A;  4U5C E;  3V7O A;  1T38 A;  4E7L A;  2FNP A;  2HQA A;  3DFG A;  4P9T A;  3K4C A;  3FBN B;  4RDA A;  4CS8 C;  3JRG A;  2J5O A;  3K4M A;  1IO2 A;  2PMZ A;  4X0G A;  3I5P A;  1HBX G;  3BP8 A;  5KYW A;  3L34 A;  1MSE C;  2VCC A;  4IKF A;  1TNT A;  4JOM A;  2LC2 A;  4CS8 A;  2XB5 A;  3CMM A;  2M0M A;  3GXO A;  4IAR A;  5CQE A;  2QQ9 A;  4JUR I;  3DBR B;  3K4N A;  4BEH A;  1XX5 A;  2VKH A;  1YJW I;  4U0Y A;  2QUP A;  4YT8 A;  2VAS A;  1DOV A;  3M4C A;  4OAZ A;  2LTP A;  3F8M A;  2DQL A;  1BL0 A;  2IOQ A;  2RQQ A;  4EBK A;  1U9N A;  3RSN A;  2WAD A;  2YL1 A;  3K10 A;  2NYX A;  2X6O A;  5F0H A;  1RC9 A;  1ZAO A;  3EUH C;  3KP5 A;  2ASR A;  1LFB A;  2KRH A;  2QSH X;  3X2Q C;  1BIA A;  4HX4 A;  3H2V A;  1YS7 A;  5FGM A;  1WAT A;  4I01 A;  4EUK B;  1ETQ A;  5E3L A;  2X6W A;  2E1M B;  4XQ1 A;  4DIQ A;  2VBW A;  3COA C;  4XTK A;  2NVX J;  3U3F A;  3U21 A;  2KJB A;  2RDP A;  4I99 C;  2VKD A;  3BJ6 A;  2DK5 A;  3SFI A;  2VL8 A;  2XAS A;  1HQC A;  3ML6 A;  2L4A A;  3HBL A;  4CS9 A;  2YWA A;  3KPH A;  3DEE A;  1S3J A;  1R1U A;  3CCY A;  1G3W A;  5D5V B;  4RGS A;  2UWM A;  4XID A;  2I15 A;  1T5O A;  4XPW A;  5ICG A;  2IA1 A;  1BBH A;  3CUQ A;  1RXQ A;  1X4O A;  1UCR A;  3ZMD A;  1BW5 A;  3KYJ A;  2VC9 A;  5L0D A;  3K4J A;  5E1Z B;  1XC5 A;  4YEL A;  1WWP A;  3VB2 A;  2V4J C;  3S84 A;  4XEF A;  3VDX A;  3J81 K;  1X1A A;  2ETH A;  1FY7 A;  1XGM A;  3LSJ A;  4Q47 A;  2LBF B;  3DPT A;  4E7Z A;  2AXT C;  5LFA A;  2GWW A;  5JLI A;  3J7Z I;  2RVC A;  3HKK A;  4ZDO A;  3BG6 A;  2LG4 A;  3F72 A;  2PMU A;  5DQZ A;  1T9K A;  2HNH A;  3V8L A;  4A12 A;  2FQ4 A;  4XRM A;  5T1D B;  3G73 A;  2RNG A;  5D91 A;  1T56 A;  3WHC A;  1HW5 A;  4EWC A;  1K83 J;  3I3L A;  2KIS A;  3ZRG A;  4MEX F;  2YQY A;  4R79 A;  3M4O J;  3ATP A;  5KYY A;  1XB4 A;  3EUK L;  4NQW B;  1ZLJ A;  4ZH4 F;  1PD1 A;  2PNO A;  3K1I C;  1BI1 A;  3W2W A;  1VND A;  4ZTF A;  5L3V A;  2DCE A;  3VSK A;  3V8K A;  2Z2S B;  2CGE A;  3S2D J;  1IRZ A;  2Q3T A;  3LFK A;  1IN8 A;  3CC7 I;  2XB0 X;  2Y3B A;  2EWN A;  2PX0 A;  2VCA A;  4YL0 A;  1XCB A;  3REO A;  3CTA A;  2GXB A;  4EIY A;  3F8C A;  5D8K B;  1OQY A;  1Y8Q B;  1VI0 A;  4AYB A;  2HZ8 A;  1OCZ C;  5COG A;  1K05 A;  4P5O A;  3E9V A;  3JRH A;  1FTT A;  2QBY B;  2V26 A;  4BE2 A;  5J1R A;  3GEZ A;  1B68 A;  2KDO A;  5DLJ A;  2VI6 A;  2AS5 F;  1KU2 A;  2NS8 A;  2XAF A;  2GA2 A;  3DXJ F;  2YSR A;  1MBE A;  4HBL A;  4JQF A;  4OIN F;  1FJL A;  1E0E A;  3K4L A;  3C63 A;  1ORS C;  4WGY A;  2Y30 A;  2HI3 A;  1I4Y A;  2VKV A;  3GME A;  2Y3H A;  2HKO A;  1OIS A;  3OYD A;  3OSG A;  1OR7 A;  3F8F A;  2AQE A;  2STT A;  3AL0 B;  3C8G B;  4AID A;  5EK0 A;  2MFZ A;  3M8F A;  2V9V A;  1AA7 A;  2XLM A;  1KQ9 A;  4DGW B;  1YX3 A;  3GCM A;  1G6N A;  3ECS A;  2OG2 A;  2BXZ A;  2Y39 A;  3DLL F;  2DA1 A;  4U5H A;  2DFE A;  4KT5 C;  2HJ3 A;  2FU4 A;  2LP4 A;  3K2A A;  3SNH A;  4HE8 D;  2Y48 A;  1P4X A;  1LVA A;  3VYR B;  4JC7 A;  5CVI A;  1TWH J;  5FKO A;  3ELK A;  2H6C A;  4E17 A;  2GOX B;  3L2U A;  1ZG1 A;  4E6K G;  3IKV A;  3CAX A;  3WAQ A;  5JS5 A;  1GM5 A;  2L01 A;  1UFM A;  1XN7 A;  3CDI A;  3EUA A;  4L5J A;  2FBK A;  3ZCO A;  5FLX Z;  2Y75 A;  2F48 A;  1H9G A;  1E3H A;  2IAI A;  4AL0 A;  1R4N B;  1ZRD A;  3KCC A;  4YWQ A;  5KAF C;  4OIQ F;  1G5Z A;  1Z23 A;  5IP9 J;  3OYG A;  2LH9 A;  3C3W A;  3RI4 A;  1ERD A;  4J32 B;  4FX5 A;  3E5Q A;  1A31 A;  5ED4 A;  2AWC A;  3H35 A;  4G9Y A;  3LAJ A;  3HTS B;  1VB5 A;  4HST A;  3BDD A;  2YL7 A;  5DM7 F;  4CA0 A;  3S9O A;  3V7S A;  5FLX K;  4ER9 A;  2KZV A;  2XUB A;  5HS9 A;  2E71 A;  2DT6 A;  3Q3S A;  4EGZ A;  3KYI A;  1IN7 A;  2OQR A;  2DW4 A;  4LG3 A;  4RD9 A;  3V5X A;  1O4X A;  1WAS A;  3K1H A;  1A7D A;  4KBL A;  5HNH A;  3PM1 A;  2VKE A;  3EH2 A;  4ZZL A;  4J00 A;  2PEX A;  3CLO A;  5K7Z A;  5IOZ A;  5DUK A;  1MDM A;  1O5H A;  2IA0 A;  2Z5U A;  4MFE A;  3JRM O;  4RGR A;  5H20 A;  2QE9 A;  4ESF A;  1JHF A;  1FP1 D;  2HSQ A;  1E3P A;  2F2E A;  2CQQ A;  2IS6 A;  3UMI A;  2KK1 A;  5JT4 A;  2VC1 A;  2LDU A;  1YQA A;  4PSX A;  1Z6R A;  1OFC X;  3HRM A;  1AHD P;  1OQC A;  3SEZ A;  3H5A A;  1ZU5 A;  2R7F A;  2K9L A;  2UZK A;  3OIP A;  4LOC A;  2B7E A;  3GW2 A;  3FKJ A;  4C7O B;  5H6R A;  1QLE C;  1VZ0 A;  2BZT A;  4U5B E;  4ZZD A;  3WE2 A;  3LSH A;  2BBY A;  5LGU A;  1M2O A;  1XSV A;  4MO7 A;  1LDJ A;  1R36 A;  2EZH A;  4AE4 A;  2LK2 A;  3QW0 A;  3CP2 A;  1Y8R B;  3EQL F;  4IO9 F;  4FE4 A;  1U0J A;  2XPU A;  1ZHZ A;  3RZO J;  2OU2 A;  4C3B A;  1Z0X A;  2YR2 A;  2VB6 A;  3HOY J;  2DLL A;  2NG1 A;  5B1A C;  2K9Q A;  1SD4 A;  3RFY A;  3G4S I;  4UVA A;  4ZYG A;  1FYL A;  4D0P A;  2AU5 A;  4RGU A;  3LJB A;  1K04 A;  1N78 A;  4R32 A;  4CS9 C;  2K5C A;  4NC8 A;  1Q0D A;  5D92 A;  4MTD A;  4CCN A;  4E7K A;  3JRD A;  2COB A;  2JVH A;  3WTS C;  1GLN A;  1MMG A;  1R6R A;  3H9G A;  2R7S A;  1Z7Q c;  5F1J A;  3JAM K;  2F5V A;  3TP3 A;  2XSJ C;  3J80 K;  5DS9 A;  3SXM A;  4QWQ A;  3FXU A;  2D45 A;  1G2H A;  4XEK A;  2E2I J;  2R7Q A;  3GM3 A;  4FE7 A;  3U2M A;  4QI2 A;  5HS8 A;  1Y1W J;  4CS7 A;  3JR9 A;  3DP7 A;  2P7C B;  1S5L C;  1HSJ A;  3ASN H;  5AON A;  4BAC A;  3KH2 A;  5A6B A;  5BOX A;  2GM4 A;  2KJC A;  1W1W E;  5GPC A;  2RRE A;  1VFC A;  4C3I J;  2QUF A;  2QM3 A;  3KEQ A;  4BS9 A;  3J7Y J;  1H88 C;  2E2J J;  3M1E A;  4M3B A;  4CCJ A;  5J1Y A;  2VIX A;  1MSF C;  4G0H A;  5KYN A;  2EBI A;  4XRS G;  3GOD A;  1OR2 A;  3RKW A;  3I56 I;  1HCR A;  4NC7 A;  3TDU C;  3FXR A;  2M3A A;  2XKO A;  3CCE I;  1CF7 A;  3C2G A;  2PJR A;  3L0I A;  2LY9 A;  1W5S A;  4DRH B;  4EJV A;  1OCR C;  2EZI A;  3C1D A;  3HTU A;  4I2O A;  4CIC A;  3OYC A;  4YT2 A;  3F22 A;  1XMX A;  3CCS I;  1V54 C;  5LRS A;  4N06 A;  2XS1 A;  1V74 B;  3N0T A;  2IJL A;  2DA3 A;  2M2E A;  3P9C A;  3QOD A;  2B0J A;  4XRS A;  5C3E J;  1PV3 A;  2VJI A;  4ESB A;  4QPO A;  2STW A;  3F21 A;  5IY5 H;  1F9N A;  4XSZ F;  4XON A;  4HF0 A;  5C4X J;  2F22 A;  3MKW B;  3ABM C;  4J19 A;  1MDM B;  2XL8 A;  3FXO A;  1G59 A;  3OYH A;  4ZLC A;  2WV0 A;  1U5T A;  2CUJ A;  1D5Y A;  1SFE A;  3GLL A;  4JTD B;  3QOE A;  5HV9 A;  1P4W A;  2DT5 A;  2JD3 A;  3V8J A;  3U5S A;  4L9N A;  2OV7 A;  4FX0 A;  4GYG A;  4G12 A;  3RTR A;  3JRA A;  2R93 J;  4JEB A;  1CQT A;  3SQN A;  2ME0 A;  3VYS B;  5DDG A;  2LD6 A;  2YU3 A;  4UNO A;  1IF1 A;  4DQ2 A;  2Q4F A;  5CVJ A;  1PP7 U;  2HMZ A;  2IP2 A;  2PMZ N;  2W25 A;  4RB0 A;  1U8R A;  4G8X A;  4DVZ A;  3K4K A;  3GZ6 A;  2OTJ I;  1OR3 A;  2P6S A;  3OS1 A;  1LFP A;  3OYJ A;  1OXK A;  2H1K A;  2DN0 A;  2BY3 A;  3VRC A;  4NCQ A;  4CHU A;  2DAO A;  4C9Y A;  4OIR F;  4CIP A;  3K7D A;  3TW6 A;  1GQA A;  3AJM A;  1DU6 A;  1D0Z A;  1D1B A;  3BQZ A;  3E5X A;  2OQG A;  3B6C A;  5F6F A;  3O6B B;  1ITY A;  2XF5 A;  4NY3 A;  2NSG A;  1V55 H;  1XMK A;  2KIF A;  2DK8 A;  1C03 A;  2VPR A;  1FT9 A;  2LKX A;  1IXS B;  5KVR A;  2E60 A;  3I58 A;  3WTT C;  2L4M A;  1FYM A;  4J01 A;  4Z6Y A;  1JGG A;  5FFZ A;  4KDP A;  5E1W A;  4AIJ A;  1OXB A;  2IEK A;  3TBI A;  5LHI A;  3IEE A;  4BQA A;  1YW9 A;  4LLN A;  4DJ9 A;  3IH2 A;  4KIG A;  1A41 A;  2ZJP F;  2G62 A;  3FMR A;  4LDQ A;  5EYR A;  1E84 A;  3KL4 A;  2XVC A;  1UJ8 A;  4XQF A;  2DB4 A;  3SYN A;  2O3F A;  2GXA A;  1JMW A;  4HPQ A;  3F46 A;  2LF7 A;  3RYR A;  2AP3 A;  5J47 A;  3NMK A;  1QNT A;  4ZYE A;  3E6C C;  1YA7 O;  3V5Y A;  1D5V A;  4ONS A;  1JPJ A;  3T9O A;  4B8X A;  1ZKG A;  2F5C A;  2K86 A;  1L0O C;  5KNL A;  1I6H J;  3CC2 I;  3NRV A;  4IRG A;  1ZHF A;  2RN7 A;  3HG9 A;  3OY9 A;  1TR2 A;  3DM5 A;  2LK4 A;  5TJ5 E;  4L18 B;  2JUG A;  4A6E A;  2GBY A;  4OWR B;  1FFT C;  1HDD C;  2EV6 A;  1WQ2 A;  3DE9 A;  3G6E I;  3BR3 A;  3S93 A;  2J9W A;  4LFU A;  2FNA A;  4IHS A;  3W8I A;  4C3J J;  4GQH A;  1BI3 A;  2D2W A;  3MMY B;  3NYJ A;  3K7A J;  2JA8 J;  1UST A;  2YPR A;  3HM5 A;  4I1O B;  1MKM A;  2CW8 A;  2W85 A;  2CV2 A;  1JUM A;  2H6B A;  1ZQ3 P;  2PI0 A;  2V7F A;  2MGQ A;  3OOU A;  1LPE A;  5J40 A;  2C6Y A;  1ZK8 A;  1PUE E;  4N9H A;  4IRU A;  2R0Q C;  2Q0O A;  3IHU A;  5E3N A;  2CNW D;  3IQT A;  4CJO A;  2PMH A;  3BEH A;  2PG4 A;  1M2V A;  3O8H A;  2DA6 A;  2F5D A;  4ZYA A;  3QU3 A;  3NYM A;  3JSP A;  5DS6 A;  4IZZ A;  1UG0 A;  3BTL A;  1JXS A;  3IWZ A;  1VK5 A;  2L9N A;  3ROU A;  1FSE A;  3SZT A;  2Z1D A;  3N24 A;  2M4K A;  3UNG C;  1DPR A;  5BQH A;  1RKT A;  4JIO A;  3M1C B;  2E2H J;  3KFW X;  4LLL A;  3LEO A;  1QPM A;  3M1C A;  4W97 A;  3HIF A;  2LKS A;  1S05 A;  4IX7 A;  4AWX B;  4UDV A;  4RA2 A;  4EVI A;  2JK3 A;  3LAY A;  1JAF A;  4BDY A;  4M6Y A;  5DV5 A;  3JTH A;  1U8B A;  4JX5 A;  1GVJ A;  1BZ4 A;  4KNV A;  1FOW A;  3VF0 A;  1Z77 A;  3ZQH A;  2NUP B;  1ZAR A;  2ZD9 A;  4V2F A;  3CES A;  4A93 J;  2CH0 A;  4AIH A;  1Q1H A;  4PDK A;  4K7B A;  4XN0 A;  1ULY A;  3CME I;  2Y3G A;  1AU7 A;  2OTL I;  3RVZ A;  3WGG A;  1U2W A;  3GWZ A;  3PQJ A;  1Z3Y A;  4NNJ A;  3ULQ B;  1LPQ A;  4P9F A;  1A6Q A;  4XMY A;  5IYC J;  2DYS C;  3H9Q A;  2VT3 A;  4KIT B;  2HU9 A;  1Z3I X;  2HXO A;  4EBJ A;  3NWT A;  4EQQ A;  4GYI A;  3OYK A;  3DMD A;  4RM2 A;  1WJ5 A;  2X0L A;  1OMI A;  1WI3 A;  4BJ6 C;  5DYM A;  2CMP A;  5JVG F;  1XGS A;  4PUS A;  5E1X A;  1SF8 A;  1WGW A;  1YAU O;  2L7M P;  2XC7 A;  1E85 A;  4HZF A;  3CCL I;  5B5E C;  2CCY A;  1WWX A;  2AXL A;  5J1U A;  1OCO C;  2EPF A;  3ZPL A;  1MMD A;  4XK4 A;  3GTK J;  4FHT A;  1H9T A;  4F92 B;  3ABT A;  2NUT A;  2E1N A;  3SHF A;  1YIJ I;  3E7L A;  5JVE A;  2JSC A;  3BR6 A;  3HEF A;  2WZG A;  5FLM J;  5K1Y A;  4BG0 A;  4GCV A;  3I4N J;  1ZGW A;  4A3G J;  1WN0 A;  1ZG5 A;  4D9J A;  1WFX A;  3ECH A;  3QPT A;  5IT9 K;  3B71 A;  1TWC A;  1R00 A;  1IZ1 A;  1YIO A;  2DU9 A;  2OEX A;  3JTG A;  256B A;  3U0C A;  1YOV B;  4M9Z A;  1OCC H;  2OCC C;  2ELH A;  2XAJ A;  1FOK A;  5F1R A;  1RRJ A;  2K9N A;  4HOB A;  4XKW A;  3BJA A;  2WWY A;  5COM A;  4Z9I A;  3CD6 I;  2D1H A;  3OYI A;  1T6S A;  1EH8 A;  1W7P B;  1LE2 A;  3TMO A;  1PUF A;  2KSF A;  1BA5 A;  4UY8 I;  2XRH A;  2Q2E A;  4XOT A;  3G4Z A;  3WG7 H;  5ILS A;  2LNB A;  4A0Y A;  3JSZ A;  2X1D A;  3RYL A;  3ABL C;  3I71 A;  3F0C A;  2HUJ A;  4EJO A;  2ZXP A;  5ICC A;  1ETV A;  2ELJ A;  3OV8 A;  2HV6 A;  3TOB A;  1YS6 A;  4LMY A;  1TW3 A;  5EEA A;  2GFH A;  2DFF A;  4HW0 A;  3U3B A;  1VMA A;  2EIL C;  3S17 J;  1KU7 A;  3KLN A;  2QKM B;  4FES A;  2QSF X;  1JJ6 C;  1HW1 A;  2Y0S N;  1IN5 A;  1V5G A;  2LMD A;  4I7H A;  3DWW A;  1T6I A;  1X19 A;  1PYV A;  4YK5 A;  2MG4 A;  4M3G A;  4LDR A;  1BIB A;  5F04 A;  5IT3 A;  1JKQ C;  1FMV A;  1J75 A;  5BS6 A;  1JT0 A;  4CDA A;  1RJ9 B;  1HKS A;  1PJR A;  1WGX A;  1MIJ A;  4RS8 A;  5HOO A;  4FT8 A;  1XGN A;  4RB1 A;  3CCQ I;  4GDF A;  1T6U A;  3P7N A;  1LVK A;  1V5E A;  3EGX A;  3HNJ A;  1XSX A;  3HOV J;  1Z63 A;  5FJ8 J;  1P7I A;  2XL4 A;  4BEH B;  4XSX F;  2KQR A;  4ESJ A;  3EFO A;  1XDU A;  5B3S H;  1BI0 A;  3ONQ A;  3OYL A;  4C30 A;  2A6E F;  3WU2 C;  4ZYH A;  2FEZ A;  2F5E A;  3CJQ B;  4A5N A;  3MCZ A;  3WG9 A;  2L7A A;  3Q6M A;  4ULV A;  2EZK A;  4G6T B;  4LK1 F;  3R6S A;  1U3E M;  1FOY A;  4EBB A;  1TWG A;  3RKX A;  5BNG A;  2J0W A;  1APC A;  4JKV A;  4G6Q A;  2VE8 A;  4II3 A;  3PUF A;  4I98 B;  1TQI A;  3ZQG A;  1EQ1 A;  5LLQ A;  1LS1 A;  2R4G A;  3V4G A;  1Y39 A;  2J45 A;  1AKH A;  3M7G A;  4DYC A;  2H8A A;  2LR8 A;  5DS4 A;  3HB9 A;  1QZE A;  3GFL A;  1LDD A;  5D5W B;  4G7O F;  1NBB A;  4F91 B;  3A0H C;  1KZH A;  4BUP A;  1YLF A;  1OR7 C;  2O8K A;  3U2L A;  3ZMV A;  3JZ0 A;  1OCC C;  2WA0 A;  1VQO I;  3AG3 C;  2EPL X;  1FR0 A;  2X4H A;  3OIQ A;  1TFK B;  4M9X A;  1FFH A;  2OC6 A;  3DTI A;  3HLZ A;  4HFK B;  4E4H A;  4I09 A;  3TOA A;  2VJ4 A;  1K4S A;  5B3I A;  2FBH A;  1YI2 I;  5L3F A;  3PQK A;  3D5S C;  2DDA A;  3DTK A;  3GTG J;  2QEX I;  4C3D A;  2VBY A;  1RKE A;  5EG0 B;  2OJQ A;  2PJP A;  3RKY A;  2KIM A;  1ZR4 A;  2VOD A;  3KX2 A;  1S29 A;  3KP4 A;  1X2M A;  3OEO A;  4OMY A;  1G3Y A;  2X1E A;  5DUI A;  3AG1 C;  3I55 I;  3R61 A;  4EEF G;  1TQM A;  1CPQ A;  5HSW A;  3S32 A;  2R7Z J;  2JRM A;  1LEB A;  3TW7 A;  3CDH A;  3H3Z A;  2HDC A;  3L2R A;  3OR1 C;  1YO5 C;  4LER A;  2EPN A;  3RPU A;  1REP C;  2O9X A;  1P92 A;  5EEG A;  5DEQ A;  1SFX A;  4LDK A;  4C3E A;  4DRJ B;  2DGJ A;  4L5I A;  2FJ1 A;  1B8I A;  5IP7 J;  1G3S A;  3I4P A;  3A11 A;  3M4B A;  2IRF G;  5HLI A;  1R58 A;  3TUL A;  4UV9 A;  5FD5 A;  2R5Z A;  5D6F A;  4YFK F;  3I59 B;  2PP4 A;  3AGT A;  2WB1 A;  5H2F C;  2R05 A;  4JCH A;  3GEE A;  2CQK A;  4U5D E;  4WAB A;  3IWF A;  1BC8 C;  5BQI A;  1U6G A;  2AWY A;  5A6A A;  5L0I A;  2QLZ A;  1DP7 P;  3EPV A;  1VTM P;  3TO6 A;  3LOC A;  1KGS A;  4FQG A;  2M45 A;  3NKE A;  2HEO A;  2XLH A;  1TWF J;  3CDL A;  4ANJ A;  3W3C A;  2F4I A;  3LSI A;  3L2C A;  2IPQ X;  1B1B A;  1MH4 A;  1TW2 A;  2JSP A;  4DBQ A;  2RSE B;  2NVQ J;  3J7A Y;  1O57 A;  1LI5 A;  2ZFU A;  1O3U A;  2KKO A;  3FVY A;  3JTL O;  3LS0 A;  1YRN B;  3F8B A;  2CYY A;  1EV7 A;  2DPD A;  3C62 A;  5E79 C;  2FSW A;  4C7O A;  2CQX A;  3MKL A;  4KFC A;  2E87 A;  2ZBK A;  3W6K B;  4O79 A;  1K6O A;  3DE8 A;  3HZJ A;  2JPC A;  2WAF A;  4BJ5 C;  1QZZ A;  2EPK X;  2UUI A;  2OUM A;  4BXF A;  2DA7 A;  4CUG A;  2W4M A;  1IXC A;  3KZZ A;  2O61 A;  3FOO A;  2A6H F;  4KYW A;  3E6M A;  2Q9C A;  2IXN A;  3DEU A;  4JVS A;  2KFD A;  2H8W A;  2HYF A;  4JZA A;  1LIH A;  4U5F E;  1MMA A;  1TZL A;  3H0G J;  3L9F A;  2CDQ A;  2FX0 A;  1S7O A;  5GAD J;  2OEV A;  3K9T A;  2AQF A;  3KLO A;  4EV0 A;  2JWT A;  3RQF A;  1OCO H;  1IN4 A;  1Z6T A;  1HW2 A;  1HKT A;  1KNY A;  2BOL A;  4MTO A;  1R5I D;  4D7N A;  5F64 A;  2IT0 A;  2ZC2 A;  4JX6 A;  3WTV C;  1UHM A;  2R7D A;  4YT5 A;  3BT9 A;  5JLW A;  3U8V A;  3ZXS A;  1JRA A;  3VFZ A;  1SEU A;  3DWL E;  3C8Z A;  2DA4 A;  3G1O A;  3GYH X;  1WRJ A;  3IQC A;  4MW3 A;  1EKY A;  4I1M A;  1I3Q J;  1V54 H;  2UXN A;  4S0H B;  1K4T A;  3S3N A;  1ZLK A;  1TKN A;  4A3F J;  4IAO A;  5L0G A;  3P5J A;  4BHC A;  3ERM A;  2QYO A;  2ZSH B;  3Q7G A;  1IRF A;  2W00 A;  4HNT A;  5HLH A;  1N75 A;  3CCU I;  3UR3 C;  1IDY A;  3SZP A;  1YRN A;  1UAA A;  1YVI A;  3GWN A;  1XTA A;  2JMW A;  4CJG A;  1E2X A;  2VOP A;  3TOM A;  2MBF A;  3FZV A;  1IRX A;  2V1X A;  3EPZ A;  3FHN A;  2ZNZ A;  3H9J A;  4N0B A;  1PDN C;  4C2U A;  2L6G A;  2L6H A;  1ZHX A;  2EZL A;  2EFQ A;  4PJL A;  1D8K A;  1ZW3 A;  3HUG B;  3S27 A;  3JAM Z;  4QI0 A;  4DNC A;  1ETK A;  1P4A A;  3QZC A;  3J80 Z;  3M8J A;  3LSK A;  2XGE A;  4E0I A;  4CIH A;  3KET A;  3GZ5 A;  1FBU A;  3BR2 A;  1YW8 A;  1ZW2 A;  1NFO A;  4IHY A;  4L9T A;  1BM9 A;  5LEJ A;  4E7J A;  2FD5 A;  4O6J A;  4M72 A;  1OYI A;  1U89 A;  3MX3 A;  1SC7 A;  3T0Y A;  2IBD A;  1YTY A;  3EYY A;  5FLV A;  3CO7 C;  4K2E A;  5COF A;  3CMA I;  3K66 A;  1O3T A;  3ZQY A;  3HSE A;  1KU3 A;  5EZH A;  2J8W A;  3HOW J;  1MJA A;  5JSL A;  2BC5 A;  3ABU A;  1ZGJ A;  1I3A A;  2WZL A;  3POV A;  3L8J A;  5EGO B;  4LIV A;  1YHQ I;  4JJF A;  3BOQ A;  2B9S A;  3DPL C;  1MJB A;  1QHG A;  3O3K A;  3OS0 A;  3S1N J;  2ZCW A;  4XRF A;  1UG7 A;  1OKK A;  1EA8 A;  4HEA 2;  1D1A A;  2LVS A;  4V2G A;  1RKE B;  3MQ0 A;  2KGO A;  2R9R B;  1G3T A;  1PCX A;  2W1O A;  1EA3 A;  3OWT A;  4HFF B;  3H65 A;  5F0F A;  4O6Y A;  4D4N A;  1Y0N A;  3RKQ A;  2Y69 C;  3MYF A;  3QU6 A;  1YJN I;  2HQ5 A;  4CZZ A;  4PSW A;  4AE4 B;  2MC3 A;  5CQG A;  2IM8 A;  2VBX A;  4RAF A;  2GAU A;  2KRC A;  3GO5 A;  3WTZ A;  1Y6D A;  2XM0 A;  1GT0 C;  5FFX A;  2XS8 A;  1ZTR A;  4AIK A;  2NRA C;  2WZF A;  4HSR A;  1Z1D A;  4PAC A;  5IY5 C;  2ISZ A;  2XAH A;  5CI8 A;  1K79 A;  5GPA A;  3IV5 A;  1D0Y A;  3K70 C;  1FOX A;  5HLT A;  4KUM A;  3J7A O;  3M3Y J;  4NQW A;  2E36 A;  3OR2 C;  3BG7 A;  1LDK B;  2R5Z B;  1K7A A;  3P9I A;  3DJN B;  3FDQ A;  4LG0 A;  2K4J A;  3O10 A;  4KN7 X;  2O7O A;  4JBA A;  3OSF A;  4UUV A;  2FMY A;  4HQE A;  4HA8 A;  2PF4 E;  2TRT A;  1FNN A;  4G78 A; 
#chains in the Genus database with same CATH homology
 1R5I D;  3KPH A;  2ICW G;  2OJE D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...