1R5ID

Crystal structure of the mam-mhc complex
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
214
structure length
214
Chain Sequence
SMKLRVENPKKAQKHFVQNLNNVVFTNKELEDIYNLSNKEETKEVLKLFKLKVNQFYRHAFGIVNDYNGLLEYKEIFNMMFLKLSVVFDTQRKEANNVEQIKRNIAILDEIMAKADNDLSYFISQNKNFQELWDKAVKLTKEMKIKLKGQKLDLRDGEVAINKVRELFGSDKNVKELWWFRSLLVKGVYLIKRYYEGDIELKTTSDFAKAVFED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Crystal structure of Mycoplasma arthritidis mitogen complexed with HLA-DR1 reveals a novel superantigen fold and a dimerized superantigen-MHC complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 84
structure length 214
sequence length 214
chains with identical sequence H
ec nomenclature
pdb deposition date 2003-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.530 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A mam-mhc complex, Chain D, Domain 2 1r5iD02
1.20.120.390 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hla class ii histocompatibility antigen, dr alpha chain. Chain D, domain 1 1r5iD01
2OJED 3KPHA 2ICWG 1R5ID
chains in the Genus database with same CATH superfamily
1X3ZB 3KETA 1FAPB 2G9WA 5KCMA 2WAEA 2VUMJ 4BJ5A 4DZPA 5HS9A 2H6BA 4HAMA 2NS7A 2LREA 1I5ZA 3F22A 2GA1A 3OSFA 1WGWA 2R7ZJ 3QU6A 1IXCA 4XEFA 1GVJA 4QI2A 5E3NA 3I53A 3ZQHA 1NG1A 2YLGA 2JPBA 4IWBA 2UZKA 3FKIJ 1S3JA 2Q2EB 3E0JB 2Q4FA 2NS0A 2D45A 4IX7A 1CF7A 4L9VA 5IP6A 1OR7A 1TQIA 2Z5UA 4KJZA 1LEBA 2Q8KA 3BTCA 3LQRA 3RVYA 4X0GA 3DQVC 3DU6A 2J9BA 2JZYA 3KMIA 5BQHA 3CLOA 5EZHA 4O79A 3ABMH 2E2HJ 4XICA 4CHUA 3BZKA 4A3CJ 4I98B 3KP2A 1IN4A 1X3WB 1W4MA 1AEPA 4WGZA 2O3FA 4Y3OA 4FAPB 4A3EJ 1WRJA 2P81A 1FJLA 1TT5B 3X2QH 5LEKA 2P6SA 3BR1A 2HZDA 2L3DA 1NU9C 3O8GA 4E18A 4QTRA 5L3FA 2AXTC 3OYNA 1SFEA 1ZVZA 5IY5H 3CMAI 1OR2A 2MWQA 4PFPA 3DBLB 2A3SA 2QENA 3BTJA 4FETA 2IXSA 3RDIA 3V8JA 2FGYA 4HBLA 3H3VK 3ZMUA 2P1AA 4WXCA 3T9OA 3DKAA 4MEYF 2WWYA 2L6FA 1BL0A 3SEOA 2YWAA 2B63J 1X1CA 1A41A 2LK4A 5L0FA 2V6CA 1YDIA 5F1JA 5CVIA 5HLIA 4E7JA 1V3FA 2E1OA 1SMTA 4ZYEA 2KK1A 2FBIA 3JTLO 3KFWX 3S0XA 5IYBJ 1C17M 4DOZA 3I58A 4DGWB 1Y1WJ 2CJJA 2HYJA 2PMZA 4ASNA 4WX9A 2HKOA 2DOEA 1KQ9A 3ABTA 4PJLA 1OKRA 2A6TA 3RF3A 1RR8C 2YL3A 2LY2A 2W00A 4IL6C 3CLQA 1E3HA 3NYLA 2MGQA 5E2QA 1TBXA 2PI0A 2JD3A 5T1DB 2E1MC 4AVPA 1U8BA 1R5GA 2YLIA 1GS9A 3ZN0A 2WAQA 1AVOB 1JMWA 1ONVA 2NYXA 1T56A 1Z6TA 3FHZA 2W48A 3G3ZA 3T1BA 3HEFA 3HSFA 1OR3A 2HKVA 3REOA 2K4JA 1N75A 4XKWA 5H6RA 4QDLA 2DYSC 3I4MJ 5ERIA 1MSEC 3L2RA 4A4AA 2KZVA 3HGYA 2P4WA 2GOMA 4NC7A 5CI9A 4RS8A 4C30A 4BE2A 2OKUA 4YFKF 4AWXB 4A0ZA 5M5WJ 3POVA 4OAYA 5E33A 1YFHA 4BY7J 3OYCA 4RGRA 4JEBA 2RQPA 2E7XA 3K4JA 3JRAA 3KH2A 3O10A 3B0UX 3EG9B 2YR2A 3QPSA 1FP2A 3GZ5A 5LFAA 1Z0XA 3C62A 2XL4A 3IEEA 2ZSIB 3IC7A 3LEVA 4O5VA 1ZG1A 1J0RA 3WGHA 4BEHA 2HR3A 3VYSB 1WJBA 4C2MJ 4CCNA 3K9TA 4BQNA 1YRNA 1M6TA 1YJ9I 5K1YA 5BPDA 3H9QA 4ZDLA 2Y30A 3PSFA 3S93A 1FEXA 1CGME 1OCZC 1SFOJ 1OCOC 1HMOA 1ORKA 2EFWA 2EQRA 2KGOA 1G4WR 3JCUC 3SXMA 3SJMA 3GWZA 4EATA 1JOGA 1LIHA 1SYQA 2NNYA 2CQKA 1JKQC 3U2LA 2FFHA 2WZGA 1RI7A 4ZYHA 4NNJA 1BR4A 2LR8A 1ZH5A 5TGTA 5GAGJ 2OJQA 1OMIA 3SYNA 3GBGA 3HB9A 1IG7A 3QOEA 4JTDB 1FIPA 2CG4A 2IT0A 5A69A 4N06A 5A6BD 4IJAA 1VQ8I 1O57A 4B4CA 1K78A 3IQ5A 2QYOA 3S17J 1JUSA 1FLIA 3S2WA 2GWRA 3H9GA 4CYCB 3GTJJ 2GLOA 2F6CA 4KISA 3ZIBA 4I1OB 3HJEA 5GPCA 1CGPA 2LY1A 2ELKA 1G3SA 2ESHA 3RIPA 4B44A 2HXOA 4HQMA 1R4MB 3S15J 2VPLA 4AL1A 3B0VC 1ZHFA 2A5YB 1XDSA 1APCA 1EH7A 2XGXA 3K10A 4N9HA 3VSKA 3EG9A 1LFUP 3US6A 1TQMA 1KONA 2JT1A 4CIHA 5D6FA 4KFCA 4KT6A 3BRJA 2MLKA 2EPMX 5F1RA 4E6KG 3VDXA 3O6BB 3TO6A 1HKQA 3FXUA 1BBHA 1WASA 5DVWA 2HFIA 2NRAC 1R5ID 3JRIA 1FNTc 3O55A 1Q0KA 5J1RA 1QZZA 3SXKA 3GF2A 2L5QA 4MHGA 2E71A 1V54C 2TRTA 2EK5A 3A2KA 3TL4X 3PJRA 4Z9JA 3I3LA 3DE8A 1Z3YA 3OV8A 2CCYA 3F8NA 1JXSA 3EYIA 3DM5A 2F4IA 3DEWA 2AU5A 1FBQA 1O5HA 3O39A 4U5FE 2YZSA 1JKRC 2M87A 2DK8A 2MG4A 4FHTA 1D0YA 1TWGJ 2IP2A 2NOJB 5FKNA 4LERA 2DODA 3DKWA 2NAZA 3DZAA 1BOBA 4X0RA 3M8EA 2VQLA 3PIPF 3TOMA 3DBHB 3U9GA 5F28E 4RMNA 1NG7A 4L6RA 2CV2A 5T3WA 5CLSA 2XM0A 1OCCC 2X4HA 4G9YA 2G62A 3HTSB 1T38A 2PFBA 1HW1A 1O4XA 2IXMA 4XBFA 1ACIA 4RDAA 2CW7A 2V26A 1EA8A 2DDBA 3U1KA 3OYEA 1YX5A 3LNQA 3GYHX 4BEMJ 1TW2A 2KRFA 2CS3A 2VH3A 1BR2A 5E8GA 1EV7A 2VKEA 1PV3A 5JHUA 4BGDA 5E79C 3K70C 1DPRA 2Y75A 2PMUA 2JK3A 1IRXA 5L3DA 1TWCA 3EETA 2EV6A 1Y8QB 2R05A 3CAXA 2OCCH 4RM3A 2GXGA 4G94A 4JX5A 1YS6A 4F92B 5IOYA 3OYBA 4AYBA 4NQFA 4IRHA 2GXBA 3W6KB 4IGGA 4IHSA 1YIJI 5DS4A 1D0ZA 1OXKA 3QWLA 1MBFA 1IW7F 4N6HA 1G2HA 1S7ZA 4MNUA 1RCPA 2Y3BA 1U5TB 2LKSA 3GODA 3HOXJ 1O3TA 1A35A 1K04A 3CO6C 3SFIA 3BP8A 3RQIA 1MQVA 1OCTC 4F55A 5JVTA 3D1NI 3SP1A 3FZVA 2R5ZB 2QLAA 1XB4A 3ECHA 3HSEA 2ZJRF 4PACA 5F5FA 2DLLA 4N4NB 3ASOH 2V9PA 4U5DE 4YL0A 1JUPA 1K83J 2HOEA 3V42A 5GAEJ 1QZXA 1IV8A 1XPXA 2LQGA 2YHSA 2L9SA 1S6LA 1XTAA 1FX7A 4J7TA 2COMA 2NVXJ 2NUTB 2O6GE 5HDGA 1GV2A 3WTWC 1MBEA 3LNMB 2RREA 4Q4ZF 1YJGA 4HEA2 2WV0A 1W0TA 3N97A 1TWAA 5F04A 2XL6A 2PQ8A 1O7LA 2JVHA 2XRLA 5ED4A 4ULWA 1JPNA 3DM9B 1RMVA 1HC8A 3KE2A 2KJCA 4RBNA 4BJ5C 4LJZF 1SAXA 1JPJA 3OIQA 2VI6A 5FZTA 5KYUA 3FM5A 4B6IA 1YOVB 2R25A 1H7IA 2DDAA 1HKTA 3IHUA 3AGUA 2AWYA 5COMA 2ZXJA 2MYSA 1V55H 2DFFA 1SD5A 2OUMA 2WVOA 4CH7A 2K3FA 4D4XA 1OR7C 2WY8Q 3OYMA 4MVQA 2FA5A 2CU7A 3OS2A 4HX7A 3JW4A 4AL0A 1AKHB 2VXDA 3F0CA 1RJ9B 2GQQA 5J47A 3IQ6A 3L34A 1E2XA 1U5TA 4P9TA 1XS9A 4NCQA 2Y0SA 4GXOA 1WPKA 4V2GA 3TMOA 4DZJA 3EH1A 4JIOA 1PUEE 1FTZA 4JJGA 3MKYB 1D1BA 2VASA 1KU9A 2H1LA 2R5ZA 2J7PD 4E0IA 2NUPB 5LHIA 3H9JA 4XLFA 2L2OA 2VQHA 4DXWA 2Z16A 3L9FA 3GEIA 4YWQA 3WU2C 5CIVA 4B3XA 1T8IA 4KDPA 1T0FA 1U78A 1MNMC 3HNLA 1O3SA 3L1MA 1XD7A 5ILSA 4MVRA 5FLXZ 2YU3A 3S90A 4QIWN 2WTEA 1VQLI 2DQLA 3ZRGA 3ZG1A 3KYDB 1LDKB 3AG4H 2MH2A 1W0UA 5HLHA 3Q3SA 1P9QC 1SC7A 5D5VB 2DJIA 4W8PA 4A3KJ 3TOLA 2GFHA 5COGA 4M9ZA 1IXRC 3PDMP 1O7FA 3RZOJ 1HY5A 2AHQA 1ZU5A 4ESJA 3GFJA 5FJ8J 2R5YB 1LB2A 3OL4A 1CPQA 2CQ7A 2J45A 3LJBA 3S3OA 1AKHA 2LFFA 5B3SH 4EWCA 5BNGA 2LD5A 3RKWA 3LSMA 5F0CA 2BL2A 1E83A 4J19A 1RKEB 4LK1F 3S29A 3FXOA 4EJWA 3UGPA 4XRSG 4OIPF 5EEAA 2ID6A 2BHZA 3JRHA 3LA7A 5KNLA 2NUPA 1R22A 4ZC3A 5BQGA 2VE8A 2CSOA 1C03A 3DTEA 3K1IA 2CH0A 1YIOA 5DD8A 4Y13A 4O3MA 4NTFA 4EJOA 2K9MA 2HTSA 3E6BA 4LMYA 2DW4A 4G6DA 3K1MA 4UV8A 3UMKA 3K70D 2H6CA 3PFYA 4NDLA 1XWJA 2QE9A 3PFIA 3J7YJ 1BI1A 4KT5C 3H0DA 2H7VC 4O6NA 3BQZA 3EJNA 2EILC 1IAWA 3S84A 5FRNA 3WAQA 2ETSA 3CEXA 3ZMSA 2WY7Q 5B1AH 4CBEA 4Q48A 4U5GA 4JP0A 2JA2A 5EEHA 3FAJA 2LBFB 3C1DA 1QPUA 5DUKA 3Q5FA 3LLKA 2V7FA 1LPEA 3BT9A 1XX5A 1QU3A 2YUSA 5JUAA 2FMLA 3E6MA 2RDPA 2P8TA 1Y0UA 3FF5A 2R5YA 1T2KA 4IB4A 3LSJA 1U2WA 3FOPA 2ICWG 4YT8A 3RQ4A 1PJRA 2X6WA 2EZIA 4HV6A 2NVTJ 3EHNA 1FPQA 3NRHA 2QKMB 1RKEA 1SZIA 1OYYA 2ME0A 3FXJA 4DJAA 1MBGA 2IS2A 3ATPA 3C2GA 4IXAA 1CQTA 3MD2A 1TZLA 1Q0MA 1ZTRA 3I5UA 1O87A 2LLKA 3IQTA 1QGPA 4N6CA 2KP6A 3RYLA 2IPQX 3OL3A 3CJTB 3FAPB 2UWMA 1FYLA 3AFHA 3SEZA 3AG1C 4FX5A 3CTAA 5EEGA 2HDWA 1MBHA 3NDBB 1B72B 3FK6A 3HSRA 3WG7H 1YYJA 1TT0A 2LVSA 2KJGA 1OYWA 2CWEA 2MD0A 5CVJA 2UXXA 5CQEA 4FASD 2P7CB 4RAYA 3VYTB 2XRHA 3RPUA 3KL4A 3SDGA 3ULQB 4EGZA 2QQ9A 2WV1A 4IKFA 4UVCA 1ETXA 1IRGA 4ER9A 3S1RJ 3T8TA 4AIJA 1KQ0A 4DIQA 3MKLA 3LFUA 2ZBKA 3RIRA 2ISZA 1HE1A 1TWGA 4MVZA 3U2MA 3L1PA 1T01A 2PX0A 4IZZA 3U5SA 2LBFA 3SFZA 1FZPB 2VT2A 3TO7A 4CZZA 5DD4A 5K5OA 3HTKC 3DXJF 1T5OA 2OEVA 5IYCJ 4QSHA 3B6AA 2KQ9A 2CRGA 2MD5A 3K6BA 4S05A 1Z5ZA 2VBZA 4E17A 5JS5A 1F36A 3CMYA 1HE9A 4E0HA 2XB0X 5M5YJ 3R60A 1WJ5A 2HMQA 2B7EA 2K9LA 4YELA 4E70A 4RGUA 1MDMA 1Q1HA 3S2DJ 1HF0A 1TQGA 2BZTA 2LH9A 4FISA 3DLAA 3ZMTA 1YJWI 1YQAA 1HA8A 3CDLA 3JRMO 2DK5A 1EKYA 3QMKA 2O7OA 2XSDC 5AC4A 2YL0A 2UUHA 1H9TA 2M7BA 4IHYA 1TWHJ 5DTDA 3DLLF 1OW8A 3JCUQ 2M7AA 4Q7CA 4NC6A 3B0PA 2R02A 4N4WA 4RB0A 2L54A 5ICCA 2QSFX 3V7OA 2F5EA 4NUBA 3GM2A 4WF2A 2VBYA 4N9IA 2K02A 5CYVA 1FBSA 3EYYA 5BPIA 3W6VA 3PO2J 2KNHA 2M64A 1LVAA 3PNVA 2FOKA 3I64A 2IM8A 2K3PA 1OCPA 3FMQA 3DJNB 1IN8A 3ZC4A 2HTJA 2E5ZA 1O3UA 2J8WA 2DMPA 1NHAA 4QPQA 4U7BA 1T6SA 3U9JA 3CMMA 5J8CA 3CF2A 3FWEA 2I10A 5E3LA 1B68A 3EGXB 2W25A 4LB6B 3KEOA 4XKVA 1LE2A 1RETA 1D1AA 4KYWA 5BOXA 1OJLA 2A6EF 1ZGAA 2L4MA 1OYIA 4YRVA 5DQTA 1WJDA 3BLYA 1WFXA 3K2ZA 2C03A 3H36A 1IN7A 4C7OB 1NK3P 4EHPA 3DKXA 4XIDA 2O61A 5D5WB 3ASNC 4MVUA 3FXLA 3EFOB 2VN2A 1YA7O 1QQIA 3C2HA 1Y8RB 1KYWA 3TW7A 2G3KA 4CX9A 3OYFA 3B73A 1W2WA 2XF7A 4I44A 1HQCA 1GGQA 4ZTJA 3ABKC 2ELHA 2WC2A 2XIGA 4HNUA 3F6VA 4JOMA 5CQGA 2XASA 1AUEA 1YJNI 5FLMJ 2AP3A 4P5OA 3CO7C 3T4RA 2QNLA 2FOWA 4A12A 2NSGA 1G5ZA 1TQPA 2WB1N 2XAFA 3K7AJ 2A6HF 2LC2A 2XC7A 1KU7A 3K0LA 3PUBA 3WTYC 1ZRCA 5T3TA 2XLDA 3C63A 1V5EA 1DPUA 4UB8C 4HSRA 5CJ9A 4EIYA 3HC7A 3WTVC 3LSRA 2K9SA 5HS7A 4MS2A 4AIHA 1ZW3A 3ZQIA 2L7MP 1WJFA 2UXNA 3WTUC 1QA6A 4IJJA 3W6JB 3D5SC 1ZG5A 3OR1C 2OPTA 3CP8A 5M3MJ 2EWNA 4KICA 2ZXWH 1YG2A 3VAYA 1FT9A 2EA4A 1XZQA 2GOXB 5JLXA 1AOYA 1Y1VJ 4ZYAA 1JRAA 3HYIA 4KIGA 3MWMA 1A6QA 4Y4RA 4ZYDA 3QPLA 1IXSB 1MW7A 4CXFA 1KGSA 3OYLA 3K1HA 3LSPA 2LIGA 5GTHC 3TJ5A 3DPTA 2YU9J 5A6AA 4FQGA 1VQ4I 1ETVA 5JP7A 1IDYA 4F91B 3I56I 5JSLA 4HX4A 1U5TC 2CDQA 2XKOA 1H0MA 3BCAA 3M8JA 4A2NB 1LFPA 2RC4A 5GAHJ 1J8MF 3N24A 4FWVA 4C3IJ 5DS9A 5JVGF 2HQNA 4L5EA 2QVOA 1NH3A 3CC2I 1Z9CA 2LF7A 4Y15A 2OQRA 2R7OA 1X19A 2EIJH 4XSZF 3IAM2 3J7ZI 1B8IA 1IUYA 3KZZA 3CUQB 1UFBA 2FSWA 1RR7A 4FT8A 2DA7A 3WG9A 5AIPA 3GWLA 3JRTA 4OIQF 1T0FC 3FX3A 1FIAA 1ZRFA 2R93J 1LI5A 2OG2A 2EV5A 4U9EA 5D4RA 2R7XA 4BDZA 5KYXA 1QZYA 3P9CA 3DP7A 4A3BJ 4YIIA 2DMUA 1VQOI 3ZMZA 2JA7J 3EZIA 2VKVA 2HZTA 3GTOJ 1FFTC 1TP4A 3CJQB 3LAPA 1Y4CA 3AOUA 4JC7A 3EUKL 2X1CA 3QP5A 1YW7A 3SHFA 2JSCA 2V1UA 2EZHA 1H6GA 2F5DA 2WZFA 3C8GD 3MKWB 1K4TA 4M71A 1NK2P 1FFHA 2IS6A 5E17F 5FKMA 1G4US 5E1WA 4I6ZA 2R7TA 3HPHA 3VYUB 3K4LA 2UUZA 4YL1A 2AO9A 3EQLF 3QTHA 2W4SA 4BYYA 2FJ1A 3U2RA 1X4OA 5D5UB 2Y3DA 1LE8B 3PUFA 1D3YA 3G71I 1YW8A 1Z3IX 3K1IC 4UDVA 5C3EJ 3CUQA 4U88A 3TGNA 2OC6A 4BBRJ 3J7AO 3JZ0A 2GM4A 1WKMA 3HDDA 4U5CE 3H3ZA 1JI8A 1UAAA 1ORJA 4HYEA 1XZPA 2HZ8A 2IA1A 4IHXA 4U9DA 5KYYB 1GDTA 3I71A 2HQ5A 2HV6A 2EFQA 3OYJA 4I99C 3C8ZA 2Y31A 4I0AA 4BE1A 1APLC 4CGZA 1AU7A 4BBSJ 3TEDA 3VODA 4GGGA 4MVSA 2NXNB 2DT7B 2X6XA 3T8RA 3FXKA 3M9AA 4S0HB 4U5HA 2XGCA 2EPNA 3V7SA 1JHFA 3G1MA 3DJUB 4BH9A 2LKPA 5LRSA 2HV7A 3V5YA 1WI3A 4NQWB 1VYIA 1XC5A 3NKDA 3CP2A 1QO0D 1VQ9I 4JVSA 4RLQA 1BOAA 4LFUA 3WTSC 1S7OA 4JK1X 3WHBA 4BDYA 4JTCB 1X1PA 1Z21A 2XPVA 3BJOA 3C18A 4M3DA 4EMSA 1G3YA 2XLOA 3G1LA 3MKZA 2KLOA 2LK2A 3IV5A 3DF8A 2RNGA 3VPRA 1C0WA 4I02A 3ZQYA 1LE8A 3KYJA 3V7CA 4RAFA 1VNDA 2ID3A 4EKWA 3WTZA 4HEAJ 1SFXA 2V1NA 3GM3A 1SEUA 1TTYA 2X1DA 4ZTFA 2J46A 1BI0A 5FRMA 2K85A 2QUPA 1W5SA 2W1OA 2R7FA 4IO9F 1EQ1A 1GXQA 1EJ9A 1TWHA 4RB2C 2L02A 2IS1A 4M3EA 2P6VA 1NG6A 5HSWA 2NS8A 2LP0A 4KN7X 2K7LA 2OTLI 2PX3A 2J9VA 4KI2A 2ZXOA 5IPAA 2YX7A 5HNHA 1UCRA 5KYYA 1ZELA 1XCVA 2FF4A 4BEHB 2CGPA 2XLHA 5L3GA 1YRNB 2XAHA 2OQMA 1S9HA 3K4MA 3EH2A 4LIUA 3BG7A 3RKQA 1LFBA 2J9UA 1MNDA 2X48A 4XPXA 4F4BA 4C3DA 4C3BA 1ETYA 5F6FA 2KRCA 2YLDA 2PJRB 3ABMC 2XAUA 2FE3A 4XQ1A 1VYKA 2Q0OA 4RGSA 1MZBA 2CYDA 3HOUJ 4NQWA 3RTRA 1I3AA 1Y6DA 2MC3A 3BTIA 4WABA 5KYWB 3X2QC 3L2UA 1PVEA 5B1BC 3E6CC 3TD7A 3FMRA 5IP7J 1K4SA 2RQQA 1Z63A 1ETQA 2K40A 3V7RA 1MSFC 4L0ZB 4YT5A 3K7DA 2QZ8A 4MQ9F 3OS1A 5IY5C 4JQFA 5DDGA 3QOPA 2CQXA 2OZ6A 3F21A 1T33A 1K78B 3J81K 3OYGA 1GM5A 1Z91A 5CVUA 2LKXA 4FESA 2ZFUA 1SMYF 1STZA 4Y7NJ 4C2TA 1U6GA 2EINH 3G2BA 3MFKA 9ANTA 1IJWC 3U0CA 2HQAA 1HSTA 2F22A 5GPGB 1RKTA 1U9OA 2P7VB 3CDHA 4IHVA 2JN6A 4BE0A 3K1PA 5GADJ 4J32B 3V8KA 3QYEA 3GO5A 4CDAA 2FNPA 1YYVA 4BS9A 4WJ0A 2HFHA 2IA0A 3PNTA 1FR0A 3JREA 3W2WA 1U0JA 2HVQA 3KZYA 3R4KA 5JR3A 3GFIA 3FXHA 1QNTA 4XN3A 1QSPA 4JCHA 3M07A 4NTAA 2HQRA 4QI0A 2PJRA 2JA6J 3MVPA 2I8DA 4UHTA 5TJJA 1IN5A 3CESA 4D7MA 2M4EA 1BIBA 5E1ZB 4YK5A 5KYWA 2B0LA 1BJZA 2Y2ZA 3WODF 4DVYP 3AG2H 4HX8A 1BZ4A 2QLZA 3DD7A 3G4SI 2O03A 3C2BA 4LG0B 3C8GB 1ZN2A 3R2PA 1JUMA 2WVNA 1IO2A 1USTA 4UY8I 3Q9VA 3LAJA 3IRRA 5LHHA 3E97A 5CI8A 4ZZLA 1MBJA 4GRIA 2DA4A 3DPUA 1WATA 3PO3J 1PP8F 2BOLA 4WCGA 4Z6YA 1BC8C 4XK4A 2P7VA 4JE9A 3IQCA 2P0NA 5B5EC 1KYZA 1HBXG 2A1DD 2DB4A 1K6OA 1B4AA 3RJPA 1QZEA 1E17A 3W8HA 4MGRA 1TR2A 4L9NA 1N78A 4BXUA 1UMQA 2ZMEC 4GQHA 2ZD9A 2A61A 4P9UA 1OCCH 2AXLA 4WK8F 4XL9A 2ZJPF 4D9JA 3JSEO 3OOUA 3RYPA 1HOMA 1OXBA 3HLZA 2XF5A 1I50J 3HUGA 4XRMA 4EUKB 3SZPA 2J0XA 3BJ6A 2L9JA 4IQJA 1SR2A 4U0WA 3LQQA 4AC0A 5HNFA 2DGJA 2R0QC 4OU0A 1R4NB 4GYIA 3MLGA 2DQRA 3RQEA 2DFIA 2DYRH 4ZYGA 1T6UA 2QUFA 1VTNC 3MQ0A 2HVSA 1UZCA 2MBFA 2L7FP 3CQZJ 3WHCA 2K9NA 4LG0A 1K79A 3C8GA 2EIKH 2EIMH 3HOWJ 4NY3A 1R7JA 2RD9A 5ICFA 1XN7A 3OIOA 2V1DA 4B43A 4HE8D 2XB5A 3K4KA 5F64A 3ZP5A 3ZVRA 5D8KB 2FQ4A 2X85A 4BHCA 3S28A 4JW1A 5E3OA 3RPUD 4RB1A 1AHDP 4XEKA 4U0YA 4F52A 3I54A 2TCTA 1Z7LA 3I55I 1DUXC 3GW2A 5D4SA 2V79A 2QM3A 4M9SA 4PJMA 3U9MA 1MMDA 1Q0FA 3BR0A 4EM1A 1Y6IA 1GHCA 2M8GX 3VYWA 3HKZA 4BJ6C 2HEOA 3ML6A 1O3QA 3UMIA 5KYUB 4CSAA 1ODDA 2M0CA 2PLYA 3ECOA 3DWLE 4L5JA 4IHWA 4K7BA 2CYYA 1MD0A 2MA3A 4G0HA 1QPIA 2R7VA 1S5LC 2OEXA 5FB2A 1H8AC 4ITVA 3TK0A 1J2XA 5HLGA 3ZDLA 2FNAA 3LLIA 2H27A 1R58A 5EDNA 5FROA 3QAHA 2JSPA 4NBQA 2IGMA 2PMZN 2X51A 1POGA 1X58A 2MH9A 3T6BA 1ZREA 3ZPLA 3RH3A 4EEFG 1BW6A 3PIOF 2Z9OA 3OYHA 3RW0A 4OD4A 1OCRC 1ZHYA 1B1BA 4IRGA 1T6QA 2LYCA 3U1DA 2L6GA 2WAQN 2XS8A 4DYCA 2BBYA 1U3EM 4XRFA 2XAGA 3LSIA 3S1MJ 3D5LA 4CCOA 5CVRA 1QQ3A 5IT9K 3CSKA 3ONQA 4JX6A 3IWZA 5COFA 2DA6A 1NFNA 2HGCA 3WHNA 2OD5A 1T98A 4WXDA 2AQFA 5JLIA 2GBYA 1W36C 3S2HJ 3PNYA 2LDUA 3UMHA 4HPQA 4ANJA 1RIOH 2H8RA 4JEAA 3VWBA 4NHJA 2OU2A 3EUHA 4RAGA 1WHUA 2R03A 3DAGA 4M73A 5DM7F 1ZAOA 5BQIA 3BZ6A 1MJBA 1QVUA 2JUGA 2ZXIA 2PX9A 5LEJA 3RI4A 1JAFA 3CUQC 3DU5A 1RKCA 3BZCA 4ZDPA 2MW8A 4KMUX 2QSGX 5JT4A 4A3IJ 3RZDJ 3E6DA 1Z67A 4JCZA 4HW0A 4CDGA 1X1AA 4HNVA 2J0WA 2OCCC 4D0PA 1H89C 2CQNA 2X0LA 4A3JJ 3E5XA 3GZ6A 1YLMA 2Y39A 3UKGA 1UG2A 3A9CA 3GVAA 3SYTA 4XNFA 1XSDA 1WTYA 4HNTA 5E20A 1NU7D 4N4OB 1T95A 2KQRA 1LUJB 3CCLI 2Y48A 2JUCA 3K69A 3LFKA 1PP7U 3IH2A 2M45A 1MH4A 2TDXA 1WH5A 4ZZDA 1TC3C 2OJED 3JTHA 4B8XA 4AK9A 2Y9ZA 4KNWA 2CMPA 1QVTA 4U7DA 2TMVP 2W24A 3ASOC 5IP9J 2B0HA 2L0KA 2CNWA 5EG0B 2LMDA 3HBLA 4MFEA 2W4BA 3I5QA 3CD6I 3F8MA 4HF0A 4EM2A 1DU0A 1HDPA 3F72A 2Z33A 3AAFA 3ERMA 1D5VA 1UHMA 4GEHA 5D6EA 4CA0A 4G7ZF 3HM5A 1OW7A 2D4UA 2W4MA 1BR1A 3CCUI 3GTPJ 1WI9A 3BWGA 2L7AA 3HZJA 3KLNA 2OAZA 2IEKA 1AWCA 1YA9A 3GTMJ 1FMVA 1LDJA 3NMKA 2DO7A 4D4NA 2HUJA 5FFXA 3U3FA 3DKYA 2XSJC 1F9NA 5L0JA 2I15A 5H20A 1HW2A 1V55C 4LG3A 2EILH 4S04A 4UVAA 4LLLA 3BOQA 3Q0WA 1YI2I 4OMZA 3G73A 1XMAA 2V9KA 3F46A 4NC3A 2CQQA 1OFCX 2ME6A 4HF2A 2IOQA 2H94A 4A3GJ 5L0HA 3VSLA 4U5BE 3DCFA 3WTTC 1R4TA 1BW5A 1G3WA 2LG4A 2ZO4A 4EGYA 4YEJA 1HMDA 2ECCA 1TW3A 3MEXA 1QBJA 2VCAA 2ZXPA 4XOTA 3DEUA 5FKOA 3TULA 1V74B 1JTYA 4ZDOA 2EFPA 1LM3B 1FMWA 4LLEA 2W84A 3CMEI 5KK1A 5EG0A 1XSVA 3F9KA 4XLPF 5FFZA 1Z7UA 2WA0A 4KNYA 2KL4A 4OAZA 2OBPA 4KITB 4M3GA 4A69C 4CS8A 4XM3A 2HPIA 2KPMA 1VF9A 3UR3C 3PM1A 3GFMA 3KIOA 3BPXA 4U0VA 2KIQA 1KQ8A 1LS4A 4MO7A 2MSYA 5HDKA 3ZQCA 3AG1H 3S1QJ 4BXFA 3HOSA 1D8KA 1HSJA 2FEZA 2X9DA 2KFDA 2VT3A 1LPQA 3GM1A 3H1CA 1BJAA 3V4GA 2BXYA 1ENHA 4A5MA 5FLVA 1WZ2A 3D0SA 1A7DA 1U89A 3ITFA 4KBLA 1R9TJ 5B3IA 3J7AY 2WADA 4A3MJ 1MDMB 2QKLB 4O6JA 5FGMA 3BY6A 2E2JJ 4XN0A 4J7YA 1IZMA 2YL1A 3M1CB 5B3SC 1K7AA 1X1BA 4AYBN 3KP7A 4G8XA 2GAQA 4LK0F 1ZLJA 4FX4A 3BG3A 1W36D 3KLOA 5E3MA 3M3YJ 3K2AA 2R7QA 3VM6A 3LSHA 4RLFA 5L0CA 3LNRA 2JA8J 4IAOA 1VI0A 2QQAA 1MNEA 1F4KA 4IQ4A 2HOTA 3LAYA 2GXAA 4XR6A 2GIVA 2EFOA 4R1HA 3ZOBA 2DOFA 3N2ZB 4YT4A 1MH3A 5CVVA 1N1CA 4IOCF 4CZCA 2YS9A 1TFKB 3RKOF 4CS7A 3MBGA 2DA3A 1VQ5I 1B6AA 2NVUB 3L0IA 3GEEA 1RKWA 5EYRA 3BR5A 4AX2A 2F4MB 4J00A 5IT3A 3MAJA 2JRMA 3N0TA 3A01B 2K4BA 4AM3A 2W57A 1CPRA 2PP4A 3DE9A 4IHTA 1M1EB 3DEEA 4P55A 3COAC 3WE2A 1FTTA 4ZLDA 2VJ4A 2R7UA 5B1AC 2IYLD 2IA2A 4ZH4F 2VB6A 3AG3H 4XQFA 3S9OA 2G7HA 4G12A 3JYYA 3E7LA 2IW5A 4LB5A 2X6YA 4MFDA 4KIFA 2Q1ZB 2L9VA 1NFOA 3F8FA 2VKDA 5DV5A 5D92A 1F1ZA 2EPOA 2F5CA 4J30B 2DN0A 2D5VA 3IRQA 2A07F 5IYDJ 5AGFA 1A36A 3M1CA 5EK0A 2R7DA 3FDQA 1IDZA 2NPUA 1FYKA 3MYIA 2F5FA 1ZW2A 1QRYA 3DV8A 1W1WE 5C4JJ 1HW5A 4B09A 3J81Z 1ST6A 5GTIC 3MZ8A 3S8PA 1XSXA 4XTKA 1OQYA 4I7HA 5JI6A 1I1SA 2C04A 3KPHA 2VJ5A 2BY0A 4JX4A 2BGCA 2MLGA 2Y0SN 2ESNA 2BY3A 2IAIA 2JTVA 1T9KA 2EJRA 3E70C 3V5XA 2QSHX 1BA5A 2XLMA 1WJCA 5HOOA 3ZGKA 4L0YB 1R00A 3NYJA 2P6TA 2E2IJ 1U6HA 3H0GJ 3CC4I 1WVRA 2XAJA 1V5GA 3GX4X 3RCOA 1E3PA 1PDNC 3ABKH 1DQUA 1Z3XA 4PSXA 3A01A 2YL7A 3JSOA 1I4ZA 1DOVA 5FCLA 5L3QA 3B29A 4CJGA 1E3OC 1HXDA 3KZIC 3NQOA 3KKBA 4PJ0C 4CIPA 1K05A 5JHFA 1XMXA 1ORSC 2E36A 4DVZA 1QHHD 4CO8A 4CYDA 4LLNA 3DAFA 4CSAC 3KX2A 2O9LA 3ABUA 1VFCA 1ZR2A 3S3NA 2RSEB 5F5HA 2RVCA 3RVZA 1EH6A 2Q9BA 3BDDA 3Q7LA 5LD2C 4LLGF 3OSGA 2KSFA 4ABZA 3VRCA 4I0BA 5KAIC 2OQGA 5HS8A 1U0BB 2KIUA 1MJAA 3LOCA 1ZZPA 3TO9A 1CGOA 2Y3HA 2ZNYA 4XKBA 4E4HA 3BEHA 3NKEA 3CZ6A 3GANA 1TFOB 1UELB 3CJNA 5KHDA 3RQFA 3OWTA 3E9VA 3QVZA 3DBRB 4UUTA 5FD6A 4BJTA 4XLNF 2L9NA 3CCQI 3GWNA 2Y3GA 3LSKA 3M8FA 3F8CA 1B8IB 2OTJI 3UGOA 1R1TA 2A5WA 1BM9A 2JRTA 5A6JA 1ORYA 5AONA 4ESBA 3FOOA 3UNGC 3HRMA 1P92A 5J1YA 1G6NA 5BMZA 1R49A 3HOTA 4A3LJ 1KNYA 2NVQJ 2KISA 2ZJ2A 4HV5A 1IUFA 1QVXA 1ZHZA 4K1OA 4K2EA 1M56C 5KYXB 4Z2YA 3R0AA 4HFKB 3GTLJ 4LD5A 4HFFB 1S7AA 5TRDA 2PMHA 2MABA 2E60A 3TP0A 1JT0A 1VQKI 2CFOA 4RGXA 1MMAA 5JRAA 3BROA 5HVQC 1A04A 1J09A 2EPKX 4RA2A 4IPAA 3TOAA 4I09A 4A0XA 2P61A 1RC9A 2NOGA 4R8HA 2XHKA 2MFZA 2ASRA 2DPDA 3K6GA 4ULVA 2VKHA 2YSRA 3NMIA 3T6JA 5H6QA 2DJNA 2BW3B 2M0MA 3TQOA 4U5EE 4MTFA 1DGWY 1REPC 4RD9A 2P5KA 1K61A 3JAMK 2PNOA 4V2FA 3A1YA 4HF1A 1M2VA 2Y69H 4CUGA 3JRBA 2JWTA 2OF7A 1ZHXA 4Q47A 3RPQA 2FBHA 2YQYA 1TKNA 2CFXA 3GLLA 1SVLA 3H35A 2M9HA 3QYBA 5M5XJ 3IP4B 2X0CA 4EBBA 4CCJA 4GO1A 2UUIA 1O3RA 2DXIA 1B9MA 5B66C 2F48A 3IKTA 3WU1B 3PCVA 3HTUA 1UJ8A 2GDCA 2H7BA 2BY2A 2VOPA 3ISPA 4IF4A 3HL2A 1VLTA 2CGEA 3ZN1A 4KMFA 3SXYA 3ZMVA 1K40A 3ZR8X 3ZXSA 3ABLH 2IVMA 1R1UA 2P5VA 1JKPC 1Q0DA 1WN0A 3FK7A 4UV9A 4EJUA 2M4KA 2XROA 1Y39A 2QTVA 1ON2A 1UHWA 1XGMA 4I1MA 1RUOA 4R32A 3U8VA 2KIMA 1YZAA 4CCKA 1YW9A 3ROUA 2LFDA 2FUG2 3D5RC 3U21A 2ZXWC 2IGKA 3L09A 4BU2A 3CCEI 3GTGJ 2HJ3A 3JTGA 1W5TA 2LSOA 3M15A 4XORA 4LITA 3FHDA 3AQBA 5EJCA 1LEAA 5BUOA 1A7VA 4BEJA 2BW3A 3OMYA 3FM3A 4F3QA 3CCVI 4E7LA 3IH3A 5IT9Z 2HS5A 3WGGA 4PDKA 2V6EA 2OOCA 2QCOA 3L2VA 1DU6A 3KP3A 1S7EA 2P0WA 4O7GA 5FKLA 5CPRB 3NWSA 1G4DA 2JX0A 4FE7A 5JVEA 1P4XA 2VBXA 4EV0A 3IH4A 3CCRI 4Y52J 4XLAA 3QW1A 4PJJA 2PN6A 4I01A 1L3LA 1RXQA 2B0JA 1U9NA 2FMYA 2EIJC 4BXXJ 1FSEA 1FSHA 2DT5A 1DGRM 2M5WA 2M4GA 2IXOA 1FP1D 3BR6A 2BC5A 1BN5A 3CCMI 4OD5A 3H65A 4II2A 4CS8C 3W2VA 3LESA 4CDVA 1E85A 2DA1A 2XVCA 4IARA 3JSZA 2J5OA 4G78A 1TWCJ 3DWWA 4F7ZA 3QZCA 2L7KA 2BV6A 1EI7A 2DTZA 3EHMA 5C44J 2VONA 3O6XA 4YJWA 4I3MA 4WXHA 3HNJA 4UB6C 4BQQA 5F27A 3HJCA 1VB5A 5DCMA 2H8WA 3HKKA 3P7NA 3FBIB 3Q0VA 3ZQ7A 1A5JA 1EA3A 3T6GB 1W7PB 2AS5F 3MCZA 4B3AA 1ZQ3P 3OYAA 2XUBA 4G7HF 4OIOF 2W85A 2KHMA 3S32A 3OYDA 4AD9A 3JR9A 1OISA 4EVIA 3P9KA 4YL3A 4XPWA 2IBDA 3F47A 4E7IA 1QPMA 2JMWA 3RSNA 4RBOA 1XCBA 2E7WA 3W3CA 2WBMA 5B1BH 4O6YA 3R61A 1IC8A 1TWAJ 3G4ZA 2DYSH 5DUIA 2LP4A 3ZTZA 4LOCA 1YE9A 2A68F 3LS0A 2M2EA 3FKJA 1G59A 5J1UA 2HDCA 4HDVA 3HNIA 2NNNA 2RGVA 3AL0B 4XPYA 3L7WA 4M74A 1OPCA 2QQ8A 4G6TB 4DRIB 3BG5A 2VC9A 1USSA 1WOLA 256BA 4HA8A 2HNHA 3NYMA 3OR2C 4B47A 2VBWA 3MZYA 1MMSA 2AWCA 2Q2EA 3OS0A 4KA4A 1BDJB 2O0YA 2L4AA 2KIFA 4FE4A 2XAQA 2K27A 4E7KA 2ZFWA 4PCQA 1SD6A 2DFHA 5TISC 4KC9A 1B9NA 4J01A 1OCZH 4PK4A 5IOZA 1OCOH 2GZWA 3CCSI 1W7PA 4QLCU 3C3WA 3DMDA 2CNWD 1SFKA 4A5NA 2XSEA 2G0EA 4XMYA 5DS5A 2M3AA 1P2FA 4XSXF 2V1XA 3SQNA 5HV9A 4U87A 2FAPB 1Z77A 1ZU4A 1GT0C 2Z1DA 1UG0A 3H5RA 1GXPA 2RKHA 2QF7A 1R6RA 2JVGA 4A6EA 2ZB9A 1JR8A 1TLHB 1MMNA 1SD7A 2B9SA 3MX3A 4JRZA 1WSUA 3FDYA 1F1MA 1SAUA 4MVOA 1FWZA 4IEJA 2VJJA 1ZG3A 2G7UA 4JYKA 4RDUA 4FCYA 3QQAA 2XLEA 3IAS2 2GAUA 2DU9A 2LY9A 4P9FA 1SANA 2HI3A 1IN6A 1G8XA 2RNJA 3HGGA 2VC0A 3HUGB 3N05A 5LGTA 3BPVA 2IGNA 4EM0B 1L7CA 5ILVA 1YITI 2GIZA 3DTIA 4L9JA 2EA2A 4AUXA 2HU9A 5GP9A 3M1EA 2E19A 1TNSA 3TP3A 1D0XA 4DYQA 4CS9A 1ZARA 5ILUA 2Z2SB 3ZQVA 1XGNA 3QU3A 2Q9AA 4BG0A 1I4YA 2KYHA 2E35A 5EHHA 2FXAA 2LRDA 2KT0A 2YPRA 1ZHWA 3L8JA 3KP6A 3KYCB 2EH3A 2HKXA 3L8IA 5A6KA 4AE4B 3MYFA 2E1NA 1A7EA 4DYRA 5H2FC 2IJLA 1IZ1A 1V54H 4OINF 1OKKA 3IPMO 4L9TA 3H5NA 4XLCA 1CGNA 2YKZA 1BIAA 3K4NA 2EINC 1MIJA 2ADUA 3A4CA 4UNOA 2LSEA 3SXZA 4B48A 5LRRA 2KDOA 1ERDA 4A3FJ 1E84A 1FY7A 5AC5A 1SVMA 2QEXI 3NAUA 4LIVA 2IS4A 4M3BA 3ERED 1NZEA 4XWJA 2ZXRA 1J8YF 2A0BA 1LJ9A 4G6QA 2NG1A 4KUMA 2R7SA 2XRNA 1K6YA 1A31A 1ZGJA 1YX3A 4C2UA 5K7ZA 1HKSA 3AQCA 3ZCOA 1WQ2A 1RNLA 5KVRA 2BEOA 2CUJA 4C3HJ 2IRFG 5CKTA 4XLHA 1FYMA 4L18B 5HLTA 5J4VA 2CW0F 4LDKA 5F0FA 4Z9IA 4CICA 1FOXA 1SVOA 1P7IA 3SNHA 3RYRA 5L3BA 2DI3A 1R5HA 3IWFA 2J5PA 3AG2C 1JHHA 2QWWA 1JTXA 2VQGA 3ESWB 3E3VA 2BVLA 2D1VA 2LF8A 3FIWA 5A2QK 3RQGA 4BPMA 4AE4A 2NVYJ 1DP3A 3IL2A 1YTYA 2DAOA 3K4BA 1VK5A 2BE5F 2ZCWA 3KEYA 5J8FA 3F6OA 4PUSA 3Q6NA 1TNTA 2W45A 1WJEA 1PYVA 1N77A 4XKCA 2IXNA 2LCHA 2Z99A 2HSQA 3GCMA 1FOYA 3I4UA 1I6HJ 2R7WA 1OCRH 5E8IA 4BACA 3OEOA 1ZR4A 3DPLC 3EPZA 5AIQA 3J80K 1H88C 1OLTA 2QQBA 4C9YA 3HRUA 1IRZA 3VFZA 2HDDA 2Q7RA 5D8LB 3VYRB 1XDUA 2VPRA 4ESFA 3AKZA 4AIKA 4MEXF 1PD1A 3GEHA 3VF0A 4X1EA 4HRIA 2XM4A 4CYCA 3W8IA 5J3LA 1RZ4A 5EZGA 4BUPA 1IV6A 1ETKA 3HHHA 3OIPA 2R7RA 4E7ZA 1L0OC 2D1HA 1JJ8C 3I4NJ 2PBEA 2KDZA 2R9RB 3JT1A 4MTDA 1E86A 1NTCA 5JFRA 3B02A 2X1EA 1I6XA 3NWTA 2L7ZA 3FISA 2DMNA 1Z1DA 4OIRF 3LUTB 4A3DJ 4Q5SF 1UB9A 2DYRC 3M7GA 2VC1A 4M3FA 1BBYA 3W2AA 4BHBA 2EIKC 4OWRB 2O5RA 1KA8A 2JA5J 1N25A 2EIMC 3U8PA 3K4CA 1ON1A 2D2WA 2L9RA 1X2MA 3WGIA 2HVRA 3GZNB 5J40A 4Z9HA 1LVKA 1T6IA 2H09A 4EJVA 4UUSB 4II3A 3OY9A 3MZHA 4HOBA 2H1KA 1XGSA 2M8EA 3CC7I 5L3EA 4GYGA 4JBAA 4GYTA 2MC4A 2PEXA 2K86A 5K7HA 3T5XA 4JJFA 1R23A 2VOOA 5TJ5E 2EPLX 2XPUA 2XV4S 1S29A 1MGTA 3B9QA 4ZJZA 3QPHA 1LQ1A 3CF5F 2Q00A 1VOMA 4BJ1A 5KYNA 4CCMA 2A69F 3ELKA 1QKRA 1JE8A 3H92A 1MMGA 3GMEA 1P6RA 2OCEA 3QPTA 2GA0A 4RB3C 5DLJA 3H5AA 1IF1A 3QODA 4G7OF 3AJMA 2F5VA 4AU7A 3G6EI 2OA4A 1DDNA 4A93J 3HRSA 1YAUO 1X4PA 5DCFA 3S16J 2Y0MA 2BHYA 1X1DA 4DRJB 3LWFA 4YN0B 3JAMZ 2R4GA 2JQ7A 1ITYA 4B1RA 3BC8A 3O8HA 1B59A 3K66A 4IRUA 3S27A 1RPWA 3WTXC 4CSWA 1EKEA 2KKOA 1ZK8A 3PSIA 4W1UA 3AGTA 2AQEA 3PL8A 4P1WA 3F23A 4IOAF 1V4AA 4PGHA 2DCEA 2ISYA 2QGUA 1ETOA 4GCVA 1D1CA 1Y56A 4BY1J 2XDVA 3HPGA 2FX0A 4HLYA 4FX0A 3E5UA 2WAFA 3VEPA 1ZLKA 4UUSA 1ULYA 5JLWA 2XGEA 3TOBA 3EGDB 2HMZA 3TDUC 2CW8A 4XRSA 3NG1A 1ZKGA 2W82A 3GEZA 3WU0A 4M6VA 1J5YA 2VLAA 3B6CA 3BQYA 2ZXHA 4M6XA 2F4OB 4AIDA 2G3VA 1P4AA 1PD0A 5K5RA 4BHPA 3JSPA 5J4YA 4UXNA 2R92J 5DS6A 2FU4A 1ZYRF 1YVIA 1FTSA 5LHGA 2DFEA 1P7JA 1XGOA 2NUTA 3PQKA 2XF6A 3SZTA 1W5CC 2CUZA 3A0HC 4DBRA 3M4CA 4I76A 4DNCA 1X2NA 4F93B 4D1QA 5C4XJ 2XLVA 4H54A 3KCCA 1EF4A 2LNBA 4XEVA 4CDYA 3K1NA 1L3PA 4A0YA 1MKMA 1AA7A 3E5QA 4OOIA 4MQVA 1BC7C 1VTMP 3BTLA 3LA2A 2XXAB 3M4OJ 2YVKA 2HXIA 4QWQA 5DEQA 3L2WA 1KTMA 2XS1A 3KYLA 3PMRA 2E1CA 1V5FA 4DBQA 1X3UA 4EQQA 3P9IA 5F0HA 1TWFJ 4TV7A 3NRVA 3LA3A 2DPUA 3S14J 4BQAA 4RM2A 4H0EA 5L3VA 1HDDC 1U8RA 2QBYB 4M63A 2W9YA 2M34A 4YFXF 1YS7A 2GA2A 2OU6A 1T08B 2COBA 2Z15A 3CJRB 4ENJA 2JJ7A 4MTOA 2M30A 4OMYA 3HXLA 2M1BA 4YIRX 1GVDA 1JJ6C 1RJ9A 6PAXA 3QW0A 3T0YA 3A0BC 4O6MA 3EGDA 2R3SA 4MW3A 2GWWA 4D7NA 2BYVE 1IGNA 3A03A 3G4XA 3Q9SA 2LD6A 1ETWA 2I8BA 4X6AJ 3PHF2 3AG4C 2WB1A 1RRJA 4C3JJ 2DTRA 2YRFA 4JURI 2LFBA 2WL8A 3P5JA 4P96A 4GFBA 3H2UA 3HOYJ 1Z7Qc 5A6BA 3NARA 3KYIA 1I3QJ 1Z05A 3HKZN 3E1SA 4QPOA 2HOAA 1PUFB 1FOKA 2O9XA 4HZFA 1YHQI 3AL0C 5LLQA 1GV5A 1KU2A 5L0IA 2DMQA 4ETSA 5L3CA 1F5TA 1ZRDA 3RFYA 3X1OA 3FXQA 4MLOA 3ZQQA 2XXAA 2V3CC 5BQTA 1BI3A 3Q6MA 2KZGA 2LOOA 3S3MA 3CCJI 3FXMA 4DJ9A 3I0TA 2E1MB 4CJOA 5LGUA 3W4YA 4CS9C 4WGYA 2EV0A 2QBYA 2Y9YA 1R71A 2J9WA 2LTPA 2XKPA 1TL8A 1IRFA 4CCLA 4MVMA 2VJIA 2DMTA 1G3TA 3JYHA 4HG2A 2QA4I 3SZRA 3N4MA 3DI5A 1QHGA 3Q7GA 4A2UA 3BJAA 1FNNA 2BY1A 5E3CA 2UV1A 4M6YA 3CQZA 3RKXA 3GTQJ 2V9VA 4KN4X 3V8LA 2MHRA 3JRGA 3SDBA 1SD4A 1UFMA 1E0EA 5L0GA 3CUOA 3DFGA 3MMYB 5KAFC 1I27A 1YO5C 1P4WA 2CUEA 2ETHA 2N8GA 4UUVA 1LKXA 2BVMA 3OYIA 5F08A 2V4JC 4PFOA 2ELJA 2DOAA 4LDQA 5K5QA 2E34A 1V4RA 3ZMDA 1PUFA 3SEQA 4BL0B 3JRCA 4N0BA 4Y17A 4D5FA 4YG2F 4MTGA 4LACB 2VCCA 5FKKA 2RAEA 3TBIA 3EDPA 3ECSA 4IVNA 4A6DA 4HDUA 2EZKA 1KZHA 1LS1A 2FD5A 4BNCA 2VXZA 3K33A 2KW3C 5EGYA 1JKOC 4HQEA 1ZGWA 1HCRA 4AVZA 3TJ6A 2QY9A 5E18F 1WJAA 1GQAA 3SZGA 5LGNA 1I5NA 1KU3A 1NSGB 3L2QA 1LE4A 4P6IC 1WWXA 5DYMA 3HHGA 1SF8A 2JPUA 2VL8A 3I59B 3ASNH 2E87A 3H3UA 2X6OA 4KNVA 2K9QA 1YLFA 2ZSHB 3WG7C 2OZUA 4XONA 4YT2A 2VE9A 3B71A 1NLXA 3FMSA 3TQNA 2F2EA 4LGWA 3VOEA 3F8BA 2W7NA 3WE3A 1RUNA 1ZHTA 3I5PA 3QVYA 1VMAA 1Q1VA 2IBFA 3IKVA 4PZJA 1Z6AA 3ZQFA 3OYKA 2L01A 5M3FJ 2IGOA 4LDRA 4ZLCA 3ZTMA 1YYXA 3BCBA 2O8KA 2WZLA 3HG9A 5FO5A 1B72A 3AG3C 4W8KA 2H8AA 1DP7P 5GPAA 1H9GA 4BKXA 2STWA 4L5IA 2I5UA 3GFLA 2EZLA 2ZMEB 3LEOA 3OA1A 2P5LC 4NB5A 1QLEC 4UVBA 1VQNI 4BAYA 2PFDA 2VQCA 2OV7A 3V5ZA 4FTHA 2XGDA 1W7PD 4W97A 2Q3TA 3TKYA 4PGGA 5ICGA 4HLXA 3JRDA 1JGSA 4BQOA 3LS1A 2AVKA 4V19K 4ONSA 1R36A 3BG9A 3ZQGA 4RAZA 2VIXA 1YZCA 3R6SA 1DOWA 3LL7A 3HOVJ 1S8NA 1M2VB 1VLSA 1I39A 2Q9CA 4EBKA 3I59A 4DRHB 1WH7A 1D5YA 2KMUA 5LBQA 5HODA 1M57C 4GDFA 3ZQLA 2WVQA 1J75A 2KRHA 4M72A 3EPVA 2L81A 4XLEA 1SFUA 4MNDA 3G50A 4MTEA 2DBBA 3QP6A 3A11A 4EJTA 2HWVA 2JPCA 1UHSA 2ZJQF 2BXZA 3KP5A 2VCBA 2J7PA 5E1XA 3IUOA 3H2VA 1M2OA 1J7KA 1FBUA 1WGXA 3LMMA 3EUHC 1J9IA 3G1OA 2HYFA 2HYGD 3GTKJ 3MFNA 4PJNA 1Z23A 2PF4E 4K0DA 3FBNB 4JKVA 5L0DA 2HSBA 2ZNZA 2Z3YA 2KJBA 3BG6A 1I1GA 3J06A 1A6IA 3KP4A 3HIFA 1OQCA 2ZMEA 3C7JA 1D8JA 4E7HA 1EH8A 1GUUA 3U3BA 3I9V2 2XPWA 3KEQA 4IRIA 2O8XA 2A0UA 1MBKA 4IAQA 1C02A 4JZAA 2ACJA 2EFNA 4ENNA 2CO5A 2E5NA 5A2QZ 4NC8A 5E3AA 1PCXA 5DQZA 1XMKA 2FQ3A 3L2CA 3EGXA 2RN7A 1WWPA 2ZKZA 2CUFA 1OKKD 2A05A 3MN2A 1YARO 3GORA 2XL8A 1UG7A 3BR2A 1VQMI 5FD5A 2PBIA 1FC3A 4JTAB 1LDDA 1LNWA 3GUDA 4C7OA 1BI2A 4YFNF 3J80Z 2EB7A 3CDIA 4I2OA 3NEUA 4KIBA 2VODA 1RESA 1GLNA 1OW6A 4XOPA 4HSTA 3EFOA 5EF6A 2IXPA 3HRTA 3A02A 3DTKA 3QRFF 2NSFA 1FOWA 5EGOB 3HNKA 3NMJA 4DW6A 1A0BA 3FHNA 5BS6A 5ICEA 3GXOA 3JRFA 2PJPA 3HOZJ 1F43A 5K0IA 4DQ2A 2HPMA 1MJ9A 2HOSA 1Z6RA 4LLCA 2KC3A 4MW8A 4NTBA 3M79A 2C6YA 3EUAA 4BJ6A 3RKYA 2H7OA 2CV1A 4ENKA 3R0JA 3F3XA 5J6XA 2XLWA 4ON0A 3LSTA 1WCMJ 3M4BA 3R7CA 1S05A 5FLXK 3ZSUA 1JT6A 2D5RB 2EBIA 4C3EA 1CF7B 3ZWIA 2K5CA 5DCMB 2PG4A 3TW6A 1LI7A 2L6HA 1T39A 5HDNA 4E7SA 3PQJA 1XG1A 2DT6A 3CCYA 3LSGA 3I4PA 1J59A 2DA5A 1VQ7I 2CV0A 3S1NJ 2YX4A 5DM6F 1S72I 3EZHA 4MIMA 4YIFA 2ECBA 2HJMA 2RV8A 5D91A 2YEVA 1VZ0A 2STTA 5D5XB 4R79A 2Y69C 3Q0UA 5K7FA 1NBBA 2ZPAA 4M9XA 4PR9A 4WWCA 2WB7A 4Y33A 3L00A 3BR3A 3GLXA 3O2PE 2DA2A 4EBJA 2FRHA 3FXRA 1Y0NA 2ZC2A 3O3KA 1Q0GA 4ENMA 1VQ6I 5EGOA 1HLVA 1VQPI 1R1VA 4D5CA 2FBKA 4H4KC 3FVYA 4PSWA 1JGGA 2EPFA 3OOPA 3TDZC 3ABLC 3VB2A 3QYFA
chains in the Genus database with same CATH topology
2OJED 3KPHA 2ICWG 1R5ID
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OJE D;  3KPH A;  2ICW G;  1R5I D; 
#chains in the Genus database with same CATH topology
 1X3Z B;  3KET A;  1FAP B;  2G9W A;  5KCM A;  2WAE A;  2VUM J;  4BJ5 A;  4DZP A;  5HS9 A;  2H6B A;  4HAM A;  2NS7 A;  2LRE A;  1I5Z A;  3F22 A;  2GA1 A;  3OSF A;  1WGW A;  2R7Z J;  3QU6 A;  1IXC A;  4XEF A;  1GVJ A;  4QI2 A;  5E3N A;  3I53 A;  3ZQH A;  1NG1 A;  2YLG A;  2JPB A;  4IWB A;  2UZK A;  3FKI J;  1S3J A;  2Q2E B;  3E0J B;  2Q4F A;  2NS0 A;  2D45 A;  4IX7 A;  1CF7 A;  4L9V A;  5IP6 A;  1OR7 A;  1TQI A;  2Z5U A;  4KJZ A;  1LEB A;  2Q8K A;  3BTC A;  3LQR A;  3RVY A;  4X0G A;  3DQV C;  3DU6 A;  2J9B A;  2JZY A;  3KMI A;  5BQH A;  3CLO A;  5EZH A;  4O79 A;  3ABM H;  2E2H J;  4XIC A;  4CHU A;  3BZK A;  4A3C J;  4I98 B;  3KP2 A;  1IN4 A;  1X3W B;  1W4M A;  1AEP A;  4WGZ A;  2O3F A;  4Y3O A;  4FAP B;  4A3E J;  1WRJ A;  2P81 A;  1FJL A;  1TT5 B;  3X2Q H;  5LEK A;  2P6S A;  3BR1 A;  2HZD A;  2L3D A;  1NU9 C;  3O8G A;  4E18 A;  4QTR A;  5L3F A;  2AXT C;  3OYN A;  1SFE A;  1ZVZ A;  5IY5 H;  3CMA I;  1OR2 A;  2MWQ A;  4PFP A;  3DBL B;  2A3S A;  2QEN A;  3BTJ A;  4FET A;  2IXS A;  3RDI A;  3V8J A;  2FGY A;  4HBL A;  3H3V K;  3ZMU A;  2P1A A;  4WXC A;  3T9O A;  3DKA A;  4MEY F;  2WWY A;  2L6F A;  1BL0 A;  3SEO A;  2YWA A;  2B63 J;  1X1C A;  1A41 A;  2LK4 A;  5L0F A;  2V6C A;  1YDI A;  5F1J A;  5CVI A;  5HLI A;  4E7J A;  1V3F A;  2E1O A;  1SMT A;  4ZYE A;  2KK1 A;  2FBI A;  3JTL O;  3KFW X;  3S0X A;  5IYB J;  1C17 M;  4DOZ A;  3I58 A;  4DGW B;  1Y1W J;  2CJJ A;  2HYJ A;  2PMZ A;  4ASN A;  4WX9 A;  2HKO A;  2DOE A;  1KQ9 A;  3ABT A;  4PJL A;  1OKR A;  2A6T A;  3RF3 A;  1RR8 C;  2YL3 A;  2LY2 A;  2W00 A;  4IL6 C;  3CLQ A;  1E3H A;  3NYL A;  2MGQ A;  5E2Q A;  1TBX A;  2PI0 A;  2JD3 A;  5T1D B;  2E1M C;  4AVP A;  1U8B A;  1R5G A;  2YLI A;  1GS9 A;  3ZN0 A;  2WAQ A;  1AVO B;  1JMW A;  1ONV A;  2NYX A;  1T56 A;  1Z6T A;  3FHZ A;  2W48 A;  3G3Z A;  3T1B A;  3HEF A;  3HSF A;  1OR3 A;  2HKV A;  3REO A;  2K4J A;  1N75 A;  4XKW A;  5H6R A;  4QDL A;  2DYS C;  3I4M J;  5ERI A;  1MSE C;  3L2R A;  4A4A A;  2KZV A;  3HGY A;  2P4W A;  2GOM A;  4NC7 A;  5CI9 A;  4RS8 A;  4C30 A;  4BE2 A;  2OKU A;  4YFK F;  4AWX B;  4A0Z A;  5M5W J;  3POV A;  4OAY A;  5E33 A;  1YFH A;  4BY7 J;  3OYC A;  4RGR A;  4JEB A;  2RQP A;  2E7X A;  3K4J A;  3JRA A;  3KH2 A;  3O10 A;  3B0U X;  3EG9 B;  2YR2 A;  3QPS A;  1FP2 A;  3GZ5 A;  5LFA A;  1Z0X A;  3C62 A;  2XL4 A;  3IEE A;  2ZSI B;  3IC7 A;  3LEV A;  4O5V A;  1ZG1 A;  1J0R A;  3WGH A;  4BEH A;  2HR3 A;  3VYS B;  1WJB A;  4C2M J;  4CCN A;  3K9T A;  4BQN A;  1YRN A;  1M6T A;  1YJ9 I;  5K1Y A;  5BPD A;  3H9Q A;  4ZDL A;  2Y30 A;  3PSF A;  3S93 A;  1FEX A;  1CGM E;  1OCZ C;  1SFO J;  1OCO C;  1HMO A;  1ORK A;  2EFW A;  2EQR A;  2KGO A;  1G4W R;  3JCU C;  3SXM A;  3SJM A;  3GWZ A;  4EAT A;  1JOG A;  1LIH A;  1SYQ A;  2NNY A;  2CQK A;  1JKQ C;  3U2L A;  2FFH A;  2WZG A;  1RI7 A;  4ZYH A;  4NNJ A;  1BR4 A;  2LR8 A;  1ZH5 A;  5TGT A;  5GAG J;  2OJQ A;  1OMI A;  3SYN A;  3GBG A;  3HB9 A;  1IG7 A;  3QOE A;  4JTD B;  1FIP A;  2CG4 A;  2IT0 A;  5A69 A;  4N06 A;  5A6B D;  4IJA A;  1VQ8 I;  1O57 A;  4B4C A;  1K78 A;  3IQ5 A;  2QYO A;  3S17 J;  1JUS A;  1FLI A;  3S2W A;  2GWR A;  3H9G A;  4CYC B;  3GTJ J;  2GLO A;  2F6C A;  4KIS A;  3ZIB A;  4I1O B;  3HJE A;  5GPC A;  1CGP A;  2LY1 A;  2ELK A;  1G3S A;  2ESH A;  3RIP A;  4B44 A;  2HXO A;  4HQM A;  1R4M B;  3S15 J;  2VPL A;  4AL1 A;  3B0V C;  1ZHF A;  2A5Y B;  1XDS A;  1APC A;  1EH7 A;  2XGX A;  3K10 A;  4N9H A;  3VSK A;  3EG9 A;  1LFU P;  3US6 A;  1TQM A;  1KON A;  2JT1 A;  4CIH A;  5D6F A;  4KFC A;  4KT6 A;  3BRJ A;  2MLK A;  2EPM X;  5F1R A;  4E6K G;  3VDX A;  3O6B B;  3TO6 A;  1HKQ A;  3FXU A;  1BBH A;  1WAS A;  5DVW A;  2HFI A;  2NRA C;  1R5I D;  3JRI A;  1FNT c;  3O55 A;  1Q0K A;  5J1R A;  1QZZ A;  3SXK A;  3GF2 A;  2L5Q A;  4MHG A;  2E71 A;  1V54 C;  2TRT A;  2EK5 A;  3A2K A;  3TL4 X;  3PJR A;  4Z9J A;  3I3L A;  3DE8 A;  1Z3Y A;  3OV8 A;  2CCY A;  3F8N A;  1JXS A;  3EYI A;  3DM5 A;  2F4I A;  3DEW A;  2AU5 A;  1FBQ A;  1O5H A;  3O39 A;  4U5F E;  2YZS A;  1JKR C;  2M87 A;  2DK8 A;  2MG4 A;  4FHT A;  1D0Y A;  1TWG J;  2IP2 A;  2NOJ B;  5FKN A;  4LER A;  2DOD A;  3DKW A;  2NAZ A;  3DZA A;  1BOB A;  4X0R A;  3M8E A;  2VQL A;  3PIP F;  3TOM A;  3DBH B;  3U9G A;  5F28 E;  4RMN A;  1NG7 A;  4L6R A;  2CV2 A;  5T3W A;  5CLS A;  2XM0 A;  1OCC C;  2X4H A;  4G9Y A;  2G62 A;  3HTS B;  1T38 A;  2PFB A;  1HW1 A;  1O4X A;  2IXM A;  4XBF A;  1ACI A;  4RDA A;  2CW7 A;  2V26 A;  1EA8 A;  2DDB A;  3U1K A;  3OYE A;  1YX5 A;  3LNQ A;  3GYH X;  4BEM J;  1TW2 A;  2KRF A;  2CS3 A;  2VH3 A;  1BR2 A;  5E8G A;  1EV7 A;  2VKE A;  1PV3 A;  5JHU A;  4BGD A;  5E79 C;  3K70 C;  1DPR A;  2Y75 A;  2PMU A;  2JK3 A;  1IRX A;  5L3D A;  1TWC A;  3EET A;  2EV6 A;  1Y8Q B;  2R05 A;  3CAX A;  2OCC H;  4RM3 A;  2GXG A;  4G94 A;  4JX5 A;  1YS6 A;  4F92 B;  5IOY A;  3OYB A;  4AYB A;  4NQF A;  4IRH A;  2GXB A;  3W6K B;  4IGG A;  4IHS A;  1YIJ I;  5DS4 A;  1D0Z A;  1OXK A;  3QWL A;  1MBF A;  1IW7 F;  4N6H A;  1G2H A;  1S7Z A;  4MNU A;  1RCP A;  2Y3B A;  1U5T B;  2LKS A;  3GOD A;  3HOX J;  1O3T A;  1A35 A;  1K04 A;  3CO6 C;  3SFI A;  3BP8 A;  3RQI A;  1MQV A;  1OCT C;  4F55 A;  5JVT A;  3D1N I;  3SP1 A;  3FZV A;  2R5Z B;  2QLA A;  1XB4 A;  3ECH A;  3HSE A;  2ZJR F;  4PAC A;  5F5F A;  2DLL A;  4N4N B;  3ASO H;  2V9P A;  4U5D E;  4YL0 A;  1JUP A;  1K83 J;  2HOE A;  3V42 A;  5GAE J;  1QZX A;  1IV8 A;  1XPX A;  2LQG A;  2YHS A;  2L9S A;  1S6L A;  1XTA A;  1FX7 A;  4J7T A;  2COM A;  2NVX J;  2NUT B;  2O6G E;  5HDG A;  1GV2 A;  3WTW C;  1MBE A;  3LNM B;  2RRE A;  4Q4Z F;  1YJG A;  4HEA 2;  2WV0 A;  1W0T A;  3N97 A;  1TWA A;  5F04 A;  2XL6 A;  2PQ8 A;  1O7L A;  2JVH A;  2XRL A;  5ED4 A;  4ULW A;  1JPN A;  3DM9 B;  1RMV A;  1HC8 A;  3KE2 A;  2KJC A;  4RBN A;  4BJ5 C;  4LJZ F;  1SAX A;  1JPJ A;  3OIQ A;  2VI6 A;  5FZT A;  5KYU A;  3FM5 A;  4B6I A;  1YOV B;  2R25 A;  1H7I A;  2DDA A;  1HKT A;  3IHU A;  3AGU A;  2AWY A;  5COM A;  2ZXJ A;  2MYS A;  1V55 H;  2DFF A;  1SD5 A;  2OUM A;  2WVO A;  4CH7 A;  2K3F A;  4D4X A;  1OR7 C;  2WY8 Q;  3OYM A;  4MVQ A;  2FA5 A;  2CU7 A;  3OS2 A;  4HX7 A;  3JW4 A;  4AL0 A;  1AKH B;  2VXD A;  3F0C A;  1RJ9 B;  2GQQ A;  5J47 A;  3IQ6 A;  3L34 A;  1E2X A;  1U5T A;  4P9T A;  1XS9 A;  4NCQ A;  2Y0S A;  4GXO A;  1WPK A;  4V2G A;  3TMO A;  4DZJ A;  3EH1 A;  4JIO A;  1PUE E;  1FTZ A;  4JJG A;  3MKY B;  1D1B A;  2VAS A;  1KU9 A;  2H1L A;  2R5Z A;  2J7P D;  4E0I A;  2NUP B;  5LHI A;  3H9J A;  4XLF A;  2L2O A;  2VQH A;  4DXW A;  2Z16 A;  3L9F A;  3GEI A;  4YWQ A;  3WU2 C;  5CIV A;  4B3X A;  1T8I A;  4KDP A;  1T0F A;  1U78 A;  1MNM C;  3HNL A;  1O3S A;  3L1M A;  1XD7 A;  5ILS A;  4MVR A;  5FLX Z;  2YU3 A;  3S90 A;  4QIW N;  2WTE A;  1VQL I;  2DQL A;  3ZRG A;  3ZG1 A;  3KYD B;  1LDK B;  3AG4 H;  2MH2 A;  1W0U A;  5HLH A;  3Q3S A;  1P9Q C;  1SC7 A;  5D5V B;  2DJI A;  4W8P A;  4A3K J;  3TOL A;  2GFH A;  5COG A;  4M9Z A;  1IXR C;  3PDM P;  1O7F A;  3RZO J;  1HY5 A;  2AHQ A;  1ZU5 A;  4ESJ A;  3GFJ A;  5FJ8 J;  2R5Y B;  1LB2 A;  3OL4 A;  1CPQ A;  2CQ7 A;  2J45 A;  3LJB A;  3S3O A;  1AKH A;  2LFF A;  5B3S H;  4EWC A;  5BNG A;  2LD5 A;  3RKW A;  3LSM A;  5F0C A;  2BL2 A;  1E83 A;  4J19 A;  1RKE B;  4LK1 F;  3S29 A;  3FXO A;  4EJW A;  3UGP A;  4XRS G;  4OIP F;  5EEA A;  2ID6 A;  2BHZ A;  3JRH A;  3LA7 A;  5KNL A;  2NUP A;  1R22 A;  4ZC3 A;  5BQG A;  2VE8 A;  2CSO A;  1C03 A;  3DTE A;  3K1I A;  2CH0 A;  1YIO A;  5DD8 A;  4Y13 A;  4O3M A;  4NTF A;  4EJO A;  2K9M A;  2HTS A;  3E6B A;  4LMY A;  2DW4 A;  4G6D A;  3K1M A;  4UV8 A;  3UMK A;  3K70 D;  2H6C A;  3PFY A;  4NDL A;  1XWJ A;  2QE9 A;  3PFI A;  3J7Y J;  1BI1 A;  4KT5 C;  3H0D A;  2H7V C;  4O6N A;  3BQZ A;  3EJN A;  2EIL C;  1IAW A;  3S84 A;  5FRN A;  3WAQ A;  2ETS A;  3CEX A;  3ZMS A;  2WY7 Q;  5B1A H;  4CBE A;  4Q48 A;  4U5G A;  4JP0 A;  2JA2 A;  5EEH A;  3FAJ A;  2LBF B;  3C1D A;  1QPU A;  5DUK A;  3Q5F A;  3LLK A;  2V7F A;  1LPE A;  3BT9 A;  1XX5 A;  1QU3 A;  2YUS A;  5JUA A;  2FML A;  3E6M A;  2RDP A;  2P8T A;  1Y0U A;  3FF5 A;  2R5Y A;  1T2K A;  4IB4 A;  3LSJ A;  1U2W A;  3FOP A;  2ICW G;  4YT8 A;  3RQ4 A;  1PJR A;  2X6W A;  2EZI A;  4HV6 A;  2NVT J;  3EHN A;  1FPQ A;  3NRH A;  2QKM B;  1RKE A;  1SZI A;  1OYY A;  2ME0 A;  3FXJ A;  4DJA A;  1MBG A;  2IS2 A;  3ATP A;  3C2G A;  4IXA A;  1CQT A;  3MD2 A;  1TZL A;  1Q0M A;  1ZTR A;  3I5U A;  1O87 A;  2LLK A;  3IQT A;  1QGP A;  4N6C A;  2KP6 A;  3RYL A;  2IPQ X;  3OL3 A;  3CJT B;  3FAP B;  2UWM A;  1FYL A;  3AFH A;  3SEZ A;  3AG1 C;  4FX5 A;  3CTA A;  5EEG A;  2HDW A;  1MBH A;  3NDB B;  1B72 B;  3FK6 A;  3HSR A;  3WG7 H;  1YYJ A;  1TT0 A;  2LVS A;  2KJG A;  1OYW A;  2CWE A;  2MD0 A;  5CVJ A;  2UXX A;  5CQE A;  4FAS D;  2P7C B;  4RAY A;  3VYT B;  2XRH A;  3RPU A;  3KL4 A;  3SDG A;  3ULQ B;  4EGZ A;  2QQ9 A;  2WV1 A;  4IKF A;  4UVC A;  1ETX A;  1IRG A;  4ER9 A;  3S1R J;  3T8T A;  4AIJ A;  1KQ0 A;  4DIQ A;  3MKL A;  3LFU A;  2ZBK A;  3RIR A;  2ISZ A;  1HE1 A;  1TWG A;  4MVZ A;  3U2M A;  3L1P A;  1T01 A;  2PX0 A;  4IZZ A;  3U5S A;  2LBF A;  3SFZ A;  1FZP B;  2VT2 A;  3TO7 A;  4CZZ A;  5DD4 A;  5K5O A;  3HTK C;  3DXJ F;  1T5O A;  2OEV A;  5IYC J;  4QSH A;  3B6A A;  2KQ9 A;  2CRG A;  2MD5 A;  3K6B A;  4S05 A;  1Z5Z A;  2VBZ A;  4E17 A;  5JS5 A;  1F36 A;  3CMY A;  1HE9 A;  4E0H A;  2XB0 X;  5M5Y J;  3R60 A;  1WJ5 A;  2HMQ A;  2B7E A;  2K9L A;  4YEL A;  4E70 A;  4RGU A;  1MDM A;  1Q1H A;  3S2D J;  1HF0 A;  1TQG A;  2BZT A;  2LH9 A;  4FIS A;  3DLA A;  3ZMT A;  1YJW I;  1YQA A;  1HA8 A;  3CDL A;  3JRM O;  2DK5 A;  1EKY A;  3QMK A;  2O7O A;  2XSD C;  5AC4 A;  2YL0 A;  2UUH A;  1H9T A;  2M7B A;  4IHY A;  1TWH J;  5DTD A;  3DLL F;  1OW8 A;  3JCU Q;  2M7A A;  4Q7C A;  4NC6 A;  3B0P A;  2R02 A;  4N4W A;  4RB0 A;  2L54 A;  5ICC A;  2QSF X;  3V7O A;  2F5E A;  4NUB A;  3GM2 A;  4WF2 A;  2VBY A;  4N9I A;  2K02 A;  5CYV A;  1FBS A;  3EYY A;  5BPI A;  3W6V A;  3PO2 J;  2KNH A;  2M64 A;  1LVA A;  3PNV A;  2FOK A;  3I64 A;  2IM8 A;  2K3P A;  1OCP A;  3FMQ A;  3DJN B;  1IN8 A;  3ZC4 A;  2HTJ A;  2E5Z A;  1O3U A;  2J8W A;  2DMP A;  1NHA A;  4QPQ A;  4U7B A;  1T6S A;  3U9J A;  3CMM A;  5J8C A;  3CF2 A;  3FWE A;  2I10 A;  5E3L A;  1B68 A;  3EGX B;  2W25 A;  4LB6 B;  3KEO A;  4XKV A;  1LE2 A;  1RET A;  1D1A A;  4KYW A;  5BOX A;  1OJL A;  2A6E F;  1ZGA A;  2L4M A;  1OYI A;  4YRV A;  5DQT A;  1WJD A;  3BLY A;  1WFX A;  3K2Z A;  2C03 A;  3H36 A;  1IN7 A;  4C7O B;  1NK3 P;  4EHP A;  3DKX A;  4XID A;  2O61 A;  5D5W B;  3ASN C;  4MVU A;  3FXL A;  3EFO B;  2VN2 A;  1YA7 O;  1QQI A;  3C2H A;  1Y8R B;  1KYW A;  3TW7 A;  2G3K A;  4CX9 A;  3OYF A;  3B73 A;  1W2W A;  2XF7 A;  4I44 A;  1HQC A;  1GGQ A;  4ZTJ A;  3ABK C;  2ELH A;  2WC2 A;  2XIG A;  4HNU A;  3F6V A;  4JOM A;  5CQG A;  2XAS A;  1AUE A;  1YJN I;  5FLM J;  2AP3 A;  4P5O A;  3CO7 C;  3T4R A;  2QNL A;  2FOW A;  4A12 A;  2NSG A;  1G5Z A;  1TQP A;  2WB1 N;  2XAF A;  3K7A J;  2A6H F;  2LC2 A;  2XC7 A;  1KU7 A;  3K0L A;  3PUB A;  3WTY C;  1ZRC A;  5T3T A;  2XLD A;  3C63 A;  1V5E A;  1DPU A;  4UB8 C;  4HSR A;  5CJ9 A;  4EIY A;  3HC7 A;  3WTV C;  3LSR A;  2K9S A;  5HS7 A;  4MS2 A;  4AIH A;  1ZW3 A;  3ZQI A;  2L7M P;  1WJF A;  2UXN A;  3WTU C;  1QA6 A;  4IJJ A;  3W6J B;  3D5S C;  1ZG5 A;  3OR1 C;  2OPT A;  3CP8 A;  5M3M J;  2EWN A;  4KIC A;  2ZXW H;  1YG2 A;  3VAY A;  1FT9 A;  2EA4 A;  1XZQ A;  2GOX B;  5JLX A;  1AOY A;  1Y1V J;  4ZYA A;  1JRA A;  3HYI A;  4KIG A;  3MWM A;  1A6Q A;  4Y4R A;  4ZYD A;  3QPL A;  1IXS B;  1MW7 A;  4CXF A;  1KGS A;  3OYL A;  3K1H A;  3LSP A;  2LIG A;  5GTH C;  3TJ5 A;  3DPT A;  2YU9 J;  5A6A A;  4FQG A;  1VQ4 I;  1ETV A;  5JP7 A;  1IDY A;  4F91 B;  3I56 I;  5JSL A;  4HX4 A;  1U5T C;  2CDQ A;  2XKO A;  1H0M A;  3BCA A;  3M8J A;  4A2N B;  1LFP A;  2RC4 A;  5GAH J;  1J8M F;  3N24 A;  4FWV A;  4C3I J;  5DS9 A;  5JVG F;  2HQN A;  4L5E A;  2QVO A;  1NH3 A;  3CC2 I;  1Z9C A;  2LF7 A;  4Y15 A;  2OQR A;  2R7O A;  1X19 A;  2EIJ H;  4XSZ F;  3IAM 2;  3J7Z I;  1B8I A;  1IUY A;  3KZZ A;  3CUQ B;  1UFB A;  2FSW A;  1RR7 A;  4FT8 A;  2DA7 A;  3WG9 A;  5AIP A;  3GWL A;  3JRT A;  4OIQ F;  1T0F C;  3FX3 A;  1FIA A;  1ZRF A;  2R93 J;  1LI5 A;  2OG2 A;  2EV5 A;  4U9E A;  5D4R A;  2R7X A;  4BDZ A;  5KYX A;  1QZY A;  3P9C A;  3DP7 A;  4A3B J;  4YII A;  2DMU A;  1VQO I;  3ZMZ A;  2JA7 J;  3EZI A;  2VKV A;  2HZT A;  3GTO J;  1FFT C;  1TP4 A;  3CJQ B;  3LAP A;  1Y4C A;  3AOU A;  4JC7 A;  3EUK L;  2X1C A;  3QP5 A;  1YW7 A;  3SHF A;  2JSC A;  2V1U A;  2EZH A;  1H6G A;  2F5D A;  2WZF A;  3C8G D;  3MKW B;  1K4T A;  4M71 A;  1NK2 P;  1FFH A;  2IS6 A;  5E17 F;  5FKM A;  1G4U S;  5E1W A;  4I6Z A;  2R7T A;  3HPH A;  3VYU B;  3K4L A;  2UUZ A;  4YL1 A;  2AO9 A;  3EQL F;  3QTH A;  2W4S A;  4BYY A;  2FJ1 A;  3U2R A;  1X4O A;  5D5U B;  2Y3D A;  1LE8 B;  3PUF A;  1D3Y A;  3G71 I;  1YW8 A;  1Z3I X;  3K1I C;  4UDV A;  5C3E J;  3CUQ A;  4U88 A;  3TGN A;  2OC6 A;  4BBR J;  3J7A O;  3JZ0 A;  2GM4 A;  1WKM A;  3HDD A;  4U5C E;  3H3Z A;  1JI8 A;  1UAA A;  1ORJ A;  4HYE A;  1XZP A;  2HZ8 A;  2IA1 A;  4IHX A;  4U9D A;  5KYY B;  1GDT A;  3I71 A;  2HQ5 A;  2HV6 A;  2EFQ A;  3OYJ A;  4I99 C;  3C8Z A;  2Y31 A;  4I0A A;  4BE1 A;  1APL C;  4CGZ A;  1AU7 A;  4BBS J;  3TED A;  3VOD A;  4GGG A;  4MVS A;  2NXN B;  2DT7 B;  2X6X A;  3T8R A;  3FXK A;  3M9A A;  4S0H B;  4U5H A;  2XGC A;  2EPN A;  3V7S A;  1JHF A;  3G1M A;  3DJU B;  4BH9 A;  2LKP A;  5LRS A;  2HV7 A;  3V5Y A;  1WI3 A;  4NQW B;  1VYI A;  1XC5 A;  3NKD A;  3CP2 A;  1QO0 D;  1VQ9 I;  4JVS A;  4RLQ A;  1BOA A;  4LFU A;  3WTS C;  1S7O A;  4JK1 X;  3WHB A;  4BDY A;  4JTC B;  1X1P A;  1Z21 A;  2XPV A;  3BJO A;  3C18 A;  4M3D A;  4EMS A;  1G3Y A;  2XLO A;  3G1L A;  3MKZ A;  2KLO A;  2LK2 A;  3IV5 A;  3DF8 A;  2RNG A;  3VPR A;  1C0W A;  4I02 A;  3ZQY A;  1LE8 A;  3KYJ A;  3V7C A;  4RAF A;  1VND A;  2ID3 A;  4EKW A;  3WTZ A;  4HEA J;  1SFX A;  2V1N A;  3GM3 A;  1SEU A;  1TTY A;  2X1D A;  4ZTF A;  2J46 A;  1BI0 A;  5FRM A;  2K85 A;  2QUP A;  1W5S A;  2W1O A;  2R7F A;  4IO9 F;  1EQ1 A;  1GXQ A;  1EJ9 A;  1TWH A;  4RB2 C;  2L02 A;  2IS1 A;  4M3E A;  2P6V A;  1NG6 A;  5HSW A;  2NS8 A;  2LP0 A;  4KN7 X;  2K7L A;  2OTL I;  2PX3 A;  2J9V A;  4KI2 A;  2ZXO A;  5IPA A;  2YX7 A;  5HNH A;  1UCR A;  5KYY A;  1ZEL A;  1XCV A;  2FF4 A;  4BEH B;  2CGP A;  2XLH A;  5L3G A;  1YRN B;  2XAH A;  2OQM A;  1S9H A;  3K4M A;  3EH2 A;  4LIU A;  3BG7 A;  3RKQ A;  1LFB A;  2J9U A;  1MND A;  2X48 A;  4XPX A;  4F4B A;  4C3D A;  4C3B A;  1ETY A;  5F6F A;  2KRC A;  2YLD A;  2PJR B;  3ABM C;  2XAU A;  2FE3 A;  4XQ1 A;  1VYK A;  2Q0O A;  4RGS A;  1MZB A;  2CYD A;  3HOU J;  4NQW A;  3RTR A;  1I3A A;  1Y6D A;  2MC3 A;  3BTI A;  4WAB A;  5KYW B;  3X2Q C;  3L2U A;  1PVE A;  5B1B C;  3E6C C;  3TD7 A;  3FMR A;  5IP7 J;  1K4S A;  2RQQ A;  1Z63 A;  1ETQ A;  2K40 A;  3V7R A;  1MSF C;  4L0Z B;  4YT5 A;  3K7D A;  2QZ8 A;  4MQ9 F;  3OS1 A;  5IY5 C;  4JQF A;  5DDG A;  3QOP A;  2CQX A;  2OZ6 A;  3F21 A;  1T33 A;  1K78 B;  3J81 K;  3OYG A;  1GM5 A;  1Z91 A;  5CVU A;  2LKX A;  4FES A;  2ZFU A;  1SMY F;  1STZ A;  4Y7N J;  4C2T A;  1U6G A;  2EIN H;  3G2B A;  3MFK A;  9ANT A;  1IJW C;  3U0C A;  2HQA A;  1HST A;  2F22 A;  5GPG B;  1RKT A;  1U9O A;  2P7V B;  3CDH A;  4IHV A;  2JN6 A;  4BE0 A;  3K1P A;  5GAD J;  4J32 B;  3V8K A;  3QYE A;  3GO5 A;  4CDA A;  2FNP A;  1YYV A;  4BS9 A;  4WJ0 A;  2HFH A;  2IA0 A;  3PNT A;  1FR0 A;  3JRE A;  3W2W A;  1U0J A;  2HVQ A;  3KZY A;  3R4K A;  5JR3 A;  3GFI A;  3FXH A;  1QNT A;  4XN3 A;  1QSP A;  4JCH A;  3M07 A;  4NTA A;  2HQR A;  4QI0 A;  2PJR A;  2JA6 J;  3MVP A;  2I8D A;  4UHT A;  5TJJ A;  1IN5 A;  3CES A;  4D7M A;  2M4E A;  1BIB A;  5E1Z B;  4YK5 A;  5KYW A;  2B0L A;  1BJZ A;  2Y2Z A;  3WOD F;  4DVY P;  3AG2 H;  4HX8 A;  1BZ4 A;  2QLZ A;  3DD7 A;  3G4S I;  2O03 A;  3C2B A;  4LG0 B;  3C8G B;  1ZN2 A;  3R2P A;  1JUM A;  2WVN A;  1IO2 A;  1UST A;  4UY8 I;  3Q9V A;  3LAJ A;  3IRR A;  5LHH A;  3E97 A;  5CI8 A;  4ZZL A;  1MBJ A;  4GRI A;  2DA4 A;  3DPU A;  1WAT A;  3PO3 J;  1PP8 F;  2BOL A;  4WCG A;  4Z6Y A;  1BC8 C;  4XK4 A;  2P7V A;  4JE9 A;  3IQC A;  2P0N A;  5B5E C;  1KYZ A;  1HBX G;  2A1D D;  2DB4 A;  1K6O A;  1B4A A;  3RJP A;  1QZE A;  1E17 A;  3W8H A;  4MGR A;  1TR2 A;  4L9N A;  1N78 A;  4BXU A;  1UMQ A;  2ZME C;  4GQH A;  2ZD9 A;  2A61 A;  4P9U A;  1OCC H;  2AXL A;  4WK8 F;  4XL9 A;  2ZJP F;  4D9J A;  3JSE O;  3OOU A;  3RYP A;  1HOM A;  1OXB A;  3HLZ A;  2XF5 A;  1I50 J;  3HUG A;  4XRM A;  4EUK B;  3SZP A;  2J0X A;  3BJ6 A;  2L9J A;  4IQJ A;  1SR2 A;  4U0W A;  3LQQ A;  4AC0 A;  5HNF A;  2DGJ A;  2R0Q C;  4OU0 A;  1R4N B;  4GYI A;  3MLG A;  2DQR A;  3RQE A;  2DFI A;  2DYR H;  4ZYG A;  1T6U A;  2QUF A;  1VTN C;  3MQ0 A;  2HVS A;  1UZC A;  2MBF A;  2L7F P;  3CQZ J;  3WHC A;  2K9N A;  4LG0 A;  1K79 A;  3C8G A;  2EIK H;  2EIM H;  3HOW J;  4NY3 A;  1R7J A;  2RD9 A;  5ICF A;  1XN7 A;  3OIO A;  2V1D A;  4B43 A;  4HE8 D;  2XB5 A;  3K4K A;  5F64 A;  3ZP5 A;  3ZVR A;  5D8K B;  2FQ4 A;  2X85 A;  4BHC A;  3S28 A;  4JW1 A;  5E3O A;  3RPU D;  4RB1 A;  1AHD P;  4XEK A;  4U0Y A;  4F52 A;  3I54 A;  2TCT A;  1Z7L A;  3I55 I;  1DUX C;  3GW2 A;  5D4S A;  2V79 A;  2QM3 A;  4M9S A;  4PJM A;  3U9M A;  1MMD A;  1Q0F A;  3BR0 A;  4EM1 A;  1Y6I A;  1GHC A;  2M8G X;  3VYW A;  3HKZ A;  4BJ6 C;  2HEO A;  3ML6 A;  1O3Q A;  3UMI A;  5KYU B;  4CSA A;  1ODD A;  2M0C A;  2PLY A;  3ECO A;  3DWL E;  4L5J A;  4IHW A;  4K7B A;  2CYY A;  1MD0 A;  2MA3 A;  4G0H A;  1QPI A;  2R7V A;  1S5L C;  2OEX A;  5FB2 A;  1H8A C;  4ITV A;  3TK0 A;  1J2X A;  5HLG A;  3ZDL A;  2FNA A;  3LLI A;  2H27 A;  1R58 A;  5EDN A;  5FRO A;  3QAH A;  2JSP A;  4NBQ A;  2IGM A;  2PMZ N;  2X51 A;  1POG A;  1X58 A;  2MH9 A;  3T6B A;  1ZRE A;  3ZPL A;  3RH3 A;  4EEF G;  1BW6 A;  3PIO F;  2Z9O A;  3OYH A;  3RW0 A;  4OD4 A;  1OCR C;  1ZHY A;  1B1B A;  4IRG A;  1T6Q A;  2LYC A;  3U1D A;  2L6G A;  2WAQ N;  2XS8 A;  4DYC A;  2BBY A;  1U3E M;  4XRF A;  2XAG A;  3LSI A;  3S1M J;  3D5L A;  4CCO A;  5CVR A;  1QQ3 A;  5IT9 K;  3CSK A;  3ONQ A;  4JX6 A;  3IWZ A;  5COF A;  2DA6 A;  1NFN A;  2HGC A;  3WHN A;  2OD5 A;  1T98 A;  4WXD A;  2AQF A;  5JLI A;  2GBY A;  1W36 C;  3S2H J;  3PNY A;  2LDU A;  3UMH A;  4HPQ A;  4ANJ A;  1RIO H;  2H8R A;  4JEA A;  3VWB A;  4NHJ A;  2OU2 A;  3EUH A;  4RAG A;  1WHU A;  2R03 A;  3DAG A;  4M73 A;  5DM7 F;  1ZAO A;  5BQI A;  3BZ6 A;  1MJB A;  1QVU A;  2JUG A;  2ZXI A;  2PX9 A;  5LEJ A;  3RI4 A;  1JAF A;  3CUQ C;  3DU5 A;  1RKC A;  3BZC A;  4ZDP A;  2MW8 A;  4KMU X;  2QSG X;  5JT4 A;  4A3I J;  3RZD J;  3E6D A;  1Z67 A;  4JCZ A;  4HW0 A;  4CDG A;  1X1A A;  4HNV A;  2J0W A;  2OCC C;  4D0P A;  1H89 C;  2CQN A;  2X0L A;  4A3J J;  3E5X A;  3GZ6 A;  1YLM A;  2Y39 A;  3UKG A;  1UG2 A;  3A9C A;  3GVA A;  3SYT A;  4XNF A;  1XSD A;  1WTY A;  4HNT A;  5E20 A;  1NU7 D;  4N4O B;  1T95 A;  2KQR A;  1LUJ B;  3CCL I;  2Y48 A;  2JUC A;  3K69 A;  3LFK A;  1PP7 U;  3IH2 A;  2M45 A;  1MH4 A;  2TDX A;  1WH5 A;  4ZZD A;  1TC3 C;  2OJE D;  3JTH A;  4B8X A;  4AK9 A;  2Y9Z A;  4KNW A;  2CMP A;  1QVT A;  4U7D A;  2TMV P;  2W24 A;  3ASO C;  5IP9 J;  2B0H A;  2L0K A;  2CNW A;  5EG0 B;  2LMD A;  3HBL A;  4MFE A;  2W4B A;  3I5Q A;  3CD6 I;  3F8M A;  4HF0 A;  4EM2 A;  1DU0 A;  1HDP A;  3F72 A;  2Z33 A;  3AAF A;  3ERM A;  1D5V A;  1UHM A;  4GEH A;  5D6E A;  4CA0 A;  4G7Z F;  3HM5 A;  1OW7 A;  2D4U A;  2W4M A;  1BR1 A;  3CCU I;  3GTP J;  1WI9 A;  3BWG A;  2L7A A;  3HZJ A;  3KLN A;  2OAZ A;  2IEK A;  1AWC A;  1YA9 A;  3GTM J;  1FMV A;  1LDJ A;  3NMK A;  2DO7 A;  4D4N A;  2HUJ A;  5FFX A;  3U3F A;  3DKY A;  2XSJ C;  1F9N A;  5L0J A;  2I15 A;  5H20 A;  1HW2 A;  1V55 C;  4LG3 A;  2EIL H;  4S04 A;  4UVA A;  4LLL A;  3BOQ A;  3Q0W A;  1YI2 I;  4OMZ A;  3G73 A;  1XMA A;  2V9K A;  3F46 A;  4NC3 A;  2CQQ A;  1OFC X;  2ME6 A;  4HF2 A;  2IOQ A;  2H94 A;  4A3G J;  5L0H A;  3VSL A;  4U5B E;  3DCF A;  3WTT C;  1R4T A;  1BW5 A;  1G3W A;  2LG4 A;  2ZO4 A;  4EGY A;  4YEJ A;  1HMD A;  2ECC A;  1TW3 A;  3MEX A;  1QBJ A;  2VCA A;  2ZXP A;  4XOT A;  3DEU A;  5FKO A;  3TUL A;  1V74 B;  1JTY A;  4ZDO A;  2EFP A;  1LM3 B;  1FMW A;  4LLE A;  2W84 A;  3CME I;  5KK1 A;  5EG0 A;  1XSV A;  3F9K A;  4XLP F;  5FFZ A;  1Z7U A;  2WA0 A;  4KNY A;  2KL4 A;  4OAZ A;  2OBP A;  4KIT B;  4M3G A;  4A69 C;  4CS8 A;  4XM3 A;  2HPI A;  2KPM A;  1VF9 A;  3UR3 C;  3PM1 A;  3GFM A;  3KIO A;  3BPX A;  4U0V A;  2KIQ A;  1KQ8 A;  1LS4 A;  4MO7 A;  2MSY A;  5HDK A;  3ZQC A;  3AG1 H;  3S1Q J;  4BXF A;  3HOS A;  1D8K A;  1HSJ A;  2FEZ A;  2X9D A;  2KFD A;  2VT3 A;  1LPQ A;  3GM1 A;  3H1C A;  1BJA A;  3V4G A;  2BXY A;  1ENH A;  4A5M A;  5FLV A;  1WZ2 A;  3D0S A;  1A7D A;  1U89 A;  3ITF A;  4KBL A;  1R9T J;  5B3I A;  3J7A Y;  2WAD A;  4A3M J;  1MDM B;  2QKL B;  4O6J A;  5FGM A;  3BY6 A;  2E2J J;  4XN0 A;  4J7Y A;  1IZM A;  2YL1 A;  3M1C B;  5B3S C;  1K7A A;  1X1B A;  4AYB N;  3KP7 A;  4G8X A;  2GAQ A;  4LK0 F;  1ZLJ A;  4FX4 A;  3BG3 A;  1W36 D;  3KLO A;  5E3M A;  3M3Y J;  3K2A A;  2R7Q A;  3VM6 A;  3LSH A;  4RLF A;  5L0C A;  3LNR A;  2JA8 J;  4IAO A;  1VI0 A;  2QQA A;  1MNE A;  1F4K A;  4IQ4 A;  2HOT A;  3LAY A;  2GXA A;  4XR6 A;  2GIV A;  2EFO A;  4R1H A;  3ZOB A;  2DOF A;  3N2Z B;  4YT4 A;  1MH3 A;  5CVV A;  1N1C A;  4IOC F;  4CZC A;  2YS9 A;  1TFK B;  3RKO F;  4CS7 A;  3MBG A;  2DA3 A;  1VQ5 I;  1B6A A;  2NVU B;  3L0I A;  3GEE A;  1RKW A;  5EYR A;  3BR5 A;  4AX2 A;  2F4M B;  4J00 A;  5IT3 A;  3MAJ A;  2JRM A;  3N0T A;  3A01 B;  2K4B A;  4AM3 A;  2W57 A;  1CPR A;  2PP4 A;  3DE9 A;  4IHT A;  1M1E B;  3DEE A;  4P55 A;  3COA C;  3WE2 A;  1FTT A;  4ZLD A;  2VJ4 A;  2R7U A;  5B1A C;  2IYL D;  2IA2 A;  4ZH4 F;  2VB6 A;  3AG3 H;  4XQF A;  3S9O A;  2G7H A;  4G12 A;  3JYY A;  3E7L A;  2IW5 A;  4LB5 A;  2X6Y A;  4MFD A;  4KIF A;  2Q1Z B;  2L9V A;  1NFO A;  3F8F A;  2VKD A;  5DV5 A;  5D92 A;  1F1Z A;  2EPO A;  2F5C A;  4J30 B;  2DN0 A;  2D5V A;  3IRQ A;  2A07 F;  5IYD J;  5AGF A;  1A36 A;  3M1C A;  5EK0 A;  2R7D A;  3FDQ A;  1IDZ A;  2NPU A;  1FYK A;  3MYI A;  2F5F A;  1ZW2 A;  1QRY A;  3DV8 A;  1W1W E;  5C4J J;  1HW5 A;  4B09 A;  3J81 Z;  1ST6 A;  5GTI C;  3MZ8 A;  3S8P A;  1XSX A;  4XTK A;  1OQY A;  4I7H A;  5JI6 A;  1I1S A;  2C04 A;  3KPH A;  2VJ5 A;  2BY0 A;  4JX4 A;  2BGC A;  2MLG A;  2Y0S N;  2ESN A;  2BY3 A;  2IAI A;  2JTV A;  1T9K A;  2EJR A;  3E70 C;  3V5X A;  2QSH X;  1BA5 A;  2XLM A;  1WJC A;  5HOO A;  3ZGK A;  4L0Y B;  1R00 A;  3NYJ A;  2P6T A;  2E2I J;  1U6H A;  3H0G J;  3CC4 I;  1WVR A;  2XAJ A;  1V5G A;  3GX4 X;  3RCO A;  1E3P A;  1PDN C;  3ABK H;  1DQU A;  1Z3X A;  4PSX A;  3A01 A;  2YL7 A;  3JSO A;  1I4Z A;  1DOV A;  5FCL A;  5L3Q A;  3B29 A;  4CJG A;  1E3O C;  1HXD A;  3KZI C;  3NQO A;  3KKB A;  4PJ0 C;  4CIP A;  1K05 A;  5JHF A;  1XMX A;  1ORS C;  2E36 A;  4DVZ A;  1QHH D;  4CO8 A;  4CYD A;  4LLN A;  3DAF A;  4CSA C;  3KX2 A;  2O9L A;  3ABU A;  1VFC A;  1ZR2 A;  3S3N A;  2RSE B;  5F5H A;  2RVC A;  3RVZ A;  1EH6 A;  2Q9B A;  3BDD A;  3Q7L A;  5LD2 C;  4LLG F;  3OSG A;  2KSF A;  4ABZ A;  3VRC A;  4I0B A;  5KAI C;  2OQG A;  5HS8 A;  1U0B B;  2KIU A;  1MJA A;  3LOC A;  1ZZP A;  3TO9 A;  1CGO A;  2Y3H A;  2ZNY A;  4XKB A;  4E4H A;  3BEH A;  3NKE A;  3CZ6 A;  3GAN A;  1TFO B;  1UEL B;  3CJN A;  5KHD A;  3RQF A;  3OWT A;  3E9V A;  3QVZ A;  3DBR B;  4UUT A;  5FD6 A;  4BJT A;  4XLN F;  2L9N A;  3CCQ I;  3GWN A;  2Y3G A;  3LSK A;  3M8F A;  3F8C A;  1B8I B;  2OTJ I;  3UGO A;  1R1T A;  2A5W A;  1BM9 A;  2JRT A;  5A6J A;  1ORY A;  5AON A;  4ESB A;  3FOO A;  3UNG C;  3HRM A;  1P92 A;  5J1Y A;  1G6N A;  5BMZ A;  1R49 A;  3HOT A;  4A3L J;  1KNY A;  2NVQ J;  2KIS A;  2ZJ2 A;  4HV5 A;  1IUF A;  1QVX A;  1ZHZ A;  4K1O A;  4K2E A;  1M56 C;  5KYX B;  4Z2Y A;  3R0A A;  4HFK B;  3GTL J;  4LD5 A;  4HFF B;  1S7A A;  5TRD A;  2PMH A;  2MAB A;  2E60 A;  3TP0 A;  1JT0 A;  1VQK I;  2CFO A;  4RGX A;  1MMA A;  5JRA A;  3BRO A;  5HVQ C;  1A04 A;  1J09 A;  2EPK X;  4RA2 A;  4IPA A;  3TOA A;  4I09 A;  4A0X A;  2P61 A;  1RC9 A;  2NOG A;  4R8H A;  2XHK A;  2MFZ A;  2ASR A;  2DPD A;  3K6G A;  4ULV A;  2VKH A;  2YSR A;  3NMI A;  3T6J A;  5H6Q A;  2DJN A;  2BW3 B;  2M0M A;  3TQO A;  4U5E E;  4MTF A;  1DGW Y;  1REP C;  4RD9 A;  2P5K A;  1K61 A;  3JAM K;  2PNO A;  4V2F A;  3A1Y A;  4HF1 A;  1M2V A;  2Y69 H;  4CUG A;  3JRB A;  2JWT A;  2OF7 A;  1ZHX A;  4Q47 A;  3RPQ A;  2FBH A;  2YQY A;  1TKN A;  2CFX A;  3GLL A;  1SVL A;  3H35 A;  2M9H A;  3QYB A;  5M5X J;  3IP4 B;  2X0C A;  4EBB A;  4CCJ A;  4GO1 A;  2UUI A;  1O3R A;  2DXI A;  1B9M A;  5B66 C;  2F48 A;  3IKT A;  3WU1 B;  3PCV A;  3HTU A;  1UJ8 A;  2GDC A;  2H7B A;  2BY2 A;  2VOP A;  3ISP A;  4IF4 A;  3HL2 A;  1VLT A;  2CGE A;  3ZN1 A;  4KMF A;  3SXY A;  3ZMV A;  1K40 A;  3ZR8 X;  3ZXS A;  3ABL H;  2IVM A;  1R1U A;  2P5V A;  1JKP C;  1Q0D A;  1WN0 A;  3FK7 A;  4UV9 A;  4EJU A;  2M4K A;  2XRO A;  1Y39 A;  2QTV A;  1ON2 A;  1UHW A;  1XGM A;  4I1M A;  1RUO A;  4R32 A;  3U8V A;  2KIM A;  1YZA A;  4CCK A;  1YW9 A;  3ROU A;  2LFD A;  2FUG 2;  3D5R C;  3U21 A;  2ZXW C;  2IGK A;  3L09 A;  4BU2 A;  3CCE I;  3GTG J;  2HJ3 A;  3JTG A;  1W5T A;  2LSO A;  3M15 A;  4XOR A;  4LIT A;  3FHD A;  3AQB A;  5EJC A;  1LEA A;  5BUO A;  1A7V A;  4BEJ A;  2BW3 A;  3OMY A;  3FM3 A;  4F3Q A;  3CCV I;  4E7L A;  3IH3 A;  5IT9 Z;  2HS5 A;  3WGG A;  4PDK A;  2V6E A;  2OOC A;  2QCO A;  3L2V A;  1DU6 A;  3KP3 A;  1S7E A;  2P0W A;  4O7G A;  5FKL A;  5CPR B;  3NWS A;  1G4D A;  2JX0 A;  4FE7 A;  5JVE A;  1P4X A;  2VBX A;  4EV0 A;  3IH4 A;  3CCR I;  4Y52 J;  4XLA A;  3QW1 A;  4PJJ A;  2PN6 A;  4I01 A;  1L3L A;  1RXQ A;  2B0J A;  1U9N A;  2FMY A;  2EIJ C;  4BXX J;  1FSE A;  1FSH A;  2DT5 A;  1DGR M;  2M5W A;  2M4G A;  2IXO A;  1FP1 D;  3BR6 A;  2BC5 A;  1BN5 A;  3CCM I;  4OD5 A;  3H65 A;  4II2 A;  4CS8 C;  3W2V A;  3LES A;  4CDV A;  1E85 A;  2DA1 A;  2XVC A;  4IAR A;  3JSZ A;  2J5O A;  4G78 A;  1TWC J;  3DWW A;  4F7Z A;  3QZC A;  2L7K A;  2BV6 A;  1EI7 A;  2DTZ A;  3EHM A;  5C44 J;  2VON A;  3O6X A;  4YJW A;  4I3M A;  4WXH A;  3HNJ A;  4UB6 C;  4BQQ A;  5F27 A;  3HJC A;  1VB5 A;  5DCM A;  2H8W A;  3HKK A;  3P7N A;  3FBI B;  3Q0V A;  3ZQ7 A;  1A5J A;  1EA3 A;  3T6G B;  1W7P B;  2AS5 F;  3MCZ A;  4B3A A;  1ZQ3 P;  3OYA A;  2XUB A;  4G7H F;  4OIO F;  2W85 A;  2KHM A;  3S32 A;  3OYD A;  4AD9 A;  3JR9 A;  1OIS A;  4EVI A;  3P9K A;  4YL3 A;  4XPW A;  2IBD A;  3F47 A;  4E7I A;  1QPM A;  2JMW A;  3RSN A;  4RBO A;  1XCB A;  2E7W A;  3W3C A;  2WBM A;  5B1B H;  4O6Y A;  3R61 A;  1IC8 A;  1TWA J;  3G4Z A;  2DYS H;  5DUI A;  2LP4 A;  3ZTZ A;  4LOC A;  1YE9 A;  2A68 F;  3LS0 A;  2M2E A;  3FKJ A;  1G59 A;  5J1U A;  2HDC A;  4HDV A;  3HNI A;  2NNN A;  2RGV A;  3AL0 B;  4XPY A;  3L7W A;  4M74 A;  1OPC A;  2QQ8 A;  4G6T B;  4DRI B;  3BG5 A;  2VC9 A;  1USS A;  1WOL A;  256B A;  4HA8 A;  2HNH A;  3NYM A;  3OR2 C;  4B47 A;  2VBW A;  3MZY A;  1MMS A;  2AWC A;  2Q2E A;  3OS0 A;  4KA4 A;  1BDJ B;  2O0Y A;  2L4A A;  2KIF A;  4FE4 A;  2XAQ A;  2K27 A;  4E7K A;  2ZFW A;  4PCQ A;  1SD6 A;  2DFH A;  5TIS C;  4KC9 A;  1B9N A;  4J01 A;  1OCZ H;  4PK4 A;  5IOZ A;  1OCO H;  2GZW A;  3CCS I;  1W7P A;  4QLC U;  3C3W A;  3DMD A;  2CNW D;  1SFK A;  4A5N A;  2XSE A;  2G0E A;  4XMY A;  5DS5 A;  2M3A A;  1P2F A;  4XSX F;  2V1X A;  3SQN A;  5HV9 A;  4U87 A;  2FAP B;  1Z77 A;  1ZU4 A;  1GT0 C;  2Z1D A;  1UG0 A;  3H5R A;  1GXP A;  2RKH A;  2QF7 A;  1R6R A;  2JVG A;  4A6E A;  2ZB9 A;  1JR8 A;  1TLH B;  1MMN A;  1SD7 A;  2B9S A;  3MX3 A;  4JRZ A;  1WSU A;  3FDY A;  1F1M A;  1SAU A;  4MVO A;  1FWZ A;  4IEJ A;  2VJJ A;  1ZG3 A;  2G7U A;  4JYK A;  4RDU A;  4FCY A;  3QQA A;  2XLE A;  3IAS 2;  2GAU A;  2DU9 A;  2LY9 A;  4P9F A;  1SAN A;  2HI3 A;  1IN6 A;  1G8X A;  2RNJ A;  3HGG A;  2VC0 A;  3HUG B;  3N05 A;  5LGT A;  3BPV A;  2IGN A;  4EM0 B;  1L7C A;  5ILV A;  1YIT I;  2GIZ A;  3DTI A;  4L9J A;  2EA2 A;  4AUX A;  2HU9 A;  5GP9 A;  3M1E A;  2E19 A;  1TNS A;  3TP3 A;  1D0X A;  4DYQ A;  4CS9 A;  1ZAR A;  5ILU A;  2Z2S B;  3ZQV A;  1XGN A;  3QU3 A;  2Q9A A;  4BG0 A;  1I4Y A;  2KYH A;  2E35 A;  5EHH A;  2FXA A;  2LRD A;  2KT0 A;  2YPR A;  1ZHW A;  3L8J A;  3KP6 A;  3KYC B;  2EH3 A;  2HKX A;  3L8I A;  5A6K A;  4AE4 B;  3MYF A;  2E1N A;  1A7E A;  4DYR A;  5H2F C;  2IJL A;  1IZ1 A;  1V54 H;  4OIN F;  1OKK A;  3IPM O;  4L9T A;  3H5N A;  4XLC A;  1CGN A;  2YKZ A;  1BIA A;  3K4N A;  2EIN C;  1MIJ A;  2ADU A;  3A4C A;  4UNO A;  2LSE A;  3SXZ A;  4B48 A;  5LRR A;  2KDO A;  1ERD A;  4A3F J;  1E84 A;  1FY7 A;  5AC5 A;  1SVM A;  2QEX I;  3NAU A;  4LIV A;  2IS4 A;  4M3B A;  3ERE D;  1NZE A;  4XWJ A;  2ZXR A;  1J8Y F;  2A0B A;  1LJ9 A;  4G6Q A;  2NG1 A;  4KUM A;  2R7S A;  2XRN A;  1K6Y A;  1A31 A;  1ZGJ A;  1YX3 A;  4C2U A;  5K7Z A;  1HKS A;  3AQC A;  3ZCO A;  1WQ2 A;  1RNL A;  5KVR A;  2BEO A;  2CUJ A;  4C3H J;  2IRF G;  5CKT A;  4XLH A;  1FYM A;  4L18 B;  5HLT A;  5J4V A;  2CW0 F;  4LDK A;  5F0F A;  4Z9I A;  4CIC A;  1FOX A;  1SVO A;  1P7I A;  3SNH A;  3RYR A;  5L3B A;  2DI3 A;  1R5H A;  3IWF A;  2J5P A;  3AG2 C;  1JHH A;  2QWW A;  1JTX A;  2VQG A;  3ESW B;  3E3V A;  2BVL A;  2D1V A;  2LF8 A;  3FIW A;  5A2Q K;  3RQG A;  4BPM A;  4AE4 A;  2NVY J;  1DP3 A;  3IL2 A;  1YTY A;  2DAO A;  3K4B A;  1VK5 A;  2BE5 F;  2ZCW A;  3KEY A;  5J8F A;  3F6O A;  4PUS A;  3Q6N A;  1TNT A;  2W45 A;  1WJE A;  1PYV A;  1N77 A;  4XKC A;  2IXN A;  2LCH A;  2Z99 A;  2HSQ A;  3GCM A;  1FOY A;  3I4U A;  1I6H J;  2R7W A;  1OCR H;  5E8I A;  4BAC A;  3OEO A;  1ZR4 A;  3DPL C;  3EPZ A;  5AIQ A;  3J80 K;  1H88 C;  1OLT A;  2QQB A;  4C9Y A;  3HRU A;  1IRZ A;  3VFZ A;  2HDD A;  2Q7R A;  5D8L B;  3VYR B;  1XDU A;  2VPR A;  4ESF A;  3AKZ A;  4AIK A;  4MEX F;  1PD1 A;  3GEH A;  3VF0 A;  4X1E A;  4HRI A;  2XM4 A;  4CYC A;  3W8I A;  5J3L A;  1RZ4 A;  5EZG A;  4BUP A;  1IV6 A;  1ETK A;  3HHH A;  3OIP A;  2R7R A;  4E7Z A;  1L0O C;  2D1H A;  1JJ8 C;  3I4N J;  2PBE A;  2KDZ A;  2R9R B;  3JT1 A;  4MTD A;  1E86 A;  1NTC A;  5JFR A;  3B02 A;  2X1E A;  1I6X A;  3NWT A;  2L7Z A;  3FIS A;  2DMN A;  1Z1D A;  4OIR F;  3LUT B;  4A3D J;  4Q5S F;  1UB9 A;  2DYR C;  3M7G A;  2VC1 A;  4M3F A;  1BBY A;  3W2A A;  4BHB A;  2EIK C;  4OWR B;  2O5R A;  1KA8 A;  2JA5 J;  1N25 A;  2EIM C;  3U8P A;  3K4C A;  1ON1 A;  2D2W A;  2L9R A;  1X2M A;  3WGI A;  2HVR A;  3GZN B;  5J40 A;  4Z9H A;  1LVK A;  1T6I A;  2H09 A;  4EJV A;  4UUS B;  4II3 A;  3OY9 A;  3MZH A;  4HOB A;  2H1K A;  1XGS A;  2M8E A;  3CC7 I;  5L3E A;  4GYG A;  4JBA A;  4GYT A;  2MC4 A;  2PEX A;  2K86 A;  5K7H A;  3T5X A;  4JJF A;  1R23 A;  2VOO A;  5TJ5 E;  2EPL X;  2XPU A;  2XV4 S;  1S29 A;  1MGT A;  3B9Q A;  4ZJZ A;  3QPH A;  1LQ1 A;  3CF5 F;  2Q00 A;  1VOM A;  4BJ1 A;  5KYN A;  4CCM A;  2A69 F;  3ELK A;  1QKR A;  1JE8 A;  3H92 A;  1MMG A;  3GME A;  1P6R A;  2OCE A;  3QPT A;  2GA0 A;  4RB3 C;  5DLJ A;  3H5A A;  1IF1 A;  3QOD A;  4G7O F;  3AJM A;  2F5V A;  4AU7 A;  3G6E I;  2OA4 A;  1DDN A;  4A93 J;  3HRS A;  1YAU O;  1X4P A;  5DCF A;  3S16 J;  2Y0M A;  2BHY A;  1X1D A;  4DRJ B;  3LWF A;  4YN0 B;  3JAM Z;  2R4G A;  2JQ7 A;  1ITY A;  4B1R A;  3BC8 A;  3O8H A;  1B59 A;  3K66 A;  4IRU A;  3S27 A;  1RPW A;  3WTX C;  4CSW A;  1EKE A;  2KKO A;  1ZK8 A;  3PSI A;  4W1U A;  3AGT A;  2AQE A;  3PL8 A;  4P1W A;  3F23 A;  4IOA F;  1V4A A;  4PGH A;  2DCE A;  2ISY A;  2QGU A;  1ETO A;  4GCV A;  1D1C A;  1Y56 A;  4BY1 J;  2XDV A;  3HPG A;  2FX0 A;  4HLY A;  4FX0 A;  3E5U A;  2WAF A;  3VEP A;  1ZLK A;  4UUS A;  1ULY A;  5JLW A;  2XGE A;  3TOB A;  3EGD B;  2HMZ A;  3TDU C;  2CW8 A;  4XRS A;  3NG1 A;  1ZKG A;  2W82 A;  3GEZ A;  3WU0 A;  4M6V A;  1J5Y A;  2VLA A;  3B6C A;  3BQY A;  2ZXH A;  4M6X A;  2F4O B;  4AID A;  2G3V A;  1P4A A;  1PD0 A;  5K5R A;  4BHP A;  3JSP A;  5J4Y A;  4UXN A;  2R92 J;  5DS6 A;  2FU4 A;  1ZYR F;  1YVI A;  1FTS A;  5LHG A;  2DFE A;  1P7J A;  1XGO A;  2NUT A;  3PQK A;  2XF6 A;  3SZT A;  1W5C C;  2CUZ A;  3A0H C;  4DBR A;  3M4C A;  4I76 A;  4DNC A;  1X2N A;  4F93 B;  4D1Q A;  5C4X J;  2XLV A;  4H54 A;  3KCC A;  1EF4 A;  2LNB A;  4XEV A;  4CDY A;  3K1N A;  1L3P A;  4A0Y A;  1MKM A;  1AA7 A;  3E5Q A;  4OOI A;  4MQV A;  1BC7 C;  1VTM P;  3BTL A;  3LA2 A;  2XXA B;  3M4O J;  2YVK A;  2HXI A;  4QWQ A;  5DEQ A;  3L2W A;  1KTM A;  2XS1 A;  3KYL A;  3PMR A;  2E1C A;  1V5F A;  4DBQ A;  1X3U A;  4EQQ A;  3P9I A;  5F0H A;  1TWF J;  4TV7 A;  3NRV A;  3LA3 A;  2DPU A;  3S14 J;  4BQA A;  4RM2 A;  4H0E A;  5L3V A;  1HDD C;  1U8R A;  2QBY B;  4M63 A;  2W9Y A;  2M34 A;  4YFX F;  1YS7 A;  2GA2 A;  2OU6 A;  1T08 B;  2COB A;  2Z15 A;  3CJR B;  4ENJ A;  2JJ7 A;  4MTO A;  2M30 A;  4OMY A;  3HXL A;  2M1B A;  4YIR X;  1GVD A;  1JJ6 C;  1RJ9 A;  6PAX A;  3QW0 A;  3T0Y A;  3A0B C;  4O6M A;  3EGD A;  2R3S A;  4MW3 A;  2GWW A;  4D7N A;  2BYV E;  1IGN A;  3A03 A;  3G4X A;  3Q9S A;  2LD6 A;  1ETW A;  2I8B A;  4X6A J;  3PHF 2;  3AG4 C;  2WB1 A;  1RRJ A;  4C3J J;  2DTR A;  2YRF A;  4JUR I;  2LFB A;  2WL8 A;  3P5J A;  4P96 A;  4GFB A;  3H2U A;  3HOY J;  1Z7Q c;  5A6B A;  3NAR A;  3KYI A;  1I3Q J;  1Z05 A;  3HKZ N;  3E1S A;  4QPO A;  2HOA A;  1PUF B;  1FOK A;  2O9X A;  4HZF A;  1YHQ I;  3AL0 C;  5LLQ A;  1GV5 A;  1KU2 A;  5L0I A;  2DMQ A;  4ETS A;  5L3C A;  1F5T A;  1ZRD A;  3RFY A;  3X1O A;  3FXQ A;  4MLO A;  3ZQQ A;  2XXA A;  2V3C C;  5BQT A;  1BI3 A;  3Q6M A;  2KZG A;  2LOO A;  3S3M A;  3CCJ I;  3FXM A;  4DJ9 A;  3I0T A;  2E1M B;  4CJO A;  5LGU A;  3W4Y A;  4CS9 C;  4WGY A;  2EV0 A;  2QBY A;  2Y9Y A;  1R71 A;  2J9W A;  2LTP A;  2XKP A;  1TL8 A;  1IRF A;  4CCL A;  4MVM A;  2VJI A;  2DMT A;  1G3T A;  3JYH A;  4HG2 A;  2QA4 I;  3SZR A;  3N4M A;  3DI5 A;  1QHG A;  3Q7G A;  4A2U A;  3BJA A;  1FNN A;  2BY1 A;  5E3C A;  2UV1 A;  4M6Y A;  3CQZ A;  3RKX A;  3GTQ J;  2V9V A;  4KN4 X;  3V8L A;  2MHR A;  3JRG A;  3SDB A;  1SD4 A;  1UFM A;  1E0E A;  5L0G A;  3CUO A;  3DFG A;  3MMY B;  5KAF C;  1I27 A;  1YO5 C;  1P4W A;  2CUE A;  2ETH A;  2N8G A;  4UUV A;  1LKX A;  2BVM A;  3OYI A;  5F08 A;  2V4J C;  4PFO A;  2ELJ A;  2DOA A;  4LDQ A;  5K5Q A;  2E34 A;  1V4R A;  3ZMD A;  1PUF A;  3SEQ A;  4BL0 B;  3JRC A;  4N0B A;  4Y17 A;  4D5F A;  4YG2 F;  4MTG A;  4LAC B;  2VCC A;  5FKK A;  2RAE A;  3TBI A;  3EDP A;  3ECS A;  4IVN A;  4A6D A;  4HDU A;  2EZK A;  1KZH A;  1LS1 A;  2FD5 A;  4BNC A;  2VXZ A;  3K33 A;  2KW3 C;  5EGY A;  1JKO C;  4HQE A;  1ZGW A;  1HCR A;  4AVZ A;  3TJ6 A;  2QY9 A;  5E18 F;  1WJA A;  1GQA A;  3SZG A;  5LGN A;  1I5N A;  1KU3 A;  1NSG B;  3L2Q A;  1LE4 A;  4P6I C;  1WWX A;  5DYM A;  3HHG A;  1SF8 A;  2JPU A;  2VL8 A;  3I59 B;  3ASN H;  2E87 A;  3H3U A;  2X6O A;  4KNV A;  2K9Q A;  1YLF A;  2ZSH B;  3WG7 C;  2OZU A;  4XON A;  4YT2 A;  2VE9 A;  3B71 A;  1NLX A;  3FMS A;  3TQN A;  2F2E A;  4LGW A;  3VOE A;  3F8B A;  2W7N A;  3WE3 A;  1RUN A;  1ZHT A;  3I5P A;  3QVY A;  1VMA A;  1Q1V A;  2IBF A;  3IKV A;  4PZJ A;  1Z6A A;  3ZQF A;  3OYK A;  2L01 A;  5M3F J;  2IGO A;  4LDR A;  4ZLC A;  3ZTM A;  1YYX A;  3BCB A;  2O8K A;  2WZL A;  3HG9 A;  5FO5 A;  1B72 A;  3AG3 C;  4W8K A;  2H8A A;  1DP7 P;  5GPA A;  1H9G A;  4BKX A;  2STW A;  4L5I A;  2I5U A;  3GFL A;  2EZL A;  2ZME B;  3LEO A;  3OA1 A;  2P5L C;  4NB5 A;  1QLE C;  4UVB A;  1VQN I;  4BAY A;  2PFD A;  2VQC A;  2OV7 A;  3V5Z A;  4FTH A;  2XGD A;  1W7P D;  4W97 A;  2Q3T A;  3TKY A;  4PGG A;  5ICG A;  4HLX A;  3JRD A;  1JGS A;  4BQO A;  3LS1 A;  2AVK A;  4V19 K;  4ONS A;  1R36 A;  3BG9 A;  3ZQG A;  4RAZ A;  2VIX A;  1YZC A;  3R6S A;  1DOW A;  3LL7 A;  3HOV J;  1S8N A;  1M2V B;  1VLS A;  1I39 A;  2Q9C A;  4EBK A;  3I59 A;  4DRH B;  1WH7 A;  1D5Y A;  2KMU A;  5LBQ A;  5HOD A;  1M57 C;  4GDF A;  3ZQL A;  2WVQ A;  1J75 A;  2KRH A;  4M72 A;  3EPV A;  2L81 A;  4XLE A;  1SFU A;  4MND A;  3G50 A;  4MTE A;  2DBB A;  3QP6 A;  3A11 A;  4EJT A;  2HWV A;  2JPC A;  1UHS A;  2ZJQ F;  2BXZ A;  3KP5 A;  2VCB A;  2J7P A;  5E1X A;  3IUO A;  3H2V A;  1M2O A;  1J7K A;  1FBU A;  1WGX A;  3LMM A;  3EUH C;  1J9I A;  3G1O A;  2HYF A;  2HYG D;  3GTK J;  3MFN A;  4PJN A;  1Z23 A;  2PF4 E;  4K0D A;  3FBN B;  4JKV A;  5L0D A;  2HSB A;  2ZNZ A;  2Z3Y A;  2KJB A;  3BG6 A;  1I1G A;  3J06 A;  1A6I A;  3KP4 A;  3HIF A;  1OQC A;  2ZME A;  3C7J A;  1D8J A;  4E7H A;  1EH8 A;  1GUU A;  3U3B A;  3I9V 2;  2XPW A;  3KEQ A;  4IRI A;  2O8X A;  2A0U A;  1MBK A;  4IAQ A;  1C02 A;  4JZA A;  2ACJ A;  2EFN A;  4ENN A;  2CO5 A;  2E5N A;  5A2Q Z;  4NC8 A;  5E3A A;  1PCX A;  5DQZ A;  1XMK A;  2FQ3 A;  3L2C A;  3EGX A;  2RN7 A;  1WWP A;  2ZKZ A;  2CUF A;  1OKK D;  2A05 A;  3MN2 A;  1YAR O;  3GOR A;  2XL8 A;  1UG7 A;  3BR2 A;  1VQM I;  5FD5 A;  2PBI A;  1FC3 A;  4JTA B;  1LDD A;  1LNW A;  3GUD A;  4C7O A;  1BI2 A;  4YFN F;  3J80 Z;  2EB7 A;  3CDI A;  4I2O A;  3NEU A;  4KIB A;  2VOD A;  1RES A;  1GLN A;  1OW6 A;  4XOP A;  4HST A;  3EFO A;  5EF6 A;  2IXP A;  3HRT A;  3A02 A;  3DTK A;  3QRF F;  2NSF A;  1FOW A;  5EGO B;  3HNK A;  3NMJ A;  4DW6 A;  1A0B A;  3FHN A;  5BS6 A;  5ICE A;  3GXO A;  3JRF A;  2PJP A;  3HOZ J;  1F43 A;  5K0I A;  4DQ2 A;  2HPM A;  1MJ9 A;  2HOS A;  1Z6R A;  4LLC A;  2KC3 A;  4MW8 A;  4NTB A;  3M79 A;  2C6Y A;  3EUA A;  4BJ6 A;  3RKY A;  2H7O A;  2CV1 A;  4ENK A;  3R0J A;  3F3X A;  5J6X A;  2XLW A;  4ON0 A;  3LST A;  1WCM J;  3M4B A;  3R7C A;  1S05 A;  5FLX K;  3ZSU A;  1JT6 A;  2D5R B;  2EBI A;  4C3E A;  1CF7 B;  3ZWI A;  2K5C A;  5DCM B;  2PG4 A;  3TW6 A;  1LI7 A;  2L6H A;  1T39 A;  5HDN A;  4E7S A;  3PQJ A;  1XG1 A;  2DT6 A;  3CCY A;  3LSG A;  3I4P A;  1J59 A;  2DA5 A;  1VQ7 I;  2CV0 A;  3S1N J;  2YX4 A;  5DM6 F;  1S72 I;  3EZH A;  4MIM A;  4YIF A;  2ECB A;  2HJM A;  2RV8 A;  5D91 A;  2YEV A;  1VZ0 A;  2STT A;  5D5X B;  4R79 A;  2Y69 C;  3Q0U A;  5K7F A;  1NBB A;  2ZPA A;  4M9X A;  4PR9 A;  4WWC A;  2WB7 A;  4Y33 A;  3L00 A;  3BR3 A;  3GLX A;  3O2P E;  2DA2 A;  4EBJ A;  2FRH A;  3FXR A;  1Y0N A;  2ZC2 A;  3O3K A;  1Q0G A;  4ENM A;  1VQ6 I;  5EGO A;  1HLV A;  1VQP I;  1R1V A;  4D5C A;  2FBK A;  4H4K C;  3FVY A;  4PSW A;  1JGG A;  2EPF A;  3OOP A;  3TDZ C;  3ABL C;  3VB2 A;  3QYF A; 
#chains in the Genus database with same CATH homology
 2OJE D;  3KPH A;  2ICW G;  1R5I D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...