1R5ID

Crystal structure of the mam-mhc complex
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
214
structure length
214
Chain Sequence
SMKLRVENPKKAQKHFVQNLNNVVFTNKELEDIYNLSNKEETKEVLKLFKLKVNQFYRHAFGIVNDYNGLLEYKEIFNMMFLKLSVVFDTQRKEANNVEQIKRNIAILDEIMAKADNDLSYFISQNKNFQELWDKAVKLTKEMKIKLKGQKLDLRDGEVAINKVRELFGSDKNVKELWWFRSLLVKGVYLIKRYYEGDIELKTTSDFAKAVFED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Mycoplasma arthritidis mitogen complexed with HLA-DR1 reveals a novel superantigen fold and a dimerized superantigen-MHC complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
total genus 84
structure length 214
sequence length 214
chains with identical sequence H
ec nomenclature
pdb deposition date 2003-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.530 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A mam-mhc complex, Chain D, Domain 2 1r5iD02
1.20.120.390 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hla class ii histocompatibility antigen, dr alpha chain. Chain D, domain 1 1r5iD01
1R5ID 2OJED 2ICWG 3KPHA
chains in the Genus database with same CATH superfamily
2OPTA 1KU3A 1SAXA 2XF6A 1IAWA 2OBPA 2TMVP 2Z2SB 3E6DA 3AG4C 1P7IA 2H8WA 2CUZA 4M9XA 1VQ4I 1VK5A 2LREA 3F46A 2Y39A 2DMTA 2X48A 4X0GA 1WI3A 4BACA 4MQVA 1ORYA 2L6GA 1MBHA 2HQ5A 3GTPJ 3H0DA 4QLCU 2HDCA 1D1BA 4HAMA 1U5TB 4MNUA 1W0UA 2UWMA 3B29A 3FWEA 3RYLA 2CFXA 3TQOA 4FTHA 1RPWA 3KP6A 3EZIA 4G0HA 2VPRA 1QU3A 4E6KG 2DGJA 3CO6C 3QW1A 1U9OA 1YO5C 2R4GA 3CTAA 2DFFA 3B73A 2UUZA 1JI8A 2BGCA 1M6TA 1XTAA 4QTRA 3BP8A 3S3NA 2HQRA 2COMA 3HNLA 1UJ8A 5A6KA 2QA4I 4I1MA 4IOAF 1JE8A 4IJJA 1TL8A 1GQAA 2DA5A 3R6SA 2D45A 1IRGA 2IBDA 3CJRB 2NYXA 4RM2A 3U9GA 3OIQA 2DYSC 3Q9SA 4ULWA 2Q9CA 1MQVA 2BW3A 2EZLA 5HODA 1OKKA 2AP3A 4U9EA 3OSFA 3AQBA 2WB1N 3RTRA 3ZOBA 3A1YA 3HL2A 1M1EB 2K9NA 2VT2A 2IXNA 2STTA 1E0EA 3P9CA 5ILVA 2KT0A 3ISPA 1HKQA 5LEJA 1G3WA 3EH2A 3DTIA 3I55I 2W24A 2QKLB 1Z1DA 3HPHA 5GPCA 3JRDA 1JRAA 1GHCA 2LD6A 2LP0A 2ZSHB 2P6SA 4JK1X 2XAJA 3OYAA 3GLXA 4B3XA 1RR8C 4XLHA 3HKKA 2PQ8A 5F5FA 5EEGA 2PFBA 1CF7A 3ABKC 3IQCA 2AXLA 4CDGA 1ZK8A 3F9KA 4XIDA 1FYLA 4LIVA 3LEVA 3E6MA 3K1MA 2OJQA 3P9IA 2W45A 1ZHWA 4UV8A 1KZHA 2XLDA 1OR2A 2B7EA 3JCUC 2LK4A 1HA8A 4LLEA 5DS4A 2J9WA 3RZOJ 4CA0A 3S32A 1S29A 1PUEE 3DF8A 1D1AA 4H54A 2KRFA 3AKZA 3GX4X 2GOXB 3IWFA 2ACJA 4KFCA 1NBBA 2IA2A 3H1CA 1R5GA 1VQKI 3GZ5A 3S1NJ 3Q5FA 2ZMEC 2TDXA 3OYIA 3R61A 2XHKA 1JKPC 1ZHYA 3KL4A 4JJGA 1WH7A 3U0CA 1MMAA 2O8KA 4BBSJ 1APLC 4I7HA 1T5OA 1LB2A 1TWCA 4BBRJ 3LOCA 1GDTA 1G59A 3GODA 2BOLA 2M7BA 3TQNA 3V7RA 3EETA 1S05A 4LIUA 3NQOA 1DGWY 1R4TA 4DGWB 2ZFWA 3JAMZ 3TO6A 4P96A 1YA7O 5JS5A 1JJ6C 4IHVA 3HXLA 2X6XA 3KP5A 3KETA 2L01A 2L7ZA 1A41A 2ETSA 3QYFA 3K1IA 4L9JA 1J75A 3QU6A 3SNHA 1S8NA 2LCHA 3BDDA 4BQOA 3LQRA 2BY0A 2P7VA 2LK2A 3A2KA 2HUJA 1K6YA 4B47A 2DA1A 4L5IA 1GUUA 4WXDA 5BS6A 3KEOA 3JAMK 2A68F 2LF7A 1YYJA 4WX9A 5DCMB 3K1IC 2X1CA 1UB9A 5L3DA 4N9IA 1VQNI 1FAPB 5JVGF 3GWNA 3EUHC 1V4AA 3G1MA 3I3LA 4UB8C 4XWJA 2XAHA 1QPIA 4ANJA 1Y6IA 3JRFA 3U2LA 1SD7A 5FLMJ 1RJ9B 3AJMA 1OCRH 4DJAA 2X0LA 3HRSA 1SMYF 2ADUA 1D0XA 2L54A 4LLCA 3U3BA 3HZJA 3JTGA 4K1OA 1HOMA 2FXAA 2Z9OA 2F5CA 1PCXA 2J9UA 2Y9YA 3OV8A 1TWFJ 2P8TA 2GZWA 5JHUA 1U9NA 5IPAA 5B1AH 3VYTB 2KQRA 2W00A 2WL8A 2X1EA 3LNMB 2MSYA 2DQLA 4ITVA 2VB6A 3CJNA 2WB1A 3DEEA 1TKNA 4Z9HA 5JR3A 3HNJA 1O57A 2O8XA 5E2QA 3CUQB 2VKEA 1ETKA 3JSPA 4RGUA 3ABMC 2ID3A 1JJ8C 1NFNA 3SDBA 4BQAA 5CVVA 3EJNA 4IRIA 2R03A 3EPZA 4BJ6A 2CDQA 3SYTA 2B63J 4WABA 2H6CA 1MNMC 2GXBA 2XAFA 4XQFA 3LFKA 2LSEA 1SVOA 1XCVA 2JSCA 4NNJA 4A3DJ 2DFEA 2DU9A 1FWZA 1V55H 2BXZA 3GTKJ 3T9OA 5EZHA 1DPUA 1MBJA 2FQ3A 2LF8A 1VF9A 1ZHXA 2RN7A 3HOYJ 3NARA 1T6SA 1HLVA 2CH0A 4Z9JA 5KYWB 2VJIA 5F64A 2HMQA 1B9MA 1MNDA 2WY8Q 3ZN1A 4FASD 4A0ZA 2A3SA 4E4HA 2NUTB 3FM3A 3R0JA 1DGRM 5DD8A 5BQGA 2QUFA 4W1UA 1A6QA 3B6AA 5DCFA 2K9QA 5FFZA 2VLAA 4V19K 1T6UA 2PBEA 2YEVA 2YUSA 1T01A 2Q0OA 4B43A 4EIYA 1NLXA 1GXPA 4FT8A 3E5XA 5GAGJ 5CKTA 4JZAA 2YR2A 4Y33A 5FD6A 1LJ9A 5A2QK 3S1RJ 2WZLA 3DKXA 5A6BD 3ZMDA 4D7NA 4I76A 3HGYA 2ZD9A 3H9JA 5D92A 2XSJC 3I9V2 2EBIA 3DKWA 5AIPA 1YJNI 2MLGA 4KC9A 2NS0A 3KMIA 3ZQYA 3EGXB 1KGSA 3VFZA 2IW5A 3T6JA 1HC8A 2LRDA 2E2IJ 4U87A 1WSUA 2A61A 3WE2A 1XGOA 3G50A 1MBFA 2E1NA 3TKYA 1YAUO 2Q2EB 5DDGA 2DA3A 4AYBA 2FEZA 4NBQA 2WAQN 4G7HF 2XC7A 1OPCA 4RAFA 4XOPA 1SD4A 3F21A 1P4XA 1FOXA 3KZYA 2MD5A 4U5FE 1FSHA 3UMIA 2J8WA 3H65A 2O6GE 3U9MA 4DRIB 2FMLA 4IOCF 4A5NA 3EYYA 1MZBA 4IKFA 3ZP5A 1YFHA 1G4US 4KMUX 3RKOF 2YRFA 2W85A 3TMOA 3EGDA 1X2NA 1LQ1A 1USTA 5DLJA 2HS5A 4XRSG 5ICFA 4AVZA 2LY2A 3FXHA 4I1OB 2HPIA 2NSFA 1FZPB 4BPMA 4E17A 5IP6A 2OEXA 5JLWA 2W9YA 2ID6A 1S7AA 1YQAA 5IT9Z 1MKMA 1J9IA 1WGXA 5CQGA 1VQOI 2JA8J 4LK1F 3SP1A 1P4WA 3DTEA 1WVRA 4N4OB 3MFNA 4EMSA 4A3MJ 5JVEA 1YLMA 1LVKA 4DZJA 2YPRA 2NVUB 5HLTA 3LESA 1P9QC 4AM3A 3LS1A 4GEHA 3ZSUA 3BR1A 1ZREA 5LHGA 5EG0B 2YKZA 4C3DA 3GLLA 2VBXA 5DCMA 1FTZA 4A3FJ 1ITYA 4XQ1A 5J4YA 3L7WA 1DOVA 1G4WR 2KSFA 1N78A 4HSTA 4UVCA 2LH9A 5HVQC 1FY7A 3M79A 2Y0SN 3FX3A 2CQ7A 4W8KA 4YN0B 2M87A 1GM5A 5FJ8J 5E1WA 4A69C 5A6AA 3POVA 4AE4B 5CIVA 2ZXIA 3A03A 4HX8A 4LMYA 1E3HA 3OSGA 2EPKX 1NG6A 4J7YA 2QE9A 1J0RA 3GEEA 1BI3A 3HHGA 2GIVA 4GYTA 3F8NA 2L0KA 3WGGA 3G1OA 2L5QA 2VE9A 4IHWA 5D5WB 5ICEA 1ZGAA 3OS0A 4IWBA 3B02A 3H5RA 1KQ8A 2RKHA 3JRAA 4IL6C 3DBHB 2ME0A 3CUQA 2A69F 3GFJA 4HF1A 1YYXA 2KRCA 2MWQA 4MTOA 1ZYRF 4CIHA 1XWJA 1CPQA 3JTLO 3QVZA 3CDIA 3U5SA 3S0XA 4GFBA 2OA4A 4KICA 1B8IB 3E9VA 3CD6I 4MVUA 2Q7RA 1OCCC 3L1MA 5L3BA 3IUOA 3GMEA 3TOMA 2E36A 2RDPA 3L2WA 1JHHA 2Y3DA 3PNTA 2FQ4A 5EGOA 4IX7A 1S9HA 2EA2A 1IN6A 4JCHA 1E2XA 5BQIA 4BH9A 4KT6A 4IRUA 2VQGA 1RC9A 1E17A 4M3GA 2CW8A 2YL1A 1TW3A 2F5FA 4DQ2A 3K2AA 2W7NA 2B9SA 2W4MA 2KJCA 4MTEA 3GEHA 5CQEA 4Q47A 4HNUA 1TC3C 1G6NA 4R1HA 2OD5A 3CCVI 1R4MB 2EIKC 3K4MA 1RJ9A 4L5EA 2Z99A 3RPQA 2CV0A 3CDLA 3H3VK 3ERMA 2ECCA 2H94A 3RJPA 2HMZA 2DODA 3L9FA 3CP2A 4Y7NJ 2I15A 4HRIA 4YL1A 3FK7A 1KU2A 1SFXA 1TT0A 2V4JC 1YS7A 3O6XA 1Z7LA 3QYEA 2AO9A 5ICCA 1FMWA 2CSOA 4RAZA 1YIJI 1JGGA 3I4PA 3UGOA 5HLHA 3WODF 4O79A 1L0OC 2LY1A 1MH4A 3EG9B 2NNYA 2WV0A 1U0BB 4Z9IA 2ESHA 3C62A 1SFUA 3EDPA 3LSJA 3CP8A 3RQGA 3I59B 3UMHA 4PSWA 5DYMA 2RQPA 3HB9A 3KX2A 4NQWB 1JUPA 3FK6A 4I3MA 3CMYA 2BY1A 3U1KA 1Z3IX 3RH3A 3PFIA 1VI0A 3FHDA 5JI6A 3RVYA 3FXJA 2QLAA 3Q0WA 2WAEA 2EFWA 5D4SA 2HFHA 1BM9A 3WTZA 2M0CA 1YIOA 4Q48A 2EWNA 1XPXA 3J81K 4AWXB 4OWRB 1Z6AA 2E1OA 4D4XA 2AWYA 2IVMA 3ZPLA 1D0ZA 4EJVA 3PIPF 1K4SA 1YW9A 1CF7B 1OR7C 4GQHA 1XD7A 2XLOA 3EGDB 1ZQ3P 3W2VA 4MTGA 2OTJI 3EG9A 1BBYA 3U2MA 5HV9A 3S90A 2DJNA 5CVUA 5D8LB 3AOUA 3NEUA 1EQ1A 3BPXA 1OW8A 4CS9C 3OWTA 1W7PA 3IAS2 2LP4A 3JT1A 4ZLDA 4GYGA 1D5VA 1BIAA 4A3LJ 4MQ9F 4B6IA 4MFDA 1KYWA 4UUVA 1H88C 2W57A 2EFPA 4F55A 2CCYA 2H7BA 2F5VA 2DA2A 1TWAJ 3I58A 3T6BA 3SQNA 5B1BC 2RD9A 1R6RA 1B59A 1FP1D 3LA7A 1HKTA 2A0BA 1VQMI 4EV0A 3W4YA 3R60A 3FISA 2QWWA 1YRNA 2D4UA 4IQ4A 2VUMJ 3C63A 3NAUA 1K61A 2JMWA 3C8ZA 1FC3A 3LSKA 3EH1A 4QPOA 2P0NA 2XF5A 3I0TA 1SD5A 4ABZA 4MS2A 4A5MA 4CS8A 1B72B 1W5CC 3R7CA 3HRTA 4C2TA 3VM6A 2KDOA 2LY9A 3G1LA 3PQKA 1BDJB 1U6GA 2O7OA 1NSGB 3WU1B 1T39A 1WHUA 3EGXA 2X0CA 5HSWA 3RQEA 4M3DA 4M6XA 1OW7A 3JYHA 2OC6A 3T0YA 4UB6C 1M2OA 1W2WA 3ZC4A 2MC4A 1V55C 3HRMA 1OYIA 5DD4A 2P61A 2QQAA 1ETQA 2CG4A 2OF7A 4FE7A 2MABA 3IH4A 3K2ZA 1YHQI 4HV6A 3DAFA 3DM5A 4XSXF 2EPLX 2GFHA 3DD7A 4H4KC 2FNAA 1PYVA 4A3KJ 2IGMA 2PBIA 1B72A 1JGSA 4P9UA 1MW7A 2KFDA 5C4JJ 5E3LA 3JSEO 2FX0A 3C7JA 3I71A 3DM9B 3HOSA 4JW1A 4OINF 2R7RA 2GXGA 4BJ1A 5B1AC 3ULQB 4A2UA 3NWSA 2JA5J 3I4UA 2W4SA 2MFZA 4JYKA 3ZXSA 3H92A 2IXPA 1LI5A 5JUAA 3KYCB 1O7LA 2XRNA 2OU2A 3RSNA 1BJAA 3LSIA 2BHZA 3VODA 2QLZA 1GV2A 4UUSA 2BBYA 5H2FC 1IV8A 1EKEA 1T33A 3HOWJ 2OJED 2VQLA 1SFEA 2BY3A 2HV7A 1O3QA 4G9YA 4JEBA 1X1BA 1V5FA 1X3WB 3IV5A 5B3SC 2R7QA 3LQQA 2UV1A 1RMVA 3BG6A 1EH8A 3J7AY 1C17M 3I5QA 4NC7A 4AYBN 2YHSA 4GDFA 4J30B 1ORJA 1RKWA 5FKKA 1JKRC 3LLIA 3HKZA 3A11A 1LNWA 3E70C 1YYVA 1O4XA 2HEOA 1DU6A 5TJ5E 2DTZA 3TEDA 2PX0A 3TGNA 3LJBA 2IGOA 3DPTA 4O5VA 2XL4A 3R0AA 2YX7A 1I1GA 2DA7A 2HU9A 2LR8A 4CCOA 1VFCA 1DP3A 3FHNA 3EUAA 4IVNA 1T38A 2XKPA 2MLKA 2KGOA 3K4KA 1ZARA 1MNEA 1DQUA 3OL3A 3MN2A 3TO9A 1J09A 3IRQA 3MEXA 2J46A 1D8JA 3X1OA 2QSGX 4B09A 3PSFA 2L4MA 4DZPA 5FRNA 3ZTZA 4E18A 2K9LA 1WTYA 3S93A 2L6FA 2P6TA 5DUIA 2HDWA 1OYWA 4WWCA 3W2AA 1IUYA 5EEHA 4C3IJ 2ZNZA 1NFOA 1B68A 3W2WA 3SYNA 2EPMX 2Y0SA 3FZVA 2W4BA 4XPWA 4I6ZA 2EINH 1NU7D 3PUBA 1U6HA 1GS9A 4WJ0A 2HKXA 3L1PA 1B8IA 1I27A 3QPLA 4TV7A 3GZNB 3W8IA 2PLYA 3S16J 5EYRA 1TNSA 1QQ3A 3R4KA 3LSGA 2F22A 4PJ0C 3AG2H 2DMQA 1W0TA 1OCPA 5EGOB 2FBIA 2ELJA 1E86A 1MJBA 3GEIA 3SZRA 2COBA 2L4AA 3CJQB 3V4GA 1V5GA 3PMRA 4CSAA 2RV8A 4JRZA 2QYOA 2KP6A 2RQQA 2STWA 2DN0A 2X1DA 4BUPA 2JVGA 1SZIA 5KK1A 2XM4A 4CYCA 4ESBA 1ULYA 3DKAA 4ZYEA 3WG7C 2DLLA 4AK9A 1FTTA 3ABKH 1Q0DA 2RNJA 5FKLA 3K7AJ 4UY8I 1OJLA 1QVTA 2KZVA 2WZGA 3IPMO 5TGTA 3KE2A 3GTQJ 4L9TA 3BLYA 5EDNA 3MX3A 3BG3A 3AGUA 4CSAC 2XXAA 3MWMA 3AG3C 5JHFA 3JTHA 1VQ7I 3IRRA 4YK5A 3FM5A 2OCCC 4P9TA 1RI7A 3IH3A 1PD1A 5JSLA 5EGYA 4RLQA 1ORKA 4EVIA 2M7AA 1MDMB 4CZCA 1GVDA 3FXLA 3LSMA 2OZ6A 3X2QH 1IJWC 2QUPA 2UUHA 4YT4A 2YLGA 2QVOA 2RSEB 3M8EA 2K40A 4BXFA 3LAPA 1JPJA 3JREA 2PF4E 3VB2A 1OQYA 2XGCA 4PUSA 1YX3A 2OCEA 1HE9A 1SR2A 4Z2YA 4KNVA 2DDAA 4LLGF 1A7VA 2IP2A 3TO7A 1U78A 2A5WA 1TWHA 1ZZPA 3FOPA 4HZFA 5CI9A 4ER9A 5ICGA 5JLIA 4KI2A 1F9NA 2VJ4A 3NRVA 4MVOA 4NQFA 1ZTRA 4YELA 2P5LC 3MFKA 2DCEA 4I99C 1FR0A 3J7AO 2OKUA 3VF0A 3HJCA 4PJNA 4CO8A 5FROA 3ASNH 2GQQA 2EIKH 2QEXI 1QVXA 4ZJZA 1FEXA 2B0LA 2A6EF 4UDVA 4AE4A 2VC0A 4LDQA 4ZTFA 3HNIA 4CSWA 1QO0D 2JPCA 2G62A 2XLMA 2LFBA 2XS8A 3FKIJ 1NZEA 5FO5A 3DU5A 3BTCA 3LA2A 1ZHZA 3FDYA 1B6AA 2A6TA 2HQAA 2K3FA 5ED4A 1YVIA 2BW3B 3QTHA 4P6IC 3M4BA 3GVAA 1E84A 3BEHA 4YT5A 1Z3XA 1BOAA 4UUSB 2PX9A 2HTSA 2XVCA 4B48A 5K5RA 4E70A 3OYFA 1VYIA 2HSQA 3C8GD 1JTYA 1VMAA 2BY2A 4Y3OA 5JVTA 4CGZA 5IYDJ 4BNCA 2BV6A 2FNPA 3VPRA 4HEAJ 3WTXC 3CCUI 1GLNA 3OYGA 3CEXA 3OYEA 3PO2J 4NCQA 2KIQA 3BR3A 6PAXA 5FRMA 3QU3A 5DS5A 1AKHB 2QQBA 3U1DA 3G4XA 1D1CA 4XL9A 1XB4A 2KRHA 2E1CA 3QYBA 4Y17A 2ESNA 1ETXA 1ST6A 1QBJA 3CO7C 1LPQA 4PJLA 2E7XA 2KIUA 1JT0A 2IRFG 1A7EA 1DOWA 2XV4S 4ZYDA 4IHYA 4M3EA 3S9OA 2HWVA 1TZLA 2RAEA 3S84A 3GBGA 3DBRB 5D6FA 3TOLA 3RFYA 4MTDA 4JX6A 3I53A 2DMUA 2MH2A 4PJMA 1PD0A 1OW6A 4YG2F 2Z3YA 1JXSA 2NVXJ 2EPFA 2ZJPF 1J7KA 1SAUA 4BJTA 2EV5A 1NU9C 1T6IA 1KQ9A 2J45A 3ZGKA 3PIOF 2KISA 1RKCA 5KHDA 2WB7A 2Z15A 3BJAA 2HJ3A 2A5YB 4DRHB 5GTIC 3FXKA 5M5YJ 2QF7A 3IHUA 4J7TA 5FKNA 2EJRA 1P2FA 1ZU4A 4EM0B 3TK0A 3CDHA 3TOBA 3FAPB 4MVSA 5DVWA 4GYIA 3RDIA 1T0FC 4KIBA 4LERA 4EJOA 2H1KA 2VCBA 2DDBA 3OR1C 2YL0A 2KZGA 2WY7Q 3OOPA 5CVJA 3JRBA 1E3OC 1F36A 1K6OA 4YFKF 5HS9A 2DFHA 2XUBA 1IN8A 3HPGA 5B5EC 2PI0A 2B0HA 2E87A 2W84A 3ZQFA 5FFXA 2XSDC 1YOVB 1Z91A 3BTJA 4FE4A 5E3OA 2VOOA 4QDLA 2DT5A 1B9NA 2EZKA 4IB4A 1T0FA 3BC8A 4MEXF 1R1TA 3C1DA 1D5YA 5B66C 1AOYA 1VOMA 4F4BA 2OOCA 3V8KA 1LVAA 4I98B 1YX5A 1ZR4A 3T1BA 3KCCA 2IS4A 1RCPA 4I01A 2RVCA 2MG4A 3GFMA 4A0XA 3DLLF 2VH3A 5CPRB 3W8HA 4M73A 3S17J 4B1RA 3MKWB 3SHFA 2MHRA 2G9WA 2VC9A 2M34A 4GGGA 4CICA 2OAZA 2G3KA 2E2JJ 3KP4A 3QPHA 4O3MA 1QZYA 3A0BC 3RKQA 2OU6A 1RXQA 5LHHA 4LG3A 2L6HA 3LEOA 4E7SA 1EH6A 1HW1A 3GWLA 1SANA 1YE9A 1H6GA 5B1BH 4XLFA 4C3HJ 2V6EA 4E7ZA 4YFNF 3G4SI 1YTYA 3CESA 3E0JB 1QGPA 3F8FA 3OYDA 1O3SA 4MW3A 1FNTc 1YI2I 3K4JA 1MSFC 1T56A 1LM3B 1HF0A 2HTJA 2ZFUA 2R25A 1I50J 3KP7A 3FMRA 2OUMA 3C2BA 3BZKA 1NG1A 3MAJA 2V1DA 4Q4ZF 2VKVA 2HYFA 3QODA 2NPUA 3CLQA 1TQIA 1QHHD 2A05A 3J7ZI 2Z33A 1I1SA 1XCBA 2MW8A 3HOTA 3CJTB 1XDUA 3F6VA 5A6BA 3HTKC 2XLWA 3AG4H 2VONA 3RQIA 3W3CA 3AGTA 2VKHA 3Q6NA 3PM1A 1UCRA 2L02A 4M3FA 5K1YA 1NK3P 1BW6A 2R7TA 2EILC 3VYSB 2EIMH 5LGNA 2BL2A 3DZAA 1G3YA 4ONSA 2CQQA 3VRCA 2Y9ZA 5AONA 2KJBA 2UXXA 2GA1A 5F6FA 4LG0A 1XMKA 2L9NA 2VI6A 2XGXA 2Q8KA 1IDZA 2M45A 3ECSA 5L3QA 3ZMSA 4RMNA 2IGKA 5DEQA 4A0YA 3RIPA 2IM8A 4NQWA 1OCRC 2Q9BA 4JP0A 4O6NA 1D0YA 3H3UA 1B1BA 3F0CA 2K7LA 3E6BA 2YVKA 1X3UA 1VQ8I 4C7OA 4R8HA 2LQGA 1LE4A 2DPDA 3TULA 5KVRA 1XDSA 1VB5A 2EPOA 5AIQA 3HOUJ 4BU2A 3K1HA 4KN4X 2KYHA 3O39A 4LB6B 3HRUA 1F4KA 2DOFA 2DXIA 2IA1A 1HKSA 3LL7A 4JVSA 3DQVC 3WU0A 1R23A 4LLLA 3CCJI 1J59A 1DDNA 3QZCA 4IHTA 2OTLI 3BJOA 5KYUA 1FT9A 5F0FA 2DFIA 3C2GA 4KITB 2UZKA 1QLEC 3PO3J 1TQPA 4N6CA 2V26A 3DPUA 4CJGA 4FISA 5J3LA 1Z67A 1EA8A 5CYVA 4EUKB 5TISC 5BQTA 1ORSC 4KIGA 2Y69H 2EV0A 2F5DA 5E3MA 3AG1C 1SMTA 4IAQA 2HSBA 4JQFA 2X85A 4XPXA 2DOAA 2Y2ZA 2FFHA 1X19A 3HUGB 3ZWIA 4FX0A 4NTFA 4B44A 2C03A 3MZYA 4KN7X 1LS1A 3RCOA 2DB4A 4OAZA 4IARA 4DRJB 2CW0F 5K7FA 2CGEA 5HDNA 5D91A 2K9SA 3DFGA 3ELKA 5F04A 2NVQJ 2L9RA 3I5PA 3ZMVA 2NSGA 3OYBA 1EF4A 5LGTA 4JTAB 3LAJA 2H1LA 1Y0UA 1T9KA 3KLOA 4HG2A 5BQHA 2P1AA 2DTRA 3F8MA 1H8AC 4X6AJ 3S14J 1LEBA 2CQXA 4CCMA 3ITFA 3DP7A 1F1MA 4I0AA 2IOQA 3IQTA 4BEJA 2H6BA 1W36D 3E1SA 3NYMA 3OR2C 3HC7A 4O7GA 2EINC 3ZQVA 5IY5C 3D5RC 3RIRA 1MH3A 2VCCA 5COFA 3OL4A 4BY1J 1IV6A 3H36A 3A0HC 2LD5A 3TP0A 3P7NA 2HVSA 4A3IJ 1J2XA 5EF6A 2IXMA 1XSDA 3BT9A 2LKXA 1TWCJ 4RBNA 2KMUA 5HS8A 1GVJA 1W5SA 5E3CA 1B4AA 1I6XA 1WFXA 2AHQA 4HSRA 1VZ0A 4ZDPA 4DVYP 1YW7A 4YT2A 1WOLA 1EI7A 2FAPB 2R05A 3DWWA 3V5ZA 2O9XA 3T8TA 3L2UA 2D1HA 3WE3A 3DEWA 1WZ2A 2H27A 2J7PA 4MHGA 2Q00A 4XONA 1Z7UA 4HDUA 1VTNC 3M4CA 4NY3A 3MZHA 4XLAA 2ZMEA 3SXYA 4U0YA 1ETOA 2R7OA 1R9TJ 1Y1WJ 1KNYA 2KNHA 2PJPA 1O3UA 1QPUA 1WJAA 2VE8A 3S2WA 5DS9A 5K7ZA 1R5HA 1APCA 4GO1A 3HOVJ 4XM3A 2YL7A 1ZHFA 2MBFA 2V9KA 2XXAB 4DYQA 4IQJA 5BMZA 1D8KA 5GPGB 1TWGA 1VQLI 3HGGA 2BE5F 4RLFA 2NAZA 2FF4A 3DXJF 4EGZA 3F47A 2VODA 2XPVA 2HI3A 5CVIA 4YIIA 3IQ6A 4BHCA 5J8CA 1IXRC 4CHUA 2EH3A 3TDZC 2IXSA 1IC8A 4BEHA 4U5EE 3RPUD 2BZTA 5J4VA 2X6WA 4AD9A 5BPDA 1R4NB 1Y8RB 1UG7A 4LG0B 1OCOH 2M1BA 2W82A 1YITI 3K10A 4CXFA 1A6IA 2JN6A 3BOQA 4A2NB 2OV7A 1IRFA 2LDUA 2JJ7A 3MD2A 3B71A 4MFEA 1F1ZA 3KFWX 3SZPA 4NB5A 3OYMA 4G7ZF 3U8PA 3MKYB 4BJ5C 5DQTA 2HKVA 2LBFB 4YJWA 3FVYA 1R1UA 2O3FA 1L3LA 3DBLB 3ERED 1ON2A 1Q1VA 4U5GA 2PX3A 4NC8A 1YS6A 2G7HA 3ZQQA 2WWYA 4IHSA 3AFHA 2A0UA 2J0WA 2VN2A 1TR2A 1KTMA 3DJNB 5FLVA 5KYWA 1K79A 4LJZF 5LRRA 2OG2A 3GF2A 3P5JA 4XRFA 4DW6A 3ZCOA 1OCCH 3CMMA 3PSIA 3NRHA 4BHPA 3GTLJ 5IOZA 4CYCB 3K9TA 1AWCA 1PVEA 4CCNA 1YZAA 2NUPA 4K7BA 1O87A 3NMIA 5E8IA 5COGA 2JPBA 2P5VA 5KAFC 1LDKB 4PACA 4FCYA 3W6JB 5E8GA 4A6EA 1MBEA 2WBMA 5D5UB 2CYDA 3M07A 4KMFA 5CLSA 1RESA 5IP9J 4ENNA 3PL8A 3ZDLA 4BY7J 2RNGA 1UFBA 2IBFA 3FXRA 3RPUA 5CVRA 1AKHA 2TRTA 4N4WA 2L7MP 5E1ZB 5IP7J 4E7JA 3FMSA 1FSEA 2ZXJA 2VCAA 2Y69C 4MNDA 3K4BA 2XAUA 2LFFA 2F5EA 1W7PB 4UVBA 1Y4CA 3HNKA 3K69A 3OS1A 3KYDB 1E83A 2BEOA 2CV2A 1ZVZA 2X6YA 3MCZA 3KP2A 3CUOA 3WTVC 3BQZA 1I4YA 4UV9A 1HMOA 4C7OB 2L7AA 1Y1VJ 2AQEA 2KIMA 1PUFB 1Z05A 1EKYA 3J7YJ 2HXIA 3E7LA 2F4IA 4JC7A 3DLAA 1HSTA 2ISZA 4Z6YA 1G8XA 3ECHA 3QOEA 2PEXA 3G3ZA 5L3EA 2WZFA 1Q0MA 4NTAA 1K4TA 4N0BA 4C30A 2QKMB 2XS1A 4Y13A 5HS7A 4YL0A 2EZHA 3GTJJ 3JW4A 3WTWC 3CSKA 5HDGA 3EFOA 4XEKA 1X2MA 5GAHJ 3SXKA 2CYYA 3TW6A 1IF1A 1V3FA 3M9AA 1K05A 1DPRA 2V3CC 1FBQA 3BROA 4ZC3A 3ZVRA 1GV5A 3O10A 2AS5F 3QPSA 1OKKD 1VTMP 1OCZH 1FNNA 2NXNB 5F5HA 1P7JA 1HCRA 4C3BA 3K6GA 3OYCA 4II3A 1FLIA 4XRMA 4Q5SF 3IH2A 3O8HA 4CX9A 4HDVA 4PSXA 2M4EA 1U2WA 2F2EA 2XPWA 5HOOA 2A1DD 5D6EA 1Z21A 3U2RA 3ZN0A 3BR0A 4BS9A 4YRVA 4PDKA 4PGHA 2MGQA 3EFOB 5IYBJ 5IYCJ 1BR2A 1BN5A 4AL1A 1FFTC 4F92B 5IT3A 1MJ9A 2V9VA 3J81Z 4HPQA 3E6CC 1YJ9I 4IHXA 2O03A 4NDLA 2HYJA 2M5WA 1P6RA 4XBFA 1LE2A 2P5KA 4I02A 2M8GX 2Y0MA 2XPUA 2VASA 3Q0UA 1WN0A 3DE8A 4WF2A 5BUOA 2HR3A 4EM2A 3FIWA 5FGMA 4BG0A 2DBBA 2DW4A 1BI0A 3I5UA 1SFKA 5TRDA 2OCCH 4QWQA 3V5XA 4FQGA 4M9SA 2VBYA 2PN6A 1XGSA 3KEQA 1ERDA 4ZDOA 1HDDC 1Z6TA 2ME6A 2D1VA 3BY6A 2F6CA 2L3DA 3NYJA 3OYLA 2XRLA 2LVSA 1POGA 5E18F 2ZPAA 3OS2A 2HZTA 2ICWG 2CU7A 3F22A 2M8EA 2YSRA 1TWGJ 3FOOA 2PFDA 3JYYA 1FOWA 4RM3A 3KYJA 2KLOA 5E17F 1GGQA 3OA1A 2KQ9A 4BJ5A 4CBEA 2MD0A 3DAGA 4G7OF 1IDYA 2Y48A 3L34A 5EEAA 2BVLA 2HNHA 2JVHA 1HY5A 1X3ZB 3GXOA 4M72A 3SZTA 4X1EA 1SYQA 4EKWA 2FOWA 4E0IA 1U3EM 2LKSA 3ZQCA 2XM0A 1WRJA 1R1VA 5J8FA 2XF7A 2MA3A 3V7SA 5GADJ 3ZTMA 3Q0VA 2NUPB 5L0IA 2V1UA 3ASNC 1Y8QB 2Z16A 4LGWA 4K0DA 1IN4A 3BG9A 5GPAA 5IT9K 5L3CA 4U88A 1K04A 4JOMA 3G2BA 1QQIA 3RW0A 4ZZLA 3L8JA 3VYWA 4WXCA 2HVRA 4QPQA 2JA7J 2IXOA 1FPQA 2R7UA 3UR3C 4XKVA 2KL4A 1STZA 3E3VA 2DK8A 4HOBA 4GXOA 3IQ5A 4NHJA 1TWHJ 5T3TA 3I59A 1QZXA 3KZIC 3UKGA 4BE1A 1QRYA 2FBKA 4IJAA 2XIGA 5F08A 1LI7A 2KPMA 1Y39A 2VXDA 3OMYA 2XL6A 2LBFA 3HTUA 2R7FA 2VKDA 2I10A 3S1QJ 4II2A 4PK4A 1PUFA 2QTVA 1H9TA 3ABMH 3WHBA 4OIQF 2IEKA 2ELHA 3BWGA 3DV8A 1JKOC 2DMNA 1LFUP 1MSEC 1XGNA 3DWLE 3K1NA 3ML6A 3MZ8A 4AIJA 2PNOA 4MVRA 5E79C 3N24A 2TCTA 1X1CA 1UG2A 3VYUB 1VYKA 3J80Z 3ECOA 2L81A 3L2CA 1OXBA 4HV5A 3GM2A 1HQCA 3M7GA 5LD2C 4JTDB 3H9GA 3IC7A 2VJ5A 2LG4A 2W25A 3CAXA 4U0VA 4G8XA 2XGEA 4MTFA 1IXSB 2VQCA 4F52A 3N97A 4NTBA 2AQFA 1LUJB 5COMA 1Y0NA 3BPVA 2E2HJ 2NRAC 2LFDA 3S28A 5L0FA 3SXMA 3V7OA 2R7VA 3HEFA 1EH7A 1LFPA 4U7BA 3K70D 2AVKA 2E60A 4N06A 2NVYJ 5HDKA 3BG7A 4KT5C 3S27A 4U0WA 1CPRA 1J8MF 2P4WA 4HF0A 3DU6A 2H09A 3V42A 5E33A 3DEUA 1YRNB 1OR7A 5H6RA 1TNTA 1OISA 2DA6A 2NNNA 1WKMA 4D5CA 2M64A 2VBWA 2Z5UA 3CCRI 3HSFA 4BQQA 3X2QC 4ZDLA 1SEUA 4IF4A 2QENA 3KYLA 2R9RB 3UGPA 4RS8A 5F1RA 3LSPA 1DU0A 3CQZJ 4PR9A 4J01A 4XMYA 4B4CA 5HNHA 3MYIA 1FP2A 3TP3A 2JX0A 3WHCA 1I3AA 1NG7A 2K9MA 3AL0C 3SEOA 4XK4A 3MLGA 1T8IA 4DOZA 5KYUB 1TQMA 1CGNA 2ZMEB 2XL8A 3N2ZB 4XN0A 2IJLA 5L0GA 4L18B 3N05A 2IYLD 4OIPF 1ZHTA 3RKXA 3WG9A 2WAFA 1Z6RA 1YDIA 1X1AA 4N9HA 3TDUC 1XC5A 2RGVA 1JR8A 3FXUA 2JWTA 3VWBA 5AGFA 3H0GJ 3K0LA 3GO5A 2V9PA 1KONA 3DMDA 3ZIBA 2GIZA 4CS8C 2M30A 4IGGA 3NKDA 4BDZA 3HUGA 3PFYA 5JRAA 5A6JA 4HE8D 1YG2A 3RQ4A 3GCMA 3RYPA 4JX5A 1TBXA 3K4LA 4RA2A 1IN5A 4MVMA 1BR1A 2CJJA 4EBBA 1EV7A 1AUEA 1RR7A 3LS0A 2VOPA 4WXHA 2AXTC 3H9QA 1OCOC 4HF2A 3C3WA 3L09A 4MEYF 5FB2A 2ISYA 4FWVA 2J9BA 4FX4A 4RDAA 1M57C 3ABUA 1V5EA 4FESA 5KNLA 1VQPI 4BGDA 4RBOA 2K5CA 4HFFB 4U9DA 3KYIA 1QPMA 2Y31A 3OYHA 2YLIA 4QI2A 2QZ8A 4O6YA 1MIJA 2ZXWC 2DPUA 1F5TA 1Y6DA 4XEFA 3GORA 2ETHA 4A3CJ 2ZXRA 5LGUA 4XN3A 3LMMA 4ASNA 2L2OA 1WASA 4JEAA 1RKEB 2J5PA 4NC6A 1FJLA 2ZB9A 3SEZA 3PCVA 3B6CA 3K1PA 1PJRA 1MBGA 4ENKA 3QQAA 5GP9A 3JRHA 1JHFA 1XZPA 3L8IA 4U5CE 1K78A 4BQNA 2LMDA 5EJCA 1VQ5I 2OQRA 3EPVA 2PG4A 4L9VA 2NVTJ 3SEQA 5LFAA 1BI1A 3KZZA 5J1YA 3CUQC 2VPLA 4EJWA 3K70C 1WJEA 1FFHA 1MJAA 1OFCX 1ZH5A 1JAFA 2N8GA 4OAYA 3G73A 2R93J 3Q7GA 2HOAA 4BJ6C 4EJUA 2OQGA 2Y30A 4D5FA 4HQMA 4L5JA 1UHWA 1O5HA 1T08B 3GTMJ 3GM1A 1U8RA 3AG2C 3ATPA 3UMKA 3A02A 2X51A 2JT1A 1USSA 3GFLA 3HSEA 1N25A 3EHMA 4ZLCA 1CQTA 1MBKA 4HNTA 4OMYA 3V7CA 1I3QJ 3VOEA 2FUG2 2Q1ZB 1FOYA 2D5RB 2H7VC 1R49A 2LTPA 2R02A 4J00A 1S7OA 1WCMJ 1DUXC 2NS8A 4RGSA 3GTGJ 3PNYA 3WU2C 4D1QA 1WI9A 1TWAA 2XSEA 2I8DA 4BL0B 3DCFA 1YJWI 1G2HA 4RB3C 2H7OA 2ZCWA 3J06A 4EBKA 4BEHB 4M74A 1UMQA 5L0HA 1V4RA 3E97A 4CJOA 2O9LA 1LPEA 4IAOA 3M1CB 5HLIA 1HXDA 4HQEA 1BC8C 1WWXA 2ECBA 4XKWA 4EM1A 1IN7A 3B0VC 1ETWA 2FJ1A 2K86A 3BR5A 3M8JA 4OOIA 1IRXA 2K4JA 2GAQA 4U5DE 4G94A 4A6DA 2CUEA 1PP7U 2CS3A 3NMKA 3FXQA 1LE8A 5KYYB 3S29A 4C3EA 4N6HA 2NUTA 4ETSA 5DTDA 1OYYA 3RZDJ 2DYSH 3RF3A 1KQ0A 3MKZA 4RAGA 1XN7A 4E7KA 4A3JJ 3HIFA 2IS2A 3ABLC 1LIHA 1U8BA 1ETYA 2ZC2A 2CW7A 4B8XA 1WPKA 3BZ6A 3N4MA 1H0MA 2DJIA 2C6YA 4A3BJ 1ETVA 3KKBA 3QAHA 2JK3A 2HVQA 3J80K 3N0TA 3DE9A 4LLNA 1HW5A 1OQCA 3H2VA 2M2EA 4QSHA 2QM3A 3I56I 4AIHA 1I6HJ 2R7WA 3MQ0A 4MLOA 3RVZA 4MVQA 2VXZA 1L7CA 2FGYA 5TJJA 2DO7A 3HOZJ 5T1DB 1J8YF 1TLHB 2A6HF 1ZLJA 3IKTA 2W1OA 2CGPA 3HJEA 3CC7I 4ZTJA 1CGOA 4CS9A 2JTVA 2B0JA 5HLGA 2YL3A 3JZ0A 5BPIA 1XX5A 2CFOA 1ZW2A 3JRMO 1LFBA 1Q0KA 2G0EA 1KYZA 2FD5A 3I4MJ 3QP6A 2QBYB 4IRGA 2DOEA 3WGIA 3G71I 5BOXA 2X9DA 3I54A 1ZRFA 1M2VB 1IUFA 3LFUA 3JSZA 3QVYA 2M4GA 3RQFA 3K7DA 2KHMA 3FBIB 1V54H 2JA2A 2HGCA 3BQYA 3WTTC 4FETA 2G7UA 3SDGA 2F4OB 3F8BA 3U21A 2CWEA 4C9YA 1Z63A 1ENHA 2DMPA 1E3PA 4M3BA 1BC7C 4UXNA 5H6QA 2GWRA 2DK5A 4KNYA 4P9FA 4DVZA 3I4NJ 1BJZA 2HYGD 4BDYA 5A2QZ 3RKWA 1Y56A 4ZYGA 3E5QA 1W36C 1YA9A 1R71A 3O8GA 5DUKA 5M3MJ 4N4NB 3BCBA 2NOJB 3VSLA 2LKPA 4IPAA 5E20A 4LITA 1SVMA 3M8FA 1XSXA 3JSOA 4EGYA 3JRCA 1HBXG 4OD4A 3H3ZA 1AVOB 2KC3A 2OEVA 3VAYA 4EEFG 1RNLA 5J6XA 4XLNF 4ZYHA 3OIPA 2Y75A 3MMYB 2Q4FA 1IXCA 2VT3A 4D9JA 1JOGA 4L0ZB 1UHSA 1X4OA 3VYRB 1ZW3A 2H8AA 4CIPA 3B0UX 1NHAA 3S8PA 2Z1DA 3ESWB 1CGME 3L2QA 1V74B 4P5OA 2ZJRF 2LLKA 1ZRCA 3HLZA 3FHZA 1RKTA 1SD6A 4B3AA 1R7JA 4DYRA 2OZUA 1VQ6I 2BXYA 2V79A 3WTYC 3PJRA 1C02A 2EA4A 1S5LC 4BE0A 3SFZA 5LBQA 4W97A 2HPMA 2FOKA 4EWCA 2YWAA 4JBAA 2PJRB 3MYFA 5A69A 3S3MA 3ONQA 2GA2A 2G3VA 1MMGA 4M71A 1O3RA 1CGPA 2GA0A 2CMPA 3GEZA 4IRHA 1H89C 2JRMA 1VLSA 1ZG5A 4E7HA 4JIOA 2QSHX 2L7KA 5K5OA 1RETA 2JA6J 2WV1A 2ZXPA 2M0MA 3L2RA 3FBNB 3GUDA 3H5AA 1PV3A 2GXAA 1T2KA 2R5YB 4ZZDA 1IO2A 3D0SA 4LK0F 3QMKA 4C2UA 4XRSA 5J1RA 3ZQIA 4CUGA 2KK1A 2R7XA 4AX2A 3GWZA 4W8PA 3M1EA 2WVOA 1A0BA 1LDJA 2QGUA 2HOTA 3JRTA 1RUNA 4PFPA 1W7PD 4HLYA 1ZGWA 1Z5ZA 4S04A 2J0XA 4U7DA 4Y4RA 1ZGJA 5L0DA 1RKEA 4QIWN 4IXAA 4L9NA 4XOTA 3UNGC 5C4XJ 2E34A 3GFIA 3ZQLA 2HFIA 4DIQA 3SXZA 3JR9A 1ZKGA 3REOA 5FD5A 4IEJA 1U0JA 2GOMA 2IAIA 3H5NA 3ZMUA 4EQQA 4KIFA 4M63A 4HYEA 1K78B 3CCLI 2IT0A 2R3SA 5L0CA 1LDDA 2I8BA 2LOOA 1UHMA 1WWPA 4JJFA 3M3YJ 2IS6A 2XGDA 1K83J 1ZG1A 3HHHA 2XKOA 4KBLA 4JE9A 4KJZA 3LA3A 2L9VA 1QKRA 1Z9CA 1Z77A 4KYWA 2DYRC 3L0IA 2GBYA 4O6MA 5JT4A 2XB0X 3DKYA 3NWTA 4UNOA 5KYXA 2CUFA 2EILH 4I44A 3LWFA 5LLQA 4DYCA 1SF8A 1MMNA 2PP4A 1YW8A 3H2UA 2QQ8A 1KA8A 4XSZF 4HNVA 1W5TA 4YFXF 4L6RA 1WQ2A 2L7FP 3CCYA 5DM6F 3IL2A 2J7PD 4G6QA 4XORA 3KH2A 2K3PA 1T98A 2P81A 4BXUA 2E35A 3SZGA 3WTUC 3FAJA 3FDQA 1GT0C 1SVLA 1BL0A 1ZRDA 3E5UA 5BNGA 3C2HA 3K33A 2CO5A 1ZR2A 1A35A 2GWWA 3CF5F 2DT7B 3OYJA 4NUBA 4RAYA 3M1CA 2VQHA 2XLVA 2Y3HA 2CRGA 2XDVA 4G12A 3AAFA 3CCMI 3HBLA 3WG7H 1XG1A 5KYNA 2CQKA 3LSTA 5J47A 2QCOA 4F91B 3CQZA 5LRSA 3HKZN 5B3IA 4HA8A 2DAOA 1LS4A 2Y3GA 5DV5A 4F7ZA 4X0RA 2A07F 3G6EI 1HMDA 2K4BA 2LC2A 3BCAA 4EHPA 1F43A 2Q2EA 3I64A 1KU9A 4JX4A 2EIMC 4XEVA 4XKCA 5AC5A 3RYRA 2E71A 1MGTA 2HOSA 5DQZA 2M4KA 1JUSA 1Q1HA 3K6BA 2PMUA 1R36A 2XRHA 4RB2C 4BYYA 2K85A 4LFUA 4MVZA 3AG1H 4WGYA 1UAAA 2YX4A 4BKXA 1OLTA 2ZXWH 3FXMA 2EIJH 3Q9VA 2PMZA 1UZCA 1Z7Qc 4JKVA 1QSPA 5EZGA 4KA4A 3CMAI 3US6A 5EK0A 3JRIA 1NH3A 3BTIA 3ABTA 4XLPF 2FE3A 2X6OA 3ZG1A 1RRJA 2D2WA 2JUGA 2ZJQF 1MMDA 4M9ZA 2PMHA 4E7IA 3TOAA 2EFNA 4ULVA 3C8GB 2DI3A 3Q3SA 1JMWA 1VNDA 4HX7A 1I4ZA 3HM5A 2FMYA 3T8RA 1O3TA 2CQNA 2DQRA 4KUMA 3NMJA 2GLOA 2BYVE 2LNBA 2E1MC 3D5SC 3IWZA 4AL0A 2JZYA 3BJ6A 2XROA 4P1WA 3BZCA 3LAYA 4CS7A 2KJGA 1IZ1A 3VDXA 1M2VA 4UHTA 3PHF2 2R5ZB 2GM4A 1U89A 5D5XB 1QVUA 4RB0A 2K27A 2FBHA 3Q7LA 4PGGA 3O3KA 2R92J 2EQRA 4HW0A 4YIFA 2QBYA 1ACIA 2WVQA 1UG0A 4PCQA 5FKMA 5L3FA 3K66A 3T6GB 4CZZA 1N1CA 5LEKA 1WATA 4PFOA 3V5YA 4YWQA 2Y3BA 5F0CA 2GDCA 1EJ9A 1TP4A 4S0HB 5GAEJ 3C8GA 2KKOA 3U3FA 3MKLA 5H20A 4M6YA 3OYKA 5CJ9A 1WGWA 4JTCB 2JSPA 3LSHA 3CMEI 5ILUA 2YU3A 1FMVA 4RD9A 3F3XA 3GTOJ 2PMZN 4KNWA 1GXQA 4FHTA 3GZ6A 4ON0A 2E5NA 2V1XA 2OQMA 2K02A 2R0QC 2YQYA 5L0JA 3CC2I 2LYCA 2ZNYA 3IKVA 4A3GJ 1PP8F 4D4NA 1TTYA 3HYIA 3U8VA 4YT8A 4AIKA 2JQ7A 1TFKB 2R7SA 1A7DA 1ZN2A 4XKBA 3ZMZA 3PQJA 4H0EA 1T6QA 4AU7A 1BI2A 2IGNA 2UXNA 1D3YA 3QPTA 1RIOH 1JKQC 1Q0FA 1AHDP 5AC4A 3ZQGA 3EZHA 3JRGA 1I5NA 5D8KB 4E0HA 2L9JA 3CLOA 1K40A 1Z0XA 3LSRA 1BW5A 3S1MJ 3G4ZA 4KDPA 3BTLA 1G4DA 2MC3A 4BAYA 3GW2A 5LHIA 3L2VA 5EHHA 3K4NA 4IZZA 1QA6A 2FU4A 1R5ID 3EQLF 3QRFF 1PDNC 2O61A 1YARO 1TW2A 2RC4A 5KYXB 2WTEA 4XLCA 4MGRA 9ANTA 1FTSA 3DTKA 1Q0GA 3ABLH 4V2GA 1V54C 3VEPA 4LACB 5KYYA 5FLXK 2YLDA 4PJJA 3LNQA 3OEOA 1OCZC 4ZYAA 2QNLA 2QY9A 1MD0A 1LEAA 4J32B 4IO9F 2HZ8A 3S3OA 2ZBKA 4DBRA 4RGRA 1G3TA 1JT6A 3O55A 1M56C 1A04A 2AU5A 2MYSA 3U9JA 2V1NA 4HBLA 4G6DA 1OXKA 5ILSA 2R5YA 4WK8F 1XSVA 1OKRA 1O7FA 2IS1A 1JTXA 2JUCA 4WCGA 3BRJA 4ESJA 3Q6MA 1FBUA 1BIBA 1FIPA 1OR3A 3B9QA 1U5TC 2FRHA 1YJGA 3V8LA 3MVPA 4D0PA 1XZQA 1IRZA 1AEPA 4J19A 1AA7A 2M3AA 4G6TB 2FA5A 4MO7A 1REPC 5JFRA 3F23A 1BA5A 256BA 2EPNA 4HLXA 2ZSIB 2J5OA 3F8CA 5KAIC 4OIRF 2YU9J 4LDRA 3PDMP 3FF5A 3K4CA 1P4AA 4BEMJ 3MBGA 1U5TA 1ZLKA 5D4RA 4KISA 4R79A 3A01B 1A31A 1H9GA 3QWLA 4BXXJ 2RREA 4OU0A 1QZEA 1ON1A 4CCLA 3QW0A 2ZKZA 1W4MA 2FSWA 2C04A 2DYRH 3D5LA 4AUXA 3S2HJ 3A4CA 1JPNA 2BHYA 2EFQA 2AWCA 2IA0A 3W6VA 1C0WA 4HFKB 2I5UA 4UVAA 1C03A 2P6VA 3FXOA 1S7ZA 1FX7A 4WGZA 3DPLC 1K7AA 1WJFA 1ZG3A 1DP7P 2KW3C 1MDMA 2HDDA 5F27A 2HQNA 4ENMA 1X1PA 5DS6A 4OMZA 4ENJA 3NYLA 4U5BE 5FCLA 5E1XA 3IEEA 1ZU5A 3CCSI 4LOCA 1WJ5A 2KIFA 3PUFA 2MH9A 4XR6A 4LB5A 3WAQA 4FAPB 2HXOA 1OMIA 1QZZA 4EATA 3S2DJ 2R7DA 1WJBA 3L00A 3WGHA 2WC2A 3GYHX 1LE8B 4GRIA 4NC3A 2YZSA 1R22A 2F4MB 3BR6A 1I5ZA 4XPYA 1SC7A 1AU7A 1TFOB 3GM3A 2ELKA 2ZXHA 2HKOA 3F6OA 4DXWA 2W48A 4HX4A 3TJ6A 1RUOA 3EHNA 2XLEA 4XLEA 1TT5B 3KP3A 2CUJA 3C18A 3RI4A 4EBJA 4CDVA 3HSRA 5K0IA 3BR2A 1IZMA 2ZXOA 1FBSA 1W1WE 5B3SH 3KEYA 5M5XJ 3IAM2 2R7ZJ 1S6LA 1VLTA 2WADA 3IP4B 2VJJA 2XASA 2E7WA 3B0PA 2IPQX 1FOKA 4RDUA 2KDZA 2Q9AA 3DJUB 2ZO4A 1Z3YA 4GCVA 2XAQA 1XMXA 5C3EJ 1YZCA 3AQCA 2VIXA 4RB1A 2WA0A 4DNCA 4JURI 2M9HA 4I09A 4CCKA 1LKXA 2EIJC 1QNTA 3T4RA 2V7FA 4BHBA 4M6VA 1X1DA 4A12A 2PJRA 4YL3A 3VSKA 1ZAOA 2QQ9A 4CDYA 5FZTA 5IY5H 3OYNA 4CYDA 4PZJA 1NTCA 2J9VA 2EFOA 3NKEA 5KCMA 3RKYA 1HSJA 3KLNA 3W6KB 2P7CB 5F0HA 3F72A 1XMAA 2JPUA 3TD7A 4BE2A 5K5QA 3COAC 5IOYA 4UUTA 3CCQI 1BR4A 2NOGA 2E5ZA 3JCUQ 1IW7F 2GAUA 5D5VB 1IG7A 3HTSB 1S7EA 3OOUA 4OIOF 5GTHC 3FKJA 3M4OJ 1E85A 2L9SA 3CF2A 3AL0B 4Q7CA 1FIAA 1FYMA 2QSFX 4ZH4F 1KU7A 3ZRGA 3BG5A 1WJCA 2LIGA 4LDKA 4A3EJ 1JUMA 2O0YA 2P0WA 4LD5A 5K7HA 1S72I 2WVNA 4RGXA 3ASOC 2HOEA 3SFIA 3KPHA 3CZ6A 4S05A 1HDPA 1R58A 5M5WJ 2E19A 3H35A 2WAQA 1L3PA 3ZQ7A 1S3JA 2F48A 1MMSA 2DT6A 5L3GA 1R00A 1SFOJ 2YS9A 4MIMA 4R32A 2X4HA 3NDBB 3O2PE 1Z23A 4ESFA 4Y52J 2XLHA 4CH7A 2R5ZA 1N77A 4V2FA 1P92A 3T5XA 4F93B 5F1JA 5M3FJ 3EYIA 2EZIA 1A5JA 4XICA 3A9CA 2HZDA 1QHGA 1XS9A 5J1UA 5T3WA 4C3JJ 3SJMA 1OCTC 3LNRA 4AVPA 4L0YB 4JCZA 4CCJA 4XTKA 5J40A 4D7MA 3GANA 1EA3A 1UFMA 2EV6A 1X4PA 2ZJ2A 1WJDA 2BC5A 3DI5A 1XGMA 2JRTA 3OY9A 3ROUA 4K2EA 2HJMA 2Q3TA 3EUKL 2JD3A 4DBQA 1BZ4A 3OIOA 2BVMA 2XB5A 1BBHA 5E3AA 3CC4I 3D1NI 5JP7A 3A01A 4FX5A 5FKOA 5EG0A 4HEA2 1G5ZA 4G78A 2VBZA 4O6JA 1FYKA 3R2PA 5F28E 5L3VA 4I0BA 2CNWA 3LLKA 4I2OA 1VQ9I 3NG1A 3ZQHA 5FLXZ 1A36A 1J5YA 3S15J 3HDDA 4CDAA 1TQGA 4QI0A 1UELB 1RZ4A 3WTSC 4DJ9A 3AG3H 3TL4X 1IGNA 1YLFA 1ODDA 2EB7A 1BOBA 2O5RA 1I39A 5E3NA 3TJ5A 5DM7F 1T95A 1X58A 2NG1A 4OD5A 1N75A 4Y15A 4A93J 3EUHA 4U5HA 2XAGA 3WHNA 2P7VB 3QP5A 2V6CA 5C44J 4AIDA 5JLXA 4YEJA 3ZR8X 3QOPA 3HOXJ 3O6BB 4P55A 3TBIA 4XNFA 2VC1A 3V8JA 4C2MJ 3TW7A 2HV6A 4E7LA 2UUIA 4F3QA 2VL8A 1ONVA 5HNFA 2D5VA 2CV1A 4MW8A 1HE1A 3ZMTA 2CNWD 2LSOA 3CCEI 4A4AA 4YIRX 1G3SA 2ASRA 1HW2A 3ASOH 3PNVA 2H8RA 1ZELA 3KIOA 1H7IA 5ERIA 1WH5A 3FMQA 3HG9A 3LUTB 2NS7A 2E1MB 2EK5A 3P9KA 4AC0A 1NK2P 3M15A 4EJTA 2DA4A 5CI8A
chains in the Genus database with same CATH topology
1R5ID 2OJED 2ICWG 3KPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R5I D;  2OJE D;  2ICW G;  3KPH A; 
#chains in the Genus database with same CATH topology
 2OPT A;  1KU3 A;  1SAX A;  2XF6 A;  1IAW A;  2OBP A;  2TMV P;  2Z2S B;  3E6D A;  3AG4 C;  1P7I A;  2H8W A;  2CUZ A;  4M9X A;  1VQ4 I;  1VK5 A;  2LRE A;  3F46 A;  2Y39 A;  2DMT A;  2X48 A;  4X0G A;  1WI3 A;  4BAC A;  4MQV A;  1ORY A;  2L6G A;  1MBH A;  2HQ5 A;  3GTP J;  3H0D A;  4QLC U;  2HDC A;  1D1B A;  4HAM A;  1U5T B;  4MNU A;  1W0U A;  2UWM A;  3B29 A;  3FWE A;  3RYL A;  2CFX A;  3TQO A;  4FTH A;  1RPW A;  3KP6 A;  3EZI A;  4G0H A;  2VPR A;  1QU3 A;  4E6K G;  2DGJ A;  3CO6 C;  3QW1 A;  1U9O A;  1YO5 C;  2R4G A;  3CTA A;  2DFF A;  3B73 A;  2UUZ A;  1JI8 A;  2BGC A;  1M6T A;  1XTA A;  4QTR A;  3BP8 A;  3S3N A;  2HQR A;  2COM A;  3HNL A;  1UJ8 A;  5A6K A;  2QA4 I;  4I1M A;  4IOA F;  1JE8 A;  4IJJ A;  1TL8 A;  1GQA A;  2DA5 A;  3R6S A;  2D45 A;  1IRG A;  2IBD A;  3CJR B;  2NYX A;  4RM2 A;  3U9G A;  3OIQ A;  2DYS C;  3Q9S A;  4ULW A;  2Q9C A;  1MQV A;  2BW3 A;  2EZL A;  5HOD A;  1OKK A;  2AP3 A;  4U9E A;  3OSF A;  3AQB A;  2WB1 N;  3RTR A;  3ZOB A;  3A1Y A;  3HL2 A;  1M1E B;  2K9N A;  2VT2 A;  2IXN A;  2STT A;  1E0E A;  3P9C A;  5ILV A;  2KT0 A;  3ISP A;  1HKQ A;  5LEJ A;  1G3W A;  3EH2 A;  3DTI A;  3I55 I;  2W24 A;  2QKL B;  1Z1D A;  3HPH A;  5GPC A;  3JRD A;  1JRA A;  1GHC A;  2LD6 A;  2LP0 A;  2ZSH B;  2P6S A;  4JK1 X;  2XAJ A;  3OYA A;  3GLX A;  4B3X A;  1RR8 C;  4XLH A;  3HKK A;  2PQ8 A;  5F5F A;  5EEG A;  2PFB A;  1CF7 A;  3ABK C;  3IQC A;  2AXL A;  4CDG A;  1ZK8 A;  3F9K A;  4XID A;  1FYL A;  4LIV A;  3LEV A;  3E6M A;  3K1M A;  2OJQ A;  3P9I A;  2W45 A;  1ZHW A;  4UV8 A;  1KZH A;  2XLD A;  1OR2 A;  2B7E A;  3JCU C;  2LK4 A;  1HA8 A;  4LLE A;  5DS4 A;  2J9W A;  3RZO J;  4CA0 A;  3S32 A;  1S29 A;  1PUE E;  3DF8 A;  1D1A A;  4H54 A;  2KRF A;  3AKZ A;  3GX4 X;  2GOX B;  3IWF A;  2ACJ A;  4KFC A;  1NBB A;  2IA2 A;  3H1C A;  1R5G A;  1VQK I;  3GZ5 A;  3S1N J;  3Q5F A;  2ZME C;  2TDX A;  3OYI A;  3R61 A;  2XHK A;  1JKP C;  1ZHY A;  3KL4 A;  4JJG A;  1WH7 A;  3U0C A;  1MMA A;  2O8K A;  4BBS J;  1APL C;  4I7H A;  1T5O A;  1LB2 A;  1TWC A;  4BBR J;  3LOC A;  1GDT A;  1G59 A;  3GOD A;  2BOL A;  2M7B A;  3TQN A;  3V7R A;  3EET A;  1S05 A;  4LIU A;  3NQO A;  1DGW Y;  1R4T A;  4DGW B;  2ZFW A;  3JAM Z;  3TO6 A;  4P96 A;  1YA7 O;  5JS5 A;  1JJ6 C;  4IHV A;  3HXL A;  2X6X A;  3KP5 A;  3KET A;  2L01 A;  2L7Z A;  1A41 A;  2ETS A;  3QYF A;  3K1I A;  4L9J A;  1J75 A;  3QU6 A;  3SNH A;  1S8N A;  2LCH A;  3BDD A;  4BQO A;  3LQR A;  2BY0 A;  2P7V A;  2LK2 A;  3A2K A;  2HUJ A;  1K6Y A;  4B47 A;  2DA1 A;  4L5I A;  1GUU A;  4WXD A;  5BS6 A;  3KEO A;  3JAM K;  2A68 F;  2LF7 A;  1YYJ A;  4WX9 A;  5DCM B;  3K1I C;  2X1C A;  1UB9 A;  5L3D A;  4N9I A;  1VQN I;  1FAP B;  5JVG F;  3GWN A;  3EUH C;  1V4A A;  3G1M A;  3I3L A;  4UB8 C;  4XWJ A;  2XAH A;  1QPI A;  4ANJ A;  1Y6I A;  3JRF A;  3U2L A;  1SD7 A;  5FLM J;  1RJ9 B;  3AJM A;  1OCR H;  4DJA A;  2X0L A;  3HRS A;  1SMY F;  2ADU A;  1D0X A;  2L54 A;  4LLC A;  3U3B A;  3HZJ A;  3JTG A;  4K1O A;  1HOM A;  2FXA A;  2Z9O A;  2F5C A;  1PCX A;  2J9U A;  2Y9Y A;  3OV8 A;  1TWF J;  2P8T A;  2GZW A;  5JHU A;  1U9N A;  5IPA A;  5B1A H;  3VYT B;  2KQR A;  2W00 A;  2WL8 A;  2X1E A;  3LNM B;  2MSY A;  2DQL A;  4ITV A;  2VB6 A;  3CJN A;  2WB1 A;  3DEE A;  1TKN A;  4Z9H A;  5JR3 A;  3HNJ A;  1O57 A;  2O8X A;  5E2Q A;  3CUQ B;  2VKE A;  1ETK A;  3JSP A;  4RGU A;  3ABM C;  2ID3 A;  1JJ8 C;  1NFN A;  3SDB A;  4BQA A;  5CVV A;  3EJN A;  4IRI A;  2R03 A;  3EPZ A;  4BJ6 A;  2CDQ A;  3SYT A;  2B63 J;  4WAB A;  2H6C A;  1MNM C;  2GXB A;  2XAF A;  4XQF A;  3LFK A;  2LSE A;  1SVO A;  1XCV A;  2JSC A;  4NNJ A;  4A3D J;  2DFE A;  2DU9 A;  1FWZ A;  1V55 H;  2BXZ A;  3GTK J;  3T9O A;  5EZH A;  1DPU A;  1MBJ A;  2FQ3 A;  2LF8 A;  1VF9 A;  1ZHX A;  2RN7 A;  3HOY J;  3NAR A;  1T6S A;  1HLV A;  2CH0 A;  4Z9J A;  5KYW B;  2VJI A;  5F64 A;  2HMQ A;  1B9M A;  1MND A;  2WY8 Q;  3ZN1 A;  4FAS D;  4A0Z A;  2A3S A;  4E4H A;  2NUT B;  3FM3 A;  3R0J A;  1DGR M;  5DD8 A;  5BQG A;  2QUF A;  4W1U A;  1A6Q A;  3B6A A;  5DCF A;  2K9Q A;  5FFZ A;  2VLA A;  4V19 K;  1T6U A;  2PBE A;  2YEV A;  2YUS A;  1T01 A;  2Q0O A;  4B43 A;  4EIY A;  1NLX A;  1GXP A;  4FT8 A;  3E5X A;  5GAG J;  5CKT A;  4JZA A;  2YR2 A;  4Y33 A;  5FD6 A;  1LJ9 A;  5A2Q K;  3S1R J;  2WZL A;  3DKX A;  5A6B D;  3ZMD A;  4D7N A;  4I76 A;  3HGY A;  2ZD9 A;  3H9J A;  5D92 A;  2XSJ C;  3I9V 2;  2EBI A;  3DKW A;  5AIP A;  1YJN I;  2MLG A;  4KC9 A;  2NS0 A;  3KMI A;  3ZQY A;  3EGX B;  1KGS A;  3VFZ A;  2IW5 A;  3T6J A;  1HC8 A;  2LRD A;  2E2I J;  4U87 A;  1WSU A;  2A61 A;  3WE2 A;  1XGO A;  3G50 A;  1MBF A;  2E1N A;  3TKY A;  1YAU O;  2Q2E B;  5DDG A;  2DA3 A;  4AYB A;  2FEZ A;  4NBQ A;  2WAQ N;  4G7H F;  2XC7 A;  1OPC A;  4RAF A;  4XOP A;  1SD4 A;  3F21 A;  1P4X A;  1FOX A;  3KZY A;  2MD5 A;  4U5F E;  1FSH A;  3UMI A;  2J8W A;  3H65 A;  2O6G E;  3U9M A;  4DRI B;  2FML A;  4IOC F;  4A5N A;  3EYY A;  1MZB A;  4IKF A;  3ZP5 A;  1YFH A;  1G4U S;  4KMU X;  3RKO F;  2YRF A;  2W85 A;  3TMO A;  3EGD A;  1X2N A;  1LQ1 A;  1UST A;  5DLJ A;  2HS5 A;  4XRS G;  5ICF A;  4AVZ A;  2LY2 A;  3FXH A;  4I1O B;  2HPI A;  2NSF A;  1FZP B;  4BPM A;  4E17 A;  5IP6 A;  2OEX A;  5JLW A;  2W9Y A;  2ID6 A;  1S7A A;  1YQA A;  5IT9 Z;  1MKM A;  1J9I A;  1WGX A;  5CQG A;  1VQO I;  2JA8 J;  4LK1 F;  3SP1 A;  1P4W A;  3DTE A;  1WVR A;  4N4O B;  3MFN A;  4EMS A;  4A3M J;  5JVE A;  1YLM A;  1LVK A;  4DZJ A;  2YPR A;  2NVU B;  5HLT A;  3LES A;  1P9Q C;  4AM3 A;  3LS1 A;  4GEH A;  3ZSU A;  3BR1 A;  1ZRE A;  5LHG A;  5EG0 B;  2YKZ A;  4C3D A;  3GLL A;  2VBX A;  5DCM A;  1FTZ A;  4A3F J;  1ITY A;  4XQ1 A;  5J4Y A;  3L7W A;  1DOV A;  1G4W R;  2KSF A;  1N78 A;  4HST A;  4UVC A;  2LH9 A;  5HVQ C;  1FY7 A;  3M79 A;  2Y0S N;  3FX3 A;  2CQ7 A;  4W8K A;  4YN0 B;  2M87 A;  1GM5 A;  5FJ8 J;  5E1W A;  4A69 C;  5A6A A;  3POV A;  4AE4 B;  5CIV A;  2ZXI A;  3A03 A;  4HX8 A;  4LMY A;  1E3H A;  3OSG A;  2EPK X;  1NG6 A;  4J7Y A;  2QE9 A;  1J0R A;  3GEE A;  1BI3 A;  3HHG A;  2GIV A;  4GYT A;  3F8N A;  2L0K A;  3WGG A;  3G1O A;  2L5Q A;  2VE9 A;  4IHW A;  5D5W B;  5ICE A;  1ZGA A;  3OS0 A;  4IWB A;  3B02 A;  3H5R A;  1KQ8 A;  2RKH A;  3JRA A;  4IL6 C;  3DBH B;  2ME0 A;  3CUQ A;  2A69 F;  3GFJ A;  4HF1 A;  1YYX A;  2KRC A;  2MWQ A;  4MTO A;  1ZYR F;  4CIH A;  1XWJ A;  1CPQ A;  3JTL O;  3QVZ A;  3CDI A;  3U5S A;  3S0X A;  4GFB A;  2OA4 A;  4KIC A;  1B8I B;  3E9V A;  3CD6 I;  4MVU A;  2Q7R A;  1OCC C;  3L1M A;  5L3B A;  3IUO A;  3GME A;  3TOM A;  2E36 A;  2RDP A;  3L2W A;  1JHH A;  2Y3D A;  3PNT A;  2FQ4 A;  5EGO A;  4IX7 A;  1S9H A;  2EA2 A;  1IN6 A;  4JCH A;  1E2X A;  5BQI A;  4BH9 A;  4KT6 A;  4IRU A;  2VQG A;  1RC9 A;  1E17 A;  4M3G A;  2CW8 A;  2YL1 A;  1TW3 A;  2F5F A;  4DQ2 A;  3K2A A;  2W7N A;  2B9S A;  2W4M A;  2KJC A;  4MTE A;  3GEH A;  5CQE A;  4Q47 A;  4HNU A;  1TC3 C;  1G6N A;  4R1H A;  2OD5 A;  3CCV I;  1R4M B;  2EIK C;  3K4M A;  1RJ9 A;  4L5E A;  2Z99 A;  3RPQ A;  2CV0 A;  3CDL A;  3H3V K;  3ERM A;  2ECC A;  2H94 A;  3RJP A;  2HMZ A;  2DOD A;  3L9F A;  3CP2 A;  4Y7N J;  2I15 A;  4HRI A;  4YL1 A;  3FK7 A;  1KU2 A;  1SFX A;  1TT0 A;  2V4J C;  1YS7 A;  3O6X A;  1Z7L A;  3QYE A;  2AO9 A;  5ICC A;  1FMW A;  2CSO A;  4RAZ A;  1YIJ I;  1JGG A;  3I4P A;  3UGO A;  5HLH A;  3WOD F;  4O79 A;  1L0O C;  2LY1 A;  1MH4 A;  3EG9 B;  2NNY A;  2WV0 A;  1U0B B;  4Z9I A;  2ESH A;  3C62 A;  1SFU A;  3EDP A;  3LSJ A;  3CP8 A;  3RQG A;  3I59 B;  3UMH A;  4PSW A;  5DYM A;  2RQP A;  3HB9 A;  3KX2 A;  4NQW B;  1JUP A;  3FK6 A;  4I3M A;  3CMY A;  2BY1 A;  3U1K A;  1Z3I X;  3RH3 A;  3PFI A;  1VI0 A;  3FHD A;  5JI6 A;  3RVY A;  3FXJ A;  2QLA A;  3Q0W A;  2WAE A;  2EFW A;  5D4S A;  2HFH A;  1BM9 A;  3WTZ A;  2M0C A;  1YIO A;  4Q48 A;  2EWN A;  1XPX A;  3J81 K;  4AWX B;  4OWR B;  1Z6A A;  2E1O A;  4D4X A;  2AWY A;  2IVM A;  3ZPL A;  1D0Z A;  4EJV A;  3PIP F;  1K4S A;  1YW9 A;  1CF7 B;  1OR7 C;  4GQH A;  1XD7 A;  2XLO A;  3EGD B;  1ZQ3 P;  3W2V A;  4MTG A;  2OTJ I;  3EG9 A;  1BBY A;  3U2M A;  5HV9 A;  3S90 A;  2DJN A;  5CVU A;  5D8L B;  3AOU A;  3NEU A;  1EQ1 A;  3BPX A;  1OW8 A;  4CS9 C;  3OWT A;  1W7P A;  3IAS 2;  2LP4 A;  3JT1 A;  4ZLD A;  4GYG A;  1D5V A;  1BIA A;  4A3L J;  4MQ9 F;  4B6I A;  4MFD A;  1KYW A;  4UUV A;  1H88 C;  2W57 A;  2EFP A;  4F55 A;  2CCY A;  2H7B A;  2F5V A;  2DA2 A;  1TWA J;  3I58 A;  3T6B A;  3SQN A;  5B1B C;  2RD9 A;  1R6R A;  1B59 A;  1FP1 D;  3LA7 A;  1HKT A;  2A0B A;  1VQM I;  4EV0 A;  3W4Y A;  3R60 A;  3FIS A;  2QWW A;  1YRN A;  2D4U A;  4IQ4 A;  2VUM J;  3C63 A;  3NAU A;  1K61 A;  2JMW A;  3C8Z A;  1FC3 A;  3LSK A;  3EH1 A;  4QPO A;  2P0N A;  2XF5 A;  3I0T A;  1SD5 A;  4ABZ A;  4MS2 A;  4A5M A;  4CS8 A;  1B72 B;  1W5C C;  3R7C A;  3HRT A;  4C2T A;  3VM6 A;  2KDO A;  2LY9 A;  3G1L A;  3PQK A;  1BDJ B;  1U6G A;  2O7O A;  1NSG B;  3WU1 B;  1T39 A;  1WHU A;  3EGX A;  2X0C A;  5HSW A;  3RQE A;  4M3D A;  4M6X A;  1OW7 A;  3JYH A;  2OC6 A;  3T0Y A;  4UB6 C;  1M2O A;  1W2W A;  3ZC4 A;  2MC4 A;  1V55 C;  3HRM A;  1OYI A;  5DD4 A;  2P61 A;  2QQA A;  1ETQ A;  2CG4 A;  2OF7 A;  4FE7 A;  2MAB A;  3IH4 A;  3K2Z A;  1YHQ I;  4HV6 A;  3DAF A;  3DM5 A;  4XSX F;  2EPL X;  2GFH A;  3DD7 A;  4H4K C;  2FNA A;  1PYV A;  4A3K J;  2IGM A;  2PBI A;  1B72 A;  1JGS A;  4P9U A;  1MW7 A;  2KFD A;  5C4J J;  5E3L A;  3JSE O;  2FX0 A;  3C7J A;  3I71 A;  3DM9 B;  3HOS A;  4JW1 A;  4OIN F;  2R7R A;  2GXG A;  4BJ1 A;  5B1A C;  3ULQ B;  4A2U A;  3NWS A;  2JA5 J;  3I4U A;  2W4S A;  2MFZ A;  4JYK A;  3ZXS A;  3H92 A;  2IXP A;  1LI5 A;  5JUA A;  3KYC B;  1O7L A;  2XRN A;  2OU2 A;  3RSN A;  1BJA A;  3LSI A;  2BHZ A;  3VOD A;  2QLZ A;  1GV2 A;  4UUS A;  2BBY A;  5H2F C;  1IV8 A;  1EKE A;  1T33 A;  3HOW J;  2OJE D;  2VQL A;  1SFE A;  2BY3 A;  2HV7 A;  1O3Q A;  4G9Y A;  4JEB A;  1X1B A;  1V5F A;  1X3W B;  3IV5 A;  5B3S C;  2R7Q A;  3LQQ A;  2UV1 A;  1RMV A;  3BG6 A;  1EH8 A;  3J7A Y;  1C17 M;  3I5Q A;  4NC7 A;  4AYB N;  2YHS A;  4GDF A;  4J30 B;  1ORJ A;  1RKW A;  5FKK A;  1JKR C;  3LLI A;  3HKZ A;  3A11 A;  1LNW A;  3E70 C;  1YYV A;  1O4X A;  2HEO A;  1DU6 A;  5TJ5 E;  2DTZ A;  3TED A;  2PX0 A;  3TGN A;  3LJB A;  2IGO A;  3DPT A;  4O5V A;  2XL4 A;  3R0A A;  2YX7 A;  1I1G A;  2DA7 A;  2HU9 A;  2LR8 A;  4CCO A;  1VFC A;  1DP3 A;  3FHN A;  3EUA A;  4IVN A;  1T38 A;  2XKP A;  2MLK A;  2KGO A;  3K4K A;  1ZAR A;  1MNE A;  1DQU A;  3OL3 A;  3MN2 A;  3TO9 A;  1J09 A;  3IRQ A;  3MEX A;  2J46 A;  1D8J A;  3X1O A;  2QSG X;  4B09 A;  3PSF A;  2L4M A;  4DZP A;  5FRN A;  3ZTZ A;  4E18 A;  2K9L A;  1WTY A;  3S93 A;  2L6F A;  2P6T A;  5DUI A;  2HDW A;  1OYW A;  4WWC A;  3W2A A;  1IUY A;  5EEH A;  4C3I J;  2ZNZ A;  1NFO A;  1B68 A;  3W2W A;  3SYN A;  2EPM X;  2Y0S A;  3FZV A;  2W4B A;  4XPW A;  4I6Z A;  2EIN H;  1NU7 D;  3PUB A;  1U6H A;  1GS9 A;  4WJ0 A;  2HKX A;  3L1P A;  1B8I A;  1I27 A;  3QPL A;  4TV7 A;  3GZN B;  3W8I A;  2PLY A;  3S16 J;  5EYR A;  1TNS A;  1QQ3 A;  3R4K A;  3LSG A;  2F22 A;  4PJ0 C;  3AG2 H;  2DMQ A;  1W0T A;  1OCP A;  5EGO B;  2FBI A;  2ELJ A;  1E86 A;  1MJB A;  3GEI A;  3SZR A;  2COB A;  2L4A A;  3CJQ B;  3V4G A;  1V5G A;  3PMR A;  4CSA A;  2RV8 A;  4JRZ A;  2QYO A;  2KP6 A;  2RQQ A;  2STW A;  2DN0 A;  2X1D A;  4BUP A;  2JVG A;  1SZI A;  5KK1 A;  2XM4 A;  4CYC A;  4ESB A;  1ULY A;  3DKA A;  4ZYE A;  3WG7 C;  2DLL A;  4AK9 A;  1FTT A;  3ABK H;  1Q0D A;  2RNJ A;  5FKL A;  3K7A J;  4UY8 I;  1OJL A;  1QVT A;  2KZV A;  2WZG A;  3IPM O;  5TGT A;  3KE2 A;  3GTQ J;  4L9T A;  3BLY A;  5EDN A;  3MX3 A;  3BG3 A;  3AGU A;  4CSA C;  2XXA A;  3MWM A;  3AG3 C;  5JHF A;  3JTH A;  1VQ7 I;  3IRR A;  4YK5 A;  3FM5 A;  2OCC C;  4P9T A;  1RI7 A;  3IH3 A;  1PD1 A;  5JSL A;  5EGY A;  4RLQ A;  1ORK A;  4EVI A;  2M7A A;  1MDM B;  4CZC A;  1GVD A;  3FXL A;  3LSM A;  2OZ6 A;  3X2Q H;  1IJW C;  2QUP A;  2UUH A;  4YT4 A;  2YLG A;  2QVO A;  2RSE B;  3M8E A;  2K40 A;  4BXF A;  3LAP A;  1JPJ A;  3JRE A;  2PF4 E;  3VB2 A;  1OQY A;  2XGC A;  4PUS A;  1YX3 A;  2OCE A;  1HE9 A;  1SR2 A;  4Z2Y A;  4KNV A;  2DDA A;  4LLG F;  1A7V A;  2IP2 A;  3TO7 A;  1U78 A;  2A5W A;  1TWH A;  1ZZP A;  3FOP A;  4HZF A;  5CI9 A;  4ER9 A;  5ICG A;  5JLI A;  4KI2 A;  1F9N A;  2VJ4 A;  3NRV A;  4MVO A;  4NQF A;  1ZTR A;  4YEL A;  2P5L C;  3MFK A;  2DCE A;  4I99 C;  1FR0 A;  3J7A O;  2OKU A;  3VF0 A;  3HJC A;  4PJN A;  4CO8 A;  5FRO A;  3ASN H;  2GQQ A;  2EIK H;  2QEX I;  1QVX A;  4ZJZ A;  1FEX A;  2B0L A;  2A6E F;  4UDV A;  4AE4 A;  2VC0 A;  4LDQ A;  4ZTF A;  3HNI A;  4CSW A;  1QO0 D;  2JPC A;  2G62 A;  2XLM A;  2LFB A;  2XS8 A;  3FKI J;  1NZE A;  5FO5 A;  3DU5 A;  3BTC A;  3LA2 A;  1ZHZ A;  3FDY A;  1B6A A;  2A6T A;  2HQA A;  2K3F A;  5ED4 A;  1YVI A;  2BW3 B;  3QTH A;  4P6I C;  3M4B A;  3GVA A;  1E84 A;  3BEH A;  4YT5 A;  1Z3X A;  1BOA A;  4UUS B;  2PX9 A;  2HTS A;  2XVC A;  4B48 A;  5K5R A;  4E70 A;  3OYF A;  1VYI A;  2HSQ A;  3C8G D;  1JTY A;  1VMA A;  2BY2 A;  4Y3O A;  5JVT A;  4CGZ A;  5IYD J;  4BNC A;  2BV6 A;  2FNP A;  3VPR A;  4HEA J;  3WTX C;  3CCU I;  1GLN A;  3OYG A;  3CEX A;  3OYE A;  3PO2 J;  4NCQ A;  2KIQ A;  3BR3 A;  6PAX A;  5FRM A;  3QU3 A;  5DS5 A;  1AKH B;  2QQB A;  3U1D A;  3G4X A;  1D1C A;  4XL9 A;  1XB4 A;  2KRH A;  2E1C A;  3QYB A;  4Y17 A;  2ESN A;  1ETX A;  1ST6 A;  1QBJ A;  3CO7 C;  1LPQ A;  4PJL A;  2E7X A;  2KIU A;  1JT0 A;  2IRF G;  1A7E A;  1DOW A;  2XV4 S;  4ZYD A;  4IHY A;  4M3E A;  3S9O A;  2HWV A;  1TZL A;  2RAE A;  3S84 A;  3GBG A;  3DBR B;  5D6F A;  3TOL A;  3RFY A;  4MTD A;  4JX6 A;  3I53 A;  2DMU A;  2MH2 A;  4PJM A;  1PD0 A;  1OW6 A;  4YG2 F;  2Z3Y A;  1JXS A;  2NVX J;  2EPF A;  2ZJP F;  1J7K A;  1SAU A;  4BJT A;  2EV5 A;  1NU9 C;  1T6I A;  1KQ9 A;  2J45 A;  3ZGK A;  3PIO F;  2KIS A;  1RKC A;  5KHD A;  2WB7 A;  2Z15 A;  3BJA A;  2HJ3 A;  2A5Y B;  4DRH B;  5GTI C;  3FXK A;  5M5Y J;  2QF7 A;  3IHU A;  4J7T A;  5FKN A;  2EJR A;  1P2F A;  1ZU4 A;  4EM0 B;  3TK0 A;  3CDH A;  3TOB A;  3FAP B;  4MVS A;  5DVW A;  4GYI A;  3RDI A;  1T0F C;  4KIB A;  4LER A;  4EJO A;  2H1K A;  2VCB A;  2DDB A;  3OR1 C;  2YL0 A;  2KZG A;  2WY7 Q;  3OOP A;  5CVJ A;  3JRB A;  1E3O C;  1F36 A;  1K6O A;  4YFK F;  5HS9 A;  2DFH A;  2XUB A;  1IN8 A;  3HPG A;  5B5E C;  2PI0 A;  2B0H A;  2E87 A;  2W84 A;  3ZQF A;  5FFX A;  2XSD C;  1YOV B;  1Z91 A;  3BTJ A;  4FE4 A;  5E3O A;  2VOO A;  4QDL A;  2DT5 A;  1B9N A;  2EZK A;  4IB4 A;  1T0F A;  3BC8 A;  4MEX F;  1R1T A;  3C1D A;  1D5Y A;  5B66 C;  1AOY A;  1VOM A;  4F4B A;  2OOC A;  3V8K A;  1LVA A;  4I98 B;  1YX5 A;  1ZR4 A;  3T1B A;  3KCC A;  2IS4 A;  1RCP A;  4I01 A;  2RVC A;  2MG4 A;  3GFM A;  4A0X A;  3DLL F;  2VH3 A;  5CPR B;  3W8H A;  4M73 A;  3S17 J;  4B1R A;  3MKW B;  3SHF A;  2MHR A;  2G9W A;  2VC9 A;  2M34 A;  4GGG A;  4CIC A;  2OAZ A;  2G3K A;  2E2J J;  3KP4 A;  3QPH A;  4O3M A;  1QZY A;  3A0B C;  3RKQ A;  2OU6 A;  1RXQ A;  5LHH A;  4LG3 A;  2L6H A;  3LEO A;  4E7S A;  1EH6 A;  1HW1 A;  3GWL A;  1SAN A;  1YE9 A;  1H6G A;  5B1B H;  4XLF A;  4C3H J;  2V6E A;  4E7Z A;  4YFN F;  3G4S I;  1YTY A;  3CES A;  3E0J B;  1QGP A;  3F8F A;  3OYD A;  1O3S A;  4MW3 A;  1FNT c;  1YI2 I;  3K4J A;  1MSF C;  1T56 A;  1LM3 B;  1HF0 A;  2HTJ A;  2ZFU A;  2R25 A;  1I50 J;  3KP7 A;  3FMR A;  2OUM A;  3C2B A;  3BZK A;  1NG1 A;  3MAJ A;  2V1D A;  4Q4Z F;  2VKV A;  2HYF A;  3QOD A;  2NPU A;  3CLQ A;  1TQI A;  1QHH D;  2A05 A;  3J7Z I;  2Z33 A;  1I1S A;  1XCB A;  2MW8 A;  3HOT A;  3CJT B;  1XDU A;  3F6V A;  5A6B A;  3HTK C;  2XLW A;  3AG4 H;  2VON A;  3RQI A;  3W3C A;  3AGT A;  2VKH A;  3Q6N A;  3PM1 A;  1UCR A;  2L02 A;  4M3F A;  5K1Y A;  1NK3 P;  1BW6 A;  2R7T A;  2EIL C;  3VYS B;  2EIM H;  5LGN A;  2BL2 A;  3DZA A;  1G3Y A;  4ONS A;  2CQQ A;  3VRC A;  2Y9Z A;  5AON A;  2KJB A;  2UXX A;  2GA1 A;  5F6F A;  4LG0 A;  1XMK A;  2L9N A;  2VI6 A;  2XGX A;  2Q8K A;  1IDZ A;  2M45 A;  3ECS A;  5L3Q A;  3ZMS A;  4RMN A;  2IGK A;  5DEQ A;  4A0Y A;  3RIP A;  2IM8 A;  4NQW A;  1OCR C;  2Q9B A;  4JP0 A;  4O6N A;  1D0Y A;  3H3U A;  1B1B A;  3F0C A;  2K7L A;  3E6B A;  2YVK A;  1X3U A;  1VQ8 I;  4C7O A;  4R8H A;  2LQG A;  1LE4 A;  2DPD A;  3TUL A;  5KVR A;  1XDS A;  1VB5 A;  2EPO A;  5AIQ A;  3HOU J;  4BU2 A;  3K1H A;  4KN4 X;  2KYH A;  3O39 A;  4LB6 B;  3HRU A;  1F4K A;  2DOF A;  2DXI A;  2IA1 A;  1HKS A;  3LL7 A;  4JVS A;  3DQV C;  3WU0 A;  1R23 A;  4LLL A;  3CCJ I;  1J59 A;  1DDN A;  3QZC A;  4IHT A;  2OTL I;  3BJO A;  5KYU A;  1FT9 A;  5F0F A;  2DFI A;  3C2G A;  4KIT B;  2UZK A;  1QLE C;  3PO3 J;  1TQP A;  4N6C A;  2V26 A;  3DPU A;  4CJG A;  4FIS A;  5J3L A;  1Z67 A;  1EA8 A;  5CYV A;  4EUK B;  5TIS C;  5BQT A;  1ORS C;  4KIG A;  2Y69 H;  2EV0 A;  2F5D A;  5E3M A;  3AG1 C;  1SMT A;  4IAQ A;  2HSB A;  4JQF A;  2X85 A;  4XPX A;  2DOA A;  2Y2Z A;  2FFH A;  1X19 A;  3HUG B;  3ZWI A;  4FX0 A;  4NTF A;  4B44 A;  2C03 A;  3MZY A;  4KN7 X;  1LS1 A;  3RCO A;  2DB4 A;  4OAZ A;  4IAR A;  4DRJ B;  2CW0 F;  5K7F A;  2CGE A;  5HDN A;  5D91 A;  2K9S A;  3DFG A;  3ELK A;  5F04 A;  2NVQ J;  2L9R A;  3I5P A;  3ZMV A;  2NSG A;  3OYB A;  1EF4 A;  5LGT A;  4JTA B;  3LAJ A;  2H1L A;  1Y0U A;  1T9K A;  3KLO A;  4HG2 A;  5BQH A;  2P1A A;  2DTR A;  3F8M A;  1H8A C;  4X6A J;  3S14 J;  1LEB A;  2CQX A;  4CCM A;  3ITF A;  3DP7 A;  1F1M A;  4I0A A;  2IOQ A;  3IQT A;  4BEJ A;  2H6B A;  1W36 D;  3E1S A;  3NYM A;  3OR2 C;  3HC7 A;  4O7G A;  2EIN C;  3ZQV A;  5IY5 C;  3D5R C;  3RIR A;  1MH3 A;  2VCC A;  5COF A;  3OL4 A;  4BY1 J;  1IV6 A;  3H36 A;  3A0H C;  2LD5 A;  3TP0 A;  3P7N A;  2HVS A;  4A3I J;  1J2X A;  5EF6 A;  2IXM A;  1XSD A;  3BT9 A;  2LKX A;  1TWC J;  4RBN A;  2KMU A;  5HS8 A;  1GVJ A;  1W5S A;  5E3C A;  1B4A A;  1I6X A;  1WFX A;  2AHQ A;  4HSR A;  1VZ0 A;  4ZDP A;  4DVY P;  1YW7 A;  4YT2 A;  1WOL A;  1EI7 A;  2FAP B;  2R05 A;  3DWW A;  3V5Z A;  2O9X A;  3T8T A;  3L2U A;  2D1H A;  3WE3 A;  3DEW A;  1WZ2 A;  2H27 A;  2J7P A;  4MHG A;  2Q00 A;  4XON A;  1Z7U A;  4HDU A;  1VTN C;  3M4C A;  4NY3 A;  3MZH A;  4XLA A;  2ZME A;  3SXY A;  4U0Y A;  1ETO A;  2R7O A;  1R9T J;  1Y1W J;  1KNY A;  2KNH A;  2PJP A;  1O3U A;  1QPU A;  1WJA A;  2VE8 A;  3S2W A;  5DS9 A;  5K7Z A;  1R5H A;  1APC A;  4GO1 A;  3HOV J;  4XM3 A;  2YL7 A;  1ZHF A;  2MBF A;  2V9K A;  2XXA B;  4DYQ A;  4IQJ A;  5BMZ A;  1D8K A;  5GPG B;  1TWG A;  1VQL I;  3HGG A;  2BE5 F;  4RLF A;  2NAZ A;  2FF4 A;  3DXJ F;  4EGZ A;  3F47 A;  2VOD A;  2XPV A;  2HI3 A;  5CVI A;  4YII A;  3IQ6 A;  4BHC A;  5J8C A;  1IXR C;  4CHU A;  2EH3 A;  3TDZ C;  2IXS A;  1IC8 A;  4BEH A;  4U5E E;  3RPU D;  2BZT A;  5J4V A;  2X6W A;  4AD9 A;  5BPD A;  1R4N B;  1Y8R B;  1UG7 A;  4LG0 B;  1OCO H;  2M1B A;  2W82 A;  1YIT I;  3K10 A;  4CXF A;  1A6I A;  2JN6 A;  3BOQ A;  4A2N B;  2OV7 A;  1IRF A;  2LDU A;  2JJ7 A;  3MD2 A;  3B71 A;  4MFE A;  1F1Z A;  3KFW X;  3SZP A;  4NB5 A;  3OYM A;  4G7Z F;  3U8P A;  3MKY B;  4BJ5 C;  5DQT A;  2HKV A;  2LBF B;  4YJW A;  3FVY A;  1R1U A;  2O3F A;  1L3L A;  3DBL B;  3ERE D;  1ON2 A;  1Q1V A;  4U5G A;  2PX3 A;  4NC8 A;  1YS6 A;  2G7H A;  3ZQQ A;  2WWY A;  4IHS A;  3AFH A;  2A0U A;  2J0W A;  2VN2 A;  1TR2 A;  1KTM A;  3DJN B;  5FLV A;  5KYW A;  1K79 A;  4LJZ F;  5LRR A;  2OG2 A;  3GF2 A;  3P5J A;  4XRF A;  4DW6 A;  3ZCO A;  1OCC H;  3CMM A;  3PSI A;  3NRH A;  4BHP A;  3GTL J;  5IOZ A;  4CYC B;  3K9T A;  1AWC A;  1PVE A;  4CCN A;  1YZA A;  2NUP A;  4K7B A;  1O87 A;  3NMI A;  5E8I A;  5COG A;  2JPB A;  2P5V A;  5KAF C;  1LDK B;  4PAC A;  4FCY A;  3W6J B;  5E8G A;  4A6E A;  1MBE A;  2WBM A;  5D5U B;  2CYD A;  3M07 A;  4KMF A;  5CLS A;  1RES A;  5IP9 J;  4ENN A;  3PL8 A;  3ZDL A;  4BY7 J;  2RNG A;  1UFB A;  2IBF A;  3FXR A;  3RPU A;  5CVR A;  1AKH A;  2TRT A;  4N4W A;  2L7M P;  5E1Z B;  5IP7 J;  4E7J A;  3FMS A;  1FSE A;  2ZXJ A;  2VCA A;  2Y69 C;  4MND A;  3K4B A;  2XAU A;  2LFF A;  2F5E A;  1W7P B;  4UVB A;  1Y4C A;  3HNK A;  3K69 A;  3OS1 A;  3KYD B;  1E83 A;  2BEO A;  2CV2 A;  1ZVZ A;  2X6Y A;  3MCZ A;  3KP2 A;  3CUO A;  3WTV C;  3BQZ A;  1I4Y A;  4UV9 A;  1HMO A;  4C7O B;  2L7A A;  1Y1V J;  2AQE A;  2KIM A;  1PUF B;  1Z05 A;  1EKY A;  3J7Y J;  2HXI A;  3E7L A;  2F4I A;  4JC7 A;  3DLA A;  1HST A;  2ISZ A;  4Z6Y A;  1G8X A;  3ECH A;  3QOE A;  2PEX A;  3G3Z A;  5L3E A;  2WZF A;  1Q0M A;  4NTA A;  1K4T A;  4N0B A;  4C30 A;  2QKM B;  2XS1 A;  4Y13 A;  5HS7 A;  4YL0 A;  2EZH A;  3GTJ J;  3JW4 A;  3WTW C;  3CSK A;  5HDG A;  3EFO A;  4XEK A;  1X2M A;  5GAH J;  3SXK A;  2CYY A;  3TW6 A;  1IF1 A;  1V3F A;  3M9A A;  1K05 A;  1DPR A;  2V3C C;  1FBQ A;  3BRO A;  4ZC3 A;  3ZVR A;  1GV5 A;  3O10 A;  2AS5 F;  3QPS A;  1OKK D;  1VTM P;  1OCZ H;  1FNN A;  2NXN B;  5F5H A;  1P7J A;  1HCR A;  4C3B A;  3K6G A;  3OYC A;  4II3 A;  1FLI A;  4XRM A;  4Q5S F;  3IH2 A;  3O8H A;  4CX9 A;  4HDV A;  4PSX A;  2M4E A;  1U2W A;  2F2E A;  2XPW A;  5HOO A;  2A1D D;  5D6E A;  1Z21 A;  3U2R A;  3ZN0 A;  3BR0 A;  4BS9 A;  4YRV A;  4PDK A;  4PGH A;  2MGQ A;  3EFO B;  5IYB J;  5IYC J;  1BR2 A;  1BN5 A;  4AL1 A;  1FFT C;  4F92 B;  5IT3 A;  1MJ9 A;  2V9V A;  3J81 Z;  4HPQ A;  3E6C C;  1YJ9 I;  4IHX A;  2O03 A;  4NDL A;  2HYJ A;  2M5W A;  1P6R A;  4XBF A;  1LE2 A;  2P5K A;  4I02 A;  2M8G X;  2Y0M A;  2XPU A;  2VAS A;  3Q0U A;  1WN0 A;  3DE8 A;  4WF2 A;  5BUO A;  2HR3 A;  4EM2 A;  3FIW A;  5FGM A;  4BG0 A;  2DBB A;  2DW4 A;  1BI0 A;  3I5U A;  1SFK A;  5TRD A;  2OCC H;  4QWQ A;  3V5X A;  4FQG A;  4M9S A;  2VBY A;  2PN6 A;  1XGS A;  3KEQ A;  1ERD A;  4ZDO A;  1HDD C;  1Z6T A;  2ME6 A;  2D1V A;  3BY6 A;  2F6C A;  2L3D A;  3NYJ A;  3OYL A;  2XRL A;  2LVS A;  1POG A;  5E18 F;  2ZPA A;  3OS2 A;  2HZT A;  2ICW G;  2CU7 A;  3F22 A;  2M8E A;  2YSR A;  1TWG J;  3FOO A;  2PFD A;  3JYY A;  1FOW A;  4RM3 A;  3KYJ A;  2KLO A;  5E17 F;  1GGQ A;  3OA1 A;  2KQ9 A;  4BJ5 A;  4CBE A;  2MD0 A;  3DAG A;  4G7O F;  1IDY A;  2Y48 A;  3L34 A;  5EEA A;  2BVL A;  2HNH A;  2JVH A;  1HY5 A;  1X3Z B;  3GXO A;  4M72 A;  3SZT A;  4X1E A;  1SYQ A;  4EKW A;  2FOW A;  4E0I A;  1U3E M;  2LKS A;  3ZQC A;  2XM0 A;  1WRJ A;  1R1V A;  5J8F A;  2XF7 A;  2MA3 A;  3V7S A;  5GAD J;  3ZTM A;  3Q0V A;  2NUP B;  5L0I A;  2V1U A;  3ASN C;  1Y8Q B;  2Z16 A;  4LGW A;  4K0D A;  1IN4 A;  3BG9 A;  5GPA A;  5IT9 K;  5L3C A;  4U88 A;  1K04 A;  4JOM A;  3G2B A;  1QQI A;  3RW0 A;  4ZZL A;  3L8J A;  3VYW A;  4WXC A;  2HVR A;  4QPQ A;  2JA7 J;  2IXO A;  1FPQ A;  2R7U A;  3UR3 C;  4XKV A;  2KL4 A;  1STZ A;  3E3V A;  2DK8 A;  4HOB A;  4GXO A;  3IQ5 A;  4NHJ A;  1TWH J;  5T3T A;  3I59 A;  1QZX A;  3KZI C;  3UKG A;  4BE1 A;  1QRY A;  2FBK A;  4IJA A;  2XIG A;  5F08 A;  1LI7 A;  2KPM A;  1Y39 A;  2VXD A;  3OMY A;  2XL6 A;  2LBF A;  3HTU A;  2R7F A;  2VKD A;  2I10 A;  3S1Q J;  4II2 A;  4PK4 A;  1PUF A;  2QTV A;  1H9T A;  3ABM H;  3WHB A;  4OIQ F;  2IEK A;  2ELH A;  3BWG A;  3DV8 A;  1JKO C;  2DMN A;  1LFU P;  1MSE C;  1XGN A;  3DWL E;  3K1N A;  3ML6 A;  3MZ8 A;  4AIJ A;  2PNO A;  4MVR A;  5E79 C;  3N24 A;  2TCT A;  1X1C A;  1UG2 A;  3VYU B;  1VYK A;  3J80 Z;  3ECO A;  2L81 A;  3L2C A;  1OXB A;  4HV5 A;  3GM2 A;  1HQC A;  3M7G A;  5LD2 C;  4JTD B;  3H9G A;  3IC7 A;  2VJ5 A;  2LG4 A;  2W25 A;  3CAX A;  4U0V A;  4G8X A;  2XGE A;  4MTF A;  1IXS B;  2VQC A;  4F52 A;  3N97 A;  4NTB A;  2AQF A;  1LUJ B;  5COM A;  1Y0N A;  3BPV A;  2E2H J;  2NRA C;  2LFD A;  3S28 A;  5L0F A;  3SXM A;  3V7O A;  2R7V A;  3HEF A;  1EH7 A;  1LFP A;  4U7B A;  3K70 D;  2AVK A;  2E60 A;  4N06 A;  2NVY J;  5HDK A;  3BG7 A;  4KT5 C;  3S27 A;  4U0W A;  1CPR A;  1J8M F;  2P4W A;  4HF0 A;  3DU6 A;  2H09 A;  3V42 A;  5E33 A;  3DEU A;  1YRN B;  1OR7 A;  5H6R A;  1TNT A;  1OIS A;  2DA6 A;  2NNN A;  1WKM A;  4D5C A;  2M64 A;  2VBW A;  2Z5U A;  3CCR I;  3HSF A;  4BQQ A;  3X2Q C;  4ZDL A;  1SEU A;  4IF4 A;  2QEN A;  3KYL A;  2R9R B;  3UGP A;  4RS8 A;  5F1R A;  3LSP A;  1DU0 A;  3CQZ J;  4PR9 A;  4J01 A;  4XMY A;  4B4C A;  5HNH A;  3MYI A;  1FP2 A;  3TP3 A;  2JX0 A;  3WHC A;  1I3A A;  1NG7 A;  2K9M A;  3AL0 C;  3SEO A;  4XK4 A;  3MLG A;  1T8I A;  4DOZ A;  5KYU B;  1TQM A;  1CGN A;  2ZME B;  2XL8 A;  3N2Z B;  4XN0 A;  2IJL A;  5L0G A;  4L18 B;  3N05 A;  2IYL D;  4OIP F;  1ZHT A;  3RKX A;  3WG9 A;  2WAF A;  1Z6R A;  1YDI A;  1X1A A;  4N9H A;  3TDU C;  1XC5 A;  2RGV A;  1JR8 A;  3FXU A;  2JWT A;  3VWB A;  5AGF A;  3H0G J;  3K0L A;  3GO5 A;  2V9P A;  1KON A;  3DMD A;  3ZIB A;  2GIZ A;  4CS8 C;  2M30 A;  4IGG A;  3NKD A;  4BDZ A;  3HUG A;  3PFY A;  5JRA A;  5A6J A;  4HE8 D;  1YG2 A;  3RQ4 A;  3GCM A;  3RYP A;  4JX5 A;  1TBX A;  3K4L A;  4RA2 A;  1IN5 A;  4MVM A;  1BR1 A;  2CJJ A;  4EBB A;  1EV7 A;  1AUE A;  1RR7 A;  3LS0 A;  2VOP A;  4WXH A;  2AXT C;  3H9Q A;  1OCO C;  4HF2 A;  3C3W A;  3L09 A;  4MEY F;  5FB2 A;  2ISY A;  4FWV A;  2J9B A;  4FX4 A;  4RDA A;  1M57 C;  3ABU A;  1V5E A;  4FES A;  5KNL A;  1VQP I;  4BGD A;  4RBO A;  2K5C A;  4HFF B;  4U9D A;  3KYI A;  1QPM A;  2Y31 A;  3OYH A;  2YLI A;  4QI2 A;  2QZ8 A;  4O6Y A;  1MIJ A;  2ZXW C;  2DPU A;  1F5T A;  1Y6D A;  4XEF A;  3GOR A;  2ETH A;  4A3C J;  2ZXR A;  5LGU A;  4XN3 A;  3LMM A;  4ASN A;  2L2O A;  1WAS A;  4JEA A;  1RKE B;  2J5P A;  4NC6 A;  1FJL A;  2ZB9 A;  3SEZ A;  3PCV A;  3B6C A;  3K1P A;  1PJR A;  1MBG A;  4ENK A;  3QQA A;  5GP9 A;  3JRH A;  1JHF A;  1XZP A;  3L8I A;  4U5C E;  1K78 A;  4BQN A;  2LMD A;  5EJC A;  1VQ5 I;  2OQR A;  3EPV A;  2PG4 A;  4L9V A;  2NVT J;  3SEQ A;  5LFA A;  1BI1 A;  3KZZ A;  5J1Y A;  3CUQ C;  2VPL A;  4EJW A;  3K70 C;  1WJE A;  1FFH A;  1MJA A;  1OFC X;  1ZH5 A;  1JAF A;  2N8G A;  4OAY A;  3G73 A;  2R93 J;  3Q7G A;  2HOA A;  4BJ6 C;  4EJU A;  2OQG A;  2Y30 A;  4D5F A;  4HQM A;  4L5J A;  1UHW A;  1O5H A;  1T08 B;  3GTM J;  3GM1 A;  1U8R A;  3AG2 C;  3ATP A;  3UMK A;  3A02 A;  2X51 A;  2JT1 A;  1USS A;  3GFL A;  3HSE A;  1N25 A;  3EHM A;  4ZLC A;  1CQT A;  1MBK A;  4HNT A;  4OMY A;  3V7C A;  1I3Q J;  3VOE A;  2FUG 2;  2Q1Z B;  1FOY A;  2D5R B;  2H7V C;  1R49 A;  2LTP A;  2R02 A;  4J00 A;  1S7O A;  1WCM J;  1DUX C;  2NS8 A;  4RGS A;  3GTG J;  3PNY A;  3WU2 C;  4D1Q A;  1WI9 A;  1TWA A;  2XSE A;  2I8D A;  4BL0 B;  3DCF A;  1YJW I;  1G2H A;  4RB3 C;  2H7O A;  2ZCW A;  3J06 A;  4EBK A;  4BEH B;  4M74 A;  1UMQ A;  5L0H A;  1V4R A;  3E97 A;  4CJO A;  2O9L A;  1LPE A;  4IAO A;  3M1C B;  5HLI A;  1HXD A;  4HQE A;  1BC8 C;  1WWX A;  2ECB A;  4XKW A;  4EM1 A;  1IN7 A;  3B0V C;  1ETW A;  2FJ1 A;  2K86 A;  3BR5 A;  3M8J A;  4OOI A;  1IRX A;  2K4J A;  2GAQ A;  4U5D E;  4G94 A;  4A6D A;  2CUE A;  1PP7 U;  2CS3 A;  3NMK A;  3FXQ A;  1LE8 A;  5KYY B;  3S29 A;  4C3E A;  4N6H A;  2NUT A;  4ETS A;  5DTD A;  1OYY A;  3RZD J;  2DYS H;  3RF3 A;  1KQ0 A;  3MKZ A;  4RAG A;  1XN7 A;  4E7K A;  4A3J J;  3HIF A;  2IS2 A;  3ABL C;  1LIH A;  1U8B A;  1ETY A;  2ZC2 A;  2CW7 A;  4B8X A;  1WPK A;  3BZ6 A;  3N4M A;  1H0M A;  2DJI A;  2C6Y A;  4A3B J;  1ETV A;  3KKB A;  3QAH A;  2JK3 A;  2HVQ A;  3J80 K;  3N0T A;  3DE9 A;  4LLN A;  1HW5 A;  1OQC A;  3H2V A;  2M2E A;  4QSH A;  2QM3 A;  3I56 I;  4AIH A;  1I6H J;  2R7W A;  3MQ0 A;  4MLO A;  3RVZ A;  4MVQ A;  2VXZ A;  1L7C A;  2FGY A;  5TJJ A;  2DO7 A;  3HOZ J;  5T1D B;  1J8Y F;  1TLH B;  2A6H F;  1ZLJ A;  3IKT A;  2W1O A;  2CGP A;  3HJE A;  3CC7 I;  4ZTJ A;  1CGO A;  4CS9 A;  2JTV A;  2B0J A;  5HLG A;  2YL3 A;  3JZ0 A;  5BPI A;  1XX5 A;  2CFO A;  1ZW2 A;  3JRM O;  1LFB A;  1Q0K A;  2G0E A;  1KYZ A;  2FD5 A;  3I4M J;  3QP6 A;  2QBY B;  4IRG A;  2DOE A;  3WGI A;  3G71 I;  5BOX A;  2X9D A;  3I54 A;  1ZRF A;  1M2V B;  1IUF A;  3LFU A;  3JSZ A;  3QVY A;  2M4G A;  3RQF A;  3K7D A;  2KHM A;  3FBI B;  1V54 H;  2JA2 A;  2HGC A;  3BQY A;  3WTT C;  4FET A;  2G7U A;  3SDG A;  2F4O B;  3F8B A;  3U21 A;  2CWE A;  4C9Y A;  1Z63 A;  1ENH A;  2DMP A;  1E3P A;  4M3B A;  1BC7 C;  4UXN A;  5H6Q A;  2GWR A;  2DK5 A;  4KNY A;  4P9F A;  4DVZ A;  3I4N J;  1BJZ A;  2HYG D;  4BDY A;  5A2Q Z;  3RKW A;  1Y56 A;  4ZYG A;  3E5Q A;  1W36 C;  1YA9 A;  1R71 A;  3O8G A;  5DUK A;  5M3M J;  4N4N B;  3BCB A;  2NOJ B;  3VSL A;  2LKP A;  4IPA A;  5E20 A;  4LIT A;  1SVM A;  3M8F A;  1XSX A;  3JSO A;  4EGY A;  3JRC A;  1HBX G;  4OD4 A;  3H3Z A;  1AVO B;  2KC3 A;  2OEV A;  3VAY A;  4EEF G;  1RNL A;  5J6X A;  4XLN F;  4ZYH A;  3OIP A;  2Y75 A;  3MMY B;  2Q4F A;  1IXC A;  2VT3 A;  4D9J A;  1JOG A;  4L0Z B;  1UHS A;  1X4O A;  3VYR B;  1ZW3 A;  2H8A A;  4CIP A;  3B0U X;  1NHA A;  3S8P A;  2Z1D A;  3ESW B;  1CGM E;  3L2Q A;  1V74 B;  4P5O A;  2ZJR F;  2LLK A;  1ZRC A;  3HLZ A;  3FHZ A;  1RKT A;  1SD6 A;  4B3A A;  1R7J A;  4DYR A;  2OZU A;  1VQ6 I;  2BXY A;  2V79 A;  3WTY C;  3PJR A;  1C02 A;  2EA4 A;  1S5L C;  4BE0 A;  3SFZ A;  5LBQ A;  4W97 A;  2HPM A;  2FOK A;  4EWC A;  2YWA A;  4JBA A;  2PJR B;  3MYF A;  5A69 A;  3S3M A;  3ONQ A;  2GA2 A;  2G3V A;  1MMG A;  4M71 A;  1O3R A;  1CGP A;  2GA0 A;  2CMP A;  3GEZ A;  4IRH A;  1H89 C;  2JRM A;  1VLS A;  1ZG5 A;  4E7H A;  4JIO A;  2QSH X;  2L7K A;  5K5O A;  1RET A;  2JA6 J;  2WV1 A;  2ZXP A;  2M0M A;  3L2R A;  3FBN B;  3GUD A;  3H5A A;  1PV3 A;  2GXA A;  1T2K A;  2R5Y B;  4ZZD A;  1IO2 A;  3D0S A;  4LK0 F;  3QMK A;  4C2U A;  4XRS A;  5J1R A;  3ZQI A;  4CUG A;  2KK1 A;  2R7X A;  4AX2 A;  3GWZ A;  4W8P A;  3M1E A;  2WVO A;  1A0B A;  1LDJ A;  2QGU A;  2HOT A;  3JRT A;  1RUN A;  4PFP A;  1W7P D;  4HLY A;  1ZGW A;  1Z5Z A;  4S04 A;  2J0X A;  4U7D A;  4Y4R A;  1ZGJ A;  5L0D A;  1RKE A;  4QIW N;  4IXA A;  4L9N A;  4XOT A;  3UNG C;  5C4X J;  2E34 A;  3GFI A;  3ZQL A;  2HFI A;  4DIQ A;  3SXZ A;  3JR9 A;  1ZKG A;  3REO A;  5FD5 A;  4IEJ A;  1U0J A;  2GOM A;  2IAI A;  3H5N A;  3ZMU A;  4EQQ A;  4KIF A;  4M63 A;  4HYE A;  1K78 B;  3CCL I;  2IT0 A;  2R3S A;  5L0C A;  1LDD A;  2I8B A;  2LOO A;  1UHM A;  1WWP A;  4JJF A;  3M3Y J;  2IS6 A;  2XGD A;  1K83 J;  1ZG1 A;  3HHH A;  2XKO A;  4KBL A;  4JE9 A;  4KJZ A;  3LA3 A;  2L9V A;  1QKR A;  1Z9C A;  1Z77 A;  4KYW A;  2DYR C;  3L0I A;  2GBY A;  4O6M A;  5JT4 A;  2XB0 X;  3DKY A;  3NWT A;  4UNO A;  5KYX A;  2CUF A;  2EIL H;  4I44 A;  3LWF A;  5LLQ A;  4DYC A;  1SF8 A;  1MMN A;  2PP4 A;  1YW8 A;  3H2U A;  2QQ8 A;  1KA8 A;  4XSZ F;  4HNV A;  1W5T A;  4YFX F;  4L6R A;  1WQ2 A;  2L7F P;  3CCY A;  5DM6 F;  3IL2 A;  2J7P D;  4G6Q A;  4XOR A;  3KH2 A;  2K3P A;  1T98 A;  2P81 A;  4BXU A;  2E35 A;  3SZG A;  3WTU C;  3FAJ A;  3FDQ A;  1GT0 C;  1SVL A;  1BL0 A;  1ZRD A;  3E5U A;  5BNG A;  3C2H A;  3K33 A;  2CO5 A;  1ZR2 A;  1A35 A;  2GWW A;  3CF5 F;  2DT7 B;  3OYJ A;  4NUB A;  4RAY A;  3M1C A;  2VQH A;  2XLV A;  2Y3H A;  2CRG A;  2XDV A;  4G12 A;  3AAF A;  3CCM I;  3HBL A;  3WG7 H;  1XG1 A;  5KYN A;  2CQK A;  3LST A;  5J47 A;  2QCO A;  4F91 B;  3CQZ A;  5LRS A;  3HKZ N;  5B3I A;  4HA8 A;  2DAO A;  1LS4 A;  2Y3G A;  5DV5 A;  4F7Z A;  4X0R A;  2A07 F;  3G6E I;  1HMD A;  2K4B A;  2LC2 A;  3BCA A;  4EHP A;  1F43 A;  2Q2E A;  3I64 A;  1KU9 A;  4JX4 A;  2EIM C;  4XEV A;  4XKC A;  5AC5 A;  3RYR A;  2E71 A;  1MGT A;  2HOS A;  5DQZ A;  2M4K A;  1JUS A;  1Q1H A;  3K6B A;  2PMU A;  1R36 A;  2XRH A;  4RB2 C;  4BYY A;  2K85 A;  4LFU A;  4MVZ A;  3AG1 H;  4WGY A;  1UAA A;  2YX4 A;  4BKX A;  1OLT A;  2ZXW H;  3FXM A;  2EIJ H;  3Q9V A;  2PMZ A;  1UZC A;  1Z7Q c;  4JKV A;  1QSP A;  5EZG A;  4KA4 A;  3CMA I;  3US6 A;  5EK0 A;  3JRI A;  1NH3 A;  3BTI A;  3ABT A;  4XLP F;  2FE3 A;  2X6O A;  3ZG1 A;  1RRJ A;  2D2W A;  2JUG A;  2ZJQ F;  1MMD A;  4M9Z A;  2PMH A;  4E7I A;  3TOA A;  2EFN A;  4ULV A;  3C8G B;  2DI3 A;  3Q3S A;  1JMW A;  1VND A;  4HX7 A;  1I4Z A;  3HM5 A;  2FMY A;  3T8R A;  1O3T A;  2CQN A;  2DQR A;  4KUM A;  3NMJ A;  2GLO A;  2BYV E;  2LNB A;  2E1M C;  3D5S C;  3IWZ A;  4AL0 A;  2JZY A;  3BJ6 A;  2XRO A;  4P1W A;  3BZC A;  3LAY A;  4CS7 A;  2KJG A;  1IZ1 A;  3VDX A;  1M2V A;  4UHT A;  3PHF 2;  2R5Z B;  2GM4 A;  1U89 A;  5D5X B;  1QVU A;  4RB0 A;  2K27 A;  2FBH A;  3Q7L A;  4PGG A;  3O3K A;  2R92 J;  2EQR A;  4HW0 A;  4YIF A;  2QBY A;  1ACI A;  2WVQ A;  1UG0 A;  4PCQ A;  5FKM A;  5L3F A;  3K66 A;  3T6G B;  4CZZ A;  1N1C A;  5LEK A;  1WAT A;  4PFO A;  3V5Y A;  4YWQ A;  2Y3B A;  5F0C A;  2GDC A;  1EJ9 A;  1TP4 A;  4S0H B;  5GAE J;  3C8G A;  2KKO A;  3U3F A;  3MKL A;  5H20 A;  4M6Y A;  3OYK A;  5CJ9 A;  1WGW A;  4JTC B;  2JSP A;  3LSH A;  3CME I;  5ILU A;  2YU3 A;  1FMV A;  4RD9 A;  3F3X A;  3GTO J;  2PMZ N;  4KNW A;  1GXQ A;  4FHT A;  3GZ6 A;  4ON0 A;  2E5N A;  2V1X A;  2OQM A;  2K02 A;  2R0Q C;  2YQY A;  5L0J A;  3CC2 I;  2LYC A;  2ZNY A;  3IKV A;  4A3G J;  1PP8 F;  4D4N A;  1TTY A;  3HYI A;  3U8V A;  4YT8 A;  4AIK A;  2JQ7 A;  1TFK B;  2R7S A;  1A7D A;  1ZN2 A;  4XKB A;  3ZMZ A;  3PQJ A;  4H0E A;  1T6Q A;  4AU7 A;  1BI2 A;  2IGN A;  2UXN A;  1D3Y A;  3QPT A;  1RIO H;  1JKQ C;  1Q0F A;  1AHD P;  5AC4 A;  3ZQG A;  3EZH A;  3JRG A;  1I5N A;  5D8K B;  4E0H A;  2L9J A;  3CLO A;  1K40 A;  1Z0X A;  3LSR A;  1BW5 A;  3S1M J;  3G4Z A;  4KDP A;  3BTL A;  1G4D A;  2MC3 A;  4BAY A;  3GW2 A;  5LHI A;  3L2V A;  5EHH A;  3K4N A;  4IZZ A;  1QA6 A;  2FU4 A;  1R5I D;  3EQL F;  3QRF F;  1PDN C;  2O61 A;  1YAR O;  1TW2 A;  2RC4 A;  5KYX B;  2WTE A;  4XLC A;  4MGR A;  9ANT A;  1FTS A;  3DTK A;  1Q0G A;  3ABL H;  4V2G A;  1V54 C;  3VEP A;  4LAC B;  5KYY A;  5FLX K;  2YLD A;  4PJJ A;  3LNQ A;  3OEO A;  1OCZ C;  4ZYA A;  2QNL A;  2QY9 A;  1MD0 A;  1LEA A;  4J32 B;  4IO9 F;  2HZ8 A;  3S3O A;  2ZBK A;  4DBR A;  4RGR A;  1G3T A;  1JT6 A;  3O55 A;  1M56 C;  1A04 A;  2AU5 A;  2MYS A;  3U9J A;  2V1N A;  4HBL A;  4G6D A;  1OXK A;  5ILS A;  2R5Y A;  4WK8 F;  1XSV A;  1OKR A;  1O7F A;  2IS1 A;  1JTX A;  2JUC A;  4WCG A;  3BRJ A;  4ESJ A;  3Q6M A;  1FBU A;  1BIB A;  1FIP A;  1OR3 A;  3B9Q A;  1U5T C;  2FRH A;  1YJG A;  3V8L A;  3MVP A;  4D0P A;  1XZQ A;  1IRZ A;  1AEP A;  4J19 A;  1AA7 A;  2M3A A;  4G6T B;  2FA5 A;  4MO7 A;  1REP C;  5JFR A;  3F23 A;  1BA5 A;  256B A;  2EPN A;  4HLX A;  2ZSI B;  2J5O A;  3F8C A;  5KAI C;  4OIR F;  2YU9 J;  4LDR A;  3PDM P;  3FF5 A;  3K4C A;  1P4A A;  4BEM J;  3MBG A;  1U5T A;  1ZLK A;  5D4R A;  4KIS A;  4R79 A;  3A01 B;  1A31 A;  1H9G A;  3QWL A;  4BXX J;  2RRE A;  4OU0 A;  1QZE A;  1ON1 A;  4CCL A;  3QW0 A;  2ZKZ A;  1W4M A;  2FSW A;  2C04 A;  2DYR H;  3D5L A;  4AUX A;  3S2H J;  3A4C A;  1JPN A;  2BHY A;  2EFQ A;  2AWC A;  2IA0 A;  3W6V A;  1C0W A;  4HFK B;  2I5U A;  4UVA A;  1C03 A;  2P6V A;  3FXO A;  1S7Z A;  1FX7 A;  4WGZ A;  3DPL C;  1K7A A;  1WJF A;  1ZG3 A;  1DP7 P;  2KW3 C;  1MDM A;  2HDD A;  5F27 A;  2HQN A;  4ENM A;  1X1P A;  5DS6 A;  4OMZ A;  4ENJ A;  3NYL A;  4U5B E;  5FCL A;  5E1X A;  3IEE A;  1ZU5 A;  3CCS I;  4LOC A;  1WJ5 A;  2KIF A;  3PUF A;  2MH9 A;  4XR6 A;  4LB5 A;  3WAQ A;  4FAP B;  2HXO A;  1OMI A;  1QZZ A;  4EAT A;  3S2D J;  2R7D A;  1WJB A;  3L00 A;  3WGH A;  2WC2 A;  3GYH X;  1LE8 B;  4GRI A;  4NC3 A;  2YZS A;  1R22 A;  2F4M B;  3BR6 A;  1I5Z A;  4XPY A;  1SC7 A;  1AU7 A;  1TFO B;  3GM3 A;  2ELK A;  2ZXH A;  2HKO A;  3F6O A;  4DXW A;  2W48 A;  4HX4 A;  3TJ6 A;  1RUO A;  3EHN A;  2XLE A;  4XLE A;  1TT5 B;  3KP3 A;  2CUJ A;  3C18 A;  3RI4 A;  4EBJ A;  4CDV A;  3HSR A;  5K0I A;  3BR2 A;  1IZM A;  2ZXO A;  1FBS A;  1W1W E;  5B3S H;  3KEY A;  5M5X J;  3IAM 2;  2R7Z J;  1S6L A;  1VLT A;  2WAD A;  3IP4 B;  2VJJ A;  2XAS A;  2E7W A;  3B0P A;  2IPQ X;  1FOK A;  4RDU A;  2KDZ A;  2Q9A A;  3DJU B;  2ZO4 A;  1Z3Y A;  4GCV A;  2XAQ A;  1XMX A;  5C3E J;  1YZC A;  3AQC A;  2VIX A;  4RB1 A;  2WA0 A;  4DNC A;  4JUR I;  2M9H A;  4I09 A;  4CCK A;  1LKX A;  2EIJ C;  1QNT A;  3T4R A;  2V7F A;  4BHB A;  4M6V A;  1X1D A;  4A12 A;  2PJR A;  4YL3 A;  3VSK A;  1ZAO A;  2QQ9 A;  4CDY A;  5FZT A;  5IY5 H;  3OYN A;  4CYD A;  4PZJ A;  1NTC A;  2J9V A;  2EFO A;  3NKE A;  5KCM A;  3RKY A;  1HSJ A;  3KLN A;  3W6K B;  2P7C B;  5F0H A;  3F72 A;  1XMA A;  2JPU A;  3TD7 A;  4BE2 A;  5K5Q A;  3COA C;  5IOY A;  4UUT A;  3CCQ I;  1BR4 A;  2NOG A;  2E5Z A;  3JCU Q;  1IW7 F;  2GAU A;  5D5V B;  1IG7 A;  3HTS B;  1S7E A;  3OOU A;  4OIO F;  5GTH C;  3FKJ A;  3M4O J;  1E85 A;  2L9S A;  3CF2 A;  3AL0 B;  4Q7C A;  1FIA A;  1FYM A;  2QSF X;  4ZH4 F;  1KU7 A;  3ZRG A;  3BG5 A;  1WJC A;  2LIG A;  4LDK A;  4A3E J;  1JUM A;  2O0Y A;  2P0W A;  4LD5 A;  5K7H A;  1S72 I;  2WVN A;  4RGX A;  3ASO C;  2HOE A;  3SFI A;  3KPH A;  3CZ6 A;  4S05 A;  1HDP A;  1R58 A;  5M5W J;  2E19 A;  3H35 A;  2WAQ A;  1L3P A;  3ZQ7 A;  1S3J A;  2F48 A;  1MMS A;  2DT6 A;  5L3G A;  1R00 A;  1SFO J;  2YS9 A;  4MIM A;  4R32 A;  2X4H A;  3NDB B;  3O2P E;  1Z23 A;  4ESF A;  4Y52 J;  2XLH A;  4CH7 A;  2R5Z A;  1N77 A;  4V2F A;  1P92 A;  3T5X A;  4F93 B;  5F1J A;  5M3F J;  3EYI A;  2EZI A;  1A5J A;  4XIC A;  3A9C A;  2HZD A;  1QHG A;  1XS9 A;  5J1U A;  5T3W A;  4C3J J;  3SJM A;  1OCT C;  3LNR A;  4AVP A;  4L0Y B;  4JCZ A;  4CCJ A;  4XTK A;  5J40 A;  4D7M A;  3GAN A;  1EA3 A;  1UFM A;  2EV6 A;  1X4P A;  2ZJ2 A;  1WJD A;  2BC5 A;  3DI5 A;  1XGM A;  2JRT A;  3OY9 A;  3ROU A;  4K2E A;  2HJM A;  2Q3T A;  3EUK L;  2JD3 A;  4DBQ A;  1BZ4 A;  3OIO A;  2BVM A;  2XB5 A;  1BBH A;  5E3A A;  3CC4 I;  3D1N I;  5JP7 A;  3A01 A;  4FX5 A;  5FKO A;  5EG0 A;  4HEA 2;  1G5Z A;  4G78 A;  2VBZ A;  4O6J A;  1FYK A;  3R2P A;  5F28 E;  5L3V A;  4I0B A;  2CNW A;  3LLK A;  4I2O A;  1VQ9 I;  3NG1 A;  3ZQH A;  5FLX Z;  1A36 A;  1J5Y A;  3S15 J;  3HDD A;  4CDA A;  1TQG A;  4QI0 A;  1UEL B;  1RZ4 A;  3WTS C;  4DJ9 A;  3AG3 H;  3TL4 X;  1IGN A;  1YLF A;  1ODD A;  2EB7 A;  1BOB A;  2O5R A;  1I39 A;  5E3N A;  3TJ5 A;  5DM7 F;  1T95 A;  1X58 A;  2NG1 A;  4OD5 A;  1N75 A;  4Y15 A;  4A93 J;  3EUH A;  4U5H A;  2XAG A;  3WHN A;  2P7V B;  3QP5 A;  2V6C A;  5C44 J;  4AID A;  5JLX A;  4YEJ A;  3ZR8 X;  3QOP A;  3HOX J;  3O6B B;  4P55 A;  3TBI A;  4XNF A;  2VC1 A;  3V8J A;  4C2M J;  3TW7 A;  2HV6 A;  4E7L A;  2UUI A;  4F3Q A;  2VL8 A;  1ONV A;  5HNF A;  2D5V A;  2CV1 A;  4MW8 A;  1HE1 A;  3ZMT A;  2CNW D;  2LSO A;  3CCE I;  4A4A A;  4YIR X;  1G3S A;  2ASR A;  1HW2 A;  3ASO H;  3PNV A;  2H8R A;  1ZEL A;  3KIO A;  1H7I A;  5ERI A;  1WH5 A;  3FMQ A;  3HG9 A;  3LUT B;  2NS7 A;  2E1M B;  2EK5 A;  3P9K A;  4AC0 A;  1NK2 P;  3M15 A;  4EJT A;  2DA4 A;  5CI8 A; 
#chains in the Genus database with same CATH homology
 1R5I D;  2OJE D;  2ICW G;  3KPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...