1R5ID

Crystal structure of the mam-mhc complex
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
214
structure length
214
Chain Sequence
SMKLRVENPKKAQKHFVQNLNNVVFTNKELEDIYNLSNKEETKEVLKLFKLKVNQFYRHAFGIVNDYNGLLEYKEIFNMMFLKLSVVFDTQRKEANNVEQIKRNIAILDEIMAKADNDLSYFISQNKNFQELWDKAVKLTKEMKIKLKGQKLDLRDGEVAINKVRELFGSDKNVKELWWFRSLLVKGVYLIKRYYEGDIELKTTSDFAKAVFED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Mycoplasma arthritidis mitogen complexed with HLA-DR1 reveals a novel superantigen fold and a dimerized superantigen-MHC complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
total genus 84
structure length 214
sequence length 214
chains with identical sequence H
ec nomenclature
pdb deposition date 2003-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.530 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A mam-mhc complex, Chain D, Domain 2 1r5iD02
1.20.120.390 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hla class ii histocompatibility antigen, dr alpha chain. Chain D, domain 1 1r5iD01
2OJED 3KPHA 2ICWG 1R5ID
chains in the Genus database with same CATH superfamily
2O8KA 2YZSA 3DE9A 4Z9JA 4ULWA 3QODA 3R7CA 5ICEA 1CGPA 4O5VA 2E60A 4EJTA 3HOSA 1U6HA 2EQRA 1TQPA 2IEKA 4BDYA 4XRFA 3I55I 1W0UA 2RREA 1IW7F 4A0XA 4QWQA 1UHSA 4I99C 4U7DA 3ZTZA 3BEHA 4W1UA 2ZBKA 1QPIA 1R1UA 2F2EA 5DS5A 3IQ5A 4E18A 1TWAJ 4U5FE 3BPXA 1KZHA 3QVZA 2LY9A 4KITB 2P7VB 2DGJA 1U0JA 2W25A 2RVCA 5IYDJ 3W2AA 4MFEA 2STTA 1B9MA 3V7SA 4A3MJ 3AG2C 3E9VA 3K33A 2W85A 2VCCA 4JKVA 2X4HA 1ZW2A 2Y3DA 1XMXA 2IAIA 3CUQB 4KN4X 5FLVA 1D3YA 1E3PA 2GOXB 2PBIA 1YI2I 2O61A 3FISA 3REOA 3T8TA 2IBFA 2VPLA 2AQEA 4LLLA 3LFKA 3L2RA 4M71A 1ZGJA 2EH3A 3FHNA 3E70C 1V54H 4FE4A 2QKLB 4UV8A 2HQ5A 3BZKA 3A0HC 3LA2A 4HQMA 1Y8RB 3KE2A 1PDNC 3FAJA 1HDPA 1R1TA 3G4XA 4DJ9A 3HJCA 3LSIA 2ICWG 2WB1N 1OCCH 1FOYA 2BW3B 2Y0MA 3HKZA 4JX5A 4O6NA 3ZCOA 3GMEA 1LDDA 3GM3A 3SZGA 5HVQC 1Q1HA 3ZOBA 3NWSA 4DNCA 3S3NA 2R7FA 3B73A 5F0HA 2CV2A 4NBQA 1SVLA 2WA0A 5FKOA 4EM0B 1ST6A 2IYLD 3O6BB 3E97A 3TO6A 2MC3A 3W6KB 4DYCA 4R8HA 1XGOA 1Q1VA 3JTLO 3ERMA 1H7IA 4CCLA 4HNVA 3VWBA 1ORKA 2K3PA 3TP3A 5E18F 1QVTA 1HLVA 5A2QZ 2XF5A 5DQTA 2HYGD 2DT7B 2G62A 2JSCA 1RRJA 2BC5A 1XPXA 3G1LA 4MFDA 1XSVA 4CBEA 2BZTA 1JE8A 5FGMA 3VSKA 4CXFA 2RSEB 1QA6A 3LOCA 1OW6A 3CDLA 2AVKA 4I76A 2XDVA 3ZMSA 2AWYA 4CH7A 1G5ZA 1OR7C 1M2VB 5F5HA 2LOOA 3MAJA 5D6FA 3JT1A 3VYUB 2B7EA 2QENA 3HL2A 1WSUA 3J7ZI 1SFXA 2DI3A 2QE9A 4A4AA 2O9XA 4I98B 4OAYA 2AU5A 1F5TA 2YX7A 5J4VA 2DA5A 1YS6A 2DTZA 1S7AA 3GTKJ 2BW3A 2VKVA 2AHQA 3LSGA 3AGTA 4XONA 3A01B 2FGYA 5KYNA 1H9GA 3KKBA 1A6IA 1UB9A 4A0YA 2EJRA 3RQEA 3BT9A 1D0XA 1JGSA 5CKTA 5D8LB 5L0DA 2MG4A 4AIHA 3SXMA 2XLEA 1D1AA 3AG1H 2R93J 2VC0A 2LK4A 5AC4A 3LAJA 4Z9HA 2IBDA 1FSHA 3GW2A 1WATA 3ZQCA 1J75A 5E1XA 4IOCF 2ZXHA 5KYYB 5IOYA 2XLVA 1E86A 3ZQQA 3DWWA 4YT8A 4CZZA 1AWCA 5BUOA 1B59A 2E7XA 4YT4A 2RNGA 2NVQJ 2NS0A 1MH4A 5HODA 1W7PD 2WB7A 3A9CA 4YT5A 3BOQA 5KYXB 2Z9OA 2XVCA 3WHNA 2IXOA 3V5YA 1D0YA 1WJEA 5FD5A 4C2MJ 3GANA 3OYNA 2QLZA 2DFEA 2P5LC 3CUOA 1JUPA 5H2FC 1KU2A 4CX9A 1F9NA 2XAHA 3I64A 3QPHA 2JZYA 3SFIA 5AGFA 3ZIBA 1F36A 4MTEA 1NH3A 2ELHA 1MMAA 1USTA 2HQRA 4MVRA 2HXOA 4BEJA 1R00A 3Q0VA 2LD5A 2WZFA 1XTAA 3M1CB 1P4WA 3SNHA 4BHPA 4F92B 1ORSC 1ZR4A 5CI9A 1DP7P 2LKXA 2BVMA 4LDRA 2PEXA 4U5CE 3K70C 1SD7A 1EV7A 5EZGA 2M30A 3DBLB 3OYIA 3K4NA 1VQ9I 1QPMA 2P81A 3BDDA 1FBUA 1FR0A 2HEOA 4I1OB 1ZGWA 3CF2A 1TW3A 3AG3H 3OYJA 2HOTA 2UXNA 3HUGA 2ZSHB 3ASNH 3IAS2 4RAFA 4RLQA 2DBBA 3R4KA 1JKQC 1K79A 2VCBA 3B29A 3K66A 4MVSA 3RVZA 4A3FJ 5D5UB 1U5TA 2VBYA 1P7IA 4L5EA 1DU6A 3KEOA 3O8GA 1FLIA 5B3SC 2VQCA 3TBIA 4BH9A 2L81A 1LE8A 2NNNA 3ZQGA 4KMFA 3QPSA 1O3RA 4OOIA 1LJ9A 5HDKA 4XEVA 2FRHA 3QYFA 4UB6C 1VQOI 1R49A 1JKOC 5DV5A 5LHIA 1Z67A 5DM6F 1NFOA 1ZHZA 3DD7A 4HDVA 2O03A 2F6CA 1WWPA 5A6JA 2P8TA 4ENJA 4EBKA 3OS0A 3B0VC 1FMWA 4BBSJ 1RMVA 2M9HA 2VQHA 3AG4H 5BQTA 4LDQA 2NVTJ 2DOAA 5B5EC 1O3SA 3OEOA 4XRSA 5JS5A 2WL8A 1CGME 1ZN2A 3S2HJ 1R7JA 3EG9A 1ZYRF 2BOLA 5TRDA 1UFMA 2J5PA 2QY9A 5HNFA 1D8JA 2FA5A 4KN7X 4JE9A 4P1WA 2HKVA 2KRFA 3HNIA 3MFNA 4H54A 1T5OA 1NK2P 2YLDA 2X9DA 2XGDA 5B1AC 3U9JA 4XOTA 3T8RA 2ZB9A 2Q8KA 1SFOJ 1K05A 1VOMA 3BLYA 3AG1C 2L9VA 2YHSA 2K9QA 3DKWA 2OF7A 4LMYA 2NNYA 3K69A 1LI7A 3HOZJ 3RQFA 1SD4A 5IYBJ 4AK9A 4EV0A 2NG1A 4L0YB 5E8GA 2XRLA 2JUCA 2QVOA 3EPZA 3ECSA 4PUSA 5DQZA 1FMVA 2WTEA 1GXQA 2EPOA 2D2WA 1NBBA 3KPHA 4L9VA 4XRMA 3RZOJ 4ZZDA 2ZXIA 4OMYA 2VBWA 1WJBA 2LC2A 3GLLA 3R0JA 1TQGA 2W45A 1TT5B 4RAZA 5CVRA 2X6XA 3ZQ7A 2WWYA 2DMPA 1YRNB 4IHWA 3S16J 4UB8C 4IOAF 4I3MA 1MD0A 5D4SA 1A0BA 4HOBA 1U2WA 4U7BA 2IXSA 2KMUA 3DU5A 1VFCA 1MBJA 1Y0NA 1IRZA 1UHMA 6PAXA 3LMMA 4D5CA 2DQRA 1M56C 5CQGA 2FEZA 2VJJA 3DTEA 3GTMJ 3PM1A 2VE8A 3BR2A 1D5VA 3W6JB 5L3VA 1U3EM 3DAFA 3HRTA 2E1OA 5GP9A 2H7VC 2XL6A 1U9NA 4WGZA 1LPQA 2VOOA 3MZYA 3K10A 3QMKA 2HR3A 2VN2A 3BCBA 4BGDA 1EJ9A 2FBIA 1L7CA 4BNCA 2MLGA 3E5XA 3OA1A 5L3BA 4A6EA 5DM7F 4L9TA 1I4YA 3DJNB 4P96A 2GZWA 2JPUA 2A61A 1OMIA 5LGNA 1O7FA 3PO2J 3NYJA 4EM2A 3VFZA 3PJRA 4CSWA 3MZ8A 4YELA 1I5NA 4Y15A 5B3IA 4MEXF 2VC1A 1BN5A 1ZHXA 2ZJ2A 2A5WA 3S93A 3HOWJ 2M4EA 4G94A 3S14J 3CCMI 2ID3A 1JPNA 1IRGA 5EG0B 3ZVRA 4GYTA 1P4XA 2CO5A 1ACIA 2R02A 2NS8A 1OKKD 2L3DA 2I8BA 5B1AH 2V1UA 3T6JA 2FE3A 5E3NA 3NARA 4KI2A 1U9OA 2ESNA 3ULQB 2PF4E 2Y3HA 3T5XA 1LVKA 1E0EA 1JPJA 2P5KA 2Q00A 2H6CA 2Q2EB 3ISPA 1I3AA 3PNVA 3EDPA 2GAQA 2E7WA 2MGQA 3QW1A 4A93J 5J4YA 1KYZA 3LAYA 1YYXA 5E79C 4M3BA 5L0HA 3FKJA 3KYCB 5CVIA 2BY0A 3K9TA 1VQ4I 1ZG1A 2JA5J 1MJBA 3SHFA 1A7DA 3DFGA 1WI3A 2FQ3A 1ZTRA 1XSXA 2A1DD 4O79A 3NMIA 5F28E 4DVYP 2WZGA 4CDGA 4BDZA 1LFUP 2YSRA 1MSFC 1OCRH 4YIFA 5J1YA 3S1QJ 2M1BA 3LSTA 4ZYDA 4L0ZB 5K7HA 4A3LJ 2LREA 4L9JA 4RM2A 3F8NA 2IA0A 2WAFA 4II3A 5CI8A 2DJIA 1ZRDA 4JJGA 1B9NA 2I8DA 3BTJA 3RKWA 4JQFA 4D9JA 1AOYA 2P0NA 4GXOA 4ZDPA 5HOOA 1M2VA 1HMOA 4ZTJA 2DA4A 3VPRA 4Z9IA 3GZNB 2IRFG 4HEA2 5EEHA 2F22A 1A7VA 3OYGA 2P6TA 4HE8D 4FASD 1WPKA 2BEOA 2LFFA 2AP3A 3LUTB 2TRTA 4ANJA 3GEEA 1T39A 1EH6A 4C7OB 2LNBA 4ABZA 1DPRA 3J81Z 2QQ9A 5KYWB 1T6QA 2EIJH 1IF1A 2BVLA 3V8JA 2OPTA 3T6GB 2QUFA 3WTZA 3S3OA 2PX3A 2HYFA 4XMYA 4HX7A 2R05A 4D4XA 3IEEA 4Y17A 2BGCA 1BR1A 5HV9A 2PFBA 2K9NA 3D5RC 4KNYA 1ZHTA 5E3OA 2Z2SB 1YITI 1HA8A 3B9QA 4KIGA 1R71A 3WG7C 2OJED 3GFLA 3KYLA 4ULVA 5IT9K 1ZARA 5FLXK 3BY6A 3CUQC 2LTPA 2EB7A 2NAZA 5EHHA 4AM3A 3PCVA 4I09A 4KNVA 5EZHA 3I58A 4EMSA 4E0IA 1VI0A 3KLOA 1V5GA 3QP5A 3S32A 3BP8A 3A01A 3LEVA 4C3DA 4N4WA 1GV5A 1SVOA 4E7IA 5B1BC 2DAOA 3DEEA 2NOGA 2GFHA 1NHAA 1YW9A 1Z05A 2EFQA 2OCCH 3HB9A 3IKVA 4HX8A 4GCVA 3RZDJ 4BXXJ 5TJJA 4MTGA 2ECBA 3B6CA 1MMSA 4ZZLA 4I2OA 5BQGA 4EHPA 2DFIA 2NXNB 4HW0A 4C7OA 1ONVA 1XMKA 2XF7A 3HEFA 2LKSA 5HDNA 3V4GA 1LB2A 1IXRC 2H6BA 4U0YA 1UMQA 3WG7H 1BL0A 1WASA 2EINH 2ZXPA 4EM1A 1M2OA 1W2WA 4CYDA 3CCVI 3MYIA 1FWZA 1OR7A 4NDLA 5TISC 1QU3A 1ZELA 4H4KC 4ZC3A 2LG4A 5L0GA 3FXJA 1S05A 3S90A 2F5EA 4CS7A 3FXHA 1HY5A 4CA0A 2HOSA 4XEKA 5A6BD 1FNTc 5FROA 2QNLA 1CGOA 4CDYA 3M9AA 2UUHA 1T2KA 1U89A 4RMNA 5B1BH 3RQ4A 2VE9A 4E7SA 4CJGA 4EGZA 4C3BA 5K5QA 1IXCA 4HG2A 4KT6A 5LEKA 3V42A 1T6UA 2K85A 1XZQA 3NAUA 4JYKA 2IA1A 3OSGA 2M7BA 3TDZC 4EJUA 1JI8A 3HGYA 4CS9A 1SFUA 3I9V2 2J9VA 3J80K 3R61A 1BBYA 1YW7A 3IWFA 1Z0XA 1JGGA 1UELB 4HF2A 4IHXA 2PLYA 2WV1A 1ERDA 2EPNA 2WAEA 4JVSA 2XC7A 4KIBA 3DQVC 1PVEA 1B68A 2VT3A 2XAUA 4PK4A 1AU7A 1TWCA 1TW2A 3D0SA 5JFRA 3RIPA 2XM0A 1ZREA 2VODA 3PSIA 3K4CA 4BHBA 4BAYA 1APCA 4AIDA 4HLYA 5B3SH 4ENNA 4G8XA 2GA1A 4LG3A 2ZO4A 5FLXZ 5GPCA 3JZ0A 5GTIC 4CHUA 2DPDA 2DYRC 1Z3YA 2BXYA 3JRHA 1S7EA 1K6YA 2DLLA 3GFMA 2TDXA 2OUMA 2OV7A 2KIQA 4L18B 2J46A 4E7LA 3KH2A 4IPAA 4AL1A 3B02A 2COMA 4IQJA 1RKTA 1TNSA 4IEJA 2V6EA 1QLEC 1POGA 4QPQA 1ZG5A 1EH8A 1VZ0A 2D1VA 2KLOA 2HVSA 2L02A 3I54A 4DYQA 1GV2A 4KMUX 4FX4A 2H8RA 2JRMA 2QGUA 3FM3A 3JCUC 1TFOB 2Y69C 2DDBA 4OMZA 4B44A 3C8ZA 4IB4A 1FAPB 1HXDA 2B9SA 1WJ5A 4S05A 3SFZA 3S1RJ 1PCXA 3FF5A 2EIKH 4AE4B 2OCEA 3F3XA 2O7OA 3DLAA 2E2JJ 2Y39A 2X0CA 2QYOA 2WZLA 4D0PA 3S8PA 1SAXA 4WJ0A 5EGOB 1D0ZA 3R60A 2E1NA 1NLXA 3K1MA 4XNFA 5FRMA 2OZ6A 3FBIB 1TWGJ 1X58A 5GADJ 3S3MA 2C6YA 4G0HA 2HS5A 1P6RA 4XOPA 4NCQA 1MJAA 2V9PA 3U9GA 3HRSA 1GLNA 1WVRA 5E3MA 1GHCA 2GWRA 2WVNA 3PIPF 4FX5A 1MGTA 2Y3BA 3KP3A 1BA5A 2ZC2A 4AWXB 1AKHB 1J8YF 2VOPA 2NYXA 3TK0A 3LQQA 3VF0A 4MEYF 2LFBA 3L7WA 1YZAA 4HEAJ 3G1OA 4AIJA 3ZWIA 5JUAA 4LFUA 1YIJI 2QBYA 2KYHA 3EGDA 3HNLA 3U1KA 1J09A 1TQMA 2WAQN 4B4CA 4BUPA 4MS2A 4A69C 2BY2A 5J8FA 1XB4A 5CQEA 3DM5A 1W5TA 3MWMA 3NKEA 1NG7A 1RETA 4CCMA 3LNRA 4MNUA 3DCFA 2PP4A 1F1MA 4F93B 2KISA 4HX4A 4AYBN 3DPUA 1SF8A 1TNTA 1IXSB 4DXWA 2DU9A 3DBRB 3FDYA 4DZPA 3GO5A 1KONA 1OPCA 4M9SA 2KGOA 1R4TA 4ZYEA 3L2QA 4BACA 2EV0A 1A5JA 2L9NA 2V4JC 2XF6A 1T6IA 4IZZA 2F4IA 1YA7O 1YTYA 1MDMB 5FKKA 1FIPA 5FFZA 2DA2A 3M8FA 1RKCA 2Q4FA 2H8WA 1VQ5I 1Z3IX 3H9QA 3G4SI 3EHNA 1T8IA 1XGNA 4CS8A 2O5RA 1JJ8C 2DA6A 3QPLA 1FBSA 3F23A 2CYYA 1NK3P 3G3ZA 1WGWA 3CP2A 4BEHB 2D5VA 4MO7A 3ITFA 3JSZA 2KNHA 5KYYA 4UUVA 4J01A 3DTKA 3SEZA 4PDKA 2L2OA 4BXUA 3E0JB 1BW5A 2E2IJ 1Q0MA 4PSWA 4P6IC 3S9OA 3PHF2 3PDMP 2QBYB 5JT4A 3F8BA 4MQVA 4Z6YA 1LM3B 3FDQA 4JEAA 1I6XA 3JSPA 4CICA 3HBLA 1VQLI 1FPQA 1DOWA 1XG1A 1LNWA 5TJ5E 1OKKA 2XPUA 5AC5A 2EZKA 2F5CA 2VJIA 2J0XA 1QKRA 3FMQA 3I0TA 3LFUA 3F8MA 3GYHX 1B8IB 4IRUA 2NUTB 3DU6A 5DYMA 3TGNA 1TFKB 1RC9A 1KU7A 4ZYGA 4RB3C 2STWA 4Q48A 3TDUC 3QVYA 2XXAB 3OIPA 2WBMA 2D5RB 2TMVP 5DUIA 4CCNA 2R7SA 4OIRF 2L01A 3DF8A 3JREA 2CV0A 1X4OA 1XSDA 3RH3A 1BOBA 3RSNA 1JXSA 4UV9A 5LGTA 4WWCA 3DZAA 3W4YA 4ER9A 1K6OA 5HDGA 3EETA 2OG2A 3HIFA 2Q9BA 3F9KA 5DEQA 1WJFA 2M2EA 4XR6A 1FYLA 3MKWB 4U5HA 3QU3A 3TULA 5BS6A 2YU3A 1IN8A 3MD2A 5D92A 4UUSB 4EATA 2GLOA 1OXKA 3OOUA 3R6SA 1R5HA 3EJNA 4NTBA 2KKOA 3GTGJ 2VXZA 2HV7A 2Q1ZB 3AL0B 1EA8A 2NUPB 3C8GD 2O9LA 3HNJA 1I5ZA 1T0FA 3FBNB 2O6GE 2GA2A 3DKXA 5AIPA 4NNJA 3OV8A 4Y3OA 2OQRA 4MNDA 3MLGA 1OCTC 1S29A 3PNTA 1ODDA 1P7JA 1PD0A 4A3BJ 4DBQA 3H2UA 3F72A 5K5OA 4CCJA 3Q9SA 2P5VA 4B47A 2M0CA 3WU0A 3M15A 2Y2ZA 4WXCA 2M64A 2X48A 5F6FA 2MC4A 2EZIA 4XN3A 3VDXA 2QSHX 4PACA 1SYQA 4CCKA 3HKKA 3LLKA 2DA7A 3IV5A 1BM9A 2OTJI 5KYWA 2K5CA 3A4CA 4KC9A 3M1CA 2P4WA 2JA7J 4XSXF 5JVTA 1XWJA 1I3QJ 1I1GA 3OYCA 2E1MC 2LBFA 3CMYA 1JRAA 2XIGA 3OIOA 3QYEA 1TWCJ 4RGSA 4WXHA 3RKYA 3JRGA 4MW8A 3KP5A 4UUTA 5CVUA 2JN6A 2R7UA 2VB6A 4RGUA 1E3HA 3BJAA 4OWRB 3TKYA 5BMZA 4JCZA 4AX2A 2P61A 3HGGA 3LSHA 1KQ0A 2WVOA 3TO9A 1ZGAA 1XCBA 2UWMA 1FP2A 4XKCA 3L1PA 1ZKGA 2EV6A 1F1ZA 2A5YB 2CQXA 5ERIA 3I4MJ 2CUZA 2HZTA 3I4NJ 3SZPA 3P9IA 4HZFA 3C63A 4BJ5C 2HYJA 1FX7A 2X6YA 1N78A 3LNMB 2KL4A 3I53A 1BJZA 5IOZA 1WHUA 4A3GJ 2CNWA 2HSBA 1FP1D 2DA1A 1X3ZB 5C4XJ 3ZQYA 4A2UA 1J8MF 1Z6TA 4P9TA 1RI7A 2QEXI 5H6QA 3DPTA 3L2WA 2NVUB 4RGXA 4F7ZA 3DTIA 5J47A 3FXRA 2NS7A 4E70A 2P7CB 3FMRA 4OD5A 1LEAA 2DFHA 2EPMX 4EKWA 4RS8A 4NTFA 3RPQA 1J7KA 4RGRA 2MFZA 3A02A 3OR2C 2R7QA 3QOPA 1H9TA 1CF7A 1VB5A 4MVUA 2R4GA 2W1OA 3K1IA 3Q6MA 3H9JA 4IHTA 2PX0A 3JR9A 1RKEA 2XSJC 2E87A 3OOPA 4MVQA 4OIQF 3CJQB 4YIIA 4X6AJ 3OIQA 1QRYA 2M5WA 2FAPB 2CYDA 1MBKA 4MTOA 1W0TA 4YL1A 2CSOA 3S2DJ 3DJUB 2HSQA 4D4NA 3CTAA 1K4TA 4IJAA 2ZFWA 4IAQA 4LG0B 3WTYC 1YJNI 5D6EA 2ZXJA 3WODF 2HFHA 3WHCA 1VQ7I 2I5UA 4K1OA 4LACB 2GAUA 1E83A 4N0BA 5AONA 4DW6A 3FWEA 1K7AA 1FOKA 4D7MA 1HCRA 2K02A 5FFXA 1E84A 3O3KA 4XLNF 2JPCA 3HOYJ 1BZ4A 1OYWA 4HNTA 3CCLI 1K78B 1UCRA 5LHHA 4LDKA 3GX4X 5L3CA 3LJBA 1ZQ3P 1MSEC 3CQZJ 2UUZA 1VQPI 2M4GA 3V8KA 2QLAA 2DK8A 4JRZA 1Y6IA 2YS9A 5JI6A 1MBHA 2IGOA 5HLIA 4LLNA 2KK1A 4W8PA 3KYIA 3K6GA 2HMQA 4XICA 4XBFA 3GFIA 4IF4A 1PUEE 2GIZA 2PMUA 1QHHD 1R9TJ 3K7DA 1EI7A 1LKXA 1QNTA 3EQLF 4GFBA 2HVRA 1ORJA 2VQGA 4RB0A 3BRJA 4WCGA 5LRSA 3CDIA 3AQBA 2E5NA 1G3TA 4BQQA 1JOGA 2JPBA 2LLKA 2Z99A 2F5DA 3EPVA 2VLAA 2XLHA 3T4RA 1Y1VJ 2R7WA 4BE0A 5LD2C 1S72I 1NZEA 1ZHYA 3RKOF 1J5YA 2BHYA 4KYWA 5BNGA 4LGWA 2E19A 4U0VA 4BY1J 4HSRA 4QLCU 4I7HA 2UZKA 1TL8A 4N6HA 2FD5A 2LSOA 3V5ZA 1BDJB 1V4AA 1YQAA 1O57A 2FOWA 5LGUA 5ILUA 1O7LA 3BR1A 2RV8A 3TL4X 4X1EA 1J0RA 2QQAA 5L3FA 1JHHA 1RZ4A 4DYRA 2LH9A 2VBZA 5M3FJ 1HW5A 4BHCA 2CQNA 4WF2A 5T3WA 2CS3A 3PUBA 1YDIA 3K1IC 2E5ZA 2KQRA 4AE4A 1DGRM 2ELKA 1K4SA 3GTQJ 1Z91A 3EUHA 1YA9A 3O10A 1WI9A 2KDZA 1WH5A 3SYTA 3QTHA 4C3JJ 3X2QH 1SC7A 2BV6A 3H36A 2Y75A 4AD9A 1R6RA 1PYVA 3JRMO 3U5SA 2QF7A 3GWLA 4WXDA 4XORA 5D5WB 4W97A 5KAIC 4GYGA 2FMYA 4GDFA 3H3UA 3H0DA 2YL1A 3CCUI 3JRCA 5F1JA 1U5TB 2IPQX 5A69A 2R0QC 3KP7A 5GAGJ 2DPUA 2EIJC 4M6VA 2ZMEC 4JP0A 4AU7A 4BJ5A 5F04A 4JTAB 4KBLA 1HKQA 5DCMA 2KJBA 3CLQA 3K2ZA 2CCYA 1W7PB 2ETHA 4XSZF 3KZYA 256BA 4YG2F 1IUYA 2EA4A 2EILC 1V74B 3ABMH 2LQGA 4U0WA 3ZMTA 5HLTA 2VT2A 3WU2C 5K5RA 2JSPA 5A6BA 2F4OB 1DQUA 3P5JA 2ISZA 1O3UA 2EINC 3I59A 3ZG1A 4HAMA 3QAHA 2KIFA 1IGNA 2HOEA 2XGEA 1RKEB 4RDUA 3EG9B 2EIMH 4B8XA 2FX0A 1BI1A 3ROUA 3LLIA 2A6EF 1EA3A 1ETXA 3NRVA 5FJ8J 2DA3A 3GTLJ 4YFNF 3G1MA 2WVQA 3L1MA 2CW0F 4P9FA 3OYFA 3H2VA 3WGHA 1R23A 3TQOA 3U8PA 4BY7J 3O8HA 2A07F 4O6JA 2GA0A 2MSYA 1QZZA 4ZDOA 1UG7A 1IZ1A 2PX9A 4BQOA 1RPWA 4YL3A 3PNYA 4B09A 4BQNA 1Q0KA 2IS4A 5T3TA 3G50A 3JRBA 2K9SA 1N75A 4PJLA 4JTCB 4CYCB 5JLXA 5K7FA 5FKNA 4J7TA 2JX0A 4K7BA 1R5GA 2OZUA 3H5AA 1R36A 2O8XA 3GVAA 2X1DA 4DIQA 1UAAA 1HQCA 2EFNA 1BOAA 2XAFA 4F91B 2A69F 2IS6A 3VODA 3QRFF 1VQ6I 4F3QA 2CUEA 2YR2A 1FFTC 1ETWA 1SR2A 2PG4A 1W1WE 5H6RA 4AC0A 2OJQA 2D4UA 4JC7A 3RFYA 2YLIA 3MFKA 4A6DA 1MNEA 3IC7A 2G9WA 4NHJA 2QQ8A 3DWLE 5COGA 2IXNA 2NOJB 3I56I 1AVOB 2J7PD 1KA8A 4QSHA 3PMRA 3ZQLA 4EJWA 2DYSH 2HDWA 3BWGA 3Q0UA 5EEAA 1HMDA 3F6VA 1JUSA 2GDCA 3SYNA 1BI0A 1QZYA 3RPUD 2PJRA 2JJ7A 4JZAA 4XIDA 1LPEA 2ZCWA 3HXLA 3W6VA 3LSRA 3RF3A 1VQMI 5J8CA 1VTMP 2MBFA 2ESHA 2R7XA 3KFWX 4IRGA 3ZMVA 2DXIA 2RDPA 2R7VA 3CCQI 2EZLA 4G12A 3LSJA 3HOXJ 1QQIA 3DEUA 3NYLA 3L2CA 3SDBA 4B1RA 3OYDA 5JP7A 2NVYJ 2ZKZA 3EUHC 5DD4A 3CC7I 5LRRA 5IP9J 4EJVA 2FMLA 4XLPF 3GLXA 4C3HJ 4UVAA 4YL0A 2B0LA 3DKAA 1NG6A 3J7AO 3IP4B 2PNOA 3GM1A 3WTWC 4M6XA 1P2FA 1FYKA 2B0JA 4UY8I 4FESA 1BIAA 2L9RA 4M63A 3GEHA 2X1CA 4HA8A 1RUNA 1TZLA 1T6SA 2LP0A 1X2NA 1CQTA 3D5SC 9ANTA 4MLOA 2LD6A 4IXAA 2L54A 2CDQA 1VNDA 3E7LA 3RIRA 2PJRB 2Y31A 3CLOA 4PFPA 2MHRA 2R25A 1T9KA 2CUFA 4ESFA 5ILSA 5EG0A 1ZLKA 3M4CA 1IN4A 1V55C 3E5QA 2CV1A 4FHTA 3H3VK 2HUJA 2Z1DA 1FBQA 3OYMA 1OR3A 1ZAOA 3FOOA 3CESA 3OL4A 2JTVA 1K40A 2LDUA 1NSGB 4BKXA 3EGDB 4RB2C 4FTHA 2KZVA 3IKTA 3ABKH 3ZSUA 4P9UA 1UG2A 2DB4A 5FZTA 2OKUA 4E7ZA 3GUDA 3O39A 3L2VA 1GGQA 2ZXWC 4ASNA 1UG0A 1Y39A 1F43A 1X1CA 4JX4A 5J40A 4BU2A 5IY5C 1VF9A 2DYSC 5BPDA 4UHTA 3E6DA 2LCHA 1YJ9I 1O5HA 1K83J 2EPKX 2XS1A 2DT6A 4V19K 2DTRA 3QPTA 1U78A 2QSGX 1P9QC 2IGKA 3HJEA 3OYHA 3OYEA 3K4KA 3JYHA 3DI5A 4AL0A 1OJLA 2ZNZA 5J1UA 3OS1A 4UDVA 4HNUA 4LOCA 2ZD9A 1WKMA 2IA2A 5FO5A 2HDCA 1G3YA 4GGGA 3OMYA 2PN6A 4NC7A 2JK3A 1ITYA 2FXAA 3ABTA 1X19A 1QPUA 2BXZA 3PQJA 2GXAA 2KP6A 1ZU5A 4U5GA 1FEXA 1YZCA 3H65A 3DLLF 5IPAA 1BIBA 1W5SA 1X2MA 4AYBA 2IS1A 2DMUA 3R0AA 3ESWB 2HU9A 3FXUA 4D7NA 2J9UA 1JUMA 4FE7A 4JX6A 2J0WA 3OS2A 2L5QA 3C62A 4BEMJ 1MMDA 2DODA 3S1NJ 3A1YA 5CJ9A 2X51A 1X1BA 5IYCJ 1T01A 3Q7LA 5JLIA 4BL0B 4OAZA 2R7TA 3M7GA 1R1VA 2HXIA 1S8NA 4G9YA 1WH7A 2PI0A 2ZXOA 3AG3C 3I5UA 1CGNA 2NSGA 1PD1A 1T95A 3CMAI 2CMPA 3FIWA 4A12A 1X1DA 3S15J 4Q7CA 4BPMA 4CDAA 4G6DA 4Q5SF 1ENHA 2M45A 4M3FA 3GF2A 3IH4A 5COMA 4S0HB 2AXLA 2ELJA 4FQGA 2ZSIB 3C2GA 3HTSB 1WGXA 3FAPB 1XGSA 4B3XA 4BE1A 3GWZA 2CU7A 1V55H 2NUPA 4UXNA 2YPRA 3NQOA 1MNMC 5DCFA 5DLJA 3BPVA 2LFDA 4BJ1A 2HTJA 4Z2YA 5FKMA 3ZMDA 1VQ8I 4OINF 4IAOA 1GS9A 2PMZN 1T38A 1SMTA 4N4NB 1E3OC 1DUXC 3LQRA 4WGYA 3KEQA 3RYLA 4MW3A 4A3CJ 1X1PA 3CCJI 2OU2A 1DP3A 1K78A 1LS4A 1IV6A 2HV6A 5DUKA 3WTSC 1E85A 2VIXA 3MKZA 4JW1A 3AG2H 3BR5A 3JW4A 3HUGB 1BR4A 4JJFA 4I02A 3Q7GA 4ENMA 4FISA 4OD4A 2IGNA 3JCUQ 3X2QC 3HKZN 1XX5A 4Q4ZF 4LLEA 1MBGA 2PMHA 3CCSI 2QM3A 3BROA 3K0LA 3SJMA 4IX7A 4PJMA 1RUOA 1J9IA 3ZQVA 3LS0A 3SXYA 3L9FA 3WTUC 3QW0A 3V7CA 2XAGA 4DGWB 2COBA 4AUXA 2MA3A 5FCLA 1ETVA 3HM5A 2WY8Q 1H8AC 1IO2A 2OBPA 2ZXWH 1BW6A 3A03A 4A5NA 1Z9CA 2K3FA 4HF0A 1Y4CA 2OOCA 4M3GA 2KC3A 3GZ6A 5C4JJ 1RESA 2IGMA 1HW1A 3C2BA 3HZJA 5F27A 4KICA 1X1AA 3FHZA 2UUIA 1OQCA 1XMAA 3S2WA 1G3WA 1H0MA 1R58A 3KYJA 1TKNA 2LSEA 3PFYA 5EK0A 3JTGA 4XQ1A 2EK5A 2EILH 3CMEI 4BBRJ 2C04A 2XASA 1C02A 3T1BA 3WGIA 1FIAA 2HTSA 1YX5A 5E3CA 1TT0A 3DP7A 1HKTA 1JHFA 4LLCA 2VONA 2H1LA 1Z5ZA 5LLQA 4M73A 1U8BA 1GXPA 2LP4A 3TOMA 1ETOA 3AQCA 4UNOA 1YFHA 1T33A 4ZJZA 2CQKA 3N0TA 1S9HA 3RYRA 3HOVJ 3CO7C 4E17A 2XLMA 2BBYA 2L9SA 2ECCA 2EPFA 3LA3A 4I6ZA 4LD5A 1YO5C 2KFDA 1U5TC 4ZLCA 3EFOA 1QSPA 5JLWA 3EGXB 5L3QA 1KQ8A 1OCOC 4CO8A 2J9BA 2M8EA 4P5OA 1IJWC 2HGCA 3ZRGA 2JA2A 5DVWA 4O6YA 1OYYA 5L0FA 3NWTA 1PUFB 5EJCA 2CG4A 1QQ3A 3S1MJ 2KDOA 3GZ5A 3H35A 4BE2A 1SMYF 2IS2A 2PQ8A 1HSJA 4CUGA 3C8GA 1OCZC 2V6CA 3SZRA 2L4MA 1TLHB 3HOTA 1Y1WJ 4QDLA 1IUFA 1OISA 3IH3A 3VEPA 2KJGA 3GEZA 3GODA 3DAGA 3P9KA 3BG7A 2L6FA 4JBAA 5L3EA 4I44A 4CSAA 2XUBA 4HPQA 2LBFB 4LB6B 4IGGA 1D1CA 1MW7A 1SANA 2JMWA 4UVCA 2OEXA 2L7MP 4Y33A 4I1MA 3RQIA 3WTVC 4RLFA 2JT1A 2JVHA 4M74A 2PJPA 5F5FA 1A31A 1O3TA 1RR7A 2VXDA 2FNAA 3KP6A 1GDTA 3RQGA 3V5XA 2XPWA 3TEDA 5KYUB 2Y3GA 2LF7A 3H3ZA 3BG9A 4JOMA 1Z77A 3IHUA 2LY1A 3C7JA 3ECHA 3PQKA 4WX9A 1YLFA 2V9VA 1LE8B 3OYKA 3I5QA 4CJOA 2WC2A 2KHMA 5DDGA 1TWHJ 4JURI 1LQ1A 4YRVA 1FOWA 3CC2I 1Z7Qc 2VPRA 1MQVA 1G4WR 3ABLH 5KHDA 2G0EA 4E7HA 3S29A 1JAFA 1RCPA 4KFCA 1OCRC 4F4BA 2XKPA 1R22A 3DBHB 1G4US 3OR1C 4EUKB 3CO6C 3J06A 1JTYA 3C2HA 5GTHC 1OCOH 3G6EI 1ZW3A 1Q0GA 3NMKA 2O3FA 1WJAA 4KT5C 1I4ZA 2CNWD 3LEOA 4N9IA 4V2FA 4JEBA 3ASNC 1D1BA 1ZVZA 4MTFA 2RQPA 3RKQA 3IWZA 1SFEA 2YRFA 2E35A 4YJWA 3FMSA 5HS7A 4ZTFA 1L3PA 5FLMJ 2FF4A 4P55A 2LYCA 2QKMB 2R7DA 3T9OA 2F5FA 3Q9VA 2QQBA 3QU6A 3BCAA 2ETSA 2XRNA 3CCRI 1WWXA 5ICFA 3H92A 2Z3YA 5CPRB 3BC8A 4HV6A 2ZXRA 1I39A 3ML6A 4U5EE 2RN7A 4HBLA 5HLHA 3J80Z 1YE9A 2MH2A 3ZQFA 2XLDA 4HRIA 4C30A 3FHDA 4G7HF 3M8EA 4XKBA 3K1HA 2L6HA 4N4OB 1TWHA 2NSFA 1OCPA 2CWEA 3WGGA 4QIWN 3ZP5A 1JMWA 4X0RA 1QHGA 3COAC 4EGYA 2H7BA 3OL3A 5IP6A 1GVJA 4DJAA 3O55A 4QI2A 2A3SA 2DQLA 2KPMA 2E1CA 1B72A 3DXJF 1L0OC 2DDAA 1TQIA 2EFPA 2ISYA 1ORYA 2XRHA 1KGSA 4XKWA 2LRDA 4PCQA 1Z21A 1FOXA 5K1YA 1YG2A 1WFXA 2NRAC 1YRNA 1IG7A 2L7FP 4PJNA 5EYRA 5GPAA 5E8IA 3M79A 4YT2A 2VQLA 1OCZH 3FKIJ 1VYKA 4KNWA 1GQAA 2F4MB 4I0AA 4KIFA 2XLWA 1IN7A 1P4AA 2DO7A 1GT0C 2QZ8A 1WTYA 1WOLA 2M7AA 1A7EA 2I15A 3JAMZ 1ETQA 1E2XA 4E6KG 1S5LC 3G71I 1XGMA 2W24A 1S6LA 2ZJPF 2XM4A 3UGOA 3JSOA 4HFKB 4MTDA 4HV5A 3I5PA 4EQQA 3H9GA 3DKYA 2VH3A 4LG0A 2IP2A 2MWQA 2Y9YA 1QVXA 2PMZA 3G73A 2XSDC 3JRIA 2GXBA 3ZN1A 5JR3A 2B63J 3AGUA 2G3VA 3UKGA 4A3DJ 4A3EJ 3GTPJ 4E0HA 1OR2A 3U3BA 2EZHA 1JT6A 4XLAA 3J81K 1APLC 5C44J 2QWWA 2CFOA 1SVMA 1K04A 4Q47A 2VUMJ 1A35A 1B72B 3CP8A 3VRCA 2R5ZB 3ZMUA 1MH3A 1WQ2A 1YX3A 1HKSA 4XN0A 4RDAA 3H1CA 4NY3A 4I01A 3DMDA 2ACJA 4W8KA 3PIOF 1Y6DA 3C3WA 3WHBA 2L4AA 1IN6A 5E33A 3FX3A 3TOBA 1A6QA 2G3KA 4G6TB 1SFKA 3VM6A 2AQFA 2CJJA 3VSLA 1W5CC 5IT3A 3T6BA 1R4MB 4G6QA 4AVZA 1G59A 4A2NB 3AJMA 3HTUA 2J9WA 2HJ3A 4N06A 1ZLJA 3BG6A 4XLCA 2DN0A 5C3EJ 2R5YA 1XD7A 3TOAA 1M6TA 4RBNA 3V8LA 1S7ZA 4M9XA 3S27A 5GAHJ 4KA4A 1O3QA 3F0CA 1SZIA 1V54C 2LKPA 5FKLA 1RIOH 1FJLA 1K61A 3GM2A 2ZJRF 3V7OA 3DV8A 1H89C 4JTDB 2VKDA 1G3SA 3ABLC 1EKEA 4F52A 5BQHA 1UHWA 3QOEA 1FFHA 1QZXA 1EQ1A 1W36C 2ASRA 2W00A 3O2PE 1MNDA 5L0CA 2CRGA 2YWAA 2HWVA 1NU9C 4MVZA 4XM3A 3GTOJ 1WJDA 2BHZA 2YX4A 2KQ9A 3BJ6A 3K4LA 2JA8J 5J1RA 2QSFX 4B3AA 5K7ZA 1KNYA 3ABMC 1STZA 3DPLC 4F55A 1ZG3A 4E7JA 1IDYA 1LDKB 4ON0A 2R7ZJ 3WE3A 5LEJA 3CC4I 2OQMA 5CVVA 5EGYA 2GQQA 2AWCA 3RPUA 2KZGA 3NYMA 2JA6J 1REPC 3H5RA 3I3LA 3L0IA 1TBXA 4LIVA 2DMTA 4M3DA 3BZ6A 3JRDA 1N77A 1TWGA 3PL8A 1YYJA 5KAFC 4E7KA 5BOXA 3ONQA 3D1NI 1VQNI 1ETKA 3M8JA 1TWAA 3E3VA 2A0UA 1N25A 2EIKC 5KYXA 3RYPA 3HHGA 3KP4A 4UVBA 4FAPB 5D8KB 5ICGA 1B6AA 5E1WA 4CS9C 3LESA 3W8IA 2ADUA 1JT0A 2Q9AA 3BTLA 2XPVA 3BR3A 4RAYA 2DMNA 5FB2A 3X1OA 1BC7C 2YU9J 4R79A 2Q9CA 3JYYA 3JRFA 1QZEA 1A41A 3TQNA 1MBFA 2EWNA 3FXLA 2H1KA 1FTSA 4NC8A 1H6GA 2Z5UA 1L3LA 3ELKA 2GIVA 3TD7A 4DBRA 3LS1A 1WN0A 5ED4A 1A36A 2L7KA 4EWCA 2BL2A 4HSTA 4MVMA 4ONSA 1LVAA 1OW8A 2HMZA 3LAPA 1Z3XA 5F0FA 5DTDA 2A0BA 2JWTA 2ZNYA 3ZQIA 3GTJJ 2IXMA 1TR2A 4K2EA 5HSWA 1GUUA 3U2RA 3EYYA 3B0UX 3MYFA 1TTYA 3HRUA 3K7AJ 1MKMA 1N1CA 3L8JA 2DMQA 2K40A 1CF7B 1T0FC 4LJZF 3RJPA 1G4DA 2C03A 2DT5A 5EGOA 3Q0WA 3KETA 1IDZA 4OU0A 5F0CA 2JQ7A 1P92A 4LIUA 1FTZA 4R32A 3WTXC 4XPWA 3ABKC 5L0JA 3SQNA 2FBHA 1MDMA 4U5DE 3KCCA 2W82A 3S0XA 2YLGA 3CJRB 3ZXSA 4ESBA 2W7NA 1AEPA 2VBXA 1Z23A 4QI0A 4EBJA 2LK2A 3GXOA 1X4PA 1Y56A 2KT0A 3EUAA 4MIMA 5L3GA 1TC3C 3F47A 4J7YA 1MIJA 1MZBA 1EH7A 1GVDA 3KEYA 4E4HA 4A5MA 1VK5A 1EKYA 3KLNA 1U8RA 3TP0A 3EYIA 1FY7A 1MMGA 2F5VA 2QTVA 4EBBA 5HLGA 4C2UA 4XPXA 3H5NA 4LLGF 2G7HA 3CF5F 3J7AY 2Q3TA 4CIHA 2VKHA 1KYWA 3ATPA 3GWNA 5F64A 2ID6A 3WTTC 2CH0A 4XQFA 4FETA 3BQYA 4A3JJ 2V1NA 3BR0A 3GEIA 2YKZA 4S04A 3UNGC 2CQ7A 1XDUA 2MLKA 4BYYA 2TCTA 5D5XB 3J7YJ 2XGCA 5K0IA 3NDBB 1BBHA 3BG5A 1B8IA 1BI3A 1WRJA 5F08A 1J2XA 2OU6A 3K2AA 2GM4A 3W3CA 1F4KA 2IXPA 5J6XA 1U0BB 3U21A 2FU4A 2WY7Q 4L5IA 3N97A 5D4RA 1T98A 4EIYA 2J5OA 4ENKA 5M3MJ 4GRIA 2VL8A 1JKPC 4XK4A 1IRFA 3LA7A 3OY9A 1ZH5A 5GAEJ 4N9HA 3MN2A 3K6BA 2FJ1A 4WK8F 3BZCA 1X3UA 1KTMA 3C8GB 2VC9A 1XC5A 3HRMA 3NEUA 2OAZA 2LY2A 3LWFA 1I27A 1V5EA 2P7VA 3IPMO 3BQZA 1FSEA 3SXKA 3ZN0A 2GOMA 2WB1A 2OA4A 2I10A 4Y7NJ 3IRRA 3L2UA 1UJ8A 3S17J 2OD5A 1NTCA 3GFJA 4RBOA 4BXFA 2A05A 2MH9A 4OIOF 4KISA 3RKXA 1J59A 2H27A 5DS6A 3I59B 2EPLX 4RD9A 3JAMK 4C3IJ 4NTAA 3UMHA 2RGVA 4CGZA 2M0MA 2EFWA 5TGTA 4MQ9F 3S28A 2CUJA 3ABUA 3IRQA 5KYUA 2GXGA 2MD5A 1WJCA 3CSKA 4XWJA 4JCHA 2WV0A 2K27A 3IUOA 1ZU4A 3IQ6A 5AIQA 2CW8A 3FVYA 5J3LA 1VLTA 1Q0DA 2FUG2 2YUSA 2IJLA 1ZZPA 2CGEA 1AA7A 4QPOA 4IHYA 4XTKA 3E6BA 3QWLA 4CZCA 3TJ5A 4CS8C 4XEFA 2VCAA 4IWBA 2PBEA 5KK1A 3UGPA 2Y0SA 2OTLI 5F1RA 3GBGA 4AIKA 2DCEA 4CYCA 1VQKI 4U88A 3UMIA 1LI5A 2L9JA 2M4KA 2HOAA 3C1DA 2W4MA 2YL7A 3HHHA 5BPIA 1TP4A 1LEBA 3N2ZB 1OQYA 3P7NA 4R1HA 4FX0A 1JTXA 3TW7A 3OWTA 1Z1DA 3BR6A 1CPRA 2XLOA 3FOPA 1Z6RA 1VLSA 1HF0A 2YL0A 3W8HA 1XCVA 3TMOA 4XPYA 1PP7U 4FT8A 4HDUA 1KQ9A 2H7OA 1S3JA 1WCMJ 1I1SA 2Z33A 3RCOA 3EHMA 2V1DA 5E3LA 2DFFA 4NQWA 2RC4A 1HC8A 5E20A 2BYVE 3I4PA 1XDSA 5EEGA 3QZCA 2F48A 5L3DA 1I6HJ 2E34A 3EZIA 2BE5F 1PP8F 1FTTA 2ZJQF 2KRHA 3F6OA 3IQTA 3BTIA 3CJTB 5H20A 1CPQA 5IP7J 2H94A 2XB5A 1B4AA 1ETYA 2Q2EA 1NU7D 2E2HJ 3RTRA 4M3EA 3VOEA 5LHGA 1BR2A 2M34A 2VI6A 1HBXG 1E17A 5JVEA 3CZ6A 4J32B 2K7LA 3KZIC 2ZPAA 1Z7LA 1RJ9B 3POVA 2QUPA 1OKRA 1SAUA 3LSKA 1ZR2A 1HSTA 3F22A 4M9ZA 3AAFA 1ON1A 2VKEA 3GCMA 4XLHA 3T0YA 4B43A 2X6OA 3ZC4A 2BY1A 5FD6A 4PZJA 1RKWA 3DE8A 3K4JA 2IW5A 3QP6A 2XV4S 2R5ZA 4HQEA 4DVZA 2KRCA 3B6AA 4PGGA 2IM8A 4OIPF 3KZZA 4KJZA 4A0ZA 4RM3A 5JSLA 3U3FA 3OYLA 3N24A 1JJ6C 4IHSA 4J19A 3OYAA 4WABA 1KU9A 2D1HA 2MYSA 2HQNA 2IOQA 3F46A 2O0YA 3KX2A 2V3CC 1QVUA 1TWFJ 2AO9A 4Y4RA 1ZK8A 2KSFA 2Y48A 5DS9A 1Y8QB 3F21A 3IQCA 1LDJA 4GQHA 4PJJA 1T08B 3CMMA 3M07A 4IARA 4ESJA 2HFIA 3JSEO 2X0LA 3CDHA 3HC7A 4U5BE 1UFBA 3RVYA 3R2PA 2WAQA 3MVPA 2JUGA 3BG3A 4NUBA 1MJ9A 4CSAC 2Y9ZA 3GORA 2R5YB 1ULYA 4V2GA 4HLXA 3ZTMA 2MW8A 4CIPA 1IAWA 3K1PA 4IRHA 5L0IA 5HNHA 1MBEA 2VASA 1YYVA 1BC8C 1YAUO 2JD3A 3TOLA 1YW8A 1FC3A 2R3SA 4EEFG 3HG9A 2R7OA 3RI4A 2RKHA 3N05A 2H8AA 5M5XJ 4NC6A 5JHUA 4N6CA 1Y0UA 3K4MA 2H09A 4DOZA 2XKOA 4D5FA 2IVMA 3PUFA 1Z6AA 1VTNC 2HQAA 2A6HF 1OCCC 3ASOC 1GM5A 2NVXJ 3JTHA 4GO1A 2XROA 3ZQHA 4FCYA 2P6VA 2XL4A 3U2MA 3HPHA 3B0PA 3CJNA 3CCEI 3V7RA 5M5YJ 4BQAA 4BJTA 5ICCA 2NPUA 2JVGA 2LR8A 4YWQA 3PFIA 2NUTA 4MGRA 5DS4A 4YN0B 2CW7A 3L09A 3FXOA 1FZPB 3MZHA 1SD6A 4H0EA 2GBYA 3VYRB 5DD8A 2XS8A 2HNHA 4PGHA 2K86A 2OQGA 4PJ0C 5EDNA 4KUMA 5E1ZB 3DM9B 4BS9A 4NQFA 3Q6NA 5IT9Z 3HOUJ 4BJ6C 2UXXA 3KIOA 2J7PA 4II2A 2J8WA 1W7PA 1MMNA 2Y0SN 4G78A 2D45A 1W36D 1DU0A 1YHQI 4ZYHA 3NG1A 3H0GJ 4B6IA 1SD5A 4G7OF 1WZ2A 2A6TA 3Q3SA 3E6CC 3HNKA 4ETSA 3G2BA 1HE1A 4YFXF 2QCOA 1IRXA 2BY3A 1SEUA 2P0WA 3EUKL 1C0WA 3HYIA 3L8IA 3MQ0A 3NRHA 5GPGB 3NKDA 5CVJA 2Y30A 4TV7A 5T1DB 5BQIA 3S84A 1LE4A 2B0HA 2HZ8A 3US6A 5CIVA 3HDDA 1JR8A 4Y52J 3U8VA 5D91A 1ON2A 5E17F 4HYEA 4IRIA 1X3WB 4J30B 4M6YA 2J45A 2W4BA 4ITVA 2HPMA 1C17M 2DOFA 2DJNA 3ZR8X 3CEXA 5LFAA 5A6AA 2YEVA 4IQ4A 3CAXA 3MMYB 3SZTA 2K4JA 3PSFA 3RDIA 3LL7A 5ILVA 2K9LA 3FK6A 1OLTA 3U1DA 3U0CA 2W48A 2X1EA 3MCZA 2XHKA 5CYVA 2XXAA 3FM5A 3ERED 2Y69H 4XRSG 3E6MA 3LSPA 2Q7RA 2MD0A 2AXTC 4XL9A 1IN5A 5LBQA 4RB1A 3VYSB 1RR8C 1PV3A 3IH2A 1G8XA 4JK1X 5HS8A 1DDNA 2HPIA 4GEHA 3L00A 2RNJA 2QA4I 4LB5A 1IC8A 3HLZA 1ZHFA 3JRTA 1USSA 3WAQA 3ASOH 2EIMC 2XB0X 4DRHB 1V4RA 3VYWA 4IHVA 3EH1A 3D5LA 3HSEA 4XKVA 4UUSA 1B1BA 3E5UA 5M5WJ 3Q5FA 1O4XA 4CCOA 1IZMA 4L6RA 1XS9A 4U9EA 1V5FA 2IT0A 2KW3C 3TO7A 2RD9A 5EF6A 1W4MA 2XAJA 1NFNA 1DOVA 4BG0A 3I4UA 2XAQA 1YARO 3VB2A 3SEOA 1R5ID 2KIMA 2X6WA 3U2LA 1YIOA 4A3IJ 3F8FA 3KP2A 3M3YJ 3SXZA 1R4NB 3HSFA 3FXQA 1LFBA 2HI3A 1C03A 2YQYA 4A3KJ 4C2TA 4BJ6A 3SEQA 1FNNA 3M4OJ 3LSMA 3RW0A 3BJOA 3A0BC 3K70D 3AL0C 1LE2A 2OC6A 1DGWY 1D8KA 2KIUA 4U87A 4B48A 2R7RA 2K9MA 4IO9F 2L7ZA 2KJCA 4HFFB 4YIRX 2E36A 1I50J 2M3AA 4I0BA 1M57C 1FYMA 1VYIA 2W84A 3EZHA 1RNLA 3P9CA 5A6KA 1ZRCA 2FBKA 1M1EB 2ZMEA 1YLMA 2LF8A 1T56A 3IL2A 1U6GA 2W9YA 3VYTB 3LNQA 3HTKC 2Q0OA 4PR9A 2XGXA 3TW6A 2GWWA 3VAYA 4ZDLA 4IJJA 2CQQA 3O6XA 2EV5A 4LK1F 1AUEA 3QQAA 3AKZA 2E71A 4KDPA 2R03A 2WADA 3HSRA 4PSXA 1YVIA 2CGPA 4PFOA 1Q0FA 3UMKA 5KNLA 3B71A 1ZRFA 2M87A 2M8GX 4BEHA 3C18A 2LVSA 1QGPA 4L9NA 3EGXA 2FNPA 3EFOB 1NG1A 3L34A 3I71A 4DZJA 2HKXA 3MBGA 3AG4C 5COFA 2VJ5A 4LITA 2LMDA 2K4BA 2E1MB 1AKHA 2RQQA 4O3MA 3G4ZA 4X0GA 1PUFA 4ZYAA 3EH2A 2OCCC 3CQZA 3KL4A 2HZDA 4U9DA 3TJ6A 4YEJA 3UR3C 1XN7A 1UZCA 2DW4A 4K0DA 2G7UA 3AFHA 2R92J 3FK7A 3U9MA 1IV8A 3MX3A 4ZH4F 1A04A 4DRIB 1HE9A 4L5JA 4DQ2A 1Z63A 1HOMA 1OFCX 3DEWA 2LIGA 3ZPLA 2P1AA 3N4MA 3KYDB 5KVRA 4NQWB 2MABA 1DPUA 1V3FA 1G2HA 3QYBA 3CCYA 4O7GA 1LFPA 5CLSA 2DOEA 3FXKA 2ME0A 4JIOA 2RAEA 3F8CA 2VJ4A 1YJGA 4Y13A 1EF4A 1ZHWA 5JHFA 1KU3A 4RA2A 2L0KA 3M1EA 2CFXA 2HVQA 2V26A 2EBIA 3A2KA 4EJOA 3CD6I 3WE2A 1D5YA 2A68F 5D5VB 2EFOA 5FRNA 1YOVB 2Z15A 4CDVA 4AVPA 3MKYB 2W4SA 3HPGA 1QBJA 1O87A 1OW7A 1YS7A 4IL6C 2X85A 1HDDC 4NC3A 3AOUA 1RJ9A 3JRAA 2ZMEB 4HF1A 5B66C 3A11A 3NMJA 3K4BA 5JRAA 3OYBA 5KCMA 1AHDP 4FWVA 1LIHA 3WG9A 3CUQA 3MKLA 3WU1B 2ME6A 3W2WA 2UV1A 2HDDA 4XLEA 4MHGA 4C9YA 3OSFA 2L6GA 2YL3A 3BTCA 2FSWA 4IVNA 2P6SA 1FT9A 2FFHA 5HS9A 3M4BA 3KMIA 2V79A 2AS5F 2N8GA 2V7FA 3W2VA 2HKOA 5IY5H 3FXMA 2V1XA 3ZGKA 2ZFUA 1BJAA 2DYRH 3FZVA 1S7OA 4RAGA 4C3EA 1QO0D 5JVGF 4GYIA 1G6NA 2OEVA 1OYIA 4LK0F 4G7ZF 4M72A 4MVOA 4XLFA 3MEXA 1BI2A 3SDGA 4YK5A 3IAM2 5A2QK 1H88C 4QTRA 4IKFA 2L7AA 2XL8A 2HJMA 2JRTA 2XSEA 1PJRA 2DK5A 2EA2A 2V9KA 1YJWI 1OXBA 2PFDA 4LERA 5DCMB 4O6MA 3SP1A 3ZMZA 5E2QA 4ZLDA 4J00A 1VMAA 3ZDLA 1LUJB 1LS1A 2FQ4A 4DRJB 1HW2A 4NB5A 1JKRC 4EVIA 5E3AA 2FOKA 3E1SA 1RXQA 2Z16A 2R9RB 3ECOA 4YFKF 3K1NA 4D1QA 3PO3J 1XZPA 2W57A 2YVKA 1Z7UA
chains in the Genus database with same CATH topology
2OJED 3KPHA 2ICWG 1R5ID
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OJE D;  3KPH A;  2ICW G;  1R5I D; 
#chains in the Genus database with same CATH topology
 2O8K A;  2YZS A;  3DE9 A;  4Z9J A;  4ULW A;  3QOD A;  3R7C A;  5ICE A;  1CGP A;  4O5V A;  2E60 A;  4EJT A;  3HOS A;  1U6H A;  2EQR A;  1TQP A;  2IEK A;  4BDY A;  4XRF A;  3I55 I;  1W0U A;  2RRE A;  1IW7 F;  4A0X A;  4QWQ A;  1UHS A;  4I99 C;  4U7D A;  3ZTZ A;  3BEH A;  4W1U A;  2ZBK A;  1QPI A;  1R1U A;  2F2E A;  5DS5 A;  3IQ5 A;  4E18 A;  1TWA J;  4U5F E;  3BPX A;  1KZH A;  3QVZ A;  2LY9 A;  4KIT B;  2P7V B;  2DGJ A;  1U0J A;  2W25 A;  2RVC A;  5IYD J;  3W2A A;  4MFE A;  2STT A;  1B9M A;  3V7S A;  4A3M J;  3AG2 C;  3E9V A;  3K33 A;  2W85 A;  2VCC A;  4JKV A;  2X4H A;  1ZW2 A;  2Y3D A;  1XMX A;  2IAI A;  3CUQ B;  4KN4 X;  5FLV A;  1D3Y A;  1E3P A;  2GOX B;  2PBI A;  1YI2 I;  2O61 A;  3FIS A;  3REO A;  3T8T A;  2IBF A;  2VPL A;  2AQE A;  4LLL A;  3LFK A;  3L2R A;  4M71 A;  1ZGJ A;  2EH3 A;  3FHN A;  3E70 C;  1V54 H;  4FE4 A;  2QKL B;  4UV8 A;  2HQ5 A;  3BZK A;  3A0H C;  3LA2 A;  4HQM A;  1Y8R B;  3KE2 A;  1PDN C;  3FAJ A;  1HDP A;  1R1T A;  3G4X A;  4DJ9 A;  3HJC A;  3LSI A;  2ICW G;  2WB1 N;  1OCC H;  1FOY A;  2BW3 B;  2Y0M A;  3HKZ A;  4JX5 A;  4O6N A;  3ZCO A;  3GME A;  1LDD A;  3GM3 A;  3SZG A;  5HVQ C;  1Q1H A;  3ZOB A;  3NWS A;  4DNC A;  3S3N A;  2R7F A;  3B73 A;  5F0H A;  2CV2 A;  4NBQ A;  1SVL A;  2WA0 A;  5FKO A;  4EM0 B;  1ST6 A;  2IYL D;  3O6B B;  3E97 A;  3TO6 A;  2MC3 A;  3W6K B;  4DYC A;  4R8H A;  1XGO A;  1Q1V A;  3JTL O;  3ERM A;  1H7I A;  4CCL A;  4HNV A;  3VWB A;  1ORK A;  2K3P A;  3TP3 A;  5E18 F;  1QVT A;  1HLV A;  5A2Q Z;  2XF5 A;  5DQT A;  2HYG D;  2DT7 B;  2G62 A;  2JSC A;  1RRJ A;  2BC5 A;  1XPX A;  3G1L A;  4MFD A;  1XSV A;  4CBE A;  2BZT A;  1JE8 A;  5FGM A;  3VSK A;  4CXF A;  2RSE B;  1QA6 A;  3LOC A;  1OW6 A;  3CDL A;  2AVK A;  4I76 A;  2XDV A;  3ZMS A;  2AWY A;  4CH7 A;  1G5Z A;  1OR7 C;  1M2V B;  5F5H A;  2LOO A;  3MAJ A;  5D6F A;  3JT1 A;  3VYU B;  2B7E A;  2QEN A;  3HL2 A;  1WSU A;  3J7Z I;  1SFX A;  2DI3 A;  2QE9 A;  4A4A A;  2O9X A;  4I98 B;  4OAY A;  2AU5 A;  1F5T A;  2YX7 A;  5J4V A;  2DA5 A;  1YS6 A;  2DTZ A;  1S7A A;  3GTK J;  2BW3 A;  2VKV A;  2AHQ A;  3LSG A;  3AGT A;  4XON A;  3A01 B;  2FGY A;  5KYN A;  1H9G A;  3KKB A;  1A6I A;  1UB9 A;  4A0Y A;  2EJR A;  3RQE A;  3BT9 A;  1D0X A;  1JGS A;  5CKT A;  5D8L B;  5L0D A;  2MG4 A;  4AIH A;  3SXM A;  2XLE A;  1D1A A;  3AG1 H;  2R93 J;  2VC0 A;  2LK4 A;  5AC4 A;  3LAJ A;  4Z9H A;  2IBD A;  1FSH A;  3GW2 A;  1WAT A;  3ZQC A;  1J75 A;  5E1X A;  4IOC F;  2ZXH A;  5KYY B;  5IOY A;  2XLV A;  1E86 A;  3ZQQ A;  3DWW A;  4YT8 A;  4CZZ A;  1AWC A;  5BUO A;  1B59 A;  2E7X A;  4YT4 A;  2RNG A;  2NVQ J;  2NS0 A;  1MH4 A;  5HOD A;  1W7P D;  2WB7 A;  3A9C A;  4YT5 A;  3BOQ A;  5KYX B;  2Z9O A;  2XVC A;  3WHN A;  2IXO A;  3V5Y A;  1D0Y A;  1WJE A;  5FD5 A;  4C2M J;  3GAN A;  3OYN A;  2QLZ A;  2DFE A;  2P5L C;  3CUO A;  1JUP A;  5H2F C;  1KU2 A;  4CX9 A;  1F9N A;  2XAH A;  3I64 A;  3QPH A;  2JZY A;  3SFI A;  5AGF A;  3ZIB A;  1F36 A;  4MTE A;  1NH3 A;  2ELH A;  1MMA A;  1UST A;  2HQR A;  4MVR A;  2HXO A;  4BEJ A;  1R00 A;  3Q0V A;  2LD5 A;  2WZF A;  1XTA A;  3M1C B;  1P4W A;  3SNH A;  4BHP A;  4F92 B;  1ORS C;  1ZR4 A;  5CI9 A;  1DP7 P;  2LKX A;  2BVM A;  4LDR A;  2PEX A;  4U5C E;  3K70 C;  1SD7 A;  1EV7 A;  5EZG A;  2M30 A;  3DBL B;  3OYI A;  3K4N A;  1VQ9 I;  1QPM A;  2P81 A;  3BDD A;  1FBU A;  1FR0 A;  2HEO A;  4I1O B;  1ZGW A;  3CF2 A;  1TW3 A;  3AG3 H;  3OYJ A;  2HOT A;  2UXN A;  3HUG A;  2ZSH B;  3ASN H;  3IAS 2;  4RAF A;  4RLQ A;  2DBB A;  3R4K A;  1JKQ C;  1K79 A;  2VCB A;  3B29 A;  3K66 A;  4MVS A;  3RVZ A;  4A3F J;  5D5U B;  1U5T A;  2VBY A;  1P7I A;  4L5E A;  1DU6 A;  3KEO A;  3O8G A;  1FLI A;  5B3S C;  2VQC A;  3TBI A;  4BH9 A;  2L81 A;  1LE8 A;  2NNN A;  3ZQG A;  4KMF A;  3QPS A;  1O3R A;  4OOI A;  1LJ9 A;  5HDK A;  4XEV A;  2FRH A;  3QYF A;  4UB6 C;  1VQO I;  1R49 A;  1JKO C;  5DV5 A;  5LHI A;  1Z67 A;  5DM6 F;  1NFO A;  1ZHZ A;  3DD7 A;  4HDV A;  2O03 A;  2F6C A;  1WWP A;  5A6J A;  2P8T A;  4ENJ A;  4EBK A;  3OS0 A;  3B0V C;  1FMW A;  4BBS J;  1RMV A;  2M9H A;  2VQH A;  3AG4 H;  5BQT A;  4LDQ A;  2NVT J;  2DOA A;  5B5E C;  1O3S A;  3OEO A;  4XRS A;  5JS5 A;  2WL8 A;  1CGM E;  1ZN2 A;  3S2H J;  1R7J A;  3EG9 A;  1ZYR F;  2BOL A;  5TRD A;  1UFM A;  2J5P A;  2QY9 A;  5HNF A;  1D8J A;  2FA5 A;  4KN7 X;  4JE9 A;  4P1W A;  2HKV A;  2KRF A;  3HNI A;  3MFN A;  4H54 A;  1T5O A;  1NK2 P;  2YLD A;  2X9D A;  2XGD A;  5B1A C;  3U9J A;  4XOT A;  3T8R A;  2ZB9 A;  2Q8K A;  1SFO J;  1K05 A;  1VOM A;  3BLY A;  3AG1 C;  2L9V A;  2YHS A;  2K9Q A;  3DKW A;  2OF7 A;  4LMY A;  2NNY A;  3K69 A;  1LI7 A;  3HOZ J;  3RQF A;  1SD4 A;  5IYB J;  4AK9 A;  4EV0 A;  2NG1 A;  4L0Y B;  5E8G A;  2XRL A;  2JUC A;  2QVO A;  3EPZ A;  3ECS A;  4PUS A;  5DQZ A;  1FMV A;  2WTE A;  1GXQ A;  2EPO A;  2D2W A;  1NBB A;  3KPH A;  4L9V A;  4XRM A;  3RZO J;  4ZZD A;  2ZXI A;  4OMY A;  2VBW A;  1WJB A;  2LC2 A;  3GLL A;  3R0J A;  1TQG A;  2W45 A;  1TT5 B;  4RAZ A;  5CVR A;  2X6X A;  3ZQ7 A;  2WWY A;  2DMP A;  1YRN B;  4IHW A;  3S16 J;  4UB8 C;  4IOA F;  4I3M A;  1MD0 A;  5D4S A;  1A0B A;  4HOB A;  1U2W A;  4U7B A;  2IXS A;  2KMU A;  3DU5 A;  1VFC A;  1MBJ A;  1Y0N A;  1IRZ A;  1UHM A;  6PAX A;  3LMM A;  4D5C A;  2DQR A;  1M56 C;  5CQG A;  2FEZ A;  2VJJ A;  3DTE A;  3GTM J;  3PM1 A;  2VE8 A;  3BR2 A;  1D5V A;  3W6J B;  5L3V A;  1U3E M;  3DAF A;  3HRT A;  2E1O A;  5GP9 A;  2H7V C;  2XL6 A;  1U9N A;  4WGZ A;  1LPQ A;  2VOO A;  3MZY A;  3K10 A;  3QMK A;  2HR3 A;  2VN2 A;  3BCB A;  4BGD A;  1EJ9 A;  2FBI A;  1L7C A;  4BNC A;  2MLG A;  3E5X A;  3OA1 A;  5L3B A;  4A6E A;  5DM7 F;  4L9T A;  1I4Y A;  3DJN B;  4P96 A;  2GZW A;  2JPU A;  2A61 A;  1OMI A;  5LGN A;  1O7F A;  3PO2 J;  3NYJ A;  4EM2 A;  3VFZ A;  3PJR A;  4CSW A;  3MZ8 A;  4YEL A;  1I5N A;  4Y15 A;  5B3I A;  4MEX F;  2VC1 A;  1BN5 A;  1ZHX A;  2ZJ2 A;  2A5W A;  3S93 A;  3HOW J;  2M4E A;  4G94 A;  3S14 J;  3CCM I;  2ID3 A;  1JPN A;  1IRG A;  5EG0 B;  3ZVR A;  4GYT A;  1P4X A;  2CO5 A;  1ACI A;  2R02 A;  2NS8 A;  1OKK D;  2L3D A;  2I8B A;  5B1A H;  2V1U A;  3T6J A;  2FE3 A;  5E3N A;  3NAR A;  4KI2 A;  1U9O A;  2ESN A;  3ULQ B;  2PF4 E;  2Y3H A;  3T5X A;  1LVK A;  1E0E A;  1JPJ A;  2P5K A;  2Q00 A;  2H6C A;  2Q2E B;  3ISP A;  1I3A A;  3PNV A;  3EDP A;  2GAQ A;  2E7W A;  2MGQ A;  3QW1 A;  4A93 J;  5J4Y A;  1KYZ A;  3LAY A;  1YYX A;  5E79 C;  4M3B A;  5L0H A;  3FKJ A;  3KYC B;  5CVI A;  2BY0 A;  3K9T A;  1VQ4 I;  1ZG1 A;  2JA5 J;  1MJB A;  3SHF A;  1A7D A;  3DFG A;  1WI3 A;  2FQ3 A;  1ZTR A;  1XSX A;  2A1D D;  4O79 A;  3NMI A;  5F28 E;  4DVY P;  2WZG A;  4CDG A;  4BDZ A;  1LFU P;  2YSR A;  1MSF C;  1OCR H;  4YIF A;  5J1Y A;  3S1Q J;  2M1B A;  3LST A;  4ZYD A;  4L0Z B;  5K7H A;  4A3L J;  2LRE A;  4L9J A;  4RM2 A;  3F8N A;  2IA0 A;  2WAF A;  4II3 A;  5CI8 A;  2DJI A;  1ZRD A;  4JJG A;  1B9N A;  2I8D A;  3BTJ A;  3RKW A;  4JQF A;  4D9J A;  1AOY A;  2P0N A;  4GXO A;  4ZDP A;  5HOO A;  1M2V A;  1HMO A;  4ZTJ A;  2DA4 A;  3VPR A;  4Z9I A;  3GZN B;  2IRF G;  4HEA 2;  5EEH A;  2F22 A;  1A7V A;  3OYG A;  2P6T A;  4HE8 D;  4FAS D;  1WPK A;  2BEO A;  2LFF A;  2AP3 A;  3LUT B;  2TRT A;  4ANJ A;  3GEE A;  1T39 A;  1EH6 A;  4C7O B;  2LNB A;  4ABZ A;  1DPR A;  3J81 Z;  2QQ9 A;  5KYW B;  1T6Q A;  2EIJ H;  1IF1 A;  2BVL A;  3V8J A;  2OPT A;  3T6G B;  2QUF A;  3WTZ A;  3S3O A;  2PX3 A;  2HYF A;  4XMY A;  4HX7 A;  2R05 A;  4D4X A;  3IEE A;  4Y17 A;  2BGC A;  1BR1 A;  5HV9 A;  2PFB A;  2K9N A;  3D5R C;  4KNY A;  1ZHT A;  5E3O A;  2Z2S B;  1YIT I;  1HA8 A;  3B9Q A;  4KIG A;  1R71 A;  3WG7 C;  2OJE D;  3GFL A;  3KYL A;  4ULV A;  5IT9 K;  1ZAR A;  5FLX K;  3BY6 A;  3CUQ C;  2LTP A;  2EB7 A;  2NAZ A;  5EHH A;  4AM3 A;  3PCV A;  4I09 A;  4KNV A;  5EZH A;  3I58 A;  4EMS A;  4E0I A;  1VI0 A;  3KLO A;  1V5G A;  3QP5 A;  3S32 A;  3BP8 A;  3A01 A;  3LEV A;  4C3D A;  4N4W A;  1GV5 A;  1SVO A;  4E7I A;  5B1B C;  2DAO A;  3DEE A;  2NOG A;  2GFH A;  1NHA A;  1YW9 A;  1Z05 A;  2EFQ A;  2OCC H;  3HB9 A;  3IKV A;  4HX8 A;  4GCV A;  3RZD J;  4BXX J;  5TJJ A;  4MTG A;  2ECB A;  3B6C A;  1MMS A;  4ZZL A;  4I2O A;  5BQG A;  4EHP A;  2DFI A;  2NXN B;  4HW0 A;  4C7O A;  1ONV A;  1XMK A;  2XF7 A;  3HEF A;  2LKS A;  5HDN A;  3V4G A;  1LB2 A;  1IXR C;  2H6B A;  4U0Y A;  1UMQ A;  3WG7 H;  1BL0 A;  1WAS A;  2EIN H;  2ZXP A;  4EM1 A;  1M2O A;  1W2W A;  4CYD A;  3CCV I;  3MYI A;  1FWZ A;  1OR7 A;  4NDL A;  5TIS C;  1QU3 A;  1ZEL A;  4H4K C;  4ZC3 A;  2LG4 A;  5L0G A;  3FXJ A;  1S05 A;  3S90 A;  2F5E A;  4CS7 A;  3FXH A;  1HY5 A;  4CA0 A;  2HOS A;  4XEK A;  5A6B D;  1FNT c;  5FRO A;  2QNL A;  1CGO A;  4CDY A;  3M9A A;  2UUH A;  1T2K A;  1U89 A;  4RMN A;  5B1B H;  3RQ4 A;  2VE9 A;  4E7S A;  4CJG A;  4EGZ A;  4C3B A;  5K5Q A;  1IXC A;  4HG2 A;  4KT6 A;  5LEK A;  3V42 A;  1T6U A;  2K85 A;  1XZQ A;  3NAU A;  4JYK A;  2IA1 A;  3OSG A;  2M7B A;  3TDZ C;  4EJU A;  1JI8 A;  3HGY A;  4CS9 A;  1SFU A;  3I9V 2;  2J9V A;  3J80 K;  3R61 A;  1BBY A;  1YW7 A;  3IWF A;  1Z0X A;  1JGG A;  1UEL B;  4HF2 A;  4IHX A;  2PLY A;  2WV1 A;  1ERD A;  2EPN A;  2WAE A;  4JVS A;  2XC7 A;  4KIB A;  3DQV C;  1PVE A;  1B68 A;  2VT3 A;  2XAU A;  4PK4 A;  1AU7 A;  1TWC A;  1TW2 A;  3D0S A;  5JFR A;  3RIP A;  2XM0 A;  1ZRE A;  2VOD A;  3PSI A;  3K4C A;  4BHB A;  4BAY A;  1APC A;  4AID A;  4HLY A;  5B3S H;  4ENN A;  4G8X A;  2GA1 A;  4LG3 A;  2ZO4 A;  5FLX Z;  5GPC A;  3JZ0 A;  5GTI C;  4CHU A;  2DPD A;  2DYR C;  1Z3Y A;  2BXY A;  3JRH A;  1S7E A;  1K6Y A;  2DLL A;  3GFM A;  2TDX A;  2OUM A;  2OV7 A;  2KIQ A;  4L18 B;  2J46 A;  4E7L A;  3KH2 A;  4IPA A;  4AL1 A;  3B02 A;  2COM A;  4IQJ A;  1RKT A;  1TNS A;  4IEJ A;  2V6E A;  1QLE C;  1POG A;  4QPQ A;  1ZG5 A;  1EH8 A;  1VZ0 A;  2D1V A;  2KLO A;  2HVS A;  2L02 A;  3I54 A;  4DYQ A;  1GV2 A;  4KMU X;  4FX4 A;  2H8R A;  2JRM A;  2QGU A;  3FM3 A;  3JCU C;  1TFO B;  2Y69 C;  2DDB A;  4OMZ A;  4B44 A;  3C8Z A;  4IB4 A;  1FAP B;  1HXD A;  2B9S A;  1WJ5 A;  4S05 A;  3SFZ A;  3S1R J;  1PCX A;  3FF5 A;  2EIK H;  4AE4 B;  2OCE A;  3F3X A;  2O7O A;  3DLA A;  2E2J J;  2Y39 A;  2X0C A;  2QYO A;  2WZL A;  4D0P A;  3S8P A;  1SAX A;  4WJ0 A;  5EGO B;  1D0Z A;  3R60 A;  2E1N A;  1NLX A;  3K1M A;  4XNF A;  5FRM A;  2OZ6 A;  3FBI B;  1TWG J;  1X58 A;  5GAD J;  3S3M A;  2C6Y A;  4G0H A;  2HS5 A;  1P6R A;  4XOP A;  4NCQ A;  1MJA A;  2V9P A;  3U9G A;  3HRS A;  1GLN A;  1WVR A;  5E3M A;  1GHC A;  2GWR A;  2WVN A;  3PIP F;  4FX5 A;  1MGT A;  2Y3B A;  3KP3 A;  1BA5 A;  2ZC2 A;  4AWX B;  1AKH B;  1J8Y F;  2VOP A;  2NYX A;  3TK0 A;  3LQQ A;  3VF0 A;  4MEY F;  2LFB A;  3L7W A;  1YZA A;  4HEA J;  3G1O A;  4AIJ A;  3ZWI A;  5JUA A;  4LFU A;  1YIJ I;  2QBY A;  2KYH A;  3EGD A;  3HNL A;  3U1K A;  1J09 A;  1TQM A;  2WAQ N;  4B4C A;  4BUP A;  4MS2 A;  4A69 C;  2BY2 A;  5J8F A;  1XB4 A;  5CQE A;  3DM5 A;  1W5T A;  3MWM A;  3NKE A;  1NG7 A;  1RET A;  4CCM A;  3LNR A;  4MNU A;  3DCF A;  2PP4 A;  1F1M A;  4F93 B;  2KIS A;  4HX4 A;  4AYB N;  3DPU A;  1SF8 A;  1TNT A;  1IXS B;  4DXW A;  2DU9 A;  3DBR B;  3FDY A;  4DZP A;  3GO5 A;  1KON A;  1OPC A;  4M9S A;  2KGO A;  1R4T A;  4ZYE A;  3L2Q A;  4BAC A;  2EV0 A;  1A5J A;  2L9N A;  2V4J C;  2XF6 A;  1T6I A;  4IZZ A;  2F4I A;  1YA7 O;  1YTY A;  1MDM B;  5FKK A;  1FIP A;  5FFZ A;  2DA2 A;  3M8F A;  1RKC A;  2Q4F A;  2H8W A;  1VQ5 I;  1Z3I X;  3H9Q A;  3G4S I;  3EHN A;  1T8I A;  1XGN A;  4CS8 A;  2O5R A;  1JJ8 C;  2DA6 A;  3QPL A;  1FBS A;  3F23 A;  2CYY A;  1NK3 P;  3G3Z A;  1WGW A;  3CP2 A;  4BEH B;  2D5V A;  4MO7 A;  3ITF A;  3JSZ A;  2KNH A;  5KYY A;  4UUV A;  4J01 A;  3DTK A;  3SEZ A;  4PDK A;  2L2O A;  4BXU A;  3E0J B;  1BW5 A;  2E2I J;  1Q0M A;  4PSW A;  4P6I C;  3S9O A;  3PHF 2;  3PDM P;  2QBY B;  5JT4 A;  3F8B A;  4MQV A;  4Z6Y A;  1LM3 B;  3FDQ A;  4JEA A;  1I6X A;  3JSP A;  4CIC A;  3HBL A;  1VQL I;  1FPQ A;  1DOW A;  1XG1 A;  1LNW A;  5TJ5 E;  1OKK A;  2XPU A;  5AC5 A;  2EZK A;  2F5C A;  2VJI A;  2J0X A;  1QKR A;  3FMQ A;  3I0T A;  3LFU A;  3F8M A;  3GYH X;  1B8I B;  4IRU A;  2NUT B;  3DU6 A;  5DYM A;  3TGN A;  1TFK B;  1RC9 A;  1KU7 A;  4ZYG A;  4RB3 C;  2STW A;  4Q48 A;  3TDU C;  3QVY A;  2XXA B;  3OIP A;  2WBM A;  2D5R B;  2TMV P;  5DUI A;  4CCN A;  2R7S A;  4OIR F;  2L01 A;  3DF8 A;  3JRE A;  2CV0 A;  1X4O A;  1XSD A;  3RH3 A;  1BOB A;  3RSN A;  1JXS A;  4UV9 A;  5LGT A;  4WWC A;  3DZA A;  3W4Y A;  4ER9 A;  1K6O A;  5HDG A;  3EET A;  2OG2 A;  3HIF A;  2Q9B A;  3F9K A;  5DEQ A;  1WJF A;  2M2E A;  4XR6 A;  1FYL A;  3MKW B;  4U5H A;  3QU3 A;  3TUL A;  5BS6 A;  2YU3 A;  1IN8 A;  3MD2 A;  5D92 A;  4UUS B;  4EAT A;  2GLO A;  1OXK A;  3OOU A;  3R6S A;  1R5H A;  3EJN A;  4NTB A;  2KKO A;  3GTG J;  2VXZ A;  2HV7 A;  2Q1Z B;  3AL0 B;  1EA8 A;  2NUP B;  3C8G D;  2O9L A;  3HNJ A;  1I5Z A;  1T0F A;  3FBN B;  2O6G E;  2GA2 A;  3DKX A;  5AIP A;  4NNJ A;  3OV8 A;  4Y3O A;  2OQR A;  4MND A;  3MLG A;  1OCT C;  1S29 A;  3PNT A;  1ODD A;  1P7J A;  1PD0 A;  4A3B J;  4DBQ A;  3H2U A;  3F72 A;  5K5O A;  4CCJ A;  3Q9S A;  2P5V A;  4B47 A;  2M0C A;  3WU0 A;  3M15 A;  2Y2Z A;  4WXC A;  2M64 A;  2X48 A;  5F6F A;  2MC4 A;  2EZI A;  4XN3 A;  3VDX A;  2QSH X;  4PAC A;  1SYQ A;  4CCK A;  3HKK A;  3LLK A;  2DA7 A;  3IV5 A;  1BM9 A;  2OTJ I;  5KYW A;  2K5C A;  3A4C A;  4KC9 A;  3M1C A;  2P4W A;  2JA7 J;  4XSX F;  5JVT A;  1XWJ A;  1I3Q J;  1I1G A;  3OYC A;  2E1M C;  2LBF A;  3CMY A;  1JRA A;  2XIG A;  3OIO A;  3QYE A;  1TWC J;  4RGS A;  4WXH A;  3RKY A;  3JRG A;  4MW8 A;  3KP5 A;  4UUT A;  5CVU A;  2JN6 A;  2R7U A;  2VB6 A;  4RGU A;  1E3H A;  3BJA A;  4OWR B;  3TKY A;  5BMZ A;  4JCZ A;  4AX2 A;  2P61 A;  3HGG A;  3LSH A;  1KQ0 A;  2WVO A;  3TO9 A;  1ZGA A;  1XCB A;  2UWM A;  1FP2 A;  4XKC A;  3L1P A;  1ZKG A;  2EV6 A;  1F1Z A;  2A5Y B;  2CQX A;  5ERI A;  3I4M J;  2CUZ A;  2HZT A;  3I4N J;  3SZP A;  3P9I A;  4HZF A;  3C63 A;  4BJ5 C;  2HYJ A;  1FX7 A;  2X6Y A;  1N78 A;  3LNM B;  2KL4 A;  3I53 A;  1BJZ A;  5IOZ A;  1WHU A;  4A3G J;  2CNW A;  2HSB A;  1FP1 D;  2DA1 A;  1X3Z B;  5C4X J;  3ZQY A;  4A2U A;  1J8M F;  1Z6T A;  4P9T A;  1RI7 A;  2QEX I;  5H6Q A;  3DPT A;  3L2W A;  2NVU B;  4RGX A;  4F7Z A;  3DTI A;  5J47 A;  3FXR A;  2NS7 A;  4E70 A;  2P7C B;  3FMR A;  4OD5 A;  1LEA A;  2DFH A;  2EPM X;  4EKW A;  4RS8 A;  4NTF A;  3RPQ A;  1J7K A;  4RGR A;  2MFZ A;  3A02 A;  3OR2 C;  2R7Q A;  3QOP A;  1H9T A;  1CF7 A;  1VB5 A;  4MVU A;  2R4G A;  2W1O A;  3K1I A;  3Q6M A;  3H9J A;  4IHT A;  2PX0 A;  3JR9 A;  1RKE A;  2XSJ C;  2E87 A;  3OOP A;  4MVQ A;  4OIQ F;  3CJQ B;  4YII A;  4X6A J;  3OIQ A;  1QRY A;  2M5W A;  2FAP B;  2CYD A;  1MBK A;  4MTO A;  1W0T A;  4YL1 A;  2CSO A;  3S2D J;  3DJU B;  2HSQ A;  4D4N A;  3CTA A;  1K4T A;  4IJA A;  2ZFW A;  4IAQ A;  4LG0 B;  3WTY C;  1YJN I;  5D6E A;  2ZXJ A;  3WOD F;  2HFH A;  3WHC A;  1VQ7 I;  2I5U A;  4K1O A;  4LAC B;  2GAU A;  1E83 A;  4N0B A;  5AON A;  4DW6 A;  3FWE A;  1K7A A;  1FOK A;  4D7M A;  1HCR A;  2K02 A;  5FFX A;  1E84 A;  3O3K A;  4XLN F;  2JPC A;  3HOY J;  1BZ4 A;  1OYW A;  4HNT A;  3CCL I;  1K78 B;  1UCR A;  5LHH A;  4LDK A;  3GX4 X;  5L3C A;  3LJB A;  1ZQ3 P;  1MSE C;  3CQZ J;  2UUZ A;  1VQP I;  2M4G A;  3V8K A;  2QLA A;  2DK8 A;  4JRZ A;  1Y6I A;  2YS9 A;  5JI6 A;  1MBH A;  2IGO A;  5HLI A;  4LLN A;  2KK1 A;  4W8P A;  3KYI A;  3K6G A;  2HMQ A;  4XIC A;  4XBF A;  3GFI A;  4IF4 A;  1PUE E;  2GIZ A;  2PMU A;  1QHH D;  1R9T J;  3K7D A;  1EI7 A;  1LKX A;  1QNT A;  3EQL F;  4GFB A;  2HVR A;  1ORJ A;  2VQG A;  4RB0 A;  3BRJ A;  4WCG A;  5LRS A;  3CDI A;  3AQB A;  2E5N A;  1G3T A;  4BQQ A;  1JOG A;  2JPB A;  2LLK A;  2Z99 A;  2F5D A;  3EPV A;  2VLA A;  2XLH A;  3T4R A;  1Y1V J;  2R7W A;  4BE0 A;  5LD2 C;  1S72 I;  1NZE A;  1ZHY A;  3RKO F;  1J5Y A;  2BHY A;  4KYW A;  5BNG A;  4LGW A;  2E19 A;  4U0V A;  4BY1 J;  4HSR A;  4QLC U;  4I7H A;  2UZK A;  1TL8 A;  4N6H A;  2FD5 A;  2LSO A;  3V5Z A;  1BDJ B;  1V4A A;  1YQA A;  1O57 A;  2FOW A;  5LGU A;  5ILU A;  1O7L A;  3BR1 A;  2RV8 A;  3TL4 X;  4X1E A;  1J0R A;  2QQA A;  5L3F A;  1JHH A;  1RZ4 A;  4DYR A;  2LH9 A;  2VBZ A;  5M3F J;  1HW5 A;  4BHC A;  2CQN A;  4WF2 A;  5T3W A;  2CS3 A;  3PUB A;  1YDI A;  3K1I C;  2E5Z A;  2KQR A;  4AE4 A;  1DGR M;  2ELK A;  1K4S A;  3GTQ J;  1Z91 A;  3EUH A;  1YA9 A;  3O10 A;  1WI9 A;  2KDZ A;  1WH5 A;  3SYT A;  3QTH A;  4C3J J;  3X2Q H;  1SC7 A;  2BV6 A;  3H36 A;  2Y75 A;  4AD9 A;  1R6R A;  1PYV A;  3JRM O;  3U5S A;  2QF7 A;  3GWL A;  4WXD A;  4XOR A;  5D5W B;  4W97 A;  5KAI C;  4GYG A;  2FMY A;  4GDF A;  3H3U A;  3H0D A;  2YL1 A;  3CCU I;  3JRC A;  5F1J A;  1U5T B;  2IPQ X;  5A69 A;  2R0Q C;  3KP7 A;  5GAG J;  2DPU A;  2EIJ C;  4M6V A;  2ZME C;  4JP0 A;  4AU7 A;  4BJ5 A;  5F04 A;  4JTA B;  4KBL A;  1HKQ A;  5DCM A;  2KJB A;  3CLQ A;  3K2Z A;  2CCY A;  1W7P B;  2ETH A;  4XSZ F;  3KZY A;  256B A;  4YG2 F;  1IUY A;  2EA4 A;  2EIL C;  1V74 B;  3ABM H;  2LQG A;  4U0W A;  3ZMT A;  5HLT A;  2VT2 A;  3WU2 C;  5K5R A;  2JSP A;  5A6B A;  2F4O B;  1DQU A;  3P5J A;  2ISZ A;  1O3U A;  2EIN C;  3I59 A;  3ZG1 A;  4HAM A;  3QAH A;  2KIF A;  1IGN A;  2HOE A;  2XGE A;  1RKE B;  4RDU A;  3EG9 B;  2EIM H;  4B8X A;  2FX0 A;  1BI1 A;  3ROU A;  3LLI A;  2A6E F;  1EA3 A;  1ETX A;  3NRV A;  5FJ8 J;  2DA3 A;  3GTL J;  4YFN F;  3G1M A;  2WVQ A;  3L1M A;  2CW0 F;  4P9F A;  3OYF A;  3H2V A;  3WGH A;  1R23 A;  3TQO A;  3U8P A;  4BY7 J;  3O8H A;  2A07 F;  4O6J A;  2GA0 A;  2MSY A;  1QZZ A;  4ZDO A;  1UG7 A;  1IZ1 A;  2PX9 A;  4BQO A;  1RPW A;  4YL3 A;  3PNY A;  4B09 A;  4BQN A;  1Q0K A;  2IS4 A;  5T3T A;  3G50 A;  3JRB A;  2K9S A;  1N75 A;  4PJL A;  4JTC B;  4CYC B;  5JLX A;  5K7F A;  5FKN A;  4J7T A;  2JX0 A;  4K7B A;  1R5G A;  2OZU A;  3H5A A;  1R36 A;  2O8X A;  3GVA A;  2X1D A;  4DIQ A;  1UAA A;  1HQC A;  2EFN A;  1BOA A;  2XAF A;  4F91 B;  2A69 F;  2IS6 A;  3VOD A;  3QRF F;  1VQ6 I;  4F3Q A;  2CUE A;  2YR2 A;  1FFT C;  1ETW A;  1SR2 A;  2PG4 A;  1W1W E;  5H6R A;  4AC0 A;  2OJQ A;  2D4U A;  4JC7 A;  3RFY A;  2YLI A;  3MFK A;  4A6D A;  1MNE A;  3IC7 A;  2G9W A;  4NHJ A;  2QQ8 A;  3DWL E;  5COG A;  2IXN A;  2NOJ B;  3I56 I;  1AVO B;  2J7P D;  1KA8 A;  4QSH A;  3PMR A;  3ZQL A;  4EJW A;  2DYS H;  2HDW A;  3BWG A;  3Q0U A;  5EEA A;  1HMD A;  3F6V A;  1JUS A;  2GDC A;  3SYN A;  1BI0 A;  1QZY A;  3RPU D;  2PJR A;  2JJ7 A;  4JZA A;  4XID A;  1LPE A;  2ZCW A;  3HXL A;  3W6V A;  3LSR A;  3RF3 A;  1VQM I;  5J8C A;  1VTM P;  2MBF A;  2ESH A;  2R7X A;  3KFW X;  4IRG A;  3ZMV A;  2DXI A;  2RDP A;  2R7V A;  3CCQ I;  2EZL A;  4G12 A;  3LSJ A;  3HOX J;  1QQI A;  3DEU A;  3NYL A;  3L2C A;  3SDB A;  4B1R A;  3OYD A;  5JP7 A;  2NVY J;  2ZKZ A;  3EUH C;  5DD4 A;  3CC7 I;  5LRR A;  5IP9 J;  4EJV A;  2FML A;  4XLP F;  3GLX A;  4C3H J;  4UVA A;  4YL0 A;  2B0L A;  3DKA A;  1NG6 A;  3J7A O;  3IP4 B;  2PNO A;  3GM1 A;  3WTW C;  4M6X A;  1P2F A;  1FYK A;  2B0J A;  4UY8 I;  4FES A;  1BIA A;  2L9R A;  4M63 A;  3GEH A;  2X1C A;  4HA8 A;  1RUN A;  1TZL A;  1T6S A;  2LP0 A;  1X2N A;  1CQT A;  3D5S C;  9ANT A;  4MLO A;  2LD6 A;  4IXA A;  2L54 A;  2CDQ A;  1VND A;  3E7L A;  3RIR A;  2PJR B;  2Y31 A;  3CLO A;  4PFP A;  2MHR A;  2R25 A;  1T9K A;  2CUF A;  4ESF A;  5ILS A;  5EG0 A;  1ZLK A;  3M4C A;  1IN4 A;  1V55 C;  3E5Q A;  2CV1 A;  4FHT A;  3H3V K;  2HUJ A;  2Z1D A;  1FBQ A;  3OYM A;  1OR3 A;  1ZAO A;  3FOO A;  3CES A;  3OL4 A;  2JTV A;  1K40 A;  2LDU A;  1NSG B;  4BKX A;  3EGD B;  4RB2 C;  4FTH A;  2KZV A;  3IKT A;  3ABK H;  3ZSU A;  4P9U A;  1UG2 A;  2DB4 A;  5FZT A;  2OKU A;  4E7Z A;  3GUD A;  3O39 A;  3L2V A;  1GGQ A;  2ZXW C;  4ASN A;  1UG0 A;  1Y39 A;  1F43 A;  1X1C A;  4JX4 A;  5J40 A;  4BU2 A;  5IY5 C;  1VF9 A;  2DYS C;  5BPD A;  4UHT A;  3E6D A;  2LCH A;  1YJ9 I;  1O5H A;  1K83 J;  2EPK X;  2XS1 A;  2DT6 A;  4V19 K;  2DTR A;  3QPT A;  1U78 A;  2QSG X;  1P9Q C;  2IGK A;  3HJE A;  3OYH A;  3OYE A;  3K4K A;  3JYH A;  3DI5 A;  4AL0 A;  1OJL A;  2ZNZ A;  5J1U A;  3OS1 A;  4UDV A;  4HNU A;  4LOC A;  2ZD9 A;  1WKM A;  2IA2 A;  5FO5 A;  2HDC A;  1G3Y A;  4GGG A;  3OMY A;  2PN6 A;  4NC7 A;  2JK3 A;  1ITY A;  2FXA A;  3ABT A;  1X19 A;  1QPU A;  2BXZ A;  3PQJ A;  2GXA A;  2KP6 A;  1ZU5 A;  4U5G A;  1FEX A;  1YZC A;  3H65 A;  3DLL F;  5IPA A;  1BIB A;  1W5S A;  1X2M A;  4AYB A;  2IS1 A;  2DMU A;  3R0A A;  3ESW B;  2HU9 A;  3FXU A;  4D7N A;  2J9U A;  1JUM A;  4FE7 A;  4JX6 A;  2J0W A;  3OS2 A;  2L5Q A;  3C62 A;  4BEM J;  1MMD A;  2DOD A;  3S1N J;  3A1Y A;  5CJ9 A;  2X51 A;  1X1B A;  5IYC J;  1T01 A;  3Q7L A;  5JLI A;  4BL0 B;  4OAZ A;  2R7T A;  3M7G A;  1R1V A;  2HXI A;  1S8N A;  4G9Y A;  1WH7 A;  2PI0 A;  2ZXO A;  3AG3 C;  3I5U A;  1CGN A;  2NSG A;  1PD1 A;  1T95 A;  3CMA I;  2CMP A;  3FIW A;  4A12 A;  1X1D A;  3S15 J;  4Q7C A;  4BPM A;  4CDA A;  4G6D A;  4Q5S F;  1ENH A;  2M45 A;  4M3F A;  3GF2 A;  3IH4 A;  5COM A;  4S0H B;  2AXL A;  2ELJ A;  4FQG A;  2ZSI B;  3C2G A;  3HTS B;  1WGX A;  3FAP B;  1XGS A;  4B3X A;  4BE1 A;  3GWZ A;  2CU7 A;  1V55 H;  2NUP A;  4UXN A;  2YPR A;  3NQO A;  1MNM C;  5DCF A;  5DLJ A;  3BPV A;  2LFD A;  4BJ1 A;  2HTJ A;  4Z2Y A;  5FKM A;  3ZMD A;  1VQ8 I;  4OIN F;  4IAO A;  1GS9 A;  2PMZ N;  1T38 A;  1SMT A;  4N4N B;  1E3O C;  1DUX C;  3LQR A;  4WGY A;  3KEQ A;  3RYL A;  4MW3 A;  4A3C J;  1X1P A;  3CCJ I;  2OU2 A;  1DP3 A;  1K78 A;  1LS4 A;  1IV6 A;  2HV6 A;  5DUK A;  3WTS C;  1E85 A;  2VIX A;  3MKZ A;  4JW1 A;  3AG2 H;  3BR5 A;  3JW4 A;  3HUG B;  1BR4 A;  4JJF A;  4I02 A;  3Q7G A;  4ENM A;  4FIS A;  4OD4 A;  2IGN A;  3JCU Q;  3X2Q C;  3HKZ N;  1XX5 A;  4Q4Z F;  4LLE A;  1MBG A;  2PMH A;  3CCS I;  2QM3 A;  3BRO A;  3K0L A;  3SJM A;  4IX7 A;  4PJM A;  1RUO A;  1J9I A;  3ZQV A;  3LS0 A;  3SXY A;  3L9F A;  3WTU C;  3QW0 A;  3V7C A;  2XAG A;  4DGW B;  2COB A;  4AUX A;  2MA3 A;  5FCL A;  1ETV A;  3HM5 A;  2WY8 Q;  1H8A C;  1IO2 A;  2OBP A;  2ZXW H;  1BW6 A;  3A03 A;  4A5N A;  1Z9C A;  2K3F A;  4HF0 A;  1Y4C A;  2OOC A;  4M3G A;  2KC3 A;  3GZ6 A;  5C4J J;  1RES A;  2IGM A;  1HW1 A;  3C2B A;  3HZJ A;  5F27 A;  4KIC A;  1X1A A;  3FHZ A;  2UUI A;  1OQC A;  1XMA A;  3S2W A;  1G3W A;  1H0M A;  1R58 A;  3KYJ A;  1TKN A;  2LSE A;  3PFY A;  5EK0 A;  3JTG A;  4XQ1 A;  2EK5 A;  2EIL H;  3CME I;  4BBR J;  2C04 A;  2XAS A;  1C02 A;  3T1B A;  3WGI A;  1FIA A;  2HTS A;  1YX5 A;  5E3C A;  1TT0 A;  3DP7 A;  1HKT A;  1JHF A;  4LLC A;  2VON A;  2H1L A;  1Z5Z A;  5LLQ A;  4M73 A;  1U8B A;  1GXP A;  2LP4 A;  3TOM A;  1ETO A;  3AQC A;  4UNO A;  1YFH A;  1T33 A;  4ZJZ A;  2CQK A;  3N0T A;  1S9H A;  3RYR A;  3HOV J;  3CO7 C;  4E17 A;  2XLM A;  2BBY A;  2L9S A;  2ECC A;  2EPF A;  3LA3 A;  4I6Z A;  4LD5 A;  1YO5 C;  2KFD A;  1U5T C;  4ZLC A;  3EFO A;  1QSP A;  5JLW A;  3EGX B;  5L3Q A;  1KQ8 A;  1OCO C;  4CO8 A;  2J9B A;  2M8E A;  4P5O A;  1IJW C;  2HGC A;  3ZRG A;  2JA2 A;  5DVW A;  4O6Y A;  1OYY A;  5L0F A;  3NWT A;  1PUF B;  5EJC A;  2CG4 A;  1QQ3 A;  3S1M J;  2KDO A;  3GZ5 A;  3H35 A;  4BE2 A;  1SMY F;  2IS2 A;  2PQ8 A;  1HSJ A;  4CUG A;  3C8G A;  1OCZ C;  2V6C A;  3SZR A;  2L4M A;  1TLH B;  3HOT A;  1Y1W J;  4QDL A;  1IUF A;  1OIS A;  3IH3 A;  3VEP A;  2KJG A;  3GEZ A;  3GOD A;  3DAG A;  3P9K A;  3BG7 A;  2L6F A;  4JBA A;  5L3E A;  4I44 A;  4CSA A;  2XUB A;  4HPQ A;  2LBF B;  4LB6 B;  4IGG A;  1D1C A;  1MW7 A;  1SAN A;  2JMW A;  4UVC A;  2OEX A;  2L7M P;  4Y33 A;  4I1M A;  3RQI A;  3WTV C;  4RLF A;  2JT1 A;  2JVH A;  4M74 A;  2PJP A;  5F5F A;  1A31 A;  1O3T A;  1RR7 A;  2VXD A;  2FNA A;  3KP6 A;  1GDT A;  3RQG A;  3V5X A;  2XPW A;  3TED A;  5KYU B;  2Y3G A;  2LF7 A;  3H3Z A;  3BG9 A;  4JOM A;  1Z77 A;  3IHU A;  2LY1 A;  3C7J A;  3ECH A;  3PQK A;  4WX9 A;  1YLF A;  2V9V A;  1LE8 B;  3OYK A;  3I5Q A;  4CJO A;  2WC2 A;  2KHM A;  5DDG A;  1TWH J;  4JUR I;  1LQ1 A;  4YRV A;  1FOW A;  3CC2 I;  1Z7Q c;  2VPR A;  1MQV A;  1G4W R;  3ABL H;  5KHD A;  2G0E A;  4E7H A;  3S29 A;  1JAF A;  1RCP A;  4KFC A;  1OCR C;  4F4B A;  2XKP A;  1R22 A;  3DBH B;  1G4U S;  3OR1 C;  4EUK B;  3CO6 C;  3J06 A;  1JTY A;  3C2H A;  5GTH C;  1OCO H;  3G6E I;  1ZW3 A;  1Q0G A;  3NMK A;  2O3F A;  1WJA A;  4KT5 C;  1I4Z A;  2CNW D;  3LEO A;  4N9I A;  4V2F A;  4JEB A;  3ASN C;  1D1B A;  1ZVZ A;  4MTF A;  2RQP A;  3RKQ A;  3IWZ A;  1SFE A;  2YRF A;  2E35 A;  4YJW A;  3FMS A;  5HS7 A;  4ZTF A;  1L3P A;  5FLM J;  2FF4 A;  4P55 A;  2LYC A;  2QKM B;  2R7D A;  3T9O A;  2F5F A;  3Q9V A;  2QQB A;  3QU6 A;  3BCA A;  2ETS A;  2XRN A;  3CCR I;  1WWX A;  5ICF A;  3H92 A;  2Z3Y A;  5CPR B;  3BC8 A;  4HV6 A;  2ZXR A;  1I39 A;  3ML6 A;  4U5E E;  2RN7 A;  4HBL A;  5HLH A;  3J80 Z;  1YE9 A;  2MH2 A;  3ZQF A;  2XLD A;  4HRI A;  4C30 A;  3FHD A;  4G7H F;  3M8E A;  4XKB A;  3K1H A;  2L6H A;  4N4O B;  1TWH A;  2NSF A;  1OCP A;  2CWE A;  3WGG A;  4QIW N;  3ZP5 A;  1JMW A;  4X0R A;  1QHG A;  3COA C;  4EGY A;  2H7B A;  3OL3 A;  5IP6 A;  1GVJ A;  4DJA A;  3O55 A;  4QI2 A;  2A3S A;  2DQL A;  2KPM A;  2E1C A;  1B72 A;  3DXJ F;  1L0O C;  2DDA A;  1TQI A;  2EFP A;  2ISY A;  1ORY A;  2XRH A;  1KGS A;  4XKW A;  2LRD A;  4PCQ A;  1Z21 A;  1FOX A;  5K1Y A;  1YG2 A;  1WFX A;  2NRA C;  1YRN A;  1IG7 A;  2L7F P;  4PJN A;  5EYR A;  5GPA A;  5E8I A;  3M79 A;  4YT2 A;  2VQL A;  1OCZ H;  3FKI J;  1VYK A;  4KNW A;  1GQA A;  2F4M B;  4I0A A;  4KIF A;  2XLW A;  1IN7 A;  1P4A A;  2DO7 A;  1GT0 C;  2QZ8 A;  1WTY A;  1WOL A;  2M7A A;  1A7E A;  2I15 A;  3JAM Z;  1ETQ A;  1E2X A;  4E6K G;  1S5L C;  3G71 I;  1XGM A;  2W24 A;  1S6L A;  2ZJP F;  2XM4 A;  3UGO A;  3JSO A;  4HFK B;  4MTD A;  4HV5 A;  3I5P A;  4EQQ A;  3H9G A;  3DKY A;  2VH3 A;  4LG0 A;  2IP2 A;  2MWQ A;  2Y9Y A;  1QVX A;  2PMZ A;  3G73 A;  2XSD C;  3JRI A;  2GXB A;  3ZN1 A;  5JR3 A;  2B63 J;  3AGU A;  2G3V A;  3UKG A;  4A3D J;  4A3E J;  3GTP J;  4E0H A;  1OR2 A;  3U3B A;  2EZH A;  1JT6 A;  4XLA A;  3J81 K;  1APL C;  5C44 J;  2QWW A;  2CFO A;  1SVM A;  1K04 A;  4Q47 A;  2VUM J;  1A35 A;  1B72 B;  3CP8 A;  3VRC A;  2R5Z B;  3ZMU A;  1MH3 A;  1WQ2 A;  1YX3 A;  1HKS A;  4XN0 A;  4RDA A;  3H1C A;  4NY3 A;  4I01 A;  3DMD A;  2ACJ A;  4W8K A;  3PIO F;  1Y6D A;  3C3W A;  3WHB A;  2L4A A;  1IN6 A;  5E33 A;  3FX3 A;  3TOB A;  1A6Q A;  2G3K A;  4G6T B;  1SFK A;  3VM6 A;  2AQF A;  2CJJ A;  3VSL A;  1W5C C;  5IT3 A;  3T6B A;  1R4M B;  4G6Q A;  4AVZ A;  1G59 A;  4A2N B;  3AJM A;  3HTU A;  2J9W A;  2HJ3 A;  4N06 A;  1ZLJ A;  3BG6 A;  4XLC A;  2DN0 A;  5C3E J;  2R5Y A;  1XD7 A;  3TOA A;  1M6T A;  4RBN A;  3V8L A;  1S7Z A;  4M9X A;  3S27 A;  5GAH J;  4KA4 A;  1O3Q A;  3F0C A;  1SZI A;  1V54 C;  2LKP A;  5FKL A;  1RIO H;  1FJL A;  1K61 A;  3GM2 A;  2ZJR F;  3V7O A;  3DV8 A;  1H89 C;  4JTD B;  2VKD A;  1G3S A;  3ABL C;  1EKE A;  4F52 A;  5BQH A;  1UHW A;  3QOE A;  1FFH A;  1QZX A;  1EQ1 A;  1W36 C;  2ASR A;  2W00 A;  3O2P E;  1MND A;  5L0C A;  2CRG A;  2YWA A;  2HWV A;  1NU9 C;  4MVZ A;  4XM3 A;  3GTO J;  1WJD A;  2BHZ A;  2YX4 A;  2KQ9 A;  3BJ6 A;  3K4L A;  2JA8 J;  5J1R A;  2QSF X;  4B3A A;  5K7Z A;  1KNY A;  3ABM C;  1STZ A;  3DPL C;  4F55 A;  1ZG3 A;  4E7J A;  1IDY A;  1LDK B;  4ON0 A;  2R7Z J;  3WE3 A;  5LEJ A;  3CC4 I;  2OQM A;  5CVV A;  5EGY A;  2GQQ A;  2AWC A;  3RPU A;  2KZG A;  3NYM A;  2JA6 J;  1REP C;  3H5R A;  3I3L A;  3L0I A;  1TBX A;  4LIV A;  2DMT A;  4M3D A;  3BZ6 A;  3JRD A;  1N77 A;  1TWG A;  3PL8 A;  1YYJ A;  5KAF C;  4E7K A;  5BOX A;  3ONQ A;  3D1N I;  1VQN I;  1ETK A;  3M8J A;  1TWA A;  3E3V A;  2A0U A;  1N25 A;  2EIK C;  5KYX A;  3RYP A;  3HHG A;  3KP4 A;  4UVB A;  4FAP B;  5D8K B;  5ICG A;  1B6A A;  5E1W A;  4CS9 C;  3LES A;  3W8I A;  2ADU A;  1JT0 A;  2Q9A A;  3BTL A;  2XPV A;  3BR3 A;  4RAY A;  2DMN A;  5FB2 A;  3X1O A;  1BC7 C;  2YU9 J;  4R79 A;  2Q9C A;  3JYY A;  3JRF A;  1QZE A;  1A41 A;  3TQN A;  1MBF A;  2EWN A;  3FXL A;  2H1K A;  1FTS A;  4NC8 A;  1H6G A;  2Z5U A;  1L3L A;  3ELK A;  2GIV A;  3TD7 A;  4DBR A;  3LS1 A;  1WN0 A;  5ED4 A;  1A36 A;  2L7K A;  4EWC A;  2BL2 A;  4HST A;  4MVM A;  4ONS A;  1LVA A;  1OW8 A;  2HMZ A;  3LAP A;  1Z3X A;  5F0F A;  5DTD A;  2A0B A;  2JWT A;  2ZNY A;  3ZQI A;  3GTJ J;  2IXM A;  1TR2 A;  4K2E A;  5HSW A;  1GUU A;  3U2R A;  3EYY A;  3B0U X;  3MYF A;  1TTY A;  3HRU A;  3K7A J;  1MKM A;  1N1C A;  3L8J A;  2DMQ A;  2K40 A;  1CF7 B;  1T0F C;  4LJZ F;  3RJP A;  1G4D A;  2C03 A;  2DT5 A;  5EGO A;  3Q0W A;  3KET A;  1IDZ A;  4OU0 A;  5F0C A;  2JQ7 A;  1P92 A;  4LIU A;  1FTZ A;  4R32 A;  3WTX C;  4XPW A;  3ABK C;  5L0J A;  3SQN A;  2FBH A;  1MDM A;  4U5D E;  3KCC A;  2W82 A;  3S0X A;  2YLG A;  3CJR B;  3ZXS A;  4ESB A;  2W7N A;  1AEP A;  2VBX A;  1Z23 A;  4QI0 A;  4EBJ A;  2LK2 A;  3GXO A;  1X4P A;  1Y56 A;  2KT0 A;  3EUA A;  4MIM A;  5L3G A;  1TC3 C;  3F47 A;  4J7Y A;  1MIJ A;  1MZB A;  1EH7 A;  1GVD A;  3KEY A;  4E4H A;  4A5M A;  1VK5 A;  1EKY A;  3KLN A;  1U8R A;  3TP0 A;  3EYI A;  1FY7 A;  1MMG A;  2F5V A;  2QTV A;  4EBB A;  5HLG A;  4C2U A;  4XPX A;  3H5N A;  4LLG F;  2G7H A;  3CF5 F;  3J7A Y;  2Q3T A;  4CIH A;  2VKH A;  1KYW A;  3ATP A;  3GWN A;  5F64 A;  2ID6 A;  3WTT C;  2CH0 A;  4XQF A;  4FET A;  3BQY A;  4A3J J;  2V1N A;  3BR0 A;  3GEI A;  2YKZ A;  4S04 A;  3UNG C;  2CQ7 A;  1XDU A;  2MLK A;  4BYY A;  2TCT A;  5D5X B;  3J7Y J;  2XGC A;  5K0I A;  3NDB B;  1BBH A;  3BG5 A;  1B8I A;  1BI3 A;  1WRJ A;  5F08 A;  1J2X A;  2OU6 A;  3K2A A;  2GM4 A;  3W3C A;  1F4K A;  2IXP A;  5J6X A;  1U0B B;  3U21 A;  2FU4 A;  2WY7 Q;  4L5I A;  3N97 A;  5D4R A;  1T98 A;  4EIY A;  2J5O A;  4ENK A;  5M3M J;  4GRI A;  2VL8 A;  1JKP C;  4XK4 A;  1IRF A;  3LA7 A;  3OY9 A;  1ZH5 A;  5GAE J;  4N9H A;  3MN2 A;  3K6B A;  2FJ1 A;  4WK8 F;  3BZC A;  1X3U A;  1KTM A;  3C8G B;  2VC9 A;  1XC5 A;  3HRM A;  3NEU A;  2OAZ A;  2LY2 A;  3LWF A;  1I27 A;  1V5E A;  2P7V A;  3IPM O;  3BQZ A;  1FSE A;  3SXK A;  3ZN0 A;  2GOM A;  2WB1 A;  2OA4 A;  2I10 A;  4Y7N J;  3IRR A;  3L2U A;  1UJ8 A;  3S17 J;  2OD5 A;  1NTC A;  3GFJ A;  4RBO A;  4BXF A;  2A05 A;  2MH9 A;  4OIO F;  4KIS A;  3RKX A;  1J59 A;  2H27 A;  5DS6 A;  3I59 B;  2EPL X;  4RD9 A;  3JAM K;  4C3I J;  4NTA A;  3UMH A;  2RGV A;  4CGZ A;  2M0M A;  2EFW A;  5TGT A;  4MQ9 F;  3S28 A;  2CUJ A;  3ABU A;  3IRQ A;  5KYU A;  2GXG A;  2MD5 A;  1WJC A;  3CSK A;  4XWJ A;  4JCH A;  2WV0 A;  2K27 A;  3IUO A;  1ZU4 A;  3IQ6 A;  5AIQ A;  2CW8 A;  3FVY A;  5J3L A;  1VLT A;  1Q0D A;  2FUG 2;  2YUS A;  2IJL A;  1ZZP A;  2CGE A;  1AA7 A;  4QPO A;  4IHY A;  4XTK A;  3E6B A;  3QWL A;  4CZC A;  3TJ5 A;  4CS8 C;  4XEF A;  2VCA A;  4IWB A;  2PBE A;  5KK1 A;  3UGP A;  2Y0S A;  2OTL I;  5F1R A;  3GBG A;  4AIK A;  2DCE A;  4CYC A;  1VQK I;  4U88 A;  3UMI A;  1LI5 A;  2L9J A;  2M4K A;  2HOA A;  3C1D A;  2W4M A;  2YL7 A;  3HHH A;  5BPI A;  1TP4 A;  1LEB A;  3N2Z B;  1OQY A;  3P7N A;  4R1H A;  4FX0 A;  1JTX A;  3TW7 A;  3OWT A;  1Z1D A;  3BR6 A;  1CPR A;  2XLO A;  3FOP A;  1Z6R A;  1VLS A;  1HF0 A;  2YL0 A;  3W8H A;  1XCV A;  3TMO A;  4XPY A;  1PP7 U;  4FT8 A;  4HDU A;  1KQ9 A;  2H7O A;  1S3J A;  1WCM J;  1I1S A;  2Z33 A;  3RCO A;  3EHM A;  2V1D A;  5E3L A;  2DFF A;  4NQW A;  2RC4 A;  1HC8 A;  5E20 A;  2BYV E;  3I4P A;  1XDS A;  5EEG A;  3QZC A;  2F48 A;  5L3D A;  1I6H J;  2E34 A;  3EZI A;  2BE5 F;  1PP8 F;  1FTT A;  2ZJQ F;  2KRH A;  3F6O A;  3IQT A;  3BTI A;  3CJT B;  5H20 A;  1CPQ A;  5IP7 J;  2H94 A;  2XB5 A;  1B4A A;  1ETY A;  2Q2E A;  1NU7 D;  2E2H J;  3RTR A;  4M3E A;  3VOE A;  5LHG A;  1BR2 A;  2M34 A;  2VI6 A;  1HBX G;  1E17 A;  5JVE A;  3CZ6 A;  4J32 B;  2K7L A;  3KZI C;  2ZPA A;  1Z7L A;  1RJ9 B;  3POV A;  2QUP A;  1OKR A;  1SAU A;  3LSK A;  1ZR2 A;  1HST A;  3F22 A;  4M9Z A;  3AAF A;  1ON1 A;  2VKE A;  3GCM A;  4XLH A;  3T0Y A;  4B43 A;  2X6O A;  3ZC4 A;  2BY1 A;  5FD6 A;  4PZJ A;  1RKW A;  3DE8 A;  3K4J A;  2IW5 A;  3QP6 A;  2XV4 S;  2R5Z A;  4HQE A;  4DVZ A;  2KRC A;  3B6A A;  4PGG A;  2IM8 A;  4OIP F;  3KZZ A;  4KJZ A;  4A0Z A;  4RM3 A;  5JSL A;  3U3F A;  3OYL A;  3N24 A;  1JJ6 C;  4IHS A;  4J19 A;  3OYA A;  4WAB A;  1KU9 A;  2D1H A;  2MYS A;  2HQN A;  2IOQ A;  3F46 A;  2O0Y A;  3KX2 A;  2V3C C;  1QVU A;  1TWF J;  2AO9 A;  4Y4R A;  1ZK8 A;  2KSF A;  2Y48 A;  5DS9 A;  1Y8Q B;  3F21 A;  3IQC A;  1LDJ A;  4GQH A;  4PJJ A;  1T08 B;  3CMM A;  3M07 A;  4IAR A;  4ESJ A;  2HFI A;  3JSE O;  2X0L A;  3CDH A;  3HC7 A;  4U5B E;  1UFB A;  3RVY A;  3R2P A;  2WAQ A;  3MVP A;  2JUG A;  3BG3 A;  4NUB A;  1MJ9 A;  4CSA C;  2Y9Z A;  3GOR A;  2R5Y B;  1ULY A;  4V2G A;  4HLX A;  3ZTM A;  2MW8 A;  4CIP A;  1IAW A;  3K1P A;  4IRH A;  5L0I A;  5HNH A;  1MBE A;  2VAS A;  1YYV A;  1BC8 C;  1YAU O;  2JD3 A;  3TOL A;  1YW8 A;  1FC3 A;  2R3S A;  4EEF G;  3HG9 A;  2R7O A;  3RI4 A;  2RKH A;  3N05 A;  2H8A A;  5M5X J;  4NC6 A;  5JHU A;  4N6C A;  1Y0U A;  3K4M A;  2H09 A;  4DOZ A;  2XKO A;  4D5F A;  2IVM A;  3PUF A;  1Z6A A;  1VTN C;  2HQA A;  2A6H F;  1OCC C;  3ASO C;  1GM5 A;  2NVX J;  3JTH A;  4GO1 A;  2XRO A;  3ZQH A;  4FCY A;  2P6V A;  2XL4 A;  3U2M A;  3HPH A;  3B0P A;  3CJN A;  3CCE I;  3V7R A;  5M5Y J;  4BQA A;  4BJT A;  5ICC A;  2NPU A;  2JVG A;  2LR8 A;  4YWQ A;  3PFI A;  2NUT A;  4MGR A;  5DS4 A;  4YN0 B;  2CW7 A;  3L09 A;  3FXO A;  1FZP B;  3MZH A;  1SD6 A;  4H0E A;  2GBY A;  3VYR B;  5DD8 A;  2XS8 A;  2HNH A;  4PGH A;  2K86 A;  2OQG A;  4PJ0 C;  5EDN A;  4KUM A;  5E1Z B;  3DM9 B;  4BS9 A;  4NQF A;  3Q6N A;  5IT9 Z;  3HOU J;  4BJ6 C;  2UXX A;  3KIO A;  2J7P A;  4II2 A;  2J8W A;  1W7P A;  1MMN A;  2Y0S N;  4G78 A;  2D45 A;  1W36 D;  1DU0 A;  1YHQ I;  4ZYH A;  3NG1 A;  3H0G J;  4B6I A;  1SD5 A;  4G7O F;  1WZ2 A;  2A6T A;  3Q3S A;  3E6C C;  3HNK A;  4ETS A;  3G2B A;  1HE1 A;  4YFX F;  2QCO A;  1IRX A;  2BY3 A;  1SEU A;  2P0W A;  3EUK L;  1C0W A;  3HYI A;  3L8I A;  3MQ0 A;  3NRH A;  5GPG B;  3NKD A;  5CVJ A;  2Y30 A;  4TV7 A;  5T1D B;  5BQI A;  3S84 A;  1LE4 A;  2B0H A;  2HZ8 A;  3US6 A;  5CIV A;  3HDD A;  1JR8 A;  4Y52 J;  3U8V A;  5D91 A;  1ON2 A;  5E17 F;  4HYE A;  4IRI A;  1X3W B;  4J30 B;  4M6Y A;  2J45 A;  2W4B A;  4ITV A;  2HPM A;  1C17 M;  2DOF A;  2DJN A;  3ZR8 X;  3CEX A;  5LFA A;  5A6A A;  2YEV A;  4IQ4 A;  3CAX A;  3MMY B;  3SZT A;  2K4J A;  3PSF A;  3RDI A;  3LL7 A;  5ILV A;  2K9L A;  3FK6 A;  1OLT A;  3U1D A;  3U0C A;  2W48 A;  2X1E A;  3MCZ A;  2XHK A;  5CYV A;  2XXA A;  3FM5 A;  3ERE D;  2Y69 H;  4XRS G;  3E6M A;  3LSP A;  2Q7R A;  2MD0 A;  2AXT C;  4XL9 A;  1IN5 A;  5LBQ A;  4RB1 A;  3VYS B;  1RR8 C;  1PV3 A;  3IH2 A;  1G8X A;  4JK1 X;  5HS8 A;  1DDN A;  2HPI A;  4GEH A;  3L00 A;  2RNJ A;  2QA4 I;  4LB5 A;  1IC8 A;  3HLZ A;  1ZHF A;  3JRT A;  1USS A;  3WAQ A;  3ASO H;  2EIM C;  2XB0 X;  4DRH B;  1V4R A;  3VYW A;  4IHV A;  3EH1 A;  3D5L A;  3HSE A;  4XKV A;  4UUS A;  1B1B A;  3E5U A;  5M5W J;  3Q5F A;  1O4X A;  4CCO A;  1IZM A;  4L6R A;  1XS9 A;  4U9E A;  1V5F A;  2IT0 A;  2KW3 C;  3TO7 A;  2RD9 A;  5EF6 A;  1W4M A;  2XAJ A;  1NFN A;  1DOV A;  4BG0 A;  3I4U A;  2XAQ A;  1YAR O;  3VB2 A;  3SEO A;  1R5I D;  2KIM A;  2X6W A;  3U2L A;  1YIO A;  4A3I J;  3F8F A;  3KP2 A;  3M3Y J;  3SXZ A;  1R4N B;  3HSF A;  3FXQ A;  1LFB A;  2HI3 A;  1C03 A;  2YQY A;  4A3K J;  4C2T A;  4BJ6 A;  3SEQ A;  1FNN A;  3M4O J;  3LSM A;  3RW0 A;  3BJO A;  3A0B C;  3K70 D;  3AL0 C;  1LE2 A;  2OC6 A;  1DGW Y;  1D8K A;  2KIU A;  4U87 A;  4B48 A;  2R7R A;  2K9M A;  4IO9 F;  2L7Z A;  2KJC A;  4HFF B;  4YIR X;  2E36 A;  1I50 J;  2M3A A;  4I0B A;  1M57 C;  1FYM A;  1VYI A;  2W84 A;  3EZH A;  1RNL A;  3P9C A;  5A6K A;  1ZRC A;  2FBK A;  1M1E B;  2ZME A;  1YLM A;  2LF8 A;  1T56 A;  3IL2 A;  1U6G A;  2W9Y A;  3VYT B;  3LNQ A;  3HTK C;  2Q0O A;  4PR9 A;  2XGX A;  3TW6 A;  2GWW A;  3VAY A;  4ZDL A;  4IJJ A;  2CQQ A;  3O6X A;  2EV5 A;  4LK1 F;  1AUE A;  3QQA A;  3AKZ A;  2E71 A;  4KDP A;  2R03 A;  2WAD A;  3HSR A;  4PSX A;  1YVI A;  2CGP A;  4PFO A;  1Q0F A;  3UMK A;  5KNL A;  3B71 A;  1ZRF A;  2M87 A;  2M8G X;  4BEH A;  3C18 A;  2LVS A;  1QGP A;  4L9N A;  3EGX A;  2FNP A;  3EFO B;  1NG1 A;  3L34 A;  3I71 A;  4DZJ A;  2HKX A;  3MBG A;  3AG4 C;  5COF A;  2VJ5 A;  4LIT A;  2LMD A;  2K4B A;  2E1M B;  1AKH A;  2RQQ A;  4O3M A;  3G4Z A;  4X0G A;  1PUF A;  4ZYA A;  3EH2 A;  2OCC C;  3CQZ A;  3KL4 A;  2HZD A;  4U9D A;  3TJ6 A;  4YEJ A;  3UR3 C;  1XN7 A;  1UZC A;  2DW4 A;  4K0D A;  2G7U A;  3AFH A;  2R92 J;  3FK7 A;  3U9M A;  1IV8 A;  3MX3 A;  4ZH4 F;  1A04 A;  4DRI B;  1HE9 A;  4L5J A;  4DQ2 A;  1Z63 A;  1HOM A;  1OFC X;  3DEW A;  2LIG A;  3ZPL A;  2P1A A;  3N4M A;  3KYD B;  5KVR A;  4NQW B;  2MAB A;  1DPU A;  1V3F A;  1G2H A;  3QYB A;  3CCY A;  4O7G A;  1LFP A;  5CLS A;  2DOE A;  3FXK A;  2ME0 A;  4JIO A;  2RAE A;  3F8C A;  2VJ4 A;  1YJG A;  4Y13 A;  1EF4 A;  1ZHW A;  5JHF A;  1KU3 A;  4RA2 A;  2L0K A;  3M1E A;  2CFX A;  2HVQ A;  2V26 A;  2EBI A;  3A2K A;  4EJO A;  3CD6 I;  3WE2 A;  1D5Y A;  2A68 F;  5D5V B;  2EFO A;  5FRN A;  1YOV B;  2Z15 A;  4CDV A;  4AVP A;  3MKY B;  2W4S A;  3HPG A;  1QBJ A;  1O87 A;  1OW7 A;  1YS7 A;  4IL6 C;  2X85 A;  1HDD C;  4NC3 A;  3AOU A;  1RJ9 A;  3JRA A;  2ZME B;  4HF1 A;  5B66 C;  3A11 A;  3NMJ A;  3K4B A;  5JRA A;  3OYB A;  5KCM A;  1AHD P;  4FWV A;  1LIH A;  3WG9 A;  3CUQ A;  3MKL A;  3WU1 B;  2ME6 A;  3W2W A;  2UV1 A;  2HDD A;  4XLE A;  4MHG A;  4C9Y A;  3OSF A;  2L6G A;  2YL3 A;  3BTC A;  2FSW A;  4IVN A;  2P6S A;  1FT9 A;  2FFH A;  5HS9 A;  3M4B A;  3KMI A;  2V79 A;  2AS5 F;  2N8G A;  2V7F A;  3W2V A;  2HKO A;  5IY5 H;  3FXM A;  2V1X A;  3ZGK A;  2ZFU A;  1BJA A;  2DYR H;  3FZV A;  1S7O A;  4RAG A;  4C3E A;  1QO0 D;  5JVG F;  4GYI A;  1G6N A;  2OEV A;  1OYI A;  4LK0 F;  4G7Z F;  4M72 A;  4MVO A;  4XLF A;  3MEX A;  1BI2 A;  3SDG A;  4YK5 A;  3IAM 2;  5A2Q K;  1H88 C;  4QTR A;  4IKF A;  2L7A A;  2XL8 A;  2HJM A;  2JRT A;  2XSE A;  1PJR A;  2DK5 A;  2EA2 A;  2V9K A;  1YJW I;  1OXB A;  2PFD A;  4LER A;  5DCM B;  4O6M A;  3SP1 A;  3ZMZ A;  5E2Q A;  4ZLD A;  4J00 A;  1VMA A;  3ZDL A;  1LUJ B;  1LS1 A;  2FQ4 A;  4DRJ B;  1HW2 A;  4NB5 A;  1JKR C;  4EVI A;  5E3A A;  2FOK A;  3E1S A;  1RXQ A;  2Z16 A;  2R9R B;  3ECO A;  4YFK F;  3K1N A;  4D1Q A;  3PO3 J;  1XZP A;  2W57 A;  2YVK A;  1Z7U A; 
#chains in the Genus database with same CATH homology
 2OJE D;  3KPH A;  2ICW G;  1R5I D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...