1R5ID

Crystal structure of the mam-mhc complex
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
214
structure length
214
Chain Sequence
SMKLRVENPKKAQKHFVQNLNNVVFTNKELEDIYNLSNKEETKEVLKLFKLKVNQFYRHAFGIVNDYNGLLEYKEIFNMMFLKLSVVFDTQRKEANNVEQIKRNIAILDEIMAKADNDLSYFISQNKNFQELWDKAVKLTKEMKIKLKGQKLDLRDGEVAINKVRELFGSDKNVKELWWFRSLLVKGVYLIKRYYEGDIELKTTSDFAKAVFED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Crystal structure of Mycoplasma arthritidis mitogen complexed with HLA-DR1 reveals a novel superantigen fold and a dimerized superantigen-MHC complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 84
structure length 214
sequence length 214
chains with identical sequence H
ec nomenclature
pdb deposition date 2003-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.530 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A mam-mhc complex, Chain D, Domain 2 1r5iD02
1.20.120.390 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hla class ii histocompatibility antigen, dr alpha chain. Chain D, domain 1 1r5iD01
2OJED 3KPHA 1R5ID 2ICWG
chains in the Genus database with same CATH superfamily
3FKJA 4IB4A 3B0VC 2XGEA 4MQ9F 2DJNA 2WBMA 4UB6C 4LLLA 1VQ8I 2IXOA 3T9OA 2KRFA 3GXOA 4RMNA 4B4CA 5HS8A 2G3VA 2WB1A 2W24A 4I09A 2VODA 1IRZA 2M45A 2R7VA 2YL1A 2Z9OA 4DJ9A 4UVAA 5EDNA 1IN6A 1TQIA 4GCVA 3LSIA 4D7NA 3H2UA 3KH2A 2KIUA 1O3TA 1OPCA 4EUKB 4A3BJ 3SZGA 4HAMA 4YFNF 2EH3A 1YW8A 3KP4A 4YN0B 1CGPA 2DT7B 3C3WA 1MDMB 4UXNA 3ZN0A 3B0PA 1V55C 5A6BD 2X1EA 3LSRA 1YYVA 2OJED 3OYFA 3PMRA 5EZHA 5DYMA 3WODF 3V7OA 1IZ1A 4X1EA 2V1UA 2P5VA 4RBNA 1GVJA 3G4ZA 4ON0A 1GT0C 1ZQ3P 3FXUA 5FD6A 1V74B 1WATA 2M7AA 4CDYA 2X9DA 5KYXB 3EZHA 2R25A 1TWCJ 2A6EF 3K4JA 3JSPA 2R7UA 1GV2A 1X4PA 2F5DA 1H9GA 4A2UA 5GP9A 3M1CB 3J81Z 2MH2A 4AYBN 2I10A 5LHIA 2AWYA 5DLJA 2R7TA 1DGWY 4CS8A 5J1RA 5T1DB 4RGUA 5E3MA 2HOSA 1SFKA 4BY1J 3HNLA 1SVMA 3HSRA 4C3DA 4Q5SF 3KKBA 2BXYA 3NAUA 2UV1A 4PFOA 3MZHA 2JJ7A 1BC8C 3J06A 3CLOA 3QPHA 2VIXA 4MHGA 4M6VA 3RPQA 4KDPA 2KJGA 4J32B 2FXAA 2WY8Q 2A0UA 1FX7A 1T39A 5BQIA 4MVMA 1IZMA 4I1MA 2IBFA 5E33A 1ZGJA 4LOCA 2MW8A 3IWFA 2M87A 2HOEA 3S3NA 1KU2A 2YX4A 5DDGA 4KITB 1YX3A 2O03A 5IYDJ 4BJ5A 3U2RA 1FYLA 4GRIA 4O3MA 3O3KA 1FPQA 5F1RA 2K5CA 3ASOH 3SYTA 1MKMA 3BRJA 3LSKA 2DLLA 2A6TA 1M1EB 1SFEA 4XLFA 2F4MB 2I8DA 2E1MC 2BYVE 5A69A 2LKXA 1RKWA 1RR7A 3BC8A 4MVSA 2LBFB 4FX5A 2QVOA 2H27A 1QO0D 2Q3TA 1OR7A 3O6XA 2X6WA 2M7BA 1LDDA 1S05A 2H6BA 1S29A 3GLLA 5DUIA 1VQKI 1NFNA 2L7KA 2ZNZA 1ZN2A 1SF8A 1MBFA 2H7BA 1JPNA 2HMQA 3BR1A 1I6HJ 4ENMA 3B6AA 1T6QA 4IJJA 2NVYJ 4MQVA 5CVJA 3FMQA 1W0TA 4HOBA 5E20A 2F5EA 3NKDA 1FP2A 1W7PD 1OISA 3MVPA 2F4IA 3HPHA 3F21A 4AIKA 4QDLA 5HV9A 2DTRA 4W1UA 3AL0C 1R7JA 1UHSA 1FOYA 1ZLJA 1LE2A 4OIPF 1IC8A 2Q4FA 2GDCA 2RV8A 5DCMA 2Y0SN 3NRVA 1R71A 4A69C 3GM2A 4KNVA 2HSBA 4DRIB 1UFBA 2M8GX 2VBYA 3RPUD 2PJPA 3HTUA 1TWGJ 2PI0A 2ZMEC 3SDBA 1ZTRA 2EIKH 3HM5A 4CSWA 3P9KA 1J9IA 1TQGA 4O6NA 5H20A 2QENA 2EV5A 2KISA 3OYMA 1FFTC 2WV0A 3H9GA 3GM1A 4C3HJ 1T2KA 4XPXA 4DYCA 4F4BA 2J9UA 3NQOA 1W7PA 2R0QC 2M0CA 4L5EA 4HA8A 1SVLA 1T8IA 2K40A 3BR2A 3JSOA 3LNQA 3S16J 1ORSC 3SXKA 5C4JJ 2OTJI 4A3EJ 3C8GB 2MLKA 2E2JJ 4G94A 2DOFA 5FLXK 2V3CC 1YJNI 2YZSA 2X85A 9ANTA 3BJ6A 4HPQA 2XROA 1PV3A 1ZLKA 1NTCA 3FM5A 3JW4A 3FHZA 2Y2ZA 3M4OJ 3IPMO 3AG2C 4IHVA 3S29A 2FUG2 1T5OA 5DD8A 4U5FE 3JAMK 2DTZA 1YO5C 1JGGA 2H8AA 3EH1A 1SD7A 1Z05A 5EYRA 5H6QA 3TOAA 1TT0A 2PQ8A 1ZARA 1NZEA 1UG7A 1F9NA 2WB7A 2HKXA 3LFKA 5ERIA 3ZMZA 4LDRA 2VE9A 1OCZH 3V5ZA 3FHDA 4H4KC 4J19A 1BOBA 3VYUB 1ZW3A 2DFIA 5JVTA 2K27A 3TO7A 4ASNA 2BXZA 5K7HA 3CCJI 4OMYA 3IQTA 1TTYA 4M73A 3LSPA 2KDZA 4AD9A 3GUDA 2P6VA 3S27A 4JX4A 2VKHA 3U2MA 1JJ6C 3KPHA 2H09A 4HSRA 3WTTC 4KYWA 1B9MA 1WHUA 2L01A 3TDZC 4IXAA 3CF2A 2E60A 3W4YA 3UGPA 4XORA 2C6YA 1GHCA 3TW6A 2NUPB 3LS0A 3TQNA 3W2WA 4C9YA 1KU9A 2VBZA 2Q9CA 2DB4A 2DODA 1VQLI 2P5LC 1BW6A 4MW8A 2J46A 4CIPA 3K4CA 5LHHA 2TDXA 3QW0A 4BY7J 2G62A 3U1DA 1ON2A 4FETA 1WJFA 4EVIA 5B66C 1YE9A 3A2KA 1BDJB 3CCLI 4JX6A 2PJRB 1SZIA 4EATA 2NXNB 3PM1A 2XGCA 4QTRA 3RFYA 2W84A 3IL2A 4QI0A 4AK9A 4UV9A 1FTTA 4KMFA 1MJ9A 1P4AA 2HI3A 3COAC 2XVCA 1DP3A 2HJMA 3EGDB 3TQOA 1B8IA 2VPLA 4BE2A 1NLXA 2LF7A 3US6A 4NQWA 1ETWA 2JT1A 3LNRA 3X1OA 2Y30A 2XLVA 1DUXC 2HFIA 3W6KB 3BQYA 3EH2A 1QPMA 4A3IJ 1MQVA 2JA8J 5HDNA 1A0BA 1HOMA 1S7ZA 3ZTZA 2LKSA 3DM5A 5KYYA 1FAPB 4GEHA 1TNTA 5GAHJ 4ENKA 1IJWC 2FFHA 2YSRA 1S7AA 2ZO4A 2LY1A 3PFIA 1VF9A 2MWQA 4I98B 1BC7C 2PLYA 3CO7C 3CMYA 1U9OA 3GBGA 3HHHA 3AG3H 1TW2A 5EGOA 2FOKA 1EV7A 3OYDA 1IN5A 3F47A 4M63A 1IN8A 3S17J 2L7ZA 5HSWA 1FOWA 2JPUA 1K4TA 2VBWA 2QCOA 5J1YA 5DS5A 4BQAA 3IKTA 4MTGA 2ESHA 3BY6A 1YHQI 4P1WA 3U9MA 4JX5A 4XICA 1PP7U 4KBLA 4DJAA 1IDYA 2KIFA 3EG9B 4Z2YA 4ENJA 1ZG1A 2F6CA 2BVLA 4M9ZA 2GA1A 1HCRA 4ZH4F 1LI7A 1FEXA 5TJJA 2DO7A 3PQJA 2E2HJ 5ICGA 4BL0B 2R05A 2KMUA 3WHBA 4XPWA 1Y39A 1Q1VA 2MABA 4U0YA 1Z6RA 2OZUA 4DGWB 3CCUI 2VKEA 1K04A 3MYIA 1WWPA 3BWGA 4LMYA 5L0IA 2HVSA 1JTXA 2HSQA 3BCBA 1DGRM 1HW2A 4JZAA 5A2QK 1TFOB 2WADA 1T95A 2EINH 3GFIA 5HVQC 5J8FA 2L9NA 3EDPA 4FE7A 3L1MA 2XASA 3F0CA 1I1GA 1D5YA 3REOA 2H8RA 3LSHA 2HYFA 2QNLA 2EILH 3CJRB 2FX0A 3CD6I 3EUKL 3VEPA 1WVRA 3R7CA 4Y3OA 4OIQF 4GFBA 4IO9F 1VQPI 2VH3A 1FBQA 2XIGA 3L2WA 4P9TA 2DFFA 4A4AA 4BYYA 4CXFA 2ZD9A 4W8KA 1ZRCA 4JJGA 4KI2A 1HKTA 2KQ9A 1PJRA 2E34A 1QKRA 3E6BA 4XKBA 2VKDA 4DBRA 1OFCX 4BAYA 1C17M 3GODA 3HOWJ 1EKYA 4JCZA 3FBNB 3TO9A 3I4MJ 2I8BA 5FD5A 1MMAA 1D0XA 4MFEA 2QUFA 2Y31A 5CPRB 4RM3A 1XGSA 4HF1A 3ZXSA 3C2HA 2DI3A 3LJBA 3DEWA 3MBGA 1IF1A 1J8MF 2XRNA 2KHMA 2E5ZA 3FM3A 3LESA 2DXIA 2CQKA 4N4NB 1HW1A 5D6FA 3C18A 4I99C 5EZGA 4K2EA 2LP4A 1GGQA 3GORA 4L5JA 3ABMH 3M8FA 4KMUX 4XN3A 5DTDA 1O3RA 3BJOA 2ZJRF 4A3GJ 1VB5A 1FNNA 2F22A 3FK6A 3DWLE 3JRTA 1I6XA 3PQKA 4CICA 4B43A 4NHJA 4IGGA 4CZCA 1H7IA 3I5PA 1P4WA 4XLNF 2YU9J 4B3XA 4HG2A 3S28A 4XEFA 1T0FC 1O3UA 1KONA 3B02A 3HJEA 5IP7J 3GZ6A 4ZDLA 3G2BA 4PSWA 2IJLA 3CUQB 4W8PA 3CQZJ 1YJGA 3V7CA 3D1NI 1MJAA 4J01A 4CYCA 4RAGA 3HUGA 3ZQ7A 4XSZF 1K79A 5J8CA 3DKXA 4M3GA 4Q48A 4TV7A 1LM3B 3F22A 5JUAA 5DM7F 4ESJA 1Y0UA 2J8WA 4R1HA 2DFEA 3Q0VA 2O8XA 2ELKA 2COMA 2ZJ2A 2WVOA 5GPGB 1LEBA 1OKKD 2CW8A 4MW3A 5DCMB 4C3BA 3L8IA 1T6SA 4IHSA 2PN6A 4JTAB 1DU0A 2BV6A 1FC3A 4NQFA 4BHPA 2ZFWA 4PFPA 4NC8A 4RGXA 4XRSG 3RYPA 4LLNA 3F3XA 3JRMO 2CFOA 5DEQA 4U7BA 3ZOBA 1R6RA 2V26A 3FXHA 1XG1A 4WXHA 1O3QA 1W7PB 2KW3C 2XSJC 2WWYA 4XIDA 4AU7A 1QU3A 1YVIA 2PX9A 3VDXA 5IT3A 3X2QC 4Y4RA 2YLIA 1SC7A 3OYHA 3BROA 1H6GA 3ABMC 2WZFA 1QRYA 1ZHTA 2LQGA 2WZGA 2ISZA 5L3QA 2BZTA 3JRFA 2DBBA 5JR3A 3HOZJ 4WXDA 4O6MA 5BPIA 1Z5ZA 3P9IA 4XOPA 4XLEA 4MS2A 1T56A 2XS1A 3S1QJ 4A3CJ 2CJJA 2PFBA 2ZBKA 4KIGA 2J7PA 3CSKA 1SAXA 2CU7A 2LVSA 3EZIA 4B48A 1Q0FA 3I59A 2KIMA 2OQRA 4I0BA 4JRZA 4LGWA 4IRGA 1G6NA 4G9YA 4D7MA 1RESA 4BGDA 5M3FJ 4N4WA 2HJ3A 1U2WA 2NNYA 5IP6A 1DQUA 3ABKH 1W36C 3LMMA 3TJ5A 2FBIA 2R03A 3QPSA 2GXGA 3IH2A 4V2FA 1LE4A 1WGWA 5J3LA 2V79A 1D8KA 3NYJA 4U0VA 4ZZLA 3F72A 2QY9A 4IAOA 1WPKA 2KIQA 2BBYA 1IXSB 2NVXJ 1L3LA 1AA7A 1ZELA 1OW7A 4MVQA 2L7AA 3SZPA 5LFAA 1S9HA 5AGFA 1X4OA 3NEUA 3A11A 4BJ6A 2FSWA 3HOUJ 3HIFA 3BCAA 3ML6A 2P6TA 5CQGA 2CV0A 5ILSA 4L0ZB 4EGYA 4WF2A 3L2RA 4UNOA 2HQNA 1U5TA 2F48A 2CRGA 5T3WA 4XKVA 2DMTA 3MFNA 1K40A 1NHAA 3EFOA 1P4XA 4BHCA 3FXQA 5KHDA 3G4XA 1FNTc 2DJIA 5GADJ 4CS9C 2KDOA 3TDUC 3M15A 1J09A 4CDVA 5EEHA 3DPLC 3CP8A 2EPNA 1FYKA 3I4PA 4IHYA 1E17A 3DBRB 4UHTA 5FFZA 3KLNA 4WK8F 2HOTA 2O9XA 3ZQYA 2PG4A 1EH7A 3F8NA 5L3DA 1NH3A 4HNTA 3OS2A 3I58A 2R9RB 4YL0A 2Z99A 1T08B 5ICEA 4A3MJ 1B8IB 3U9JA 4LG0A 1WI9A 4NQWB 5CQEA 3AG1C 4RB0A 4C7OA 1XCVA 5CVVA 3K4MA 5J47A 3ZQLA 3K4KA 3WTWC 4R8HA 1ZRDA 5KYYB 1X1BA 1MBKA 1PUEE 1JKOC 4BJ1A 1E83A 4OAYA 2YL0A 2ID6A 3ABKC 3B9QA 3GF2A 1UG2A 2O6GE 5A6KA 1WASA 2W82A 2VC1A 3AKZA 1BI1A 3HKZA 4BJTA 1WN0A 4ZC3A 4N9HA 2JD3A 4JYKA 2LNBA 3IP4B 5EGOB 3F23A 3RYLA 4ZYHA 5K5OA 2GIZA 1IXRC 4MTEA 2D1HA 1U3EM 2L2OA 4RA2A 2KP6A 2R7SA 1F1MA 4ULVA 2VPRA 4XSXF 2DYSH 4EMSA 3C8GA 2WY7Q 2H1KA 3ZQQA 3ZTMA 3K9TA 1F43A 4P5OA 5FROA 4DVYP 2V7FA 2ZXHA 1E3OC 2H8WA 2B0LA 1NU7D 2F5VA 4HFFB 3VM6A 5EHHA 3K2AA 3ASNC 3DF8A 3S3MA 1AKHA 1N1CA 2YX7A 1G5ZA 3D5RC 1WCMJ 2HQRA 3IEEA 3HNJA 2Z33A 3KZIC 3T6JA 1R36A 5LHGA 4EEFG 5TJ5E 2NS8A 3T6GB 3GWNA 5TRDA 1ETKA 1HXDA 2R4GA 1YTYA 2M0MA 4YFKF 2X1DA 1MMGA 5E8IA 3JRBA 2FQ4A 2EPOA 1BR2A 2OOCA 4E7HA 1BIBA 1F1ZA 2YRFA 4BKXA 1UAAA 1T6UA 2FJ1A 1MNDA 2HXOA 2VXDA 3FX3A 3NWSA 2DA7A 1QQIA 3MKWB 1KQ9A 3S3OA 2MD5A 2OUMA 2IBDA 2DW4A 2OF7A 2QTVA 4XNFA 1C0WA 4W97A 5AONA 3OR2C 2HYJA 4WCGA 4ONSA 1XPXA 4AL1A 1V54H 3BPXA 4HQMA 3DJUB 4KUMA 1OCOH 2AVKA 1KQ0A 3Q3SA 1B68A 3MZYA 3JTLO 3J80Z 4NC7A 5D5VB 3MEXA 2VJIA 3FMSA 4CHUA 1HA8A 1Q0GA 1NG6A 3DE8A 3T5XA 2VCAA 1Z3IX 1L0OC 3E5QA 3GTPJ 3GEHA 4JTDB 1VTNC 4Z9IA 2O5RA 1JRAA 1R4TA 5LGUA 3MX3A 2WAQA 2AS5F 1HQCA 5DD4A 3CJNA 2D5RB 2Q00A 3DD7A 2XM4A 3BLYA 5IYCJ 1TWHA 3HPGA 2XRHA 1UHMA 2JUGA 2VQHA 2Y9YA 3FXLA 2VQCA 4D9JA 1YIJI 1UFMA 2HDCA 1A7VA 2Y3HA 3H2VA 5CVRA 3JREA 5FKNA 2K7LA 1BJZA 2JK3A 5JVEA 1USSA 4A6DA 1WH5A 1RZ4A 2ZSHB 1VYKA 4CJGA 4A3DJ 4FHTA 3OS0A 4DZPA 2Y3GA 2X51A 4KJZA 5J6XA 4E7LA 1LE8A 1YIOA 5E3CA 2PBIA 5L0JA 2EV6A 2FOWA 1MGTA 1O7LA 3BT9A 4AIDA 2Y69C 3U8PA 1K4SA 1P7JA 1V55H 4U7DA 1X3WB 4BXXJ 4AVPA 4FTHA 3S0XA 4UV8A 2I5UA 2AP3A 2ZXJA 3VWBA 2J0WA 2HKOA 3DPUA 4L9TA 3V8KA 3JRHA 1U0BB 2KLOA 1FFHA 2OCCC 3CUOA 4M3DA 3ZVRA 1ORKA 3BZKA 1GDTA 4FASD 4YIFA 5ICCA 1VQOI 5LD2C 1UHWA 3NDBB 2QM3A 3HUGB 3LLIA 5IY5C 3UMHA 2LY2A 4IKFA 5LEJA 4E0HA 2HV7A 2KSFA 2HV6A 3RKQA 2L54A 3OIQA 1MIJA 1J7KA 1CGNA 4FE4A 5H2FC 3EHMA 3KEOA 1NSGB 2X6OA 3KETA 2LFDA 4XM3A 4QPOA 2L9RA 4ZDPA 1G4WR 1OR2A 2GA2A 1OQCA 2IS2A 2F4OB 2JRTA 1KU7A 2B0JA 2CQXA 4KN4X 1VQMI 4B6IA 1E3PA 2LDUA 2PMZA 4I02A 3QODA 3GZ5A 3FXKA 3MCZA 5M5YJ 5F04A 1TNSA 2NOGA 3EG9A 4YL3A 4AE4A 2DK8A 3JSEO 4O79A 4BEMJ 2FU4A 1LKXA 3HB9A 4RS8A 2WZLA 4AM3A 2CNWA 2HTJA 2D5VA 1Y8QB 3O8GA 4AIJA 4HZFA 3Q5FA 1TWFJ 4X6AJ 3GYHX 3C8ZA 2VUMJ 3DWWA 5KYNA 3GVAA 1QZYA 2M5WA 5GAGJ 3H9QA 3PIOF 3OYBA 3Q7LA 1JKRC 3WAQA 4ZYGA 2FEZA 3GW2A 2GAUA 4OIRF 2EZIA 4PGGA 1WJAA 5GPCA 5EG0A 1DU6A 2J0XA 3H9JA 4KNYA 1SMTA 2BHYA 3I71A 4G0HA 2VJJA 2ECBA 3C7JA 1A6IA 1QZXA 1G3TA 3G71I 5DV5A 3JYYA 3M9AA 1NK2P 3M3YJ 3NRHA 2NYXA 2KQRA 1OCRC 3QQAA 1TWAJ 4HV5A 4EQQA 1AEPA 1WTYA 5FZTA 4G78A 4N6CA 2E87A 5AIPA 3SFIA 3HOYJ 4EHPA 3BG9A 1QGPA 2PFDA 2DMPA 3I59B 2LYCA 1SEUA 3L8JA 1DPUA 2JZYA 1LFBA 1AU7A 4LLEA 5D4SA 4EBJA 2CDQA 2MHRA 4D4NA 2OQMA 2N8GA 3P5JA 5A6BA 5K5RA 3RQFA 2QZ8A 1HDPA 2W4SA 3IC7A 3OS1A 1VK5A 4M71A 4G8XA 1QVTA 1JI8A 3K4BA 1I4YA 3NWTA 1SFOJ 3FMRA 1ITYA 4H54A 4DYRA 3K7DA 3HOVJ 1FTSA 4HNVA 4B1RA 4FCYA 1APLC 2Z1DA 2IA2A 3CMMA 4P9FA 2HNHA 2FRHA 2W00A 4ZLCA 3Q6MA 1U5TB 1XDSA 1FR0A 2DGJA 2EZHA 1IDZA 3EFOB 1IG7A 2ICWG 2AQFA 2WA0A 3BTIA 3B6CA 4C30A 3N2ZB 2ZSIB 2JVGA 3AG2H 3HGGA 2MBFA 5FRMA 4MO7A 1JUSA 1TBXA 1JUMA 3HOTA 1W0UA 4I2OA 1B72B 3JCUQ 2LG4A 2A6HF 3CUQA 3I5UA 5EF6A 1WI3A 1UB9A 3M07A 4QLCU 4HYEA 2XSDC 1D1CA 2M4EA 4CSAC 3FHNA 1FMVA 3PCVA 4DW6A 3TO6A 2Y3BA 4K0DA 4LG0B 2V9VA 4E18A 3OYGA 2MC3A 1M57C 3W2AA 4C7OB 2R7XA 4FX4A 2XL4A 3I55I 5M5WJ 5E17F 1YX5A 2W57A 4IWBA 3W8HA 1YDIA 3DTKA 4YIIA 1GXPA 2FF4A 4LDQA 2EJRA 2GWRA 1PDNC 5F6FA 4FQGA 3SEQA 1RNLA 4RB2C 2L6GA 1JTYA 2VI6A 3A0BC 2VOOA 1IUYA 1XC5A 1EJ9A 2XF6A 4XEVA 4M6YA 2CQQA 1N75A 5E79C 3NMKA 3GEZA 3LLKA 1RXQA 2MYSA 1D3YA 3MFKA 1C03A 3BG7A 2CYDA 1BL0A 1G4DA 4BUPA 2IGMA 1QPUA 3OYIA 2RGVA 1MZBA 2LC2A 3KYCB 1OYIA 2V1NA 5ED4A 3E5XA 2GOMA 3LA7A 3HEFA 2IS6A 1RPWA 5BNGA 1G4US 1IO2A 4EIYA 2ACJA 2IRFG 2Y3DA 4L9NA 4NDLA 4KFCA 4ZZDA 2P0WA 1YRNB 1K83J 2XAHA 1AKHB 2KK1A 2XPUA 1NBBA 4A0ZA 5CVIA 2XGDA 4IX7A 3I54A 4M3FA 2LP0A 3RPUA 1BI0A 2VJ5A 3PSFA 2VE8A 1TQPA 2JTVA 3I9V2 1JKPC 1KQ8A 1BN5A 4IQJA 2Z3YA 3DTIA 4DYQA 5DM6F 2RQPA 1YS6A 2V9KA 2UXNA 3BTCA 3ZQCA 4JURI 2STWA 5ICFA 2PMUA 2CUZA 3KP2A 2EFWA 2WVQA 3V7RA 2EPMX 2DAOA 5KYUA 2DA5A 1F36A 1VQ7I 2XLMA 1MMDA 2OPTA 1GUUA 2ZNYA 1XB4A 5DQTA 1OXKA 1ZRFA 2RVCA 4ABZA 1V4RA 3DXJF 2RC4A 2VONA 1SMYF 2NVTJ 5D91A 1BI2A 5IOYA 1XN7A 3VB2A 4LIUA 1TR2A 1ZHFA 3DPTA 3H0GJ 4HF0A 2KYHA 3TP3A 4CJOA 4BEHA 4J00A 2ZXPA 3JZ0A 2E7XA 1LJ9A 3E9VA 3BTLA 3ZCOA 1SD6A 2R7ZJ 1M6TA 1HF0A 3VYWA 4EV0A 1E0EA 3S1RJ 5GTHC 4DNCA 3QTHA 4Y7NJ 1Q0DA 1S7OA 3OYNA 2RNJA 2OEVA 4K7BA 1LS1A 3GX4X 4CCKA 5COFA 1OCCC 1YA9A 3K1HA 3GFJA 3PUBA 1YOVB 2Y75A 3TK0A 3S93A 4ENNA 4CS8C 3WHNA 1EH6A 2OQGA 4BNCA 4DBQA 2DQRA 1LE8B 4G7OF 3K1MA 3SXMA 2M1BA 2KC3A 1Q1HA 2NUTA 3WG7C 2VQGA 1ZU4A 5JHFA 2XXAA 3J7AY 4ZDOA 3SXYA 3UNGC 2W9YA 4BJ5C 4C2TA 3RTRA 2HOAA 4F55A 1X3UA 5B3IA 5E1WA 1R4MB 4HNUA 5JS5A 3K1PA 2R7DA 2YL3A 2HVQA 2YLGA 1P9QC 1BW5A 4RBOA 4N9IA 5CYVA 2LK4A 4CGZA 5EK0A 1EA8A 4UUTA 5GTIC 5L3BA 1JMWA 2BY1A 2LH9A 5L0DA 1WWXA 3RI4A 3CF5F 3RKXA 1OR7C 2R5ZA 2CW7A 4OWRB 3TOMA 2AWCA 3LSJA 2ZMEB 3WGHA 5BMZA 2YHSA 1Z7Qc 1R5GA 3DEEA 1N25A 3C1DA 3FDQA 2VJ4A 3BZ6A 4PK4A 5LBQA 1B6AA 2WC2A 1SANA 1G3YA 2CUFA 3ECHA 5TISC 4NB5A 3SEZA 3SHFA 2PNOA 4KNWA 3AFHA 2HZDA 3RQGA 1M2VA 3CUQC 1RKTA 2MLGA 3H5NA 4F52A 1QBJA 1ACIA 2R02A 2EBIA 3WE2A 1J59A 3NG1A 5J40A 1W36D 3BP8A 4ETSA 4S0HB 5H6RA 1D1AA 2YQYA 3GWLA 3LSGA 5LGNA 4E4HA 1LIHA 4AE4B 3FXOA 3OEOA 2P6SA 3FISA 3EJNA 3WTZA 3MLGA 1RMVA 3KYJA 3HG9A 2K3PA 1QQ3A 4M9SA 3JRGA 4H0EA 1WGXA 4JC7A 1FOXA 3RVZA 1OW6A 3AQBA 4U5CE 2AO9A 3QWLA 3HBLA 4E6KG 4QWQA 2QQAA 5FKKA 2RD9A 2OG2A 1E84A 3B0UX 3K1NA 3CESA 1CGME 3K69A 5HLTA 3HSFA 3WTUC 3TL4X 4G7HF 1JXSA 1L3PA 2NG1A 5L3CA 4HLYA 2H94A 5EG0B 2IYLD 3I5QA 2PEXA 2E1OA 1X3ZB 3RIRA 1KZHA 3IH3A 1JOGA 3CDIA 4E7KA 3FIWA 1ZR2A 1Q0KA 1OR3A 3E97A 1RI7A 4XRMA 2DDAA 3CJTB 3A01A 2YEVA 2HPIA 3V8LA 2HGCA 4UB8C 2QQ8A 2ZKZA 4U5EE 5K5QA 2JWTA 4PACA 1S6LA 3OIPA 1LS4A 3ATPA 5TGTA 4U5BE 3HRTA 2L4MA 4AUXA 3ONQA 4C2MJ 2MH9A 4IHWA 4MVZA 4EKWA 1MD0A 2BY2A 4X0GA 4E7IA 3K1IA 1U0JA 1IGNA 2J9WA 1X1DA 2K86A 3MMYB 2XLDA 3W8IA 3PIPF 3N4MA 1Z1DA 4WJ0A 3HRMA 1VYIA 1I3AA 4AYBA 2Z2SB 5K0IA 2DT5A 1GM5A 3B73A 2JUCA 3DBLB 1X58A 1P6RA 1U89A 3KL4A 4MEXF 1I5NA 3GANA 3G1LA 2XF7A 1O5HA 3ZQHA 4AIHA 1EF4A 2XLOA 5DVWA 1D0ZA 5AIQA 2Q9AA 2Q9BA 4CS7A 4FX0A 2LREA 3K70D 1Y8RB 4CYDA 1Z6TA 2Q7RA 3VAYA 3X2QH 5KAFC 2P7VA 2QSFX 4D5FA 1HKSA 3B71A 5A6AA 2K9MA 5FRNA 2RKHA 1VMAA 5IT9Z 3EGXA 3FAJA 1YFHA 3NMIA 2HFHA 3I56I 1NK3P 1FY7A 2A3SA 3HC7A 4BXFA 4CX9A 4IVNA 5JLXA 2BGCA 3GTKJ 3DKAA 1W5SA 4GO1A 4DIQA 3TMOA 4RAZA 4CH7A 1XS9A 4ESFA 4YJWA 4IHXA 4E70A 1ETXA 1RETA 2MSYA 2XV4S 4R79A 1SD5A 5ILVA 4Q4ZF 4XLAA 3W6VA 2VOPA 1X1PA 1OLTA 3LEOA 1E86A 3BR3A 3RQIA 3S2HJ 1OKRA 2EK5A 1QHHD 1ZAOA 4G6DA 4GYIA 4N06A 4DOZA 3SP1A 5BQGA 1WQ2A 1R5ID 4OINF 2O7OA 5HLIA 2X48A 3CMEI 2G9WA 1SVOA 3I4UA 2HZTA 2ME6A 1EI7A 4HBLA 2LOOA 2P5KA 5BQHA 2EIMC 4B44A 5T3TA 4XRSA 1MNMC 1Z3YA 4MNDA 2XAJA 3NYMA 3CDLA 3RYRA 1XMAA 1S3JA 3KP7A 4XLHA 2JA2A 4UY8I 3DP7A 3G6EI 1L7CA 1R58A 3S14J 3F46A 4QIWN 5L0HA 4YG2F 3CZ6A 3L09A 4GQHA 4CUGA 4DRHB 3L0IA 4WABA 1YJWI 3KYIA 5CI8A 3CCVI 3P7NA 1XSDA 2RDPA 3T8TA 2ZJPF 1H89C 2IT0A 2EA2A 5L3EA 2J5PA 5EJCA 1W4MA 2WB1N 4XOTA 3U21A 2E5NA 5GPAA 2JMWA 1RRJA 2QYOA 1MSFC 3T4RA 4ZLDA 2QKLB 4I3MA 2XL6A 1OKKA 1HMDA 2ZXWC 1VLSA 2P4WA 4IF4A 2UXXA 5B3SH 3VYSB 2FNAA 2IW5A 1PD1A 1OMIA 2LCHA 3U3FA 2JRMA 2E19A 4UUVA 3GTOJ 3AGTA 3TW7A 2ETHA 1XGOA 4HX7A 2O61A 1SR2A 1KA8A 2J5OA 1R5HA 3AG1H 3SJMA 2O8KA 2CUEA 4DXWA 3FDYA 2IEKA 3OOUA 3PNTA 3RW0A 2EPFA 2UZKA 2LFBA 3F6VA 1T33A 3QYFA 4RDAA 5KYUB 3WGIA 2R5YA 4E0IA 3BOQA 3CLQA 3ZGKA 1IUFA 2IA1A 2CG4A 5EEGA 1IV6A 3EHNA 2DN0A 4YK5A 2YS9A 2XPVA 3QU3A 1H8AC 2ZB9A 4LG3A 4HEAJ 5JFRA 5JP7A 4E17A 1S72I 1NG7A 1BBHA 1PYVA 1XSXA 5E3OA 2VASA 3TOBA 2HWVA 3ZQFA 1H9TA 5L3VA 2BW3A 1XZPA 4BEHB 2OCEA 1Z7LA 4EBBA 3C62A 5ILUA 2ELHA 3FK7A 4PGHA 3PJRA 4RB3C 2QBYB 2P0NA 2H7VC 2YU3A 4Y17A 3ASNH 2MD0A 4FT8A 1YYXA 2OEXA 2BY3A 2GQQA 5COGA 4E7SA 3RZOJ 3QAHA 3QVYA 4IQ4A 5D8LB 4F3QA 3MZ8A 2LKPA 1FP1D 3CJQB 3KFWX 4OU0A 3LA2A 1TWCA 3HNKA 3E6DA 3O55A 3GM3A 4XLPF 4JIOA 3E1SA 3QPLA 3BEHA 1BI3A 1B72A 3U8VA 3DTEA 3N0TA 2A61A 3WTYC 5E3NA 2RN7A 4EM1A 4S05A 2L0KA 5B3SC 2M9HA 3LQQA 3JYHA 1X1CA 3J7ZI 2V6CA 2RREA 1FOKA 2NUTB 2K4BA 5C4XJ 3MKZA 1OJLA 3LL7A 2QA4I 1WJBA 2B0HA 4J7TA 2HVRA 2VB6A 2XXAB 2XHKA 3DMDA 3OIOA 5FLXZ 3WHCA 2YKZA 3LNMB 3C2BA 3BR0A 2LTPA 2AQEA 3GFMA 2GWWA 3K2ZA 1JAFA 3C2GA 4HRIA 3CCRI 3PO3J 3HLZA 4YEJA 4IRUA 4CZZA 3K7AJ 4XK4A 4C3JJ 4ZYDA 5K7ZA 4XN0A 2GAQA 3JAMZ 3RJPA 5B1AC 4XBFA 2CGEA 4BE1A 2R5ZB 4B8XA 1YZCA 3S2WA 4L9VA 4BH9A 2G3KA 3SNHA 3HKKA 2BHZA 3IWZA 4G7ZF 1MMSA 3A0HC 1M2VB 2ECCA 4RGRA 3L2CA 3T1BA 1B59A 4NCQA 2Z5UA 2XF5A 3RQEA 4IRHA 1KU3A 1YA7O 4XQFA 2IXMA 3K66A 3PNYA 5L0FA 2XDVA 1ZHXA 2L3DA 4EGZA 1I5ZA 3DFGA 1FZPB 4G6TB 1YRNA 1W2WA 3JRDA 1A04A 2A5WA 2KL4A 2Y69H 2JN6A 1ERDA 3OYEA 4CBEA 1IW7F 2M30A 5E18F 1TC3C 1F5TA 1OYYA 1V5EA 2CQNA 2X6YA 2H6CA 3R61A 3OYKA 2GFHA 5HODA 2Q0OA 3BZCA 1ZHZA 3VYRB 5KCMA 2I15A 1Z67A 4R32A 2OCCH 1VLTA 2KKOA 2QEXI 3T0YA 4QSHA 4WWCA 1ENHA 1JHFA 1TWGA 4JEBA 4IARA 4YT2A 3S32A 3IUOA 1RKCA 4LK0F 4PUSA 1BJAA 2OZ6A 3A01B 2MA3A 5IY5H 3DCFA 4AL0A 3SZTA 1B9NA 3QP6A 3S8PA 4Z6YA 2NSFA 2JA6J 3TJ6A 3HXLA 4LERA 4BQOA 3LWFA 1FLIA 4I6ZA 1OW8A 3DU5A 4RDUA 3KP3A 2A1DD 4PJMA 5F0FA 4BDYA 3O8HA 1MBGA 1WJ5A 2DOEA 3H5AA 3NMJA 3K4NA 3DAFA 4QI2A 1R4NB 5FKOA 1SYQA 3NYLA 4EWCA 1FT9A 1AWCA 2EA4A 2YWAA 1XTAA 4BS9A 3S1MJ 5HNFA 1XWJA 3N97A 2P8TA 1YS7A 3S15J 4GXOA 4EJOA 5HDGA 1W5CC 2FNPA 2W7NA 2KRCA 1SD4A 3K10A 1J0RA 1BBYA 3DLAA 4ZJZA 1KGSA 1D5VA 1GQAA 1QSPA 3EYYA 3CC2I 1U6HA 2J9BA 1K6OA 1RUOA 4QPQA 3MWMA 1WOLA 1RJ9A 4HF2A 2X0CA 2P7VB 4P9UA 2E1CA 4A12A 1CPQA 2B7EA 3H35A 3BPVA 3FAPB 2VKVA 3KZYA 1VQ5I 3SFZA 2L9VA 1TQMA 3EGXB 3MD2A 1WH7A 1MBHA 4N4OB 4I44A 2IM8A 5JT4A 1HW5A 1D1BA 3BG5A 2GOXB 3BDDA 2CGPA 5B1BH 1OCRH 2GLOA 4OIOF 4GDFA 1ON1A 1A31A 3JCUC 5HDKA 4MTFA 1Z9CA 3L2QA 4BJ6C 4K1OA 1JT0A 2KZVA 5F64A 4M72A 4IEJA 3W2VA 2C03A 2LSOA 5F0HA 2OKUA 4KICA 1T9KA 3EQLF 5IOZA 3O39A 1U5TC 4Y52J 1Y56A 2HU9A 2ZMEA 3QP5A 3V7SA 5A2QZ 4YRVA 4A3LJ 2DA1A 2NRAC 5CIVA 1JUPA 5E3AA 1IN4A 5E8GA 3ZC4A 1ORYA 5C3EJ 3DI5A 3CEXA 2CYYA 4NTBA 1R1VA 4RLQA 2DPUA 1TKNA 3DQVC 4DZJA 4RB1A 3HRUA 3WU0A 3AGUA 5JRAA 3H1CA 5F08A 3WG9A 3ABUA 1SAUA 3DKYA 4O5VA 4WX9A 2IVMA 4N6HA 3U2LA 2CO5A 2DFHA 3IAM2 5KVRA 3HL2A 2OD5A 2AXLA 1Y1WJ 3BG3A 4HDVA 2DA3A 2VN2A 3ERMA 2OJQA 2NOJB 3G1OA 3PO2J 5J4YA 4GYTA 1YW9A 3SZRA 3BTJA 3OOPA 1R22A 4C3IJ 3LS1A 3M4BA 3OSGA 3LAYA 1BA5A 1C02A 2HZ8A 1U9NA 3ABLC 1JJ8C 3LOCA 3K6GA 3OV8A 2J45A 5FJ8J 3QRFF 2CFXA 2VC9A 1YARO 4LLCA 1QVUA 5LEKA 3HOSA 3CMAI 4CIHA 3T8RA 5BS6A 1PD0A 4RD9A 4A2NB 2VT3A 1SFUA 1T38A 3C63A 1E2XA 3DKWA 4OOIA 3IRQA 3JRIA 4KISA 3K0LA 1U8BA 1QLEC 1OQYA 3W6JB 2VCBA 2IGOA 4HEA2 2L9JA 1TFKB 3R6SA 5B1BC 3HZJA 3OL3A 1CQTA 5B5EC 3MQ0A 2D1VA 3QOPA 4KIBA 3I64A 4MGRA 3TOLA 1QA6A 2FD5A 1PCXA 1ZHWA 3FOOA 3K6BA 1IXCA 3H5RA 3D0SA 1HE1A 4NC3A 1D0YA 1W1WE 1R1UA 1W5TA 1BR4A 2C04A 2GXAA 2EFNA 2ISYA 2ZXIA 1SFXA 3M8JA 3G1MA 2R5YB 2MGQA 3BJAA 1P7IA 3QZCA 3IQCA 4BG0A 4UDVA 1QHGA 1KNYA 3V42A 3E6MA 1UELB 2CW0F 1N78A 1YI2I 4O6YA 5J4VA 5D6EA 3OR1C 5LRSA 3JTGA 4JK1X 1KYWA 3EPZA 1G3SA 2LY9A 1XGMA 1YAUO 5J1UA 2VL8A 4M9XA 1A7DA 2AU5A 1U6GA 2BW3B 1LUJB 2OAZA 2WV1A 3E7LA 4F7ZA 3L1PA 2K9SA 2OV7A 1S5LC 1M2OA 3IQ6A 4U0WA 3KYLA 2M4GA 3E3VA 2VXZA 3VSKA 5D5WB 2AHQA 2IP2A 5F27A 2L4AA 3BQZA 3MYFA 2M4KA 3DU6A 4UVBA 2WVNA 4CCMA 3ECSA 2WAEA 1IRXA 2JVHA 2XB0X 3GTJJ 1APCA 2CSOA 2FMYA 3S2DJ 5F5FA 4JJFA 2DA6A 2KFDA 3HDDA 1WZ2A 2G7HA 2P7CB 1D8JA 2XAFA 3RKYA 1ONVA 4KC9A 2VQLA 4XLCA 4A5NA 4EJVA 2E2IJ 1A6QA 2FAPB 3JRAA 4JW1A 2ZJQF 1E85A 1TZLA 4XR6A 3Q9VA 2EFOA 4CCLA 4MLOA 1MW7A 2R7RA 3E6CC 3PFYA 1NG1A 2DA4A 1FWZA 4JE9A 4JTCB 1I4ZA 1JT6A 1X2NA 1FTZA 4IAQA 4O7GA 4O6JA 2IA0A 4LB5A 5CVUA 4HX4A 1A41A 4HE8D 2LK2A 3KCCA 1IN7A 3NARA 3I3LA 4KN7X 4FISA 1R23A 4OMZA 2F5CA 2NAZA 2HTSA 4AWXB 4A3FJ 1HE9A 2QLAA 3V8JA 1I39A 1QZEA 3F8MA 1LDKB 5HNHA 1R49A 2EV0A 3E0JB 1U78A 2PMHA 2Y0MA 4AVZA 3DJNB 3M4CA 2KJBA 2XAGA 1Z3XA 3KEQA 3GTLJ 4FAPB 5DQZA 1LDJA 5D4RA 3R2PA 1V4AA 1GVDA 2YUSA 1ZKGA 2STTA 4L9JA 4N0BA 2K9QA 4RAFA 1LB2A 4YT4A 5E1ZB 2ZXRA 4I76A 3H3UA 3OA1A 3CAXA 2IOQA 4YL1A 2MFZA 2IXSA 3ULQB 3OYJA 4OD4A 1KYZA 3DLLF 3PHF2 5CKTA 4ZYEA 3AG4H 1Z23A 2CV1A 3HOXJ 1OCCH 2HYGD 3KEYA 2VCCA 1NU9C 1MMNA 3Q0WA 4UUSA 2HQ5A 3FZVA 1O3SA 3CQZA 2Z15A 1X19A 2DCEA 3RSNA 3IHUA 2IGNA 2L9SA 1WJEA 2ELJA 1CF7A 2XPWA 2H1LA 2DMQA 5DCFA 3WG7H 2DYRH 3LQRA 1ZR4A 1XDUA 1U8RA 3GTQJ 2A07F 1I1SA 1EH8A 2LRDA 1ETQA 3N05A 2Q8KA 2D45A 2QQBA 5JLWA 1DOWA 2FBKA 3ASOC 1IRFA 1YLFA 3H65A 3L00A 4BHBA 3TEDA 2WL8A 1Z6AA 3RCOA 4DVZA 1NFOA 1FJLA 3JSZA 4YWQA 3KYDB 3OWTA 1VTMP 4IRIA 1K6YA 4MTDA 1M56C 4MVRA 2E71A 4XWJA 4M3BA 1RKEA 1I50J 3FXMA 1JGSA 2IS4A 3NKEA 3CP2A 3KIOA 1TWHJ 3BG6A 4PJ0C 1K05A 2M8EA 3IAS2 5BUOA 3M1EA 5JSLA 1P92A 2ADUA 2F2EA 4EJUA 4NY3A 3WGGA 5E2QA 4M6XA 2FQ3A 4NUBA 1Y4CA 1HLVA 2JPBA 2DOAA 2Q1ZB 4MNUA 2GZWA 3UR3C 4BBRJ 5HOOA 3KZZA 1F4KA 4KIFA 4YIRX 2YPRA 2DK5A 2COBA 2QBYA 4CCNA 2CQ7A 2DA2A 3DBHB 1S8NA 2DMUA 3CC7I 4LJZF 5L3GA 3F8CA 2E1MB 2KJCA 1TLHB 1JPJA 2G7UA 5F5HA 1XD7A 4A0YA 4U5GA 3AG4C 2FMLA 4E7JA 3RIPA 1Z91A 3VPRA 2NNNA 3L7WA 3EUHA 3VFZA 3ZMUA 3IV5A 1ZG3A 1PUFA 4BXUA 1AUEA 3FF5A 4GGGA 1T0FA 2ZXOA 2FA5A 2EIKC 2E35A 1RJ9B 2IS1A 2XS8A 2W85A 4J7YA 1WJCA 3W3CA 2P81A 3Q6NA 4XMYA 3JR9A 2P1AA 5EEAA 3GTMJ 3ZMVA 2FBHA 1OCTC 4GYGA 2DYRC 2L81A 3FKIJ 2XB5A 2ZCWA 4CDGA 1GLNA 1MJBA 2VT2A 4I7HA 3ZRGA 2R7WA 2VLAA 3CCMI 3GCMA 3GO5A 1YITI 3ISPA 1EA3A 4A6EA 4MEYF 3J7AO 2O3FA 1TW3A 2QSHX 5M3MJ 3VYTB 4XKCA 3OYLA 3AL0B 2OC6A 1RC9A 3TULA 1VFCA 2ZC2A 2P61A 1RIOH 1J8YF 2HKVA 5GAEJ 2KT0A 1T01A 2LFFA 3ROUA 3GTGJ 3RKOF 1QVXA 5CJ9A 1Z7UA 4HW0A 4CA0A 4PSXA 4M74A 3J80K 1DP7P 2IPQX 1R1TA 2CV2A 2PX3A 1TP4A 2CMPA 2JSCA 2EZKA 1ZW2A 3B29A 1ZYRF 3GZNB 2ZFUA 4LIVA 3H3VK 1VI0A 1ZHYA 2IXPA 2QLZA 4MTOA 3V5YA 1OCZC 4ER9A 2EFPA 2PF4E 1ZH5A 4XEKA 2K4JA 3GMEA 3HKZN 3OYCA 2LSEA 3S84A 3H3ZA 4JVSA 3LA3A 1ZK8A 5CLSA 3VRCA 1A36A 3ZQIA 3ZG1A 3U0CA 3EPVA 2E7WA 3ZQGA 5K7FA 3V4GA 4L18B 3A9CA 3TKYA 2KZGA 1UMQA 4EM2A 1BIAA 4F93B 2D4UA 3SXZA 2E36A 2V6EA 3VODA 2Z16A 2M2EA 2A05A 4ANJA 4EM0B 1O4XA 2K02A 3J7YJ 2B63J 3HTKC 2JA7J 4HFKB 3IQ5A 1K78A 4FESA 3G3ZA 2PP4A 1G8XA 1Y1VJ 2JQ7A 2UUHA 2GBYA 1VOMA 2LD5A 3DM9B 2BL2A 3D5LA 3CCEI 4WGZA 4XONA 5HS9A 3S9OA 3ECOA 3ABTA 4I01A 4MVOA 2EWNA 3KP5A 4PCQA 2R7OA 3IRRA 1G59A 1Q0MA 1X1AA 4LFUA 2DPDA 1HY5A 2Q2EA 1PP8F 3K4LA 4IOAF 1J2XA 1MBEA 1HSTA 4PJNA 3ZMTA 1FSHA 4L5IA 2F5FA 2EIMH 4D0PA 2L02A 2YVKA 1JHHA 1R00A 1S7EA 1Y0NA 4AC0A 2XUBA 2UWMA 2M34A 4JQFA 4E7ZA 4A3JJ 1TL8A 2NS7A 2BY0A 3FBIB 4NTFA 5HLHA 3QU6A 3QYBA 4WGYA 2XRLA 5FLMJ 4A5MA 1WFXA 1UCRA 1V3FA 4JKVA 1A7EA 1YLMA 1YW7A 2OA4A 3ZMDA 5KYWA 2B9SA 3M7GA 3HRSA 5C44J 2W4MA 3ESWB 4KA4A 2HEOA 3WTSC 3CC4I 2VC0A 1WJDA 2WAQN 4CS9A 3HJCA 2XKPA 4JP0A 4A3KJ 1IRGA 5E3LA 3F8FA 2QSGX 256BA 3AG3C 2DT6A 4ESBA 2LR8A 4G6QA 4LITA 3S90A 2M64A 3VSLA 2W25A 1MBJA 1FBUA 2ZXWH 1POGA 1Y6IA 1G3WA 3H36A 1PVEA 3L9FA 2UUZA 5D5XB 3R0JA 4IL6C 1LQ1A 2KNHA 1KTMA 2YL7A 3IH4A 1EKEA 1IAWA 4XPYA 1H88C 1O7FA 1HDDC 3VOEA 3U5SA 3I53A 1XSVA 3CTAA 2QE9A 4P6IC 3ZP5A 1LPQA 3ZQVA 3QOEA 3WE3A 3LAPA 4D1QA 4B3AA 3ITFA 3A02A 3LFUA 3J81K 4CO8A 2J9VA 3FOPA 1LVKA 3EYIA 4V19K 3UMIA 3BR5A 4U87A 4BE0A 3GWZA 3RF3A 3EUHC 1AHDP 4BEJA 2AXTC 3FXRA 2JA5J 2EINC 2A69F 4IOCF 3IKVA 2MC4A 4EBKA 1BZ4A 5FO5A 2GIVA 2EPLX 4PR9A 4YFXF 2X1CA 3PL8A 3QYEA 4LLGF 2Y0SA 5F1JA 2EILC 1QZZA 3MAJA 2XLHA 3F6OA 1V5GA 3EETA 1YJ9I 1MSEC 2R7FA 4J30B 1WSUA 4JCHA 5F28E 1Z77A 1USTA 2W48A 5FGMA 3P9CA 3QW1A 1RUNA 1B1BA 2UUIA 3ZPLA 3E70C 4PZJA 3Q0UA 1MH4A 4ITVA 3JRCA 2X4HA 4ULWA 2HS5A 4P96A 2ASRA 4JEAA 3T6BA 2QQ9A 2ID3A 1EQ1A 1H0MA 4DQ2A 5A6JA 4YT8A 2PMZN 1ZVZA 1ETYA 4EJTA 1LEAA 1RR8C 5L0GA 2GA0A 1YZAA 3G50A 1ULYA 4UUSB 5FCLA 4L6RA 2J7PD 2L7MP 3OMYA 2NSGA 4LB6B 3AJMA 2PBEA 4PJJA 5DS9A 3U9GA 2HDWA 5FLVA 2XLWA 2ESNA 3UKGA 1E3HA 4D5CA 1K7AA 3WU1B 1K61A 3DZAA 1CF7B 2OTLI 4ZYAA 3BR6A 3R0AA 2DQLA 2R3SA 3ZN1A 2ZPAA 3LEVA 2XL8A 3HHGA 3CCYA 2RSEB 4II2A 1XMXA 2BVMA 3OL4A 3G4SI 1MDMA 1GXQA 2GXBA 2QUPA 3QVZA 4JOMA 3SQNA 3DV8A 2EIJH 4II3A 2YLDA 3HNIA 2EZLA 4CCJA 1N77A 3TP0A 1VQ4I 2R7QA 4G12A 1RKEB 2QF7A 2O0YA 3RDIA 4C3EA 4DRJB 2ME0A 4V2GA 1FIAA 2HR3A 1P2FA 2XSEA 5AC4A 3LSTA 1R9TJ 5DUKA 5B1AH 4I1OB 4ZTJA 4LACB 4U5HA 1ETVA 1WRJA 5D8KB 4MIMA 2Y9ZA 3LAJA 5JLIA 5KYXA 3POVA 3LSMA 3ZSUA 2WAFA 1Z21A 1LPEA 3HSEA 1JKQC 5CI9A 4YELA 3HGYA 1WKMA 2KGOA 3M1CA 4EJWA 4NNJA 2RNGA 5JI6A 1CPRA 2W1OA 1AVOB 3SEOA 3VF0A 3ZDLA 1BR1A 2CH0A 5COMA 5DS4A 5L3FA 1I3QJ 1J5YA 4FWVA 2YR2A 1T98A 4Z9HA 1YQAA 4LD5A 1FSEA 3S1NJ 1T6IA 5D5UB 3A4CA 1XMKA 3R4KA 1TWAA 4WXCA 2CUJA 2HMZA 2HXIA 2LLKA 5FKMA 3MKLA 3K1IC 1XGNA 2QGUA 2X6XA 4RM2A 5FB2A 1FIPA 5F0CA 1PUFB 4CDAA 3ZIBA 4HV6A 4PJLA 3OY9A 3EUAA 3V5XA 4HLXA 2IAIA 5EGYA 3ELKA 5IYBJ 3LUTB 4HQEA 3DAGA 3I0TA 2W4BA 3CDHA 2R92J 3RH3A 1FMWA 2EQRA 2LBFA 5LRRA 2LIGA 4U9EA 5HS7A 3F9KA 4S04A 3KE2A 2HDDA 4L0YB 2HUJA 1ZGWA 2K3FA 2V1DA 5E1XA 1ORJA 2EIJC 4CCOA 1BM9A 4OAZA 2O9LA 4I0AA 5KNLA 4JBAA 4KT6A 4U5DE 3OSFA 1ODDA 3JTHA 1Z0XA 3QMKA 4NC6A 3KP6A 3FXJA 5BQTA 1HSJA 1HMOA 2Y39A 4BACA 3O6BB 1A5JA 3WTVC 2HPMA 2XAUA 2BE5F 2OBPA 2MG4A 2EB7A 2KPMA 2NS0A 3RKWA 1UJ8A 2XAQA 4M3EA 4A93J 2K85A 3C8GD 5IP9J 2R93J 1XZQA 1B4AA 3D5SC 2L6HA 4MVUA 2VBXA 3E5UA 2HQAA 2XGXA 3A03A 5L0CA 2RAEA 5JVGF 2FGYA 5KAIC 4HDUA 2L5QA 4Y15A 1V5FA 1ZU5A 3K70C 3I4NJ 2D2WA 3KX2A 3AQCA 3N24A 2NPUA 1IV8A 2K9NA 2TRTA 5M5XJ 2Y48A 3DE9A 2XC7A 1HKQA 2NVUB 3UMKA 2H7OA 3M79A 1ST6A 1VZ0A 1JE8A 3AOUA 2L6FA 1FYMA 2IGKA 4MFDA 4BDZA 3PNVA 1REPC 1J75A 1RCPA 2RQQA 5KK1A 4IPAA 4UVCA 3L2VA 3O10A 3A1YA 1K78B 5D92A 3FWEA 3L34A 4XRFA 6PAXA 2L7FP 2GM4A 4IJAA 1Y6DA 3CCQI 2XKOA 5JHUA 4NBQA 3RZDJ 2CCYA 2A5YB 2BC5A 5K1YA 1OYWA 4XL9A 5LLQA 3U3BA 3DEUA 1VQ9I 3PDMP 3R60A 4C2UA 3K33A 3PSIA 3ZWIA 2Q2EB 3KLOA 3QPTA 4F91B 4A0XA 3ERED 2V4JC 1A35A 1Z63A 2IXNA 2BOLA 3MKYB 3ZR8X 4BU2A 3CCSI 1HBXG 1G2HA 2EPKX 1I27A 2OU6A 3SYNA 3PUFA 1DDNA 4Z9JA 5FKLA 4BQNA 1LFPA 1ETOA 3TGNA 4XKWA 4Y13A 2XM0A 2M3AA 3FVYA 2QWWA 2ETSA 3ZMSA 2X0LA 2E1NA 2TCTA 1OCPA 5KYWB 2XLEA 4PDKA 3GLXA 3RQ4A 4BBSJ 3HYIA 3G73A 1LFUP 2TMVP 1UG0A 2CS3A 2LF8A 3H92A 3JT1A 3L2UA 2K9LA 4IHTA 3ABLH 2PX0A 4XTKA 2JSPA 4RGSA 2LMDA 1LNWA 3O2PE 5DS6A 5AC5A 3UGOA 1DOVA 3HTSB 1MH3A 1GS9A 2NUPA 4OD5A 1STZA 5BPDA 1JR8A 4ZTFA 4X0RA 2A68F 4D4XA 3M8EA 1DPRA 1OXBA 4NTAA 2DYSC 2KRHA 3RVYA 4CSAA 5HLGA 1HC8A 4HSTA 4BPMA 2DDBA 3AAFA 3WTXC 1TT5B 1O57A 1VNDA 2V1XA 2G0EA 3GEEA 4RAYA 3Q7GA 1GV5A 1UZCA 2DU9A 2PJRA 4Q47A 5FFXA 3Q9SA 2A0BA 2W45A 1BOAA 4Y33A 4RLFA 3MN2A 4B47A 3U1KA 3EGDA 3CO6C 2EFQA 4BQQA 2JPCA 2QKMB 1MNEA 4P55A 5IPAA 3SDGA 1ZREA 4Q7CA 1X2MA 1LVAA 4F92B 5LGTA 2NVQJ 1CGOA 3OYAA 2CWEA 4LDKA 1XX5A 4B09A 1LI5A 2WTEA 3GFLA 4IZZA 1ZG5A 1FBSA 2DMNA 4LK1F 3WU2C 2CNWD 4U9DA 4XQ1A 3GEIA 3F8BA 4CYCB 4U88A 2V9PA 4HX8A 5BOXA 1YG2A 2BEOA 1YYJA 3TBIA 3H0DA 1V54C 3KMIA 2OU2A 1OCOC 1QNTA 1ZZPA 4KT5C 4YT5A 1QPIA 3TD7A 1AOYA 1O87A 2FE3A 4AX2A 2JX0A 1VQ6I 1XCBA 2LD6A 1VQNI 5IT9K 1ZGAA
chains in the Genus database with same CATH topology
2OJED 3KPHA 1R5ID 2ICWG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OJE D;  3KPH A;  1R5I D;  2ICW G; 
#chains in the Genus database with same CATH topology
 3FKJ A;  4IB4 A;  3B0V C;  2XGE A;  4MQ9 F;  2DJN A;  2WBM A;  4UB6 C;  4LLL A;  1VQ8 I;  2IXO A;  3T9O A;  2KRF A;  3GXO A;  4RMN A;  4B4C A;  5HS8 A;  2G3V A;  2WB1 A;  2W24 A;  4I09 A;  2VOD A;  1IRZ A;  2M45 A;  2R7V A;  2YL1 A;  2Z9O A;  4DJ9 A;  4UVA A;  5EDN A;  1IN6 A;  1TQI A;  4GCV A;  3LSI A;  4D7N A;  3H2U A;  3KH2 A;  2KIU A;  1O3T A;  1OPC A;  4EUK B;  4A3B J;  3SZG A;  4HAM A;  4YFN F;  2EH3 A;  1YW8 A;  3KP4 A;  4YN0 B;  1CGP A;  2DT7 B;  3C3W A;  1MDM B;  4UXN A;  3ZN0 A;  3B0P A;  1V55 C;  5A6B D;  2X1E A;  3LSR A;  1YYV A;  2OJE D;  3OYF A;  3PMR A;  5EZH A;  5DYM A;  3WOD F;  3V7O A;  1IZ1 A;  4X1E A;  2V1U A;  2P5V A;  4RBN A;  1GVJ A;  3G4Z A;  4ON0 A;  1GT0 C;  1ZQ3 P;  3FXU A;  5FD6 A;  1V74 B;  1WAT A;  2M7A A;  4CDY A;  2X9D A;  5KYX B;  3EZH A;  2R25 A;  1TWC J;  2A6E F;  3K4J A;  3JSP A;  2R7U A;  1GV2 A;  1X4P A;  2F5D A;  1H9G A;  4A2U A;  5GP9 A;  3M1C B;  3J81 Z;  2MH2 A;  4AYB N;  2I10 A;  5LHI A;  2AWY A;  5DLJ A;  2R7T A;  1DGW Y;  4CS8 A;  5J1R A;  5T1D B;  4RGU A;  5E3M A;  2HOS A;  1SFK A;  4BY1 J;  3HNL A;  1SVM A;  3HSR A;  4C3D A;  4Q5S F;  3KKB A;  2BXY A;  3NAU A;  2UV1 A;  4PFO A;  3MZH A;  2JJ7 A;  1BC8 C;  3J06 A;  3CLO A;  3QPH A;  2VIX A;  4MHG A;  4M6V A;  3RPQ A;  4KDP A;  2KJG A;  4J32 B;  2FXA A;  2WY8 Q;  2A0U A;  1FX7 A;  1T39 A;  5BQI A;  4MVM A;  1IZM A;  4I1M A;  2IBF A;  5E33 A;  1ZGJ A;  4LOC A;  2MW8 A;  3IWF A;  2M87 A;  2HOE A;  3S3N A;  1KU2 A;  2YX4 A;  5DDG A;  4KIT B;  1YX3 A;  2O03 A;  5IYD J;  4BJ5 A;  3U2R A;  1FYL A;  4GRI A;  4O3M A;  3O3K A;  1FPQ A;  5F1R A;  2K5C A;  3ASO H;  3SYT A;  1MKM A;  3BRJ A;  3LSK A;  2DLL A;  2A6T A;  1M1E B;  1SFE A;  4XLF A;  2F4M B;  2I8D A;  2E1M C;  2BYV E;  5A69 A;  2LKX A;  1RKW A;  1RR7 A;  3BC8 A;  4MVS A;  2LBF B;  4FX5 A;  2QVO A;  2H27 A;  1QO0 D;  2Q3T A;  1OR7 A;  3O6X A;  2X6W A;  2M7B A;  1LDD A;  1S05 A;  2H6B A;  1S29 A;  3GLL A;  5DUI A;  1VQK I;  1NFN A;  2L7K A;  2ZNZ A;  1ZN2 A;  1SF8 A;  1MBF A;  2H7B A;  1JPN A;  2HMQ A;  3BR1 A;  1I6H J;  4ENM A;  3B6A A;  1T6Q A;  4IJJ A;  2NVY J;  4MQV A;  5CVJ A;  3FMQ A;  1W0T A;  4HOB A;  5E20 A;  2F5E A;  3NKD A;  1FP2 A;  1W7P D;  1OIS A;  3MVP A;  2F4I A;  3HPH A;  3F21 A;  4AIK A;  4QDL A;  5HV9 A;  2DTR A;  4W1U A;  3AL0 C;  1R7J A;  1UHS A;  1FOY A;  1ZLJ A;  1LE2 A;  4OIP F;  1IC8 A;  2Q4F A;  2GDC A;  2RV8 A;  5DCM A;  2Y0S N;  3NRV A;  1R71 A;  4A69 C;  3GM2 A;  4KNV A;  2HSB A;  4DRI B;  1UFB A;  2M8G X;  2VBY A;  3RPU D;  2PJP A;  3HTU A;  1TWG J;  2PI0 A;  2ZME C;  3SDB A;  1ZTR A;  2EIK H;  3HM5 A;  4CSW A;  3P9K A;  1J9I A;  1TQG A;  4O6N A;  5H20 A;  2QEN A;  2EV5 A;  2KIS A;  3OYM A;  1FFT C;  2WV0 A;  3H9G A;  3GM1 A;  4C3H J;  1T2K A;  4XPX A;  4DYC A;  4F4B A;  2J9U A;  3NQO A;  1W7P A;  2R0Q C;  2M0C A;  4L5E A;  4HA8 A;  1SVL A;  1T8I A;  2K40 A;  3BR2 A;  3JSO A;  3LNQ A;  3S16 J;  1ORS C;  3SXK A;  5C4J J;  2OTJ I;  4A3E J;  3C8G B;  2MLK A;  2E2J J;  4G94 A;  2DOF A;  5FLX K;  2V3C C;  1YJN I;  2YZS A;  2X85 A;  9ANT A;  3BJ6 A;  4HPQ A;  2XRO A;  1PV3 A;  1ZLK A;  1NTC A;  3FM5 A;  3JW4 A;  3FHZ A;  2Y2Z A;  3M4O J;  3IPM O;  3AG2 C;  4IHV A;  3S29 A;  2FUG 2;  1T5O A;  5DD8 A;  4U5F E;  3JAM K;  2DTZ A;  1YO5 C;  1JGG A;  2H8A A;  3EH1 A;  1SD7 A;  1Z05 A;  5EYR A;  5H6Q A;  3TOA A;  1TT0 A;  2PQ8 A;  1ZAR A;  1NZE A;  1UG7 A;  1F9N A;  2WB7 A;  2HKX A;  3LFK A;  5ERI A;  3ZMZ A;  4LDR A;  2VE9 A;  1OCZ H;  3V5Z A;  3FHD A;  4H4K C;  4J19 A;  1BOB A;  3VYU B;  1ZW3 A;  2DFI A;  5JVT A;  2K27 A;  3TO7 A;  4ASN A;  2BXZ A;  5K7H A;  3CCJ I;  4OMY A;  3IQT A;  1TTY A;  4M73 A;  3LSP A;  2KDZ A;  4AD9 A;  3GUD A;  2P6V A;  3S27 A;  4JX4 A;  2VKH A;  3U2M A;  1JJ6 C;  3KPH A;  2H09 A;  4HSR A;  3WTT C;  4KYW A;  1B9M A;  1WHU A;  2L01 A;  3TDZ C;  4IXA A;  3CF2 A;  2E60 A;  3W4Y A;  3UGP A;  4XOR A;  2C6Y A;  1GHC A;  3TW6 A;  2NUP B;  3LS0 A;  3TQN A;  3W2W A;  4C9Y A;  1KU9 A;  2VBZ A;  2Q9C A;  2DB4 A;  2DOD A;  1VQL I;  2P5L C;  1BW6 A;  4MW8 A;  2J46 A;  4CIP A;  3K4C A;  5LHH A;  2TDX A;  3QW0 A;  4BY7 J;  2G62 A;  3U1D A;  1ON2 A;  4FET A;  1WJF A;  4EVI A;  5B66 C;  1YE9 A;  3A2K A;  1BDJ B;  3CCL I;  4JX6 A;  2PJR B;  1SZI A;  4EAT A;  2NXN B;  3PM1 A;  2XGC A;  4QTR A;  3RFY A;  2W84 A;  3IL2 A;  4QI0 A;  4AK9 A;  4UV9 A;  1FTT A;  4KMF A;  1MJ9 A;  1P4A A;  2HI3 A;  3COA C;  2XVC A;  1DP3 A;  2HJM A;  3EGD B;  3TQO A;  1B8I A;  2VPL A;  4BE2 A;  1NLX A;  2LF7 A;  3US6 A;  4NQW A;  1ETW A;  2JT1 A;  3LNR A;  3X1O A;  2Y30 A;  2XLV A;  1DUX C;  2HFI A;  3W6K B;  3BQY A;  3EH2 A;  1QPM A;  4A3I J;  1MQV A;  2JA8 J;  5HDN A;  1A0B A;  1HOM A;  1S7Z A;  3ZTZ A;  2LKS A;  3DM5 A;  5KYY A;  1FAP B;  4GEH A;  1TNT A;  5GAH J;  4ENK A;  1IJW C;  2FFH A;  2YSR A;  1S7A A;  2ZO4 A;  2LY1 A;  3PFI A;  1VF9 A;  2MWQ A;  4I98 B;  1BC7 C;  2PLY A;  3CO7 C;  3CMY A;  1U9O A;  3GBG A;  3HHH A;  3AG3 H;  1TW2 A;  5EGO A;  2FOK A;  1EV7 A;  3OYD A;  1IN5 A;  3F47 A;  4M63 A;  1IN8 A;  3S17 J;  2L7Z A;  5HSW A;  1FOW A;  2JPU A;  1K4T A;  2VBW A;  2QCO A;  5J1Y A;  5DS5 A;  4BQA A;  3IKT A;  4MTG A;  2ESH A;  3BY6 A;  1YHQ I;  4P1W A;  3U9M A;  4JX5 A;  4XIC A;  1PP7 U;  4KBL A;  4DJA A;  1IDY A;  2KIF A;  3EG9 B;  4Z2Y A;  4ENJ A;  1ZG1 A;  2F6C A;  2BVL A;  4M9Z A;  2GA1 A;  1HCR A;  4ZH4 F;  1LI7 A;  1FEX A;  5TJJ A;  2DO7 A;  3PQJ A;  2E2H J;  5ICG A;  4BL0 B;  2R05 A;  2KMU A;  3WHB A;  4XPW A;  1Y39 A;  1Q1V A;  2MAB A;  4U0Y A;  1Z6R A;  2OZU A;  4DGW B;  3CCU I;  2VKE A;  1K04 A;  3MYI A;  1WWP A;  3BWG A;  4LMY A;  5L0I A;  2HVS A;  1JTX A;  2HSQ A;  3BCB A;  1DGR M;  1HW2 A;  4JZA A;  5A2Q K;  1TFO B;  2WAD A;  1T95 A;  2EIN H;  3GFI A;  5HVQ C;  5J8F A;  2L9N A;  3EDP A;  4FE7 A;  3L1M A;  2XAS A;  3F0C A;  1I1G A;  1D5Y A;  3REO A;  2H8R A;  3LSH A;  2HYF A;  2QNL A;  2EIL H;  3CJR B;  2FX0 A;  3CD6 I;  3EUK L;  3VEP A;  1WVR A;  3R7C A;  4Y3O A;  4OIQ F;  4GFB A;  4IO9 F;  1VQP I;  2VH3 A;  1FBQ A;  2XIG A;  3L2W A;  4P9T A;  2DFF A;  4A4A A;  4BYY A;  4CXF A;  2ZD9 A;  4W8K A;  1ZRC A;  4JJG A;  4KI2 A;  1HKT A;  2KQ9 A;  1PJR A;  2E34 A;  1QKR A;  3E6B A;  4XKB A;  2VKD A;  4DBR A;  1OFC X;  4BAY A;  1C17 M;  3GOD A;  3HOW J;  1EKY A;  4JCZ A;  3FBN B;  3TO9 A;  3I4M J;  2I8B A;  5FD5 A;  1MMA A;  1D0X A;  4MFE A;  2QUF A;  2Y31 A;  5CPR B;  4RM3 A;  1XGS A;  4HF1 A;  3ZXS A;  3C2H A;  2DI3 A;  3LJB A;  3DEW A;  3MBG A;  1IF1 A;  1J8M F;  2XRN A;  2KHM A;  2E5Z A;  3FM3 A;  3LES A;  2DXI A;  2CQK A;  4N4N B;  1HW1 A;  5D6F A;  3C18 A;  4I99 C;  5EZG A;  4K2E A;  2LP4 A;  1GGQ A;  3GOR A;  4L5J A;  3ABM H;  3M8F A;  4KMU X;  4XN3 A;  5DTD A;  1O3R A;  3BJO A;  2ZJR F;  4A3G J;  1VB5 A;  1FNN A;  2F22 A;  3FK6 A;  3DWL E;  3JRT A;  1I6X A;  3PQK A;  4CIC A;  4B43 A;  4NHJ A;  4IGG A;  4CZC A;  1H7I A;  3I5P A;  1P4W A;  4XLN F;  2YU9 J;  4B3X A;  4HG2 A;  3S28 A;  4XEF A;  1T0F C;  1O3U A;  1KON A;  3B02 A;  3HJE A;  5IP7 J;  3GZ6 A;  4ZDL A;  3G2B A;  4PSW A;  2IJL A;  3CUQ B;  4W8P A;  3CQZ J;  1YJG A;  3V7C A;  3D1N I;  1MJA A;  4J01 A;  4CYC A;  4RAG A;  3HUG A;  3ZQ7 A;  4XSZ F;  1K79 A;  5J8C A;  3DKX A;  4M3G A;  4Q48 A;  4TV7 A;  1LM3 B;  3F22 A;  5JUA A;  5DM7 F;  4ESJ A;  1Y0U A;  2J8W A;  4R1H A;  2DFE A;  3Q0V A;  2O8X A;  2ELK A;  2COM A;  2ZJ2 A;  2WVO A;  5GPG B;  1LEB A;  1OKK D;  2CW8 A;  4MW3 A;  5DCM B;  4C3B A;  3L8I A;  1T6S A;  4IHS A;  2PN6 A;  4JTA B;  1DU0 A;  2BV6 A;  1FC3 A;  4NQF A;  4BHP A;  2ZFW A;  4PFP A;  4NC8 A;  4RGX A;  4XRS G;  3RYP A;  4LLN A;  3F3X A;  3JRM O;  2CFO A;  5DEQ A;  4U7B A;  3ZOB A;  1R6R A;  2V26 A;  3FXH A;  1XG1 A;  4WXH A;  1O3Q A;  1W7P B;  2KW3 C;  2XSJ C;  2WWY A;  4XID A;  4AU7 A;  1QU3 A;  1YVI A;  2PX9 A;  3VDX A;  5IT3 A;  3X2Q C;  4Y4R A;  2YLI A;  1SC7 A;  3OYH A;  3BRO A;  1H6G A;  3ABM C;  2WZF A;  1QRY A;  1ZHT A;  2LQG A;  2WZG A;  2ISZ A;  5L3Q A;  2BZT A;  3JRF A;  2DBB A;  5JR3 A;  3HOZ J;  4WXD A;  4O6M A;  5BPI A;  1Z5Z A;  3P9I A;  4XOP A;  4XLE A;  4MS2 A;  1T56 A;  2XS1 A;  3S1Q J;  4A3C J;  2CJJ A;  2PFB A;  2ZBK A;  4KIG A;  2J7P A;  3CSK A;  1SAX A;  2CU7 A;  2LVS A;  3EZI A;  4B48 A;  1Q0F A;  3I59 A;  2KIM A;  2OQR A;  4I0B A;  4JRZ A;  4LGW A;  4IRG A;  1G6N A;  4G9Y A;  4D7M A;  1RES A;  4BGD A;  5M3F J;  4N4W A;  2HJ3 A;  1U2W A;  2NNY A;  5IP6 A;  1DQU A;  3ABK H;  1W36 C;  3LMM A;  3TJ5 A;  2FBI A;  2R03 A;  3QPS A;  2GXG A;  3IH2 A;  4V2F A;  1LE4 A;  1WGW A;  5J3L A;  2V79 A;  1D8K A;  3NYJ A;  4U0V A;  4ZZL A;  3F72 A;  2QY9 A;  4IAO A;  1WPK A;  2KIQ A;  2BBY A;  1IXS B;  2NVX J;  1L3L A;  1AA7 A;  1ZEL A;  1OW7 A;  4MVQ A;  2L7A A;  3SZP A;  5LFA A;  1S9H A;  5AGF A;  1X4O A;  3NEU A;  3A11 A;  4BJ6 A;  2FSW A;  3HOU J;  3HIF A;  3BCA A;  3ML6 A;  2P6T A;  5CQG A;  2CV0 A;  5ILS A;  4L0Z B;  4EGY A;  4WF2 A;  3L2R A;  4UNO A;  2HQN A;  1U5T A;  2F48 A;  2CRG A;  5T3W A;  4XKV A;  2DMT A;  3MFN A;  1K40 A;  1NHA A;  3EFO A;  1P4X A;  4BHC A;  3FXQ A;  5KHD A;  3G4X A;  1FNT c;  2DJI A;  5GAD J;  4CS9 C;  2KDO A;  3TDU C;  3M15 A;  1J09 A;  4CDV A;  5EEH A;  3DPL C;  3CP8 A;  2EPN A;  1FYK A;  3I4P A;  4IHY A;  1E17 A;  3DBR B;  4UHT A;  5FFZ A;  3KLN A;  4WK8 F;  2HOT A;  2O9X A;  3ZQY A;  2PG4 A;  1EH7 A;  3F8N A;  5L3D A;  1NH3 A;  4HNT A;  3OS2 A;  3I58 A;  2R9R B;  4YL0 A;  2Z99 A;  1T08 B;  5ICE A;  4A3M J;  1B8I B;  3U9J A;  4LG0 A;  1WI9 A;  4NQW B;  5CQE A;  3AG1 C;  4RB0 A;  4C7O A;  1XCV A;  5CVV A;  3K4M A;  5J47 A;  3ZQL A;  3K4K A;  3WTW C;  4R8H A;  1ZRD A;  5KYY B;  1X1B A;  1MBK A;  1PUE E;  1JKO C;  4BJ1 A;  1E83 A;  4OAY A;  2YL0 A;  2ID6 A;  3ABK C;  3B9Q A;  3GF2 A;  1UG2 A;  2O6G E;  5A6K A;  1WAS A;  2W82 A;  2VC1 A;  3AKZ A;  1BI1 A;  3HKZ A;  4BJT A;  1WN0 A;  4ZC3 A;  4N9H A;  2JD3 A;  4JYK A;  2LNB A;  3IP4 B;  5EGO B;  3F23 A;  3RYL A;  4ZYH A;  5K5O A;  2GIZ A;  1IXR C;  4MTE A;  2D1H A;  1U3E M;  2L2O A;  4RA2 A;  2KP6 A;  2R7S A;  1F1M A;  4ULV A;  2VPR A;  4XSX F;  2DYS H;  4EMS A;  3C8G A;  2WY7 Q;  2H1K A;  3ZQQ A;  3ZTM A;  3K9T A;  1F43 A;  4P5O A;  5FRO A;  4DVY P;  2V7F A;  2ZXH A;  1E3O C;  2H8W A;  2B0L A;  1NU7 D;  2F5V A;  4HFF B;  3VM6 A;  5EHH A;  3K2A A;  3ASN C;  3DF8 A;  3S3M A;  1AKH A;  1N1C A;  2YX7 A;  1G5Z A;  3D5R C;  1WCM J;  2HQR A;  3IEE A;  3HNJ A;  2Z33 A;  3KZI C;  3T6J A;  1R36 A;  5LHG A;  4EEF G;  5TJ5 E;  2NS8 A;  3T6G B;  3GWN A;  5TRD A;  1ETK A;  1HXD A;  2R4G A;  1YTY A;  2M0M A;  4YFK F;  2X1D A;  1MMG A;  5E8I A;  3JRB A;  2FQ4 A;  2EPO A;  1BR2 A;  2OOC A;  4E7H A;  1BIB A;  1F1Z A;  2YRF A;  4BKX A;  1UAA A;  1T6U A;  2FJ1 A;  1MND A;  2HXO A;  2VXD A;  3FX3 A;  3NWS A;  2DA7 A;  1QQI A;  3MKW B;  1KQ9 A;  3S3O A;  2MD5 A;  2OUM A;  2IBD A;  2DW4 A;  2OF7 A;  2QTV A;  4XNF A;  1C0W A;  4W97 A;  5AON A;  3OR2 C;  2HYJ A;  4WCG A;  4ONS A;  1XPX A;  4AL1 A;  1V54 H;  3BPX A;  4HQM A;  3DJU B;  4KUM A;  1OCO H;  2AVK A;  1KQ0 A;  3Q3S A;  1B68 A;  3MZY A;  3JTL O;  3J80 Z;  4NC7 A;  5D5V B;  3MEX A;  2VJI A;  3FMS A;  4CHU A;  1HA8 A;  1Q0G A;  1NG6 A;  3DE8 A;  3T5X A;  2VCA A;  1Z3I X;  1L0O C;  3E5Q A;  3GTP J;  3GEH A;  4JTD B;  1VTN C;  4Z9I A;  2O5R A;  1JRA A;  1R4T A;  5LGU A;  3MX3 A;  2WAQ A;  2AS5 F;  1HQC A;  5DD4 A;  3CJN A;  2D5R B;  2Q00 A;  3DD7 A;  2XM4 A;  3BLY A;  5IYC J;  1TWH A;  3HPG A;  2XRH A;  1UHM A;  2JUG A;  2VQH A;  2Y9Y A;  3FXL A;  2VQC A;  4D9J A;  1YIJ I;  1UFM A;  2HDC A;  1A7V A;  2Y3H A;  3H2V A;  5CVR A;  3JRE A;  5FKN A;  2K7L A;  1BJZ A;  2JK3 A;  5JVE A;  1USS A;  4A6D A;  1WH5 A;  1RZ4 A;  2ZSH B;  1VYK A;  4CJG A;  4A3D J;  4FHT A;  3OS0 A;  4DZP A;  2Y3G A;  2X51 A;  4KJZ A;  5J6X A;  4E7L A;  1LE8 A;  1YIO A;  5E3C A;  2PBI A;  5L0J A;  2EV6 A;  2FOW A;  1MGT A;  1O7L A;  3BT9 A;  4AID A;  2Y69 C;  3U8P A;  1K4S A;  1P7J A;  1V55 H;  4U7D A;  1X3W B;  4BXX J;  4AVP A;  4FTH A;  3S0X A;  4UV8 A;  2I5U A;  2AP3 A;  2ZXJ A;  3VWB A;  2J0W A;  2HKO A;  3DPU A;  4L9T A;  3V8K A;  3JRH A;  1U0B B;  2KLO A;  1FFH A;  2OCC C;  3CUO A;  4M3D A;  3ZVR A;  1ORK A;  3BZK A;  1GDT A;  4FAS D;  4YIF A;  5ICC A;  1VQO I;  5LD2 C;  1UHW A;  3NDB B;  2QM3 A;  3HUG B;  3LLI A;  5IY5 C;  3UMH A;  2LY2 A;  4IKF A;  5LEJ A;  4E0H A;  2HV7 A;  2KSF A;  2HV6 A;  3RKQ A;  2L54 A;  3OIQ A;  1MIJ A;  1J7K A;  1CGN A;  4FE4 A;  5H2F C;  3EHM A;  3KEO A;  1NSG B;  2X6O A;  3KET A;  2LFD A;  4XM3 A;  4QPO A;  2L9R A;  4ZDP A;  1G4W R;  1OR2 A;  2GA2 A;  1OQC A;  2IS2 A;  2F4O B;  2JRT A;  1KU7 A;  2B0J A;  2CQX A;  4KN4 X;  1VQM I;  4B6I A;  1E3P A;  2LDU A;  2PMZ A;  4I02 A;  3QOD A;  3GZ5 A;  3FXK A;  3MCZ A;  5M5Y J;  5F04 A;  1TNS A;  2NOG A;  3EG9 A;  4YL3 A;  4AE4 A;  2DK8 A;  3JSE O;  4O79 A;  4BEM J;  2FU4 A;  1LKX A;  3HB9 A;  4RS8 A;  2WZL A;  4AM3 A;  2CNW A;  2HTJ A;  2D5V A;  1Y8Q B;  3O8G A;  4AIJ A;  4HZF A;  3Q5F A;  1TWF J;  4X6A J;  3GYH X;  3C8Z A;  2VUM J;  3DWW A;  5KYN A;  3GVA A;  1QZY A;  2M5W A;  5GAG J;  3H9Q A;  3PIO F;  3OYB A;  3Q7L A;  1JKR C;  3WAQ A;  4ZYG A;  2FEZ A;  3GW2 A;  2GAU A;  4OIR F;  2EZI A;  4PGG A;  1WJA A;  5GPC A;  5EG0 A;  1DU6 A;  2J0X A;  3H9J A;  4KNY A;  1SMT A;  2BHY A;  3I71 A;  4G0H A;  2VJJ A;  2ECB A;  3C7J A;  1A6I A;  1QZX A;  1G3T A;  3G71 I;  5DV5 A;  3JYY A;  3M9A A;  1NK2 P;  3M3Y J;  3NRH A;  2NYX A;  2KQR A;  1OCR C;  3QQA A;  1TWA J;  4HV5 A;  4EQQ A;  1AEP A;  1WTY A;  5FZT A;  4G78 A;  4N6C A;  2E87 A;  5AIP A;  3SFI A;  3HOY J;  4EHP A;  3BG9 A;  1QGP A;  2PFD A;  2DMP A;  3I59 B;  2LYC A;  1SEU A;  3L8J A;  1DPU A;  2JZY A;  1LFB A;  1AU7 A;  4LLE A;  5D4S A;  4EBJ A;  2CDQ A;  2MHR A;  4D4N A;  2OQM A;  2N8G A;  3P5J A;  5A6B A;  5K5R A;  3RQF A;  2QZ8 A;  1HDP A;  2W4S A;  3IC7 A;  3OS1 A;  1VK5 A;  4M71 A;  4G8X A;  1QVT A;  1JI8 A;  3K4B A;  1I4Y A;  3NWT A;  1SFO J;  3FMR A;  1ITY A;  4H54 A;  4DYR A;  3K7D A;  3HOV J;  1FTS A;  4HNV A;  4B1R A;  4FCY A;  1APL C;  2Z1D A;  2IA2 A;  3CMM A;  4P9F A;  2HNH A;  2FRH A;  2W00 A;  4ZLC A;  3Q6M A;  1U5T B;  1XDS A;  1FR0 A;  2DGJ A;  2EZH A;  1IDZ A;  3EFO B;  1IG7 A;  2ICW G;  2AQF A;  2WA0 A;  3BTI A;  3B6C A;  4C30 A;  3N2Z B;  2ZSI B;  2JVG A;  3AG2 H;  3HGG A;  2MBF A;  5FRM A;  4MO7 A;  1JUS A;  1TBX A;  1JUM A;  3HOT A;  1W0U A;  4I2O A;  1B72 B;  3JCU Q;  2LG4 A;  2A6H F;  3CUQ A;  3I5U A;  5EF6 A;  1WI3 A;  1UB9 A;  3M07 A;  4QLC U;  4HYE A;  2XSD C;  1D1C A;  2M4E A;  4CSA C;  3FHN A;  1FMV A;  3PCV A;  4DW6 A;  3TO6 A;  2Y3B A;  4K0D A;  4LG0 B;  2V9V A;  4E18 A;  3OYG A;  2MC3 A;  1M57 C;  3W2A A;  4C7O B;  2R7X A;  4FX4 A;  2XL4 A;  3I55 I;  5M5W J;  5E17 F;  1YX5 A;  2W57 A;  4IWB A;  3W8H A;  1YDI A;  3DTK A;  4YII A;  1GXP A;  2FF4 A;  4LDQ A;  2EJR A;  2GWR A;  1PDN C;  5F6F A;  4FQG A;  3SEQ A;  1RNL A;  4RB2 C;  2L6G A;  1JTY A;  2VI6 A;  3A0B C;  2VOO A;  1IUY A;  1XC5 A;  1EJ9 A;  2XF6 A;  4XEV A;  4M6Y A;  2CQQ A;  1N75 A;  5E79 C;  3NMK A;  3GEZ A;  3LLK A;  1RXQ A;  2MYS A;  1D3Y A;  3MFK A;  1C03 A;  3BG7 A;  2CYD A;  1BL0 A;  1G4D A;  4BUP A;  2IGM A;  1QPU A;  3OYI A;  2RGV A;  1MZB A;  2LC2 A;  3KYC B;  1OYI A;  2V1N A;  5ED4 A;  3E5X A;  2GOM A;  3LA7 A;  3HEF A;  2IS6 A;  1RPW A;  5BNG A;  1G4U S;  1IO2 A;  4EIY A;  2ACJ A;  2IRF G;  2Y3D A;  4L9N A;  4NDL A;  4KFC A;  4ZZD A;  2P0W A;  1YRN B;  1K83 J;  2XAH A;  1AKH B;  2KK1 A;  2XPU A;  1NBB A;  4A0Z A;  5CVI A;  2XGD A;  4IX7 A;  3I54 A;  4M3F A;  2LP0 A;  3RPU A;  1BI0 A;  2VJ5 A;  3PSF A;  2VE8 A;  1TQP A;  2JTV A;  3I9V 2;  1JKP C;  1KQ8 A;  1BN5 A;  4IQJ A;  2Z3Y A;  3DTI A;  4DYQ A;  5DM6 F;  2RQP A;  1YS6 A;  2V9K A;  2UXN A;  3BTC A;  3ZQC A;  4JUR I;  2STW A;  5ICF A;  2PMU A;  2CUZ A;  3KP2 A;  2EFW A;  2WVQ A;  3V7R A;  2EPM X;  2DAO A;  5KYU A;  2DA5 A;  1F36 A;  1VQ7 I;  2XLM A;  1MMD A;  2OPT A;  1GUU A;  2ZNY A;  1XB4 A;  5DQT A;  1OXK A;  1ZRF A;  2RVC A;  4ABZ A;  1V4R A;  3DXJ F;  2RC4 A;  2VON A;  1SMY F;  2NVT J;  5D91 A;  1BI2 A;  5IOY A;  1XN7 A;  3VB2 A;  4LIU A;  1TR2 A;  1ZHF A;  3DPT A;  3H0G J;  4HF0 A;  2KYH A;  3TP3 A;  4CJO A;  4BEH A;  4J00 A;  2ZXP A;  3JZ0 A;  2E7X A;  1LJ9 A;  3E9V A;  3BTL A;  3ZCO A;  1SD6 A;  2R7Z J;  1M6T A;  1HF0 A;  3VYW A;  4EV0 A;  1E0E A;  3S1R J;  5GTH C;  4DNC A;  3QTH A;  4Y7N J;  1Q0D A;  1S7O A;  3OYN A;  2RNJ A;  2OEV A;  4K7B A;  1LS1 A;  3GX4 X;  4CCK A;  5COF A;  1OCC C;  1YA9 A;  3K1H A;  3GFJ A;  3PUB A;  1YOV B;  2Y75 A;  3TK0 A;  3S93 A;  4ENN A;  4CS8 C;  3WHN A;  1EH6 A;  2OQG A;  4BNC A;  4DBQ A;  2DQR A;  1LE8 B;  4G7O F;  3K1M A;  3SXM A;  2M1B A;  2KC3 A;  1Q1H A;  2NUT A;  3WG7 C;  2VQG A;  1ZU4 A;  5JHF A;  2XXA A;  3J7A Y;  4ZDO A;  3SXY A;  3UNG C;  2W9Y A;  4BJ5 C;  4C2T A;  3RTR A;  2HOA A;  4F55 A;  1X3U A;  5B3I A;  5E1W A;  1R4M B;  4HNU A;  5JS5 A;  3K1P A;  2R7D A;  2YL3 A;  2HVQ A;  2YLG A;  1P9Q C;  1BW5 A;  4RBO A;  4N9I A;  5CYV A;  2LK4 A;  4CGZ A;  5EK0 A;  1EA8 A;  4UUT A;  5GTI C;  5L3B A;  1JMW A;  2BY1 A;  2LH9 A;  5L0D A;  1WWX A;  3RI4 A;  3CF5 F;  3RKX A;  1OR7 C;  2R5Z A;  2CW7 A;  4OWR B;  3TOM A;  2AWC A;  3LSJ A;  2ZME B;  3WGH A;  5BMZ A;  2YHS A;  1Z7Q c;  1R5G A;  3DEE A;  1N25 A;  3C1D A;  3FDQ A;  2VJ4 A;  3BZ6 A;  4PK4 A;  5LBQ A;  1B6A A;  2WC2 A;  1SAN A;  1G3Y A;  2CUF A;  3ECH A;  5TIS C;  4NB5 A;  3SEZ A;  3SHF A;  2PNO A;  4KNW A;  3AFH A;  2HZD A;  3RQG A;  1M2V A;  3CUQ C;  1RKT A;  2MLG A;  3H5N A;  4F52 A;  1QBJ A;  1ACI A;  2R02 A;  2EBI A;  3WE2 A;  1J59 A;  3NG1 A;  5J40 A;  1W36 D;  3BP8 A;  4ETS A;  4S0H B;  5H6R A;  1D1A A;  2YQY A;  3GWL A;  3LSG A;  5LGN A;  4E4H A;  1LIH A;  4AE4 B;  3FXO A;  3OEO A;  2P6S A;  3FIS A;  3EJN A;  3WTZ A;  3MLG A;  1RMV A;  3KYJ A;  3HG9 A;  2K3P A;  1QQ3 A;  4M9S A;  3JRG A;  4H0E A;  1WGX A;  4JC7 A;  1FOX A;  3RVZ A;  1OW6 A;  3AQB A;  4U5C E;  2AO9 A;  3QWL A;  3HBL A;  4E6K G;  4QWQ A;  2QQA A;  5FKK A;  2RD9 A;  2OG2 A;  1E84 A;  3B0U X;  3K1N A;  3CES A;  1CGM E;  3K69 A;  5HLT A;  3HSF A;  3WTU C;  3TL4 X;  4G7H F;  1JXS A;  1L3P A;  2NG1 A;  5L3C A;  4HLY A;  2H94 A;  5EG0 B;  2IYL D;  3I5Q A;  2PEX A;  2E1O A;  1X3Z B;  3RIR A;  1KZH A;  3IH3 A;  1JOG A;  3CDI A;  4E7K A;  3FIW A;  1ZR2 A;  1Q0K A;  1OR3 A;  3E97 A;  1RI7 A;  4XRM A;  2DDA A;  3CJT B;  3A01 A;  2YEV A;  2HPI A;  3V8L A;  2HGC A;  4UB8 C;  2QQ8 A;  2ZKZ A;  4U5E E;  5K5Q A;  2JWT A;  4PAC A;  1S6L A;  3OIP A;  1LS4 A;  3ATP A;  5TGT A;  4U5B E;  3HRT A;  2L4M A;  4AUX A;  3ONQ A;  4C2M J;  2MH9 A;  4IHW A;  4MVZ A;  4EKW A;  1MD0 A;  2BY2 A;  4X0G A;  4E7I A;  3K1I A;  1U0J A;  1IGN A;  2J9W A;  1X1D A;  2K86 A;  3MMY B;  2XLD A;  3W8I A;  3PIP F;  3N4M A;  1Z1D A;  4WJ0 A;  3HRM A;  1VYI A;  1I3A A;  4AYB A;  2Z2S B;  5K0I A;  2DT5 A;  1GM5 A;  3B73 A;  2JUC A;  3DBL B;  1X58 A;  1P6R A;  1U89 A;  3KL4 A;  4MEX F;  1I5N A;  3GAN A;  3G1L A;  2XF7 A;  1O5H A;  3ZQH A;  4AIH A;  1EF4 A;  2XLO A;  5DVW A;  1D0Z A;  5AIQ A;  2Q9A A;  2Q9B A;  4CS7 A;  4FX0 A;  2LRE A;  3K70 D;  1Y8R B;  4CYD A;  1Z6T A;  2Q7R A;  3VAY A;  3X2Q H;  5KAF C;  2P7V A;  2QSF X;  4D5F A;  1HKS A;  3B71 A;  5A6A A;  2K9M A;  5FRN A;  2RKH A;  1VMA A;  5IT9 Z;  3EGX A;  3FAJ A;  1YFH A;  3NMI A;  2HFH A;  3I56 I;  1NK3 P;  1FY7 A;  2A3S A;  3HC7 A;  4BXF A;  4CX9 A;  4IVN A;  5JLX A;  2BGC A;  3GTK J;  3DKA A;  1W5S A;  4GO1 A;  4DIQ A;  3TMO A;  4RAZ A;  4CH7 A;  1XS9 A;  4ESF A;  4YJW A;  4IHX A;  4E70 A;  1ETX A;  1RET A;  2MSY A;  2XV4 S;  4R79 A;  1SD5 A;  5ILV A;  4Q4Z F;  4XLA A;  3W6V A;  2VOP A;  1X1P A;  1OLT A;  3LEO A;  1E86 A;  3BR3 A;  3RQI A;  3S2H J;  1OKR A;  2EK5 A;  1QHH D;  1ZAO A;  4G6D A;  4GYI A;  4N06 A;  4DOZ A;  3SP1 A;  5BQG A;  1WQ2 A;  1R5I D;  4OIN F;  2O7O A;  5HLI A;  2X48 A;  3CME I;  2G9W A;  1SVO A;  3I4U A;  2HZT A;  2ME6 A;  1EI7 A;  4HBL A;  2LOO A;  2P5K A;  5BQH A;  2EIM C;  4B44 A;  5T3T A;  4XRS A;  1MNM C;  1Z3Y A;  4MND A;  2XAJ A;  3NYM A;  3CDL A;  3RYR A;  1XMA A;  1S3J A;  3KP7 A;  4XLH A;  2JA2 A;  4UY8 I;  3DP7 A;  3G6E I;  1L7C A;  1R58 A;  3S14 J;  3F46 A;  4QIW N;  5L0H A;  4YG2 F;  3CZ6 A;  3L09 A;  4GQH A;  4CUG A;  4DRH B;  3L0I A;  4WAB A;  1YJW I;  3KYI A;  5CI8 A;  3CCV I;  3P7N A;  1XSD A;  2RDP A;  3T8T A;  2ZJP F;  1H89 C;  2IT0 A;  2EA2 A;  5L3E A;  2J5P A;  5EJC A;  1W4M A;  2WB1 N;  4XOT A;  3U21 A;  2E5N A;  5GPA A;  2JMW A;  1RRJ A;  2QYO A;  1MSF C;  3T4R A;  4ZLD A;  2QKL B;  4I3M A;  2XL6 A;  1OKK A;  1HMD A;  2ZXW C;  1VLS A;  2P4W A;  4IF4 A;  2UXX A;  5B3S H;  3VYS B;  2FNA A;  2IW5 A;  1PD1 A;  1OMI A;  2LCH A;  3U3F A;  2JRM A;  2E19 A;  4UUV A;  3GTO J;  3AGT A;  3TW7 A;  2ETH A;  1XGO A;  4HX7 A;  2O61 A;  1SR2 A;  1KA8 A;  2J5O A;  1R5H A;  3AG1 H;  3SJM A;  2O8K A;  2CUE A;  4DXW A;  3FDY A;  2IEK A;  3OOU A;  3PNT A;  3RW0 A;  2EPF A;  2UZK A;  2LFB A;  3F6V A;  1T33 A;  3QYF A;  4RDA A;  5KYU B;  3WGI A;  2R5Y A;  4E0I A;  3BOQ A;  3CLQ A;  3ZGK A;  1IUF A;  2IA1 A;  2CG4 A;  5EEG A;  1IV6 A;  3EHN A;  2DN0 A;  4YK5 A;  2YS9 A;  2XPV A;  3QU3 A;  1H8A C;  2ZB9 A;  4LG3 A;  4HEA J;  5JFR A;  5JP7 A;  4E17 A;  1S72 I;  1NG7 A;  1BBH A;  1PYV A;  1XSX A;  5E3O A;  2VAS A;  3TOB A;  2HWV A;  3ZQF A;  1H9T A;  5L3V A;  2BW3 A;  1XZP A;  4BEH B;  2OCE A;  1Z7L A;  4EBB A;  3C62 A;  5ILU A;  2ELH A;  3FK7 A;  4PGH A;  3PJR A;  4RB3 C;  2QBY B;  2P0N A;  2H7V C;  2YU3 A;  4Y17 A;  3ASN H;  2MD0 A;  4FT8 A;  1YYX A;  2OEX A;  2BY3 A;  2GQQ A;  5COG A;  4E7S A;  3RZO J;  3QAH A;  3QVY A;  4IQ4 A;  5D8L B;  4F3Q A;  3MZ8 A;  2LKP A;  1FP1 D;  3CJQ B;  3KFW X;  4OU0 A;  3LA2 A;  1TWC A;  3HNK A;  3E6D A;  3O55 A;  3GM3 A;  4XLP F;  4JIO A;  3E1S A;  3QPL A;  3BEH A;  1BI3 A;  1B72 A;  3U8V A;  3DTE A;  3N0T A;  2A61 A;  3WTY C;  5E3N A;  2RN7 A;  4EM1 A;  4S05 A;  2L0K A;  5B3S C;  2M9H A;  3LQQ A;  3JYH A;  1X1C A;  3J7Z I;  2V6C A;  2RRE A;  1FOK A;  2NUT B;  2K4B A;  5C4X J;  3MKZ A;  1OJL A;  3LL7 A;  2QA4 I;  1WJB A;  2B0H A;  4J7T A;  2HVR A;  2VB6 A;  2XXA B;  2XHK A;  3DMD A;  3OIO A;  5FLX Z;  3WHC A;  2YKZ A;  3LNM B;  3C2B A;  3BR0 A;  2LTP A;  2AQE A;  3GFM A;  2GWW A;  3K2Z A;  1JAF A;  3C2G A;  4HRI A;  3CCR I;  3PO3 J;  3HLZ A;  4YEJ A;  4IRU A;  4CZZ A;  3K7A J;  4XK4 A;  4C3J J;  4ZYD A;  5K7Z A;  4XN0 A;  2GAQ A;  3JAM Z;  3RJP A;  5B1A C;  4XBF A;  2CGE A;  4BE1 A;  2R5Z B;  4B8X A;  1YZC A;  3S2W A;  4L9V A;  4BH9 A;  2G3K A;  3SNH A;  3HKK A;  2BHZ A;  3IWZ A;  4G7Z F;  1MMS A;  3A0H C;  1M2V B;  2ECC A;  4RGR A;  3L2C A;  3T1B A;  1B59 A;  4NCQ A;  2Z5U A;  2XF5 A;  3RQE A;  4IRH A;  1KU3 A;  1YA7 O;  4XQF A;  2IXM A;  3K66 A;  3PNY A;  5L0F A;  2XDV A;  1ZHX A;  2L3D A;  4EGZ A;  1I5Z A;  3DFG A;  1FZP B;  4G6T B;  1YRN A;  1W2W A;  3JRD A;  1A04 A;  2A5W A;  2KL4 A;  2Y69 H;  2JN6 A;  1ERD A;  3OYE A;  4CBE A;  1IW7 F;  2M30 A;  5E18 F;  1TC3 C;  1F5T A;  1OYY A;  1V5E A;  2CQN A;  2X6Y A;  2H6C A;  3R61 A;  3OYK A;  2GFH A;  5HOD A;  2Q0O A;  3BZC A;  1ZHZ A;  3VYR B;  5KCM A;  2I15 A;  1Z67 A;  4R32 A;  2OCC H;  1VLT A;  2KKO A;  2QEX I;  3T0Y A;  4QSH A;  4WWC A;  1ENH A;  1JHF A;  1TWG A;  4JEB A;  4IAR A;  4YT2 A;  3S32 A;  3IUO A;  1RKC A;  4LK0 F;  4PUS A;  1BJA A;  2OZ6 A;  3A01 B;  2MA3 A;  5IY5 H;  3DCF A;  4AL0 A;  3SZT A;  1B9N A;  3QP6 A;  3S8P A;  4Z6Y A;  2NSF A;  2JA6 J;  3TJ6 A;  3HXL A;  4LER A;  4BQO A;  3LWF A;  1FLI A;  4I6Z A;  1OW8 A;  3DU5 A;  4RDU A;  3KP3 A;  2A1D D;  4PJM A;  5F0F A;  4BDY A;  3O8H A;  1MBG A;  1WJ5 A;  2DOE A;  3H5A A;  3NMJ A;  3K4N A;  3DAF A;  4QI2 A;  1R4N B;  5FKO A;  1SYQ A;  3NYL A;  4EWC A;  1FT9 A;  1AWC A;  2EA4 A;  2YWA A;  1XTA A;  4BS9 A;  3S1M J;  5HNF A;  1XWJ A;  3N97 A;  2P8T A;  1YS7 A;  3S15 J;  4GXO A;  4EJO A;  5HDG A;  1W5C C;  2FNP A;  2W7N A;  2KRC A;  1SD4 A;  3K10 A;  1J0R A;  1BBY A;  3DLA A;  4ZJZ A;  1KGS A;  1D5V A;  1GQA A;  1QSP A;  3EYY A;  3CC2 I;  1U6H A;  2J9B A;  1K6O A;  1RUO A;  4QPQ A;  3MWM A;  1WOL A;  1RJ9 A;  4HF2 A;  2X0C A;  2P7V B;  4P9U A;  2E1C A;  4A12 A;  1CPQ A;  2B7E A;  3H35 A;  3BPV A;  3FAP B;  2VKV A;  3KZY A;  1VQ5 I;  3SFZ A;  2L9V A;  1TQM A;  3EGX B;  3MD2 A;  1WH7 A;  1MBH A;  4N4O B;  4I44 A;  2IM8 A;  5JT4 A;  1HW5 A;  1D1B A;  3BG5 A;  2GOX B;  3BDD A;  2CGP A;  5B1B H;  1OCR H;  2GLO A;  4OIO F;  4GDF A;  1ON1 A;  1A31 A;  3JCU C;  5HDK A;  4MTF A;  1Z9C A;  3L2Q A;  4BJ6 C;  4K1O A;  1JT0 A;  2KZV A;  5F64 A;  4M72 A;  4IEJ A;  3W2V A;  2C03 A;  2LSO A;  5F0H A;  2OKU A;  4KIC A;  1T9K A;  3EQL F;  5IOZ A;  3O39 A;  1U5T C;  4Y52 J;  1Y56 A;  2HU9 A;  2ZME A;  3QP5 A;  3V7S A;  5A2Q Z;  4YRV A;  4A3L J;  2DA1 A;  2NRA C;  5CIV A;  1JUP A;  5E3A A;  1IN4 A;  5E8G A;  3ZC4 A;  1ORY A;  5C3E J;  3DI5 A;  3CEX A;  2CYY A;  4NTB A;  1R1V A;  4RLQ A;  2DPU A;  1TKN A;  3DQV C;  4DZJ A;  4RB1 A;  3HRU A;  3WU0 A;  3AGU A;  5JRA A;  3H1C A;  5F08 A;  3WG9 A;  3ABU A;  1SAU A;  3DKY A;  4O5V A;  4WX9 A;  2IVM A;  4N6H A;  3U2L A;  2CO5 A;  2DFH A;  3IAM 2;  5KVR A;  3HL2 A;  2OD5 A;  2AXL A;  1Y1W J;  3BG3 A;  4HDV A;  2DA3 A;  2VN2 A;  3ERM A;  2OJQ A;  2NOJ B;  3G1O A;  3PO2 J;  5J4Y A;  4GYT A;  1YW9 A;  3SZR A;  3BTJ A;  3OOP A;  1R22 A;  4C3I J;  3LS1 A;  3M4B A;  3OSG A;  3LAY A;  1BA5 A;  1C02 A;  2HZ8 A;  1U9N A;  3ABL C;  1JJ8 C;  3LOC A;  3K6G A;  3OV8 A;  2J45 A;  5FJ8 J;  3QRF F;  2CFX A;  2VC9 A;  1YAR O;  4LLC A;  1QVU A;  5LEK A;  3HOS A;  3CMA I;  4CIH A;  3T8R A;  5BS6 A;  1PD0 A;  4RD9 A;  4A2N B;  2VT3 A;  1SFU A;  1T38 A;  3C63 A;  1E2X A;  3DKW A;  4OOI A;  3IRQ A;  3JRI A;  4KIS A;  3K0L A;  1U8B A;  1QLE C;  1OQY A;  3W6J B;  2VCB A;  2IGO A;  4HEA 2;  2L9J A;  1TFK B;  3R6S A;  5B1B C;  3HZJ A;  3OL3 A;  1CQT A;  5B5E C;  3MQ0 A;  2D1V A;  3QOP A;  4KIB A;  3I64 A;  4MGR A;  3TOL A;  1QA6 A;  2FD5 A;  1PCX A;  1ZHW A;  3FOO A;  3K6B A;  1IXC A;  3H5R A;  3D0S A;  1HE1 A;  4NC3 A;  1D0Y A;  1W1W E;  1R1U A;  1W5T A;  1BR4 A;  2C04 A;  2GXA A;  2EFN A;  2ISY A;  2ZXI A;  1SFX A;  3M8J A;  3G1M A;  2R5Y B;  2MGQ A;  3BJA A;  1P7I A;  3QZC A;  3IQC A;  4BG0 A;  4UDV A;  1QHG A;  1KNY A;  3V42 A;  3E6M A;  1UEL B;  2CW0 F;  1N78 A;  1YI2 I;  4O6Y A;  5J4V A;  5D6E A;  3OR1 C;  5LRS A;  3JTG A;  4JK1 X;  1KYW A;  3EPZ A;  1G3S A;  2LY9 A;  1XGM A;  1YAU O;  5J1U A;  2VL8 A;  4M9X A;  1A7D A;  2AU5 A;  1U6G A;  2BW3 B;  1LUJ B;  2OAZ A;  2WV1 A;  3E7L A;  4F7Z A;  3L1P A;  2K9S A;  2OV7 A;  1S5L C;  1M2O A;  3IQ6 A;  4U0W A;  3KYL A;  2M4G A;  3E3V A;  2VXZ A;  3VSK A;  5D5W B;  2AHQ A;  2IP2 A;  5F27 A;  2L4A A;  3BQZ A;  3MYF A;  2M4K A;  3DU6 A;  4UVB A;  2WVN A;  4CCM A;  3ECS A;  2WAE A;  1IRX A;  2JVH A;  2XB0 X;  3GTJ J;  1APC A;  2CSO A;  2FMY A;  3S2D J;  5F5F A;  4JJF A;  2DA6 A;  2KFD A;  3HDD A;  1WZ2 A;  2G7H A;  2P7C B;  1D8J A;  2XAF A;  3RKY A;  1ONV A;  4KC9 A;  2VQL A;  4XLC A;  4A5N A;  4EJV A;  2E2I J;  1A6Q A;  2FAP B;  3JRA A;  4JW1 A;  2ZJQ F;  1E85 A;  1TZL A;  4XR6 A;  3Q9V A;  2EFO A;  4CCL A;  4MLO A;  1MW7 A;  2R7R A;  3E6C C;  3PFY A;  1NG1 A;  2DA4 A;  1FWZ A;  4JE9 A;  4JTC B;  1I4Z A;  1JT6 A;  1X2N A;  1FTZ A;  4IAQ A;  4O7G A;  4O6J A;  2IA0 A;  4LB5 A;  5CVU A;  4HX4 A;  1A41 A;  4HE8 D;  2LK2 A;  3KCC A;  1IN7 A;  3NAR A;  3I3L A;  4KN7 X;  4FIS A;  1R23 A;  4OMZ A;  2F5C A;  2NAZ A;  2HTS A;  4AWX B;  4A3F J;  1HE9 A;  2QLA A;  3V8J A;  1I39 A;  1QZE A;  3F8M A;  1LDK B;  5HNH A;  1R49 A;  2EV0 A;  3E0J B;  1U78 A;  2PMH A;  2Y0M A;  4AVZ A;  3DJN B;  3M4C A;  2KJB A;  2XAG A;  1Z3X A;  3KEQ A;  3GTL J;  4FAP B;  5DQZ A;  1LDJ A;  5D4R A;  3R2P A;  1V4A A;  1GVD A;  2YUS A;  1ZKG A;  2STT A;  4L9J A;  4N0B A;  2K9Q A;  4RAF A;  1LB2 A;  4YT4 A;  5E1Z B;  2ZXR A;  4I76 A;  3H3U A;  3OA1 A;  3CAX A;  2IOQ A;  4YL1 A;  2MFZ A;  2IXS A;  3ULQ B;  3OYJ A;  4OD4 A;  1KYZ A;  3DLL F;  3PHF 2;  5CKT A;  4ZYE A;  3AG4 H;  1Z23 A;  2CV1 A;  3HOX J;  1OCC H;  2HYG D;  3KEY A;  2VCC A;  1NU9 C;  1MMN A;  3Q0W A;  4UUS A;  2HQ5 A;  3FZV A;  1O3S A;  3CQZ A;  2Z15 A;  1X19 A;  2DCE A;  3RSN A;  3IHU A;  2IGN A;  2L9S A;  1WJE A;  2ELJ A;  1CF7 A;  2XPW A;  2H1L A;  2DMQ A;  5DCF A;  3WG7 H;  2DYR H;  3LQR A;  1ZR4 A;  1XDU A;  1U8R A;  3GTQ J;  2A07 F;  1I1S A;  1EH8 A;  2LRD A;  1ETQ A;  3N05 A;  2Q8K A;  2D45 A;  2QQB A;  5JLW A;  1DOW A;  2FBK A;  3ASO C;  1IRF A;  1YLF A;  3H65 A;  3L00 A;  4BHB A;  3TED A;  2WL8 A;  1Z6A A;  3RCO A;  4DVZ A;  1NFO A;  1FJL A;  3JSZ A;  4YWQ A;  3KYD B;  3OWT A;  1VTM P;  4IRI A;  1K6Y A;  4MTD A;  1M56 C;  4MVR A;  2E71 A;  4XWJ A;  4M3B A;  1RKE A;  1I50 J;  3FXM A;  1JGS A;  2IS4 A;  3NKE A;  3CP2 A;  3KIO A;  1TWH J;  3BG6 A;  4PJ0 C;  1K05 A;  2M8E A;  3IAS 2;  5BUO A;  3M1E A;  5JSL A;  1P92 A;  2ADU A;  2F2E A;  4EJU A;  4NY3 A;  3WGG A;  5E2Q A;  4M6X A;  2FQ3 A;  4NUB A;  1Y4C A;  1HLV A;  2JPB A;  2DOA A;  2Q1Z B;  4MNU A;  2GZW A;  3UR3 C;  4BBR J;  5HOO A;  3KZZ A;  1F4K A;  4KIF A;  4YIR X;  2YPR A;  2DK5 A;  2COB A;  2QBY A;  4CCN A;  2CQ7 A;  2DA2 A;  3DBH B;  1S8N A;  2DMU A;  3CC7 I;  4LJZ F;  5L3G A;  3F8C A;  2E1M B;  2KJC A;  1TLH B;  1JPJ A;  2G7U A;  5F5H A;  1XD7 A;  4A0Y A;  4U5G A;  3AG4 C;  2FML A;  4E7J A;  3RIP A;  1Z91 A;  3VPR A;  2NNN A;  3L7W A;  3EUH A;  3VFZ A;  3ZMU A;  3IV5 A;  1ZG3 A;  1PUF A;  4BXU A;  1AUE A;  3FF5 A;  4GGG A;  1T0F A;  2ZXO A;  2FA5 A;  2EIK C;  2E35 A;  1RJ9 B;  2IS1 A;  2XS8 A;  2W85 A;  4J7Y A;  1WJC A;  3W3C A;  2P81 A;  3Q6N A;  4XMY A;  3JR9 A;  2P1A A;  5EEA A;  3GTM J;  3ZMV A;  2FBH A;  1OCT C;  4GYG A;  2DYR C;  2L81 A;  3FKI J;  2XB5 A;  2ZCW A;  4CDG A;  1GLN A;  1MJB A;  2VT2 A;  4I7H A;  3ZRG A;  2R7W A;  2VLA A;  3CCM I;  3GCM A;  3GO5 A;  1YIT I;  3ISP A;  1EA3 A;  4A6E A;  4MEY F;  3J7A O;  2O3F A;  1TW3 A;  2QSH X;  5M3M J;  3VYT B;  4XKC A;  3OYL A;  3AL0 B;  2OC6 A;  1RC9 A;  3TUL A;  1VFC A;  2ZC2 A;  2P61 A;  1RIO H;  1J8Y F;  2HKV A;  5GAE J;  2KT0 A;  1T01 A;  2LFF A;  3ROU A;  3GTG J;  3RKO F;  1QVX A;  5CJ9 A;  1Z7U A;  4HW0 A;  4CA0 A;  4PSX A;  4M74 A;  3J80 K;  1DP7 P;  2IPQ X;  1R1T A;  2CV2 A;  2PX3 A;  1TP4 A;  2CMP A;  2JSC A;  2EZK A;  1ZW2 A;  3B29 A;  1ZYR F;  3GZN B;  2ZFU A;  4LIV A;  3H3V K;  1VI0 A;  1ZHY A;  2IXP A;  2QLZ A;  4MTO A;  3V5Y A;  1OCZ C;  4ER9 A;  2EFP A;  2PF4 E;  1ZH5 A;  4XEK A;  2K4J A;  3GME A;  3HKZ N;  3OYC A;  2LSE A;  3S84 A;  3H3Z A;  4JVS A;  3LA3 A;  1ZK8 A;  5CLS A;  3VRC A;  1A36 A;  3ZQI A;  3ZG1 A;  3U0C A;  3EPV A;  2E7W A;  3ZQG A;  5K7F A;  3V4G A;  4L18 B;  3A9C A;  3TKY A;  2KZG A;  1UMQ A;  4EM2 A;  1BIA A;  4F93 B;  2D4U A;  3SXZ A;  2E36 A;  2V6E A;  3VOD A;  2Z16 A;  2M2E A;  2A05 A;  4ANJ A;  4EM0 B;  1O4X A;  2K02 A;  3J7Y J;  2B63 J;  3HTK C;  2JA7 J;  4HFK B;  3IQ5 A;  1K78 A;  4FES A;  3G3Z A;  2PP4 A;  1G8X A;  1Y1V J;  2JQ7 A;  2UUH A;  2GBY A;  1VOM A;  2LD5 A;  3DM9 B;  2BL2 A;  3D5L A;  3CCE I;  4WGZ A;  4XON A;  5HS9 A;  3S9O A;  3ECO A;  3ABT A;  4I01 A;  4MVO A;  2EWN A;  3KP5 A;  4PCQ A;  2R7O A;  3IRR A;  1G59 A;  1Q0M A;  1X1A A;  4LFU A;  2DPD A;  1HY5 A;  2Q2E A;  1PP8 F;  3K4L A;  4IOA F;  1J2X A;  1MBE A;  1HST A;  4PJN A;  3ZMT A;  1FSH A;  4L5I A;  2F5F A;  2EIM H;  4D0P A;  2L02 A;  2YVK A;  1JHH A;  1R00 A;  1S7E A;  1Y0N A;  4AC0 A;  2XUB A;  2UWM A;  2M34 A;  4JQF A;  4E7Z A;  4A3J J;  1TL8 A;  2NS7 A;  2BY0 A;  3FBI B;  4NTF A;  5HLH A;  3QU6 A;  3QYB A;  4WGY A;  2XRL A;  5FLM J;  4A5M A;  1WFX A;  1UCR A;  1V3F A;  4JKV A;  1A7E A;  1YLM A;  1YW7 A;  2OA4 A;  3ZMD A;  5KYW A;  2B9S A;  3M7G A;  3HRS A;  5C44 J;  2W4M A;  3ESW B;  4KA4 A;  2HEO A;  3WTS C;  3CC4 I;  2VC0 A;  1WJD A;  2WAQ N;  4CS9 A;  3HJC A;  2XKP A;  4JP0 A;  4A3K J;  1IRG A;  5E3L A;  3F8F A;  2QSG X;  256B A;  3AG3 C;  2DT6 A;  4ESB A;  2LR8 A;  4G6Q A;  4LIT A;  3S90 A;  2M64 A;  3VSL A;  2W25 A;  1MBJ A;  1FBU A;  2ZXW H;  1POG A;  1Y6I A;  1G3W A;  3H36 A;  1PVE A;  3L9F A;  2UUZ A;  5D5X B;  3R0J A;  4IL6 C;  1LQ1 A;  2KNH A;  1KTM A;  2YL7 A;  3IH4 A;  1EKE A;  1IAW A;  4XPY A;  1H88 C;  1O7F A;  1HDD C;  3VOE A;  3U5S A;  3I53 A;  1XSV A;  3CTA A;  2QE9 A;  4P6I C;  3ZP5 A;  1LPQ A;  3ZQV A;  3QOE A;  3WE3 A;  3LAP A;  4D1Q A;  4B3A A;  3ITF A;  3A02 A;  3LFU A;  3J81 K;  4CO8 A;  2J9V A;  3FOP A;  1LVK A;  3EYI A;  4V19 K;  3UMI A;  3BR5 A;  4U87 A;  4BE0 A;  3GWZ A;  3RF3 A;  3EUH C;  1AHD P;  4BEJ A;  2AXT C;  3FXR A;  2JA5 J;  2EIN C;  2A69 F;  4IOC F;  3IKV A;  2MC4 A;  4EBK A;  1BZ4 A;  5FO5 A;  2GIV A;  2EPL X;  4PR9 A;  4YFX F;  2X1C A;  3PL8 A;  3QYE A;  4LLG F;  2Y0S A;  5F1J A;  2EIL C;  1QZZ A;  3MAJ A;  2XLH A;  3F6O A;  1V5G A;  3EET A;  1YJ9 I;  1MSE C;  2R7F A;  4J30 B;  1WSU A;  4JCH A;  5F28 E;  1Z77 A;  1UST A;  2W48 A;  5FGM A;  3P9C A;  3QW1 A;  1RUN A;  1B1B A;  2UUI A;  3ZPL A;  3E70 C;  4PZJ A;  3Q0U A;  1MH4 A;  4ITV A;  3JRC A;  2X4H A;  4ULW A;  2HS5 A;  4P96 A;  2ASR A;  4JEA A;  3T6B A;  2QQ9 A;  2ID3 A;  1EQ1 A;  1H0M A;  4DQ2 A;  5A6J A;  4YT8 A;  2PMZ N;  1ZVZ A;  1ETY A;  4EJT A;  1LEA A;  1RR8 C;  5L0G A;  2GA0 A;  1YZA A;  3G50 A;  1ULY A;  4UUS B;  5FCL A;  4L6R A;  2J7P D;  2L7M P;  3OMY A;  2NSG A;  4LB6 B;  3AJM A;  2PBE A;  4PJJ A;  5DS9 A;  3U9G A;  2HDW A;  5FLV A;  2XLW A;  2ESN A;  3UKG A;  1E3H A;  4D5C A;  1K7A A;  3WU1 B;  1K61 A;  3DZA A;  1CF7 B;  2OTL I;  4ZYA A;  3BR6 A;  3R0A A;  2DQL A;  2R3S A;  3ZN1 A;  2ZPA A;  3LEV A;  2XL8 A;  3HHG A;  3CCY A;  2RSE B;  4II2 A;  1XMX A;  2BVM A;  3OL4 A;  3G4S I;  1MDM A;  1GXQ A;  2GXB A;  2QUP A;  3QVZ A;  4JOM A;  3SQN A;  3DV8 A;  2EIJ H;  4II3 A;  2YLD A;  3HNI A;  2EZL A;  4CCJ A;  1N77 A;  3TP0 A;  1VQ4 I;  2R7Q A;  4G12 A;  1RKE B;  2QF7 A;  2O0Y A;  3RDI A;  4C3E A;  4DRJ B;  2ME0 A;  4V2G A;  1FIA A;  2HR3 A;  1P2F A;  2XSE A;  5AC4 A;  3LST A;  1R9T J;  5DUK A;  5B1A H;  4I1O B;  4ZTJ A;  4LAC B;  4U5H A;  1ETV A;  1WRJ A;  5D8K B;  4MIM A;  2Y9Z A;  3LAJ A;  5JLI A;  5KYX A;  3POV A;  3LSM A;  3ZSU A;  2WAF A;  1Z21 A;  1LPE A;  3HSE A;  1JKQ C;  5CI9 A;  4YEL A;  3HGY A;  1WKM A;  2KGO A;  3M1C A;  4EJW A;  4NNJ A;  2RNG A;  5JI6 A;  1CPR A;  2W1O A;  1AVO B;  3SEO A;  3VF0 A;  3ZDL A;  1BR1 A;  2CH0 A;  5COM A;  5DS4 A;  5L3F A;  1I3Q J;  1J5Y A;  4FWV A;  2YR2 A;  1T98 A;  4Z9H A;  1YQA A;  4LD5 A;  1FSE A;  3S1N J;  1T6I A;  5D5U B;  3A4C A;  1XMK A;  3R4K A;  1TWA A;  4WXC A;  2CUJ A;  2HMZ A;  2HXI A;  2LLK A;  5FKM A;  3MKL A;  3K1I C;  1XGN A;  2QGU A;  2X6X A;  4RM2 A;  5FB2 A;  1FIP A;  5F0C A;  1PUF B;  4CDA A;  3ZIB A;  4HV6 A;  4PJL A;  3OY9 A;  3EUA A;  3V5X A;  4HLX A;  2IAI A;  5EGY A;  3ELK A;  5IYB J;  3LUT B;  4HQE A;  3DAG A;  3I0T A;  2W4B A;  3CDH A;  2R92 J;  3RH3 A;  1FMW A;  2EQR A;  2LBF A;  5LRR A;  2LIG A;  4U9E A;  5HS7 A;  3F9K A;  4S04 A;  3KE2 A;  2HDD A;  4L0Y B;  2HUJ A;  1ZGW A;  2K3F A;  2V1D A;  5E1X A;  1ORJ A;  2EIJ C;  4CCO A;  1BM9 A;  4OAZ A;  2O9L A;  4I0A A;  5KNL A;  4JBA A;  4KT6 A;  4U5D E;  3OSF A;  1ODD A;  3JTH A;  1Z0X A;  3QMK A;  4NC6 A;  3KP6 A;  3FXJ A;  5BQT A;  1HSJ A;  1HMO A;  2Y39 A;  4BAC A;  3O6B B;  1A5J A;  3WTV C;  2HPM A;  2XAU A;  2BE5 F;  2OBP A;  2MG4 A;  2EB7 A;  2KPM A;  2NS0 A;  3RKW A;  1UJ8 A;  2XAQ A;  4M3E A;  4A93 J;  2K85 A;  3C8G D;  5IP9 J;  2R93 J;  1XZQ A;  1B4A A;  3D5S C;  2L6H A;  4MVU A;  2VBX A;  3E5U A;  2HQA A;  2XGX A;  3A03 A;  5L0C A;  2RAE A;  5JVG F;  2FGY A;  5KAI C;  4HDU A;  2L5Q A;  4Y15 A;  1V5F A;  1ZU5 A;  3K70 C;  3I4N J;  2D2W A;  3KX2 A;  3AQC A;  3N24 A;  2NPU A;  1IV8 A;  2K9N A;  2TRT A;  5M5X J;  2Y48 A;  3DE9 A;  2XC7 A;  1HKQ A;  2NVU B;  3UMK A;  2H7O A;  3M79 A;  1ST6 A;  1VZ0 A;  1JE8 A;  3AOU A;  2L6F A;  1FYM A;  2IGK A;  4MFD A;  4BDZ A;  3PNV A;  1REP C;  1J75 A;  1RCP A;  2RQQ A;  5KK1 A;  4IPA A;  4UVC A;  3L2V A;  3O10 A;  3A1Y A;  1K78 B;  5D92 A;  3FWE A;  3L34 A;  4XRF A;  6PAX A;  2L7F P;  2GM4 A;  4IJA A;  1Y6D A;  3CCQ I;  2XKO A;  5JHU A;  4NBQ A;  3RZD J;  2CCY A;  2A5Y B;  2BC5 A;  5K1Y A;  1OYW A;  4XL9 A;  5LLQ A;  3U3B A;  3DEU A;  1VQ9 I;  3PDM P;  3R60 A;  4C2U A;  3K33 A;  3PSI A;  3ZWI A;  2Q2E B;  3KLO A;  3QPT A;  4F91 B;  4A0X A;  3ERE D;  2V4J C;  1A35 A;  1Z63 A;  2IXN A;  2BOL A;  3MKY B;  3ZR8 X;  4BU2 A;  3CCS I;  1HBX G;  1G2H A;  2EPK X;  1I27 A;  2OU6 A;  3SYN A;  3PUF A;  1DDN A;  4Z9J A;  5FKL A;  4BQN A;  1LFP A;  1ETO A;  3TGN A;  4XKW A;  4Y13 A;  2XM0 A;  2M3A A;  3FVY A;  2QWW A;  2ETS A;  3ZMS A;  2X0L A;  2E1N A;  2TCT A;  1OCP A;  5KYW B;  2XLE A;  4PDK A;  3GLX A;  3RQ4 A;  4BBS J;  3HYI A;  3G73 A;  1LFU P;  2TMV P;  1UG0 A;  2CS3 A;  2LF8 A;  3H92 A;  3JT1 A;  3L2U A;  2K9L A;  4IHT A;  3ABL H;  2PX0 A;  4XTK A;  2JSP A;  4RGS A;  2LMD A;  1LNW A;  3O2P E;  5DS6 A;  5AC5 A;  3UGO A;  1DOV A;  3HTS B;  1MH3 A;  1GS9 A;  2NUP A;  4OD5 A;  1STZ A;  5BPD A;  1JR8 A;  4ZTF A;  4X0R A;  2A68 F;  4D4X A;  3M8E A;  1DPR A;  1OXB A;  4NTA A;  2DYS C;  2KRH A;  3RVY A;  4CSA A;  5HLG A;  1HC8 A;  4HST A;  4BPM A;  2DDB A;  3AAF A;  3WTX C;  1TT5 B;  1O57 A;  1VND A;  2V1X A;  2G0E A;  3GEE A;  4RAY A;  3Q7G A;  1GV5 A;  1UZC A;  2DU9 A;  2PJR A;  4Q47 A;  5FFX A;  3Q9S A;  2A0B A;  2W45 A;  1BOA A;  4Y33 A;  4RLF A;  3MN2 A;  4B47 A;  3U1K A;  3EGD A;  3CO6 C;  2EFQ A;  4BQQ A;  2JPC A;  2QKM B;  1MNE A;  4P55 A;  5IPA A;  3SDG A;  1ZRE A;  4Q7C A;  1X2M A;  1LVA A;  4F92 B;  5LGT A;  2NVQ J;  1CGO A;  3OYA A;  2CWE A;  4LDK A;  1XX5 A;  4B09 A;  1LI5 A;  2WTE A;  3GFL A;  4IZZ A;  1ZG5 A;  1FBS A;  2DMN A;  4LK1 F;  3WU2 C;  2CNW D;  4U9D A;  4XQ1 A;  3GEI A;  3F8B A;  4CYC B;  4U88 A;  2V9P A;  4HX8 A;  5BOX A;  1YG2 A;  2BEO A;  1YYJ A;  3TBI A;  3H0D A;  1V54 C;  3KMI A;  2OU2 A;  1OCO C;  1QNT A;  1ZZP A;  4KT5 C;  4YT5 A;  1QPI A;  3TD7 A;  1AOY A;  1O87 A;  2FE3 A;  4AX2 A;  2JX0 A;  1VQ6 I;  1XCB A;  2LD6 A;  1VQN I;  5IT9 K;  1ZGA A; 
#chains in the Genus database with same CATH homology
 2OJE D;  3KPH A;  1R5I D;  2ICW G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...