1R5ID

Crystal structure of the mam-mhc complex
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
214
structure length
214
Chain Sequence
SMKLRVENPKKAQKHFVQNLNNVVFTNKELEDIYNLSNKEETKEVLKLFKLKVNQFYRHAFGIVNDYNGLLEYKEIFNMMFLKLSVVFDTQRKEANNVEQIKRNIAILDEIMAKADNDLSYFISQNKNFQELWDKAVKLTKEMKIKLKGQKLDLRDGEVAINKVRELFGSDKNVKELWWFRSLLVKGVYLIKRYYEGDIELKTTSDFAKAVFED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Crystal structure of Mycoplasma arthritidis mitogen complexed with HLA-DR1 reveals a novel superantigen fold and a dimerized superantigen-MHC complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 84
structure length 214
sequence length 214
chains with identical sequence H
ec nomenclature
pdb deposition date 2003-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.530 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A mam-mhc complex, Chain D, Domain 2 1r5iD02
1.20.120.390 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hla class ii histocompatibility antigen, dr alpha chain. Chain D, domain 1 1r5iD01
2ICWG 1R5ID 2OJED 3KPHA
chains in the Genus database with same CATH superfamily
2IAIA 1TWAJ 3GBGA 4JYKA 3VAYA 2X4HA 2GXAA 3PMRA 1FMWA 1TKNA 3PQJA 3ERED 1QPUA 1HXDA 3C7JA 5BQTA 3RKOF 4A5NA 1JT0A 1SD6A 3RPQA 4XEFA 1TNTA 3N24A 4ULWA 3RF3A 5K0IA 2EZIA 2EB7A 2M7AA 3RPUD 3WG7H 4BJ5C 2COBA 3LQQA 1JPJA 4J19A 3JSPA 3CF2A 4MQ9F 3DLLF 1RI7A 2OAZA 3KP6A 3PSFA 3F21A 1AHDP 2B9SA 4I0AA 3WHBA 4I2OA 1Z6AA 2LQGA 3B71A 3K4KA 1GLNA 2R7SA 1H7IA 4U9DA 2VL8A 4ZYAA 3HRUA 1ZVZA 4BG0A 5KYXA 1U5TC 4DJAA 3JRAA 1WGXA 3A1YA 3VFZA 1QZEA 3A0HC 3DZAA 1MKMA 1O3RA 2UUHA 4M6VA 1G6NA 1I4ZA 1JTXA 1TT0A 4E7LA 1TFKB 4H4KC 1YFHA 4Y3OA 1TP4A 5KYXB 2BOLA 2K9MA 1Z67A 3GTGJ 2EPMX 3ZVRA 2W4BA 5B1AH 1VQOI 3A11A 4Q48A 4YL0A 1QNTA 2ZXHA 3I9V2 1R49A 2V1DA 4DQ2A 4HLYA 1T0FC 3K70D 2F5EA 4UB6C 2YU3A 2KT0A 3US6A 2XPUA 3K33A 2NVTJ 3KCCA 3X2QH 2W4SA 1ON2A 1KU3A 4I09A 3G50A 5GPCA 2ECBA 2KSFA 2P6VA 2WY7Q 2DXIA 3K2AA 1VYKA 3LSIA 3N4MA 1V55H 2NYXA 3CMMA 5ILUA 2DPDA 4C3DA 3F23A 1HC8A 2Y3GA 4AK9A 1Q0KA 4HLXA 4QI0A 2CG4A 2R7OA 3BR3A 3CJTB 4XRSG 5BNGA 2BGCA 4M3DA 1AU7A 1L3LA 2OTLI 1PUFA 5CVIA 5DD8A 1S72I 1BZ4A 2H7VC 3C8GD 3MLGA 3SXZA 4BXUA 2XB0X 2CQXA 4XRMA 1OFCX 2E2JJ 3I71A 3LMMA 4GDFA 4HA8A 1T01A 2PMZA 3O8HA 2AWYA 1OR7A 2KLOA 1K79A 3CC7I 4PJ0C 2XLWA 3IUOA 2R7FA 3A0BC 2HOTA 2L6GA 5EZGA 2QEXI 3QZCA 2X0CA 5EZHA 2K85A 3DJUB 3UGPA 1X1CA 2K3FA 2FEZA 1IJWC 1XB4A 2K3PA 3PQKA 5FLMJ 4JIOA 4EBBA 4RM3A 1Z7Qc 1F5TA 4MTDA 5IT9K 2G9WA 4RAYA 4E7KA 1A7DA 4LLNA 2E87A 2L01A 3B6CA 3ZOBA 4O3MA 4PDKA 3E7LA 4PSWA 2MYSA 3T9OA 1YZCA 2Q7RA 1OCZH 2EZLA 1OR3A 2HZ8A 1VQLI 1X1AA 1O3UA 4JW1A 4CYCB 1F1MA 3K7AJ 4BEHA 2XPWA 3MKLA 2KL4A 1MQVA 2DJIA 2CJJA 4A6EA 4Z9JA 3S1NJ 1KU2A 3HLZA 1OKKD 3NG1A 4F55A 3FHDA 3NWSA 2ZXOA 1QQ3A 5J4VA 5J8CA 4GXOA 2YL7A 3LFKA 4BEHB 4A3JJ 5DCFA 1ETOA 3G3ZA 3DEWA 5J6XA 2XGCA 4LJZF 5H2FC 2KZGA 3OYEA 3O55A 5C4XJ 3ONQA 2E19A 2E2HJ 2RGVA 3ZWIA 2PLYA 4A0ZA 3S15J 1XTAA 4EJTA 1XC5A 2CUJA 2IXPA 4RAZA 5BMZA 5DS6A 2LIGA 4S05A 2XLDA 4U5DE 3AG1C 3TOLA 1YS7A 2CS3A 2QLZA 1D1CA 2E5ZA 3D5LA 1IUYA 3EZHA 1TTYA 1V74B 1VQKI 1LI7A 1EV7A 3TP3A 2W00A 1V4RA 2O5RA 5B3SH 3I59A 3WG9A 2VJIA 5LGTA 2EIJC 5A69A 4KJZA 3K4BA 4DGWB 4F52A 4YIRX 4ENNA 3LESA 2OZ6A 4YFKF 3KP4A 3HTKC 3CCEI 4BEMJ 4N0BA 2Z33A 4UVAA 1IZ1A 4HBLA 1T9KA 3ZMTA 2M8GX 1G4DA 1QHGA 2JSPA 3I59B 4OMZA 4W8PA 4AL0A 4RBNA 3ZIBA 2JSCA 3LAPA 3LUTB 3I58A 2RVCA 3G1OA 4G6QA 3F6VA 3FXJA 2EFQA 1WCMJ 1VZ0A 4CYDA 5KYNA 4G6TB 2WVQA 5FKNA 3O3KA 5K5QA 2XHKA 4DBQA 1LS4A 3T6JA 4A12A 2DA7A 4AYBN 2Z1DA 3UMIA 3P9IA 5FROA 3GFMA 4IHTA 4W1UA 3ABMH 4RBOA 4C3EA 4A4AA 2K9LA 3SNHA 4K1OA 1DU6A 4YFNF 3VYSB 2MD0A 1XSVA 5IOZA 5LBQA 2R5ZB 2R7UA 2MG4A 3ABLC 3JYHA 4ZTJA 1ORKA 3J7ZI 4EGZA 3DFGA 2LK4A 2KIQA 3SHFA 3OL3A 4EM0B 5L3EA 1T38A 3CP2A 4CO8A 3C8ZA 1BJZA 2H6BA 2LMDA 3QU3A 4HNTA 5K5RA 2P5LC 2DK8A 4ZTFA 1MBGA 2O8XA 4DRHB 4RGXA 1T95A 4CZZA 2LKXA 4HFFB 1MNMC 4M63A 4FQGA 4C2MJ 2IXOA 3RW0A 2M34A 1DP3A 2IXNA 4K0DA 4EV0A 5IT3A 3MBGA 3C1DA 3PO3J 4YELA 1M57C 1U9NA 3M07A 3SZPA 5DS9A 2DA1A 5K5OA 2CDQA 4JX5A 1ZG3A 3L2VA 2KQ9A 1LDKB 1EI7A 2RNJA 2XAGA 1JRAA 3WG7C 4E7HA 3JSOA 3WTYC 5A6JA 2BW3A 2HXOA 1DDNA 1O4XA 3FX3A 2LF8A 3BJ6A 4JTAB 2HUJA 3H65A 1OYWA 3LSHA 1JMWA 2LKPA 1TWHJ 4UB8C 3BJOA 2CV0A 2YRFA 1UHWA 3KP7A 2GFHA 2EINH 3H1CA 5EEGA 4MVOA 3V7SA 1WJFA 3HOYJ 4JCZA 1S3JA 4Y17A 1CGME 3JCUQ 2BW3B 2A05A 5HLGA 2IS2A 1YYVA 1C02A 1V54C 5A2QK 3ZGKA 1XPXA 4IRIA 3L8IA 2R7DA 3MKZA 4JCHA 2P8TA 1HE9A 5K7FA 3I4PA 5KHDA 2PI0A 4MVUA 4B09A 1BBHA 1CPRA 2J5PA 2I15A 1OQCA 3IPMO 2Q2EA 5LGUA 3ZCOA 4R8HA 1CGPA 2OJED 2ZXIA 1Y6IA 4B6IA 4CJGA 5DTDA 5D5XB 2E60A 3FXUA 4E6KG 5EGYA 3EUHA 1BIAA 2FMYA 2JTVA 4U5CE 1XSXA 5HLHA 3FK7A 2WBMA 3X2QC 2HSBA 5FKOA 3ZC4A 2Q2EB 2HWVA 3SP1A 2Y75A 4NTFA 2MBFA 2JMWA 1V55C 2ETSA 2XSJC 3JAMK 1A36A 1JJ6C 1EQ1A 2IXSA 5D6FA 3T5XA 4FAPB 1UHSA 4Y4RA 2QZ8A 5L3VA 1VTMP 1OPCA 4WF2A 2DCEA 2KPMA 3BG6A 4EBKA 2KMUA 2OZUA 3U2RA 2K7LA 1GGQA 2OQMA 1F9NA 3GANA 2XUBA 4WJ0A 1E3OC 2VC9A 3RDIA 3FM3A 3J81Z 1XCVA 4IEJA 4BQNA 4LG3A 4XMYA 1WSUA 3U3FA 4QPOA 2Y69H 1MJ9A 1B4AA 2W24A 4IJAA 4CS8C 3JYYA 1QLEC 2F5CA 2QENA 4HSRA 4ESBA 4C3BA 3U1DA 3CMEI 2FQ3A 1JTYA 3QWLA 1VLSA 1YARO 2LF7A 1SMTA 3IH4A 2FUG2 2YVKA 1DP7P 1XX5A 2VLAA 3K2ZA 1PD0A 3LAYA 4CCLA 2HJ3A 2UV1A 1KONA 3VYRB 1ORSC 1W5CC 3O2PE 4LITA 2QNLA 3DWWA 4E4HA 4E7JA 3JTLO 1MDMB 4MNDA 3TMOA 2QA4I 2MH2A 3S3OA 3S1RJ 4O79A 3LAJA 1OCZC 1U9OA 3CDLA 2XL4A 4U0WA 3OYNA 1MJBA 3SZTA 4A93J 4RGUA 2J45A 1IRXA 1ZR4A 1Z05A 1Y8QB 1SF8A 4CX9A 1FOKA 3EG9A 2CNWD 1U5TA 3CESA 1ZYRF 2LD5A 4XOTA 1ZG1A 2M4KA 4XIDA 3ZMSA 1VOMA 1G3TA 3V7CA 5IYDJ 3CJQB 1H88C 4DXWA 3W4YA 2XGXA 3HBLA 3EG9B 4U9EA 1GHCA 4EJVA 1GVDA 4I44A 1O7LA 3Q7LA 2VI6A 4N9IA 5HLIA 2W84A 2VC0A 3A4CA 3KMIA 2ID3A 4HEA2 1JKRC 2KRCA 3BOQA 2R0QC 2Q3TA 1IF1A 4K7BA 2FA5A 1ULYA 3HC7A 5FD5A 4KITB 4B4CA 1PV3A 3RSNA 5HVQC 3CCRI 3TBIA 1A35A 1LS1A 1RKEA 2R7XA 1R6RA 1I1GA 4ZDOA 1ZHYA 3GX4X 4KC9A 4YIIA 3ERMA 2WAQN 3H3UA 2I5UA 4WCGA 4HV5A 3LQRA 5FKMA 3EJNA 4CUGA 1IW7F 2BXZA 3CUQC 2XC7A 3KFWX 3CCSI 1RKEB 3L2UA 5M5XJ 2E5NA 1W5SA 3OMYA 1VQ7I 1J0RA 2A68F 3TULA 3OIOA 2BZTA 4XKCA 2XSDC 4KISA 3IAM2 3U9GA 2VCBA 2PX3A 1NFOA 5HOOA 1ZELA 2E1MC 3PUFA 1ERDA 5FRNA 4C9YA 3NAUA 2GWRA 1WRJA 4Q7CA 4XN3A 1FP1D 4G94A 3L2RA 2WB1N 1FNNA 3H5RA 2HTJA 3GWNA 1R23A 4L0ZB 1Z23A 1XMXA 4I98B 3VYTB 3NYJA 1TFOB 5FKLA 2EFOA 2J5OA 2GWWA 2QQ8A 3MFNA 1U3EM 4HZFA 3OS2A 4S04A 2EIMH 3PCVA 3C2HA 1RETA 5HDKA 3GM2A 1WN0A 4FASD 2X51A 1J59A 2Z3YA 1APLC 2VPLA 1I3QJ 3GODA 2R7WA 3IHUA 3LOCA 3HXLA 4FE4A 3CZ6A 1SEUA 2LKSA 4DZJA 3VSLA 5FGMA 2A0BA 2PG4A 2VCCA 4KYWA 1IN4A 3P9CA 3SEZA 2GIVA 1MBKA 1LQ1A 2PX9A 5K1YA 3QPHA 3BTCA 3U21A 1IGNA 2CGEA 3G6EI 2ZMEB 4IRHA 2DOFA 4AIDA 2D45A 5L0JA 2VQGA 4KMFA 2Y3DA 5IYCJ 2G3VA 1BBYA 2YSRA 2DI3A 3UGOA 2D5VA 4B43A 2R5YB 5DD4A 5LRRA 2P7VA 3IQCA 4DBRA 3AJMA 1VQ9I 3DTIA 2W9YA 4HF0A 1LDDA 4PGGA 4IL6C 1B68A 3HSEA 3GFLA 3TQNA 2VCAA 5IPAA 4OINF 1EH7A 2EINC 1CGOA 2LOOA 2DB4A 5M3FJ 2Y30A 3QODA 1HW1A 2DN0A 2RSEB 4RD9A 4YRVA 3ZQHA 3QOPA 4V2GA 2P7VB 1G59A 2UUIA 2G7UA 3ZG1A 3ZQQA 4F3QA 1UFMA 1DUXC 2Z15A 3GO5A 1IC8A 2GA2A 2ICWG 2P4WA 1REPC 3L1PA 2JA8J 3J80K 2W25A 5DVWA 2XXAA 2XLEA 4XPXA 2ZBKA 3NWTA 1W4MA 3DJNB 4U7BA 3TQOA 4DNCA 4CZCA 2J9UA 4NC7A 3KKBA 2BYVE 2BE5F 1T6UA 5E3CA 1UELB 3MQ0A 4IO9F 3FXMA 2GBYA 1PUEE 3GTKJ 5ILVA 3HOZJ 5T3WA 1MH3A 2XXAB 4BEJA 5E8IA 3S2WA 1YOVB 2GOXB 1LUJB 4CXFA 2DTZA 1BC7C 1MW7A 1BOBA 4FT8A 3F22A 3CC4I 2L4MA 2E35A 5TGTA 3LSTA 4YT2A 2LFBA 5F04A 3WGGA 2HSQA 4F4BA 4DW6A 1A31A 3RQEA 1TWGA 1LJ9A 3DU6A 4GO1A 3OYGA 3BWGA 1PJRA 3LNRA 4KIGA 2JRTA 2JK3A 2OC6A 3AG2H 4XORA 1VQ4I 4LACB 3HHGA 1FIAA 5HNFA 3HM5A 3DMDA 4LGWA 2DODA 1ZLJA 3M9AA 5L0FA 1R1TA 1O5HA 3C18A 1P4AA 1S8NA 1B9NA 2L9SA 1XMAA 2XVCA 2E7XA 1XGMA 1C03A 2KW3C 3OYMA 1MNDA 2DT5A 5FO5A 1OQYA 1W36D 3B9QA 3GORA 2DO7A 2Y3HA 4M3FA 2HVRA 4AE4A 2CSOA 9ANTA 4CCNA 3RCOA 1MNEA 3KETA 3E5UA 2V6CA 2GXBA 2Y69C 2CCYA 2QM3A 5J47A 4KIBA 3ULQB 1LDJA 2IBDA 2J0XA 2BVMA 4P96A 4LMYA 3BR6A 3H0GJ 4TV7A 3OIQA 2RQQA 1SAXA 5E3MA 4AE4B 5EJCA 3O8GA 4E0IA 2VE9A 2IRFG 4BXFA 2GA1A 1ZHFA 4UXNA 1ETQA 3IL2A 3RYLA 3KZYA 4D5FA 1FBQA 3BC8A 3WE3A 1ZLKA 2JWTA 3QTHA 3FF5A 5IP7J 1ZRDA 2HKVA 2Q8KA 4D0PA 5E3OA 4MHGA 5F08A 2OJQA 1Q0GA 3G1LA 2R7RA 1Y1VJ 1TWCJ 1O3SA 4V2FA 2HOEA 4OD5A 5JP7A 4GYIA 3JRDA 3JRFA 5KAIC 2WWYA 2PF4E 2EV5A 3JTGA 4CJOA 1WJEA 2ZFWA 3NQOA 5IP6A 1KGSA 3OS1A 1K05A 1GXPA 4A3CJ 2HDWA 3QP6A 3W8HA 1RC9A 1OCRH 2UXNA 1BL0A 3VSKA 1MBJA 1D3YA 1SVOA 4UV8A 2OU2A 2F22A 3SEOA 3GLLA 2XF7A 3EH2A 1F36A 2VBWA 3PL8A 1FP2A 1HKQA 2RDPA 4I99C 2EPOA 2OG2A 3HKKA 1ZAOA 2CFXA 5COMA 2WTEA 3V5ZA 3F9KA 1K61A 2JX0A 1QPIA 4YWQA 4QSHA 2WAFA 4P9TA 4BL0B 3IV5A 3FAPB 2HEOA 4IHVA 5CIVA 4RB0A 4BHCA 1D0YA 2WY8Q 3ECSA 2QTVA 4KN7X 2EJRA 4LIVA 3KYDB 4EEFG 4BPMA 2VB6A 5KCMA 3S17J 1HSTA 2CQQA 3S27A 1JE8A 4YEJA 2M0MA 1AVOB 1FWZA 1JHHA 3B0PA 5T3TA 4U5GA 2NUTB 1ACIA 3TO9A 1Z63A 5B66C 5FLXZ 3I4UA 4FX0A 3F8NA 1I5NA 3KYCB 4CIHA 3U5SA 2IGNA 2O03A 4XLAA 5JLXA 2QQBA 3TW6A 4B3AA 2ZKZA 1O3QA 2LLKA 2M0CA 2STTA 2F5VA 1LIHA 4KUMA 2W57A 2OEVA 3K1HA 2LH9A 3JW4A 2L7AA 4PCQA 2E36A 4QLCU 5FLVA 2HJMA 1Q1VA 1L0OC 3S14J 4BE2A 4CDYA 4OIPF 1UMQA 2PMHA 2VT3A 2XLHA 2GA0A 4Q5SF 1H9GA 5JT4A 2WA0A 2X1CA 5J1UA 4J00A 1ZHXA 2GM4A 3F8CA 2K9SA 2V4JC 4A0YA 1T56A 3K70C 3FOOA 4MVSA 2ZO4A 3IH3A 3KZIC 5L3FA 1PCXA 4PACA 5L0IA 3JCUC 3HJEA 3ZDLA 4DVZA 4O6YA 3I56I 4CBEA 1R4TA 1E86A 3EGXA 2LREA 1RKCA 1NLXA 5ICEA 1G2HA 3LNMB 1S6LA 2CU7A 2YX7A 2P61A 4PZJA 1ETXA 1ZARA 4JE9A 1HLVA 2EPLX 1E3PA 1VQ5I 4IARA 2WVNA 1IDZA 2HMQA 2LK2A 3AFHA 2HOSA 4L18B 4UV9A 3OYBA 1BI0A 2M9HA 4UNOA 2DA2A 1QZXA 3CUOA 1X4OA 4A6DA 4HF1A 3EGXB 3DU5A 4PJLA 1GM5A 3ZTZA 1P7IA 1MBEA 3T0YA 2ZXWH 1QGPA 1UB9A 3EQLF 3OYAA 1Y6DA 2RNGA 3KEQA 5EYRA 4DYRA 2LD6A 2G3KA 3IQ5A 1JR8A 3QPSA 1GQAA 3G71I 2GAUA 2VXDA 1G3SA 1X2MA 2K4BA 2B0HA 3JRMO 1AEPA 3GZ5A 4BQQA 1OCCC 4LLCA 3K1MA 4L0YB 1BW6A 2TMVP 1LVKA 2DYRH 2R3SA 1F4KA 2NAZA 2QE9A 5D4SA 2CUEA 4HDVA 2OOCA 3QVZA 3ECHA 3HGGA 3HJCA 4D4NA 4CDGA 1ZHZA 3ABUA 5FB2A 1R4NB 3ML6A 1GS9A 1OJLA 4JURI 1IXSB 2CRGA 3IP4B 3G73A 3CUQA 1HQCA 4II3A 1VTNC 3WTTC 4L6RA 1Z6TA 3A03A 3LSJA 1LFBA 2Z99A 1W2WA 2AQEA 1R71A 3C62A 4I3MA 2FNPA 2CQKA 2LP0A 2O0YA 3SDGA 2D1HA 2CO5A 1R58A 4U0VA 3V4GA 2OCCC 2OPTA 2CFOA 1G8XA 2AXTC 3L2WA 4XRFA 3ASNH 2FBKA 3SXYA 2V26A 4AVPA 1E17A 1Z7LA 2JJ7A 3DPUA 2CYYA 3ZQFA 3ZN0A 2EPFA 1JKQC 5CKTA 1E85A 1M6TA 4XTKA 4DRJB 4XKWA 1RR8C 2FAPB 3IKTA 3OSFA 2BV6A 1PUFB 1N77A 1U2WA 3FZVA 4HQMA 3E6CC 2VPRA 1Q0MA 2GAQA 1OXKA 3FMRA 2KYHA 5H6RA 2ZXPA 2W82A 3WHCA 4MTOA 3WGIA 2HPMA 1TQIA 2NXNB 3L09A 4Q47A 2LY1A 4BBRJ 1ODDA 4AL1A 5FCLA 4RGRA 4IPAA 1L3PA 4CSAC 1J7KA 3BZKA 1IV8A 2ZJQF 3Q3SA 5D92A 3S84A 1FTTA 3KYIA 3IQ6A 4ITVA 2OBPA 3FXKA 1NH3A 2L0KA 2PQ8A 1JHFA 2ZSHB 4BKXA 5FRMA 1QHHD 4KMUX 1Y56A 1ZK8A 5AC5A 3RI4A 5T1DB 3M7GA 3OYIA 1HBXG 4D7MA 3AL0B 1ORJA 3KYLA 4RLFA 1Z5ZA 3LL7A 2HV6A 1SD7A 3HSFA 3QMKA 3IQTA 4YT5A 1XGSA 1WH5A 4MLOA 1R7JA 4PK4A 1AWCA 1SYQA 3I55I 4NC3A 1YHQI 2WZLA 2Q9AA 2ME6A 3WTVC 4WGZA 4HW0A 2LY9A 1ZZPA 1TBXA 4Y13A 5CYVA 5KYYA 5L0DA 1FOXA 3H9GA 4JOMA 4DRIB 2DW4A 5CJ9A 4KIFA 4E70A 5HS8A 2XGEA 3DTEA 4JKVA 1VQ8I 3HRTA 3FDQA 2IXMA 3OYCA 5D4RA 3HB9A 1TC3C 1SZIA 3NARA 3E0JB 1C0WA 2M4GA 4PFOA 2G62A 3CQZA 5DEQA 5KYYB 3PNYA 2K27A 3VOEA 4LD5A 4M71A 3DCFA 3TGNA 2KFDA 2AVKA 1WPKA 2LSOA 1WZ2A 1V4AA 2NOJB 1YG2A 2X6XA 4G7HF 2YLGA 3ZTMA 2F2EA 1GT0C 2EV0A 1QBJA 2DQLA 2VONA 1A0BA 4HE8D 4ZLDA 3WU1B 4CSWA 1JUSA 4G7OF 2O9LA 4X0RA 4QI2A 2F5FA 2RC4A 3SEQA 3KP5A 3GTQJ 1HY5A 3K6GA 4ZC3A 2DA6A 4FX4A 3HTUA 1I50J 3K1IA 3Q0WA 4AU7A 1CQTA 1X58A 5F28E 3KL4A 2OD5A 3VYWA 2IBFA 2NUPA 2A1DD 2BY1A 4B44A 4IQ4A 3M3YJ 5IT9Z 3UNGC 3S0XA 4AC0A 2FQ4A 1JXSA 4Q4ZF 1LE8A 5CVVA 3WE2A 3LWFA 1DPUA 4HV6A 1VMAA 2PN6A 3ABTA 4XNFA 2QGUA 4JX4A 4RMNA 1P2FA 1UZCA 2X6WA 2NUPB 2YLIA 4XRSA 4A3MJ 1FFHA 5GP9A 3HPHA 1RIOH 3R4KA 4DVYP 3WTUC 4YJWA 3HHHA 3Q5FA 1FYMA 1KQ8A 1NG7A 2EPKX 1T8IA 2UUZA 2QY9A 5KYWA 1RKTA 3FK6A 3L1MA 3TOAA 4ZZLA 2BBYA 4RLQA 1QU3A 2X6YA 2FOWA 2Y39A 3FXOA 1YJGA 3K7DA 1M2OA 1XWJA 4MEYF 2Z9OA 1N75A 2HS5A 3S29A 1NK3P 3V5XA 3HKZN 3TDZC 1HCRA 3DV8A 1YW8A 1Z0XA 3SXKA 4ASNA 5DM7F 5GTIC 4EQQA 2YEVA 1Z6RA 4EKWA 2CYDA 2AO9A 2YHSA 1Y1WJ 5FFZA 1HW5A 1X3UA 4ENMA 4U0YA 2H8AA 3U2MA 2DFHA 1M1EB 3CCLI 5LRSA 2EIKC 3NMKA 4OD4A 3F72A 2PNOA 3JT1A 1LEBA 3CF5F 1L7CA 1YZAA 1FSEA 3HL2A 4J01A 2HPIA 3GWZA 4HF2A 3BR2A 4ENJA 3FHZA 2UZKA 2JA7J 4N06A 4BJTA 4E7ZA 3LSKA 3B0VC 4JEAA 2TRTA 5E1ZB 5JHUA 2MGQA 1DPRA 3QOEA 5D5VB 1MSFC 2L7ZA 3K66A 3KPHA 3SFIA 2L9JA 2PBEA 3IKVA 4GGGA 2Q9CA 1DOVA 2Y0SA 2B63J 3QVYA 2R9RB 4H0EA 2YL0A 3M4CA 4XKBA 4A3DJ 3K1NA 2WAEA 3LFUA 1UAAA 2R7VA 1X1BA 5LLQA 3F8BA 2EK5A 1JUMA 2IS1A 2JA2A 1NHAA 3K1PA 1HMDA 2ME0A 3FMQA 3MFKA 1SFEA 1RR7A 3BTJA 3E6DA 3CCYA 3BJAA 4JP0A 4WGYA 2IP2A 1TWAA 2JRMA 2JT1A 1MMNA 2FOKA 3LA2A 1ZU4A 4MS2A 2NSFA 1NK2P 4YT8A 3S8PA 5K7ZA 2JD3A 4IKFA 3FXRA 2V6EA 4AD9A 2B0LA 3N97A 5DQTA 3U0CA 3S1QJ 2EZHA 2DYRC 3JTHA 4HX7A 5J3LA 1MH4A 3M8FA 1S7AA 5E1XA 1S7EA 2KIMA 2RQPA 2ZNYA 4KT5C 3LS1A 4FHTA 3KP2A 3L34A 5B1AC 2JVGA 2MC3A 4L9TA 3V7RA 2CQNA 3M4OJ 3V42A 1OYIA 4ETSA 4XQFA 4ZYHA 5EGOA 4C7OA 1C17M 5BPDA 4M6YA 2BY3A 2P6TA 2XAUA 4UVCA 4P9FA 3TJ6A 1RUOA 1YX3A 2ZJRF 5HODA 3RVZA 3LA3A 1UFBA 3TK0A 1XGNA 4EJUA 2KKOA 3ZMVA 1U0BB 3DI5A 3RFYA 4IZZA 2ELJA 4CCJA 3C63A 3U8VA 1O57A 4B1RA 3RKXA 1HW2A 3D5SC 1WJDA 4EVIA 4BE1A 3JZ0A 2OUMA 1KYWA 2MH9A 3AOUA 2GQQA 2V1UA 1F43A 3CTAA 3TD7A 2IYLD 1VB5A 5BQIA 2WV0A 3KIOA 3R7CA 3RYRA 1NBBA 3GZ6A 1QVTA 3T6GB 2F48A 2XIGA 2AWCA 3GEIA 4C3IJ 1HDPA 2CUFA 1ZQ3P 1D8KA 2K5CA 4UUVA 1ENHA 4A3BJ 4JEBA 4NQFA 3KH2A 2E1OA 1R4MB 1S9HA 1KU7A 1YLFA 1ZHWA 1G4US 3LNQA 1SAUA 4XSXF 1FAPB 1K40A 3HIFA 3LSMA 3HOVJ 1LKXA 3V7OA 2LNBA 4E0HA 4MIMA 3NYLA 4BJ5A 4IXAA 4CIPA 5E3LA 4N4OB 2R4GA 1FPQA 4B47A 1BR2A 2IPQX 3G4ZA 4RAGA 4NHJA 2EFNA 4D5CA 1IXRC 2Z5UA 2LG4A 3A01A 3T8TA 2IS6A 1I5ZA 2BHZA 2R93J 1VFCA 3A02A 3D5RC 3QW1A 4U5FE 3U3BA 1MD0A 2RN7A 1KQ0A 4HSTA 1W7PA 3JAMZ 1TR2A 1WGWA 1Q0FA 4Y15A 1YVIA 3H3ZA 3K4JA 4GEHA 2DFEA 3A01B 4XM3A 4E7SA 5JHFA 3S1MJ 3IWFA 4JJFA 1SD4A 1LPEA 2XS1A 3RVYA 1YO5C 1MZBA 1U5TB 1W7PB 2EQRA 1WI3A 3OR2C 2NVUB 4XR6A 2MA3A 4O5VA 5L3DA 2IGMA 4XICA 2YWAA 1T0FA 1IV6A 1IG7A 4NY3A 1LFUP 2ESNA 3O6BB 3F8FA 2VJJA 4M72A 2XV4S 3E6MA 2L7KA 1IAWA 4ER9A 2HFIA 3HOXJ 3BG3A 2BC5A 3BLYA 5E18F 3DWLE 3QYEA 2NVQJ 4HG2A 1XDUA 5B3SC 1WJ5A 2KK1A 1OKKA 2O3FA 3ZQVA 3K9TA 2WB7A 4BNCA 3MKWB 3CO6C 5HDGA 1SC7A 3Q0VA 1EF4A 3GTLJ 2ASRA 2H7OA 3B73A 2QSGX 4GCVA 2L3DA 1D0ZA 4E17A 2QUFA 3HOTA 2DMPA 2VJ5A 3Q6NA 4N6HA 2CV1A 4OAZA 2DPUA 4L5EA 2DYSH 3MEXA 1MGTA 2QUPA 3DLAA 2ZFUA 4QDLA 3BROA 1EJ9A 2DMQA 3HEFA 3IRRA 4XEVA 1RZ4A 1FYKA 1Q0DA 3DKAA 3KLNA 2H09A 3GUDA 3H2VA 4CSAA 4QPQA 3ZMDA 1RESA 3QYFA 4XLNF 2W85A 1TW2A 1MMSA 3ABMC 3DAGA 4U7DA 3K69A 3E1SA 3PIOF 3RZDJ 3HRMA 2CGPA 2VBYA 2A6EF 2ZXJA 1Z7UA 3IWZA 3QAHA 3WGHA 3ZP5A 3TEDA 3O10A 4MVRA 2YLDA 2JQ7A 1PDNC 4BUPA 4LLLA 3MYIA 1LFPA 1MMAA 1EA3A 3GTMJ 2JZYA 3DQVC 4MFEA 3GLXA 4Y52J 1WJBA 2F6CA 1XDSA 2HVQA 1IXCA 1X3ZB 2BY0A 4ZZDA 1GUUA 1HSJA 1OR7C 4G6DA 1YA7O 4P6IC 3UMKA 1IUFA 2XGDA 4I01A 3V8KA 2QBYA 4E7IA 2NRAC 3HOWJ 2XM0A 3SFZA 3G4XA 4JRZA 1BI3A 2P0WA 2OQRA 2PMZN 3OYKA 3S90A 1Z1DA 5L3QA 1D0XA 2OA4A 4U88A 2XROA 1FNTc 2XL6A 3EYIA 1ZW3A 5EG0A 3DKXA 3ZN1A 1T98A 2GXGA 2P1AA 2HZDA 1FBSA 3I3LA 3KP3A 4C3JJ 2O61A 1JPNA 2QCOA 2HQRA 3OA1A 4R1HA 2FX0A 1M56C 3N2ZB 4Y7NJ 2DMNA 5EG0B 1SR2A 5E20A 2FSWA 4IHYA 3OR1C 1H9TA 2IS4A 2HNHA 3NRHA 4BH9A 2QQ9A 3CMYA 5A6BA 1T6IA 5COFA 4EHPA 3I53A 3OOPA 3BG9A 4II2A 1FYLA 1J75A 5E1WA 3GFJA 1UCRA 4XLFA 4BJ6C 2W48A 3M4BA 1B9MA 2DT7B 2JUGA 2ZCWA 4RB2C 5AC4A 1IN6A 3I5QA 3M8JA 2FF4A 5C4JJ 3MCZA 3EH1A 4P9UA 2R25A 3PFIA 3DP7A 3KEYA 4AYBA 1TWHA 2XRHA 3GCMA 1ZH5A 1ZKGA 1A7VA 2H7BA 1GDTA 2IT0A 3W2AA 1O3TA 3AKZA 4FESA 3L00A 1USSA 2ELHA 1FX7A 2EFPA 1NG6A 3E9VA 4HFKB 4IHWA 3O6XA 1FJLA 3PSIA 2Q1ZB 5JVTA 1ONVA 2PBIA 3E97A 4PGHA 2MW8A 3MZYA 5LEKA 4A3KJ 4HAMA 1XCBA 1IRFA 1MJAA 1WHUA 2XAFA 3RIRA 4UHTA 1V5GA 1JJ8C 2QLAA 5F5FA 2CV2A 1WI9A 4NNJA 3RQGA 3UR3C 4OIOF 3W2WA 1QA6A 2FBIA 4U5BE 3HSRA 1YITI 3TOMA 1IZMA 5CPRB 4KN4X 2NSGA 3B6AA 1ZG5A 5GTHC 1SVLA 2ISZA 5EF6A 1HMOA 3W2VA 5EK0A 2F4OB 1QQIA 1EA8A 1ETVA 1HOMA 1WWPA 3MZ8A 1WTYA 2DQRA 5HS9A 1FZPB 1J8YF 4Z2YA 2M87A 2DMUA 3M1CA 3M15A 4ESFA 3E5QA 2KZVA 1HDDC 2VKEA 2Y9YA 4YG2F 1AA7A 1VYIA 1ZHTA 2JA5J 1B6AA 3DTKA 5JSLA 1JGSA 3QYBA 4HQEA 5L3BA 3LEOA 3CEXA 3VPRA 2XLMA 4XLEA 4KNYA 2HMZA 5C44J 3H2UA 4L9NA 3GEZA 3TL4X 1U8RA 5IY5H 2OV7A 4W97A 4BXXJ 5E79C 1VNDA 1FMVA 2OKUA 2X1DA 5M5YJ 2VN2A 1U78A 1R1UA 3L8JA 3HUGA 1MBFA 3EFOA 5E3NA 1T2KA 3ZQCA 4BU2A 2E1NA 2DOAA 2GZWA 4M73A 5EHHA 4NDLA 2DMTA 4RB3C 4G0HA 3ISPA 2F5DA 1N1CA 1M2VA 3BQZA 3BTIA 4F92B 3KYJA 2AHQA 3HUGB 1VI0A 2ID6A 5BS6A 1MMDA 2A07F 3EFOB 3F0CA 4IAOA 2WL8A 2ZC2A 3RH3A 4CDVA 5JUAA 2ZJ2A 2XDVA 3PNTA 2NG1A 3BR0A 3R60A 1JAFA 2KNHA 3V8LA 4IB4A 3GF2A 5JFRA 5LHHA 4NQWA 3VM6A 4GRIA 1M2VB 3RJPA 3GYHX 4CDAA 5FJ8J 1IN8A 2KQRA 1ZRCA 3OWTA 3U9MA 1IO2A 3E70C 1S5LC 2VBZA 5B5EC 2QWWA 1R36A 3FISA 4XPYA 3KE2A 3ABKH 2VODA 3DM9B 4I0BA 4GYGA 2WV1A 3HGYA 3GEHA 5GAEJ 4CA0A 3HNLA 1Z3IX 3EGDA 3S2DJ 2EILH 1V5FA 1U0JA 2EPNA 1FSHA 3QPTA 4FX5A 2LDUA 2LR8A 4A3EJ 1VLTA 1B59A 4R32A 2ZB9A 3QU6A 4G8XA 5ICCA 3GWLA 1T39A 2H8RA 1P9QC 1IN5A 1RKWA 3TOBA 5JI6A 3M79A 4NBQA 1B72A 5HLTA 2M64A 4IVNA 2GOMA 3JRTA 2DYSC 4FTHA 3EGDB 1TZLA 3FVYA 4LDKA 2A3SA 1BIBA 3EDPA 1YIOA 3G4SI 1VK5A 2L2OA 1BDJB 2L02A 2J7PA 2MLKA 4CS8A 2NPUA 4ZYGA 4RB1A 1YI2I 2Q9BA 3GTOJ 3Q9VA 2K40A 5F1RA 3MN2A 3HNIA 4JZAA 1B72B 1YS6A 1PYVA 2EWNA 2OCEA 2G7HA 3ZSUA 1IRZA 4DJ9A 1TLHB 1YE9A 3WAQA 5ED4A 5FZTA 4J7YA 2J46A 1VF9A 3K10A 4EUKB 1WASA 1KNYA 2H27A 1FEXA 2EIMC 5A6AA 1WKMA 3HYIA 1VQNI 1I1SA 3DD7A 2J9VA 5AGFA 1WOLA 4OMYA 1WVRA 3ABLH 2FMLA 3VEPA 1MMGA 2XPVA 3RKYA 1RUNA 4E18A 5KYUA 2JN6A 3H36A 1YDIA 5L3CA 1BN5A 2EA4A 2VH3A 2E7WA 1OCOH 5D91A 1UHMA 3J7AO 1Z9CA 1ZGJA 5DM6F 1G3YA 3AG4H 2XLVA 2VXZA 3POVA 3R6SA 3E5XA 2K9NA 4LB6B 2OU6A 1AKHA 4YL1A 4BY7J 1SFUA 3BR5A 2WVOA 3DBLB 4BHBA 1ZN2A 3JRIA 2NVXJ 5KYUB 4UUTA 1JI8A 2TDXA 3PDMP 1KYZA 4F91B 4D1QA 4UVBA 2XRLA 3N0TA 3I4MJ 2N8GA 2Y48A 1X19A 4A69C 1D5YA 1XZPA 2XRNA 3KZZA 4M9XA 1RXQA 2WAQA 3FDYA 1AKHB 2K02A 1W0UA 2HI3A 2QKLB 2ZSIB 3ROUA 3SYTA 3CCQI 2W4MA 1EH6A 256BA 4ZJZA 3J7AY 5KK1A 1X1PA 2MLGA 5ICFA 2IA2A 2FU4A 3DPTA 2DFIA 1QKRA 3GW2A 5COGA 1A6QA 4B48A 2VQHA 3MAJA 1CPQA 5GAHJ 4PJJA 2CW0F 4W8KA 1K7AA 5F64A 4EBJA 2BXYA 1W1WE 1SD5A 2CMPA 3EPVA 4DYQA 1G4WR 2PMUA 2XAQA 3PNVA 2YKZA 1V54H 4HX8A 4ZYEA 1Z3XA 3BRJA 2V9KA 3RQIA 2XL8A 3I64A 5E33A 3NEUA 1ORYA 3F47A 1YTYA 2ESHA 2IA0A 2WC2A 4XEKA 5JR3A 2WB1A 4EJWA 3CUQB 3QPLA 2OF7A 4BGDA 1OR2A 2R92J 2J0WA 5GAGJ 2JUCA 3AAFA 2CUZA 2DOEA 4EIYA 2H6CA 3FXHA 3DXJF 5D8KB 4K2EA 2DBBA 5CI9A 1HKSA 1OYYA 2BVLA 4JX6A 2I8BA 4ULVA 3T6BA 5FD6A 2O6GE 3HOUJ 4IOCF 4A2NB 3I0TA 2DA5A 4OAYA 3CP8A 2C03A 2IEKA 2P7CB 3SDBA 4DOZA 4X6AJ 5TJ5E 2CQ7A 1EH8A 1Y0NA 2JVHA 5CVJA 3KEOA 3NRVA 3VF0A 2HQAA 5B3IA 4QIWN 2E1MB 1NZEA 1FIPA 2QVOA 2DT6A 3AG2C 4JBAA 2MWQA 3DBHB 5IP9J 2XS8A 2NS0A 1BA5A 1A41A 1DOWA 1JGGA 1E2XA 3CJNA 3H3VK 3RZOJ 4BBSJ 5E17F 2FGYA 4ZH4F 2XF6A 5JRAA 3K0LA 4WXDA 3WTSC 2R05A 3MX3A 4MVZA 2PX0A 4BJ1A 1DGWY 1B1BA 1XD7A 1BW5A 1TNSA 3BPVA 3PJRA 2NNYA 4B8XA 4O6JA 5C3EJ 1VQ6I 1W7PD 3LEVA 3VYUB 4MVQA 2A6TA 1T5OA 1EKYA 1LVAA 2MHRA 5K7HA 3KX2A 2LFDA 2KJCA 2D2WA 3LSPA 3F8MA 4EJOA 4BE0A 4AM3A 2O9XA 3TO6A 1N25A 5H6QA 1YAUO 1E0EA 1I39A 3ZQ7A 1QRYA 4YK5A 5HS7A 5F1JA 2K86A 1R5GA 2EA2A 4CYCA 5IY5C 4HDUA 4XN0A 4KT6A 4G9YA 1T08B 3GMEA 4XOPA 3H9QA 4NB5A 2HYJA 2P5VA 3JSZA 3IAS2 5EDNA 3IC7A 3GM3A 4NCQA 3W8IA 1ETKA 5DS5A 3CSKA 3FXQA 3TKYA 1Y8RB 1V3FA 1KZHA 4BDYA 3BPXA 3O39A 1VQPI 4N9HA 5FFXA 3W6JB 1OCPA 3IRQA 5JVGF 2M5WA 2HDCA 1ZR2A 4AIKA 1XMKA 2J9WA 2PP4A 1TQMA 3FXLA 5B1BH 1ZGWA 2KP6A 2ZMEC 1D1AA 1J5YA 4RS8A 1A7EA 2A69F 1Z3YA 1H6GA 2QQAA 4WXHA 3CMAI 3NMJA 4U5HA 3U2LA 2A61A 5DUIA 1P6RA 4I7HA 4LB5A 4MW3A 4BJ6A 1I4YA 1OCRC 2NOGA 4J7TA 5LEJA 2HYGD 2E71A 3SYNA 4NTBA 4IX7A 1RPWA 1YRNA 4H54A 2FBHA 3FAJA 1TW3A 2L4AA 2ISYA 1UJ8A 2V1NA 1TWCA 3HG9A 4UUSA 1H89C 4KFCA 1FTZA 3EHMA 3R0AA 4M6XA 5CVRA 2PFBA 5D5WB 1KA8A 2V1XA 3CLOA 4PJMA 4XSZF 5EEHA 5J40A 4G7ZF 1OCTC 2OTJI 2R7TA 4M3GA 1K83J 1XN7A 1HA8A 1YRNB 1ETYA 5BPIA 3HRSA 2QSFX 2X48A 3ABKC 2CW7A 2YU9J 4CICA 4UUSB 3JR9A 3OYHA 1LE8B 4L9VA 4EATA 5DUKA 2FNAA 5BOXA 2EILC 4CHUA 2EFWA 4G78A 4N6CA 4L5JA 2V79A 2IJLA 1OW6A 4WK8F 2FD5A 1OW8A 2W7NA 2ZNZA 4MEXF 1XZQA 4A3IJ 2IM8A 2VQLA 3OIPA 1ZU5A 2LC2A 1WWXA 2VQCA 2AQFA 4Z6YA 2ECCA 3BQYA 2E2IJ 3QP5A 3PFYA 1YJ9I 1FTSA 5KYWB 5IOYA 1D5VA 2Y2ZA 3RKQA 1ON1A 5LD2C 4IJJA 4LLEA 1Z77A 4JTDB 2Y9ZA 3ITFA 2UXXA 5JVEA 5L0CA 4L5IA 2R5ZA 2DDBA 5ILSA 2GDCA 3X1OA 3DEUA 4NC6A 3R61A 5L0GA 5J8FA 4XLHA 4MTGA 4F7ZA 5DDGA 3GTJJ 1AOYA 3ZMZA 1F1ZA 1Q1HA 3HDDA 2DK5A 3MZHA 2AP3A 3H0DA 4LFUA 1SVMA 2HVSA 3WHNA 1OXBA 2Y3BA 4CCMA 4HX4A 5A6KA 1JT6A 3C2GA 4PSXA 2CH0A 4A0XA 1OLTA 2BEOA 2M8EA 3JRCA 5M3MJ 4HNUA 2LYCA 2VBXA 3S9OA 2OEXA 3WODF 2RV8A 1Y4CA 3CCJI 2KGOA 2H1LA 2DA4A 3K4NA 3ZRGA 1OCOC 2HR3A 4IQJA 2O8KA 3AG4C 1GXQA 3HNJA 1U89A 3BT9A 1BR4A 4L9JA 4ESJA 2HDDA 4XLCA 3WU0A 2YUSA 1MSEC 3AGUA 5A6BD 1YW7A 1YA9A 4MNUA 4BQOA 2ZXWC 4ZDLA 2VUMJ 2IGKA 4MQVA 4I76A 1STZA 3GVAA 2H8WA 3CDIA 2M45A 4MO7A 1YJNI 5E3AA 1Z21A 2ZJPF 3W6VA 4HNVA 3V5YA 2V3CC 2VE8A 5TISC 1G3WA 2STWA 4JJGA 2VIXA 2G0EA 2L5QA 3BCAA 1RJ9A 3K4MA 5CQGA 2VOOA 2Z16A 2XKOA 3C3WA 1JKOC 3EHNA 1QZYA 3W6KB 1ITYA 2NVYJ 2EZKA 3QRFF 4MW8A 4NTAA 3J81K 2IA1A 2QF7A 3PIPF 2M4EA 2WZFA 5JS5A 3COAC 1E83A 1USTA 2MC4A 3RPUA 3V8JA 2VC1A 1P92A 1RJ9B 5F6FA 1XG1A 4IF4A 1WQ2A 4RDAA 1KTMA 5GPAA 2LRDA 5F5HA 3BDDA 1OKRA 1NG1A 2FE3A 1I27A 1PVEA 1LB2A 1YYXA 2KIFA 3TJ5A 3GZNB 1LM3B 3DE8A 2DFFA 2XF5A 5EGOB 4RM2A 4C7OB 4A5MA 1TWGJ 5HV9A 3M1EA 3S3MA 4XWJA 3B02A 1WATA 3A9CA 3ASNC 5KAFC 3S2HJ 2X0LA 3KLOA 2BL2A 1R5ID 2K9QA 4QWQA 3IEEA 4MTFA 3ZR8X 1SFOJ 3FWEA 3MMYB 5KNLA 3SJMA 1N78A 3LLIA 4JTCB 1S7OA 4D7NA 1OMIA 5HDNA 3CDHA 3CLQA 2Q0OA 2VJ4A 1WJAA 2OQGA 3F6OA 2M2EA 4EMSA 1WJCA 2A0UA 3FM5A 3JRHA 2DLLA 2O7OA 3H5NA 3AQCA 2MFZA 5A2QZ 5BQHA 3S16J 4MTEA 3DEEA 2DJNA 4P55A 4OIRF 2HZTA 1R5HA 1S29A 2H94A 2R7QA 2CW8A 1PP7U 4XBFA 2ZD9A 2VKHA 3FKJA 4IRUA 4X1EA 3OYJA 1RNLA 3DM5A 4XQ1A 3ASOH 4A3LJ 2VKDA 3L2QA 3ZQGA 3ATPA 3C8GA 3MVPA 1NU9C 2KRHA 2MD5A 4QTRA 2HGCA 2JPUA 3VB2A 3BY6A 3LA7A 5AONA 2LVSA 3BG7A 3ECOA 3ZXSA 4IHSA 3DF8A 4LK0F 3OL4A 4XK4A 3WTZA 4KDPA 2L6FA 4J32B 3HNKA 3JSEO 2M30A 4FETA 3TP0A 4KA4A 3ZMUA 4I1OB 2KC3A 1MDMA 1D1BA 4I02A 4KBLA 2Y0MA 4LDQA 3C8GB 2XLOA 3DE9A 1SANA 1K04A 2IW5A 2DTRA 4LDRA 4ZYDA 2KRFA 1LPQA 4ON0A 5J1RA 4MVMA 3R0JA 3TO7A 1KQ9A 2DDAA 4YL3A 5JLIA 3G2BA 2NNNA 4O6MA 2MSYA 1BOAA 4ENKA 1R9TJ 3J7YJ 3OOUA 2Z2SB 1H8AC 3W3CA 4PUSA 1K4SA 1QVXA 3R2PA 1UG0A 1ETWA 3T1BA 1W0TA 4A2UA 2L7FP 1QZZA 2FJ1A 4LOCA 3H35A 4JQFA 1IRGA 2EBIA 1NFNA 3FOPA 5B1BC 3CCUI 1WH7A 3U8PA 3H5AA 3L9FA 3OY9A 1JKPC 5D5UB 3JRBA 3S3NA 1TWFJ 2LBFA 2GLOA 2K4JA 2KISA 4IAQA 4IRGA 2X1EA 4CCKA 2UWMA 1W5TA 4M3EA 1T6QA 4A3FJ 4WXCA 4AUXA 1APCA 1ST6A 3FKIJ 3VWBA 2L9VA 2NS7A 2LBFB 3AG3H 2L9RA 2VOPA 2YR2A 4ANJA 1XGOA 3CO7C 2J7PD 2ADUA 1BR1A 2NS8A 3Q9SA 3G1MA 2LY2A 4RDUA 3DBRB 3EETA 2JPCA 3QW0A 2HTSA 5M5WJ 1QPMA 1GV2A 1SFKA 4EM2A 1K6OA 4FWVA 3ZQIA 2IGOA 2DGJA 3L7WA 2RREA 2KJGA 1A6IA 3FMSA 2BY2A 3OS0A 3GXOA 4I6ZA 3ESWB 2KJBA 4LERA 3RIPA 2KDOA 1R1VA 2YZSA 1LE2A 4BACA 3BZ6A 5DLJA 2ELKA 2XSEA 1P4XA 2CWEA 4BY1J 3A2KA 2X6OA 2PFDA 5BQGA 5F0FA 3EPZA 1KU9A 2YX4A 3RKWA 1OW7A 3QQAA 4BYYA 1DQUA 2M1BA 1BM9A 1LEAA 3DAFA 4F93B 1H0MA 1ZREA 2AU5A 2J9BA 1SFXA 2V7FA 4JC7A 2FXAA 2JPBA 3I4NJ 2ZPAA 1U6HA 4HEAJ 5J4YA 4OIQF 4ZDPA 3DKYA 2XASA 5AIPA 2R03A 3WTXC 1J2XA 5LHGA 3I54A 5FKKA 3AQBA 1ZTRA 4D9JA 2YS9A 3SZGA 1NSGB 2F4MB 4FE7A 1FY7A 4IWBA 3C2BA 3T4RA 3CAXA 4EM1A 2YPRA 2ZXRA 3P7NA 1HE1A 1HF0A 2LSEA 2RKHA 2YQYA 2H1KA 5CLSA 4WABA 4HPQA 3AL0C 3REOA 3GEEA 3I5UA 3TDUC 2P81A 2L54A 4RGSA 3RYPA 4S0HB 1DU0A 2HOAA 3OEOA 3K6BA 5DQZA 2L9NA 5EEAA 1ZW2A 2PJRA 1U8BA 2QBYB 4Z9IA 2YL3A 4NUBA 1TQPA 3FIWA 1AUEA 1I3AA 3L0IA 4LLGF 2ZMEA 3CCMI 1S7ZA 3K4LA 4BDZA 3CJRB 4AX2A 1Y0UA 1BJAA 1R00A 1QVUA 2D1VA 2QKMB 2XAHA 5DV5A 4BS9A 4CCOA 3HOSA 1J9IA 4XL9A 3SQNA 2DA3A 1MIJA 1J8MF 4RAFA 4FISA 5E8GA 4GFBA 1W36C 1YLMA 2ETHA 5LGNA 4CGZA 2PJRB 4DYCA 2A6HF 1SMYF 1UG2A 2R5YA 2HV7A 5DYMA 3JREA 2X85A 4M3BA 2Q4FA 4AIHA 2YL1A 3UKGA 4N4NB 4PFPA 3ZPLA 1A04A 1FOWA 4YT4A 1Z91A 2XB5A 2D5RB 5AIQA 3TW7A 3T8RA 2I8DA 4XONA 3B29A 3MYFA 2GIZA 1HKTA 1OCCH 1FT9A 2ACJA 4GQHA 3MD2A 5DCMA 5BUOA 1TT5B 4ABZA 5LHIA 4KI2A 4LIUA 3GTPJ 4IHXA 3E6BA 1A5JA 4BHPA 4IGGA 4O6NA 1JUPA 4HYEA 2Q00A 4LG0A 2HKOA 1YJWI 3LSRA 4XLPF 3FBNB 3HKZA 1WFXA 4PR9A 1J09A 4G12A 2P0NA 2QYOA 2AS5F 1CGNA 2X9DA 4MGRA 5DCMB 4DIQA 4B3XA 5TRDA 1RCPA 1E3HA 4YN0B 1FBUA 4CH7A 1YQAA 2FFHA 1POGA 5IYBJ 4LG0B 2IOQA 3S32A 1K4TA 1LNWA 2A5YB 3K1IC 1GVJA 2I10A 1CF7A 5JLWA 1P4WA 2OCCH 4A3GJ 3BP8A 3NDBB 2TCTA 2HQNA 3DPLC 4HOBA 3NMIA 1X3WB 2Y31A 1LE4A 1E84A 1XS9A 6PAXA 5E2QA 3WU2C 1NU7D 1D8JA 3GM1A 2COMA 4C2TA 3Q7GA 3HTSB 1QSPA 1CF7B 3PHF2 2L7MP 3RQ4A 3LJBA 4IOAF 1FFTC 1T6SA 2D4UA 1FC3A 1O7FA 3HZJA 5J1YA 2M7BA 2J8WA 3WTWC 3UMHA 2F4IA 2VKVA 4BAYA 3ELKA 2A5WA 5GPGB 4D4XA 3P9KA 4MFDA 4UDVA 3VDXA 4KNWA 3BEHA 1P7JA 4PJNA 3J06A 4U87A 4HRIA 3LLKA 3F46A 2R02A 4M74A 3J80Z 1ZRFA 4ZLCA 4NC8A 3M1CB 2JA6J 5F0CA 2LCHA 2HFHA 3ASOC 3CC2I 2MABA 1YW9A 3Q0UA 4CS9C 3ZQYA 3FHNA 5L0HA 2KDZA 4FCYA 3FBIB 4R79A 3JRGA 4Y33A 2AXLA 1O87A 3OV8A 4V19K 2RD9A 1B8IA 3NKEA 3LSGA 2W45A 4X0GA 1K78A 2QSHX 2BHYA 2HKXA 4P1WA 4OU0A 2L6HA 3CQZJ 3D0SA 3AGTA 2RAEA 5HSWA 5CQEA 5KVRA 2E1CA 4C30A 1YX5A 5ICGA 4JVSA 3PUBA 1VQMI 2C6YA 4C3HJ 5HNHA 4AVZA 3ZQLA 2C04A 1IDYA 4ONSA 3H92A 1I6HJ 4P5OA 2W1OA 2XKPA 1B8IB 1OISA 2LTPA 3U1KA 2V9PA 3EUKL 4LK1F 1K78B 4Z9HA 3S93A 3BG5A 3NYMA 4O7GA 4DZPA 4EWCA 5FLXK 1UG7A 1X1DA 3E3VA 1FR0A 2IVMA 4KICA 4UY8I 1MBHA 2E34A 3OSGA 4WX9A 5F27A 3MKYB 1NTCA 2B0JA 4J30B 3RTRA 3BR1A 3OYFA 5DS4A 5GADJ 3U9JA 1BC8C 1DGRM 3GFIA 3BCBA 3OYLA 5TJJA 3S28A 4NQWB 1XSDA 1X2NA 2EV6A 2HYFA 4GYTA 2WADA 3VRCA 2CNWA 4XKVA 3AG1H 1JOGA 1QO0D 3IH2A 2Y0SN 4N4WA 1LI5A 1TL8A 2L81A 3Q6MA 3L2CA 3EYYA 4BQAA 2B7EA 4YFXF 3N05A 1PP8F 2EIJH 4M9ZA 4AIJA 3AG3C 4U5EE 2VT2A 4I1MA 4OWRB 2EH3A 3RQFA 1TQGA 1BI1A 2HQ5A 3BZCA 3MWMA 1RMVA 2LFFA 2LP4A 3SXMA 1X4PA 5ERIA 2NUTA 1EKEA 3H9JA 3M8EA 3PO2J 5H20A 4C2UA 1RRJA 3CD6I 4RA2A 2DU9A 3VODA 3EUHC 4M9SA 1ZGAA 2VASA 3PM1A 1FLIA 2M3AA 4JK1X 2FRHA 2DAOA 1YYJA 3SZRA 4KNVA 2XAJA 1I6XA 3K4CA 1K6YA 5L3GA 3DKWA 5F0HA 4CS7A 2PJPA 3NKDA 3HPGA 1Y39A 1BI2A 2KIUA 1V5EA 4CS9A 2HXIA 2PEXA 5CVUA 2XM4A 4YIFA 1PD1A 2R7ZJ 3CCVI 2WZGA 2P6SA 4EGYA 2V9VA 3LS0A 4AWXB 2KHMA 5LFAA 1G5ZA 3EZIA 2EIKH 3B0UX 3BTLA 3D1NI 3OYDA 1GV5A 2P5KA 3P5JA 3I5PA 5D8LB 4XPWA 4OOIA 5D6EA 1U6GA 3F3XA 1IN7A 5CI8A 3EUAA 1FOYA 4WWCA 1S05A 1R22A 1T33A 2HU9A 1YIJI
chains in the Genus database with same CATH topology
2ICWG 1R5ID 2OJED 3KPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ICW G;  1R5I D;  2OJE D;  3KPH A; 
#chains in the Genus database with same CATH topology
 2IAI A;  1TWA J;  3GBG A;  4JYK A;  3VAY A;  2X4H A;  2GXA A;  3PMR A;  1FMW A;  1TKN A;  3PQJ A;  3ERE D;  1QPU A;  1HXD A;  3C7J A;  5BQT A;  3RKO F;  4A5N A;  1JT0 A;  1SD6 A;  3RPQ A;  4XEF A;  1TNT A;  3N24 A;  4ULW A;  3RF3 A;  5K0I A;  2EZI A;  2EB7 A;  2M7A A;  3RPU D;  3WG7 H;  4BJ5 C;  2COB A;  3LQQ A;  1JPJ A;  4J19 A;  3JSP A;  3CF2 A;  4MQ9 F;  3DLL F;  1RI7 A;  2OAZ A;  3KP6 A;  3PSF A;  3F21 A;  1AHD P;  2B9S A;  4I0A A;  3WHB A;  4I2O A;  1Z6A A;  2LQG A;  3B71 A;  3K4K A;  1GLN A;  2R7S A;  1H7I A;  4U9D A;  2VL8 A;  4ZYA A;  3HRU A;  1ZVZ A;  4BG0 A;  5KYX A;  1U5T C;  4DJA A;  3JRA A;  1WGX A;  3A1Y A;  3VFZ A;  1QZE A;  3A0H C;  3DZA A;  1MKM A;  1O3R A;  2UUH A;  4M6V A;  1G6N A;  1I4Z A;  1JTX A;  1TT0 A;  4E7L A;  1TFK B;  4H4K C;  1YFH A;  4Y3O A;  1TP4 A;  5KYX B;  2BOL A;  2K9M A;  1Z67 A;  3GTG J;  2EPM X;  3ZVR A;  2W4B A;  5B1A H;  1VQO I;  3A11 A;  4Q48 A;  4YL0 A;  1QNT A;  2ZXH A;  3I9V 2;  1R49 A;  2V1D A;  4DQ2 A;  4HLY A;  1T0F C;  3K70 D;  2F5E A;  4UB6 C;  2YU3 A;  2KT0 A;  3US6 A;  2XPU A;  3K33 A;  2NVT J;  3KCC A;  3X2Q H;  2W4S A;  1ON2 A;  1KU3 A;  4I09 A;  3G50 A;  5GPC A;  2ECB A;  2KSF A;  2P6V A;  2WY7 Q;  2DXI A;  3K2A A;  1VYK A;  3LSI A;  3N4M A;  1V55 H;  2NYX A;  3CMM A;  5ILU A;  2DPD A;  4C3D A;  3F23 A;  1HC8 A;  2Y3G A;  4AK9 A;  1Q0K A;  4HLX A;  4QI0 A;  2CG4 A;  2R7O A;  3BR3 A;  3CJT B;  4XRS G;  5BNG A;  2BGC A;  4M3D A;  1AU7 A;  1L3L A;  2OTL I;  1PUF A;  5CVI A;  5DD8 A;  1S72 I;  1BZ4 A;  2H7V C;  3C8G D;  3MLG A;  3SXZ A;  4BXU A;  2XB0 X;  2CQX A;  4XRM A;  1OFC X;  2E2J J;  3I71 A;  3LMM A;  4GDF A;  4HA8 A;  1T01 A;  2PMZ A;  3O8H A;  2AWY A;  1OR7 A;  2KLO A;  1K79 A;  3CC7 I;  4PJ0 C;  2XLW A;  3IUO A;  2R7F A;  3A0B C;  2HOT A;  2L6G A;  5EZG A;  2QEX I;  3QZC A;  2X0C A;  5EZH A;  2K85 A;  3DJU B;  3UGP A;  1X1C A;  2K3F A;  2FEZ A;  1IJW C;  1XB4 A;  2K3P A;  3PQK A;  5FLM J;  4JIO A;  4EBB A;  4RM3 A;  1Z7Q c;  1F5T A;  4MTD A;  5IT9 K;  2G9W A;  4RAY A;  4E7K A;  1A7D A;  4LLN A;  2E87 A;  2L01 A;  3B6C A;  3ZOB A;  4O3M A;  4PDK A;  3E7L A;  4PSW A;  2MYS A;  3T9O A;  1YZC A;  2Q7R A;  1OCZ H;  2EZL A;  1OR3 A;  2HZ8 A;  1VQL I;  1X1A A;  1O3U A;  4JW1 A;  4CYC B;  1F1M A;  3K7A J;  4BEH A;  2XPW A;  3MKL A;  2KL4 A;  1MQV A;  2DJI A;  2CJJ A;  4A6E A;  4Z9J A;  3S1N J;  1KU2 A;  3HLZ A;  1OKK D;  3NG1 A;  4F55 A;  3FHD A;  3NWS A;  2ZXO A;  1QQ3 A;  5J4V A;  5J8C A;  4GXO A;  2YL7 A;  3LFK A;  4BEH B;  4A3J J;  5DCF A;  1ETO A;  3G3Z A;  3DEW A;  5J6X A;  2XGC A;  4LJZ F;  5H2F C;  2KZG A;  3OYE A;  3O55 A;  5C4X J;  3ONQ A;  2E19 A;  2E2H J;  2RGV A;  3ZWI A;  2PLY A;  4A0Z A;  3S15 J;  1XTA A;  4EJT A;  1XC5 A;  2CUJ A;  2IXP A;  4RAZ A;  5BMZ A;  5DS6 A;  2LIG A;  4S05 A;  2XLD A;  4U5D E;  3AG1 C;  3TOL A;  1YS7 A;  2CS3 A;  2QLZ A;  1D1C A;  2E5Z A;  3D5L A;  1IUY A;  3EZH A;  1TTY A;  1V74 B;  1VQK I;  1LI7 A;  1EV7 A;  3TP3 A;  2W00 A;  1V4R A;  2O5R A;  5B3S H;  3I59 A;  3WG9 A;  2VJI A;  5LGT A;  2EIJ C;  5A69 A;  4KJZ A;  3K4B A;  4DGW B;  4F52 A;  4YIR X;  4ENN A;  3LES A;  2OZ6 A;  4YFK F;  3KP4 A;  3HTK C;  3CCE I;  4BEM J;  4N0B A;  2Z33 A;  4UVA A;  1IZ1 A;  4HBL A;  1T9K A;  3ZMT A;  2M8G X;  1G4D A;  1QHG A;  2JSP A;  3I59 B;  4OMZ A;  4W8P A;  4AL0 A;  4RBN A;  3ZIB A;  2JSC A;  3LAP A;  3LUT B;  3I58 A;  2RVC A;  3G1O A;  4G6Q A;  3F6V A;  3FXJ A;  2EFQ A;  1WCM J;  1VZ0 A;  4CYD A;  5KYN A;  4G6T B;  2WVQ A;  5FKN A;  3O3K A;  5K5Q A;  2XHK A;  4DBQ A;  1LS4 A;  3T6J A;  4A12 A;  2DA7 A;  4AYB N;  2Z1D A;  3UMI A;  3P9I A;  5FRO A;  3GFM A;  4IHT A;  4W1U A;  3ABM H;  4RBO A;  4C3E A;  4A4A A;  2K9L A;  3SNH A;  4K1O A;  1DU6 A;  4YFN F;  3VYS B;  2MD0 A;  1XSV A;  5IOZ A;  5LBQ A;  2R5Z B;  2R7U A;  2MG4 A;  3ABL C;  3JYH A;  4ZTJ A;  1ORK A;  3J7Z I;  4EGZ A;  3DFG A;  2LK4 A;  2KIQ A;  3SHF A;  3OL3 A;  4EM0 B;  5L3E A;  1T38 A;  3CP2 A;  4CO8 A;  3C8Z A;  1BJZ A;  2H6B A;  2LMD A;  3QU3 A;  4HNT A;  5K5R A;  2P5L C;  2DK8 A;  4ZTF A;  1MBG A;  2O8X A;  4DRH B;  4RGX A;  1T95 A;  4CZZ A;  2LKX A;  4HFF B;  1MNM C;  4M63 A;  4FQG A;  4C2M J;  2IXO A;  3RW0 A;  2M34 A;  1DP3 A;  2IXN A;  4K0D A;  4EV0 A;  5IT3 A;  3MBG A;  3C1D A;  3PO3 J;  4YEL A;  1M57 C;  1U9N A;  3M07 A;  3SZP A;  5DS9 A;  2DA1 A;  5K5O A;  2CDQ A;  4JX5 A;  1ZG3 A;  3L2V A;  2KQ9 A;  1LDK B;  1EI7 A;  2RNJ A;  2XAG A;  1JRA A;  3WG7 C;  4E7H A;  3JSO A;  3WTY C;  5A6J A;  2BW3 A;  2HXO A;  1DDN A;  1O4X A;  3FX3 A;  2LF8 A;  3BJ6 A;  4JTA B;  2HUJ A;  3H65 A;  1OYW A;  3LSH A;  1JMW A;  2LKP A;  1TWH J;  4UB8 C;  3BJO A;  2CV0 A;  2YRF A;  1UHW A;  3KP7 A;  2GFH A;  2EIN H;  3H1C A;  5EEG A;  4MVO A;  3V7S A;  1WJF A;  3HOY J;  4JCZ A;  1S3J A;  4Y17 A;  1CGM E;  3JCU Q;  2BW3 B;  2A05 A;  5HLG A;  2IS2 A;  1YYV A;  1C02 A;  1V54 C;  5A2Q K;  3ZGK A;  1XPX A;  4IRI A;  3L8I A;  2R7D A;  3MKZ A;  4JCH A;  2P8T A;  1HE9 A;  5K7F A;  3I4P A;  5KHD A;  2PI0 A;  4MVU A;  4B09 A;  1BBH A;  1CPR A;  2J5P A;  2I15 A;  1OQC A;  3IPM O;  2Q2E A;  5LGU A;  3ZCO A;  4R8H A;  1CGP A;  2OJE D;  2ZXI A;  1Y6I A;  4B6I A;  4CJG A;  5DTD A;  5D5X B;  2E60 A;  3FXU A;  4E6K G;  5EGY A;  3EUH A;  1BIA A;  2FMY A;  2JTV A;  4U5C E;  1XSX A;  5HLH A;  3FK7 A;  2WBM A;  3X2Q C;  2HSB A;  5FKO A;  3ZC4 A;  2Q2E B;  2HWV A;  3SP1 A;  2Y75 A;  4NTF A;  2MBF A;  2JMW A;  1V55 C;  2ETS A;  2XSJ C;  3JAM K;  1A36 A;  1JJ6 C;  1EQ1 A;  2IXS A;  5D6F A;  3T5X A;  4FAP B;  1UHS A;  4Y4R A;  2QZ8 A;  5L3V A;  1VTM P;  1OPC A;  4WF2 A;  2DCE A;  2KPM A;  3BG6 A;  4EBK A;  2KMU A;  2OZU A;  3U2R A;  2K7L A;  1GGQ A;  2OQM A;  1F9N A;  3GAN A;  2XUB A;  4WJ0 A;  1E3O C;  2VC9 A;  3RDI A;  3FM3 A;  3J81 Z;  1XCV A;  4IEJ A;  4BQN A;  4LG3 A;  4XMY A;  1WSU A;  3U3F A;  4QPO A;  2Y69 H;  1MJ9 A;  1B4A A;  2W24 A;  4IJA A;  4CS8 C;  3JYY A;  1QLE C;  2F5C A;  2QEN A;  4HSR A;  4ESB A;  4C3B A;  3U1D A;  3CME I;  2FQ3 A;  1JTY A;  3QWL A;  1VLS A;  1YAR O;  2LF7 A;  1SMT A;  3IH4 A;  2FUG 2;  2YVK A;  1DP7 P;  1XX5 A;  2VLA A;  3K2Z A;  1PD0 A;  3LAY A;  4CCL A;  2HJ3 A;  2UV1 A;  1KON A;  3VYR B;  1ORS C;  1W5C C;  3O2P E;  4LIT A;  2QNL A;  3DWW A;  4E4H A;  4E7J A;  3JTL O;  1MDM B;  4MND A;  3TMO A;  2QA4 I;  2MH2 A;  3S3O A;  3S1R J;  4O79 A;  3LAJ A;  1OCZ C;  1U9O A;  3CDL A;  2XL4 A;  4U0W A;  3OYN A;  1MJB A;  3SZT A;  4A93 J;  4RGU A;  2J45 A;  1IRX A;  1ZR4 A;  1Z05 A;  1Y8Q B;  1SF8 A;  4CX9 A;  1FOK A;  3EG9 A;  2CNW D;  1U5T A;  3CES A;  1ZYR F;  2LD5 A;  4XOT A;  1ZG1 A;  2M4K A;  4XID A;  3ZMS A;  1VOM A;  1G3T A;  3V7C A;  5IYD J;  3CJQ B;  1H88 C;  4DXW A;  3W4Y A;  2XGX A;  3HBL A;  3EG9 B;  4U9E A;  1GHC A;  4EJV A;  1GVD A;  4I44 A;  1O7L A;  3Q7L A;  2VI6 A;  4N9I A;  5HLI A;  2W84 A;  2VC0 A;  3A4C A;  3KMI A;  2ID3 A;  4HEA 2;  1JKR C;  2KRC A;  3BOQ A;  2R0Q C;  2Q3T A;  1IF1 A;  4K7B A;  2FA5 A;  1ULY A;  3HC7 A;  5FD5 A;  4KIT B;  4B4C A;  1PV3 A;  3RSN A;  5HVQ C;  3CCR I;  3TBI A;  1A35 A;  1LS1 A;  1RKE A;  2R7X A;  1R6R A;  1I1G A;  4ZDO A;  1ZHY A;  3GX4 X;  4KC9 A;  4YII A;  3ERM A;  2WAQ N;  3H3U A;  2I5U A;  4WCG A;  4HV5 A;  3LQR A;  5FKM A;  3EJN A;  4CUG A;  1IW7 F;  2BXZ A;  3CUQ C;  2XC7 A;  3KFW X;  3CCS I;  1RKE B;  3L2U A;  5M5X J;  2E5N A;  1W5S A;  3OMY A;  1VQ7 I;  1J0R A;  2A68 F;  3TUL A;  3OIO A;  2BZT A;  4XKC A;  2XSD C;  4KIS A;  3IAM 2;  3U9G A;  2VCB A;  2PX3 A;  1NFO A;  5HOO A;  1ZEL A;  2E1M C;  3PUF A;  1ERD A;  5FRN A;  4C9Y A;  3NAU A;  2GWR A;  1WRJ A;  4Q7C A;  4XN3 A;  1FP1 D;  4G94 A;  3L2R A;  2WB1 N;  1FNN A;  3H5R A;  2HTJ A;  3GWN A;  1R23 A;  4L0Z B;  1Z23 A;  1XMX A;  4I98 B;  3VYT B;  3NYJ A;  1TFO B;  5FKL A;  2EFO A;  2J5O A;  2GWW A;  2QQ8 A;  3MFN A;  1U3E M;  4HZF A;  3OS2 A;  4S04 A;  2EIM H;  3PCV A;  3C2H A;  1RET A;  5HDK A;  3GM2 A;  1WN0 A;  4FAS D;  2X51 A;  1J59 A;  2Z3Y A;  1APL C;  2VPL A;  1I3Q J;  3GOD A;  2R7W A;  3IHU A;  3LOC A;  3HXL A;  4FE4 A;  3CZ6 A;  1SEU A;  2LKS A;  4DZJ A;  3VSL A;  5FGM A;  2A0B A;  2PG4 A;  2VCC A;  4KYW A;  1IN4 A;  3P9C A;  3SEZ A;  2GIV A;  1MBK A;  1LQ1 A;  2PX9 A;  5K1Y A;  3QPH A;  3BTC A;  3U21 A;  1IGN A;  2CGE A;  3G6E I;  2ZME B;  4IRH A;  2DOF A;  4AID A;  2D45 A;  5L0J A;  2VQG A;  4KMF A;  2Y3D A;  5IYC J;  2G3V A;  1BBY A;  2YSR A;  2DI3 A;  3UGO A;  2D5V A;  4B43 A;  2R5Y B;  5DD4 A;  5LRR A;  2P7V A;  3IQC A;  4DBR A;  3AJM A;  1VQ9 I;  3DTI A;  2W9Y A;  4HF0 A;  1LDD A;  4PGG A;  4IL6 C;  1B68 A;  3HSE A;  3GFL A;  3TQN A;  2VCA A;  5IPA A;  4OIN F;  1EH7 A;  2EIN C;  1CGO A;  2LOO A;  2DB4 A;  5M3F J;  2Y30 A;  3QOD A;  1HW1 A;  2DN0 A;  2RSE B;  4RD9 A;  4YRV A;  3ZQH A;  3QOP A;  4V2G A;  2P7V B;  1G59 A;  2UUI A;  2G7U A;  3ZG1 A;  3ZQQ A;  4F3Q A;  1UFM A;  1DUX C;  2Z15 A;  3GO5 A;  1IC8 A;  2GA2 A;  2ICW G;  2P4W A;  1REP C;  3L1P A;  2JA8 J;  3J80 K;  2W25 A;  5DVW A;  2XXA A;  2XLE A;  4XPX A;  2ZBK A;  3NWT A;  1W4M A;  3DJN B;  4U7B A;  3TQO A;  4DNC A;  4CZC A;  2J9U A;  4NC7 A;  3KKB A;  2BYV E;  2BE5 F;  1T6U A;  5E3C A;  1UEL B;  3MQ0 A;  4IO9 F;  3FXM A;  2GBY A;  1PUE E;  3GTK J;  5ILV A;  3HOZ J;  5T3W A;  1MH3 A;  2XXA B;  4BEJ A;  5E8I A;  3S2W A;  1YOV B;  2GOX B;  1LUJ B;  4CXF A;  2DTZ A;  1BC7 C;  1MW7 A;  1BOB A;  4FT8 A;  3F22 A;  3CC4 I;  2L4M A;  2E35 A;  5TGT A;  3LST A;  4YT2 A;  2LFB A;  5F04 A;  3WGG A;  2HSQ A;  4F4B A;  4DW6 A;  1A31 A;  3RQE A;  1TWG A;  1LJ9 A;  3DU6 A;  4GO1 A;  3OYG A;  3BWG A;  1PJR A;  3LNR A;  4KIG A;  2JRT A;  2JK3 A;  2OC6 A;  3AG2 H;  4XOR A;  1VQ4 I;  4LAC B;  3HHG A;  1FIA A;  5HNF A;  3HM5 A;  3DMD A;  4LGW A;  2DOD A;  1ZLJ A;  3M9A A;  5L0F A;  1R1T A;  1O5H A;  3C18 A;  1P4A A;  1S8N A;  1B9N A;  2L9S A;  1XMA A;  2XVC A;  2E7X A;  1XGM A;  1C03 A;  2KW3 C;  3OYM A;  1MND A;  2DT5 A;  5FO5 A;  1OQY A;  1W36 D;  3B9Q A;  3GOR A;  2DO7 A;  2Y3H A;  4M3F A;  2HVR A;  4AE4 A;  2CSO A;  9ANT A;  4CCN A;  3RCO A;  1MNE A;  3KET A;  3E5U A;  2V6C A;  2GXB A;  2Y69 C;  2CCY A;  2QM3 A;  5J47 A;  4KIB A;  3ULQ B;  1LDJ A;  2IBD A;  2J0X A;  2BVM A;  4P96 A;  4LMY A;  3BR6 A;  3H0G J;  4TV7 A;  3OIQ A;  2RQQ A;  1SAX A;  5E3M A;  4AE4 B;  5EJC A;  3O8G A;  4E0I A;  2VE9 A;  2IRF G;  4BXF A;  2GA1 A;  1ZHF A;  4UXN A;  1ETQ A;  3IL2 A;  3RYL A;  3KZY A;  4D5F A;  1FBQ A;  3BC8 A;  3WE3 A;  1ZLK A;  2JWT A;  3QTH A;  3FF5 A;  5IP7 J;  1ZRD A;  2HKV A;  2Q8K A;  4D0P A;  5E3O A;  4MHG A;  5F08 A;  2OJQ A;  1Q0G A;  3G1L A;  2R7R A;  1Y1V J;  1TWC J;  1O3S A;  4V2F A;  2HOE A;  4OD5 A;  5JP7 A;  4GYI A;  3JRD A;  3JRF A;  5KAI C;  2WWY A;  2PF4 E;  2EV5 A;  3JTG A;  4CJO A;  1WJE A;  2ZFW A;  3NQO A;  5IP6 A;  1KGS A;  3OS1 A;  1K05 A;  1GXP A;  4A3C J;  2HDW A;  3QP6 A;  3W8H A;  1RC9 A;  1OCR H;  2UXN A;  1BL0 A;  3VSK A;  1MBJ A;  1D3Y A;  1SVO A;  4UV8 A;  2OU2 A;  2F22 A;  3SEO A;  3GLL A;  2XF7 A;  3EH2 A;  1F36 A;  2VBW A;  3PL8 A;  1FP2 A;  1HKQ A;  2RDP A;  4I99 C;  2EPO A;  2OG2 A;  3HKK A;  1ZAO A;  2CFX A;  5COM A;  2WTE A;  3V5Z A;  3F9K A;  1K61 A;  2JX0 A;  1QPI A;  4YWQ A;  4QSH A;  2WAF A;  4P9T A;  4BL0 B;  3IV5 A;  3FAP B;  2HEO A;  4IHV A;  5CIV A;  4RB0 A;  4BHC A;  1D0Y A;  2WY8 Q;  3ECS A;  2QTV A;  4KN7 X;  2EJR A;  4LIV A;  3KYD B;  4EEF G;  4BPM A;  2VB6 A;  5KCM A;  3S17 J;  1HST A;  2CQQ A;  3S27 A;  1JE8 A;  4YEJ A;  2M0M A;  1AVO B;  1FWZ A;  1JHH A;  3B0P A;  5T3T A;  4U5G A;  2NUT B;  1ACI A;  3TO9 A;  1Z63 A;  5B66 C;  5FLX Z;  3I4U A;  4FX0 A;  3F8N A;  1I5N A;  3KYC B;  4CIH A;  3U5S A;  2IGN A;  2O03 A;  4XLA A;  5JLX A;  2QQB A;  3TW6 A;  4B3A A;  2ZKZ A;  1O3Q A;  2LLK A;  2M0C A;  2STT A;  2F5V A;  1LIH A;  4KUM A;  2W57 A;  2OEV A;  3K1H A;  2LH9 A;  3JW4 A;  2L7A A;  4PCQ A;  2E36 A;  4QLC U;  5FLV A;  2HJM A;  1Q1V A;  1L0O C;  3S14 J;  4BE2 A;  4CDY A;  4OIP F;  1UMQ A;  2PMH A;  2VT3 A;  2XLH A;  2GA0 A;  4Q5S F;  1H9G A;  5JT4 A;  2WA0 A;  2X1C A;  5J1U A;  4J00 A;  1ZHX A;  2GM4 A;  3F8C A;  2K9S A;  2V4J C;  4A0Y A;  1T56 A;  3K70 C;  3FOO A;  4MVS A;  2ZO4 A;  3IH3 A;  3KZI C;  5L3F A;  1PCX A;  4PAC A;  5L0I A;  3JCU C;  3HJE A;  3ZDL A;  4DVZ A;  4O6Y A;  3I56 I;  4CBE A;  1R4T A;  1E86 A;  3EGX A;  2LRE A;  1RKC A;  1NLX A;  5ICE A;  1G2H A;  3LNM B;  1S6L A;  2CU7 A;  2YX7 A;  2P61 A;  4PZJ A;  1ETX A;  1ZAR A;  4JE9 A;  1HLV A;  2EPL X;  1E3P A;  1VQ5 I;  4IAR A;  2WVN A;  1IDZ A;  2HMQ A;  2LK2 A;  3AFH A;  2HOS A;  4L18 B;  4UV9 A;  3OYB A;  1BI0 A;  2M9H A;  4UNO A;  2DA2 A;  1QZX A;  3CUO A;  1X4O A;  4A6D A;  4HF1 A;  3EGX B;  3DU5 A;  4PJL A;  1GM5 A;  3ZTZ A;  1P7I A;  1MBE A;  3T0Y A;  2ZXW H;  1QGP A;  1UB9 A;  3EQL F;  3OYA A;  1Y6D A;  2RNG A;  3KEQ A;  5EYR A;  4DYR A;  2LD6 A;  2G3K A;  3IQ5 A;  1JR8 A;  3QPS A;  1GQA A;  3G71 I;  2GAU A;  2VXD A;  1G3S A;  1X2M A;  2K4B A;  2B0H A;  3JRM O;  1AEP A;  3GZ5 A;  4BQQ A;  1OCC C;  4LLC A;  3K1M A;  4L0Y B;  1BW6 A;  2TMV P;  1LVK A;  2DYR H;  2R3S A;  1F4K A;  2NAZ A;  2QE9 A;  5D4S A;  2CUE A;  4HDV A;  2OOC A;  3QVZ A;  3ECH A;  3HGG A;  3HJC A;  4D4N A;  4CDG A;  1ZHZ A;  3ABU A;  5FB2 A;  1R4N B;  3ML6 A;  1GS9 A;  1OJL A;  4JUR I;  1IXS B;  2CRG A;  3IP4 B;  3G73 A;  3CUQ A;  1HQC A;  4II3 A;  1VTN C;  3WTT C;  4L6R A;  1Z6T A;  3A03 A;  3LSJ A;  1LFB A;  2Z99 A;  1W2W A;  2AQE A;  1R71 A;  3C62 A;  4I3M A;  2FNP A;  2CQK A;  2LP0 A;  2O0Y A;  3SDG A;  2D1H A;  2CO5 A;  1R58 A;  4U0V A;  3V4G A;  2OCC C;  2OPT A;  2CFO A;  1G8X A;  2AXT C;  3L2W A;  4XRF A;  3ASN H;  2FBK A;  3SXY A;  2V26 A;  4AVP A;  1E17 A;  1Z7L A;  2JJ7 A;  3DPU A;  2CYY A;  3ZQF A;  3ZN0 A;  2EPF A;  1JKQ C;  5CKT A;  1E85 A;  1M6T A;  4XTK A;  4DRJ B;  4XKW A;  1RR8 C;  2FAP B;  3IKT A;  3OSF A;  2BV6 A;  1PUF B;  1N77 A;  1U2W A;  3FZV A;  4HQM A;  3E6C C;  2VPR A;  1Q0M A;  2GAQ A;  1OXK A;  3FMR A;  2KYH A;  5H6R A;  2ZXP A;  2W82 A;  3WHC A;  4MTO A;  3WGI A;  2HPM A;  1TQI A;  2NXN B;  3L09 A;  4Q47 A;  2LY1 A;  4BBR J;  1ODD A;  4AL1 A;  5FCL A;  4RGR A;  4IPA A;  1L3P A;  4CSA C;  1J7K A;  3BZK A;  1IV8 A;  2ZJQ F;  3Q3S A;  5D92 A;  3S84 A;  1FTT A;  3KYI A;  3IQ6 A;  4ITV A;  2OBP A;  3FXK A;  1NH3 A;  2L0K A;  2PQ8 A;  1JHF A;  2ZSH B;  4BKX A;  5FRM A;  1QHH D;  4KMU X;  1Y56 A;  1ZK8 A;  5AC5 A;  3RI4 A;  5T1D B;  3M7G A;  3OYI A;  1HBX G;  4D7M A;  3AL0 B;  1ORJ A;  3KYL A;  4RLF A;  1Z5Z A;  3LL7 A;  2HV6 A;  1SD7 A;  3HSF A;  3QMK A;  3IQT A;  4YT5 A;  1XGS A;  1WH5 A;  4MLO A;  1R7J A;  4PK4 A;  1AWC A;  1SYQ A;  3I55 I;  4NC3 A;  1YHQ I;  2WZL A;  2Q9A A;  2ME6 A;  3WTV C;  4WGZ A;  4HW0 A;  2LY9 A;  1ZZP A;  1TBX A;  4Y13 A;  5CYV A;  5KYY A;  5L0D A;  1FOX A;  3H9G A;  4JOM A;  4DRI B;  2DW4 A;  5CJ9 A;  4KIF A;  4E70 A;  5HS8 A;  2XGE A;  3DTE A;  4JKV A;  1VQ8 I;  3HRT A;  3FDQ A;  2IXM A;  3OYC A;  5D4R A;  3HB9 A;  1TC3 C;  1SZI A;  3NAR A;  3E0J B;  1C0W A;  2M4G A;  4PFO A;  2G62 A;  3CQZ A;  5DEQ A;  5KYY B;  3PNY A;  2K27 A;  3VOE A;  4LD5 A;  4M71 A;  3DCF A;  3TGN A;  2KFD A;  2AVK A;  1WPK A;  2LSO A;  1WZ2 A;  1V4A A;  2NOJ B;  1YG2 A;  2X6X A;  4G7H F;  2YLG A;  3ZTM A;  2F2E A;  1GT0 C;  2EV0 A;  1QBJ A;  2DQL A;  2VON A;  1A0B A;  4HE8 D;  4ZLD A;  3WU1 B;  4CSW A;  1JUS A;  4G7O F;  2O9L A;  4X0R A;  4QI2 A;  2F5F A;  2RC4 A;  3SEQ A;  3KP5 A;  3GTQ J;  1HY5 A;  3K6G A;  4ZC3 A;  2DA6 A;  4FX4 A;  3HTU A;  1I50 J;  3K1I A;  3Q0W A;  4AU7 A;  1CQT A;  1X58 A;  5F28 E;  3KL4 A;  2OD5 A;  3VYW A;  2IBF A;  2NUP A;  2A1D D;  2BY1 A;  4B44 A;  4IQ4 A;  3M3Y J;  5IT9 Z;  3UNG C;  3S0X A;  4AC0 A;  2FQ4 A;  1JXS A;  4Q4Z F;  1LE8 A;  5CVV A;  3WE2 A;  3LWF A;  1DPU A;  4HV6 A;  1VMA A;  2PN6 A;  3ABT A;  4XNF A;  2QGU A;  4JX4 A;  4RMN A;  1P2F A;  1UZC A;  2X6W A;  2NUP B;  2YLI A;  4XRS A;  4A3M J;  1FFH A;  5GP9 A;  3HPH A;  1RIO H;  3R4K A;  4DVY P;  3WTU C;  4YJW A;  3HHH A;  3Q5F A;  1FYM A;  1KQ8 A;  1NG7 A;  2EPK X;  1T8I A;  2UUZ A;  2QY9 A;  5KYW A;  1RKT A;  3FK6 A;  3L1M A;  3TOA A;  4ZZL A;  2BBY A;  4RLQ A;  1QU3 A;  2X6Y A;  2FOW A;  2Y39 A;  3FXO A;  1YJG A;  3K7D A;  1M2O A;  1XWJ A;  4MEY F;  2Z9O A;  1N75 A;  2HS5 A;  3S29 A;  1NK3 P;  3V5X A;  3HKZ N;  3TDZ C;  1HCR A;  3DV8 A;  1YW8 A;  1Z0X A;  3SXK A;  4ASN A;  5DM7 F;  5GTI C;  4EQQ A;  2YEV A;  1Z6R A;  4EKW A;  2CYD A;  2AO9 A;  2YHS A;  1Y1W J;  5FFZ A;  1HW5 A;  1X3U A;  4ENM A;  4U0Y A;  2H8A A;  3U2M A;  2DFH A;  1M1E B;  3CCL I;  5LRS A;  2EIK C;  3NMK A;  4OD4 A;  3F72 A;  2PNO A;  3JT1 A;  1LEB A;  3CF5 F;  1L7C A;  1YZA A;  1FSE A;  3HL2 A;  4J01 A;  2HPI A;  3GWZ A;  4HF2 A;  3BR2 A;  4ENJ A;  3FHZ A;  2UZK A;  2JA7 J;  4N06 A;  4BJT A;  4E7Z A;  3LSK A;  3B0V C;  4JEA A;  2TRT A;  5E1Z B;  5JHU A;  2MGQ A;  1DPR A;  3QOE A;  5D5V B;  1MSF C;  2L7Z A;  3K66 A;  3KPH A;  3SFI A;  2L9J A;  2PBE A;  3IKV A;  4GGG A;  2Q9C A;  1DOV A;  2Y0S A;  2B63 J;  3QVY A;  2R9R B;  4H0E A;  2YL0 A;  3M4C A;  4XKB A;  4A3D J;  3K1N A;  2WAE A;  3LFU A;  1UAA A;  2R7V A;  1X1B A;  5LLQ A;  3F8B A;  2EK5 A;  1JUM A;  2IS1 A;  2JA2 A;  1NHA A;  3K1P A;  1HMD A;  2ME0 A;  3FMQ A;  3MFK A;  1SFE A;  1RR7 A;  3BTJ A;  3E6D A;  3CCY A;  3BJA A;  4JP0 A;  4WGY A;  2IP2 A;  1TWA A;  2JRM A;  2JT1 A;  1MMN A;  2FOK A;  3LA2 A;  1ZU4 A;  4MS2 A;  2NSF A;  1NK2 P;  4YT8 A;  3S8P A;  5K7Z A;  2JD3 A;  4IKF A;  3FXR A;  2V6E A;  4AD9 A;  2B0L A;  3N97 A;  5DQT A;  3U0C A;  3S1Q J;  2EZH A;  2DYR C;  3JTH A;  4HX7 A;  5J3L A;  1MH4 A;  3M8F A;  1S7A A;  5E1X A;  1S7E A;  2KIM A;  2RQP A;  2ZNY A;  4KT5 C;  3LS1 A;  4FHT A;  3KP2 A;  3L34 A;  5B1A C;  2JVG A;  2MC3 A;  4L9T A;  3V7R A;  2CQN A;  3M4O J;  3V42 A;  1OYI A;  4ETS A;  4XQF A;  4ZYH A;  5EGO A;  4C7O A;  1C17 M;  5BPD A;  4M6Y A;  2BY3 A;  2P6T A;  2XAU A;  4UVC A;  4P9F A;  3TJ6 A;  1RUO A;  1YX3 A;  2ZJR F;  5HOD A;  3RVZ A;  3LA3 A;  1UFB A;  3TK0 A;  1XGN A;  4EJU A;  2KKO A;  3ZMV A;  1U0B B;  3DI5 A;  3RFY A;  4IZZ A;  2ELJ A;  4CCJ A;  3C63 A;  3U8V A;  1O57 A;  4B1R A;  3RKX A;  1HW2 A;  3D5S C;  1WJD A;  4EVI A;  4BE1 A;  3JZ0 A;  2OUM A;  1KYW A;  2MH9 A;  3AOU A;  2GQQ A;  2V1U A;  1F43 A;  3CTA A;  3TD7 A;  2IYL D;  1VB5 A;  5BQI A;  2WV0 A;  3KIO A;  3R7C A;  3RYR A;  1NBB A;  3GZ6 A;  1QVT A;  3T6G B;  2F48 A;  2XIG A;  2AWC A;  3GEI A;  4C3I J;  1HDP A;  2CUF A;  1ZQ3 P;  1D8K A;  2K5C A;  4UUV A;  1ENH A;  4A3B J;  4JEB A;  4NQF A;  3KH2 A;  2E1O A;  1R4M B;  1S9H A;  1KU7 A;  1YLF A;  1ZHW A;  1G4U S;  3LNQ A;  1SAU A;  4XSX F;  1FAP B;  1K40 A;  3HIF A;  3LSM A;  3HOV J;  1LKX A;  3V7O A;  2LNB A;  4E0H A;  4MIM A;  3NYL A;  4BJ5 A;  4IXA A;  4CIP A;  5E3L A;  4N4O B;  2R4G A;  1FPQ A;  4B47 A;  1BR2 A;  2IPQ X;  3G4Z A;  4RAG A;  4NHJ A;  2EFN A;  4D5C A;  1IXR C;  2Z5U A;  2LG4 A;  3A01 A;  3T8T A;  2IS6 A;  1I5Z A;  2BHZ A;  2R93 J;  1VFC A;  3A02 A;  3D5R C;  3QW1 A;  4U5F E;  3U3B A;  1MD0 A;  2RN7 A;  1KQ0 A;  4HST A;  1W7P A;  3JAM Z;  1TR2 A;  1WGW A;  1Q0F A;  4Y15 A;  1YVI A;  3H3Z A;  3K4J A;  4GEH A;  2DFE A;  3A01 B;  4XM3 A;  4E7S A;  5JHF A;  3S1M J;  3IWF A;  4JJF A;  1SD4 A;  1LPE A;  2XS1 A;  3RVY A;  1YO5 C;  1MZB A;  1U5T B;  1W7P B;  2EQR A;  1WI3 A;  3OR2 C;  2NVU B;  4XR6 A;  2MA3 A;  4O5V A;  5L3D A;  2IGM A;  4XIC A;  2YWA A;  1T0F A;  1IV6 A;  1IG7 A;  4NY3 A;  1LFU P;  2ESN A;  3O6B B;  3F8F A;  2VJJ A;  4M72 A;  2XV4 S;  3E6M A;  2L7K A;  1IAW A;  4ER9 A;  2HFI A;  3HOX J;  3BG3 A;  2BC5 A;  3BLY A;  5E18 F;  3DWL E;  3QYE A;  2NVQ J;  4HG2 A;  1XDU A;  5B3S C;  1WJ5 A;  2KK1 A;  1OKK A;  2O3F A;  3ZQV A;  3K9T A;  2WB7 A;  4BNC A;  3MKW B;  3CO6 C;  5HDG A;  1SC7 A;  3Q0V A;  1EF4 A;  3GTL J;  2ASR A;  2H7O A;  3B73 A;  2QSG X;  4GCV A;  2L3D A;  1D0Z A;  4E17 A;  2QUF A;  3HOT A;  2DMP A;  2VJ5 A;  3Q6N A;  4N6H A;  2CV1 A;  4OAZ A;  2DPU A;  4L5E A;  2DYS H;  3MEX A;  1MGT A;  2QUP A;  3DLA A;  2ZFU A;  4QDL A;  3BRO A;  1EJ9 A;  2DMQ A;  3HEF A;  3IRR A;  4XEV A;  1RZ4 A;  1FYK A;  1Q0D A;  3DKA A;  3KLN A;  2H09 A;  3GUD A;  3H2V A;  4CSA A;  4QPQ A;  3ZMD A;  1RES A;  3QYF A;  4XLN F;  2W85 A;  1TW2 A;  1MMS A;  3ABM C;  3DAG A;  4U7D A;  3K69 A;  3E1S A;  3PIO F;  3RZD J;  3HRM A;  2CGP A;  2VBY A;  2A6E F;  2ZXJ A;  1Z7U A;  3IWZ A;  3QAH A;  3WGH A;  3ZP5 A;  3TED A;  3O10 A;  4MVR A;  2YLD A;  2JQ7 A;  1PDN C;  4BUP A;  4LLL A;  3MYI A;  1LFP A;  1MMA A;  1EA3 A;  3GTM J;  2JZY A;  3DQV C;  4MFE A;  3GLX A;  4Y52 J;  1WJB A;  2F6C A;  1XDS A;  2HVQ A;  1IXC A;  1X3Z B;  2BY0 A;  4ZZD A;  1GUU A;  1HSJ A;  1OR7 C;  4G6D A;  1YA7 O;  4P6I C;  3UMK A;  1IUF A;  2XGD A;  4I01 A;  3V8K A;  2QBY A;  4E7I A;  2NRA C;  3HOW J;  2XM0 A;  3SFZ A;  3G4X A;  4JRZ A;  1BI3 A;  2P0W A;  2OQR A;  2PMZ N;  3OYK A;  3S90 A;  1Z1D A;  5L3Q A;  1D0X A;  2OA4 A;  4U88 A;  2XRO A;  1FNT c;  2XL6 A;  3EYI A;  1ZW3 A;  5EG0 A;  3DKX A;  3ZN1 A;  1T98 A;  2GXG A;  2P1A A;  2HZD A;  1FBS A;  3I3L A;  3KP3 A;  4C3J J;  2O61 A;  1JPN A;  2QCO A;  2HQR A;  3OA1 A;  4R1H A;  2FX0 A;  1M56 C;  3N2Z B;  4Y7N J;  2DMN A;  5EG0 B;  1SR2 A;  5E20 A;  2FSW A;  4IHY A;  3OR1 C;  1H9T A;  2IS4 A;  2HNH A;  3NRH A;  4BH9 A;  2QQ9 A;  3CMY A;  5A6B A;  1T6I A;  5COF A;  4EHP A;  3I53 A;  3OOP A;  3BG9 A;  4II2 A;  1FYL A;  1J75 A;  5E1W A;  3GFJ A;  1UCR A;  4XLF A;  4BJ6 C;  2W48 A;  3M4B A;  1B9M A;  2DT7 B;  2JUG A;  2ZCW A;  4RB2 C;  5AC4 A;  1IN6 A;  3I5Q A;  3M8J A;  2FF4 A;  5C4J J;  3MCZ A;  3EH1 A;  4P9U A;  2R25 A;  3PFI A;  3DP7 A;  3KEY A;  4AYB A;  1TWH A;  2XRH A;  3GCM A;  1ZH5 A;  1ZKG A;  1A7V A;  2H7B A;  1GDT A;  2IT0 A;  3W2A A;  1O3T A;  3AKZ A;  4FES A;  3L00 A;  1USS A;  2ELH A;  1FX7 A;  2EFP A;  1NG6 A;  3E9V A;  4HFK B;  4IHW A;  3O6X A;  1FJL A;  3PSI A;  2Q1Z B;  5JVT A;  1ONV A;  2PBI A;  3E97 A;  4PGH A;  2MW8 A;  3MZY A;  5LEK A;  4A3K J;  4HAM A;  1XCB A;  1IRF A;  1MJA A;  1WHU A;  2XAF A;  3RIR A;  4UHT A;  1V5G A;  1JJ8 C;  2QLA A;  5F5F A;  2CV2 A;  1WI9 A;  4NNJ A;  3RQG A;  3UR3 C;  4OIO F;  3W2W A;  1QA6 A;  2FBI A;  4U5B E;  3HSR A;  1YIT I;  3TOM A;  1IZM A;  5CPR B;  4KN4 X;  2NSG A;  3B6A A;  1ZG5 A;  5GTH C;  1SVL A;  2ISZ A;  5EF6 A;  1HMO A;  3W2V A;  5EK0 A;  2F4O B;  1QQI A;  1EA8 A;  1ETV A;  1HOM A;  1WWP A;  3MZ8 A;  1WTY A;  2DQR A;  5HS9 A;  1FZP B;  1J8Y F;  4Z2Y A;  2M87 A;  2DMU A;  3M1C A;  3M15 A;  4ESF A;  3E5Q A;  2KZV A;  1HDD C;  2VKE A;  2Y9Y A;  4YG2 F;  1AA7 A;  1VYI A;  1ZHT A;  2JA5 J;  1B6A A;  3DTK A;  5JSL A;  1JGS A;  3QYB A;  4HQE A;  5L3B A;  3LEO A;  3CEX A;  3VPR A;  2XLM A;  4XLE A;  4KNY A;  2HMZ A;  5C44 J;  3H2U A;  4L9N A;  3GEZ A;  3TL4 X;  1U8R A;  5IY5 H;  2OV7 A;  4W97 A;  4BXX J;  5E79 C;  1VND A;  1FMV A;  2OKU A;  2X1D A;  5M5Y J;  2VN2 A;  1U78 A;  1R1U A;  3L8J A;  3HUG A;  1MBF A;  3EFO A;  5E3N A;  1T2K A;  3ZQC A;  4BU2 A;  2E1N A;  2DOA A;  2GZW A;  4M73 A;  5EHH A;  4NDL A;  2DMT A;  4RB3 C;  4G0H A;  3ISP A;  2F5D A;  1N1C A;  1M2V A;  3BQZ A;  3BTI A;  4F92 B;  3KYJ A;  2AHQ A;  3HUG B;  1VI0 A;  2ID6 A;  5BS6 A;  1MMD A;  2A07 F;  3EFO B;  3F0C A;  4IAO A;  2WL8 A;  2ZC2 A;  3RH3 A;  4CDV A;  5JUA A;  2ZJ2 A;  2XDV A;  3PNT A;  2NG1 A;  3BR0 A;  3R60 A;  1JAF A;  2KNH A;  3V8L A;  4IB4 A;  3GF2 A;  5JFR A;  5LHH A;  4NQW A;  3VM6 A;  4GRI A;  1M2V B;  3RJP A;  3GYH X;  4CDA A;  5FJ8 J;  1IN8 A;  2KQR A;  1ZRC A;  3OWT A;  3U9M A;  1IO2 A;  3E70 C;  1S5L C;  2VBZ A;  5B5E C;  2QWW A;  1R36 A;  3FIS A;  4XPY A;  3KE2 A;  3ABK H;  2VOD A;  3DM9 B;  4I0B A;  4GYG A;  2WV1 A;  3HGY A;  3GEH A;  5GAE J;  4CA0 A;  3HNL A;  1Z3I X;  3EGD A;  3S2D J;  2EIL H;  1V5F A;  1U0J A;  2EPN A;  1FSH A;  3QPT A;  4FX5 A;  2LDU A;  2LR8 A;  4A3E J;  1VLT A;  1B59 A;  4R32 A;  2ZB9 A;  3QU6 A;  4G8X A;  5ICC A;  3GWL A;  1T39 A;  2H8R A;  1P9Q C;  1IN5 A;  1RKW A;  3TOB A;  5JI6 A;  3M79 A;  4NBQ A;  1B72 A;  5HLT A;  2M64 A;  4IVN A;  2GOM A;  3JRT A;  2DYS C;  4FTH A;  3EGD B;  1TZL A;  3FVY A;  4LDK A;  2A3S A;  1BIB A;  3EDP A;  1YIO A;  3G4S I;  1VK5 A;  2L2O A;  1BDJ B;  2L02 A;  2J7P A;  2MLK A;  4CS8 A;  2NPU A;  4ZYG A;  4RB1 A;  1YI2 I;  2Q9B A;  3GTO J;  3Q9V A;  2K40 A;  5F1R A;  3MN2 A;  3HNI A;  4JZA A;  1B72 B;  1YS6 A;  1PYV A;  2EWN A;  2OCE A;  2G7H A;  3ZSU A;  1IRZ A;  4DJ9 A;  1TLH B;  1YE9 A;  3WAQ A;  5ED4 A;  5FZT A;  4J7Y A;  2J46 A;  1VF9 A;  3K10 A;  4EUK B;  1WAS A;  1KNY A;  2H27 A;  1FEX A;  2EIM C;  5A6A A;  1WKM A;  3HYI A;  1VQN I;  1I1S A;  3DD7 A;  2J9V A;  5AGF A;  1WOL A;  4OMY A;  1WVR A;  3ABL H;  2FML A;  3VEP A;  1MMG A;  2XPV A;  3RKY A;  1RUN A;  4E18 A;  5KYU A;  2JN6 A;  3H36 A;  1YDI A;  5L3C A;  1BN5 A;  2EA4 A;  2VH3 A;  2E7W A;  1OCO H;  5D91 A;  1UHM A;  3J7A O;  1Z9C A;  1ZGJ A;  5DM6 F;  1G3Y A;  3AG4 H;  2XLV A;  2VXZ A;  3POV A;  3R6S A;  3E5X A;  2K9N A;  4LB6 B;  2OU6 A;  1AKH A;  4YL1 A;  4BY7 J;  1SFU A;  3BR5 A;  2WVO A;  3DBL B;  4BHB A;  1ZN2 A;  3JRI A;  2NVX J;  5KYU B;  4UUT A;  1JI8 A;  2TDX A;  3PDM P;  1KYZ A;  4F91 B;  4D1Q A;  4UVB A;  2XRL A;  3N0T A;  3I4M J;  2N8G A;  2Y48 A;  1X19 A;  4A69 C;  1D5Y A;  1XZP A;  2XRN A;  3KZZ A;  4M9X A;  1RXQ A;  2WAQ A;  3FDY A;  1AKH B;  2K02 A;  1W0U A;  2HI3 A;  2QKL B;  2ZSI B;  3ROU A;  3SYT A;  3CCQ I;  2W4M A;  1EH6 A;  256B A;  4ZJZ A;  3J7A Y;  5KK1 A;  1X1P A;  2MLG A;  5ICF A;  2IA2 A;  2FU4 A;  3DPT A;  2DFI A;  1QKR A;  3GW2 A;  5COG A;  1A6Q A;  4B48 A;  2VQH A;  3MAJ A;  1CPQ A;  5GAH J;  4PJJ A;  2CW0 F;  4W8K A;  1K7A A;  5F64 A;  4EBJ A;  2BXY A;  1W1W E;  1SD5 A;  2CMP A;  3EPV A;  4DYQ A;  1G4W R;  2PMU A;  2XAQ A;  3PNV A;  2YKZ A;  1V54 H;  4HX8 A;  4ZYE A;  1Z3X A;  3BRJ A;  2V9K A;  3RQI A;  2XL8 A;  3I64 A;  5E33 A;  3NEU A;  1ORY A;  3F47 A;  1YTY A;  2ESH A;  2IA0 A;  2WC2 A;  4XEK A;  5JR3 A;  2WB1 A;  4EJW A;  3CUQ B;  3QPL A;  2OF7 A;  4BGD A;  1OR2 A;  2R92 J;  2J0W A;  5GAG J;  2JUC A;  3AAF A;  2CUZ A;  2DOE A;  4EIY A;  2H6C A;  3FXH A;  3DXJ F;  5D8K B;  4K2E A;  2DBB A;  5CI9 A;  1HKS A;  1OYY A;  2BVL A;  4JX6 A;  2I8B A;  4ULV A;  3T6B A;  5FD6 A;  2O6G E;  3HOU J;  4IOC F;  4A2N B;  3I0T A;  2DA5 A;  4OAY A;  3CP8 A;  2C03 A;  2IEK A;  2P7C B;  3SDB A;  4DOZ A;  4X6A J;  5TJ5 E;  2CQ7 A;  1EH8 A;  1Y0N A;  2JVH A;  5CVJ A;  3KEO A;  3NRV A;  3VF0 A;  2HQA A;  5B3I A;  4QIW N;  2E1M B;  1NZE A;  1FIP A;  2QVO A;  2DT6 A;  3AG2 C;  4JBA A;  2MWQ A;  3DBH B;  5IP9 J;  2XS8 A;  2NS0 A;  1BA5 A;  1A41 A;  1DOW A;  1JGG A;  1E2X A;  3CJN A;  3H3V K;  3RZO J;  4BBS J;  5E17 F;  2FGY A;  4ZH4 F;  2XF6 A;  5JRA A;  3K0L A;  4WXD A;  3WTS C;  2R05 A;  3MX3 A;  4MVZ A;  2PX0 A;  4BJ1 A;  1DGW Y;  1B1B A;  1XD7 A;  1BW5 A;  1TNS A;  3BPV A;  3PJR A;  2NNY A;  4B8X A;  4O6J A;  5C3E J;  1VQ6 I;  1W7P D;  3LEV A;  3VYU B;  4MVQ A;  2A6T A;  1T5O A;  1EKY A;  1LVA A;  2MHR A;  5K7H A;  3KX2 A;  2LFD A;  2KJC A;  2D2W A;  3LSP A;  3F8M A;  4EJO A;  4BE0 A;  4AM3 A;  2O9X A;  3TO6 A;  1N25 A;  5H6Q A;  1YAU O;  1E0E A;  1I39 A;  3ZQ7 A;  1QRY A;  4YK5 A;  5HS7 A;  5F1J A;  2K86 A;  1R5G A;  2EA2 A;  4CYC A;  5IY5 C;  4HDU A;  4XN0 A;  4KT6 A;  4G9Y A;  1T08 B;  3GME A;  4XOP A;  3H9Q A;  4NB5 A;  2HYJ A;  2P5V A;  3JSZ A;  3IAS 2;  5EDN A;  3IC7 A;  3GM3 A;  4NCQ A;  3W8I A;  1ETK A;  5DS5 A;  3CSK A;  3FXQ A;  3TKY A;  1Y8R B;  1V3F A;  1KZH A;  4BDY A;  3BPX A;  3O39 A;  1VQP I;  4N9H A;  5FFX A;  3W6J B;  1OCP A;  3IRQ A;  5JVG F;  2M5W A;  2HDC A;  1ZR2 A;  4AIK A;  1XMK A;  2J9W A;  2PP4 A;  1TQM A;  3FXL A;  5B1B H;  1ZGW A;  2KP6 A;  2ZME C;  1D1A A;  1J5Y A;  4RS8 A;  1A7E A;  2A69 F;  1Z3Y A;  1H6G A;  2QQA A;  4WXH A;  3CMA I;  3NMJ A;  4U5H A;  3U2L A;  2A61 A;  5DUI A;  1P6R A;  4I7H A;  4LB5 A;  4MW3 A;  4BJ6 A;  1I4Y A;  1OCR C;  2NOG A;  4J7T A;  5LEJ A;  2HYG D;  2E71 A;  3SYN A;  4NTB A;  4IX7 A;  1RPW A;  1YRN A;  4H54 A;  2FBH A;  3FAJ A;  1TW3 A;  2L4A A;  2ISY A;  1UJ8 A;  2V1N A;  1TWC A;  3HG9 A;  4UUS A;  1H89 C;  4KFC A;  1FTZ A;  3EHM A;  3R0A A;  4M6X A;  5CVR A;  2PFB A;  5D5W B;  1KA8 A;  2V1X A;  3CLO A;  4PJM A;  4XSZ F;  5EEH A;  5J40 A;  4G7Z F;  1OCT C;  2OTJ I;  2R7T A;  4M3G A;  1K83 J;  1XN7 A;  1HA8 A;  1YRN B;  1ETY A;  5BPI A;  3HRS A;  2QSF X;  2X48 A;  3ABK C;  2CW7 A;  2YU9 J;  4CIC A;  4UUS B;  3JR9 A;  3OYH A;  1LE8 B;  4L9V A;  4EAT A;  5DUK A;  2FNA A;  5BOX A;  2EIL C;  4CHU A;  2EFW A;  4G78 A;  4N6C A;  4L5J A;  2V79 A;  2IJL A;  1OW6 A;  4WK8 F;  2FD5 A;  1OW8 A;  2W7N A;  2ZNZ A;  4MEX F;  1XZQ A;  4A3I J;  2IM8 A;  2VQL A;  3OIP A;  1ZU5 A;  2LC2 A;  1WWX A;  2VQC A;  2AQF A;  4Z6Y A;  2ECC A;  3BQY A;  2E2I J;  3QP5 A;  3PFY A;  1YJ9 I;  1FTS A;  5KYW B;  5IOY A;  1D5V A;  2Y2Z A;  3RKQ A;  1ON1 A;  5LD2 C;  4IJJ A;  4LLE A;  1Z77 A;  4JTD B;  2Y9Z A;  3ITF A;  2UXX A;  5JVE A;  5L0C A;  4L5I A;  2R5Z A;  2DDB A;  5ILS A;  2GDC A;  3X1O A;  3DEU A;  4NC6 A;  3R61 A;  5L0G A;  5J8F A;  4XLH A;  4MTG A;  4F7Z A;  5DDG A;  3GTJ J;  1AOY A;  3ZMZ A;  1F1Z A;  1Q1H A;  3HDD A;  2DK5 A;  3MZH A;  2AP3 A;  3H0D A;  4LFU A;  1SVM A;  2HVS A;  3WHN A;  1OXB A;  2Y3B A;  4CCM A;  4HX4 A;  5A6K A;  1JT6 A;  3C2G A;  4PSX A;  2CH0 A;  4A0X A;  1OLT A;  2BEO A;  2M8E A;  3JRC A;  5M3M J;  4HNU A;  2LYC A;  2VBX A;  3S9O A;  2OEX A;  3WOD F;  2RV8 A;  1Y4C A;  3CCJ I;  2KGO A;  2H1L A;  2DA4 A;  3K4N A;  3ZRG A;  1OCO C;  2HR3 A;  4IQJ A;  2O8K A;  3AG4 C;  1GXQ A;  3HNJ A;  1U89 A;  3BT9 A;  1BR4 A;  4L9J A;  4ESJ A;  2HDD A;  4XLC A;  3WU0 A;  2YUS A;  1MSE C;  3AGU A;  5A6B D;  1YW7 A;  1YA9 A;  4MNU A;  4BQO A;  2ZXW C;  4ZDL A;  2VUM J;  2IGK A;  4MQV A;  4I76 A;  1STZ A;  3GVA A;  2H8W A;  3CDI A;  2M45 A;  4MO7 A;  1YJN I;  5E3A A;  1Z21 A;  2ZJP F;  3W6V A;  4HNV A;  3V5Y A;  2V3C C;  2VE8 A;  5TIS C;  1G3W A;  2STW A;  4JJG A;  2VIX A;  2G0E A;  2L5Q A;  3BCA A;  1RJ9 A;  3K4M A;  5CQG A;  2VOO A;  2Z16 A;  2XKO A;  3C3W A;  1JKO C;  3EHN A;  1QZY A;  3W6K B;  1ITY A;  2NVY J;  2EZK A;  3QRF F;  4MW8 A;  4NTA A;  3J81 K;  2IA1 A;  2QF7 A;  3PIP F;  2M4E A;  2WZF A;  5JS5 A;  3COA C;  1E83 A;  1UST A;  2MC4 A;  3RPU A;  3V8J A;  2VC1 A;  1P92 A;  1RJ9 B;  5F6F A;  1XG1 A;  4IF4 A;  1WQ2 A;  4RDA A;  1KTM A;  5GPA A;  2LRD A;  5F5H A;  3BDD A;  1OKR A;  1NG1 A;  2FE3 A;  1I27 A;  1PVE A;  1LB2 A;  1YYX A;  2KIF A;  3TJ5 A;  3GZN B;  1LM3 B;  3DE8 A;  2DFF A;  2XF5 A;  5EGO B;  4RM2 A;  4C7O B;  4A5M A;  1TWG J;  5HV9 A;  3M1E A;  3S3M A;  4XWJ A;  3B02 A;  1WAT A;  3A9C A;  3ASN C;  5KAF C;  3S2H J;  2X0L A;  3KLO A;  2BL2 A;  1R5I D;  2K9Q A;  4QWQ A;  3IEE A;  4MTF A;  3ZR8 X;  1SFO J;  3FWE A;  3MMY B;  5KNL A;  3SJM A;  1N78 A;  3LLI A;  4JTC B;  1S7O A;  4D7N A;  1OMI A;  5HDN A;  3CDH A;  3CLQ A;  2Q0O A;  2VJ4 A;  1WJA A;  2OQG A;  3F6O A;  2M2E A;  4EMS A;  1WJC A;  2A0U A;  3FM5 A;  3JRH A;  2DLL A;  2O7O A;  3H5N A;  3AQC A;  2MFZ A;  5A2Q Z;  5BQH A;  3S16 J;  4MTE A;  3DEE A;  2DJN A;  4P55 A;  4OIR F;  2HZT A;  1R5H A;  1S29 A;  2H94 A;  2R7Q A;  2CW8 A;  1PP7 U;  4XBF A;  2ZD9 A;  2VKH A;  3FKJ A;  4IRU A;  4X1E A;  3OYJ A;  1RNL A;  3DM5 A;  4XQ1 A;  3ASO H;  4A3L J;  2VKD A;  3L2Q A;  3ZQG A;  3ATP A;  3C8G A;  3MVP A;  1NU9 C;  2KRH A;  2MD5 A;  4QTR A;  2HGC A;  2JPU A;  3VB2 A;  3BY6 A;  3LA7 A;  5AON A;  2LVS A;  3BG7 A;  3ECO A;  3ZXS A;  4IHS A;  3DF8 A;  4LK0 F;  3OL4 A;  4XK4 A;  3WTZ A;  4KDP A;  2L6F A;  4J32 B;  3HNK A;  3JSE O;  2M30 A;  4FET A;  3TP0 A;  4KA4 A;  3ZMU A;  4I1O B;  2KC3 A;  1MDM A;  1D1B A;  4I02 A;  4KBL A;  2Y0M A;  4LDQ A;  3C8G B;  2XLO A;  3DE9 A;  1SAN A;  1K04 A;  2IW5 A;  2DTR A;  4LDR A;  4ZYD A;  2KRF A;  1LPQ A;  4ON0 A;  5J1R A;  4MVM A;  3R0J A;  3TO7 A;  1KQ9 A;  2DDA A;  4YL3 A;  5JLI A;  3G2B A;  2NNN A;  4O6M A;  2MSY A;  1BOA A;  4ENK A;  1R9T J;  3J7Y J;  3OOU A;  2Z2S B;  1H8A C;  3W3C A;  4PUS A;  1K4S A;  1QVX A;  3R2P A;  1UG0 A;  1ETW A;  3T1B A;  1W0T A;  4A2U A;  2L7F P;  1QZZ A;  2FJ1 A;  4LOC A;  3H35 A;  4JQF A;  1IRG A;  2EBI A;  1NFN A;  3FOP A;  5B1B C;  3CCU I;  1WH7 A;  3U8P A;  3H5A A;  3L9F A;  3OY9 A;  1JKP C;  5D5U B;  3JRB A;  3S3N A;  1TWF J;  2LBF A;  2GLO A;  2K4J A;  2KIS A;  4IAQ A;  4IRG A;  2X1E A;  4CCK A;  2UWM A;  1W5T A;  4M3E A;  1T6Q A;  4A3F J;  4WXC A;  4AUX A;  1APC A;  1ST6 A;  3FKI J;  3VWB A;  2L9V A;  2NS7 A;  2LBF B;  3AG3 H;  2L9R A;  2VOP A;  2YR2 A;  4ANJ A;  1XGO A;  3CO7 C;  2J7P D;  2ADU A;  1BR1 A;  2NS8 A;  3Q9S A;  3G1M A;  2LY2 A;  4RDU A;  3DBR B;  3EET A;  2JPC A;  3QW0 A;  2HTS A;  5M5W J;  1QPM A;  1GV2 A;  1SFK A;  4EM2 A;  1K6O A;  4FWV A;  3ZQI A;  2IGO A;  2DGJ A;  3L7W A;  2RRE A;  2KJG A;  1A6I A;  3FMS A;  2BY2 A;  3OS0 A;  3GXO A;  4I6Z A;  3ESW B;  2KJB A;  4LER A;  3RIP A;  2KDO A;  1R1V A;  2YZS A;  1LE2 A;  4BAC A;  3BZ6 A;  5DLJ A;  2ELK A;  2XSE A;  1P4X A;  2CWE A;  4BY1 J;  3A2K A;  2X6O A;  2PFD A;  5BQG A;  5F0F A;  3EPZ A;  1KU9 A;  2YX4 A;  3RKW A;  1OW7 A;  3QQA A;  4BYY A;  1DQU A;  2M1B A;  1BM9 A;  1LEA A;  3DAF A;  4F93 B;  1H0M A;  1ZRE A;  2AU5 A;  2J9B A;  1SFX A;  2V7F A;  4JC7 A;  2FXA A;  2JPB A;  3I4N J;  2ZPA A;  1U6H A;  4HEA J;  5J4Y A;  4OIQ F;  4ZDP A;  3DKY A;  2XAS A;  5AIP A;  2R03 A;  3WTX C;  1J2X A;  5LHG A;  3I54 A;  5FKK A;  3AQB A;  1ZTR A;  4D9J A;  2YS9 A;  3SZG A;  1NSG B;  2F4M B;  4FE7 A;  1FY7 A;  4IWB A;  3C2B A;  3T4R A;  3CAX A;  4EM1 A;  2YPR A;  2ZXR A;  3P7N A;  1HE1 A;  1HF0 A;  2LSE A;  2RKH A;  2YQY A;  2H1K A;  5CLS A;  4WAB A;  4HPQ A;  3AL0 C;  3REO A;  3GEE A;  3I5U A;  3TDU C;  2P81 A;  2L54 A;  4RGS A;  3RYP A;  4S0H B;  1DU0 A;  2HOA A;  3OEO A;  3K6B A;  5DQZ A;  2L9N A;  5EEA A;  1ZW2 A;  2PJR A;  1U8B A;  2QBY B;  4Z9I A;  2YL3 A;  4NUB A;  1TQP A;  3FIW A;  1AUE A;  1I3A A;  3L0I A;  4LLG F;  2ZME A;  3CCM I;  1S7Z A;  3K4L A;  4BDZ A;  3CJR B;  4AX2 A;  1Y0U A;  1BJA A;  1R00 A;  1QVU A;  2D1V A;  2QKM B;  2XAH A;  5DV5 A;  4BS9 A;  4CCO A;  3HOS A;  1J9I A;  4XL9 A;  3SQN A;  2DA3 A;  1MIJ A;  1J8M F;  4RAF A;  4FIS A;  5E8G A;  4GFB A;  1W36 C;  1YLM A;  2ETH A;  5LGN A;  4CGZ A;  2PJR B;  4DYC A;  2A6H F;  1SMY F;  1UG2 A;  2R5Y A;  2HV7 A;  5DYM A;  3JRE A;  2X85 A;  4M3B A;  2Q4F A;  4AIH A;  2YL1 A;  3UKG A;  4N4N B;  4PFP A;  3ZPL A;  1A04 A;  1FOW A;  4YT4 A;  1Z91 A;  2XB5 A;  2D5R B;  5AIQ A;  3TW7 A;  3T8R A;  2I8D A;  4XON A;  3B29 A;  3MYF A;  2GIZ A;  1HKT A;  1OCC H;  1FT9 A;  2ACJ A;  4GQH A;  3MD2 A;  5DCM A;  5BUO A;  1TT5 B;  4ABZ A;  5LHI A;  4KI2 A;  4LIU A;  3GTP J;  4IHX A;  3E6B A;  1A5J A;  4BHP A;  4IGG A;  4O6N A;  1JUP A;  4HYE A;  2Q00 A;  4LG0 A;  2HKO A;  1YJW I;  3LSR A;  4XLP F;  3FBN B;  3HKZ A;  1WFX A;  4PR9 A;  1J09 A;  4G12 A;  2P0N A;  2QYO A;  2AS5 F;  1CGN A;  2X9D A;  4MGR A;  5DCM B;  4DIQ A;  4B3X A;  5TRD A;  1RCP A;  1E3H A;  4YN0 B;  1FBU A;  4CH7 A;  1YQA A;  2FFH A;  1POG A;  5IYB J;  4LG0 B;  2IOQ A;  3S32 A;  1K4T A;  1LNW A;  2A5Y B;  3K1I C;  1GVJ A;  2I10 A;  1CF7 A;  5JLW A;  1P4W A;  2OCC H;  4A3G J;  3BP8 A;  3NDB B;  2TCT A;  2HQN A;  3DPL C;  4HOB A;  3NMI A;  1X3W B;  2Y31 A;  1LE4 A;  1E84 A;  1XS9 A;  6PAX A;  5E2Q A;  3WU2 C;  1NU7 D;  1D8J A;  3GM1 A;  2COM A;  4C2T A;  3Q7G A;  3HTS B;  1QSP A;  1CF7 B;  3PHF 2;  2L7M P;  3RQ4 A;  3LJB A;  4IOA F;  1FFT C;  1T6S A;  2D4U A;  1FC3 A;  1O7F A;  3HZJ A;  5J1Y A;  2M7B A;  2J8W A;  3WTW C;  3UMH A;  2F4I A;  2VKV A;  4BAY A;  3ELK A;  2A5W A;  5GPG B;  4D4X A;  3P9K A;  4MFD A;  4UDV A;  3VDX A;  4KNW A;  3BEH A;  1P7J A;  4PJN A;  3J06 A;  4U87 A;  4HRI A;  3LLK A;  3F46 A;  2R02 A;  4M74 A;  3J80 Z;  1ZRF A;  4ZLC A;  4NC8 A;  3M1C B;  2JA6 J;  5F0C A;  2LCH A;  2HFH A;  3ASO C;  3CC2 I;  2MAB A;  1YW9 A;  3Q0U A;  4CS9 C;  3ZQY A;  3FHN A;  5L0H A;  2KDZ A;  4FCY A;  3FBI B;  4R79 A;  3JRG A;  4Y33 A;  2AXL A;  1O87 A;  3OV8 A;  4V19 K;  2RD9 A;  1B8I A;  3NKE A;  3LSG A;  2W45 A;  4X0G A;  1K78 A;  2QSH X;  2BHY A;  2HKX A;  4P1W A;  4OU0 A;  2L6H A;  3CQZ J;  3D0S A;  3AGT A;  2RAE A;  5HSW A;  5CQE A;  5KVR A;  2E1C A;  4C30 A;  1YX5 A;  5ICG A;  4JVS A;  3PUB A;  1VQM I;  2C6Y A;  4C3H J;  5HNH A;  4AVZ A;  3ZQL A;  2C04 A;  1IDY A;  4ONS A;  3H92 A;  1I6H J;  4P5O A;  2W1O A;  2XKP A;  1B8I B;  1OIS A;  2LTP A;  3U1K A;  2V9P A;  3EUK L;  4LK1 F;  1K78 B;  4Z9H A;  3S93 A;  3BG5 A;  3NYM A;  4O7G A;  4DZP A;  4EWC A;  5FLX K;  1UG7 A;  1X1D A;  3E3V A;  1FR0 A;  2IVM A;  4KIC A;  4UY8 I;  1MBH A;  2E34 A;  3OSG A;  4WX9 A;  5F27 A;  3MKY B;  1NTC A;  2B0J A;  4J30 B;  3RTR A;  3BR1 A;  3OYF A;  5DS4 A;  5GAD J;  3U9J A;  1BC8 C;  1DGR M;  3GFI A;  3BCB A;  3OYL A;  5TJJ A;  3S28 A;  4NQW B;  1XSD A;  1X2N A;  2EV6 A;  2HYF A;  4GYT A;  2WAD A;  3VRC A;  2CNW A;  4XKV A;  3AG1 H;  1JOG A;  1QO0 D;  3IH2 A;  2Y0S N;  4N4W A;  1LI5 A;  1TL8 A;  2L81 A;  3Q6M A;  3L2C A;  3EYY A;  4BQA A;  2B7E A;  4YFX F;  3N05 A;  1PP8 F;  2EIJ H;  4M9Z A;  4AIJ A;  3AG3 C;  4U5E E;  2VT2 A;  4I1M A;  4OWR B;  2EH3 A;  3RQF A;  1TQG A;  1BI1 A;  2HQ5 A;  3BZC A;  3MWM A;  1RMV A;  2LFF A;  2LP4 A;  3SXM A;  1X4P A;  5ERI A;  2NUT A;  1EKE A;  3H9J A;  3M8E A;  3PO2 J;  5H20 A;  4C2U A;  1RRJ A;  3CD6 I;  4RA2 A;  2DU9 A;  3VOD A;  3EUH C;  4M9S A;  1ZGA A;  2VAS A;  3PM1 A;  1FLI A;  2M3A A;  4JK1 X;  2FRH A;  2DAO A;  1YYJ A;  3SZR A;  4KNV A;  2XAJ A;  1I6X A;  3K4C A;  1K6Y A;  5L3G A;  3DKW A;  5F0H A;  4CS7 A;  2PJP A;  3NKD A;  3HPG A;  1Y39 A;  1BI2 A;  2KIU A;  1V5E A;  4CS9 A;  2HXI A;  2PEX A;  5CVU A;  2XM4 A;  4YIF A;  1PD1 A;  2R7Z J;  3CCV I;  2WZG A;  2P6S A;  4EGY A;  2V9V A;  3LS0 A;  4AWX B;  2KHM A;  5LFA A;  1G5Z A;  3EZI A;  2EIK H;  3B0U X;  3BTL A;  3D1N I;  3OYD A;  1GV5 A;  2P5K A;  3P5J A;  3I5P A;  5D8L B;  4XPW A;  4OOI A;  5D6E A;  1U6G A;  3F3X A;  1IN7 A;  5CI8 A;  3EUA A;  1FOY A;  4WWC A;  1S05 A;  1R22 A;  1T33 A;  2HU9 A;  1YIJ I; 
#chains in the Genus database with same CATH homology
 2ICW G;  1R5I D;  2OJE D;  3KPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...