3AOUA

Structure of the na+ unbound rotor ring modified with n,n f-dicyclohexylcarbodiimide of the na+-transporting v-atpase
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
156
structure length
156
Chain Sequence
MMDYLITQNGGMVFAVLAMATATIFSGIGSAKGVGMTGEAAAALTTSQPEKFGQALILQLLPGTQGLYGFVIAFLIFINLGSDMSVVQGLNFLGASLPIAFTGLFSGIAQGKVAAAGIQILAKKPEHATKGIIFAAMVETYAILGFVISFLLVLNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords V-type sodium ATPase subunit K
publication title Structure of the rotor ring modified with N,N'-dicyclohexylcarbodiimide of the Na+-transporting vacuolar ATPase.
pubmed doi rcsb
source organism Enterococcus hirae
molecule tags Hydrolase
total genus 65
structure length 156
sequence length 156
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2010-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00137 ATP-synt_C ATP synthase subunit C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.610 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) lithium bound rotor ring of v- atpase 3aouA00
3AOUA 2BL2A 2DB4A 2CYDA 5TJ5E 4BEMJ
chains in the Genus database with same CATH superfamily
5BQGA 3T9OA 3FDQA 3GM1A 3L8JA 2EILC 4JVSA 4NTBA 4W8KA 1S05A 2XL8A 3IHUA 3ABMC 4JTCB 4NTFA 2OOCA 3UR3C 3HNKA 5HSWA 3HTKC 3JYHA 4CDYA 5JRAA 3TD7A 5EHHA 1E83A 1A7VA 4MVRA 4DRIB 1TR2A 4EIYA 2F22A 2R9RB 3ZQVA 2VH3A 5KYYB 2W4MA 4E0HA 2J9BA 4D4NA 1J8YF 5F28E 2Q7RA 1MNDA 2XLOA 4U5DE 1H7IA 3U0CA 2PP4A 1ZHWA 3DM9B 3WODF 4EKWA 2X51A 3U8VA 4DRHB 4A2NB 2EPNA 2IBFA 2C03A 1EKYA 1SF8A 1E85A 3RFYA 4CIPA 2Y3BA 3QZCA 1ZVZA 3BRJA 1RKCA 1FNTc 4CBEA 3V5YA 2J0XA 2CNWA 1NLXA 1RCPA 3SNHA 2WZFA 3AGTA 5B1AC 1V55C 4B6IA 1OCCC 2VC9A 5DS5A 3RQEA 4PFOA 4U5CE 3JT1A 5E3CA 5GPGB 3LAYA 1E2XA 3ZC4A 1T01A 2PX3A 3ATPA 1NSGB 2ETSA 2GAQA 4XEFA 4ONSA 3SXZA 1VLSA 1HMDA 1R5ID 4C7OA 5A69A 2LQGA 1BBHA 3M79A 4E18A 4JC7A 1QQ3A 3W8IA 2YVKA 4CIHA 2WVOA 1T6IA 2LK4A 3C8GD 4GQHA 1T9KA 3DMDA 5KYXB 3CZ6A 1OW6A 3EG9B 1JOGA 1BR4A 4XWJA 5L0JA 2AU5A 3LUTB 3R2PA 1XZPA 2JD3A 4YL0A 3TOLA 2KK1A 3E70C 3K1HA 1HW2A 2YHSA 1BR2A 2ZXRA 1YDIA 3NYJA 4X0RA 2DGJA 3W2WA 2ASRA 4QDLA 4EBKA 3I5QA 4ER9A 5L0CA 4KI2A 1M57C 2A1DD 2A6HF 4ANJA 2P61A 5DS6A 1WTYA 4PK4A 1VLTA 2CW0F 2I8BA 2CCYA 2ZXWC 2G3VA 3M15A 2J45A 4CDVA 5TJ5E 4AL0A 1Z5ZA 3ZQYA 3W4YA 2MWQA 2ZD9A 1VOMA 3EH2A 3L0IA 4MNDA 4XPXA 3DWWA 2AVKA 2H7BA 3FVYA 3ZWIA 1VYIA 1TWHA 3QVYA 4JTAB 2H8AA 1S7ZA 2WL8A 3QMKA 4YK5A 4CS9C 1O87A 4FAPB 1E86A 1VTMP 2NUTA 4CS8C 4Q7CA 3Q6MA 1NG1A 4KNVA 2X0CA 2TMVP 1NU9C 3CQZA 2HS5A 3EQLF 3LLKA 3CEXA 5KYYA 4HFKB 1HE9A 1O3UA 2PF4E 1OQCA 3QW1A 5DQTA 4ZLCA 3FXHA 2R25A 2QTVA 4MTOA 4ULVA 1OCOC 4FESA 4BEMJ 4WABA 2J9WA 3KMIA 3S29A 3AGUA 5T3WA 3TJ6A 5T1DB 3UGPA 2Q00A 1VK5A 2ZPAA 1LM3B 2A0UA 2FAPB 4XQ1A 1HMOA 1N1CA 4QI0A 1TKNA 1VYKA 2R03A 4PR9A 3IPMO 4CDAA 4E7ZA 4O79A 3NYMA 3TJ5A 1KU2A 3B9QA 2XM0A 1T6UA 3K66A 4H54A 1DOWA 3EZHA 4AL1A 3HLZA 2J0WA 3U5SA 1NFNA 1Q0DA 2L9JA 3C18A 4C3EA 1YYJA 1RXQA 2EIKC 2O9XA 1L7CA 5A6KA 5COFA 2YKZA 5IY5C 4EWCA 1XZQA 2B0HA 2XXAB 2V3CC 4Z9JA 2D4UA 4LLEA 3S0XA 3B0VC 2I15A 4OIOF 4DBRA 3U2MA 5KYXA 1QKRA 1LI7A 1HY5A 1NZEA 4BJ5A 1R4TA 1LIHA 3DD7A 3RVYA 2PFDA 2R7XA 3M1CB 3F46A 4N6CA 3RYLA 1C02A 5E33A 1AVOB 2R7VA 4U9EA 3BEHA 3OEOA 1QPUA 4NTAA 2A0BA 2UUIA 1FMVA 2XLDA 1D1AA 2J9VA 3UMIA 5DS4A 3NKDA 3V5ZA 1G4US 5FZTA 2YZSA 4F4BA 4NCQA 2KGOA 4MW3A 4JEAA 1EA8A 4MTGA 3JRMO 4IJJA 2B0JA 5JVEA 3FAPB 3IQ5A 3UGOA 1HW1A 1YA9A 3H2VA 4K7BA 4JJFA 4DJ9A 3C62A 4YWQA 2XXAA 2H7VC 2QNLA 1SMYF 3LS1A 1ZW2A 3JTLO 4LDQA 4CX9A 1MMDA 3PHF2 2R7QA 2EIJC 1BR1A 2HMQA 2Q9CA 1Q0KA 3L1MA 3NG1A 3MYFA 3PCVA 2CYDA 4J7YA 1H9TA 2IXOA 3IQ6A 1LS1A 3POVA 5T3TA 2R7WA 2NUTB 3O39A 3L8IA 4MQ9F 4OD4A 3DJUB 4XPWA 4U5HA 4YL1A 2HMZA 5CI9A 2W9YA 3C7JA 2ICWG 3JSEO 4JRZA 2Y3DA 1CGOA 2YLDA 5KYUA 4DVYP 3AJMA 2IOQA 4H4KC 1A7DA 1UG7A 3O6XA 4JE9A 3O10A 1JR8A 2YWAA 4KNWA 4GYTA 3VRCA 1E84A 2XL4A 5F5HA 1H9GA 2LD6A 3LNMB 3IEEA 3N2ZB 4U5GA 3RQFA 3S84A 1VB5A 1TWCA 3JRTA 4W8PA 5L0FA 1RJ9B 3IQTA 2M64A 5JT4A 1CGNA 3ZIBA 1SYQA 2XS8A 3NDBB 3CAXA 2P0NA 4QI2A 2BL2A 2YL1A 4JW1A 3LNRA 1IZMA 1D0XA 2Y69C 2YRFA 2Q9AA 2W45A 1T5OA 2CNWD 2NSGA 3AQBA 3ASNC 3JZ0A 3DE9A 3WG7C 3B0UX 2RSEB 3DZAA 1LVKA 4WJ0A 3SP1A 2C04A 3S90A 3KH2A 4Q4ZF 3ZVRA 4LLCA 2W4BA 2G3KA 5D92A 2Z15A 1TWGA 3UNGC 1NU7D 4MVMA 3JYYA 1I4ZA 3T6GB 4EUKB 2ZXPA 1YARO 2NG1A 4PFPA 4XLNF 4OIPF 1K05A 4HFFB 1HE1A 3EGXA 3ZG1A 3GM2A 1WGWA 3MLGA 5BQIA 1ZU5A 1FMWA 2LP4A 2MYSA 2YL7A 3SEOA 1AEPA 4AK9A 5B3SC 1Q0GA 2Y3HA 1G4WR 4P9FA 1I5NA 1YVIA 3ZTMA 4MVQA 1K04A 2YEVA 2WB7A 1OR2A 4BPMA 3QW0A 1UFBA 4U5FE 2EPOA 3NRHA 2Y39A 4I44A 2HKVA 2IM8A 3ABKC 3Q7GA 4KC9A 3T6BA 3EH1A 4AE4B 5JP7A 4CJGA 2G62A 1APCA 4CSAC 1C03A 1RMVA 3KYIA 1WATA 4UDVA 4IRUA 3A11A 2XLWA 1PD0A 3Q6NA 3R7CA 4YT4A 1YAUO 1AUEA 4G7HF 4BEJA 1Q0FA 1Z6AA 2QE9A 2XL6A 1FTSA 3G4ZA 2VASA 3MX3A 3B29A 2Q4FA 3N24A 4Z9HA 2PX0A 2A6EF 4LDRA 4BJTA 3PDMP 2BE5F 4MTFA 2LIGA 1YA7O 5KYUB 4CS9A 3WHNA 1MNEA 4K1OA 3RIPA 1EQ1A 3FOOA 1RJ9A 1YJGA 4I3MA 4CS8A 1BDJB 2NSFA 4OINF 2R7UA 3AG4C 2UUHA 3NMJA 5JUAA 3MFNA 4YT8A 3Q7LA 2L6GA 3W8HA 1D1BA 3CSKA 2CGEA 4IAQA 4NQFA 3RQGA 2DYSC 2OEVA 2XS1A 3HNIA 2ZXOA 3U3FA 3I5PA 1Z63A 1D1CA 3DXJF 1YZAA 1SZIA 3K1IC 1JAFA 5COGA 3FOPA 1YZCA 3EFOA 3UMKA 5L0IA 4JJGA 3QVZA 2Y3GA 3SXMA 3LLIA 2M4EA 1OR3A 1ZHYA 1TQGA 3KKBA 1WASA 1TWAA 4J7TA 4CS7A 5K0IA 5F5FA 3HKKA 1WWPA 4C3BA 3ASOC 4FWVA 4PACA 2OU6A 5AC4A 1SR2A 2BC5A 1A41A 3U2LA 4G7OF 1NFOA 1Y4CA 3RKOF 4BJ5C 1LE4A 1CPQA 4E17A 3K7DA 4A4AA 1YYXA 3SZRA 3KYJA 2J46A 3W2VA 1QSPA 4OD5A 3EGXB 1L3PA 4U5BE 3HJCA 4XPYA 4E0IA 4N6HA 1MMNA 1H6GA 2OCCC 2KQ9A 2L7AA 2YLIA 1ORJA 2VB6A 3HNLA 4K0DA 4LDKA 4RBNA 4AE4A 2E87A 3NYLA 4I1MA 1OW7A 3B0PA 2QLAA 3ZSUA 3C8GB 2J7PA 2IYLD 3DKAA 4XTKA 5EGYA 2HV6A 3OA1A 4JZAA 1IW7F 1GGQA 5E2QA 3AOUA 3WAQA 3NMKA 3ITFA 2XLMA 2IXNA 5A6BA 4IAOA 4BJ6C 2L6HA 1TFKB 3EGDB 2R02A 2OJQA 4LACB 2KJGA 4LERA 1ORYA 2MHRA 3ECSA 1YLMA 256BA 2XM4A 3AG1C 4IWBA 1TFOB 1V54C 4O6NA 1OKKA 5EK0A 3FAJA 5KYNA 3K33A 3LJBA 1ZZPA 4YN0B 3A9CA 1V4AA 2HUJA 3L34A 2P7VA 2JPUA 2R7RA 1Z3IX 2LSEA 4JEBA 2H7OA 1QZXA 3H65A 4PJLA 3QTHA 1M2VA 1B68A 3U9JA 1KNYA 3KPHA 1LE2A 3ZDLA 4JCHA 2VCAA 4G0HA 1A0BA 4DVZA 3J06A 2KSFA 3M4BA 3EJNA 3AQCA 3FMSA 3LS0A 4WGZA 2FFHA 1OXBA 1C17M 1JMWA 2OQMA 3C8ZA 4IGGA 4XLPF 5COMA 2NPUA 2A68F 2YQYA 1JPJA 3GEIA 1OXKA 3GWLA 1DOVA 2HV7A 2Q3TA 1A7EA 3LEOA 4KBLA 3T4RA 2WVQA 4P9TA 4U5EE 4JCZA 2V26A 4ULWA 1CGME 5DVWA 3EFOB 5FCLA 3VYWA 3NKEA 1I4YA 1MQVA 2GWWA 2KYHA 3GORA 4NY3A 4BJ1A 1WOLA 4EBBA 4ZLDA 4PJNA 5HV9A 1T6QA 2AWCA 2D5RB 2HSBA 2LFFA 4BG0A 1GM5A 2YLGA 2EPMX 1OW8A 2Q9BA 2J8WA 5DLJA 4Z9IA 1ZYRF 5A6JA 3B71A 1FAPB 3MBGA 2XRHA 2XLEA 2HJ3A 1U6HA 4G78A 3DJNB 3RVZA 3S9OA 3GEHA 1Q0MA 2IXMA 3N0TA 4U9DA 4AX2A 2KW3C 1RKEA 2QUPA 4DXWA 2XLHA 5L0HA 1F1MA 2NUPB 3C8GA 2PBEA 2YL3A 5L0DA 3U8PA 1Z23A 4OIQF 4XEVA 5JLIA 5KYWB 2WZLA 2OKUA 3HNJA 4O6YA 1VMAA 1FFTC 2P1AA 3AG2C 2GDCA 3K6BA 3EGDA 1Z7Qc 2RD9A 2HZ8A 3SXKA 2QY9A 2EPLX 1MMAA 1ZHTA 2CDQA 3EPVA 5B1BC 2L6FA 5L3QA 5DQZA 1PCXA 2R7SA 5L0GA 3JCUQ 4MS2A 1FFHA 2A69F 4PJJA 1D0YA 2FGYA 4FX5A 3VM6A 4DBQA 1GQAA 1W2WA 2OEXA 3RW0A 4E7SA 1JPNA 1K40A 4CJOA 1ZW3A 4NC3A 4XEKA 4IB4A 4CSAA 3I4UA 2R7TA 1WN0A 2WZGA 1EI7A 1ZHZA 3SYNA 5JSLA 1FR0A 2OG2A 1ZU4A 3E9VA 4JTDB 2YL0A 3EHNA 2DI3A 2LCHA 2L81A 2R05A 1KTMA 3VF0A 5E3AA 4DOZA 2KC3A 1OCZC 2P6VA 1M2VB 2R7OA 3PMRA 1BZ4A 1G8XA 3AG3C 1PD1A 1U89A 3VAYA 3GWNA 4J32B 1QVXA 3LESA 1PV3A 1LI5A 3GANA 3S27A 3SXYA 3GM3A 3JSZA 4HE8D 1J8MF 1D0ZA 4MVUA 2VCBA 4J30B 2IXPA 1OCRC 4HEAJ 4L6RA 1G5ZA 3H2UA 4YT5A 1ST6A 3DE8A 5CIVA 4RDAA 4O7GA 2XSEA 3U9MA 4EHPA 2JX0A 2OJED 5JS5A 1ZHXA 2HSQA 4R32A 4JIOA 1GS9A 3GEEA 5BUOA 3V7OA 3TK0A 1M2OA 2EPKX 3K1IA 4MVZA 4DRJB 4C3DA 1LS4A 3T6JA 3ZTZA 4RD9A 4MW8A 5D91A 2NUPA 5L3VA 2LFDA 2DYRC 2HJMA 2GFHA 3DAFA 2KNHA 3EHMA 4N4WA 3V5XA 5KYWA 5AC5A 4WGYA 3RH3A 5AGFA 4MVOA 4Q5SF 1RKEB 1V74B 3LEVA 1QLEC 3FHDA 4EBJA 2EIMC 3G50A 4C7OB 3TQOA 3EG9A 4O6MA 4JURI 3TULA 3IQCA 1M56C 4MVSA 5CI8A 3TOMA 3OWTA 3RF3A 3G4XA 2DB4A 4N06A 4IARA 1MMGA 4GEHA 4PJMA 1ORSC 2J7PD 2AWYA 2HFIA 3X2QC 3ABLC 3X1OA 3NMIA 3GODA 5A6AA 1U0BB 4I1OB 5A6BD 4M63A 3U3BA 3EZIA 1JRAA 1CPRA 2WVNA 3F47A 1LKXA 3M4CA 1XWJA 3KL4A 3UMHA 5BQHA 1LPEA 1O5HA 2PNOA 3DM5A 3O55A 4YL3A 4D4XA 3C63A 4JKVA 4YT2A 2J9UA 3DAGA 1M6TA 2GA0A 4OIRF 3S28A 1Y6DA 2VCCA 4BJ6A 4G7ZF 4P6IC 3DI5A 2EINC 3MYIA 2XLVA 5B3IA 3US6A 1OKKD 4YJWA 1NBBA 2AP3A
chains in the Genus database with same CATH topology
3AOUA 2BL2A 2DB4A 2CYDA 5TJ5E 4BEMJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AOU A;  2BL2 A;  2DB4 A;  2CYD A;  5TJ5 E;  4BEM J; 
#chains in the Genus database with same CATH topology
 5BQG A;  3T9O A;  3FDQ A;  3GM1 A;  3L8J A;  2EIL C;  4JVS A;  4NTB A;  4W8K A;  1S05 A;  2XL8 A;  3IHU A;  3ABM C;  4JTC B;  4NTF A;  2OOC A;  3UR3 C;  3HNK A;  5HSW A;  3HTK C;  3JYH A;  4CDY A;  5JRA A;  3TD7 A;  5EHH A;  1E83 A;  1A7V A;  4MVR A;  4DRI B;  1TR2 A;  4EIY A;  2F22 A;  2R9R B;  3ZQV A;  2VH3 A;  5KYY B;  2W4M A;  4E0H A;  2J9B A;  4D4N A;  1J8Y F;  5F28 E;  2Q7R A;  1MND A;  2XLO A;  4U5D E;  1H7I A;  3U0C A;  2PP4 A;  1ZHW A;  3DM9 B;  3WOD F;  4EKW A;  2X51 A;  3U8V A;  4DRH B;  4A2N B;  2EPN A;  2IBF A;  2C03 A;  1EKY A;  1SF8 A;  1E85 A;  3RFY A;  4CIP A;  2Y3B A;  3QZC A;  1ZVZ A;  3BRJ A;  1RKC A;  1FNT c;  4CBE A;  3V5Y A;  2J0X A;  2CNW A;  1NLX A;  1RCP A;  3SNH A;  2WZF A;  3AGT A;  5B1A C;  1V55 C;  4B6I A;  1OCC C;  2VC9 A;  5DS5 A;  3RQE A;  4PFO A;  4U5C E;  3JT1 A;  5E3C A;  5GPG B;  3LAY A;  1E2X A;  3ZC4 A;  1T01 A;  2PX3 A;  3ATP A;  1NSG B;  2ETS A;  2GAQ A;  4XEF A;  4ONS A;  3SXZ A;  1VLS A;  1HMD A;  1R5I D;  4C7O A;  5A69 A;  2LQG A;  1BBH A;  3M79 A;  4E18 A;  4JC7 A;  1QQ3 A;  3W8I A;  2YVK A;  4CIH A;  2WVO A;  1T6I A;  2LK4 A;  3C8G D;  4GQH A;  1T9K A;  3DMD A;  5KYX B;  3CZ6 A;  1OW6 A;  3EG9 B;  1JOG A;  1BR4 A;  4XWJ A;  5L0J A;  2AU5 A;  3LUT B;  3R2P A;  1XZP A;  2JD3 A;  4YL0 A;  3TOL A;  2KK1 A;  3E70 C;  3K1H A;  1HW2 A;  2YHS A;  1BR2 A;  2ZXR A;  1YDI A;  3NYJ A;  4X0R A;  2DGJ A;  3W2W A;  2ASR A;  4QDL A;  4EBK A;  3I5Q A;  4ER9 A;  5L0C A;  4KI2 A;  1M57 C;  2A1D D;  2A6H F;  4ANJ A;  2P61 A;  5DS6 A;  1WTY A;  4PK4 A;  1VLT A;  2CW0 F;  2I8B A;  2CCY A;  2ZXW C;  2G3V A;  3M15 A;  2J45 A;  4CDV A;  5TJ5 E;  4AL0 A;  1Z5Z A;  3ZQY A;  3W4Y A;  2MWQ A;  2ZD9 A;  1VOM A;  3EH2 A;  3L0I A;  4MND A;  4XPX A;  3DWW A;  2AVK A;  2H7B A;  3FVY A;  3ZWI A;  1VYI A;  1TWH A;  3QVY A;  4JTA B;  2H8A A;  1S7Z A;  2WL8 A;  3QMK A;  4YK5 A;  4CS9 C;  1O87 A;  4FAP B;  1E86 A;  1VTM P;  2NUT A;  4CS8 C;  4Q7C A;  3Q6M A;  1NG1 A;  4KNV A;  2X0C A;  2TMV P;  1NU9 C;  3CQZ A;  2HS5 A;  3EQL F;  3LLK A;  3CEX A;  5KYY A;  4HFK B;  1HE9 A;  1O3U A;  2PF4 E;  1OQC A;  3QW1 A;  5DQT A;  4ZLC A;  3FXH A;  2R25 A;  2QTV A;  4MTO A;  4ULV A;  1OCO C;  4FES A;  4BEM J;  4WAB A;  2J9W A;  3KMI A;  3S29 A;  3AGU A;  5T3W A;  3TJ6 A;  5T1D B;  3UGP A;  2Q00 A;  1VK5 A;  2ZPA A;  1LM3 B;  2A0U A;  2FAP B;  4XQ1 A;  1HMO A;  1N1C A;  4QI0 A;  1TKN A;  1VYK A;  2R03 A;  4PR9 A;  3IPM O;  4CDA A;  4E7Z A;  4O79 A;  3NYM A;  3TJ5 A;  1KU2 A;  3B9Q A;  2XM0 A;  1T6U A;  3K66 A;  4H54 A;  1DOW A;  3EZH A;  4AL1 A;  3HLZ A;  2J0W A;  3U5S A;  1NFN A;  1Q0D A;  2L9J A;  3C18 A;  4C3E A;  1YYJ A;  1RXQ A;  2EIK C;  2O9X A;  1L7C A;  5A6K A;  5COF A;  2YKZ A;  5IY5 C;  4EWC A;  1XZQ A;  2B0H A;  2XXA B;  2V3C C;  4Z9J A;  2D4U A;  4LLE A;  3S0X A;  3B0V C;  2I15 A;  4OIO F;  4DBR A;  3U2M A;  5KYX A;  1QKR A;  1LI7 A;  1HY5 A;  1NZE A;  4BJ5 A;  1R4T A;  1LIH A;  3DD7 A;  3RVY A;  2PFD A;  2R7X A;  3M1C B;  3F46 A;  4N6C A;  3RYL A;  1C02 A;  5E33 A;  1AVO B;  2R7V A;  4U9E A;  3BEH A;  3OEO A;  1QPU A;  4NTA A;  2A0B A;  2UUI A;  1FMV A;  2XLD A;  1D1A A;  2J9V A;  3UMI A;  5DS4 A;  3NKD A;  3V5Z A;  1G4U S;  5FZT A;  2YZS A;  4F4B A;  4NCQ A;  2KGO A;  4MW3 A;  4JEA A;  1EA8 A;  4MTG A;  3JRM O;  4IJJ A;  2B0J A;  5JVE A;  3FAP B;  3IQ5 A;  3UGO A;  1HW1 A;  1YA9 A;  3H2V A;  4K7B A;  4JJF A;  4DJ9 A;  3C62 A;  4YWQ A;  2XXA A;  2H7V C;  2QNL A;  1SMY F;  3LS1 A;  1ZW2 A;  3JTL O;  4LDQ A;  4CX9 A;  1MMD A;  3PHF 2;  2R7Q A;  2EIJ C;  1BR1 A;  2HMQ A;  2Q9C A;  1Q0K A;  3L1M A;  3NG1 A;  3MYF A;  3PCV A;  2CYD A;  4J7Y A;  1H9T A;  2IXO A;  3IQ6 A;  1LS1 A;  3POV A;  5T3T A;  2R7W A;  2NUT B;  3O39 A;  3L8I A;  4MQ9 F;  4OD4 A;  3DJU B;  4XPW A;  4U5H A;  4YL1 A;  2HMZ A;  5CI9 A;  2W9Y A;  3C7J A;  2ICW G;  3JSE O;  4JRZ A;  2Y3D A;  1CGO A;  2YLD A;  5KYU A;  4DVY P;  3AJM A;  2IOQ A;  4H4K C;  1A7D A;  1UG7 A;  3O6X A;  4JE9 A;  3O10 A;  1JR8 A;  2YWA A;  4KNW A;  4GYT A;  3VRC A;  1E84 A;  2XL4 A;  5F5H A;  1H9G A;  2LD6 A;  3LNM B;  3IEE A;  3N2Z B;  4U5G A;  3RQF A;  3S84 A;  1VB5 A;  1TWC A;  3JRT A;  4W8P A;  5L0F A;  1RJ9 B;  3IQT A;  2M64 A;  5JT4 A;  1CGN A;  3ZIB A;  1SYQ A;  2XS8 A;  3NDB B;  3CAX A;  2P0N A;  4QI2 A;  2BL2 A;  2YL1 A;  4JW1 A;  3LNR A;  1IZM A;  1D0X A;  2Y69 C;  2YRF A;  2Q9A A;  2W45 A;  1T5O A;  2CNW D;  2NSG A;  3AQB A;  3ASN C;  3JZ0 A;  3DE9 A;  3WG7 C;  3B0U X;  2RSE B;  3DZA A;  1LVK A;  4WJ0 A;  3SP1 A;  2C04 A;  3S90 A;  3KH2 A;  4Q4Z F;  3ZVR A;  4LLC A;  2W4B A;  2G3K A;  5D92 A;  2Z15 A;  1TWG A;  3UNG C;  1NU7 D;  4MVM A;  3JYY A;  1I4Z A;  3T6G B;  4EUK B;  2ZXP A;  1YAR O;  2NG1 A;  4PFP A;  4XLN F;  4OIP F;  1K05 A;  4HFF B;  1HE1 A;  3EGX A;  3ZG1 A;  3GM2 A;  1WGW A;  3MLG A;  5BQI A;  1ZU5 A;  1FMW A;  2LP4 A;  2MYS A;  2YL7 A;  3SEO A;  1AEP A;  4AK9 A;  5B3S C;  1Q0G A;  2Y3H A;  1G4W R;  4P9F A;  1I5N A;  1YVI A;  3ZTM A;  4MVQ A;  1K04 A;  2YEV A;  2WB7 A;  1OR2 A;  4BPM A;  3QW0 A;  1UFB A;  4U5F E;  2EPO A;  3NRH A;  2Y39 A;  4I44 A;  2HKV A;  2IM8 A;  3ABK C;  3Q7G A;  4KC9 A;  3T6B A;  3EH1 A;  4AE4 B;  5JP7 A;  4CJG A;  2G62 A;  1APC A;  4CSA C;  1C03 A;  1RMV A;  3KYI A;  1WAT A;  4UDV A;  4IRU A;  3A11 A;  2XLW A;  1PD0 A;  3Q6N A;  3R7C A;  4YT4 A;  1YAU O;  1AUE A;  4G7H F;  4BEJ A;  1Q0F A;  1Z6A A;  2QE9 A;  2XL6 A;  1FTS A;  3G4Z A;  2VAS A;  3MX3 A;  3B29 A;  2Q4F A;  3N24 A;  4Z9H A;  2PX0 A;  2A6E F;  4LDR A;  4BJT A;  3PDM P;  2BE5 F;  4MTF A;  2LIG A;  1YA7 O;  5KYU B;  4CS9 A;  3WHN A;  1MNE A;  4K1O A;  3RIP A;  1EQ1 A;  3FOO A;  1RJ9 A;  1YJG A;  4I3M A;  4CS8 A;  1BDJ B;  2NSF A;  4OIN F;  2R7U A;  3AG4 C;  2UUH A;  3NMJ A;  5JUA A;  3MFN A;  4YT8 A;  3Q7L A;  2L6G A;  3W8H A;  1D1B A;  3CSK A;  2CGE A;  4IAQ A;  4NQF A;  3RQG A;  2DYS C;  2OEV A;  2XS1 A;  3HNI A;  2ZXO A;  3U3F A;  3I5P A;  1Z63 A;  1D1C A;  3DXJ F;  1YZA A;  1SZI A;  3K1I C;  1JAF A;  5COG A;  3FOP A;  1YZC A;  3EFO A;  3UMK A;  5L0I A;  4JJG A;  3QVZ A;  2Y3G A;  3SXM A;  3LLI A;  2M4E A;  1OR3 A;  1ZHY A;  1TQG A;  3KKB A;  1WAS A;  1TWA A;  4J7T A;  4CS7 A;  5K0I A;  5F5F A;  3HKK A;  1WWP A;  4C3B A;  3ASO C;  4FWV A;  4PAC A;  2OU6 A;  5AC4 A;  1SR2 A;  2BC5 A;  1A41 A;  3U2L A;  4G7O F;  1NFO A;  1Y4C A;  3RKO F;  4BJ5 C;  1LE4 A;  1CPQ A;  4E17 A;  3K7D A;  4A4A A;  1YYX A;  3SZR A;  3KYJ A;  2J46 A;  3W2V A;  1QSP A;  4OD5 A;  3EGX B;  1L3P A;  4U5B E;  3HJC A;  4XPY A;  4E0I A;  4N6H A;  1MMN A;  1H6G A;  2OCC C;  2KQ9 A;  2L7A A;  2YLI A;  1ORJ A;  2VB6 A;  3HNL A;  4K0D A;  4LDK A;  4RBN A;  4AE4 A;  2E87 A;  3NYL A;  4I1M A;  1OW7 A;  3B0P A;  2QLA A;  3ZSU A;  3C8G B;  2J7P A;  2IYL D;  3DKA A;  4XTK A;  5EGY A;  2HV6 A;  3OA1 A;  4JZA A;  1IW7 F;  1GGQ A;  5E2Q A;  3AOU A;  3WAQ A;  3NMK A;  3ITF A;  2XLM A;  2IXN A;  5A6B A;  4IAO A;  4BJ6 C;  2L6H A;  1TFK B;  3EGD B;  2R02 A;  2OJQ A;  4LAC B;  2KJG A;  4LER A;  1ORY A;  2MHR A;  3ECS A;  1YLM A;  256B A;  2XM4 A;  3AG1 C;  4IWB A;  1TFO B;  1V54 C;  4O6N A;  1OKK A;  5EK0 A;  3FAJ A;  5KYN A;  3K33 A;  3LJB A;  1ZZP A;  4YN0 B;  3A9C A;  1V4A A;  2HUJ A;  3L34 A;  2P7V A;  2JPU A;  2R7R A;  1Z3I X;  2LSE A;  4JEB A;  2H7O A;  1QZX A;  3H65 A;  4PJL A;  3QTH A;  1M2V A;  1B68 A;  3U9J A;  1KNY A;  3KPH A;  1LE2 A;  3ZDL A;  4JCH A;  2VCA A;  4G0H A;  1A0B A;  4DVZ A;  3J06 A;  2KSF A;  3M4B A;  3EJN A;  3AQC A;  3FMS A;  3LS0 A;  4WGZ A;  2FFH A;  1OXB A;  1C17 M;  1JMW A;  2OQM A;  3C8Z A;  4IGG A;  4XLP F;  5COM A;  2NPU A;  2A68 F;  2YQY A;  1JPJ A;  3GEI A;  1OXK A;  3GWL A;  1DOV A;  2HV7 A;  2Q3T A;  1A7E A;  3LEO A;  4KBL A;  3T4R A;  2WVQ A;  4P9T A;  4U5E E;  4JCZ A;  2V26 A;  4ULW A;  1CGM E;  5DVW A;  3EFO B;  5FCL A;  3VYW A;  3NKE A;  1I4Y A;  1MQV A;  2GWW A;  2KYH A;  3GOR A;  4NY3 A;  4BJ1 A;  1WOL A;  4EBB A;  4ZLD A;  4PJN A;  5HV9 A;  1T6Q A;  2AWC A;  2D5R B;  2HSB A;  2LFF A;  4BG0 A;  1GM5 A;  2YLG A;  2EPM X;  1OW8 A;  2Q9B A;  2J8W A;  5DLJ A;  4Z9I A;  1ZYR F;  5A6J A;  3B71 A;  1FAP B;  3MBG A;  2XRH A;  2XLE A;  2HJ3 A;  1U6H A;  4G78 A;  3DJN B;  3RVZ A;  3S9O A;  3GEH A;  1Q0M A;  2IXM A;  3N0T A;  4U9D A;  4AX2 A;  2KW3 C;  1RKE A;  2QUP A;  4DXW A;  2XLH A;  5L0H A;  1F1M A;  2NUP B;  3C8G A;  2PBE A;  2YL3 A;  5L0D A;  3U8P A;  1Z23 A;  4OIQ F;  4XEV A;  5JLI A;  5KYW B;  2WZL A;  2OKU A;  3HNJ A;  4O6Y A;  1VMA A;  1FFT C;  2P1A A;  3AG2 C;  2GDC A;  3K6B A;  3EGD A;  1Z7Q c;  2RD9 A;  2HZ8 A;  3SXK A;  2QY9 A;  2EPL X;  1MMA A;  1ZHT A;  2CDQ A;  3EPV A;  5B1B C;  2L6F A;  5L3Q A;  5DQZ A;  1PCX A;  2R7S A;  5L0G A;  3JCU Q;  4MS2 A;  1FFH A;  2A69 F;  4PJJ A;  1D0Y A;  2FGY A;  4FX5 A;  3VM6 A;  4DBQ A;  1GQA A;  1W2W A;  2OEX A;  3RW0 A;  4E7S A;  1JPN A;  1K40 A;  4CJO A;  1ZW3 A;  4NC3 A;  4XEK A;  4IB4 A;  4CSA A;  3I4U A;  2R7T A;  1WN0 A;  2WZG A;  1EI7 A;  1ZHZ A;  3SYN A;  5JSL A;  1FR0 A;  2OG2 A;  1ZU4 A;  3E9V A;  4JTD B;  2YL0 A;  3EHN A;  2DI3 A;  2LCH A;  2L81 A;  2R05 A;  1KTM A;  3VF0 A;  5E3A A;  4DOZ A;  2KC3 A;  1OCZ C;  2P6V A;  1M2V B;  2R7O A;  3PMR A;  1BZ4 A;  1G8X A;  3AG3 C;  1PD1 A;  1U89 A;  3VAY A;  3GWN A;  4J32 B;  1QVX A;  3LES A;  1PV3 A;  1LI5 A;  3GAN A;  3S27 A;  3SXY A;  3GM3 A;  3JSZ A;  4HE8 D;  1J8M F;  1D0Z A;  4MVU A;  2VCB A;  4J30 B;  2IXP A;  1OCR C;  4HEA J;  4L6R A;  1G5Z A;  3H2U A;  4YT5 A;  1ST6 A;  3DE8 A;  5CIV A;  4RDA A;  4O7G A;  2XSE A;  3U9M A;  4EHP A;  2JX0 A;  2OJE D;  5JS5 A;  1ZHX A;  2HSQ A;  4R32 A;  4JIO A;  1GS9 A;  3GEE A;  5BUO A;  3V7O A;  3TK0 A;  1M2O A;  2EPK X;  3K1I A;  4MVZ A;  4DRJ B;  4C3D A;  1LS4 A;  3T6J A;  3ZTZ A;  4RD9 A;  4MW8 A;  5D91 A;  2NUP A;  5L3V A;  2LFD A;  2DYR C;  2HJM A;  2GFH A;  3DAF A;  2KNH A;  3EHM A;  4N4W A;  3V5X A;  5KYW A;  5AC5 A;  4WGY A;  3RH3 A;  5AGF A;  4MVO A;  4Q5S F;  1RKE B;  1V74 B;  3LEV A;  1QLE C;  3FHD A;  4EBJ A;  2EIM C;  3G50 A;  4C7O B;  3TQO A;  3EG9 A;  4O6M A;  4JUR I;  3TUL A;  3IQC A;  1M56 C;  4MVS A;  5CI8 A;  3TOM A;  3OWT A;  3RF3 A;  3G4X A;  2DB4 A;  4N06 A;  4IAR A;  1MMG A;  4GEH A;  4PJM A;  1ORS C;  2J7P D;  2AWY A;  2HFI A;  3X2Q C;  3ABL C;  3X1O A;  3NMI A;  3GOD A;  5A6A A;  1U0B B;  4I1O B;  5A6B D;  4M63 A;  3U3B A;  3EZI A;  1JRA A;  1CPR A;  2WVN A;  3F47 A;  1LKX A;  3M4C A;  1XWJ A;  3KL4 A;  3UMH A;  5BQH A;  1LPE A;  1O5H A;  2PNO A;  3DM5 A;  3O55 A;  4YL3 A;  4D4X A;  3C63 A;  4JKV A;  4YT2 A;  2J9U A;  3DAG A;  1M6T A;  2GA0 A;  4OIR F;  3S28 A;  1Y6D A;  2VCC A;  4BJ6 A;  4G7Z F;  4P6I C;  3DI5 A;  2EIN C;  3MYI A;  2XLV A;  5B3I A;  3US6 A;  1OKK D;  4YJW A;  1NBB A;  2AP3 A; 
#chains in the Genus database with same CATH homology
 3AOU A;  2BL2 A;  2DB4 A;  2CYD A;  5TJ5 E;  4BEM J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...