3AOUA

Structure of the na+ unbound rotor ring modified with n,n f-dicyclohexylcarbodiimide of the na+-transporting v-atpase
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
156
structure length
156
Chain Sequence
b'MMDYLITQNGGMVFAVLAMATATIFSGIGSAKGVGMTGEAAAALTTSQPEKFGQALILQLLPGTQGLYGFVIAFLIFINLGSDMSVVQGLNFLGASLPIAFTGLFSGIAQGKVAAAGIQILAKKPEHATKGIIFAAMVETYAILGFVISFLLVLNA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords V-type sodium ATPase subunit K
publication title Structure of the rotor ring modified with N,N'-dicyclohexylcarbodiimide of the Na+-transporting vacuolar ATPase.
pubmed doi rcsb
source organism Enterococcus hirae
molecule tags Hydrolase
total genus 65
structure length 156
sequence length 156
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2010-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00137 ATP-synt_C ATP synthase subunit C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.610 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) lithium bound rotor ring of v- atpase 3aouA00
5TJ5E 2CYDA 4BEMJ 2DB4A 2BL2A 3AOUA
chains in the Genus database with same CATH superfamily
1WATA 5D91A 2R7OA 5B1AC 3RF3A 4U9DA 2HSQA 3W2WA 5EGYA 1DOVA 3K7DA 3GEEA 4PFOA 1HMDA 4MVRA 5F5HA 5A6KA 2A0BA 3LESA 1ZHZA 4YL1A 2RD9A 4G7ZF 4BJ5A 1GS9A 1LS1A 1MMDA 4RBNA 3DAFA 3T9OA 1R5ID 1QKRA 1SZIA 3AJMA 2XXAB 2EINC 3IEEA 3UR3C 3ZC4A 1VYIA 4EIYA 4I1OB 3LEOA 1TWAA 3FAJA 4K1OA 3U8PA 3IQ5A 3TOLA 1MNDA 3S28A 1LI5A 4R32A 1OQCA 2J7PD 4OIQF 5F28E 4KNVA 3U0CA 3U8VA 3C8GB 3Q6NA 1JOGA 3GANA 4MVMA 3JCUQ 3MFNA 1C03A 1QSPA 3HNIA 3LLKA 1Q0MA 4JE9A 1J8MF 2HUJA 1IZMA 4E0IA 4OD5A 5JLIA 1GQAA 2ASRA 2H7BA 2M4EA 2YLGA 3H2UA 1Q0FA 4LERA 1A41A 5KYWA 3QW0A 5T3WA 2ZXOA 2A69F 4JEBA 1Q0GA 2ZPAA 2KYHA 1G4WR 3FOPA 2DI3A 5E3AA 4I3MA 4A2NB 4AE4B 1EA8A 1Z63A 1ZZPA 3K1HA 1Z7Qc 1OCOC 3S90A 3EHMA 4J32B 5T1DB 1Z5ZA 2ICWG 1U0BB 3DJNB 3JRTA 1QVXA 1D0ZA 2FFHA 1M2OA 1S05A 2XLHA 5BQGA 2R7RA 2NG1A 3I4UA 1MMGA 1D0XA 4LLEA 2DYSC 4Q7CA 3QVYA 4C3DA 2BC5A 2CNWD 4H4KC 2YLDA 3NMJA 5JT4A 1LKXA 2O9XA 1M2VA 3C18A 5KYYB 3RQGA 2Q4FA 2PFDA 2VB6A 4O6MA 3POVA 1OXBA 3GODA 3JYHA 2AWCA 2KQ9A 3DZAA 2FAPB 3FAPB 1WASA 3LJBA 3EGDA 1KU2A 2XSEA 3S9OA 4C7OB 4MTGA 1EI7A 5CIVA 1A7DA 3M4CA 4OINF 1Z3IX 1R4TA 2NUPB 1CGNA 3IHUA 2NUTA 1FFHA 1D1BA 4MNDA 2LCHA 3SNHA 4DVZA 1HW1A 4U5HA 2M64A 1E86A 4LDKA 1Q0DA 4CSAA 5A6AA 2BE5F 4XEFA 2I15A 3CZ6A 3LNMB 2YKZA 2YHSA 4JKVA 4BJ6C 1E83A 1EKYA 5L0DA 5JUAA 5A6BD 3ASNC 3ZG1A 2AP3A 2XXAA 4U5EE 1K04A 2UUIA 3AG3C 3JRMO 1YAUO 256BA 2LP4A 4MTFA 2OJQA 1YA7O 3ZVRA 1WWPA 4P6IC 4K0DA 5L0IA 2V3CC 4EBJA 2HMQA 4OIPF 3A11A 3JSEO 4CS8C 3DI5A 4WGZA 4LDQA 2IXPA 3JSZA 4WABA 2JD3A 4IJJA 1H7IA 2CNWA 3QTHA 2PP4A 2EIMC 1LM3B 1ORSC 4YJWA 4A4AA 3T4RA 5BUOA 1FR0A 1YARO 3KYJA 3QMKA 1SMYF 2WL8A 2Q9CA 1T9KA 2CW0F 2G3VA 4PFPA 4MVQA 1T5OA 3KYIA 2QNLA 1UFBA 2JPUA 3VAYA 4MVOA 2MWQA 3MBGA 4EKWA 4W8KA 4DXWA 5COGA 2QLAA 3LEVA 3L34A 3AOUA 1LVKA 1O3UA 1ZW2A 4HEAJ 1QQ3A 2E87A 1OW6A 1WGWA 2HZ8A 5B3SC 2R7XA 2EIJC 3MYFA 2OCCC 3TJ6A 1MQVA 3RIPA 3U9MA 2HSBA 3KMIA 4DRHB 1U6HA 1ZW3A 3C8GD 2HKVA 4HFKB 1JAFA 4I1MA 1JMWA 3I5QA 5B1BC 2R9RB 3V5ZA 3EG9B 4B6IA 2NSGA 3J06A 3O6XA 1VLSA 2C04A 2ZXWC 4I44A 2W4MA 4U5DE 2WZLA 3EPVA 2H8AA 3RH3A 4NTFA 1O87A 3GM2A 5JS5A 3U2LA 5JP7A 3Q7GA 2R7WA 3BRJA 3X1OA 2MYSA 3W4YA 4BPMA 2IOQA 1Y6DA 1QLEC 3FMSA 3U3BA 1JR8A 2LFDA 1NFNA 3GWLA 1Q0KA 3RYLA 1NBBA 1VK5A 3EZHA 4G0HA 4CIHA 5FZTA 1C17M 1BBHA 5K0IA 3B0UX 5F5FA 5DLJA 5L0FA 4AL0A 1KNYA 1ZHYA 4U5FE 4E7SA 2G3KA 3M15A 4JEAA 2Y3HA 3SEOA 4K7BA 3GWNA 3DE9A 1ST6A 3NYLA 3US6A 2P1AA 3N2ZB 4L6RA 5KYUB 2Q7RA 3L8JA 2Y69C 2Y3BA 3OEOA 4MQ9F 3K66A 1JPNA 3K1IC 1HW2A 4BEMJ 3Q7LA 1PV3A 3F47A 2A6EF 4XPWA 1TWHA 3ABKC 1BR2A 2DB4A 1YYJA 1J8YF 2I8BA 4FESA 2KSFA 2D5RB 3HKKA 3RVZA 1OR3A 2WVQA 2YWAA 1VOMA 1D1AA 1LIHA 1M56C 4IGGA 1ZHTA 3NMKA 2OOCA 1W2WA 4JCHA 1NG1A 1AVOB 2XL6A 2PX3A 2YVKA 4MS2A 1YLMA 3U5SA 2LFFA 2LQGA 4PR9A 3QVZA 5HV9A 1NSGB 3ZDLA 2H7VC 2KGOA 2LIGA 3ZSUA 3FVYA 2GWWA 4LLCA 2BL2A 3TD7A 4YT4A 1APCA 3QZCA 1E2XA 1RCPA 4N4WA 3WAQA 3SZRA 2OU6A 4KNWA 1NLXA 1ZVZA 1XWJA 1NFOA 4KBLA 2UUHA 5COMA 2YZSA 3B29A 4U9EA 4Z9HA 1G8XA 1M6TA 2EPMX 1RJ9B 3EQLF 3SXZA 3UMIA 4BJ6A 4CDYA 1SYQA 3FOOA 1VMAA 2R03A 2R7SA 2CCYA 5COFA 2HFIA 4N6CA 2A68F 1OKKD 2XL8A 1CPRA 1YJGA 4QI0A 3VM6A 4CS9C 1TFOB 3AGTA 5L0HA 4OIOF 4JTCB 4CBEA 4CS8A 3PCVA 2J9UA 2J9VA 3UNGC 4IAOA 1SR2A 2VCAA 3WG7C 2QTVA 3LUTB 4G78A 3W2VA 2J46A 2XLOA 3EH1A 3DXJF 3KL4A 4DOZA 4DBQA 2NUPA 2WVNA 2V26A 4JRZA 4MW3A 2YRFA 3TOMA 3VF0A 3MX3A 4Q4ZF 4E17A 3RW0A 2XS1A 4NY3A 4U5BE 1XZPA 2J7PA 2OKUA 1T01A 1NZEA 3EFOB 2W45A 3RQEA 1VTMP 2KK1A 4JC7A 4YWQA 2L81A 4G7HF 5KYWB 4O7GA 4Z9IA 5DQZA 2EILC 1WOLA 2WVOA 1NU9C 2XL4A 4IAQA 4NTBA 1DOWA 1A7EA 1FTSA 4LACB 4QI2A 1RKEB 4QDLA 1HMOA 3LNRA 2AU5A 4YL0A 3TULA 1FAPB 2EIKC 1IW7F 3ABLC 3BEHA 3IPMO 4DVYP 3B0PA 4M63A 3NDBB 3PDMP 2XM4A 3CSKA 3GEIA 2XM0A 3H65A 5L0CA 1VB5A 2XLMA 1D1CA 2IXMA 4PJJA 3DWWA 3SXMA 1HE9A 1RXQA 2VH3A 3RVYA 4O79A 5JVEA 5HSWA 2B0JA 2CYDA 2ZXRA 2Q00A 2Y3GA 3GORA 3LS0A 4JVSA 3K33A 2Y3DA 2WB7A 3DMDA 3EGDB 3M4BA 4MTOA 1BR4A 2VC9A 1V55C 3V5YA 4CX9A 5KYXA 3HNJA 1MMNA 3AQBA 3U2MA 2NUTB 2Z15A 3AGUA 1ZU4A 2R05A 3PHF2 4HFFB 1V74B 3ZIBA 3VYWA 2PF4E 3UGOA 3JT1A 4PJMA 3RFYA 4KI2A 3CEXA 1QZXA 2A0UA 1JPJA 4JJGA 2EPLX 1HY5A 3S84A 2YQYA 2R7TA 4PJNA 1T6QA 2J8WA 5CI8A 1KTMA 5D92A 2LSEA 4ER9A 4EHPA 2VCCA 3K1IA 1TFKB 3EZIA 4FWVA 5B3IA 1HE1A 2OQMA 3EG9A 2R7UA 2IXNA 5DS4A 3T6JA 5T3TA 3ZWIA 5A69A 2HMZA 3ATPA 3DKAA 4XWJA 4EBBA 4UDVA 3B9QA 2LK4A 2LD6A 3L8IA 2JX0A 4JIOA 5AC5A 5A6BA 2J0WA 2L6GA 2RSEB 3A9CA 3EHNA 3HLZA 3M79A 4OD4A 3K6BA 4GEHA 4F4BA 2IM8A 5E33A 3KH2A 4RD9A 4E7ZA 5JSLA 4O6YA 3AG2C 4XEKA 1BZ4A 4JJFA 2KC3A 4XLPF 3G4XA 3NMIA 2KJGA 3JTLO 2P61A 4AL1A 1I4YA 3O10A 1AUEA 4N6HA 4ULVA 2GFHA 2HJMA 2VASA 3NYJA 3S0XA 4C3BA 1N1CA 3TJ5A 4BEJA 1A7VA 3EGXB 1BDJB 1T6IA 4N06A 4BJTA 3N24A 2W9YA 3V7OA 1YZCA 1C02A 4JURI 2YL1A 3GEHA 2ZD9A 2FGYA 4CS9A 2J0XA 3NG1A 3UMKA 2EPNA 3ECSA 4MW8A 2DYRC 4X0RA 3UGPA 1LE2A 3SP1A 1TQGA 1QPUA 3DD7A 1F1MA 2P7VA 3FDQA 1CGME 1Y4CA 4JW1A 3DAGA 1Z6AA 3NYMA 5E3CA 2B0HA 3W8IA 5FCLA 3HNKA 1PD1A 1Z23A 3IQTA 1WTYA 1K40A 3C8GA 2X0CA 1SF8A 1RKCA 4XPYA 1M57C 4AK9A 4JTDB 1T6UA 1FNTc 1PD0A 4CDVA 3TQOA 3LLIA 3B0VC 4J7YA 3G4ZA 3RQFA 1OCCC 2HV6A 1BR1A 2P0NA 2Q9BA 3ZQYA 5L3QA 2QY9A 1RJ9A 2CDQA 3JYYA 3X2QC 2HS5A 4JZAA 2AVKA 2OJED 3ASOC 2TMVP 3ABMC 4MVSA 4GQHA 4AE4A 1JRAA 2IYLD 4XQ1A 3U3FA 5BQHA 2R7VA 1TWCA 3NKEA 1LI7A 5A6JA 2GAQA 3IQCA 4XPXA 4DRIB 3L0IA 3ZTZA 2HJ3A 2DGJA 2P6VA 1LE4A 4P9FA 3WHNA 1K05A 4DRJB 5L3VA 4PACA 2H7OA 2R02A 4ULWA 1ZYRF 5KYYA 3MYIA 4NQFA 4W8PA 5BQIA 2QE9A 3GM3A 4YK5A 1ZHWA 5L0JA 4U5GA 4HE8D 2L7AA 1E84A 2MHRA 2XLDA 2YL0A 4C7OA 1EQ1A 2VCBA 2PBEA 4H54A 3U9JA 3F46A 3EFOA 2Q3TA 2YLIA 5E2QA 4EWCA 1L7CA 5AGFA 3DJUB 3LS1A 4IWBA 2F22A 2L9JA 1GM5A 3S29A 4FX5A 1RKEA 3G50A 3AG1C 2AWYA 1I5NA 1U89A 1CGOA 3N0TA 4GYTA 2YL3A 1RMVA 5EK0A 2EPOA 1A0BA 2OEXA 2A1DD 3VRCA 1NU7D 4YT5A 3KPHA 3TK0A 3HTKC 4BJ1A 3GM1A 4BJ5C 1D0YA 1MMAA 1OR2A 1H9GA 4CIPA 4XTKA 1LS4A 3H2VA 4C3EA 4JCZA 2OEVA 1FMWA 3DM5A 3FXHA 4KC9A 3UMHA 4NCQA 3E70C 4CS7A 4YT2A 2ETSA 5IY5C 2G62A 1OKKA 3C8ZA 3MLGA 1YZAA 5GPGB 1TWGA 3V5XA 3ZTMA 3SXKA 1M2VB 4E18A 3IQ6A 3OA1A 5EHHA 1AEPA 1GGQA 3I5PA 1MNEA 2XLWA 5AC4A 1OW7A 2J9BA 1TR2A 2Q9AA 1ZU5A 4ONSA 3LAYA 3M1CB 4E0HA 2J45A 2PNOA 4JTAB 3RKOF 4EBKA 2J9WA 4CDAA 3EJNA 4NTAA 2EPKX 3O39A 4P9TA 2CGEA 1CPQA 4G7OF 5CI9A 5TJ5E 2OG2A 3T6BA 4CJGA 3S27A 4PK4A 4D4XA 4LDRA 3C63A 4PJLA 3OWTA 1YVIA 4WGYA 3R7CA 1XZQA 4FAPB 3Q6MA 3WODF 1WN0A 3HNLA 3KKBA 3ITFA 1FMVA 1UG7A 1PCXA 2GA0A 1YYXA 2GDCA 4IB4A 1YDIA 1ZHXA 2YL7A 3L1MA 4AX2A 3DM9B 3O55A 1OW8A 1B68A 1H9TA 1L3PA 4CJOA 5DS6A 4DJ9A 4Q5SF 2YEVA 5DQTA 4EUKB 2ZXPA 4MVZA 2IBFA 2XLVA 2L6FA 1H6GA 3CAXA 1ORYA 4BG0A 3ZQVA 4ANJA 5KYNA 3R2PA 3PMRA 4ZLCA 2KNHA 3B71A 3QW1A 2XRHA 2WZGA 5KYXB 1S7ZA 3EGXA 2PX0A 1LPEA 2HV7A 4IARA 2X51A 5DS5A 4YT8A 3NRHA 2NPUA 4J30B 4DBRA 2D4UA 1OCZC 3AG4C 2NSFA 1TKNA 4O6NA 3JZ0A 5L0GA 3FHDA 3SXYA 2Y39A 4CSAC 4ZLDA 4MVUA 4WJ0A 2C03A 5KYUA 2XS8A 4OIRF 3DE8A 4U5CE 1FFTC 5DVWA 4Z9JA 4YL3A 4D4NA 1O5HA 1OCRC 3C62A 3CQZA 5JRAA 3T6GB 3W8HA 2IXOA 2WZFA 2QUPA 4RDAA 3EH2A 2A6HF 1OXKA 3NKDA 2XLEA 4XLNF 1G5ZA 4XEVA 1ORJA 2L6HA 1E85A 1VLTA 4IRUA 2R25A 4YN0B 3HJCA 3C7JA 1VYKA 1V54C 2W4BA 1G4US 2R7QA 3E9VA 3SYNA 1V4AA 3AQCA 1YA9A 4J7TA 2KW3C 4NC3A 1I4ZA
chains in the Genus database with same CATH topology
5TJ5E 2CYDA 4BEMJ 2DB4A 2BL2A 3AOUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TJ5 E;  2CYD A;  4BEM J;  2DB4 A;  2BL2 A;  3AOU A; 
#chains in the Genus database with same CATH topology
 1WAT A;  5D91 A;  2R7O A;  5B1A C;  3RF3 A;  4U9D A;  2HSQ A;  3W2W A;  5EGY A;  1DOV A;  3K7D A;  3GEE A;  4PFO A;  1HMD A;  4MVR A;  5F5H A;  5A6K A;  2A0B A;  3LES A;  1ZHZ A;  4YL1 A;  2RD9 A;  4G7Z F;  4BJ5 A;  1GS9 A;  1LS1 A;  1MMD A;  4RBN A;  3DAF A;  3T9O A;  1R5I D;  1QKR A;  1SZI A;  3AJM A;  2XXA B;  2EIN C;  3IEE A;  3UR3 C;  3ZC4 A;  1VYI A;  4EIY A;  4I1O B;  3LEO A;  1TWA A;  3FAJ A;  4K1O A;  3U8P A;  3IQ5 A;  3TOL A;  1MND A;  3S28 A;  1LI5 A;  4R32 A;  1OQC A;  2J7P D;  4OIQ F;  5F28 E;  4KNV A;  3U0C A;  3U8V A;  3C8G B;  3Q6N A;  1JOG A;  3GAN A;  4MVM A;  3JCU Q;  3MFN A;  1C03 A;  1QSP A;  3HNI A;  3LLK A;  1Q0M A;  4JE9 A;  1J8M F;  2HUJ A;  1IZM A;  4E0I A;  4OD5 A;  5JLI A;  1GQA A;  2ASR A;  2H7B A;  2M4E A;  2YLG A;  3H2U A;  1Q0F A;  4LER A;  1A41 A;  5KYW A;  3QW0 A;  5T3W A;  2ZXO A;  2A69 F;  4JEB A;  1Q0G A;  2ZPA A;  2KYH A;  1G4W R;  3FOP A;  2DI3 A;  5E3A A;  4I3M A;  4A2N B;  4AE4 B;  1EA8 A;  1Z63 A;  1ZZP A;  3K1H A;  1Z7Q c;  1OCO C;  3S90 A;  3EHM A;  4J32 B;  5T1D B;  1Z5Z A;  2ICW G;  1U0B B;  3DJN B;  3JRT A;  1QVX A;  1D0Z A;  2FFH A;  1M2O A;  1S05 A;  2XLH A;  5BQG A;  2R7R A;  2NG1 A;  3I4U A;  1MMG A;  1D0X A;  4LLE A;  2DYS C;  4Q7C A;  3QVY A;  4C3D A;  2BC5 A;  2CNW D;  4H4K C;  2YLD A;  3NMJ A;  5JT4 A;  1LKX A;  2O9X A;  1M2V A;  3C18 A;  5KYY B;  3RQG A;  2Q4F A;  2PFD A;  2VB6 A;  4O6M A;  3POV A;  1OXB A;  3GOD A;  3JYH A;  2AWC A;  2KQ9 A;  3DZA A;  2FAP B;  3FAP B;  1WAS A;  3LJB A;  3EGD A;  1KU2 A;  2XSE A;  3S9O A;  4C7O B;  4MTG A;  1EI7 A;  5CIV A;  1A7D A;  3M4C A;  4OIN F;  1Z3I X;  1R4T A;  2NUP B;  1CGN A;  3IHU A;  2NUT A;  1FFH A;  1D1B A;  4MND A;  2LCH A;  3SNH A;  4DVZ A;  1HW1 A;  4U5H A;  2M64 A;  1E86 A;  4LDK A;  1Q0D A;  4CSA A;  5A6A A;  2BE5 F;  4XEF A;  2I15 A;  3CZ6 A;  3LNM B;  2YKZ A;  2YHS A;  4JKV A;  4BJ6 C;  1E83 A;  1EKY A;  5L0D A;  5JUA A;  5A6B D;  3ASN C;  3ZG1 A;  2AP3 A;  2XXA A;  4U5E E;  1K04 A;  2UUI A;  3AG3 C;  3JRM O;  1YAU O;  256B A;  2LP4 A;  4MTF A;  2OJQ A;  1YA7 O;  3ZVR A;  1WWP A;  4P6I C;  4K0D A;  5L0I A;  2V3C C;  4EBJ A;  2HMQ A;  4OIP F;  3A11 A;  3JSE O;  4CS8 C;  3DI5 A;  4WGZ A;  4LDQ A;  2IXP A;  3JSZ A;  4WAB A;  2JD3 A;  4IJJ A;  1H7I A;  2CNW A;  3QTH A;  2PP4 A;  2EIM C;  1LM3 B;  1ORS C;  4YJW A;  4A4A A;  3T4R A;  5BUO A;  1FR0 A;  1YAR O;  3KYJ A;  3QMK A;  1SMY F;  2WL8 A;  2Q9C A;  1T9K A;  2CW0 F;  2G3V A;  4PFP A;  4MVQ A;  1T5O A;  3KYI A;  2QNL A;  1UFB A;  2JPU A;  3VAY A;  4MVO A;  2MWQ A;  3MBG A;  4EKW A;  4W8K A;  4DXW A;  5COG A;  2QLA A;  3LEV A;  3L34 A;  3AOU A;  1LVK A;  1O3U A;  1ZW2 A;  4HEA J;  1QQ3 A;  2E87 A;  1OW6 A;  1WGW A;  2HZ8 A;  5B3S C;  2R7X A;  2EIJ C;  3MYF A;  2OCC C;  3TJ6 A;  1MQV A;  3RIP A;  3U9M A;  2HSB A;  3KMI A;  4DRH B;  1U6H A;  1ZW3 A;  3C8G D;  2HKV A;  4HFK B;  1JAF A;  4I1M A;  1JMW A;  3I5Q A;  5B1B C;  2R9R B;  3V5Z A;  3EG9 B;  4B6I A;  2NSG A;  3J06 A;  3O6X A;  1VLS A;  2C04 A;  2ZXW C;  4I44 A;  2W4M A;  4U5D E;  2WZL A;  3EPV A;  2H8A A;  3RH3 A;  4NTF A;  1O87 A;  3GM2 A;  5JS5 A;  3U2L A;  5JP7 A;  3Q7G A;  2R7W A;  3BRJ A;  3X1O A;  2MYS A;  3W4Y A;  4BPM A;  2IOQ A;  1Y6D A;  1QLE C;  3FMS A;  3U3B A;  1JR8 A;  2LFD A;  1NFN A;  3GWL A;  1Q0K A;  3RYL A;  1NBB A;  1VK5 A;  3EZH A;  4G0H A;  4CIH A;  5FZT A;  1C17 M;  1BBH A;  5K0I A;  3B0U X;  5F5F A;  5DLJ A;  5L0F A;  4AL0 A;  1KNY A;  1ZHY A;  4U5F E;  4E7S A;  2G3K A;  3M15 A;  4JEA A;  2Y3H A;  3SEO A;  4K7B A;  3GWN A;  3DE9 A;  1ST6 A;  3NYL A;  3US6 A;  2P1A A;  3N2Z B;  4L6R A;  5KYU B;  2Q7R A;  3L8J A;  2Y69 C;  2Y3B A;  3OEO A;  4MQ9 F;  3K66 A;  1JPN A;  3K1I C;  1HW2 A;  4BEM J;  3Q7L A;  1PV3 A;  3F47 A;  2A6E F;  4XPW A;  1TWH A;  3ABK C;  1BR2 A;  2DB4 A;  1YYJ A;  1J8Y F;  2I8B A;  4FES A;  2KSF A;  2D5R B;  3HKK A;  3RVZ A;  1OR3 A;  2WVQ A;  2YWA A;  1VOM A;  1D1A A;  1LIH A;  1M56 C;  4IGG A;  1ZHT A;  3NMK A;  2OOC A;  1W2W A;  4JCH A;  1NG1 A;  1AVO B;  2XL6 A;  2PX3 A;  2YVK A;  4MS2 A;  1YLM A;  3U5S A;  2LFF A;  2LQG A;  4PR9 A;  3QVZ A;  5HV9 A;  1NSG B;  3ZDL A;  2H7V C;  2KGO A;  2LIG A;  3ZSU A;  3FVY A;  2GWW A;  4LLC A;  2BL2 A;  3TD7 A;  4YT4 A;  1APC A;  3QZC A;  1E2X A;  1RCP A;  4N4W A;  3WAQ A;  3SZR A;  2OU6 A;  4KNW A;  1NLX A;  1ZVZ A;  1XWJ A;  1NFO A;  4KBL A;  2UUH A;  5COM A;  2YZS A;  3B29 A;  4U9E A;  4Z9H A;  1G8X A;  1M6T A;  2EPM X;  1RJ9 B;  3EQL F;  3SXZ A;  3UMI A;  4BJ6 A;  4CDY A;  1SYQ A;  3FOO A;  1VMA A;  2R03 A;  2R7S A;  2CCY A;  5COF A;  2HFI A;  4N6C A;  2A68 F;  1OKK D;  2XL8 A;  1CPR A;  1YJG A;  4QI0 A;  3VM6 A;  4CS9 C;  1TFO B;  3AGT A;  5L0H A;  4OIO F;  4JTC B;  4CBE A;  4CS8 A;  3PCV A;  2J9U A;  2J9V A;  3UNG C;  4IAO A;  1SR2 A;  2VCA A;  3WG7 C;  2QTV A;  3LUT B;  4G78 A;  3W2V A;  2J46 A;  2XLO A;  3EH1 A;  3DXJ F;  3KL4 A;  4DOZ A;  4DBQ A;  2NUP A;  2WVN A;  2V26 A;  4JRZ A;  4MW3 A;  2YRF A;  3TOM A;  3VF0 A;  3MX3 A;  4Q4Z F;  4E17 A;  3RW0 A;  2XS1 A;  4NY3 A;  4U5B E;  1XZP A;  2J7P A;  2OKU A;  1T01 A;  1NZE A;  3EFO B;  2W45 A;  3RQE A;  1VTM P;  2KK1 A;  4JC7 A;  4YWQ A;  2L81 A;  4G7H F;  5KYW B;  4O7G A;  4Z9I A;  5DQZ A;  2EIL C;  1WOL A;  2WVO A;  1NU9 C;  2XL4 A;  4IAQ A;  4NTB A;  1DOW A;  1A7E A;  1FTS A;  4LAC B;  4QI2 A;  1RKE B;  4QDL A;  1HMO A;  3LNR A;  2AU5 A;  4YL0 A;  3TUL A;  1FAP B;  2EIK C;  1IW7 F;  3ABL C;  3BEH A;  3IPM O;  4DVY P;  3B0P A;  4M63 A;  3NDB B;  3PDM P;  2XM4 A;  3CSK A;  3GEI A;  2XM0 A;  3H65 A;  5L0C A;  1VB5 A;  2XLM A;  1D1C A;  2IXM A;  4PJJ A;  3DWW A;  3SXM A;  1HE9 A;  1RXQ A;  2VH3 A;  3RVY A;  4O79 A;  5JVE A;  5HSW A;  2B0J A;  2CYD A;  2ZXR A;  2Q00 A;  2Y3G A;  3GOR A;  3LS0 A;  4JVS A;  3K33 A;  2Y3D A;  2WB7 A;  3DMD A;  3EGD B;  3M4B A;  4MTO A;  1BR4 A;  2VC9 A;  1V55 C;  3V5Y A;  4CX9 A;  5KYX A;  3HNJ A;  1MMN A;  3AQB A;  3U2M A;  2NUT B;  2Z15 A;  3AGU A;  1ZU4 A;  2R05 A;  3PHF 2;  4HFF B;  1V74 B;  3ZIB A;  3VYW A;  2PF4 E;  3UGO A;  3JT1 A;  4PJM A;  3RFY A;  4KI2 A;  3CEX A;  1QZX A;  2A0U A;  1JPJ A;  4JJG A;  2EPL X;  1HY5 A;  3S84 A;  2YQY A;  2R7T A;  4PJN A;  1T6Q A;  2J8W A;  5CI8 A;  1KTM A;  5D92 A;  2LSE A;  4ER9 A;  4EHP A;  2VCC A;  3K1I A;  1TFK B;  3EZI A;  4FWV A;  5B3I A;  1HE1 A;  2OQM A;  3EG9 A;  2R7U A;  2IXN A;  5DS4 A;  3T6J A;  5T3T A;  3ZWI A;  5A69 A;  2HMZ A;  3ATP A;  3DKA A;  4XWJ A;  4EBB A;  4UDV A;  3B9Q A;  2LK4 A;  2LD6 A;  3L8I A;  2JX0 A;  4JIO A;  5AC5 A;  5A6B A;  2J0W A;  2L6G A;  2RSE B;  3A9C A;  3EHN A;  3HLZ A;  3M79 A;  4OD4 A;  3K6B A;  4GEH A;  4F4B A;  2IM8 A;  5E33 A;  3KH2 A;  4RD9 A;  4E7Z A;  5JSL A;  4O6Y A;  3AG2 C;  4XEK A;  1BZ4 A;  4JJF A;  2KC3 A;  4XLP F;  3G4X A;  3NMI A;  2KJG A;  3JTL O;  2P61 A;  4AL1 A;  1I4Y A;  3O10 A;  1AUE A;  4N6H A;  4ULV A;  2GFH A;  2HJM A;  2VAS A;  3NYJ A;  3S0X A;  4C3B A;  1N1C A;  3TJ5 A;  4BEJ A;  1A7V A;  3EGX B;  1BDJ B;  1T6I A;  4N06 A;  4BJT A;  3N24 A;  2W9Y A;  3V7O A;  1YZC A;  1C02 A;  4JUR I;  2YL1 A;  3GEH A;  2ZD9 A;  2FGY A;  4CS9 A;  2J0X A;  3NG1 A;  3UMK A;  2EPN A;  3ECS A;  4MW8 A;  2DYR C;  4X0R A;  3UGP A;  1LE2 A;  3SP1 A;  1TQG A;  1QPU A;  3DD7 A;  1F1M A;  2P7V A;  3FDQ A;  1CGM E;  1Y4C A;  4JW1 A;  3DAG A;  1Z6A A;  3NYM A;  5E3C A;  2B0H A;  3W8I A;  5FCL A;  3HNK A;  1PD1 A;  1Z23 A;  3IQT A;  1WTY A;  1K40 A;  3C8G A;  2X0C A;  1SF8 A;  1RKC A;  4XPY A;  1M57 C;  4AK9 A;  4JTD B;  1T6U A;  1FNT c;  1PD0 A;  4CDV A;  3TQO A;  3LLI A;  3B0V C;  4J7Y A;  3G4Z A;  3RQF A;  1OCC C;  2HV6 A;  1BR1 A;  2P0N A;  2Q9B A;  3ZQY A;  5L3Q A;  2QY9 A;  1RJ9 A;  2CDQ A;  3JYY A;  3X2Q C;  2HS5 A;  4JZA A;  2AVK A;  2OJE D;  3ASO C;  2TMV P;  3ABM C;  4MVS A;  4GQH A;  4AE4 A;  1JRA A;  2IYL D;  4XQ1 A;  3U3F A;  5BQH A;  2R7V A;  1TWC A;  3NKE A;  1LI7 A;  5A6J A;  2GAQ A;  3IQC A;  4XPX A;  4DRI B;  3L0I A;  3ZTZ A;  2HJ3 A;  2DGJ A;  2P6V A;  1LE4 A;  4P9F A;  3WHN A;  1K05 A;  4DRJ B;  5L3V A;  4PAC A;  2H7O A;  2R02 A;  4ULW A;  1ZYR F;  5KYY A;  3MYI A;  4NQF A;  4W8P A;  5BQI A;  2QE9 A;  3GM3 A;  4YK5 A;  1ZHW A;  5L0J A;  4U5G A;  4HE8 D;  2L7A A;  1E84 A;  2MHR A;  2XLD A;  2YL0 A;  4C7O A;  1EQ1 A;  2VCB A;  2PBE A;  4H54 A;  3U9J A;  3F46 A;  3EFO A;  2Q3T A;  2YLI A;  5E2Q A;  4EWC A;  1L7C A;  5AGF A;  3DJU B;  3LS1 A;  4IWB A;  2F22 A;  2L9J A;  1GM5 A;  3S29 A;  4FX5 A;  1RKE A;  3G50 A;  3AG1 C;  2AWY A;  1I5N A;  1U89 A;  1CGO A;  3N0T A;  4GYT A;  2YL3 A;  1RMV A;  5EK0 A;  2EPO A;  1A0B A;  2OEX A;  2A1D D;  3VRC A;  1NU7 D;  4YT5 A;  3KPH A;  3TK0 A;  3HTK C;  4BJ1 A;  3GM1 A;  4BJ5 C;  1D0Y A;  1MMA A;  1OR2 A;  1H9G A;  4CIP A;  4XTK A;  1LS4 A;  3H2V A;  4C3E A;  4JCZ A;  2OEV A;  1FMW A;  3DM5 A;  3FXH A;  4KC9 A;  3UMH A;  4NCQ A;  3E70 C;  4CS7 A;  4YT2 A;  2ETS A;  5IY5 C;  2G62 A;  1OKK A;  3C8Z A;  3MLG A;  1YZA A;  5GPG B;  1TWG A;  3V5X A;  3ZTM A;  3SXK A;  1M2V B;  4E18 A;  3IQ6 A;  3OA1 A;  5EHH A;  1AEP A;  1GGQ A;  3I5P A;  1MNE A;  2XLW A;  5AC4 A;  1OW7 A;  2J9B A;  1TR2 A;  2Q9A A;  1ZU5 A;  4ONS A;  3LAY A;  3M1C B;  4E0H A;  2J45 A;  2PNO A;  4JTA B;  3RKO F;  4EBK A;  2J9W A;  4CDA A;  3EJN A;  4NTA A;  2EPK X;  3O39 A;  4P9T A;  2CGE A;  1CPQ A;  4G7O F;  5CI9 A;  5TJ5 E;  2OG2 A;  3T6B A;  4CJG A;  3S27 A;  4PK4 A;  4D4X A;  4LDR A;  3C63 A;  4PJL A;  3OWT A;  1YVI A;  4WGY A;  3R7C A;  1XZQ A;  4FAP B;  3Q6M A;  3WOD F;  1WN0 A;  3HNL A;  3KKB A;  3ITF A;  1FMV A;  1UG7 A;  1PCX A;  2GA0 A;  1YYX A;  2GDC A;  4IB4 A;  1YDI A;  1ZHX A;  2YL7 A;  3L1M A;  4AX2 A;  3DM9 B;  3O55 A;  1OW8 A;  1B68 A;  1H9T A;  1L3P A;  4CJO A;  5DS6 A;  4DJ9 A;  4Q5S F;  2YEV A;  5DQT A;  4EUK B;  2ZXP A;  4MVZ A;  2IBF A;  2XLV A;  2L6F A;  1H6G A;  3CAX A;  1ORY A;  4BG0 A;  3ZQV A;  4ANJ A;  5KYN A;  3R2P A;  3PMR A;  4ZLC A;  2KNH A;  3B71 A;  3QW1 A;  2XRH A;  2WZG A;  5KYX B;  1S7Z A;  3EGX A;  2PX0 A;  1LPE A;  2HV7 A;  4IAR A;  2X51 A;  5DS5 A;  4YT8 A;  3NRH A;  2NPU A;  4J30 B;  4DBR A;  2D4U A;  1OCZ C;  3AG4 C;  2NSF A;  1TKN A;  4O6N A;  3JZ0 A;  5L0G A;  3FHD A;  3SXY A;  2Y39 A;  4CSA C;  4ZLD A;  4MVU A;  4WJ0 A;  2C03 A;  5KYU A;  2XS8 A;  4OIR F;  3DE8 A;  4U5C E;  1FFT C;  5DVW A;  4Z9J A;  4YL3 A;  4D4N A;  1O5H A;  1OCR C;  3C62 A;  3CQZ A;  5JRA A;  3T6G B;  3W8H A;  2IXO A;  2WZF A;  2QUP A;  4RDA A;  3EH2 A;  2A6H F;  1OXK A;  3NKD A;  2XLE A;  4XLN F;  1G5Z A;  4XEV A;  1ORJ A;  2L6H A;  1E85 A;  1VLT A;  4IRU A;  2R25 A;  4YN0 B;  3HJC A;  3C7J A;  1VYK A;  1V54 C;  2W4B A;  1G4U S;  2R7Q A;  3E9V A;  3SYN A;  1V4A A;  3AQC A;  1YA9 A;  4J7T A;  2KW3 C;  4NC3 A;  1I4Z A; 
#chains in the Genus database with same CATH homology
 5TJ5 E;  2CYD A;  4BEM J;  2DB4 A;  2BL2 A;  3AOU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...