3AOUA

Structure of the na+ unbound rotor ring modified with n,n f-dicyclohexylcarbodiimide of the na+-transporting v-atpase
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
156
structure length
156
Chain Sequence
MMDYLITQNGGMVFAVLAMATATIFSGIGSAKGVGMTGEAAAALTTSQPEKFGQALILQLLPGTQGLYGFVIAFLIFINLGSDMSVVQGLNFLGASLPIAFTGLFSGIAQGKVAAAGIQILAKKPEHATKGIIFAAMVETYAILGFVISFLLVLNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the rotor ring modified with N,N'-dicyclohexylcarbodiimide of the Na+-transporting vacuolar ATPase.
pubmed doi rcsb
source organism Enterococcus hirae
molecule tags Hydrolase
molecule keywords V-type sodium ATPase subunit K
total genus 65
structure length 156
sequence length 156
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2010-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00137 ATP-synt_C ATP synthase subunit C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.610 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) lithium bound rotor ring of v- atpase 3aouA00
2CYDA 4BEMJ 2BL2A 3AOUA 2DB4A 5TJ5E
chains in the Genus database with same CATH superfamily
4EUKB 2WVOA 2OG2A 4MVQA 2WZGA 2XM4A 1J8YF 2P6VA 2XM0A 3DM9B 4YT4A 2DYRC 3TJ6A 2R7SA 1M6TA 4IJJA 2KC3A 3W8HA 2XL8A 3HLZA 3EGDA 4Z9IA 3KMIA 4NY3A 2NPUA 5EGYA 3B0UX 3S27A 4YL1A 3MYFA 5AGFA 3JZ0A 4C3BA 1T5OA 4ZLDA 2B0JA 2OOCA 3FOOA 4U5EE 1OQCA 2YWAA 3I5QA 1T6IA 1XWJA 3DXJF 3U0CA 2R05A 3RKOF 4MS2A 4AL1A 4DVYP 2W45A 3LJBA 1VYIA 1FMWA 2FAPB 2WZLA 2HMQA 3DE9A 1BBHA 4FX5A 1LS1A 2LFFA 3TOLA 4A2NB 1M2VB 1U0BB 1D0YA 2X51A 4CJOA 1EA8A 1M2OA 5JLIA 256BA 4GEHA 1MNDA 2Y3GA 2IBFA 1BR4A 2IXMA 1UG7A 4OINF 4FWVA 1V74B 3F47A 1EI7A 5E33A 1T01A 3T4RA 2OU6A 4CDYA 5KYXB 1H9TA 4CSAC 4O6MA 3M1CB 2GA0A 4IARA 4UDVA 5T3TA 3B0VC 1T9KA 3JYYA 3ZG1A 1JR8A 2QUPA 2YL3A 3JYHA 4JC7A 1OKKD 3OWTA 3L0IA 4Z9JA 4YT5A 3K6BA 4MNDA 4H54A 3B29A 4N4WA 2PBEA 2PNOA 1D0ZA 4HE8D 3AGUA 3SXYA 4JCHA 4LLCA 4QDLA 4BJ6C 3HJCA 5COMA 5L3QA 3JRMO 1LE2A 1JOGA 3ABMC 2MYSA 1JMWA 1G4WR 1ZHYA 1ORSC 3PHF2 3Q7GA 3DJNB 3IQ6A 3ABKC 4IRUA 1Q0MA 1ZU5A 1OCRC 5BQGA 3MX3A 4W8KA 2HZ8A 3DI5A 2MWQA 1SZIA 2JPUA 4O6NA 3J06A 1GS9A 3CZ6A 3DKAA 2J0XA 3TD7A 3GODA 1HE1A 3VYWA 1VYKA 2E87A 3HNLA 4E0HA 1TWCA 4DOZA 4C7OB 4C3EA 1AVOB 2Y3HA 4JRZA 2R7VA 2IXPA 1KNYA 4O6YA 4Z9HA 1OW7A 1QPUA 4OD5A 5JUAA 4BJTA 2J46A 1K05A 2JX0A 2W4BA 3E70C 1V4AA 4MVMA 4ZLCA 1DOWA 1VB5A 3DD7A 2QTVA 1ZYRF 2PFDA 5D92A 3RQFA 5K0IA 3M15A 2KK1A 1RCPA 1H7IA 2L9JA 1NFOA 3ECSA 3GEEA 3V5ZA 2IXOA 2ZPAA 3QW1A 2AWYA 3SEOA 3L1MA 1ZVZA 3HTKC 4JEBA 2R7QA 1MMAA 3TK0A 1H9GA 3NMJA 1OW8A 4PJNA 1G8XA 3IPMO 3N2ZB 1U89A 3NMKA 2IYLD 1ORJA 2VH3A 3Q6MA 3DAFA 3AQCA 2P61A 4KC9A 4X0RA 2NUTA 3RYLA 3OA1A 2R7XA 4E0IA 4WJ0A 2D4UA 2AWCA 4E17A 2HS5A 1C03A 2VCCA 3H65A 4K7BA 2BL2A 2J7PA 1RXQA 4YL0A 3RH3A 4DBQA 3UMIA 4G78A 5DS5A 1S7ZA 2KYHA 3S0XA 5FZTA 1C17M 1VOMA 3C8GB 2Q7RA 3IEEA 3N24A 3FMSA 1MMNA 4D4NA 5FCLA 4OIOF 3SXZA 1A7DA 2J8WA 3K66A 3A11A 3R2PA 1YJGA 4MW8A 4XEVA 5BQHA 4KI2A 1WTYA 3C7JA 5A6JA 1SR2A 2EIJC 2A0UA 3L8IA 2L6FA 2LFDA 1LPEA 1OXBA 5DQTA 2DI3A 1TR2A 1I4YA 2M4EA 4PJMA 3SXMA 3HNJA 3EHMA 3QW0A 1OKKA 4LLEA 3SNHA 3I5PA 4ANJA 1TWAA 1JAFA 4LDQA 1V54C 2OEXA 3SP1A 4BEJA 1JPNA 4XQ1A 4MW3A 3IQ5A 1O5HA 4L6RA 1NSGB 2YRFA 4E18A 5KYXA 2BE5F 1FMVA 2Y3BA 5JT4A 3GEIA 3O39A 4P9TA 1E85A 1CPRA 4JVSA 4DRIB 3NYLA 1KTMA 2J7PD 5GPGB 4EKWA 1SF8A 1BZ4A 2OQMA 3F46A 5HSWA 5KYNA 3ASOC 2VC9A 2ETSA 3K7DA 2H7OA 4J32B 5A6BA 2YL0A 1TWGA 3AOUA 5A6AA 2ASRA 4CS8A 1G5ZA 3GANA 4CDAA 3UR3C 4DXWA 3W4YA 2NUPB 4ONSA 1ORYA 1QVXA 2AVKA 4OIQF 1PD1A 1MMDA 3IHUA 2LIGA 3M79A 3MFNA 3C8ZA 2O9XA 4IGGA 3QTHA 1K04A 3ABLC 3LUTB 3V5YA 3AG2C 4MTGA 1K40A 3C63A 4MVOA 1WASA 1ZHZA 2XL4A 2LSEA 3JTLO 4BJ1A 1FR0A 1OR3A 4E7SA 1ZU4A 2YLGA 2ZXRA 3IQCA 1M56C 3W8IA 4U5DE 4PR9A 5CI8A 2HJMA 4HEAJ 1O87A 2HMZA 1YZAA 1TWHA 4MQ9F 4NCQA 4NTAA 2X0CA 2GWWA 5B1AC 2XLEA 2Q9AA 3FHDA 4CS9C 1YZCA 1YA7O 4MTOA 5HV9A 3VM6A 2EPMX 2HSQA 3X1OA 4MVRA 5KYUB 3E9VA 1T6QA 5KYYB 2QNLA 3C8GA 5JRAA 4FAPB 4JJFA 1Z3IX 4OIRF 4F4BA 4XPYA 1HMOA 1D1BA 3ZQYA 2I15A 2EPLX 1E83A 2XXAB 2A6EF 2NSFA 3BRJA 2I8BA 3K1HA 3ZTZA 2AP3A 1VK5A 2WZFA 2NUTB 3PCVA 3T6BA 3WHNA 2XS8A 4CS9A 1Q0KA 1QKRA 5B1BC 2H8AA 4B6IA 1XZQA 3POVA 1BR1A 2KNHA 1PCXA 1N1CA 4JKVA 2CNWD 1NLXA 1OCCC 2XLMA 2RSEB 4YK5A 1WGWA 3OEOA 4RD9A 5F5HA 1IW7F 4EIYA 4OD4A 1GGQA 5D91A 2EIMC 4DJ9A 3MYIA 1MNEA 4WABA 1IZMA 1TKNA 1ZHXA 2BC5A 5DS6A 2PP4A 1HW1A 4ULVA 1KU2A 3Q7LA 3EFOB 3TJ5A 1LM3B 2PX0A 3G4XA 4LDRA 3GM1A 4JTDB 5A6KA 2J9VA 4Q5SF 1NFNA 1A0BA 5B3IA 5JP7A 1QSPA 4N6HA 5T3WA 3K1IC 5L0FA 2V3CC 3O10A 4C7OA 2R02A 4U5HA 1QZXA 3H2VA 1LE4A 1A7VA 2A69F 2FFHA 1TQGA 3NKDA 3O55A 2XLHA 3N0TA 4JTCB 5A6BD 2J9BA 4O7GA 1JRAA 2HV6A 2HKVA 1Z23A 3LAYA 4KBLA 2IM8A 4PACA 1Z6AA 2A6HF 2P7VA 1Q0FA 2HSBA 1U6HA 2P1AA 3I4UA 4QI0A 1Y6DA 2YLDA 2YZSA 3GEHA 3LESA 2C03A 2QY9A 1WATA 3DZAA 1R5ID 1SYQA 3W2WA 3UGOA 3AG3C 1MQVA 2PX3A 3RQGA 5BUOA 4I1MA 1AEPA 3U9MA 1QLEC 4JTAB 2J45A 2OKUA 2YKZA 3DAGA 3HNKA 2R03A 3C62A 4P9FA 4PK4A 4PJJA 5BQIA 4BJ6A 3B71A 5KYWA 1DOVA 3AQBA 3LNRA 4PJLA 4BG0A 4CS8C 3FAJA 3EG9B 5L0JA 1PV3A 3GORA 1NU9C 1YDIA 3UMHA 2UUIA 2Y69C 5KYYA 1CGME 3U8VA 5A69A 1VMAA 2IXNA 3G4ZA 2ZD9A 4BEMJ 3UGPA 3V5XA 2HJ3A 3R7CA 3EGXB 4FESA 2DB4A 1OW6A 3C18A 3NYJA 4RBNA 1L3PA 3ASNC 3LS1A 5JS5A 3SXKA 3NKEA 2WVQA 4XPWA 2YL7A 3W2VA 4QI2A 1OCOC 2Y39A 4EHPA 1MMGA 4NC3A 3S29A 5L0IA 4AE4B 2DYSC 2L81A 5L0CA 3KPHA 2PF4E 2NSGA 3PMRA 1Z7Qc 4AX2A 1ST6A 1C02A 5IY5C 1NG1A 5COGA 2EILC 4XEKA 3U5SA 3ZDLA 1FNTc 3EFOA 4JJGA 2YEVA 4JZAA 5CI9A 2NUPA 5TJ5E 3FAPB 4I3MA 2IOQA 1LKXA 2A0BA 2L6GA 1E2XA 1YARO 4CBEA 3ITFA 3VAYA 3NG1A 4DRJB 1ZW3A 4CDVA 4MVSA 1FFHA 3US6A 1L7CA 1APCA 4A4AA 3EPVA 4W8PA 1JPJA 4BJ5A 1RKCA 4LACB 1OCZC 4KNWA 2MHRA 5JSLA 3S9OA 3ATPA 3WAQA 1GM5A 4G7HF 3B9QA 2WB7A 1EKYA 4JEAA 1VLSA 5CIVA 2YLIA 1LIHA 4XLNF 3ZIBA 4AE4A 2EINC 3GWLA 3RF3A 3RQEA 1PD0A 1WWPA 3Q6NA 1YA9A 2LK4A 3M4CA 4CX9A 2OEVA 3AGTA 4EWCA 3LS0A 4PFOA 1BDJB 3NDBB 3RW0A 1I5NA 2A1DD 4CSAA 5KYUA 5L0DA 3T6GB 3GM2A 3GWNA 1R4TA 2NG1A 4CS7A 3B0PA 5JVEA 4CIPA 3UNGC 5L3VA 3JSEO 1E84A 3NYMA 2XLOA 4AK9A 4GQHA 2ICWG 3K1IA 4J30B 2FGYA 3WG7C 4XEFA 1YVIA 3LNMB 1LI5A 1Q0DA 2AU5A 3DWWA 3G50A 4IB4A 4WGZA 3LEVA 1HY5A 3IQTA 3EZHA 3U3BA 2R7OA 1CGNA 1S05A 3M4BA 3KL4A 1G4US 2GAQA 4BPMA 2OJED 3RVZA 3MBGA 1NZEA 2HV7A 4HFKB 3NRHA 3QMKA 2WL8A 4R32A 2KSFA 4K0DA 1YYJA 3KH2A 2QLAA 2D5RB 1BR2A 1Z63A 4IWBA 5L0GA 4Q7CA 4Q4ZF 2CW0F 2XS1A 4JE9A 1ZHTA 4RDAA 3U3FA 5DLJA 2Q00A 3EGXA 2KGOA 2F22A 3GM3A 3X2QC 3EHNA 1RMVA 4D4XA 3BEHA 3AG1C 4CIHA 2TMVP 2R7TA 1YYXA 3EZIA 3KKBA 1RKEB 1YLMA 2C04A 3HKKA 3L34A 4P6IC 4DBRA 3DM5A 1XZPA 5DQZA 1HE9A 1A7EA 4EBBA 2R7RA 4WGYA 4ULWA 1TFKB 2YVKA 2EPKX 2HFIA 1VTMP 2JD3A 3ZQVA 2XLVA 1WN0A 1EQ1A 1GQAA 2HUJA 2G3VA 1H6GA 4K1OA 3FDQA 3KYIA 4G7OF 3C8GD 3RFYA 4OIPF 2L7AA 3FVYA 2XL6A 4JIOA 3AJMA 4LERA 1ZHWA 1A41A 4N6CA 3JT1A 3T6JA 4J7YA 3DE8A 2J0WA 4IAOA 4JURI 4AL0A 3ZTMA 1QQ3A 2XSEA 2YHSA 3FXHA 3S90A 1NBBA 4M63A 1FTSA 3TOMA 3A9CA 3VF0A 3ZC4A 5AC4A 3MLGA 2EIKC 3AG4C 2KW3C 3SZRA 3DJUB 1E86A 2L6HA 2LD6A 2P0NA 2Z15A 2LP4A 2Q9CA 3EG9A 4I44A 4NTBA 1OR2A 1SMYF 3EH1A 1B68A 2LCHA 2Y3DA 2R7WA 2J9UA 4JW1A 2XLDA 4N06A 4U9EA 3S84A 5EHHA 4H4KC 1LS4A 2XRHA 3CSKA 4XWJA 4EBJA 2CCYA 3ZWIA 3JSZA 1CGOA 2R25A 2VB6A 3H2UA 3DMDA 5F5FA 4YWQA 2EPOA 1HMDA 1FAPB 2Q3TA 1FFTC 1Q0GA 2V26A 3RVYA 3JCUQ 3K33A 4U5BE 5T1DB 3SYNA 3U2MA 4O79A 2CDQA 1AUEA 4JCZA 4U5GA 4GYTA 1VLTA 2KQ9A 4YN0B 1NU7D 3UMKA 5DS4A 2W9YA 4XTKA 3EH2A 1T6UA 4YL3A 2OJQA 1LVKA 2Q9BA 1CPQA 2G3KA 2VCBA 2RD9A 1TFOB 4LDKA 4MVUA 3RIPA 3V7OA 2J9WA 4DVZA 4YT8A 4XLPF 2WVNA 3TULA 3HNIA 1YAUO 3EQLF 2R7UA 1Y4CA 1Z5ZA 3T9OA 3ZVRA 1D1AA 2QE9A 2M64A 1O3UA 3KYJA 2VASA 3LEOA 2EPNA 4I1OB 4U9DA 2ZXOA 5E2QA 2CYDA 4DRHB 3PDMP 4BJ5C 2H7BA 2B0HA 3QZCA 3CEXA 4CJGA 3U9JA 1M57C 2XLWA 5E3CA 4EBKA 5L0HA 1OXKA 3FOPA 5E3AA 3CQZA 3EGDB 3ZSUA 3WODF 4NTFA 4U5FE 2OCCC 1RKEA 2YQYA 4NQFA 3U2LA 2G62A 2VCAA 2YL1A 2LQGA 2CNWA 2Q4FA 2ZXPA 4MTFA 4YJWA 4HFFB 4XPXA 1M2VA 3VRCA 2A68F 1UFBA 2DGJA 4KNVA 2W4MA 2GFHA 3CAXA 2ZXWC 3NMIA 1LI7A 4G0HA 3S28A 4E7ZA 4C3DA 1D0XA 1ZZPA 4ER9A 3EJNA 4YT2A 2GDCA 2KJGA 2R9RB 4G7ZF 3LLIA 1F1MA 3LLKA 5KYWB 1RJ9A 1W2WA 3QVZA 3U8PA 4IAQA 1V55C 5B3SC 1D1CA 2UUHA 4U5CE 3O6XA 2XXAA 2CGEA 1J8MF 5COFA 5DVWA 4PFPA 1WOLA 1ZW2A 5AC5A 1RJ9B 3QVYA 1HW2A 5F28E 3TQOA 4J7TA 1I4ZA 3L8JA 2H7VC 3JRTA 4MVZA 5EK0A
chains in the Genus database with same CATH topology
2CYDA 4BEMJ 2BL2A 3AOUA 2DB4A 5TJ5E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CYD A;  4BEM J;  2BL2 A;  3AOU A;  2DB4 A;  5TJ5 E; 
#chains in the Genus database with same CATH topology
 4EUK B;  2WVO A;  2OG2 A;  4MVQ A;  2WZG A;  2XM4 A;  1J8Y F;  2P6V A;  2XM0 A;  3DM9 B;  4YT4 A;  2DYR C;  3TJ6 A;  2R7S A;  1M6T A;  4IJJ A;  2KC3 A;  3W8H A;  2XL8 A;  3HLZ A;  3EGD A;  4Z9I A;  3KMI A;  4NY3 A;  2NPU A;  5EGY A;  3B0U X;  3S27 A;  4YL1 A;  3MYF A;  5AGF A;  3JZ0 A;  4C3B A;  1T5O A;  4ZLD A;  2B0J A;  2OOC A;  3FOO A;  4U5E E;  1OQC A;  2YWA A;  3I5Q A;  1T6I A;  1XWJ A;  3DXJ F;  3U0C A;  2R05 A;  3RKO F;  4MS2 A;  4AL1 A;  4DVY P;  2W45 A;  3LJB A;  1VYI A;  1FMW A;  2FAP B;  2WZL A;  2HMQ A;  3DE9 A;  1BBH A;  4FX5 A;  1LS1 A;  2LFF A;  3TOL A;  4A2N B;  1M2V B;  1U0B B;  1D0Y A;  2X51 A;  4CJO A;  1EA8 A;  1M2O A;  5JLI A;  256B A;  4GEH A;  1MND A;  2Y3G A;  2IBF A;  1BR4 A;  2IXM A;  1UG7 A;  4OIN F;  4FWV A;  1V74 B;  3F47 A;  1EI7 A;  5E33 A;  1T01 A;  3T4R A;  2OU6 A;  4CDY A;  5KYX B;  1H9T A;  4CSA C;  4O6M A;  3M1C B;  2GA0 A;  4IAR A;  4UDV A;  5T3T A;  3B0V C;  1T9K A;  3JYY A;  3ZG1 A;  1JR8 A;  2QUP A;  2YL3 A;  3JYH A;  4JC7 A;  1OKK D;  3OWT A;  3L0I A;  4Z9J A;  4YT5 A;  3K6B A;  4MND A;  4H54 A;  3B29 A;  4N4W A;  2PBE A;  2PNO A;  1D0Z A;  4HE8 D;  3AGU A;  3SXY A;  4JCH A;  4LLC A;  4QDL A;  4BJ6 C;  3HJC A;  5COM A;  5L3Q A;  3JRM O;  1LE2 A;  1JOG A;  3ABM C;  2MYS A;  1JMW A;  1G4W R;  1ZHY A;  1ORS C;  3PHF 2;  3Q7G A;  3DJN B;  3IQ6 A;  3ABK C;  4IRU A;  1Q0M A;  1ZU5 A;  1OCR C;  5BQG A;  3MX3 A;  4W8K A;  2HZ8 A;  3DI5 A;  2MWQ A;  1SZI A;  2JPU A;  4O6N A;  3J06 A;  1GS9 A;  3CZ6 A;  3DKA A;  2J0X A;  3TD7 A;  3GOD A;  1HE1 A;  3VYW A;  1VYK A;  2E87 A;  3HNL A;  4E0H A;  1TWC A;  4DOZ A;  4C7O B;  4C3E A;  1AVO B;  2Y3H A;  4JRZ A;  2R7V A;  2IXP A;  1KNY A;  4O6Y A;  4Z9H A;  1OW7 A;  1QPU A;  4OD5 A;  5JUA A;  4BJT A;  2J46 A;  1K05 A;  2JX0 A;  2W4B A;  3E70 C;  1V4A A;  4MVM A;  4ZLC A;  1DOW A;  1VB5 A;  3DD7 A;  2QTV A;  1ZYR F;  2PFD A;  5D92 A;  3RQF A;  5K0I A;  3M15 A;  2KK1 A;  1RCP A;  1H7I A;  2L9J A;  1NFO A;  3ECS A;  3GEE A;  3V5Z A;  2IXO A;  2ZPA A;  3QW1 A;  2AWY A;  3SEO A;  3L1M A;  1ZVZ A;  3HTK C;  4JEB A;  2R7Q A;  1MMA A;  3TK0 A;  1H9G A;  3NMJ A;  1OW8 A;  4PJN A;  1G8X A;  3IPM O;  3N2Z B;  1U89 A;  3NMK A;  2IYL D;  1ORJ A;  2VH3 A;  3Q6M A;  3DAF A;  3AQC A;  2P61 A;  4KC9 A;  4X0R A;  2NUT A;  3RYL A;  3OA1 A;  2R7X A;  4E0I A;  4WJ0 A;  2D4U A;  2AWC A;  4E17 A;  2HS5 A;  1C03 A;  2VCC A;  3H65 A;  4K7B A;  2BL2 A;  2J7P A;  1RXQ A;  4YL0 A;  3RH3 A;  4DBQ A;  3UMI A;  4G78 A;  5DS5 A;  1S7Z A;  2KYH A;  3S0X A;  5FZT A;  1C17 M;  1VOM A;  3C8G B;  2Q7R A;  3IEE A;  3N24 A;  3FMS A;  1MMN A;  4D4N A;  5FCL A;  4OIO F;  3SXZ A;  1A7D A;  2J8W A;  3K66 A;  3A11 A;  3R2P A;  1YJG A;  4MW8 A;  4XEV A;  5BQH A;  4KI2 A;  1WTY A;  3C7J A;  5A6J A;  1SR2 A;  2EIJ C;  2A0U A;  3L8I A;  2L6F A;  2LFD A;  1LPE A;  1OXB A;  5DQT A;  2DI3 A;  1TR2 A;  1I4Y A;  2M4E A;  4PJM A;  3SXM A;  3HNJ A;  3EHM A;  3QW0 A;  1OKK A;  4LLE A;  3SNH A;  3I5P A;  4ANJ A;  1TWA A;  1JAF A;  4LDQ A;  1V54 C;  2OEX A;  3SP1 A;  4BEJ A;  1JPN A;  4XQ1 A;  4MW3 A;  3IQ5 A;  1O5H A;  4L6R A;  1NSG B;  2YRF A;  4E18 A;  5KYX A;  2BE5 F;  1FMV A;  2Y3B A;  5JT4 A;  3GEI A;  3O39 A;  4P9T A;  1E85 A;  1CPR A;  4JVS A;  4DRI B;  3NYL A;  1KTM A;  2J7P D;  5GPG B;  4EKW A;  1SF8 A;  1BZ4 A;  2OQM A;  3F46 A;  5HSW A;  5KYN A;  3ASO C;  2VC9 A;  2ETS A;  3K7D A;  2H7O A;  4J32 B;  5A6B A;  2YL0 A;  1TWG A;  3AOU A;  5A6A A;  2ASR A;  4CS8 A;  1G5Z A;  3GAN A;  4CDA A;  3UR3 C;  4DXW A;  3W4Y A;  2NUP B;  4ONS A;  1ORY A;  1QVX A;  2AVK A;  4OIQ F;  1PD1 A;  1MMD A;  3IHU A;  2LIG A;  3M79 A;  3MFN A;  3C8Z A;  2O9X A;  4IGG A;  3QTH A;  1K04 A;  3ABL C;  3LUT B;  3V5Y A;  3AG2 C;  4MTG A;  1K40 A;  3C63 A;  4MVO A;  1WAS A;  1ZHZ A;  2XL4 A;  2LSE A;  3JTL O;  4BJ1 A;  1FR0 A;  1OR3 A;  4E7S A;  1ZU4 A;  2YLG A;  2ZXR A;  3IQC A;  1M56 C;  3W8I A;  4U5D E;  4PR9 A;  5CI8 A;  2HJM A;  4HEA J;  1O87 A;  2HMZ A;  1YZA A;  1TWH A;  4MQ9 F;  4NCQ A;  4NTA A;  2X0C A;  2GWW A;  5B1A C;  2XLE A;  2Q9A A;  3FHD A;  4CS9 C;  1YZC A;  1YA7 O;  4MTO A;  5HV9 A;  3VM6 A;  2EPM X;  2HSQ A;  3X1O A;  4MVR A;  5KYU B;  3E9V A;  1T6Q A;  5KYY B;  2QNL A;  3C8G A;  5JRA A;  4FAP B;  4JJF A;  1Z3I X;  4OIR F;  4F4B A;  4XPY A;  1HMO A;  1D1B A;  3ZQY A;  2I15 A;  2EPL X;  1E83 A;  2XXA B;  2A6E F;  2NSF A;  3BRJ A;  2I8B A;  3K1H A;  3ZTZ A;  2AP3 A;  1VK5 A;  2WZF A;  2NUT B;  3PCV A;  3T6B A;  3WHN A;  2XS8 A;  4CS9 A;  1Q0K A;  1QKR A;  5B1B C;  2H8A A;  4B6I A;  1XZQ A;  3POV A;  1BR1 A;  2KNH A;  1PCX A;  1N1C A;  4JKV A;  2CNW D;  1NLX A;  1OCC C;  2XLM A;  2RSE B;  4YK5 A;  1WGW A;  3OEO A;  4RD9 A;  5F5H A;  1IW7 F;  4EIY A;  4OD4 A;  1GGQ A;  5D91 A;  2EIM C;  4DJ9 A;  3MYI A;  1MNE A;  4WAB A;  1IZM A;  1TKN A;  1ZHX A;  2BC5 A;  5DS6 A;  2PP4 A;  1HW1 A;  4ULV A;  1KU2 A;  3Q7L A;  3EFO B;  3TJ5 A;  1LM3 B;  2PX0 A;  3G4X A;  4LDR A;  3GM1 A;  4JTD B;  5A6K A;  2J9V A;  4Q5S F;  1NFN A;  1A0B A;  5B3I A;  5JP7 A;  1QSP A;  4N6H A;  5T3W A;  3K1I C;  5L0F A;  2V3C C;  3O10 A;  4C7O A;  2R02 A;  4U5H A;  1QZX A;  3H2V A;  1LE4 A;  1A7V A;  2A69 F;  2FFH A;  1TQG A;  3NKD A;  3O55 A;  2XLH A;  3N0T A;  4JTC B;  5A6B D;  2J9B A;  4O7G A;  1JRA A;  2HV6 A;  2HKV A;  1Z23 A;  3LAY A;  4KBL A;  2IM8 A;  4PAC A;  1Z6A A;  2A6H F;  2P7V A;  1Q0F A;  2HSB A;  1U6H A;  2P1A A;  3I4U A;  4QI0 A;  1Y6D A;  2YLD A;  2YZS A;  3GEH A;  3LES A;  2C03 A;  2QY9 A;  1WAT A;  3DZA A;  1R5I D;  1SYQ A;  3W2W A;  3UGO A;  3AG3 C;  1MQV A;  2PX3 A;  3RQG A;  5BUO A;  4I1M A;  1AEP A;  3U9M A;  1QLE C;  4JTA B;  2J45 A;  2OKU A;  2YKZ A;  3DAG A;  3HNK A;  2R03 A;  3C62 A;  4P9F A;  4PK4 A;  4PJJ A;  5BQI A;  4BJ6 A;  3B71 A;  5KYW A;  1DOV A;  3AQB A;  3LNR A;  4PJL A;  4BG0 A;  4CS8 C;  3FAJ A;  3EG9 B;  5L0J A;  1PV3 A;  3GOR A;  1NU9 C;  1YDI A;  3UMH A;  2UUI A;  2Y69 C;  5KYY A;  1CGM E;  3U8V A;  5A69 A;  1VMA A;  2IXN A;  3G4Z A;  2ZD9 A;  4BEM J;  3UGP A;  3V5X A;  2HJ3 A;  3R7C A;  3EGX B;  4FES A;  2DB4 A;  1OW6 A;  3C18 A;  3NYJ A;  4RBN A;  1L3P A;  3ASN C;  3LS1 A;  5JS5 A;  3SXK A;  3NKE A;  2WVQ A;  4XPW A;  2YL7 A;  3W2V A;  4QI2 A;  1OCO C;  2Y39 A;  4EHP A;  1MMG A;  4NC3 A;  3S29 A;  5L0I A;  4AE4 B;  2DYS C;  2L81 A;  5L0C A;  3KPH A;  2PF4 E;  2NSG A;  3PMR A;  1Z7Q c;  4AX2 A;  1ST6 A;  1C02 A;  5IY5 C;  1NG1 A;  5COG A;  2EIL C;  4XEK A;  3U5S A;  3ZDL A;  1FNT c;  3EFO A;  4JJG A;  2YEV A;  4JZA A;  5CI9 A;  2NUP A;  5TJ5 E;  3FAP B;  4I3M A;  2IOQ A;  1LKX A;  2A0B A;  2L6G A;  1E2X A;  1YAR O;  4CBE A;  3ITF A;  3VAY A;  3NG1 A;  4DRJ B;  1ZW3 A;  4CDV A;  4MVS A;  1FFH A;  3US6 A;  1L7C A;  1APC A;  4A4A A;  3EPV A;  4W8P A;  1JPJ A;  4BJ5 A;  1RKC A;  4LAC B;  1OCZ C;  4KNW A;  2MHR A;  5JSL A;  3S9O A;  3ATP A;  3WAQ A;  1GM5 A;  4G7H F;  3B9Q A;  2WB7 A;  1EKY A;  4JEA A;  1VLS A;  5CIV A;  2YLI A;  1LIH A;  4XLN F;  3ZIB A;  4AE4 A;  2EIN C;  3GWL A;  3RF3 A;  3RQE A;  1PD0 A;  1WWP A;  3Q6N A;  1YA9 A;  2LK4 A;  3M4C A;  4CX9 A;  2OEV A;  3AGT A;  4EWC A;  3LS0 A;  4PFO A;  1BDJ B;  3NDB B;  3RW0 A;  1I5N A;  2A1D D;  4CSA A;  5KYU A;  5L0D A;  3T6G B;  3GM2 A;  3GWN A;  1R4T A;  2NG1 A;  4CS7 A;  3B0P A;  5JVE A;  4CIP A;  3UNG C;  5L3V A;  3JSE O;  1E84 A;  3NYM A;  2XLO A;  4AK9 A;  4GQH A;  2ICW G;  3K1I A;  4J30 B;  2FGY A;  3WG7 C;  4XEF A;  1YVI A;  3LNM B;  1LI5 A;  1Q0D A;  2AU5 A;  3DWW A;  3G50 A;  4IB4 A;  4WGZ A;  3LEV A;  1HY5 A;  3IQT A;  3EZH A;  3U3B A;  2R7O A;  1CGN A;  1S05 A;  3M4B A;  3KL4 A;  1G4U S;  2GAQ A;  4BPM A;  2OJE D;  3RVZ A;  3MBG A;  1NZE A;  2HV7 A;  4HFK B;  3NRH A;  3QMK A;  2WL8 A;  4R32 A;  2KSF A;  4K0D A;  1YYJ A;  3KH2 A;  2QLA A;  2D5R B;  1BR2 A;  1Z63 A;  4IWB A;  5L0G A;  4Q7C A;  4Q4Z F;  2CW0 F;  2XS1 A;  4JE9 A;  1ZHT A;  4RDA A;  3U3F A;  5DLJ A;  2Q00 A;  3EGX A;  2KGO A;  2F22 A;  3GM3 A;  3X2Q C;  3EHN A;  1RMV A;  4D4X A;  3BEH A;  3AG1 C;  4CIH A;  2TMV P;  2R7T A;  1YYX A;  3EZI A;  3KKB A;  1RKE B;  1YLM A;  2C04 A;  3HKK A;  3L34 A;  4P6I C;  4DBR A;  3DM5 A;  1XZP A;  5DQZ A;  1HE9 A;  1A7E A;  4EBB A;  2R7R A;  4WGY A;  4ULW A;  1TFK B;  2YVK A;  2EPK X;  2HFI A;  1VTM P;  2JD3 A;  3ZQV A;  2XLV A;  1WN0 A;  1EQ1 A;  1GQA A;  2HUJ A;  2G3V A;  1H6G A;  4K1O A;  3FDQ A;  3KYI A;  4G7O F;  3C8G D;  3RFY A;  4OIP F;  2L7A A;  3FVY A;  2XL6 A;  4JIO A;  3AJM A;  4LER A;  1ZHW A;  1A41 A;  4N6C A;  3JT1 A;  3T6J A;  4J7Y A;  3DE8 A;  2J0W A;  4IAO A;  4JUR I;  4AL0 A;  3ZTM A;  1QQ3 A;  2XSE A;  2YHS A;  3FXH A;  3S90 A;  1NBB A;  4M63 A;  1FTS A;  3TOM A;  3A9C A;  3VF0 A;  3ZC4 A;  5AC4 A;  3MLG A;  2EIK C;  3AG4 C;  2KW3 C;  3SZR A;  3DJU B;  1E86 A;  2L6H A;  2LD6 A;  2P0N A;  2Z15 A;  2LP4 A;  2Q9C A;  3EG9 A;  4I44 A;  4NTB A;  1OR2 A;  1SMY F;  3EH1 A;  1B68 A;  2LCH A;  2Y3D A;  2R7W A;  2J9U A;  4JW1 A;  2XLD A;  4N06 A;  4U9E A;  3S84 A;  5EHH A;  4H4K C;  1LS4 A;  2XRH A;  3CSK A;  4XWJ A;  4EBJ A;  2CCY A;  3ZWI A;  3JSZ A;  1CGO A;  2R25 A;  2VB6 A;  3H2U A;  3DMD A;  5F5F A;  4YWQ A;  2EPO A;  1HMD A;  1FAP B;  2Q3T A;  1FFT C;  1Q0G A;  2V26 A;  3RVY A;  3JCU Q;  3K33 A;  4U5B E;  5T1D B;  3SYN A;  3U2M A;  4O79 A;  2CDQ A;  1AUE A;  4JCZ A;  4U5G A;  4GYT A;  1VLT A;  2KQ9 A;  4YN0 B;  1NU7 D;  3UMK A;  5DS4 A;  2W9Y A;  4XTK A;  3EH2 A;  1T6U A;  4YL3 A;  2OJQ A;  1LVK A;  2Q9B A;  1CPQ A;  2G3K A;  2VCB A;  2RD9 A;  1TFO B;  4LDK A;  4MVU A;  3RIP A;  3V7O A;  2J9W A;  4DVZ A;  4YT8 A;  4XLP F;  2WVN A;  3TUL A;  3HNI A;  1YAU O;  3EQL F;  2R7U A;  1Y4C A;  1Z5Z A;  3T9O A;  3ZVR A;  1D1A A;  2QE9 A;  2M64 A;  1O3U A;  3KYJ A;  2VAS A;  3LEO A;  2EPN A;  4I1O B;  4U9D A;  2ZXO A;  5E2Q A;  2CYD A;  4DRH B;  3PDM P;  4BJ5 C;  2H7B A;  2B0H A;  3QZC A;  3CEX A;  4CJG A;  3U9J A;  1M57 C;  2XLW A;  5E3C A;  4EBK A;  5L0H A;  1OXK A;  3FOP A;  5E3A A;  3CQZ A;  3EGD B;  3ZSU A;  3WOD F;  4NTF A;  4U5F E;  2OCC C;  1RKE A;  2YQY A;  4NQF A;  3U2L A;  2G62 A;  2VCA A;  2YL1 A;  2LQG A;  2CNW A;  2Q4F A;  2ZXP A;  4MTF A;  4YJW A;  4HFF B;  4XPX A;  1M2V A;  3VRC A;  2A68 F;  1UFB A;  2DGJ A;  4KNV A;  2W4M A;  2GFH A;  3CAX A;  2ZXW C;  3NMI A;  1LI7 A;  4G0H A;  3S28 A;  4E7Z A;  4C3D A;  1D0X A;  1ZZP A;  4ER9 A;  3EJN A;  4YT2 A;  2GDC A;  2KJG A;  2R9R B;  4G7Z F;  3LLI A;  1F1M A;  3LLK A;  5KYW B;  1RJ9 A;  1W2W A;  3QVZ A;  3U8P A;  4IAQ A;  1V55 C;  5B3S C;  1D1C A;  2UUH A;  4U5C E;  3O6X A;  2XXA A;  2CGE A;  1J8M F;  5COF A;  5DVW A;  4PFP A;  1WOL A;  1ZW2 A;  5AC5 A;  1RJ9 B;  3QVY A;  1HW2 A;  5F28 E;  3TQO A;  4J7T A;  1I4Z A;  3L8J A;  2H7V C;  3JRT A;  4MVZ A;  5EK0 A; 
#chains in the Genus database with same CATH homology
 2CYD A;  4BEM J;  2BL2 A;  3AOU A;  2DB4 A;  5TJ5 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...