3AOUA

Structure of the na+ unbound rotor ring modified with n,n f-dicyclohexylcarbodiimide of the na+-transporting v-atpase
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
156
structure length
156
Chain Sequence
MMDYLITQNGGMVFAVLAMATATIFSGIGSAKGVGMTGEAAAALTTSQPEKFGQALILQLLPGTQGLYGFVIAFLIFINLGSDMSVVQGLNFLGASLPIAFTGLFSGIAQGKVAAAGIQILAKKPEHATKGIIFAAMVETYAILGFVISFLLVLNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords V-type sodium ATPase subunit K
publication title Structure of the rotor ring modified with N,N'-dicyclohexylcarbodiimide of the Na+-transporting vacuolar ATPase.
pubmed doi rcsb
source organism Enterococcus hirae
total genus 65
structure length 156
sequence length 156
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2010-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00137 ATP-synt_C ATP synthase subunit C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.610 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) lithium bound rotor ring of v- atpase 3aouA00
5TJ5E 2DB4A 3AOUA 2BL2A 4BEMJ 2CYDA
chains in the Genus database with same CATH superfamily
1FMVA 3W4YA 3PCVA 2J0WA 4EIYA 3MLGA 2P61A 4ER9A 2V3CC 3J06A 2A0UA 2HKVA 3GEIA 2WB7A 2PFDA 3K1HA 3RH3A 3B29A 5F5HA 1FNTc 2VCBA 3I4UA 3UMKA 4BJTA 3PHF2 5L0JA 1OQCA 1VLSA 2L7AA 2TMVP 1T6UA 3W8HA 3VF0A 4N6CA 3EFOB 2AWYA 2F22A 1S05A 2Y3HA 4IAOA 1C03A 4EBBA 2J45A 4EHPA 4G78A 1J8MF 1NFOA 3JZ0A 2MWQA 1VB5A 1RJ9A 3NYJA 1A7VA 1V4AA 1YAUO 3E70C 3TOLA 2YZSA 2H7VC 4MW3A 5A6JA 5A6KA 5L0CA 1TWGA 4X0RA 5KYYB 2I8BA 4PK4A 4A2NB 4MVZA 4JTCB 3K1IA 2J0XA 2Y3BA 4AE4B 4E7SA 2J46A 2L6GA 4CSAC 3L8IA 2WZLA 4Q7CA 3K7DA 3ZTMA 2ZPAA 4YT2A 1OKKA 2XLDA 2XRHA 3LLKA 2Y3GA 3NKDA 4NQFA 2Y69C 4N4WA 5AGFA 3N0TA 4DBQA 1VOMA 3SXMA 3TJ6A 5JUAA 3NDBB 4JJGA 3TJ5A 3IPMO 4BJ1A 3RQFA 1H7IA 2YLDA 4G7OF 1Z6AA 2NG1A 4UDVA 1G8XA 3OA1A 1SR2A 1XWJA 3N2ZB 4O6YA 3UR3C 1OCRC 4MVUA 3GM2A 4CX9A 2OJQA 1HW1A 4J7YA 2XM4A 2JX0A 2LIGA 3RFYA 2OEVA 1EI7A 2LD6A 4CS7A 3CSKA 3K6BA 4O6NA 3SZRA 1SYQA 1K40A 4Z9JA 4LDRA 1MMNA 5E3CA 4JZAA 1Y4CA 1LKXA 1Y6DA 2Y39A 3X1OA 3CAXA 5JVEA 2XLOA 4JE9A 2R7QA 2I15A 3RW0A 4XTKA 1NSGB 1TFKB 2J9BA 4OINF 4EWCA 4LDQA 1ST6A 1WASA 4YL1A 3IEEA 3V5ZA 2BE5F 2P6VA 3ZDLA 4C3DA 4DRHB 4E0IA 2X0CA 3EGDB 4CJOA 4DBRA 3U3BA 3ECSA 3V7OA 3I5PA 1NBBA 2EPOA 3DJNB 3JYHA 256BA 2CYDA 4I1OB 4DRIB 3EGXB 1K04A 3ABLC 1A7DA 2GAQA 3GWLA 4G0HA 3TQOA 3DZAA 2DYSC 2OKUA 2EPNA 2KYHA 2Q00A 3L34A 3AQCA 2KK1A 3UMHA 1LE4A 2R7RA 5E33A 3S27A 1AVOB 4YWQA 2OQMA 4U5GA 4BJ5A 4FX5A 4MS2A 1T9KA 2XS8A 3GEEA 4YT5A 4AL0A 5BQHA 3EHMA 1A0BA 2KSFA 2HFIA 3S84A 3GORA 3LESA 1ORYA 4P9FA 2YL1A 1ORSC 4P9TA 1ZU5A 2YQYA 3QVYA 4F4BA 2IM8A 1SF8A 2E87A 3DKAA 1L3PA 3KYJA 1NU9C 1OCOC 3FVYA 2L81A 2CNWD 1YZCA 1G5ZA 1VMAA 1HY5A 1YLMA 3L1MA 4E18A 1G4WR 4RBNA 2RSEB 4MVRA 4U9DA 3G4ZA 3HNKA 1TFOB 4MW8A 5DVWA 3FAPB 3C8GA 5KYWA 4H54A 5DQTA 1I4YA 3L8JA 1O87A 3WG7C 1D1BA 2G3VA 2W4BA 2JD3A 2B0JA 3JYYA 3RIPA 3ZSUA 3EQLF 1W2WA 3NYLA 3TOMA 1TWAA 2C04A 4ANJA 5JS5A 4D4XA 3RQGA 5KYUA 3U9MA 1LE2A 1OR3A 4IJJA 1GQAA 3FXHA 2PP4A 4E0HA 4XLPF 2C03A 2EINC 2QUPA 3LEOA 4QDLA 3U8PA 3WHNA 3AG4C 5KYXA 3TULA 2Z15A 3CQZA 3T6JA 4FESA 3SXYA 1RMVA 1G4US 3UMIA 5CIVA 4MQ9F 4NTAA 2KJGA 3S28A 2WL8A 1NZEA 2XLWA 5GPGB 1Q0FA 1DOVA 3JRTA 4U5HA 2R9RB 2NUTB 3TD7A 3ZC4A 1ZHTA 4PJMA 4XPXA 1OXBA 4J32B 2ZXRA 3QZCA 4JURI 3DE9A 3DE8A 4R32A 2YVKA 5B3SC 1Q0GA 2PF4E 1FFTC 4P6IC 3TK0A 3ZQVA 1C02A 2GDCA 1D0XA 4J30B 5B1AC 3LAYA 4LLCA 4XPWA 4DOZA 2OJED 4CDVA 3KPHA 1LPEA 1XZQA 4OD4A 3OWTA 5COMA 2B0HA 4BEMJ 5FCLA 1VLTA 1VYKA 2X51A 2KQ9A 3DM5A 3T4RA 2LFFA 2IOQA 3IQCA 2H7OA 1V54C 4PR9A 4WJ0A 1DOWA 1TKNA 2AP3A 2DI3A 2XLVA 2ZXOA 4YL3A 3V5XA 3UGPA 3BEHA 2R7WA 3MX3A 5DLJA 2HV7A 1M2VA 4GEHA 4GQHA 4I1MA 4W8PA 1E84A 4MVMA 3LLIA 2LFDA 2VASA 2EILC 5CI9A 4JTAB 3JRMO 3JTLO 3B0VC 3DMDA 1RCPA 2FAPB 3EJNA 5JSLA 2FFHA 2W45A 2WVNA 2J8WA 4XEFA 3AQBA 3H65A 1MNEA 2IXMA 1RKEA 2YLIA 3AG3C 4NC3A 4PFPA 2ETSA 4ULWA 5L0FA 4OIPF 2PNOA 3PMRA 2D5RB 4PJLA 3F46A 3LNRA 1E85A 4NY3A 2L9JA 4Z9IA 3U0CA 2W4MA 3U2LA 4G7ZF 3RF3A 2G62A 3Q7LA 1TWHA 3AOUA 3SXKA 1H9GA 2OG2A 3JT1A 2OU6A 3CEXA 3NG1A 1ZU4A 3WAQA 2OCCC 1PV3A 4HE8D 5JP7A 4PFOA 3UGOA 1PCXA 4WABA 4ULVA 3SNHA 1QQ3A 5JLIA 5EK0A 2DGJA 3EG9B 4I44A 1E83A 1FTSA 1HE1A 2FGYA 4AX2A 2DB4A 2Q9AA 4ZLDA 1WTYA 1EKYA 4LLEA 4DJ9A 2KC3A 2MYSA 4YL0A 4OIRF 3RKOF 1AEPA 3V5YA 1U0BB 2KGOA 2QE9A 3FOOA 2WVQA 1Z23A 3MYIA 3GEHA 4PJJA 3NMJA 2HV6A 1LI7A 2VB6A 1ZHXA 5A6BD 4C7OA 1U6HA 2LK4A 1CGNA 2UUHA 1UFBA 3O6XA 5D91A 1L7CA 4CSAA 5BQGA 3IQ5A 4HFFB 1IZMA 4U5FE 3S9OA 4NTFA 1OCCC 1VTMP 2LSEA 4PJNA 1TR2A 3R7CA 5T3TA 5AC4A 1T5OA 4JIOA 2R03A 3MBGA 4N06A 2YHSA 3HNJA 5B3IA 3NRHA 4MTGA 1OCZC 2R7OA 2J7PD 4MTOA 1WN0A 1OW7A 2R05A 2XL4A 1WGWA 2HSQA 2HJMA 2PX0A 3ABMC 3DI5A 3FOPA 1NFNA 3QW0A 4MVQA 3SXZA 1GGQA 1ZZPA 2R7UA 1BR4A 1TWCA 3JSEO 5JT4A 3POVA 2YEVA 4JRZA 4JCZA 3NKEA 1UG7A 5BUOA 1HMDA 4BG0A 5KYYA 4JKVA 1T6IA 1GM5A 4XQ1A 4BEJA 2YWAA 4O6MA 4RDAA 1HE9A 2HS5A 3G4XA 4K7BA 4YN0B 3QMKA 3SYNA 4AE4A 2OEXA 2XL6A 4Q5SF 2M4EA 4LACB 2IXPA 1YYXA 3GM3A 2A0BA 2IXNA 3HTKC 2ICWG 5FZTA 3VM6A 4CDYA 3AGTA 1FMWA 1R4TA 2D4UA 3BRJA 4J7TA 1WATA 3ZG1A 3LNMB 3G50A 3LUTB 4BPMA 1V74B 2OOCA 4KI2A 4Z9HA 4LERA 1LM3B 2YL3A 2HSBA 3U8VA 4AK9A 3O55A 2J9WA 3EH1A 2R7VA 5IY5C 1U89A 1APCA 1A7EA 1D0YA 2EPKX 3M4CA 4W8KA 1RJ9B 2R7SA 3KH2A 1JOGA 2P0NA 2HMQA 3H2UA 3VAYA 1KNYA 1JPNA 3WODF 1ZHYA 4ONSA 4PACA 1M2OA 3RVYA 4IARA 1FR0A 1V55C 2L6FA 1HMOA 4EBKA 2KNHA 2EIKC 2YL7A 3OEOA 4NCQA 1OR2A 1A41A 2A1DD 3HLZA 1FFHA 3RQEA 1RKEB 4QI0A 3EGDA 3ITFA 4WGZA 2YRFA 3DD7A 4CIPA 4JJFA 3SP1A 3IQ6A 3DXJF 2NUPA 4IAQA 2ZXPA 4XPYA 2H8AA 1YA9A 3JSZA 1QSPA 3MFNA 3FDQA 4MTFA 2Q3TA 5A69A 1ZVZA 2YL0A 3Q6MA 3PDMP 1HW2A 3I5QA 3KKBA 1FAPB 1NG1A 2VCCA 2CGEA 4KC9A 5T1DB 4WGYA 3U9JA 3HKKA 3U2MA 5F5FA 1SMYF 1ZW3A 4XLNF 2EIJC 1PD1A 2A6EF 3EHNA 5HSWA 3HNIA 2CDQA 1QLEC 3ATPA 2IYLD 2XSEA 3B0UX 1QKRA 1ZHWA 3HNLA 1KTMA 4O79A 2BC5A 2Q7RA 4AL1A 1YDIA 2PX3A 2XXAA 5E3AA 4GYTA 3FMSA 2L6HA 1NLXA 3X2QC 3N24A 1ZHZA 2DYRC 2CW0F 1WOLA 2IBFA 1RXQA 3T6GB 3W2WA 4K0DA 3ZWIA 2A69F 2AU5A 4KNWA 3W8IA 4LDKA 1MQVA 2XM0A 1NU7D 2WZGA 3AJMA 2M64A 3B71A 3DM9B 5L0GA 4C3EA 1KU2A 3FAJA 2A6HF 2GA0A 3M15A 2CNWA 4EUKB 4EBJA 2GWWA 1Q0MA 2EIMC 4L6RA 3C18A 2R02A 4JEBA 3E9VA 3VYWA 4B6IA 2AVKA 5L0HA 1B68A 2A68F 2EPLX 1E86A 1MMAA 3Q7GA 3QVZA 1CPRA 2NSGA 4XEKA 4OIQF 5K0IA 4Q4ZF 1TQGA 3B9QA 1QVXA 4KBLA 3RVZA 4G7HF 2Y3DA 2LP4A 1Z63A 1IW7F 2ZD9A 2WVOA 3C8ZA 4JTDB 3U3FA 1QZXA 3T9OA 1XZPA 2LCHA 4E17A 1MMGA 1LS4A 2J9UA 1H9TA 1OW8A 4YT4A 4O7GA 1M57C 1PD0A 2CCYA 4M63A 5D92A 3GODA 4CS8C 4K1OA 1M56C 3VRCA 4DXWA 3C7JA 4IRUA 3RYLA 1Q0DA 1WWPA 2NUTA 3KYIA 5TJ5E 3ASNC 3W2VA 1I4ZA 2IXOA 2QTVA 3U5SA 5DQZA 4U5CE 3MYFA 3GWNA 4I3MA 2W9YA 5B1BC 5F28E 3C8GB 2R25A 5KYWB 1D1CA 5AC5A 3C8GD 2R7XA 3A9CA 3Q6NA 4RD9A 3S90A 5L3VA 3C62A 3B0PA 3EPVA 5L3QA 3NMKA 3IQTA 5HV9A 1J8YF 4BJ5C 1QPUA 1C17M 2H7BA 3A11A 3O39A 5KYUB 1YJGA 3DJUB 4U5BE 3DAFA 5BQIA 4QI2A 1T01A 5KYXB 1ZYRF 3AG2C 5COGA 2VH3A 4HFKB 5EHHA 3EFOA 5DS5A 3M1CB 2V26A 4IGGA 2HJ3A 3ZQYA 3UNGC 4XWJA 4CS9C 3SEOA 1LVKA 1LIHA 4CIHA 3LS1A 1BR2A 3EZIA 4JVSA 1M6TA 1N1CA 4JC7A 4ZLCA 3JCUQ 3K33A 3DAGA 4E7ZA 2AWCA 4IB4A 1LI5A 1EA8A 2Q9BA 2NUPB 3AG1C 1Z7Qc 5L0IA 4MVOA 4NTBA 1YARO 3S0XA 1JRAA 2XS1A 3T6BA 4CS8A 5E2QA 3ZVRA 2XXAB 1R5ID 1ORJA 2XL8A 2XLHA 3HJCA 4JCHA 3S29A 3NMIA 1D0ZA 2ZXWC 1CGME 1LS1A 1S7ZA 5EGYA 3KMIA 3AGUA 3LJBA 4OIOF 2HUJA 1YZAA 3K66A 3EZHA 1SZIA 4D4NA 5L0DA 3L0IA 5T3WA 4FAPB 3GM1A 4N6HA 1JR8A 3EH2A 4U9EA 2LQGA 4DVYP 2P7VA 1H6GA 2RD9A 2Q4FA 4KNVA 3NYMA 1RKCA 2PBEA 2UUIA 3IHUA 1Z3IX 3O10A 4MVSA 4OD5A 4IWBA 1BZ4A 5JRAA 1BDJB 1D1AA 1CGOA 2XLEA 4BJ6C 1M2VB 4CJGA 1EQ1A 4JW1A 1JMWA 2NPUA 2JPUA 3EG9A 4CS9A 2MHRA 2G3KA 2YLGA 2NSFA 1BR1A 4U5DE 4JEAA 4MNDA 2QLAA 2O9XA 1JAFA 4DRJB 2VCAA 1K05A 3ASOC 1MMDA 3C63A 3F47A 3LS0A 3CZ6A 1OKKD 3R2PA 4YK5A 5A6BA 3QW1A 1CPQA 3M4BA 4CDAA 2HMZA 2KW3C 3QTHA 4HEAJ 4XEVA 5DS6A 3GANA 5CI8A 3M79A 5COFA 3ZTZA 2VC9A 4CBEA 4H4KC 2EPMX 2ASRA 3EGXA 1F1MA 1OW6A 2QY9A 4U5EE 4EKWA 1MNDA 5KYNA 5DS4A 3LEVA 1JPJA 2P1AA 5A6AA 1BBHA 2J7PA 1VYIA 1T6QA 4A4AA 2WZFA 2YKZA 1OXKA 1YVIA 1YYJA 2HZ8A 1YA7O 2XLMA 3H2VA 3K1IC 4C3BA 2J9VA 2BL2A 3DWWA 4FWVA 4BJ6A 3FHDA 4YJWA 2R7TA 1GS9A 4YT8A 1I5NA 3KL4A 1Q0KA 3ABKC 4DVZA 1AUEA 1ZW2A 2GFHA 1O3UA 4C7OB 1E2XA 1Z5ZA 2QNLA 1O5HA 2Q9CA 3US6A 1VK5A 3ZIBA
chains in the Genus database with same CATH topology
5TJ5E 2DB4A 3AOUA 2BL2A 4BEMJ 2CYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TJ5 E;  2DB4 A;  3AOU A;  2BL2 A;  4BEM J;  2CYD A; 
#chains in the Genus database with same CATH topology
 1FMV A;  3W4Y A;  3PCV A;  2J0W A;  4EIY A;  3MLG A;  2P61 A;  4ER9 A;  2V3C C;  3J06 A;  2A0U A;  2HKV A;  3GEI A;  2WB7 A;  2PFD A;  3K1H A;  3RH3 A;  3B29 A;  5F5H A;  1FNT c;  2VCB A;  3I4U A;  3UMK A;  4BJT A;  3PHF 2;  5L0J A;  1OQC A;  1VLS A;  2L7A A;  2TMV P;  1T6U A;  3W8H A;  3VF0 A;  4N6C A;  3EFO B;  2AWY A;  2F22 A;  1S05 A;  2Y3H A;  4IAO A;  1C03 A;  4EBB A;  2J45 A;  4EHP A;  4G78 A;  1J8M F;  1NFO A;  3JZ0 A;  2MWQ A;  1VB5 A;  1RJ9 A;  3NYJ A;  1A7V A;  1V4A A;  1YAU O;  3E70 C;  3TOL A;  2YZS A;  2H7V C;  4MW3 A;  5A6J A;  5A6K A;  5L0C A;  1TWG A;  4X0R A;  5KYY B;  2I8B A;  4PK4 A;  4A2N B;  4MVZ A;  4JTC B;  3K1I A;  2J0X A;  2Y3B A;  4AE4 B;  4E7S A;  2J46 A;  2L6G A;  4CSA C;  3L8I A;  2WZL A;  4Q7C A;  3K7D A;  3ZTM A;  2ZPA A;  4YT2 A;  1OKK A;  2XLD A;  2XRH A;  3LLK A;  2Y3G A;  3NKD A;  4NQF A;  2Y69 C;  4N4W A;  5AGF A;  3N0T A;  4DBQ A;  1VOM A;  3SXM A;  3TJ6 A;  5JUA A;  3NDB B;  4JJG A;  3TJ5 A;  3IPM O;  4BJ1 A;  3RQF A;  1H7I A;  2YLD A;  4G7O F;  1Z6A A;  2NG1 A;  4UDV A;  1G8X A;  3OA1 A;  1SR2 A;  1XWJ A;  3N2Z B;  4O6Y A;  3UR3 C;  1OCR C;  4MVU A;  3GM2 A;  4CX9 A;  2OJQ A;  1HW1 A;  4J7Y A;  2XM4 A;  2JX0 A;  2LIG A;  3RFY A;  2OEV A;  1EI7 A;  2LD6 A;  4CS7 A;  3CSK A;  3K6B A;  4O6N A;  3SZR A;  1SYQ A;  1K40 A;  4Z9J A;  4LDR A;  1MMN A;  5E3C A;  4JZA A;  1Y4C A;  1LKX A;  1Y6D A;  2Y39 A;  3X1O A;  3CAX A;  5JVE A;  2XLO A;  4JE9 A;  2R7Q A;  2I15 A;  3RW0 A;  4XTK A;  1NSG B;  1TFK B;  2J9B A;  4OIN F;  4EWC A;  4LDQ A;  1ST6 A;  1WAS A;  4YL1 A;  3IEE A;  3V5Z A;  2BE5 F;  2P6V A;  3ZDL A;  4C3D A;  4DRH B;  4E0I A;  2X0C A;  3EGD B;  4CJO A;  4DBR A;  3U3B A;  3ECS A;  3V7O A;  3I5P A;  1NBB A;  2EPO A;  3DJN B;  3JYH A;  256B A;  2CYD A;  4I1O B;  4DRI B;  3EGX B;  1K04 A;  3ABL C;  1A7D A;  2GAQ A;  3GWL A;  4G0H A;  3TQO A;  3DZA A;  2DYS C;  2OKU A;  2EPN A;  2KYH A;  2Q00 A;  3L34 A;  3AQC A;  2KK1 A;  3UMH A;  1LE4 A;  2R7R A;  5E33 A;  3S27 A;  1AVO B;  4YWQ A;  2OQM A;  4U5G A;  4BJ5 A;  4FX5 A;  4MS2 A;  1T9K A;  2XS8 A;  3GEE A;  4YT5 A;  4AL0 A;  5BQH A;  3EHM A;  1A0B A;  2KSF A;  2HFI A;  3S84 A;  3GOR A;  3LES A;  1ORY A;  4P9F A;  2YL1 A;  1ORS C;  4P9T A;  1ZU5 A;  2YQY A;  3QVY A;  4F4B A;  2IM8 A;  1SF8 A;  2E87 A;  3DKA A;  1L3P A;  3KYJ A;  1NU9 C;  1OCO C;  3FVY A;  2L81 A;  2CNW D;  1YZC A;  1G5Z A;  1VMA A;  1HY5 A;  1YLM A;  3L1M A;  4E18 A;  1G4W R;  4RBN A;  2RSE B;  4MVR A;  4U9D A;  3G4Z A;  3HNK A;  1TFO B;  4MW8 A;  5DVW A;  3FAP B;  3C8G A;  5KYW A;  4H54 A;  5DQT A;  1I4Y A;  3L8J A;  1O87 A;  3WG7 C;  1D1B A;  2G3V A;  2W4B A;  2JD3 A;  2B0J A;  3JYY A;  3RIP A;  3ZSU A;  3EQL F;  1W2W A;  3NYL A;  3TOM A;  1TWA A;  2C04 A;  4ANJ A;  5JS5 A;  4D4X A;  3RQG A;  5KYU A;  3U9M A;  1LE2 A;  1OR3 A;  4IJJ A;  1GQA A;  3FXH A;  2PP4 A;  4E0H A;  4XLP F;  2C03 A;  2EIN C;  2QUP A;  3LEO A;  4QDL A;  3U8P A;  3WHN A;  3AG4 C;  5KYX A;  3TUL A;  2Z15 A;  3CQZ A;  3T6J A;  4FES A;  3SXY A;  1RMV A;  1G4U S;  3UMI A;  5CIV A;  4MQ9 F;  4NTA A;  2KJG A;  3S28 A;  2WL8 A;  1NZE A;  2XLW A;  5GPG B;  1Q0F A;  1DOV A;  3JRT A;  4U5H A;  2R9R B;  2NUT B;  3TD7 A;  3ZC4 A;  1ZHT A;  4PJM A;  4XPX A;  1OXB A;  4J32 B;  2ZXR A;  3QZC A;  4JUR I;  3DE9 A;  3DE8 A;  4R32 A;  2YVK A;  5B3S C;  1Q0G A;  2PF4 E;  1FFT C;  4P6I C;  3TK0 A;  3ZQV A;  1C02 A;  2GDC A;  1D0X A;  4J30 B;  5B1A C;  3LAY A;  4LLC A;  4XPW A;  4DOZ A;  2OJE D;  4CDV A;  3KPH A;  1LPE A;  1XZQ A;  4OD4 A;  3OWT A;  5COM A;  2B0H A;  4BEM J;  5FCL A;  1VLT A;  1VYK A;  2X51 A;  2KQ9 A;  3DM5 A;  3T4R A;  2LFF A;  2IOQ A;  3IQC A;  2H7O A;  1V54 C;  4PR9 A;  4WJ0 A;  1DOW A;  1TKN A;  2AP3 A;  2DI3 A;  2XLV A;  2ZXO A;  4YL3 A;  3V5X A;  3UGP A;  3BEH A;  2R7W A;  3MX3 A;  5DLJ A;  2HV7 A;  1M2V A;  4GEH A;  4GQH A;  4I1M A;  4W8P A;  1E84 A;  4MVM A;  3LLI A;  2LFD A;  2VAS A;  2EIL C;  5CI9 A;  4JTA B;  3JRM O;  3JTL O;  3B0V C;  3DMD A;  1RCP A;  2FAP B;  3EJN A;  5JSL A;  2FFH A;  2W45 A;  2WVN A;  2J8W A;  4XEF A;  3AQB A;  3H65 A;  1MNE A;  2IXM A;  1RKE A;  2YLI A;  3AG3 C;  4NC3 A;  4PFP A;  2ETS A;  4ULW A;  5L0F A;  4OIP F;  2PNO A;  3PMR A;  2D5R B;  4PJL A;  3F46 A;  3LNR A;  1E85 A;  4NY3 A;  2L9J A;  4Z9I A;  3U0C A;  2W4M A;  3U2L A;  4G7Z F;  3RF3 A;  2G62 A;  3Q7L A;  1TWH A;  3AOU A;  3SXK A;  1H9G A;  2OG2 A;  3JT1 A;  2OU6 A;  3CEX A;  3NG1 A;  1ZU4 A;  3WAQ A;  2OCC C;  1PV3 A;  4HE8 D;  5JP7 A;  4PFO A;  3UGO A;  1PCX A;  4WAB A;  4ULV A;  3SNH A;  1QQ3 A;  5JLI A;  5EK0 A;  2DGJ A;  3EG9 B;  4I44 A;  1E83 A;  1FTS A;  1HE1 A;  2FGY A;  4AX2 A;  2DB4 A;  2Q9A A;  4ZLD A;  1WTY A;  1EKY A;  4LLE A;  4DJ9 A;  2KC3 A;  2MYS A;  4YL0 A;  4OIR F;  3RKO F;  1AEP A;  3V5Y A;  1U0B B;  2KGO A;  2QE9 A;  3FOO A;  2WVQ A;  1Z23 A;  3MYI A;  3GEH A;  4PJJ A;  3NMJ A;  2HV6 A;  1LI7 A;  2VB6 A;  1ZHX A;  5A6B D;  4C7O A;  1U6H A;  2LK4 A;  1CGN A;  2UUH A;  1UFB A;  3O6X A;  5D91 A;  1L7C A;  4CSA A;  5BQG A;  3IQ5 A;  4HFF B;  1IZM A;  4U5F E;  3S9O A;  4NTF A;  1OCC C;  1VTM P;  2LSE A;  4PJN A;  1TR2 A;  3R7C A;  5T3T A;  5AC4 A;  1T5O A;  4JIO A;  2R03 A;  3MBG A;  4N06 A;  2YHS A;  3HNJ A;  5B3I A;  3NRH A;  4MTG A;  1OCZ C;  2R7O A;  2J7P D;  4MTO A;  1WN0 A;  1OW7 A;  2R05 A;  2XL4 A;  1WGW A;  2HSQ A;  2HJM A;  2PX0 A;  3ABM C;  3DI5 A;  3FOP A;  1NFN A;  3QW0 A;  4MVQ A;  3SXZ A;  1GGQ A;  1ZZP A;  2R7U A;  1BR4 A;  1TWC A;  3JSE O;  5JT4 A;  3POV A;  2YEV A;  4JRZ A;  4JCZ A;  3NKE A;  1UG7 A;  5BUO A;  1HMD A;  4BG0 A;  5KYY A;  4JKV A;  1T6I A;  1GM5 A;  4XQ1 A;  4BEJ A;  2YWA A;  4O6M A;  4RDA A;  1HE9 A;  2HS5 A;  3G4X A;  4K7B A;  4YN0 B;  3QMK A;  3SYN A;  4AE4 A;  2OEX A;  2XL6 A;  4Q5S F;  2M4E A;  4LAC B;  2IXP A;  1YYX A;  3GM3 A;  2A0B A;  2IXN A;  3HTK C;  2ICW G;  5FZT A;  3VM6 A;  4CDY A;  3AGT A;  1FMW A;  1R4T A;  2D4U A;  3BRJ A;  4J7T A;  1WAT A;  3ZG1 A;  3LNM B;  3G50 A;  3LUT B;  4BPM A;  1V74 B;  2OOC A;  4KI2 A;  4Z9H A;  4LER A;  1LM3 B;  2YL3 A;  2HSB A;  3U8V A;  4AK9 A;  3O55 A;  2J9W A;  3EH1 A;  2R7V A;  5IY5 C;  1U89 A;  1APC A;  1A7E A;  1D0Y A;  2EPK X;  3M4C A;  4W8K A;  1RJ9 B;  2R7S A;  3KH2 A;  1JOG A;  2P0N A;  2HMQ A;  3H2U A;  3VAY A;  1KNY A;  1JPN A;  3WOD F;  1ZHY A;  4ONS A;  4PAC A;  1M2O A;  3RVY A;  4IAR A;  1FR0 A;  1V55 C;  2L6F A;  1HMO A;  4EBK A;  2KNH A;  2EIK C;  2YL7 A;  3OEO A;  4NCQ A;  1OR2 A;  1A41 A;  2A1D D;  3HLZ A;  1FFH A;  3RQE A;  1RKE B;  4QI0 A;  3EGD A;  3ITF A;  4WGZ A;  2YRF A;  3DD7 A;  4CIP A;  4JJF A;  3SP1 A;  3IQ6 A;  3DXJ F;  2NUP A;  4IAQ A;  2ZXP A;  4XPY A;  2H8A A;  1YA9 A;  3JSZ A;  1QSP A;  3MFN A;  3FDQ A;  4MTF A;  2Q3T A;  5A69 A;  1ZVZ A;  2YL0 A;  3Q6M A;  3PDM P;  1HW2 A;  3I5Q A;  3KKB A;  1FAP B;  1NG1 A;  2VCC A;  2CGE A;  4KC9 A;  5T1D B;  4WGY A;  3U9J A;  3HKK A;  3U2M A;  5F5F A;  1SMY F;  1ZW3 A;  4XLN F;  2EIJ C;  1PD1 A;  2A6E F;  3EHN A;  5HSW A;  3HNI A;  2CDQ A;  1QLE C;  3ATP A;  2IYL D;  2XSE A;  3B0U X;  1QKR A;  1ZHW A;  3HNL A;  1KTM A;  4O79 A;  2BC5 A;  2Q7R A;  4AL1 A;  1YDI A;  2PX3 A;  2XXA A;  5E3A A;  4GYT A;  3FMS A;  2L6H A;  1NLX A;  3X2Q C;  3N24 A;  1ZHZ A;  2DYR C;  2CW0 F;  1WOL A;  2IBF A;  1RXQ A;  3T6G B;  3W2W A;  4K0D A;  3ZWI A;  2A69 F;  2AU5 A;  4KNW A;  3W8I A;  4LDK A;  1MQV A;  2XM0 A;  1NU7 D;  2WZG A;  3AJM A;  2M64 A;  3B71 A;  3DM9 B;  5L0G A;  4C3E A;  1KU2 A;  3FAJ A;  2A6H F;  2GA0 A;  3M15 A;  2CNW A;  4EUK B;  4EBJ A;  2GWW A;  1Q0M A;  2EIM C;  4L6R A;  3C18 A;  2R02 A;  4JEB A;  3E9V A;  3VYW A;  4B6I A;  2AVK A;  5L0H A;  1B68 A;  2A68 F;  2EPL X;  1E86 A;  1MMA A;  3Q7G A;  3QVZ A;  1CPR A;  2NSG A;  4XEK A;  4OIQ F;  5K0I A;  4Q4Z F;  1TQG A;  3B9Q A;  1QVX A;  4KBL A;  3RVZ A;  4G7H F;  2Y3D A;  2LP4 A;  1Z63 A;  1IW7 F;  2ZD9 A;  2WVO A;  3C8Z A;  4JTD B;  3U3F A;  1QZX A;  3T9O A;  1XZP A;  2LCH A;  4E17 A;  1MMG A;  1LS4 A;  2J9U A;  1H9T A;  1OW8 A;  4YT4 A;  4O7G A;  1M57 C;  1PD0 A;  2CCY A;  4M63 A;  5D92 A;  3GOD A;  4CS8 C;  4K1O A;  1M56 C;  3VRC A;  4DXW A;  3C7J A;  4IRU A;  3RYL A;  1Q0D A;  1WWP A;  2NUT A;  3KYI A;  5TJ5 E;  3ASN C;  3W2V A;  1I4Z A;  2IXO A;  2QTV A;  3U5S A;  5DQZ A;  4U5C E;  3MYF A;  3GWN A;  4I3M A;  2W9Y A;  5B1B C;  5F28 E;  3C8G B;  2R25 A;  5KYW B;  1D1C A;  5AC5 A;  3C8G D;  2R7X A;  3A9C A;  3Q6N A;  4RD9 A;  3S90 A;  5L3V A;  3C62 A;  3B0P A;  3EPV A;  5L3Q A;  3NMK A;  3IQT A;  5HV9 A;  1J8Y F;  4BJ5 C;  1QPU A;  1C17 M;  2H7B A;  3A11 A;  3O39 A;  5KYU B;  1YJG A;  3DJU B;  4U5B E;  3DAF A;  5BQI A;  4QI2 A;  1T01 A;  5KYX B;  1ZYR F;  3AG2 C;  5COG A;  2VH3 A;  4HFK B;  5EHH A;  3EFO A;  5DS5 A;  3M1C B;  2V26 A;  4IGG A;  2HJ3 A;  3ZQY A;  3UNG C;  4XWJ A;  4CS9 C;  3SEO A;  1LVK A;  1LIH A;  4CIH A;  3LS1 A;  1BR2 A;  3EZI A;  4JVS A;  1M6T A;  1N1C A;  4JC7 A;  4ZLC A;  3JCU Q;  3K33 A;  3DAG A;  4E7Z A;  2AWC A;  4IB4 A;  1LI5 A;  1EA8 A;  2Q9B A;  2NUP B;  3AG1 C;  1Z7Q c;  5L0I A;  4MVO A;  4NTB A;  1YAR O;  3S0X A;  1JRA A;  2XS1 A;  3T6B A;  4CS8 A;  5E2Q A;  3ZVR A;  2XXA B;  1R5I D;  1ORJ A;  2XL8 A;  2XLH A;  3HJC A;  4JCH A;  3S29 A;  3NMI A;  1D0Z A;  2ZXW C;  1CGM E;  1LS1 A;  1S7Z A;  5EGY A;  3KMI A;  3AGU A;  3LJB A;  4OIO F;  2HUJ A;  1YZA A;  3K66 A;  3EZH A;  1SZI A;  4D4N A;  5L0D A;  3L0I A;  5T3W A;  4FAP B;  3GM1 A;  4N6H A;  1JR8 A;  3EH2 A;  4U9E A;  2LQG A;  4DVY P;  2P7V A;  1H6G A;  2RD9 A;  2Q4F A;  4KNV A;  3NYM A;  1RKC A;  2PBE A;  2UUI A;  3IHU A;  1Z3I X;  3O10 A;  4MVS A;  4OD5 A;  4IWB A;  1BZ4 A;  5JRA A;  1BDJ B;  1D1A A;  1CGO A;  2XLE A;  4BJ6 C;  1M2V B;  4CJG A;  1EQ1 A;  4JW1 A;  1JMW A;  2NPU A;  2JPU A;  3EG9 A;  4CS9 A;  2MHR A;  2G3K A;  2YLG A;  2NSF A;  1BR1 A;  4U5D E;  4JEA A;  4MND A;  2QLA A;  2O9X A;  1JAF A;  4DRJ B;  2VCA A;  1K05 A;  3ASO C;  1MMD A;  3C63 A;  3F47 A;  3LS0 A;  3CZ6 A;  1OKK D;  3R2P A;  4YK5 A;  5A6B A;  3QW1 A;  1CPQ A;  3M4B A;  4CDA A;  2HMZ A;  2KW3 C;  3QTH A;  4HEA J;  4XEV A;  5DS6 A;  3GAN A;  5CI8 A;  3M79 A;  5COF A;  3ZTZ A;  2VC9 A;  4CBE A;  4H4K C;  2EPM X;  2ASR A;  3EGX A;  1F1M A;  1OW6 A;  2QY9 A;  4U5E E;  4EKW A;  1MND A;  5KYN A;  5DS4 A;  3LEV A;  1JPJ A;  2P1A A;  5A6A A;  1BBH A;  2J7P A;  1VYI A;  1T6Q A;  4A4A A;  2WZF A;  2YKZ A;  1OXK A;  1YVI A;  1YYJ A;  2HZ8 A;  1YA7 O;  2XLM A;  3H2V A;  3K1I C;  4C3B A;  2J9V A;  2BL2 A;  3DWW A;  4FWV A;  4BJ6 A;  3FHD A;  4YJW A;  2R7T A;  1GS9 A;  4YT8 A;  1I5N A;  3KL4 A;  1Q0K A;  3ABK C;  4DVZ A;  1AUE A;  1ZW2 A;  2GFH A;  1O3U A;  4C7O B;  1E2X A;  1Z5Z A;  2QNL A;  1O5H A;  2Q9C A;  3US6 A;  1VK5 A;  3ZIB A; 
#chains in the Genus database with same CATH homology
 5TJ5 E;  2DB4 A;  3AOU A;  2BL2 A;  4BEM J;  2CYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...