3AOUA

Structure of the na+ unbound rotor ring modified with n,n f-dicyclohexylcarbodiimide of the na+-transporting v-atpase
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
156
structure length
156
Chain Sequence
MMDYLITQNGGMVFAVLAMATATIFSGIGSAKGVGMTGEAAAALTTSQPEKFGQALILQLLPGTQGLYGFVIAFLIFINLGSDMSVVQGLNFLGASLPIAFTGLFSGIAQGKVAAAGIQILAKKPEHATKGIIFAAMVETYAILGFVISFLLVLNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords V-type sodium ATPase subunit K
publication title Structure of the rotor ring modified with N,N'-dicyclohexylcarbodiimide of the Na+-transporting vacuolar ATPase.
pubmed doi rcsb
source organism Enterococcus hirae
molecule tags Hydrolase
total genus 65
structure length 156
sequence length 156
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2010-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00137 ATP-synt_C ATP synthase subunit C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.610 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) lithium bound rotor ring of v- atpase 3aouA00
3AOUA 2CYDA 2DB4A 4BEMJ 5TJ5E 2BL2A
chains in the Genus database with same CATH superfamily
4R32A 4EHPA 1Y4CA 5JRAA 4A2NB 1E85A 3EJNA 4U5FE 1LI7A 3F47A 5GPGB 1OR3A 2AVKA 3T9OA 1T01A 2Q3TA 4ULWA 3RW0A 1EQ1A 4CSAC 2R25A 4FESA 5F5FA 4XPWA 2FFHA 4FX5A 5BUOA 2IXPA 3R7CA 2XM4A 1J8YF 4PJLA 3DJNB 3EH1A 1JAFA 1VYIA 4B6IA 1Q0GA 3UGOA 2PNOA 3GWLA 2J9UA 1LVKA 2RSEB 3AG1C 1R4TA 2QY9A 1Z7Qc 3WODF 4C7OA 2IM8A 1Q0KA 2NUPB 1G8XA 2LCHA 3UNGC 1FMVA 5AC4A 3RQFA 4BEMJ 3U3BA 3M4BA 1SR2A 3AQCA 2IXOA 2HV7A 3DZAA 1E86A 3V7OA 2J7PA 4XTKA 1M6TA 5T3TA 5A6BD 3WHNA 4U9EA 4D4XA 1JMWA 1M2VA 1VOMA 1HW2A 4LDQA 2Q9CA 2XS8A 2IBFA 3UR3C 3C8GA 1E2XA 1VYKA 4PACA 1HMDA 1UG7A 3T6BA 2J45A 1TKNA 1NLXA 4K7BA 4YL1A 1CGNA 2OKUA 4JCHA 5BQIA 4OD4A 4CBEA 2A0BA 4MVQA 1ZZPA 3AG3C 3SZRA 1SMYF 4KI2A 4PFOA 2EPNA 1BBHA 2BL2A 4IWBA 2L81A 3KMIA 3AOUA 3G50A 3WAQA 4JTAB 2J46A 4ZLCA 1HE1A 2OCCC 2XLHA 4O7GA 4YL0A 3RYLA 4CDAA 2LSEA 4BJ5C 4NCQA 3C8ZA 4U9DA 4DRJB 2YVKA 4AL1A 4YT4A 1NU9C 1ST6A 2HV6A 3B9QA 2HMQA 3LESA 5E3CA 1YVIA 3RH3A 2A0UA 3GM2A 4BEJA 4YJWA 4PFPA 3O6XA 5CIVA 4XEFA 4L6RA 3KKBA 3Q6MA 3NRHA 3VF0A 4O6NA 4PJMA 3CEXA 2KYHA 3K6BA 1LI5A 5E3AA 1IZMA 3US6A 3HNKA 1ZU4A 3PHF2 1YARO 4K1OA 2YL0A 4EWCA 4W8KA 1OR2A 4NQFA 5L0DA 3RVYA 4Z9HA 3TOLA 2CDQA 3CSKA 2EPMX 1N1CA 2PP4A 4J7YA 2HJ3A 3NDBB 2LP4A 4ZLDA 5KYXB 4CDVA 4LDKA 1AUEA 2VCBA 4KC9A 4MNDA 2HKVA 2H7OA 2DYRC 2A6EF 1APCA 3I5QA 1H7IA 1LE2A 3SXYA 3ZTMA 3BEHA 3ZTZA 5E2QA 3S90A 4MVMA 3LEVA 3CZ6A 1T9KA 3U9JA 3GEHA 3HNLA 3NG1A 1HW1A 1F1MA 1RMVA 1Q0FA 1OW8A 1VLSA 2R7QA 1U89A 3G4ZA 1T5OA 4YT8A 4AL0A 2W9YA 4CDYA 1EA8A 2P7VA 2VCAA 2X51A 2ZXWC 1CPRA 1NU7D 2HMZA 1BR4A 4YK5A 3MFNA 1NG1A 4JRZA 4YL3A 1ZU5A 1LM3B 1I4ZA 2H7BA 1K05A 4ULVA 4XEVA 3X1OA 4OIOF 1QZXA 4G78A 3JSEO 3TJ5A 5A6AA 1R5ID 3DM5A 2YEVA 2Q4FA 2YWAA 4IB4A 2HUJA 3ECSA 3FVYA 5DQTA 3GM1A 1M57C 3KH2A 2KSFA 3K1IC 3TJ6A 2YLGA 3NYJA 4JTCB 2RD9A 1MMNA 3BRJA 1D0XA 4J7TA 4QI0A 2LFDA 3IQ5A 4YWQA 1A7VA 1D1BA 1WOLA 3MX3A 3GODA 4HEAJ 1MQVA 1D0ZA 5JP7A 5L0FA 2ZXOA 4EIYA 5AGFA 3Q7GA 4CS9A 1LS4A 2WVOA 1GS9A 2XLWA 1LPEA 3AGUA 3L1MA 5A6JA 3HTKC 3RVZA 5F5HA 3HNJA 1ZVZA 2IXNA 1IW7F 1RCPA 2QLAA 1YJGA 3DJUB 3EGXB 4NTFA 3VAYA 3K66A 3NYMA 4GQHA 4PJJA 3PCVA 2B0JA 1JOGA 1PD0A 1VLTA 5JVEA 5DVWA 2NUPA 4MQ9F 3S0XA 1S7ZA 2V3CC 1SF8A 3IQCA 4XQ1A 2X0CA 4AX2A 1YZAA 2UUIA 3L0IA 3SNHA 1C03A 1CGME 2R9RB 2XLVA 1U6HA 2WL8A 2GFHA 4E7SA 5L0CA 4EBKA 4Q4ZF 1MNEA 4I1MA 2XL4A 2Y69C 2G62A 5E33A 2L7AA 3L8IA 5A69A 3HJCA 3LAYA 1W2WA 3ABKC 1Q0DA 3H65A 2ZPAA 3L34A 3MYFA 2A69F 4RD9A 4CJOA 3Q7LA 3SXKA 3EGDB 1YAUO 3O10A 1BDJB 3MLGA 1OCCC 4CJGA 1L3PA 1M56C 3ASNC 5COFA 1OCZC 4E0HA 1G4US 4WJ0A 5T3WA 3WG7C 5DQZA 5L3VA 3B0VC 2Z15A 3RQEA 2H7VC 1VB5A 2AP3A 2NSFA 2VASA 1QVXA 3NKDA 4Z9IA 4DBQA 4OIPF 4JE9A 3AG2C 3LUTB 2M4EA 3M4CA 4DVZA 5DS5A 2C03A 2XLEA 4Z9JA 1B68A 5F28E 1A7EA 5EK0A 2LIGA 2V26A 3JT1A 4LLCA 4JURI 3U8VA 3X2QC 5L3QA 1FMWA 3HNIA 2J0WA 2OQMA 2R02A 4MVUA 2WVNA 3EZHA 1UFBA 1TWGA 2JPUA 2R7UA 3NMKA 4Q7CA 2XRHA 3O55A 1ORSC 3FXHA 2IYLD 5B3SC 2E87A 3MYIA 4P9FA 3S28A 4Q5SF 3ZDLA 3OEOA 2KW3C 1RJ9B 1TWHA 1Z63A 4CIPA 1JR8A 2R05A 3ATPA 1M2OA 1NFOA 4WGZA 4BJTA 1FAPB 2L9JA 1WTYA 2Y39A 3ZQYA 1RKCA 5KYXA 3C18A 4X0RA 4PR9A 1NFNA 2EILC 2IXMA 3KPHA 3FMSA 2PFDA 3ZVRA 4A4AA 1RXQA 4CIHA 1RKEB 3OWTA 4MVZA 1Z5ZA 1HMOA 2JX0A 2ZD9A 1ORJA 3I5PA 3QVYA 4MTOA 1GQAA 4BJ5A 1QQ3A 3V5ZA 4CS8A 2R7WA 1JPJA 3KL4A 4EKWA 3DI5A 1WWPA 256BA 2A6HF 2L6HA 2OG2A 3EG9A 2GWWA 5B1AC 3ZQVA 5JUAA 1K04A 1QLEC 1K40A 1GGQA 3M1CB 2MWQA 3N0TA 3NKEA 3TQOA 1NZEA 2AU5A 2W45A 1QKRA 4OD5A 1SZIA 1VTMP 2YL1A 1LS1A 2O9XA 4D4NA 1E83A 4QI2A 5KYNA 3E70C 4U5HA 4JZAA 2J9BA 1ZHWA 1D1CA 4W8PA 3ZIBA 2BE5F 1LKXA 3LJBA 3AQBA 3H2VA 1A0BA 1PCXA 2NG1A 4AK9A 3J06A 4IAOA 2PF4E 1KU2A 2G3KA 1H9GA 1T6IA 4P6IC 1Y6DA 1WN0A 2G3VA 4JCZA 4BJ6A 2D4UA 1ZHTA 4RBNA 2M64A 2KJGA 2YLDA 4MTGA 1E84A 2CW0F 3TK0A 4GYTA 1JRAA 3HKKA 5EHHA 2YKZA 3RQGA 3TULA 2WZLA 3EGXA 1VK5A 1YYXA 4XPXA 1TWCA 2WVQA 3EG9B 4I3MA 5JSLA 3OA1A 1V74B 2OJED 2HS5A 3T4RA 5B1BC 3VRCA 2VC9A 2R7OA 2YZSA 3LNRA 2UUHA 3EPVA 3JSZA 1OW6A 2VB6A 3CAXA 3K1HA 3K7DA 2LK4A 3U2LA 5COMA 2H8AA 3ABMC 2MHRA 3VYWA 4N6CA 3PMRA 1MMGA 4HFFB 1WATA 3Q6NA 1TQGA 4JTDB 2F22A 4IAQA 3S27A 5BQHA 3S29A 1J8MF 4I44A 4JJGA 2J9WA 2KK1A 2ZXRA 2EPKX 2A1DD 1V55C 1ZHZA 2D5RB 1YZCA 2CYDA 2IOQA 2YQYA 4HFKB 4KNWA 1TFKB 4PK4A 4XWJA 1KTMA 4N06A 3POVA 2PX3A 1YYJA 1NBBA 1PD1A 1XWJA 3LEOA 2GDCA 3RFYA 4BPMA 3EFOA 3JCUQ 3TD7A 4DVYP 5KYWA 3M15A 3EGDA 3G4XA 4PJNA 5KYYA 2R7SA 3M79A 4EBBA 2HFIA 3GWNA 1ZHXA 3UMIA 4G0HA 3C7JA 3IHUA 5D92A 5FZTA 4CS9C 3U0CA 4E18A 4N4WA 2P6VA 2WZGA 3QTHA 4JEBA 1PV3A 4RDAA 3NMIA 3KYIA 2ICWG 2C04A 1JPNA 2CNWD 3IEEA 2FAPB 3DM9B 4IRUA 1FTSA 1EKYA 2J8WA 3C63A 2XSEA 2FGYA 4EBJA 3JYHA 4K0DA 4M63A 3DXJF 4WABA 4LACB 2AWYA 2BC5A 4E0IA 5CI9A 3W2VA 3FOOA 1MMAA 4H4KC 3EHNA 4LDRA 5L0JA 4XEKA 5KYWB 3DKAA 3EFOB 4P9TA 4LERA 2KQ9A 2B0HA 4NY3A 1O87A 3EQLF 4OIRF 5KYYB 1I4YA 4J30B 3DMDA 5KYUB 5L0GA 3QW0A 1LIHA 1OKKD 2MYSA 4IARA 4CSAA 2CCYA 1NSGB 2ASRA 5K0IA 5AC5A 4NC3A 2DYSC 4JIOA 1HE9A 5TJ5E 1ORYA 1RJ9A 3GM3A 2CGEA 4WGYA 4E7ZA 3B0UX 3JTLO 4JJFA 3ZG1A 3GORA 4U5GA 1MNDA 4DXWA 3T6JA 4U5EE 1VMAA 3F46A 1DOVA 2KGOA 1V54C 2XLDA 3JZ0A 3SEOA 3C62A 1GM5A 2P1AA 2YHSA 1BR2A 2I15A 4NTBA 5JLIA 1S05A 3MBGA 4MVOA 1Q0MA 1RKEA 1A7DA 1ZYRF 2OU6A 3DE9A 3O39A 4DBRA 3KYJA 1A41A 1D1AA 1G5ZA 2DB4A 4LLEA 4QDLA 4JC7A 4EUKB 3ASOC 1T6QA 4U5DE 1WASA 2KC3A 3N24A 1QSPA 1O3UA 1T6UA 2NPUA 5DS6A 3DAGA 3UGPA 3U2MA 1YA7O 4YT2A 2XS1A 4MW8A 3RKOF 2OJQA 3T6GB 5DS4A 5A6KA 2ETSA 3DAFA 5FCLA 2VCCA 3A11A 4GEHA 1QPUA 2QE9A 4I1OB 4CX9A 3EZIA 2VH3A 3GEEA 4J32B 2L6GA 2YLIA 4FWVA 3LS0A 4F4BA 1OCOC 3U9MA 4ONSA 3W8HA 1BZ4A 1OXBA 1AEPA 2Q00A 1C02A 2KNHA 2WZFA 2Y3BA 5DLJA 3W2WA 4CS7A 1O5HA 3W4YA 5JT4A 4G7ZF 4JEAA 2JD3A 3B0PA 2NSGA 1OW7A 2XL6A 4AE4A 3AGTA 4IJJA 4MS2A 4DRHB 3LLKA 4C7OB 3HLZA 2I8BA 2W4MA 3QZCA 3GEIA 1FNTc 5COGA 1OCRC 2ZXPA 4G7OF 1TR2A 2HJMA 3K33A 3GANA 3ABLC 2R7RA 5A6BA 4KNVA 2GAQA 3SP1A 2DGJA 2J0XA 3AJMA 4BG0A 2TMVP 1AVOB 1DOWA 1FFTC 4O79A 4YN0B 2NUTA 1I5NA 2LQGA 4CS8C 1CPQA 3R2PA 2EIMC 1M2VB 4MVSA 3U3FA 4E17A 3W8IA 2AWCA 3NYLA 3C8GB 2J9VA 4H54A 3SXMA 2CNWA 1V4AA 3DE8A 1D0YA 4C3EA 5BQGA 3IPMO 3AG4C 1HY5A 2Q9BA 3V5XA 2GA0A 2W4BA 4MVRA 4AE4B 2R7TA 3B29A 3LNMB 1BR1A 2Q9AA 3JYYA 4C3DA 2P0NA 3TOMA 3SXZA 1XZPA 1TWAA 3U5SA 4DRIB 4XLPF 3NMJA 2XXAA 3EH2A 3A9CA 2J7PD 3QW1A 4BJ6C 1ZHYA 2P61A 3ZSUA 3IQ6A 3LS1A 3S84A 2QUPA 1OKKA 2NUTB 5L0IA 2R03A 2R7VA 5IY5C 3C8GD 3FOPA 3JRMO 2L6FA 4OINF 3FHDA 1CGOA 1ZW3A 4N6HA 4ER9A 2EPOA 1SYQA 2QTVA 4JKVA 4XPYA 3UMHA 2Y3DA 3PDMP 3SYNA 2YL3A 4DOZA 1OQCA 3QMKA 4HE8D 3RIPA 5EGYA 2PX0A 5T1DB 3V5YA 3DD7A 4MTFA 2R7XA 1XZQA 3DWWA 3CQZA 5HV9A 2XL8A 3L8JA 4FAPB 4MW3A 3ITFA 4U5CE 3K1IA 1TFOB 1MMDA 1FR0A 1ZW2A 2LFFA 2WB7A 2XXAB 5KYUA 3QVZA 1G4WR 4NTAA 3VM6A 4BJ1A 3H2UA 5D91A 3B71A 4XLNF 3ZWIA 2Y3GA 1U0BB 3JRTA 2OEVA 1H6GA 2DI3A 3UMKA 2LD6A 2Q7RA 3FAJA 3LLIA 4JW1A 4G7HF 1YLMA 2HSBA 5B3IA 5L0HA 2XLMA 2A68F 2EIKC 4O6YA 2QNLA 1Z6AA 3I4UA 4IGGA 1YDIA 5CI8A 3U8PA 4DJ9A 4UDVA 1H9TA 2OOCA 2YL7A 3S9OA 3N2ZB 1KNYA 3FDQA 1Z23A 4ANJA 3RF3A 1FFHA 1C17M 1OXKA 2XM0A 5HSWA 1WGWA 2YRFA 3ZC4A 2OEXA 2EPLX 1LE4A 1Z3IX 3IQTA 4JVSA 4U5BE 3EHMA 1YA9A 2Y3HA 4O6MA 2HZ8A 2XLOA 2EINC 4YT5A 1EI7A 3E9VA 2EIJC 5JS5A 2HSQA 4C3BA 2PBEA 4KBLA 3FAPB 4OIQF 1L7CA
chains in the Genus database with same CATH topology
3AOUA 2CYDA 2DB4A 4BEMJ 5TJ5E 2BL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AOU A;  2CYD A;  2DB4 A;  4BEM J;  5TJ5 E;  2BL2 A; 
#chains in the Genus database with same CATH topology
 4R32 A;  4EHP A;  1Y4C A;  5JRA A;  4A2N B;  1E85 A;  3EJN A;  4U5F E;  1LI7 A;  3F47 A;  5GPG B;  1OR3 A;  2AVK A;  3T9O A;  1T01 A;  2Q3T A;  4ULW A;  3RW0 A;  1EQ1 A;  4CSA C;  2R25 A;  4FES A;  5F5F A;  4XPW A;  2FFH A;  4FX5 A;  5BUO A;  2IXP A;  3R7C A;  2XM4 A;  1J8Y F;  4PJL A;  3DJN B;  3EH1 A;  1JAF A;  1VYI A;  4B6I A;  1Q0G A;  3UGO A;  2PNO A;  3GWL A;  2J9U A;  1LVK A;  2RSE B;  3AG1 C;  1R4T A;  2QY9 A;  1Z7Q c;  3WOD F;  4C7O A;  2IM8 A;  1Q0K A;  2NUP B;  1G8X A;  2LCH A;  3UNG C;  1FMV A;  5AC4 A;  3RQF A;  4BEM J;  3U3B A;  3M4B A;  1SR2 A;  3AQC A;  2IXO A;  2HV7 A;  3DZA A;  1E86 A;  3V7O A;  2J7P A;  4XTK A;  1M6T A;  5T3T A;  5A6B D;  3WHN A;  4U9E A;  4D4X A;  1JMW A;  1M2V A;  1VOM A;  1HW2 A;  4LDQ A;  2Q9C A;  2XS8 A;  2IBF A;  3UR3 C;  3C8G A;  1E2X A;  1VYK A;  4PAC A;  1HMD A;  1UG7 A;  3T6B A;  2J45 A;  1TKN A;  1NLX A;  4K7B A;  4YL1 A;  1CGN A;  2OKU A;  4JCH A;  5BQI A;  4OD4 A;  4CBE A;  2A0B A;  4MVQ A;  1ZZP A;  3AG3 C;  3SZR A;  1SMY F;  4KI2 A;  4PFO A;  2EPN A;  1BBH A;  2BL2 A;  4IWB A;  2L81 A;  3KMI A;  3AOU A;  3G50 A;  3WAQ A;  4JTA B;  2J46 A;  4ZLC A;  1HE1 A;  2OCC C;  2XLH A;  4O7G A;  4YL0 A;  3RYL A;  4CDA A;  2LSE A;  4BJ5 C;  4NCQ A;  3C8Z A;  4U9D A;  4DRJ B;  2YVK A;  4AL1 A;  4YT4 A;  1NU9 C;  1ST6 A;  2HV6 A;  3B9Q A;  2HMQ A;  3LES A;  5E3C A;  1YVI A;  3RH3 A;  2A0U A;  3GM2 A;  4BEJ A;  4YJW A;  4PFP A;  3O6X A;  5CIV A;  4XEF A;  4L6R A;  3KKB A;  3Q6M A;  3NRH A;  3VF0 A;  4O6N A;  4PJM A;  3CEX A;  2KYH A;  3K6B A;  1LI5 A;  5E3A A;  1IZM A;  3US6 A;  3HNK A;  1ZU4 A;  3PHF 2;  1YAR O;  4K1O A;  2YL0 A;  4EWC A;  4W8K A;  1OR2 A;  4NQF A;  5L0D A;  3RVY A;  4Z9H A;  3TOL A;  2CDQ A;  3CSK A;  2EPM X;  1N1C A;  2PP4 A;  4J7Y A;  2HJ3 A;  3NDB B;  2LP4 A;  4ZLD A;  5KYX B;  4CDV A;  4LDK A;  1AUE A;  2VCB A;  4KC9 A;  4MND A;  2HKV A;  2H7O A;  2DYR C;  2A6E F;  1APC A;  3I5Q A;  1H7I A;  1LE2 A;  3SXY A;  3ZTM A;  3BEH A;  3ZTZ A;  5E2Q A;  3S90 A;  4MVM A;  3LEV A;  3CZ6 A;  1T9K A;  3U9J A;  3GEH A;  3HNL A;  3NG1 A;  1HW1 A;  1F1M A;  1RMV A;  1Q0F A;  1OW8 A;  1VLS A;  2R7Q A;  1U89 A;  3G4Z A;  1T5O A;  4YT8 A;  4AL0 A;  2W9Y A;  4CDY A;  1EA8 A;  2P7V A;  2VCA A;  2X51 A;  2ZXW C;  1CPR A;  1NU7 D;  2HMZ A;  1BR4 A;  4YK5 A;  3MFN A;  1NG1 A;  4JRZ A;  4YL3 A;  1ZU5 A;  1LM3 B;  1I4Z A;  2H7B A;  1K05 A;  4ULV A;  4XEV A;  3X1O A;  4OIO F;  1QZX A;  4G78 A;  3JSE O;  3TJ5 A;  5A6A A;  1R5I D;  3DM5 A;  2YEV A;  2Q4F A;  2YWA A;  4IB4 A;  2HUJ A;  3ECS A;  3FVY A;  5DQT A;  3GM1 A;  1M57 C;  3KH2 A;  2KSF A;  3K1I C;  3TJ6 A;  2YLG A;  3NYJ A;  4JTC B;  2RD9 A;  1MMN A;  3BRJ A;  1D0X A;  4J7T A;  4QI0 A;  2LFD A;  3IQ5 A;  4YWQ A;  1A7V A;  1D1B A;  1WOL A;  3MX3 A;  3GOD A;  4HEA J;  1MQV A;  1D0Z A;  5JP7 A;  5L0F A;  2ZXO A;  4EIY A;  5AGF A;  3Q7G A;  4CS9 A;  1LS4 A;  2WVO A;  1GS9 A;  2XLW A;  1LPE A;  3AGU A;  3L1M A;  5A6J A;  3HTK C;  3RVZ A;  5F5H A;  3HNJ A;  1ZVZ A;  2IXN A;  1IW7 F;  1RCP A;  2QLA A;  1YJG A;  3DJU B;  3EGX B;  4NTF A;  3VAY A;  3K66 A;  3NYM A;  4GQH A;  4PJJ A;  3PCV A;  2B0J A;  1JOG A;  1PD0 A;  1VLT A;  5JVE A;  5DVW A;  2NUP A;  4MQ9 F;  3S0X A;  1S7Z A;  2V3C C;  1SF8 A;  3IQC A;  4XQ1 A;  2X0C A;  4AX2 A;  1YZA A;  2UUI A;  3L0I A;  3SNH A;  1C03 A;  1CGM E;  2R9R B;  2XLV A;  1U6H A;  2WL8 A;  2GFH A;  4E7S A;  5L0C A;  4EBK A;  4Q4Z F;  1MNE A;  4I1M A;  2XL4 A;  2Y69 C;  2G62 A;  5E33 A;  2L7A A;  3L8I A;  5A69 A;  3HJC A;  3LAY A;  1W2W A;  3ABK C;  1Q0D A;  3H65 A;  2ZPA A;  3L34 A;  3MYF A;  2A69 F;  4RD9 A;  4CJO A;  3Q7L A;  3SXK A;  3EGD B;  1YAU O;  3O10 A;  1BDJ B;  3MLG A;  1OCC C;  4CJG A;  1L3P A;  1M56 C;  3ASN C;  5COF A;  1OCZ C;  4E0H A;  1G4U S;  4WJ0 A;  5T3W A;  3WG7 C;  5DQZ A;  5L3V A;  3B0V C;  2Z15 A;  3RQE A;  2H7V C;  1VB5 A;  2AP3 A;  2NSF A;  2VAS A;  1QVX A;  3NKD A;  4Z9I A;  4DBQ A;  4OIP F;  4JE9 A;  3AG2 C;  3LUT B;  2M4E A;  3M4C A;  4DVZ A;  5DS5 A;  2C03 A;  2XLE A;  4Z9J A;  1B68 A;  5F28 E;  1A7E A;  5EK0 A;  2LIG A;  2V26 A;  3JT1 A;  4LLC A;  4JUR I;  3U8V A;  3X2Q C;  5L3Q A;  1FMW A;  3HNI A;  2J0W A;  2OQM A;  2R02 A;  4MVU A;  2WVN A;  3EZH A;  1UFB A;  1TWG A;  2JPU A;  2R7U A;  3NMK A;  4Q7C A;  2XRH A;  3O55 A;  1ORS C;  3FXH A;  2IYL D;  5B3S C;  2E87 A;  3MYI A;  4P9F A;  3S28 A;  4Q5S F;  3ZDL A;  3OEO A;  2KW3 C;  1RJ9 B;  1TWH A;  1Z63 A;  4CIP A;  1JR8 A;  2R05 A;  3ATP A;  1M2O A;  1NFO A;  4WGZ A;  4BJT A;  1FAP B;  2L9J A;  1WTY A;  2Y39 A;  3ZQY A;  1RKC A;  5KYX A;  3C18 A;  4X0R A;  4PR9 A;  1NFN A;  2EIL C;  2IXM A;  3KPH A;  3FMS A;  2PFD A;  3ZVR A;  4A4A A;  1RXQ A;  4CIH A;  1RKE B;  3OWT A;  4MVZ A;  1Z5Z A;  1HMO A;  2JX0 A;  2ZD9 A;  1ORJ A;  3I5P A;  3QVY A;  4MTO A;  1GQA A;  4BJ5 A;  1QQ3 A;  3V5Z A;  4CS8 A;  2R7W A;  1JPJ A;  3KL4 A;  4EKW A;  3DI5 A;  1WWP A;  256B A;  2A6H F;  2L6H A;  2OG2 A;  3EG9 A;  2GWW A;  5B1A C;  3ZQV A;  5JUA A;  1K04 A;  1QLE C;  1K40 A;  1GGQ A;  3M1C B;  2MWQ A;  3N0T A;  3NKE A;  3TQO A;  1NZE A;  2AU5 A;  2W45 A;  1QKR A;  4OD5 A;  1SZI A;  1VTM P;  2YL1 A;  1LS1 A;  2O9X A;  4D4N A;  1E83 A;  4QI2 A;  5KYN A;  3E70 C;  4U5H A;  4JZA A;  2J9B A;  1ZHW A;  1D1C A;  4W8P A;  3ZIB A;  2BE5 F;  1LKX A;  3LJB A;  3AQB A;  3H2V A;  1A0B A;  1PCX A;  2NG1 A;  4AK9 A;  3J06 A;  4IAO A;  2PF4 E;  1KU2 A;  2G3K A;  1H9G A;  1T6I A;  4P6I C;  1Y6D A;  1WN0 A;  2G3V A;  4JCZ A;  4BJ6 A;  2D4U A;  1ZHT A;  4RBN A;  2M64 A;  2KJG A;  2YLD A;  4MTG A;  1E84 A;  2CW0 F;  3TK0 A;  4GYT A;  1JRA A;  3HKK A;  5EHH A;  2YKZ A;  3RQG A;  3TUL A;  2WZL A;  3EGX A;  1VK5 A;  1YYX A;  4XPX A;  1TWC A;  2WVQ A;  3EG9 B;  4I3M A;  5JSL A;  3OA1 A;  1V74 B;  2OJE D;  2HS5 A;  3T4R A;  5B1B C;  3VRC A;  2VC9 A;  2R7O A;  2YZS A;  3LNR A;  2UUH A;  3EPV A;  3JSZ A;  1OW6 A;  2VB6 A;  3CAX A;  3K1H A;  3K7D A;  2LK4 A;  3U2L A;  5COM A;  2H8A A;  3ABM C;  2MHR A;  3VYW A;  4N6C A;  3PMR A;  1MMG A;  4HFF B;  1WAT A;  3Q6N A;  1TQG A;  4JTD B;  2F22 A;  4IAQ A;  3S27 A;  5BQH A;  3S29 A;  1J8M F;  4I44 A;  4JJG A;  2J9W A;  2KK1 A;  2ZXR A;  2EPK X;  2A1D D;  1V55 C;  1ZHZ A;  2D5R B;  1YZC A;  2CYD A;  2IOQ A;  2YQY A;  4HFK B;  4KNW A;  1TFK B;  4PK4 A;  4XWJ A;  1KTM A;  4N06 A;  3POV A;  2PX3 A;  1YYJ A;  1NBB A;  1PD1 A;  1XWJ A;  3LEO A;  2GDC A;  3RFY A;  4BPM A;  3EFO A;  3JCU Q;  3TD7 A;  4DVY P;  5KYW A;  3M15 A;  3EGD A;  3G4X A;  4PJN A;  5KYY A;  2R7S A;  3M79 A;  4EBB A;  2HFI A;  3GWN A;  1ZHX A;  3UMI A;  4G0H A;  3C7J A;  3IHU A;  5D92 A;  5FZT A;  4CS9 C;  3U0C A;  4E18 A;  4N4W A;  2P6V A;  2WZG A;  3QTH A;  4JEB A;  1PV3 A;  4RDA A;  3NMI A;  3KYI A;  2ICW G;  2C04 A;  1JPN A;  2CNW D;  3IEE A;  2FAP B;  3DM9 B;  4IRU A;  1FTS A;  1EKY A;  2J8W A;  3C63 A;  2XSE A;  2FGY A;  4EBJ A;  3JYH A;  4K0D A;  4M63 A;  3DXJ F;  4WAB A;  4LAC B;  2AWY A;  2BC5 A;  4E0I A;  5CI9 A;  3W2V A;  3FOO A;  1MMA A;  4H4K C;  3EHN A;  4LDR A;  5L0J A;  4XEK A;  5KYW B;  3DKA A;  3EFO B;  4P9T A;  4LER A;  2KQ9 A;  2B0H A;  4NY3 A;  1O87 A;  3EQL F;  4OIR F;  5KYY B;  1I4Y A;  4J30 B;  3DMD A;  5KYU B;  5L0G A;  3QW0 A;  1LIH A;  1OKK D;  2MYS A;  4IAR A;  4CSA A;  2CCY A;  1NSG B;  2ASR A;  5K0I A;  5AC5 A;  4NC3 A;  2DYS C;  4JIO A;  1HE9 A;  5TJ5 E;  1ORY A;  1RJ9 A;  3GM3 A;  2CGE A;  4WGY A;  4E7Z A;  3B0U X;  3JTL O;  4JJF A;  3ZG1 A;  3GOR A;  4U5G A;  1MND A;  4DXW A;  3T6J A;  4U5E E;  1VMA A;  3F46 A;  1DOV A;  2KGO A;  1V54 C;  2XLD A;  3JZ0 A;  3SEO A;  3C62 A;  1GM5 A;  2P1A A;  2YHS A;  1BR2 A;  2I15 A;  4NTB A;  5JLI A;  1S05 A;  3MBG A;  4MVO A;  1Q0M A;  1RKE A;  1A7D A;  1ZYR F;  2OU6 A;  3DE9 A;  3O39 A;  4DBR A;  3KYJ A;  1A41 A;  1D1A A;  1G5Z A;  2DB4 A;  4LLE A;  4QDL A;  4JC7 A;  4EUK B;  3ASO C;  1T6Q A;  4U5D E;  1WAS A;  2KC3 A;  3N24 A;  1QSP A;  1O3U A;  1T6U A;  2NPU A;  5DS6 A;  3DAG A;  3UGP A;  3U2M A;  1YA7 O;  4YT2 A;  2XS1 A;  4MW8 A;  3RKO F;  2OJQ A;  3T6G B;  5DS4 A;  5A6K A;  2ETS A;  3DAF A;  5FCL A;  2VCC A;  3A11 A;  4GEH A;  1QPU A;  2QE9 A;  4I1O B;  4CX9 A;  3EZI A;  2VH3 A;  3GEE A;  4J32 B;  2L6G A;  2YLI A;  4FWV A;  3LS0 A;  4F4B A;  1OCO C;  3U9M A;  4ONS A;  3W8H A;  1BZ4 A;  1OXB A;  1AEP A;  2Q00 A;  1C02 A;  2KNH A;  2WZF A;  2Y3B A;  5DLJ A;  3W2W A;  4CS7 A;  1O5H A;  3W4Y A;  5JT4 A;  4G7Z F;  4JEA A;  2JD3 A;  3B0P A;  2NSG A;  1OW7 A;  2XL6 A;  4AE4 A;  3AGT A;  4IJJ A;  4MS2 A;  4DRH B;  3LLK A;  4C7O B;  3HLZ A;  2I8B A;  2W4M A;  3QZC A;  3GEI A;  1FNT c;  5COG A;  1OCR C;  2ZXP A;  4G7O F;  1TR2 A;  2HJM A;  3K33 A;  3GAN A;  3ABL C;  2R7R A;  5A6B A;  4KNV A;  2GAQ A;  3SP1 A;  2DGJ A;  2J0X A;  3AJM A;  4BG0 A;  2TMV P;  1AVO B;  1DOW A;  1FFT C;  4O79 A;  4YN0 B;  2NUT A;  1I5N A;  2LQG A;  4CS8 C;  1CPQ A;  3R2P A;  2EIM C;  1M2V B;  4MVS A;  3U3F A;  4E17 A;  3W8I A;  2AWC A;  3NYL A;  3C8G B;  2J9V A;  4H54 A;  3SXM A;  2CNW A;  1V4A A;  3DE8 A;  1D0Y A;  4C3E A;  5BQG A;  3IPM O;  3AG4 C;  1HY5 A;  2Q9B A;  3V5X A;  2GA0 A;  2W4B A;  4MVR A;  4AE4 B;  2R7T A;  3B29 A;  3LNM B;  1BR1 A;  2Q9A A;  3JYY A;  4C3D A;  2P0N A;  3TOM A;  3SXZ A;  1XZP A;  1TWA A;  3U5S A;  4DRI B;  4XLP F;  3NMJ A;  2XXA A;  3EH2 A;  3A9C A;  2J7P D;  3QW1 A;  4BJ6 C;  1ZHY A;  2P61 A;  3ZSU A;  3IQ6 A;  3LS1 A;  3S84 A;  2QUP A;  1OKK A;  2NUT B;  5L0I A;  2R03 A;  2R7V A;  5IY5 C;  3C8G D;  3FOP A;  3JRM O;  2L6F A;  4OIN F;  3FHD A;  1CGO A;  1ZW3 A;  4N6H A;  4ER9 A;  2EPO A;  1SYQ A;  2QTV A;  4JKV A;  4XPY A;  3UMH A;  2Y3D A;  3PDM P;  3SYN A;  2YL3 A;  4DOZ A;  1OQC A;  3QMK A;  4HE8 D;  3RIP A;  5EGY A;  2PX0 A;  5T1D B;  3V5Y A;  3DD7 A;  4MTF A;  2R7X A;  1XZQ A;  3DWW A;  3CQZ A;  5HV9 A;  2XL8 A;  3L8J A;  4FAP B;  4MW3 A;  3ITF A;  4U5C E;  3K1I A;  1TFO B;  1MMD A;  1FR0 A;  1ZW2 A;  2LFF A;  2WB7 A;  2XXA B;  5KYU A;  3QVZ A;  1G4W R;  4NTA A;  3VM6 A;  4BJ1 A;  3H2U A;  5D91 A;  3B71 A;  4XLN F;  3ZWI A;  2Y3G A;  1U0B B;  3JRT A;  2OEV A;  1H6G A;  2DI3 A;  3UMK A;  2LD6 A;  2Q7R A;  3FAJ A;  3LLI A;  4JW1 A;  4G7H F;  1YLM A;  2HSB A;  5B3I A;  5L0H A;  2XLM A;  2A68 F;  2EIK C;  4O6Y A;  2QNL A;  1Z6A A;  3I4U A;  4IGG A;  1YDI A;  5CI8 A;  3U8P A;  4DJ9 A;  4UDV A;  1H9T A;  2OOC A;  2YL7 A;  3S9O A;  3N2Z B;  1KNY A;  3FDQ A;  1Z23 A;  4ANJ A;  3RF3 A;  1FFH A;  1C17 M;  1OXK A;  2XM0 A;  5HSW A;  1WGW A;  2YRF A;  3ZC4 A;  2OEX A;  2EPL X;  1LE4 A;  1Z3I X;  3IQT A;  4JVS A;  4U5B E;  3EHM A;  1YA9 A;  2Y3H A;  4O6M A;  2HZ8 A;  2XLO A;  2EIN C;  4YT5 A;  1EI7 A;  3E9V A;  2EIJ C;  5JS5 A;  2HSQ A;  4C3B A;  2PBE A;  4KBL A;  3FAP B;  4OIQ F;  1L7C A; 
#chains in the Genus database with same CATH homology
 3AOU A;  2CYD A;  2DB4 A;  4BEM J;  5TJ5 E;  2BL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...