2XLEA

Cytochrome c prime from alcaligenes xylosoxidans: ferrous r124k variant with bound no
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
127
structure length
127
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYKKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CYTOCHROME C'
publication title Distal-to-Proximal No Conversion in Hemoproteins: The Role of the Proximal Pocket.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
total genus 51
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2010-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2xleA00
3ZQYA 1QPUA 2XLDA 4CIPA 4U9DA 1E86A 3HNLA 1JAFA 4IARA 3VRCA 2YL3A 3C62A 1CPRA 3L1MA 3ZWIA 2YLIA 3M15A 2XLWA 4JEAA 3M79A 3HNKA 2YL1A 2XLMA 3QW0A 5JVEA 2XM4A 3DE9A 1E84A 1MQVA 3NMIA 2XL8A 5B3IA 1CGOA 1M6TA 1E83A 1GQAA 1S05A 1BBHA 1CGNA 4ER9A 4NC3A 5JP7A 5JSLA 3QW1A 5AGFA 3DE8A 5JT4A 3QVYA 2J8WA 1NBBA 3IQ5A 3ZQVA 2XLHA 4JE9A 4WGZA 3FOPA 3IQ6A 4N4WA 5JS5A 4WGYA 2CCYA 1QQ3A 4D4NA 4D4XA 3QVZA 4EIYA 3ZTZA 3HNJA 4CX9A 1YZCA 3NMJA 4N6HA 3NMKA 2YLDA 3C63A 1E85A 1LM3B 4CJGA 2YL7A 2XLEA 1YZAA 1RCPA 4ULVA 4L6RA 3M4CA 2XL6A 3TOMA 3TOLA 4IAQA 1YYJA 4JKVA 2XLOA 2BC5A 1CPQA 2XM0A 1A7VA 4CDYA 2YKZA 3M4BA 3U8PA 256BA 4JEBA 3FOOA 5JUAA 2YLGA 1APCA 4IB4A 2XLVA 4CDAA 2YL0A 3HNIA 4U9EA 2J9BA 4CDVA 2QLAA 4CJOA 5JRAA 5JLIA 1EKYA 1YYXA 3ZTMA
chains in the Genus database with same CATH superfamily
5DLJA 1OCOC 2MHRA 3DM5A 1WGWA 5FCLA 3WODF 1VYIA 1NSGB 2R7TA 2IM8A 3LAYA 1BR1A 1JPNA 4U9DA 3HNLA 2VB6A 2R7RA 2YL3A 2Q3TA 3H2UA 2R7SA 3C62A 2KGOA 3FVYA 4PACA 4XQ1A 4CS7A 3H2VA 4DBQA 1RXQA 3K66A 4QI2A 4DBRA 1LS1A 4RD9A 1SR2A 5F5HA 1AUEA 5L0IA 4CSAC 3VAYA 1A7EA 1T6IA 2Q00A 2Y3DA 3M79A 1LIHA 4W8KA 2H8AA 5HSWA 2R7XA 3CZ6A 2KQ9A 1NLXA 3QW0A 1YJGA 2Y3HA 2P0NA 3RVYA 1E84A 4HFKB 1PCXA 2J46A 1TR2A 2J0WA 3NMIA 1SMYF 3S90A 4LDRA 5IY5C 3WAQA 4XEVA 4Z9IA 5L3QA 3ASNC 1H6GA 1CGOA 1L3PA 2OJED 3LS0A 1B68A 2KNHA 1ZYRF 2HUJA 2GDCA 4AE4B 3T6GB 3NDBB 3F47A 3WG7C 1OXBA 2OJQA 2VC9A 3JSZA 4EBJA 1M56C 3I5QA 1E83A 1GQAA 3EG9B 3RVZA 4Q4ZF 1CGNA 2Q9BA 3EFOB 4NC3A 3SZRA 2C03A 4CS8C 3R7CA 1VLTA 2YRFA 5AGFA 2ASRA 3Q6MA 4MTFA 4MVMA 4P6IC 2R9RB 3H65A 1NBBA 3LS1A 1VLSA 3ZQVA 3O55A 2NUPB 1ORYA 5KYWB 1QKRA 1D1AA 2WVQA 3IQ6A 4MTGA 1V55C 3S84A 4LLEA 5DS5A 2J7PD 1FFHA 2LD6A 1JRAA 2A6EF 4IGGA 2JX0A 1Y4CA 2DI3A 4MTOA 4O6MA 4PJLA 4G0HA 2KW3C 2HKVA 2CCYA 4JCZA 3KMIA 2HFIA 1M57C 4D4XA 2L6GA 5L0DA 3N2ZB 2YHSA 4EIYA 2OEXA 4RBNA 3W8IA 3SXYA 5BUOA 1YZCA 2AWCA 4O7GA 2J45A 4N06A 4N6HA 2Y39A 2Y3GA 3LUTB 3TJ5A 2RSEB 2AU5A 2QTVA 3ATPA 3Q7GA 4IJJA 3LEOA 3QZCA 3TK0A 2YL7A 2XLEA 2W45A 1XWJA 2AP3A 1VK5A 3ABLC 1FR0A 4K7BA 4BEMJ 3FHDA 4EHPA 3M1CB 2Q9AA 4OIOF 1R5ID 3U5SA 1LPEA 1HY5A 1YDIA 2A0BA 2KSFA 1RJ9A 3S27A 4U5EE 5E3CA 1ZHYA 3RIPA 5D91A 4JKVA 2J9VA 2VH3A 2WZGA 2XLOA 2Z15A 4U5BE 3J06A 4C7OA 2XS1A 3L8IA 2BC5A 1YLMA 4YL0A 3X1OA 2F22A 5HV9A 3BRJA 3EH1A 2EILC 2IXMA 1VMAA 3HJCA 4XPYA 4JIOA 4FWVA 4BJ6A 4KBLA 4CDYA 1H9GA 1XZPA 1O87A 3GANA 3GWNA 3SXZA 4B6IA 2EPKX 1FMWA 3OWTA 1MMAA 3U8PA 2E87A 3EZIA 2L6HA 4A4AA 2PNOA 3ITFA 1PV3A 4AK9A 3B71A 3FOOA 4W8PA 5DS6A 4J7YA 3TD7A 3MBGA 2IXNA 3IQTA 1KU2A 3T6BA 1ZW2A 3G4ZA 3JRMO 1KTMA 5K0IA 4NY3A 1ZU4A 3SEOA 3VM6A 1JPJA 5L0FA 1ZHWA 4XLPF 2J9BA 4QDLA 3US6A 1NG1A 4ANJA 3RKOF 3LLKA 5T1DB 2IYLD 3C18A 2QLAA 3FMSA 4LDKA 4P9FA 4JCHA 5JRAA 4JURI 5JLIA 3POVA 5A6KA 1NU7D 4XPXA 4ZLDA 1FMVA 4DXWA 3NG1A 4CIHA 2KJGA 4RDAA 1QLEC 1WTYA 2XLDA 3NKDA 3NYMA 3RH3A 1ZZPA 1TQGA 3C8ZA 1GGQA 4YK5A 4BEJA 4NTAA 3U0CA 4JRZA 1UFBA 3CAXA 4IARA 1WWPA 2J7PA 4Z9HA 3VRCA 4FESA 4YN0B 3ZWIA 2IBFA 1C02A 1LS4A 2KK1A 4IAOA 4R32A 2A69F 2EPOA 5B3SC 1IW7F 2ZD9A 4BPMA 3PHF2 1RKEA 1MNDA 2CGEA 1GS9A 2NSFA 2BE5F 4CBEA 1RJ9B 3AG3C 1G4US 4JJFA 1T9KA 2OU6A 2YL1A 4WABA 4C7OB 2PX3A 4HE8D 3R2PA 2Q7RA 3S9OA 1DOVA 2A68F 1T6UA 2AWYA 1Z5ZA 3KYJA 3T9OA 3T4RA 1MQVA 1A0BA 2VCBA 1L7CA 2XL8A 5L0GA 4A2NB 3B0UX 2X0CA 3UGPA 2L9JA 1E2XA 4XTKA 4G7HF 2X51A 4BJ5A 5DVWA 4QI0A 2YQYA 1C03A 1Q0FA 1Q0KA 1WOLA 2R05A 4E0IA 2KC3A 1S05A 3TULA 3EH2A 2HMQA 3NYJA 3C7JA 3L8JA 4LERA 4YT2A 1N1CA 2R7VA 2YWAA 3EJNA 3HKKA 5JSLA 3QW1A 4E18A 5AC5A 4LDQA 3KYIA 4U5FE 2J8WA 1TWGA 1VYKA 2ZXPA 2QNLA 4PJNA 3RQGA 4CS9A 5L0CA 4GYTA 2JPUA 4MVSA 1H7IA 2MYSA 2PFDA 3FOPA 2C04A 4DRIB 4P9TA 4N4WA 2JD3A 3JTLO 3W2VA 3A11A 5JS5A 5L3VA 2FAPB 4WGYA 1V54C 1M2OA 3K7DA 4XEFA 5DS4A 5T3WA 4D4NA 1Z63A 3UMKA 4G78A 1BR2A 4O79A 3L34A 3KH2A 2HV7A 3NMKA 1HE9A 4XLNF 4DVYP 4U5CE 3RQFA 2A6HF 1LM3B 1J8MF 1RKEB 2YVKA 1VB5A 2W4MA 3U9MA 4YT4A 1YZAA 1RCPA 3DXJF 4ULVA 1EQ1A 4L6RA 2R03A 3PDMP 4M63A 4K1OA 3RF3A 3IPMO 4HFFB 2WVNA 5A6AA 1TWHA 2J0XA 2J9UA 1QSPA 2BL2A 3KPHA 4GEHA 1BZ4A 1OR3A 1YYJA 5TJ5E 2XRHA 3ECSA 5BQHA 3EGDA 5A69A 2V3CC 1CPQA 2XM0A 2ZXWC 1WATA 3EHNA 5E33A 1J8YF 1ZVZA 1A7VA 1Q0MA 3DMDA 3B0VC 4MVOA 3V7OA 5DQZA 1WASA 1HW2A 4NTBA 2IXPA 3W2WA 2WZLA 3UGOA 3AQBA 3FXHA 3SXMA 3ZG1A 1CGME 3E9VA 4FX5A 4JEBA 2B0JA 1Z7Qc 3ZSUA 5L0HA 2B0HA 2PP4A 1TFOB 4U5GA 2NG1A 3V5YA 1GM5A 1OCZC 2LFFA 1OQCA 2R7OA 2XXAA 2XLVA 5EK0A 1OW8A 2ZPAA 3GORA 1LI7A 4PK4A 5FZTA 5B1BC 1XZQA 3HNIA 3UNGC 4PFPA 2P61A 5CIVA 2MWQA 4E7SA 2H7OA 2R02A 2VCCA 3V5ZA 3AG2C 4G7OF 1PD0A 3IQCA 3LJBA 1NU9C 4JW1A 3A9CA 1LE4A 3ZTMA 2H7VC 5COFA 1QPUA 2QY9A 4YL3A 4EBBA 4CIPA 5KYYA 2PBEA 4ONSA 4BG0A 4ZLCA 1U0BB 2OQMA 5GPGB 2WL8A 4YT8A 1E86A 2Q4FA 1BDJB 4NTFA 3MYIA 3I5PA 2ZXOA 2P7VA 1CPRA 4H4KC 4DJ9A 2D5RB 2R7WA 3L1MA 3RFYA 3WHNA 2XSEA 3O6XA 2OCCC 1YVIA 3N0TA 3EGXA 3U2MA 2YLIA 2Y3BA 5BQIA 2A1DD 1SF8A 2O9XA 2XLWA 3OEOA 4JEAA 3LLIA 4K0DA 4MQ9F 1R4TA 1FNTc 4BJ6C 3UR3C 2XLMA 3AJMA 5E2QA 3DZAA 3EGDB 4J32B 3ZDLA 4ULWA 2R25A 5F28E 2XM4A 3ABMC 3DE9A 4JTDB 3U8VA 4AL0A 1LKXA 2UUIA 3DI5A 5JVEA 3UMHA 2H7BA 3BEHA 1K05A 3FDQA 1D0ZA 4MVQA 2W4BA 2LCHA 2I8BA 1WN0A 1OR2A 1Z23A 2NPUA 4LACB 1K40A 5F5FA 2YZSA 1M6TA 2LK4A 2WB7A 4I1OB 4E17A 4N6CA 2HMZA 4C3DA 2XXAB 2RD9A 2LP4A 3UMIA 1F1MA 1LI5A 1BBHA 1JMWA 1ORSC 2LSEA 2EINC 3AGUA 4U5HA 4ER9A 5JP7A 4C3EA 3O39A 1T5OA 3LNRA 3GEIA 4AL1A 5EHHA 2EIJC 1VOMA 1ZHTA 3DE8A 5CI8A 2NSGA 1M2VA 2AVKA 1RMVA 2OG2A 4PR9A 3C8GD 1D1BA 1T01A 1TKNA 3W4YA 4OD4A 5KYYB 5D92A 1YARO 1ZHZA 1SYQA 1SZIA 3CSKA 4MW8A 4XWJA 1O3UA 3PCVA 1QQ3A 2KYHA 3JYYA 4J7TA 2G3KA 3N24A 3VF0A 2ICWG 3ZTZA 4MNDA 2WVOA 3K1IA 3S29A 2G62A 4DOZA 3NMJA 3GWLA 3PMRA 2YLDA 1OCRC 4H54A 3DJNB 3C63A 1MMDA 2CDQA 2J9WA 3EGXB 4YL1A 4CJGA 4E0HA 4JZAA 3NKEA 3G50A 1TWCA 1U89A 3U2LA 1OCCC 5CI9A 3GEEA 3JT1A 3ABKC 2XL6A 2CW0F 1OKKA 3TJ6A 4BJ1A 2L7AA 4YWQA 4KI2A 3TOMA 3TOLA 3JCUQ 3GEHA 1A7DA 3DAFA 4BJ5C 5A6BD 1S7ZA 4HEAJ 1AEPA 1MNEA 1Q0DA 4IRUA 2L81A 4EUKB 4E7ZA 1H9TA 4CSAA 2W9YA 1V4AA 1W2WA 3Q7LA 2EPMX 4PJMA 1ZW3A 3G4XA 4KC9A 2PF4E 5L0JA 5KYNA 3CQZA 3M4BA 1G4WR 3AQCA 3TQOA 1D1CA 3DWWA 3FAJA 1ZU5A 2DYRC 4CS9C 4O6YA 4MS2A 2EIKC 1M2VB 4JTAB 3NYLA 2GFHA 1Z6AA 1APCA 2Y69C 3L0IA 1TWAA 4GQHA 2OKUA 2DGJA 3K6BA 1QVXA 1Y6DA 2CNWD 4U9EA 2IOQA 5DQTA 2WZFA 4CS8A 4CDVA 3F46A 1U6HA 1Q0GA 3W8HA 3EPVA 4UDVA 3ASOC 1JR8A 1EKYA 1YYXA 3ZQYA 2D4UA 1QZXA 2DB4A 3MYFA 4EKWA 3C8GA 2M4EA 4X0RA 3Q6NA 2FFHA 3ZIBA 1BR4A 4C3BA 1C17M 1MMGA 1DOWA 1JAFA 4PJJA 3EQLF 3JZ0A 4AX2A 4JVSA 3SYNA 2XL4A 3DAGA 1ORJA 1HW1A 3LESA 2P6VA 5EGYA 5KYXA 1D0YA 1OW7A 5A6JA 1LE2A 1I4YA 1JOGA 3S28A 2M64A 4JTCB 4XPWA 2HJMA 1G5ZA 3I4UA 3M15A 4Q7CA 4Z9JA 2FGYA 1VTMP 2I15A 1OW6A 4OINF 1YA9A 3HNKA 4DRJB 4EBKA 1ST6A 3U9JA 4JJGA 4OIQF 1G8XA 1T6QA 3MFNA 2VCAA 3EHMA 2QE9A 3U3BA 5B1AC 5B3IA 1FAPB 3B9QA 3CEXA 3GM2A 3O10A 4NQFA 4DRHB 3DM9B 5A6BA 1V74B 2GA0A 4I1MA 1KNYA 1YA7O 3MX3A 3QMKA 4J30B 5KYUA 4MVUA 1OKKD 2HV6A 3AG4C 1HMDA 4JC7A 3DKAA 5E3AA 2EPLX 3U3FA 3B0PA 2TMVP 3GM3A 4PFOA 3GODA 5JT4A 2LQGA 3QVYA 3MLGA 4O6NA 3SP1A 2XS8A 3B29A 1YAUO 3IQ5A 2XLHA 5COMA 4JE9A 3JYHA 1MMNA 1EI7A 4WGZA 3K1HA 4WJ0A 2DYSC 2HZ8A 2A0UA 3ZC4A 1I4ZA 4EWCA 2PX0A 3E70C 2CYDA 2R7UA 4IWBA 3C8GB 2OOCA 3KKBA 2NUTA 1FFTC 1PD1A 3RQEA 2GWWA 1UG7A 1ZHXA 1HMOA 3IHUA 2CNWA 1OXKA 2ZXRA 3S0XA 3DD7A 1NFOA 3QVZA 4FAPB 1TFKB 2L6FA 3LEVA 3HNJA 4CX9A 5KYXB 3RYLA 2LIGA 4F4BA 4I44A 4KNWA 5COGA 1E85A 1Z3IX 1O5HA 3HTKC 4BJTA 3QTHA 3FAPB 3JRTA 2HS5A 3RW0A 1A41A 3SNHA 2G3VA 3M4CA 3LNMB 3AGTA 2VASA 4LLCA 3AOUA 2YEVA 3V5XA 1NZEA 4IAQA 1AVOB 1IZMA 4G7ZF 2UUHA 4YJWA 4U5DE 2ETSA 3DJUB 2OEVA 3ZVRA 5AC4A 1LVKA 4XEKA 1K04A 4KNVA 2YKZA 1D0XA 1I5NA 3AG1C 4OD5A 5BQGA 5KYUB 3HLZA 2IXOA 2EIMC 2QUPA 3K33A 256BA 2Q9CA 4AE4A 4MVZA 2GAQA 1FTSA 2V26A 3X2QC 1EA8A 4MVRA 5JUAA 3OA1A 2YLGA 4OIRF 3T6JA 2P1AA 2EPNA 2R7QA 4I3MA 3EG9A 2HSBA 2LFDA 1NFNA 3KL4A 4IB4A 3IEEA 3EFOA 1HE1A 2HSQA 3GM1A 4CDAA 4Q5SF 4OIPF 2HJ3A 4YT5A 4DVZA 2YL0A 3SXKA 3EZHA 4MW3A 2NUTB 5KYWA 2NUPA 3JSEO 4CJOA 3K1IC 1RKCA 5T3TA 3NRHA 3VYWA 4NCQA
chains in the Genus database with same CATH topology
3ZQYA 1QPUA 2XLDA 4CIPA 4U9DA 1E86A 3HNLA 1JAFA 4IARA 3VRCA 2YL3A 3C62A 1CPRA 3L1MA 3ZWIA 2YLIA 3M15A 2XLWA 4JEAA 3M79A 3HNKA 2YL1A 2XLMA 3QW0A 5JVEA 2XM4A 3DE9A 1E84A 1MQVA 3NMIA 2XL8A 5B3IA 1CGOA 1M6TA 1E83A 1GQAA 1S05A 1BBHA 1CGNA 4ER9A 4NC3A 5JP7A 5JSLA 3QW1A 5AGFA 3DE8A 5JT4A 3QVYA 2J8WA 1NBBA 3IQ5A 3ZQVA 2XLHA 4JE9A 4WGZA 3FOPA 3IQ6A 4N4WA 5JS5A 4WGYA 2CCYA 1QQ3A 4D4NA 4D4XA 3QVZA 4EIYA 3ZTZA 3HNJA 4CX9A 1YZCA 3NMJA 4N6HA 3NMKA 2YLDA 3C63A 1E85A 1LM3B 4CJGA 2YL7A 2XLEA 1YZAA 1RCPA 4ULVA 4L6RA 3M4CA 2XL6A 3TOMA 3TOLA 4IAQA 1YYJA 4JKVA 2XLOA 2BC5A 1CPQA 2XM0A 1A7VA 4CDYA 2YKZA 3M4BA 3U8PA 256BA 4JEBA 3FOOA 5JUAA 2YLGA 1APCA 4IB4A 2XLVA 4CDAA 2YL0A 3HNIA 4U9EA 2J9BA 4CDVA 2QLAA 4CJOA 5JRAA 5JLIA 1EKYA 1YYXA 3ZTMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZQY A;  1QPU A;  2XLD A;  4CIP A;  4U9D A;  1E86 A;  3HNL A;  1JAF A;  4IAR A;  3VRC A;  2YL3 A;  3C62 A;  1CPR A;  3L1M A;  3ZWI A;  2YLI A;  3M15 A;  2XLW A;  4JEA A;  3M79 A;  3HNK A;  2YL1 A;  2XLM A;  3QW0 A;  5JVE A;  2XM4 A;  3DE9 A;  1E84 A;  1MQV A;  3NMI A;  2XL8 A;  5B3I A;  1CGO A;  1M6T A;  1E83 A;  1GQA A;  1S05 A;  1BBH A;  1CGN A;  4ER9 A;  4NC3 A;  5JP7 A;  5JSL A;  3QW1 A;  5AGF A;  3DE8 A;  5JT4 A;  3QVY A;  2J8W A;  1NBB A;  3IQ5 A;  3ZQV A;  2XLH A;  4JE9 A;  4WGZ A;  3FOP A;  3IQ6 A;  4N4W A;  5JS5 A;  4WGY A;  2CCY A;  1QQ3 A;  4D4N A;  4D4X A;  3QVZ A;  4EIY A;  3ZTZ A;  3HNJ A;  4CX9 A;  1YZC A;  3NMJ A;  4N6H A;  3NMK A;  2YLD A;  3C63 A;  1E85 A;  1LM3 B;  4CJG A;  2YL7 A;  2XLE A;  1YZA A;  1RCP A;  4ULV A;  4L6R A;  3M4C A;  2XL6 A;  3TOM A;  3TOL A;  4IAQ A;  1YYJ A;  4JKV A;  2XLO A;  2BC5 A;  1CPQ A;  2XM0 A;  1A7V A;  4CDY A;  2YKZ A;  3M4B A;  3U8P A;  256B A;  4JEB A;  3FOO A;  5JUA A;  2YLG A;  1APC A;  4IB4 A;  2XLV A;  4CDA A;  2YL0 A;  3HNI A;  4U9E A;  2J9B A;  4CDV A;  2QLA A;  4CJO A;  5JRA A;  5JLI A;  1EKY A;  1YYX A;  3ZTM A; 
#chains in the Genus database with same CATH topology
 5DLJ A;  1OCO C;  2MHR A;  3DM5 A;  1WGW A;  5FCL A;  3WOD F;  1VYI A;  1NSG B;  2R7T A;  2IM8 A;  3LAY A;  1BR1 A;  1JPN A;  4U9D A;  3HNL A;  2VB6 A;  2R7R A;  2YL3 A;  2Q3T A;  3H2U A;  2R7S A;  3C62 A;  2KGO A;  3FVY A;  4PAC A;  4XQ1 A;  4CS7 A;  3H2V A;  4DBQ A;  1RXQ A;  3K66 A;  4QI2 A;  4DBR A;  1LS1 A;  4RD9 A;  1SR2 A;  5F5H A;  1AUE A;  5L0I A;  4CSA C;  3VAY A;  1A7E A;  1T6I A;  2Q00 A;  2Y3D A;  3M79 A;  1LIH A;  4W8K A;  2H8A A;  5HSW A;  2R7X A;  3CZ6 A;  2KQ9 A;  1NLX A;  3QW0 A;  1YJG A;  2Y3H A;  2P0N A;  3RVY A;  1E84 A;  4HFK B;  1PCX A;  2J46 A;  1TR2 A;  2J0W A;  3NMI A;  1SMY F;  3S90 A;  4LDR A;  5IY5 C;  3WAQ A;  4XEV A;  4Z9I A;  5L3Q A;  3ASN C;  1H6G A;  1CGO A;  1L3P A;  2OJE D;  3LS0 A;  1B68 A;  2KNH A;  1ZYR F;  2HUJ A;  2GDC A;  4AE4 B;  3T6G B;  3NDB B;  3F47 A;  3WG7 C;  1OXB A;  2OJQ A;  2VC9 A;  3JSZ A;  4EBJ A;  1M56 C;  3I5Q A;  1E83 A;  1GQA A;  3EG9 B;  3RVZ A;  4Q4Z F;  1CGN A;  2Q9B A;  3EFO B;  4NC3 A;  3SZR A;  2C03 A;  4CS8 C;  3R7C A;  1VLT A;  2YRF A;  5AGF A;  2ASR A;  3Q6M A;  4MTF A;  4MVM A;  4P6I C;  2R9R B;  3H65 A;  1NBB A;  3LS1 A;  1VLS A;  3ZQV A;  3O55 A;  2NUP B;  1ORY A;  5KYW B;  1QKR A;  1D1A A;  2WVQ A;  3IQ6 A;  4MTG A;  1V55 C;  3S84 A;  4LLE A;  5DS5 A;  2J7P D;  1FFH A;  2LD6 A;  1JRA A;  2A6E F;  4IGG A;  2JX0 A;  1Y4C A;  2DI3 A;  4MTO A;  4O6M A;  4PJL A;  4G0H A;  2KW3 C;  2HKV A;  2CCY A;  4JCZ A;  3KMI A;  2HFI A;  1M57 C;  4D4X A;  2L6G A;  5L0D A;  3N2Z B;  2YHS A;  4EIY A;  2OEX A;  4RBN A;  3W8I A;  3SXY A;  5BUO A;  1YZC A;  2AWC A;  4O7G A;  2J45 A;  4N06 A;  4N6H A;  2Y39 A;  2Y3G A;  3LUT B;  3TJ5 A;  2RSE B;  2AU5 A;  2QTV A;  3ATP A;  3Q7G A;  4IJJ A;  3LEO A;  3QZC A;  3TK0 A;  2YL7 A;  2XLE A;  2W45 A;  1XWJ A;  2AP3 A;  1VK5 A;  3ABL C;  1FR0 A;  4K7B A;  4BEM J;  3FHD A;  4EHP A;  3M1C B;  2Q9A A;  4OIO F;  1R5I D;  3U5S A;  1LPE A;  1HY5 A;  1YDI A;  2A0B A;  2KSF A;  1RJ9 A;  3S27 A;  4U5E E;  5E3C A;  1ZHY A;  3RIP A;  5D91 A;  4JKV A;  2J9V A;  2VH3 A;  2WZG A;  2XLO A;  2Z15 A;  4U5B E;  3J06 A;  4C7O A;  2XS1 A;  3L8I A;  2BC5 A;  1YLM A;  4YL0 A;  3X1O A;  2F22 A;  5HV9 A;  3BRJ A;  3EH1 A;  2EIL C;  2IXM A;  1VMA A;  3HJC A;  4XPY A;  4JIO A;  4FWV A;  4BJ6 A;  4KBL A;  4CDY A;  1H9G A;  1XZP A;  1O87 A;  3GAN A;  3GWN A;  3SXZ A;  4B6I A;  2EPK X;  1FMW A;  3OWT A;  1MMA A;  3U8P A;  2E87 A;  3EZI A;  2L6H A;  4A4A A;  2PNO A;  3ITF A;  1PV3 A;  4AK9 A;  3B71 A;  3FOO A;  4W8P A;  5DS6 A;  4J7Y A;  3TD7 A;  3MBG A;  2IXN A;  3IQT A;  1KU2 A;  3T6B A;  1ZW2 A;  3G4Z A;  3JRM O;  1KTM A;  5K0I A;  4NY3 A;  1ZU4 A;  3SEO A;  3VM6 A;  1JPJ A;  5L0F A;  1ZHW A;  4XLP F;  2J9B A;  4QDL A;  3US6 A;  1NG1 A;  4ANJ A;  3RKO F;  3LLK A;  5T1D B;  2IYL D;  3C18 A;  2QLA A;  3FMS A;  4LDK A;  4P9F A;  4JCH A;  5JRA A;  4JUR I;  5JLI A;  3POV A;  5A6K A;  1NU7 D;  4XPX A;  4ZLD A;  1FMV A;  4DXW A;  3NG1 A;  4CIH A;  2KJG A;  4RDA A;  1QLE C;  1WTY A;  2XLD A;  3NKD A;  3NYM A;  3RH3 A;  1ZZP A;  1TQG A;  3C8Z A;  1GGQ A;  4YK5 A;  4BEJ A;  4NTA A;  3U0C A;  4JRZ A;  1UFB A;  3CAX A;  4IAR A;  1WWP A;  2J7P A;  4Z9H A;  3VRC A;  4FES A;  4YN0 B;  3ZWI A;  2IBF A;  1C02 A;  1LS4 A;  2KK1 A;  4IAO A;  4R32 A;  2A69 F;  2EPO A;  5B3S C;  1IW7 F;  2ZD9 A;  4BPM A;  3PHF 2;  1RKE A;  1MND A;  2CGE A;  1GS9 A;  2NSF A;  2BE5 F;  4CBE A;  1RJ9 B;  3AG3 C;  1G4U S;  4JJF A;  1T9K A;  2OU6 A;  2YL1 A;  4WAB A;  4C7O B;  2PX3 A;  4HE8 D;  3R2P A;  2Q7R A;  3S9O A;  1DOV A;  2A68 F;  1T6U A;  2AWY A;  1Z5Z A;  3KYJ A;  3T9O A;  3T4R A;  1MQV A;  1A0B A;  2VCB A;  1L7C A;  2XL8 A;  5L0G A;  4A2N B;  3B0U X;  2X0C A;  3UGP A;  2L9J A;  1E2X A;  4XTK A;  4G7H F;  2X51 A;  4BJ5 A;  5DVW A;  4QI0 A;  2YQY A;  1C03 A;  1Q0F A;  1Q0K A;  1WOL A;  2R05 A;  4E0I A;  2KC3 A;  1S05 A;  3TUL A;  3EH2 A;  2HMQ A;  3NYJ A;  3C7J A;  3L8J A;  4LER A;  4YT2 A;  1N1C A;  2R7V A;  2YWA A;  3EJN A;  3HKK A;  5JSL A;  3QW1 A;  4E18 A;  5AC5 A;  4LDQ A;  3KYI A;  4U5F E;  2J8W A;  1TWG A;  1VYK A;  2ZXP A;  2QNL A;  4PJN A;  3RQG A;  4CS9 A;  5L0C A;  4GYT A;  2JPU A;  4MVS A;  1H7I A;  2MYS A;  2PFD A;  3FOP A;  2C04 A;  4DRI B;  4P9T A;  4N4W A;  2JD3 A;  3JTL O;  3W2V A;  3A11 A;  5JS5 A;  5L3V A;  2FAP B;  4WGY A;  1V54 C;  1M2O A;  3K7D A;  4XEF A;  5DS4 A;  5T3W A;  4D4N A;  1Z63 A;  3UMK A;  4G78 A;  1BR2 A;  4O79 A;  3L34 A;  3KH2 A;  2HV7 A;  3NMK A;  1HE9 A;  4XLN F;  4DVY P;  4U5C E;  3RQF A;  2A6H F;  1LM3 B;  1J8M F;  1RKE B;  2YVK A;  1VB5 A;  2W4M A;  3U9M A;  4YT4 A;  1YZA A;  1RCP A;  3DXJ F;  4ULV A;  1EQ1 A;  4L6R A;  2R03 A;  3PDM P;  4M63 A;  4K1O A;  3RF3 A;  3IPM O;  4HFF B;  2WVN A;  5A6A A;  1TWH A;  2J0X A;  2J9U A;  1QSP A;  2BL2 A;  3KPH A;  4GEH A;  1BZ4 A;  1OR3 A;  1YYJ A;  5TJ5 E;  2XRH A;  3ECS A;  5BQH A;  3EGD A;  5A69 A;  2V3C C;  1CPQ A;  2XM0 A;  2ZXW C;  1WAT A;  3EHN A;  5E33 A;  1J8Y F;  1ZVZ A;  1A7V A;  1Q0M A;  3DMD A;  3B0V C;  4MVO A;  3V7O A;  5DQZ A;  1WAS A;  1HW2 A;  4NTB A;  2IXP A;  3W2W A;  2WZL A;  3UGO A;  3AQB A;  3FXH A;  3SXM A;  3ZG1 A;  1CGM E;  3E9V A;  4FX5 A;  4JEB A;  2B0J A;  1Z7Q c;  3ZSU A;  5L0H A;  2B0H A;  2PP4 A;  1TFO B;  4U5G A;  2NG1 A;  3V5Y A;  1GM5 A;  1OCZ C;  2LFF A;  1OQC A;  2R7O A;  2XXA A;  2XLV A;  5EK0 A;  1OW8 A;  2ZPA A;  3GOR A;  1LI7 A;  4PK4 A;  5FZT A;  5B1B C;  1XZQ A;  3HNI A;  3UNG C;  4PFP A;  2P61 A;  5CIV A;  2MWQ A;  4E7S A;  2H7O A;  2R02 A;  2VCC A;  3V5Z A;  3AG2 C;  4G7O F;  1PD0 A;  3IQC A;  3LJB A;  1NU9 C;  4JW1 A;  3A9C A;  1LE4 A;  3ZTM A;  2H7V C;  5COF A;  1QPU A;  2QY9 A;  4YL3 A;  4EBB A;  4CIP A;  5KYY A;  2PBE A;  4ONS A;  4BG0 A;  4ZLC A;  1U0B B;  2OQM A;  5GPG B;  2WL8 A;  4YT8 A;  1E86 A;  2Q4F A;  1BDJ B;  4NTF A;  3MYI A;  3I5P A;  2ZXO A;  2P7V A;  1CPR A;  4H4K C;  4DJ9 A;  2D5R B;  2R7W A;  3L1M A;  3RFY A;  3WHN A;  2XSE A;  3O6X A;  2OCC C;  1YVI A;  3N0T A;  3EGX A;  3U2M A;  2YLI A;  2Y3B A;  5BQI A;  2A1D D;  1SF8 A;  2O9X A;  2XLW A;  3OEO A;  4JEA A;  3LLI A;  4K0D A;  4MQ9 F;  1R4T A;  1FNT c;  4BJ6 C;  3UR3 C;  2XLM A;  3AJM A;  5E2Q A;  3DZA A;  3EGD B;  4J32 B;  3ZDL A;  4ULW A;  2R25 A;  5F28 E;  2XM4 A;  3ABM C;  3DE9 A;  4JTD B;  3U8V A;  4AL0 A;  1LKX A;  2UUI A;  3DI5 A;  5JVE A;  3UMH A;  2H7B A;  3BEH A;  1K05 A;  3FDQ A;  1D0Z A;  4MVQ A;  2W4B A;  2LCH A;  2I8B A;  1WN0 A;  1OR2 A;  1Z23 A;  2NPU A;  4LAC B;  1K40 A;  5F5F A;  2YZS A;  1M6T A;  2LK4 A;  2WB7 A;  4I1O B;  4E17 A;  4N6C A;  2HMZ A;  4C3D A;  2XXA B;  2RD9 A;  2LP4 A;  3UMI A;  1F1M A;  1LI5 A;  1BBH A;  1JMW A;  1ORS C;  2LSE A;  2EIN C;  3AGU A;  4U5H A;  4ER9 A;  5JP7 A;  4C3E A;  3O39 A;  1T5O A;  3LNR A;  3GEI A;  4AL1 A;  5EHH A;  2EIJ C;  1VOM A;  1ZHT A;  3DE8 A;  5CI8 A;  2NSG A;  1M2V A;  2AVK A;  1RMV A;  2OG2 A;  4PR9 A;  3C8G D;  1D1B A;  1T01 A;  1TKN A;  3W4Y A;  4OD4 A;  5KYY B;  5D92 A;  1YAR O;  1ZHZ A;  1SYQ A;  1SZI A;  3CSK A;  4MW8 A;  4XWJ A;  1O3U A;  3PCV A;  1QQ3 A;  2KYH A;  3JYY A;  4J7T A;  2G3K A;  3N24 A;  3VF0 A;  2ICW G;  3ZTZ A;  4MND A;  2WVO A;  3K1I A;  3S29 A;  2G62 A;  4DOZ A;  3NMJ A;  3GWL A;  3PMR A;  2YLD A;  1OCR C;  4H54 A;  3DJN B;  3C63 A;  1MMD A;  2CDQ A;  2J9W A;  3EGX B;  4YL1 A;  4CJG A;  4E0H A;  4JZA A;  3NKE A;  3G50 A;  1TWC A;  1U89 A;  3U2L A;  1OCC C;  5CI9 A;  3GEE A;  3JT1 A;  3ABK C;  2XL6 A;  2CW0 F;  1OKK A;  3TJ6 A;  4BJ1 A;  2L7A A;  4YWQ A;  4KI2 A;  3TOM A;  3TOL A;  3JCU Q;  3GEH A;  1A7D A;  3DAF A;  4BJ5 C;  5A6B D;  1S7Z A;  4HEA J;  1AEP A;  1MNE A;  1Q0D A;  4IRU A;  2L81 A;  4EUK B;  4E7Z A;  1H9T A;  4CSA A;  2W9Y A;  1V4A A;  1W2W A;  3Q7L A;  2EPM X;  4PJM A;  1ZW3 A;  3G4X A;  4KC9 A;  2PF4 E;  5L0J A;  5KYN A;  3CQZ A;  3M4B A;  1G4W R;  3AQC A;  3TQO A;  1D1C A;  3DWW A;  3FAJ A;  1ZU5 A;  2DYR C;  4CS9 C;  4O6Y A;  4MS2 A;  2EIK C;  1M2V B;  4JTA B;  3NYL A;  2GFH A;  1Z6A A;  1APC A;  2Y69 C;  3L0I A;  1TWA A;  4GQH A;  2OKU A;  2DGJ A;  3K6B A;  1QVX A;  1Y6D A;  2CNW D;  4U9E A;  2IOQ A;  5DQT A;  2WZF A;  4CS8 A;  4CDV A;  3F46 A;  1U6H A;  1Q0G A;  3W8H A;  3EPV A;  4UDV A;  3ASO C;  1JR8 A;  1EKY A;  1YYX A;  3ZQY A;  2D4U A;  1QZX A;  2DB4 A;  3MYF A;  4EKW A;  3C8G A;  2M4E A;  4X0R A;  3Q6N A;  2FFH A;  3ZIB A;  1BR4 A;  4C3B A;  1C17 M;  1MMG A;  1DOW A;  1JAF A;  4PJJ A;  3EQL F;  3JZ0 A;  4AX2 A;  4JVS A;  3SYN A;  2XL4 A;  3DAG A;  1ORJ A;  1HW1 A;  3LES A;  2P6V A;  5EGY A;  5KYX A;  1D0Y A;  1OW7 A;  5A6J A;  1LE2 A;  1I4Y A;  1JOG A;  3S28 A;  2M64 A;  4JTC B;  4XPW A;  2HJM A;  1G5Z A;  3I4U A;  3M15 A;  4Q7C A;  4Z9J A;  2FGY A;  1VTM P;  2I15 A;  1OW6 A;  4OIN F;  1YA9 A;  3HNK A;  4DRJ B;  4EBK A;  1ST6 A;  3U9J A;  4JJG A;  4OIQ F;  1G8X A;  1T6Q A;  3MFN A;  2VCA A;  3EHM A;  2QE9 A;  3U3B A;  5B1A C;  5B3I A;  1FAP B;  3B9Q A;  3CEX A;  3GM2 A;  3O10 A;  4NQF A;  4DRH B;  3DM9 B;  5A6B A;  1V74 B;  2GA0 A;  4I1M A;  1KNY A;  1YA7 O;  3MX3 A;  3QMK A;  4J30 B;  5KYU A;  4MVU A;  1OKK D;  2HV6 A;  3AG4 C;  1HMD A;  4JC7 A;  3DKA A;  5E3A A;  2EPL X;  3U3F A;  3B0P A;  2TMV P;  3GM3 A;  4PFO A;  3GOD A;  5JT4 A;  2LQG A;  3QVY A;  3MLG A;  4O6N A;  3SP1 A;  2XS8 A;  3B29 A;  1YAU O;  3IQ5 A;  2XLH A;  5COM A;  4JE9 A;  3JYH A;  1MMN A;  1EI7 A;  4WGZ A;  3K1H A;  4WJ0 A;  2DYS C;  2HZ8 A;  2A0U A;  3ZC4 A;  1I4Z A;  4EWC A;  2PX0 A;  3E70 C;  2CYD A;  2R7U A;  4IWB A;  3C8G B;  2OOC A;  3KKB A;  2NUT A;  1FFT C;  1PD1 A;  3RQE A;  2GWW A;  1UG7 A;  1ZHX A;  1HMO A;  3IHU A;  2CNW A;  1OXK A;  2ZXR A;  3S0X A;  3DD7 A;  1NFO A;  3QVZ A;  4FAP B;  1TFK B;  2L6F A;  3LEV A;  3HNJ A;  4CX9 A;  5KYX B;  3RYL A;  2LIG A;  4F4B A;  4I44 A;  4KNW A;  5COG A;  1E85 A;  1Z3I X;  1O5H A;  3HTK C;  4BJT A;  3QTH A;  3FAP B;  3JRT A;  2HS5 A;  3RW0 A;  1A41 A;  3SNH A;  2G3V A;  3M4C A;  3LNM B;  3AGT A;  2VAS A;  4LLC A;  3AOU A;  2YEV A;  3V5X A;  1NZE A;  4IAQ A;  1AVO B;  1IZM A;  4G7Z F;  2UUH A;  4YJW A;  4U5D E;  2ETS A;  3DJU B;  2OEV A;  3ZVR A;  5AC4 A;  1LVK A;  4XEK A;  1K04 A;  4KNV A;  2YKZ A;  1D0X A;  1I5N A;  3AG1 C;  4OD5 A;  5BQG A;  5KYU B;  3HLZ A;  2IXO A;  2EIM C;  2QUP A;  3K33 A;  256B A;  2Q9C A;  4AE4 A;  4MVZ A;  2GAQ A;  1FTS A;  2V26 A;  3X2Q C;  1EA8 A;  4MVR A;  5JUA A;  3OA1 A;  2YLG A;  4OIR F;  3T6J A;  2P1A A;  2EPN A;  2R7Q A;  4I3M A;  3EG9 A;  2HSB A;  2LFD A;  1NFN A;  3KL4 A;  4IB4 A;  3IEE A;  3EFO A;  1HE1 A;  2HSQ A;  3GM1 A;  4CDA A;  4Q5S F;  4OIP F;  2HJ3 A;  4YT5 A;  4DVZ A;  2YL0 A;  3SXK A;  3EZH A;  4MW3 A;  2NUT B;  5KYW A;  2NUP A;  3JSE O;  4CJO A;  3K1I C;  1RKC A;  5T3T A;  3NRH A;  3VYW A;  4NCQ A; 
#chains in the Genus database with same CATH homology
 3ZQY A;  1QPU A;  2XLD A;  4CIP A;  4U9D A;  1E86 A;  3HNL A;  1JAF A;  4IAR A;  3VRC A;  2YL3 A;  3C62 A;  1CPR A;  3L1M A;  3ZWI A;  2YLI A;  3M15 A;  2XLW A;  4JEA A;  3M79 A;  3HNK A;  2YL1 A;  2XLM A;  3QW0 A;  5JVE A;  2XM4 A;  3DE9 A;  1E84 A;  1MQV A;  3NMI A;  2XL8 A;  5B3I A;  1CGO A;  1M6T A;  1E83 A;  1GQA A;  1S05 A;  1BBH A;  1CGN A;  4ER9 A;  4NC3 A;  5JP7 A;  5JSL A;  3QW1 A;  5AGF A;  3DE8 A;  5JT4 A;  3QVY A;  2J8W A;  1NBB A;  3IQ5 A;  3ZQV A;  2XLH A;  4JE9 A;  4WGZ A;  3FOP A;  3IQ6 A;  4N4W A;  5JS5 A;  4WGY A;  2CCY A;  1QQ3 A;  4D4N A;  4D4X A;  3QVZ A;  4EIY A;  3ZTZ A;  3HNJ A;  4CX9 A;  1YZC A;  3NMJ A;  4N6H A;  3NMK A;  2YLD A;  3C63 A;  1E85 A;  1LM3 B;  4CJG A;  2YL7 A;  2XLE A;  1YZA A;  1RCP A;  4ULV A;  4L6R A;  3M4C A;  2XL6 A;  3TOM A;  3TOL A;  4IAQ A;  1YYJ A;  4JKV A;  2XLO A;  2BC5 A;  1CPQ A;  2XM0 A;  1A7V A;  4CDY A;  2YKZ A;  3M4B A;  3U8P A;  256B A;  4JEB A;  3FOO A;  5JUA A;  2YLG A;  1APC A;  4IB4 A;  2XLV A;  4CDA A;  2YL0 A;  3HNI A;  4U9E A;  2J9B A;  4CDV A;  2QLA A;  4CJO A;  5JRA A;  5JLI A;  1EKY A;  1YYX A;  3ZTM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...