2XLEA

Cytochrome c prime from alcaligenes xylosoxidans: ferrous r124k variant with bound no
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
127
structure length
127
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYKKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Distal-to-Proximal No Conversion in Hemoproteins: The Role of the Proximal Pocket.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
total genus 51
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2010-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2xleA00
3HNJA 4JEBA 4EIYA 4JKVA 4CIPA 1S05A 3QVYA 2XLMA 4WGZA 5JVEA 1CGNA 3QW0A 4CDVA 1YYXA 1GQAA 5JT4A 4IAQA 4U9EA 2XL6A 3C63A 2XLHA 1E85A 3ZQVA 3NMKA 4ULVA 1QQ3A 2BC5A 4N6HA 3DE8A 3M4BA 1A7VA 4JE9A 4U9DA 1APCA 1BBHA 4CX9A 1YZAA 1CPQA 1JAFA 2XLVA 2YLDA 2YLIA 1CGOA 4L6RA 4JEAA 2YL3A 2YLGA 5JSLA 3HNIA 3FOPA 2YL0A 4ER9A 1LM3B 2CCYA 1QPUA 2YL7A 2XLEA 3IQ5A 1E83A 4CJOA 5B3IA 5JP7A 4IARA 4NC3A 4D4XA 1YZCA 4D4NA 3L1MA 2XM4A 256BA 4CJGA 5JS5A 3HNLA 2XLDA 3IQ6A 3ZTZA 1E84A 2YKZA 3HNKA 3C62A 3FOOA 4CDAA 1NBBA 4N4WA 4CDYA 4WGYA 2XLWA 1MQVA 2J8WA 3M4CA 3ZTMA 1RCPA 5JUAA 1M6TA 3ZQYA 2XM0A 1YYJA 3DE9A 3M15A 3TOLA 3U8PA 3ZWIA 3NMIA 1CPRA 1EKYA 3TOMA 2J9BA 5JLIA 1E86A 3M79A 3QW1A 2XLOA 2YL1A 5AGFA 2QLAA 3NMJA 3QVZA 5JRAA 2XL8A 3VRCA 4IB4A
chains in the Genus database with same CATH superfamily
1WGWA 1NSGB 4O79A 3Q6NA 4EIYA 4FX5A 2G62A 3KKBA 4JKVA 2WVOA 4MTGA 3WAQA 4IRUA 4YL0A 4ANJA 3KYJA 1T6IA 3MLGA 4EBKA 3HTKC 3GM1A 1S05A 2YZSA 3KL4A 3QVYA 2BE5F 2FAPB 3FDQA 2Q4FA 2M4EA 4KBLA 2GFHA 2QTVA 4E7SA 5JVEA 1K05A 2OG2A 2L81A 3KPHA 4GQHA 3NDBB 1HMOA 1T01A 4PACA 1OKKA 5E2QA 1EI7A 1M2OA 3LJBA 3C63A 1OR3A 3W8IA 3NMKA 1IW7F 2Y3DA 3SP1A 5IY5C 1TFOB 1OQCA 2A6EF 2I15A 1D1BA 3MX3A 1I4ZA 5HV9A 2WVNA 3M4BA 4JJFA 1SZIA 5KYWA 3EH2A 4U9DA 1CGME 1RXQA 2Q9AA 3U3BA 3U8VA 5BQHA 4CX9A 1YZAA 3IQTA 3SZRA 1EQ1A 1ST6A 1I5NA 2LFFA 2KJGA 1MMAA 2LFDA 3RH3A 4JCZA 1CGOA 3FXHA 4OD4A 4U5FE 3W8HA 3Q6MA 2OOCA 2VCBA 5JSLA 2B0HA 4PR9A 3EGXB 1VB5A 1TKNA 3ZIBA 4YT8A 5L0JA 3NKDA 4A4AA 1T6QA 1YDIA 3N0TA 4PJMA 2VCAA 3OA1A 2Q9CA 5F5HA 2XXAB 4XPWA 3H65A 2LSEA 4JZAA 4ER9A 3F47A 2HUJA 4JTDB 4MQ9F 2FGYA 2XLEA 4NQFA 5COFA 3ASOC 3N2ZB 4IJJA 4OIRF 2NSGA 1D0YA 3VYWA 1T9KA 2RSEB 4MVSA 5TJ5E 3ATPA 4IARA 1FFHA 1Z6AA 4P6IC 4U5DE 3QTHA 4XWJA 3EHNA 1ZHZA 1FMWA 4E7ZA 1OKKD 1Q0FA 3ABKC 3US6A 256BA 5L0IA 5JS5A 1XZQA 2QUPA 3I5PA 3LEVA 2CYDA 3HLZA 3G50A 1H6GA 5T3TA 2J9UA 3ZTZA 1E84A 4JC7A 3S0XA 2IXNA 1ORSC 3RW0A 3OWTA 3TD7A 1Q0GA 1O87A 1PD0A 1D0XA 3UR3C 3A11A 1FFTC 4P9TA 3I4UA 2Q7RA 4Q5SF 2R03A 2WZFA 4ONSA 4I44A 3HKKA 3K33A 3ZSUA 4N4WA 4XTKA 4WGYA 1V54C 1NZEA 2YHSA 5L0GA 3RKOF 3JRMO 4MTFA 1RCPA 4GEHA 3DAGA 2OU6A 4U5GA 1M6TA 4OIOF 2IXOA 2WB7A 4JTCB 4MVZA 3ZQYA 4XEFA 1RMVA 3EHMA 1YYJA 3AOUA 5EHHA 1LS4A 1JPNA 2QY9A 2ZD9A 2R7UA 3GWLA 5KYYB 5BQIA 1L3PA 2UUHA 2OEXA 3NMIA 4HFKB 1BZ4A 1H9GA 4JTAB 4PJNA 3L8IA 5DLJA 4AK9A 1KNYA 1ORYA 2R7OA 4YWQA 1PV3A 4XEVA 3TOMA 2B0JA 3EGXA 1DOWA 5E33A 3U9MA 2KQ9A 2EPMX 3RQGA 2C04A 4U5BE 1LE4A 4Z9JA 1OW8A 2J45A 2PP4A 1R5ID 4BJ6C 1FAPB 2QLAA 2D5RB 3RQEA 2CW0F 3QVZA 5JRAA 4U5EE 3NRHA 3K7DA 2R7TA 3EQLF 3L34A 4X0RA 5EGYA 3HNJA 3WODF 2AWYA 4BJ5C 1PD1A 1OCRC 2GAQA 3DKAA 4IAOA 3NG1A 1NU7D 3LNMB 5E3CA 1ZVZA 3UMHA 5CI9A 3IEEA 5DQZA 4EBBA 1UFBA 2LCHA 4WGZA 1RKCA 2WZGA 3B0VC 3J06A 1V55C 1YYXA 3TQOA 4KNVA 3B71A 1ORJA 4JCHA 2UUIA 2XL4A 4LDRA 1DOVA 5A69A 4K0DA 2XLHA 4NY3A 2PFDA 1LI7A 3MBGA 1E85A 4ULVA 2BL2A 5BQGA 1U89A 1JPJA 2GDCA 2G3KA 1VLTA 3C7JA 4AL1A 4FESA 3EZHA 3DI5A 3JYHA 3DM9B 3U9JA 4CS9A 3B0PA 2H8AA 3T6GB 2HJ3A 1Q0KA 1AUEA 1T5OA 2YRFA 1J8MF 3E70C 3R2PA 4G78A 4JE9A 3H2UA 1TWHA 4BG0A 1YVIA 1R4TA 2Q9BA 1VTMP 4MNDA 2YEVA 1XWJA 1WASA 1LS1A 1ZW2A 2HMZA 2L6HA 4QDLA 3SNHA 4DBQA 5KYYA 2R7VA 3QZCA 2X51A 2Y3HA 3V5XA 4E18A 1FTSA 4L6RA 4MVOA 4RBNA 3S28A 5A6KA 2F22A 2YLGA 3LUTB 3GEEA 3HJCA 4C7OA 4OD5A 2W9YA 1EA8A 2VC9A 2O9XA 1SMYF 4XEKA 3CZ6A 1G4WR 3FOPA 5A6AA 1YAUO 3CQZA 1WOLA 2JD3A 2R7WA 1LM3B 2CCYA 1WATA 1AVOB 2J7PA 4I3MA 3NYLA 1YARO 4MTOA 1LIHA 1QLEC 3IPMO 4QI0A 1OCZC 3UNGC 1MMNA 3GEIA 3O39A 4CJOA 1VYKA 4BEMJ 4DOZA 1WTYA 1M57C 4NC3A 3CEXA 3POVA 2EPLX 1VOMA 2IOQA 3GODA 2H7BA 2J9WA 3AGTA 2RD9A 2ICWG 3K66A 3SXYA 2EPOA 4C3EA 4JJGA 3C8GA 3L1MA 2XM4A 3U5SA 2PX0A 1YA7O 4CJGA 1NLXA 1ZYRF 2YQYA 2HKVA 2HS5A 1D0ZA 4LERA 1E86A 1B68A 1NFOA 3S84A 5B1BC 4CS8C 2D4UA 2EPNA 3FOOA 5T1DB 3JCUQ 1NBBA 3GWNA 1Z7Qc 2W45A 1BR1A 2HMQA 2GA0A 1NU9C 2VASA 2H7OA 2XLWA 3C18A 1LPEA 2EILC 2J8WA 2QE9A 2KW3C 3K1HA 3LEOA 2HV7A 3M4CA 1HE1A 4YL3A 2X0CA 1Z5ZA 3S9OA 4RD9A 3TULA 3CSKA 2R9RB 4Q7CA 4EBJA 4DRIB 4FAPB 3K1IC 2L6GA 4GYTA 5L0CA 2W4MA 1M56C 2J0WA 3M15A 4G0HA 4JRZA 3RFYA 2V3CC 4O6NA 3GANA 3FVYA 3T4RA 3UMKA 1PCXA 2PBEA 2W4BA 1LVKA 2HSBA 5GPGB 2Y3BA 2WL8A 5COMA 4NTFA 3ZDLA 1G8XA 4AE4B 4DRJB 4AL0A 4PK4A 3M1CB 2TMVP 2J7PD 3L8JA 2R05A 1A7DA 2J9BA 3MYIA 1VYIA 2XRHA 5L0HA 1YA9A 3EH1A 3M79A 3ZVRA 2A1DD 5DS5A 3QW1A 2XLOA 3ABLC 3KH2A 2NUTB 4BJTA 2KYHA 4JIOA 3NMJA 4AX2A 2DI3A 2A0BA 3AQCA 4R32A 1T6UA 2XL8A 3EG9B 3KMIA 3LS1A 1Y4CA 1C02A 4YL1A 5E3AA 5DS4A 5L3VA 2PX3A 3G4XA 4DJ9A 4ZLCA 3W4YA 2FFHA 2EPKX 3C8GD 1XZPA 4CIPA 1OW6A 4MS2A 4YJWA 3LLIA 1BR2A 3NYMA 4LLEA 1TR2A 5CI8A 4W8PA 3S27A 3DM5A 2XLMA 1OR2A 5KYUB 2IM8A 2IXMA 3QW0A 4CDVA 2HFIA 3QMKA 4Z9HA 3DD7A 1GQAA 4M63A 1LKXA 3G4ZA 3JT1A 4MVRA 3MFNA 3RYLA 2YWAA 4U9EA 3VM6A 4DRHB 3EJNA 1FNTc 1JRAA 3DWWA 1ZHTA 2IBFA 4IWBA 4XLNF 2Z15A 3JYYA 1A41A 3PMRA 3AG4C 2R7XA 2XXAA 2L9JA 3ASNC 1K04A 3B9QA 4NTAA 4OIPF 1QZXA 2BC5A 4LDQA 1VK5A 2XSEA 3IQCA 1NG1A 5L3QA 2XS1A 5D91A 3V7OA 3B0UX 5BUOA 4PJLA 3K6BA 4YT4A 1TWGA 1ZZPA 2MWQA 4J30B 4XPYA 1LE2A 2CNWA 2YLIA 5DS6A 4G7HF 4G7ZF 3ECSA 5DQTA 3Q7LA 1G5ZA 4K1OA 4Z9IA 4N6CA 1BDJB 4KC9A 4AE4A 1GS9A 3E9VA 1O3UA 4YT2A 3GEHA 4UDVA 2AVKA 1H9TA 2VCCA 5A6BA 4A2NB 4J7YA 4NCQA 2YL0A 1QKRA 1G4US 1OCCC 1JR8A 3NYJA 4U5HA 1E83A 2HV6A 1YJGA 3AG2C 4OINF 3CAXA 2MHRA 1RJ9B 2WVQA 4HE8D 3EG9A 3UMIA 2OJED 5B3IA 5JP7A 1U0BB 1V4AA 2IYLD 4MVMA 3TJ6A 4BPMA 4D4XA 1VLSA 5FCLA 3N24A 1YZCA 3U2LA 5HSWA 5FZTA 3ZC4A 2EINC 1TWAA 3KYIA 1GM5A 2R7QA 3SEOA 5K0IA 2Y69C 4JVSA 2YVKA 1C17M 1Z3IX 5KYUA 3X1OA 1JMWA 1FMVA 1N1CA 2J46A 2R02A 3HNLA 1OXBA 4MVUA 4YK5A 2Q00A 5D92A 2AWCA 3VAYA 5AC4A 3BEHA 5L0FA 2YKZA 2DGJA 2J0XA 2NUPB 3NKEA 2Y39A 3UGPA 4LDKA 1Z63A 1UG7A 1KU2A 1A7EA 2OCCC 4C3BA 3IHUA 4J32B 4CDYA 4EHPA 4G7OF 2OEVA 2DYRC 1MMDA 3MYFA 1VMAA 1MNEA 5DVWA 3EPVA 4OIQF 2CNWD 3O55A 4O6MA 2PF4E 2LIGA 3TOLA 3U8PA 1QVXA 3ZWIA 2DB4A 3I5QA 4H54A 1Q0MA 2QNLA 3RVYA 2NG1A 5A6BD 3DAFA 2A69F 3T9OA 3PDMP 4DBRA 2PNOA 1CPRA 2M64A 3S29A 2J9VA 1AEPA 2KSFA 4WJ0A 2EIMC 1HW2A 4W8KA 1MMGA 4K7BA 5KYNA 4CSAA 3ZG1A 1D1AA 1ZHYA 1ZHXA 2L7AA 3EGDB 4P9FA 4U5CE 2LP4A 4CS7A 3UGOA 3RQFA 5EK0A 4O7GA 3W2WA 1RJ9A 2G3VA 5F28E 4IB4A 1JOGA 4HFFB 3EZIA 5T3WA 4DXWA 4JEBA 2NPUA 3F46A 4CBEA 3GORA 2AP3A 1GGQA 2ZXRA 3O6XA 2WZLA 5AC5A 4CSAC 4PFPA 4ULWA 2C03A 1E2XA 3SXZA 2VH3A 3RIPA 4CS8A 1M2VB 4J7TA 3Q7GA 3DMDA 1CGNA 3GM2A 1OCOC 2IXPA 3A9CA 4E0IA 4MVQA 1HW1A 4KI2A 2ZXOA 5JT4A 2HSQA 2P61A 3PCVA 4IAQA 3H2VA 2DYSC 2XL6A 3DJUB 2OKUA 4RDAA 2NUPA 4EUKB 2R7RA 2R7SA 2ZXPA 2MYSA 3AG1C 3ZQVA 3K1IA 4DVZA 4MW3A 4E17A 3AG3C 1QQ3A 2ETSA 5KYXB 1BR4A 3GM3A 3FAJA 4FWVA 4N6HA 4C3DA 1F1MA 3DE8A 1C03A 3ITFA 1A7VA 2A0UA 2Q3TA 3T6JA 1APCA 3JTLO 1BBHA 2XLVA 1CPQA 1JAFA 2YLDA 3JRTA 2R25A 3V5YA 4ZLDA 4F4BA 2ZXWC 3LS0A 1D1CA 3DZAA 3SXMA 3SXKA 3VF0A 1ZU5A 2LQGA 4JEAA 1HE9A 2YL3A 1H7IA 3HNIA 3O10A 1IZMA 5CIVA 1RKEB 3AQBA 1SR2A 1FR0A 2A68F 2P6VA 3U3FA 3X2QC 3BRJA 5F5FA 2YL7A 1QPUA 3EFOB 2HJMA 1QSPA 3IQ5A 4DVYP 1W2WA 2V26A 3EGDA 4MW8A 3JSEO 3LNRA 4EWCA 1WWPA 3LLKA 1MNDA 1HY5A 1ZU4A 2ZPAA 1TQGA 5L0DA 2VB6A 1OXKA 2E87A 4HEAJ 4NTBA 4E0HA 3U0CA 2GWWA 1Q0DA 2H7VC 3LESA 4XQ1A 2KK1A 2P0NA 4I1MA 4B6IA 1KTMA 3DXJF 1A0BA 4XPXA 1I4YA 2JX0A 2P7VA 3FAPB 3RF3A 4PFOA 3T6BA 4D4NA 4PJJA 4LLCA 3TJ5A 4O6YA 2P1AA 1M2VA 4H4KC 4YT5A 4C7OB 2OQMA 4QI2A 4WABA 2NSFA 4BJ6A 2XLDA 3AJMA 3FHDA 3IQ6A 4BEJA 3WHNA 2EIJC 2I8BA 3DJNB 4IGGA 4Q4ZF 1TWCA 3HNKA 3C62A 3WG7C 1HMDA 2XS8A 3R7CA 4CDAA 5A6JA 2KGOA 1J8YF 3S90A 3PHF2 4BJ5A 1SF8A 2NUTA 1S7ZA 1MQVA 4LACB 4EKWA 5KYXA 2L6FA 3ZTMA 5JUAA 3AGUA 5KYWB 1Z23A 5B3SC 1Y6DA 2LK4A 1OW7A 2XM0A 1U6HA 3DE9A 1V74B 1YLMA 3C8GB 3C8ZA 4JURI 3SYNA 2A6HF 3U2MA 4CS9C 2KC3A 2Y3GA 3TK0A 3JZ0A 1ZHWA 2JPUA 3ABMC 5COGA 4BJ1A 3JSZA 3RVZA 1EKYA 2HZ8A 4JW1A 2OJQA 2EIKC 1WN0A 1ZW3A 5JLIA 1RKEA 1LI5A 2KNHA 3W2VA 4XLPF 3V5ZA 1L7CA 4I1OB 1NFNA 2ASRA 4KNWA 1O5HA 2YL1A 2CDQA 2LD6A 4N06A 5AGFA 3EFOA 5B1AC 3OEOA 4YN0B 1SYQA 1TFKB 3B29A 3L0IA 3LAYA 3VRCA 4CIHA 3FMSA 2CGEA 2AU5A 1K40A
chains in the Genus database with same CATH topology
3HNJA 4JEBA 4EIYA 4JKVA 4CIPA 1S05A 3QVYA 2XLMA 4WGZA 5JVEA 1CGNA 3QW0A 4CDVA 1YYXA 1GQAA 5JT4A 4IAQA 4U9EA 2XL6A 3C63A 2XLHA 1E85A 3ZQVA 3NMKA 4ULVA 1QQ3A 2BC5A 4N6HA 3DE8A 3M4BA 1A7VA 4JE9A 4U9DA 1APCA 1BBHA 4CX9A 1YZAA 1CPQA 1JAFA 2XLVA 2YLDA 2YLIA 1CGOA 4L6RA 4JEAA 2YL3A 2YLGA 5JSLA 3HNIA 3FOPA 2YL0A 4ER9A 1LM3B 2CCYA 1QPUA 2YL7A 2XLEA 3IQ5A 1E83A 4CJOA 5B3IA 5JP7A 4IARA 4NC3A 4D4XA 1YZCA 4D4NA 3L1MA 2XM4A 256BA 4CJGA 5JS5A 3HNLA 2XLDA 3IQ6A 3ZTZA 1E84A 2YKZA 3HNKA 3C62A 3FOOA 4CDAA 1NBBA 4N4WA 4CDYA 4WGYA 2XLWA 1MQVA 2J8WA 3M4CA 3ZTMA 1RCPA 5JUAA 1M6TA 3ZQYA 2XM0A 1YYJA 3DE9A 3M15A 3TOLA 3U8PA 3ZWIA 3NMIA 1CPRA 1EKYA 3TOMA 2J9BA 5JLIA 1E86A 3M79A 3QW1A 2XLOA 2YL1A 5AGFA 2QLAA 3NMJA 3QVZA 5JRAA 2XL8A 3VRCA 4IB4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HNJ A;  4JEB A;  4EIY A;  4JKV A;  4CIP A;  1S05 A;  3QVY A;  2XLM A;  4WGZ A;  5JVE A;  1CGN A;  3QW0 A;  4CDV A;  1YYX A;  1GQA A;  5JT4 A;  4IAQ A;  4U9E A;  2XL6 A;  3C63 A;  2XLH A;  1E85 A;  3ZQV A;  3NMK A;  4ULV A;  1QQ3 A;  2BC5 A;  4N6H A;  3DE8 A;  3M4B A;  1A7V A;  4JE9 A;  4U9D A;  1APC A;  1BBH A;  4CX9 A;  1YZA A;  1CPQ A;  1JAF A;  2XLV A;  2YLD A;  2YLI A;  1CGO A;  4L6R A;  4JEA A;  2YL3 A;  2YLG A;  5JSL A;  3HNI A;  3FOP A;  2YL0 A;  4ER9 A;  1LM3 B;  2CCY A;  1QPU A;  2YL7 A;  2XLE A;  3IQ5 A;  1E83 A;  4CJO A;  5B3I A;  5JP7 A;  4IAR A;  4NC3 A;  4D4X A;  1YZC A;  4D4N A;  3L1M A;  2XM4 A;  256B A;  4CJG A;  5JS5 A;  3HNL A;  2XLD A;  3IQ6 A;  3ZTZ A;  1E84 A;  2YKZ A;  3HNK A;  3C62 A;  3FOO A;  4CDA A;  1NBB A;  4N4W A;  4CDY A;  4WGY A;  2XLW A;  1MQV A;  2J8W A;  3M4C A;  3ZTM A;  1RCP A;  5JUA A;  1M6T A;  3ZQY A;  2XM0 A;  1YYJ A;  3DE9 A;  3M15 A;  3TOL A;  3U8P A;  3ZWI A;  3NMI A;  1CPR A;  1EKY A;  3TOM A;  2J9B A;  5JLI A;  1E86 A;  3M79 A;  3QW1 A;  2XLO A;  2YL1 A;  5AGF A;  2QLA A;  3NMJ A;  3QVZ A;  5JRA A;  2XL8 A;  3VRC A;  4IB4 A; 
#chains in the Genus database with same CATH topology
 1WGW A;  1NSG B;  4O79 A;  3Q6N A;  4EIY A;  4FX5 A;  2G62 A;  3KKB A;  4JKV A;  2WVO A;  4MTG A;  3WAQ A;  4IRU A;  4YL0 A;  4ANJ A;  3KYJ A;  1T6I A;  3MLG A;  4EBK A;  3HTK C;  3GM1 A;  1S05 A;  2YZS A;  3KL4 A;  3QVY A;  2BE5 F;  2FAP B;  3FDQ A;  2Q4F A;  2M4E A;  4KBL A;  2GFH A;  2QTV A;  4E7S A;  5JVE A;  1K05 A;  2OG2 A;  2L81 A;  3KPH A;  4GQH A;  3NDB B;  1HMO A;  1T01 A;  4PAC A;  1OKK A;  5E2Q A;  1EI7 A;  1M2O A;  3LJB A;  3C63 A;  1OR3 A;  3W8I A;  3NMK A;  1IW7 F;  2Y3D A;  3SP1 A;  5IY5 C;  1TFO B;  1OQC A;  2A6E F;  2I15 A;  1D1B A;  3MX3 A;  1I4Z A;  5HV9 A;  2WVN A;  3M4B A;  4JJF A;  1SZI A;  5KYW A;  3EH2 A;  4U9D A;  1CGM E;  1RXQ A;  2Q9A A;  3U3B A;  3U8V A;  5BQH A;  4CX9 A;  1YZA A;  3IQT A;  3SZR A;  1EQ1 A;  1ST6 A;  1I5N A;  2LFF A;  2KJG A;  1MMA A;  2LFD A;  3RH3 A;  4JCZ A;  1CGO A;  3FXH A;  4OD4 A;  4U5F E;  3W8H A;  3Q6M A;  2OOC A;  2VCB A;  5JSL A;  2B0H A;  4PR9 A;  3EGX B;  1VB5 A;  1TKN A;  3ZIB A;  4YT8 A;  5L0J A;  3NKD A;  4A4A A;  1T6Q A;  1YDI A;  3N0T A;  4PJM A;  2VCA A;  3OA1 A;  2Q9C A;  5F5H A;  2XXA B;  4XPW A;  3H65 A;  2LSE A;  4JZA A;  4ER9 A;  3F47 A;  2HUJ A;  4JTD B;  4MQ9 F;  2FGY A;  2XLE A;  4NQF A;  5COF A;  3ASO C;  3N2Z B;  4IJJ A;  4OIR F;  2NSG A;  1D0Y A;  3VYW A;  1T9K A;  2RSE B;  4MVS A;  5TJ5 E;  3ATP A;  4IAR A;  1FFH A;  1Z6A A;  4P6I C;  4U5D E;  3QTH A;  4XWJ A;  3EHN A;  1ZHZ A;  1FMW A;  4E7Z A;  1OKK D;  1Q0F A;  3ABK C;  3US6 A;  256B A;  5L0I A;  5JS5 A;  1XZQ A;  2QUP A;  3I5P A;  3LEV A;  2CYD A;  3HLZ A;  3G50 A;  1H6G A;  5T3T A;  2J9U A;  3ZTZ A;  1E84 A;  4JC7 A;  3S0X A;  2IXN A;  1ORS C;  3RW0 A;  3OWT A;  3TD7 A;  1Q0G A;  1O87 A;  1PD0 A;  1D0X A;  3UR3 C;  3A11 A;  1FFT C;  4P9T A;  3I4U A;  2Q7R A;  4Q5S F;  2R03 A;  2WZF A;  4ONS A;  4I44 A;  3HKK A;  3K33 A;  3ZSU A;  4N4W A;  4XTK A;  4WGY A;  1V54 C;  1NZE A;  2YHS A;  5L0G A;  3RKO F;  3JRM O;  4MTF A;  1RCP A;  4GEH A;  3DAG A;  2OU6 A;  4U5G A;  1M6T A;  4OIO F;  2IXO A;  2WB7 A;  4JTC B;  4MVZ A;  3ZQY A;  4XEF A;  1RMV A;  3EHM A;  1YYJ A;  3AOU A;  5EHH A;  1LS4 A;  1JPN A;  2QY9 A;  2ZD9 A;  2R7U A;  3GWL A;  5KYY B;  5BQI A;  1L3P A;  2UUH A;  2OEX A;  3NMI A;  4HFK B;  1BZ4 A;  1H9G A;  4JTA B;  4PJN A;  3L8I A;  5DLJ A;  4AK9 A;  1KNY A;  1ORY A;  2R7O A;  4YWQ A;  1PV3 A;  4XEV A;  3TOM A;  2B0J A;  3EGX A;  1DOW A;  5E33 A;  3U9M A;  2KQ9 A;  2EPM X;  3RQG A;  2C04 A;  4U5B E;  1LE4 A;  4Z9J A;  1OW8 A;  2J45 A;  2PP4 A;  1R5I D;  4BJ6 C;  1FAP B;  2QLA A;  2D5R B;  3RQE A;  2CW0 F;  3QVZ A;  5JRA A;  4U5E E;  3NRH A;  3K7D A;  2R7T A;  3EQL F;  3L34 A;  4X0R A;  5EGY A;  3HNJ A;  3WOD F;  2AWY A;  4BJ5 C;  1PD1 A;  1OCR C;  2GAQ A;  3DKA A;  4IAO A;  3NG1 A;  1NU7 D;  3LNM B;  5E3C A;  1ZVZ A;  3UMH A;  5CI9 A;  3IEE A;  5DQZ A;  4EBB A;  1UFB A;  2LCH A;  4WGZ A;  1RKC A;  2WZG A;  3B0V C;  3J06 A;  1V55 C;  1YYX A;  3TQO A;  4KNV A;  3B71 A;  1ORJ A;  4JCH A;  2UUI A;  2XL4 A;  4LDR A;  1DOV A;  5A69 A;  4K0D A;  2XLH A;  4NY3 A;  2PFD A;  1LI7 A;  3MBG A;  1E85 A;  4ULV A;  2BL2 A;  5BQG A;  1U89 A;  1JPJ A;  2GDC A;  2G3K A;  1VLT A;  3C7J A;  4AL1 A;  4FES A;  3EZH A;  3DI5 A;  3JYH A;  3DM9 B;  3U9J A;  4CS9 A;  3B0P A;  2H8A A;  3T6G B;  2HJ3 A;  1Q0K A;  1AUE A;  1T5O A;  2YRF A;  1J8M F;  3E70 C;  3R2P A;  4G78 A;  4JE9 A;  3H2U A;  1TWH A;  4BG0 A;  1YVI A;  1R4T A;  2Q9B A;  1VTM P;  4MND A;  2YEV A;  1XWJ A;  1WAS A;  1LS1 A;  1ZW2 A;  2HMZ A;  2L6H A;  4QDL A;  3SNH A;  4DBQ A;  5KYY A;  2R7V A;  3QZC A;  2X51 A;  2Y3H A;  3V5X A;  4E18 A;  1FTS A;  4L6R A;  4MVO A;  4RBN A;  3S28 A;  5A6K A;  2F22 A;  2YLG A;  3LUT B;  3GEE A;  3HJC A;  4C7O A;  4OD5 A;  2W9Y A;  1EA8 A;  2VC9 A;  2O9X A;  1SMY F;  4XEK A;  3CZ6 A;  1G4W R;  3FOP A;  5A6A A;  1YAU O;  3CQZ A;  1WOL A;  2JD3 A;  2R7W A;  1LM3 B;  2CCY A;  1WAT A;  1AVO B;  2J7P A;  4I3M A;  3NYL A;  1YAR O;  4MTO A;  1LIH A;  1QLE C;  3IPM O;  4QI0 A;  1OCZ C;  3UNG C;  1MMN A;  3GEI A;  3O39 A;  4CJO A;  1VYK A;  4BEM J;  4DOZ A;  1WTY A;  1M57 C;  4NC3 A;  3CEX A;  3POV A;  2EPL X;  1VOM A;  2IOQ A;  3GOD A;  2H7B A;  2J9W A;  3AGT A;  2RD9 A;  2ICW G;  3K66 A;  3SXY A;  2EPO A;  4C3E A;  4JJG A;  3C8G A;  3L1M A;  2XM4 A;  3U5S A;  2PX0 A;  1YA7 O;  4CJG A;  1NLX A;  1ZYR F;  2YQY A;  2HKV A;  2HS5 A;  1D0Z A;  4LER A;  1E86 A;  1B68 A;  1NFO A;  3S84 A;  5B1B C;  4CS8 C;  2D4U A;  2EPN A;  3FOO A;  5T1D B;  3JCU Q;  1NBB A;  3GWN A;  1Z7Q c;  2W45 A;  1BR1 A;  2HMQ A;  2GA0 A;  1NU9 C;  2VAS A;  2H7O A;  2XLW A;  3C18 A;  1LPE A;  2EIL C;  2J8W A;  2QE9 A;  2KW3 C;  3K1H A;  3LEO A;  2HV7 A;  3M4C A;  1HE1 A;  4YL3 A;  2X0C A;  1Z5Z A;  3S9O A;  4RD9 A;  3TUL A;  3CSK A;  2R9R B;  4Q7C A;  4EBJ A;  4DRI B;  4FAP B;  3K1I C;  2L6G A;  4GYT A;  5L0C A;  2W4M A;  1M56 C;  2J0W A;  3M15 A;  4G0H A;  4JRZ A;  3RFY A;  2V3C C;  4O6N A;  3GAN A;  3FVY A;  3T4R A;  3UMK A;  1PCX A;  2PBE A;  2W4B A;  1LVK A;  2HSB A;  5GPG B;  2Y3B A;  2WL8 A;  5COM A;  4NTF A;  3ZDL A;  1G8X A;  4AE4 B;  4DRJ B;  4AL0 A;  4PK4 A;  3M1C B;  2TMV P;  2J7P D;  3L8J A;  2R05 A;  1A7D A;  2J9B A;  3MYI A;  1VYI A;  2XRH A;  5L0H A;  1YA9 A;  3EH1 A;  3M79 A;  3ZVR A;  2A1D D;  5DS5 A;  3QW1 A;  2XLO A;  3ABL C;  3KH2 A;  2NUT B;  4BJT A;  2KYH A;  4JIO A;  3NMJ A;  4AX2 A;  2DI3 A;  2A0B A;  3AQC A;  4R32 A;  1T6U A;  2XL8 A;  3EG9 B;  3KMI A;  3LS1 A;  1Y4C A;  1C02 A;  4YL1 A;  5E3A A;  5DS4 A;  5L3V A;  2PX3 A;  3G4X A;  4DJ9 A;  4ZLC A;  3W4Y A;  2FFH A;  2EPK X;  3C8G D;  1XZP A;  4CIP A;  1OW6 A;  4MS2 A;  4YJW A;  3LLI A;  1BR2 A;  3NYM A;  4LLE A;  1TR2 A;  5CI8 A;  4W8P A;  3S27 A;  3DM5 A;  2XLM A;  1OR2 A;  5KYU B;  2IM8 A;  2IXM A;  3QW0 A;  4CDV A;  2HFI A;  3QMK A;  4Z9H A;  3DD7 A;  1GQA A;  4M63 A;  1LKX A;  3G4Z A;  3JT1 A;  4MVR A;  3MFN A;  3RYL A;  2YWA A;  4U9E A;  3VM6 A;  4DRH B;  3EJN A;  1FNT c;  1JRA A;  3DWW A;  1ZHT A;  2IBF A;  4IWB A;  4XLN F;  2Z15 A;  3JYY A;  1A41 A;  3PMR A;  3AG4 C;  2R7X A;  2XXA A;  2L9J A;  3ASN C;  1K04 A;  3B9Q A;  4NTA A;  4OIP F;  1QZX A;  2BC5 A;  4LDQ A;  1VK5 A;  2XSE A;  3IQC A;  1NG1 A;  5L3Q A;  2XS1 A;  5D91 A;  3V7O A;  3B0U X;  5BUO A;  4PJL A;  3K6B A;  4YT4 A;  1TWG A;  1ZZP A;  2MWQ A;  4J30 B;  4XPY A;  1LE2 A;  2CNW A;  2YLI A;  5DS6 A;  4G7H F;  4G7Z F;  3ECS A;  5DQT A;  3Q7L A;  1G5Z A;  4K1O A;  4Z9I A;  4N6C A;  1BDJ B;  4KC9 A;  4AE4 A;  1GS9 A;  3E9V A;  1O3U A;  4YT2 A;  3GEH A;  4UDV A;  2AVK A;  1H9T A;  2VCC A;  5A6B A;  4A2N B;  4J7Y A;  4NCQ A;  2YL0 A;  1QKR A;  1G4U S;  1OCC C;  1JR8 A;  3NYJ A;  4U5H A;  1E83 A;  2HV6 A;  1YJG A;  3AG2 C;  4OIN F;  3CAX A;  2MHR A;  1RJ9 B;  2WVQ A;  4HE8 D;  3EG9 A;  3UMI A;  2OJE D;  5B3I A;  5JP7 A;  1U0B B;  1V4A A;  2IYL D;  4MVM A;  3TJ6 A;  4BPM A;  4D4X A;  1VLS A;  5FCL A;  3N24 A;  1YZC A;  3U2L A;  5HSW A;  5FZT A;  3ZC4 A;  2EIN C;  1TWA A;  3KYI A;  1GM5 A;  2R7Q A;  3SEO A;  5K0I A;  2Y69 C;  4JVS A;  2YVK A;  1C17 M;  1Z3I X;  5KYU A;  3X1O A;  1JMW A;  1FMV A;  1N1C A;  2J46 A;  2R02 A;  3HNL A;  1OXB A;  4MVU A;  4YK5 A;  2Q00 A;  5D92 A;  2AWC A;  3VAY A;  5AC4 A;  3BEH A;  5L0F A;  2YKZ A;  2DGJ A;  2J0X A;  2NUP B;  3NKE A;  2Y39 A;  3UGP A;  4LDK A;  1Z63 A;  1UG7 A;  1KU2 A;  1A7E A;  2OCC C;  4C3B A;  3IHU A;  4J32 B;  4CDY A;  4EHP A;  4G7O F;  2OEV A;  2DYR C;  1MMD A;  3MYF A;  1VMA A;  1MNE A;  5DVW A;  3EPV A;  4OIQ F;  2CNW D;  3O55 A;  4O6M A;  2PF4 E;  2LIG A;  3TOL A;  3U8P A;  1QVX A;  3ZWI A;  2DB4 A;  3I5Q A;  4H54 A;  1Q0M A;  2QNL A;  3RVY A;  2NG1 A;  5A6B D;  3DAF A;  2A69 F;  3T9O A;  3PDM P;  4DBR A;  2PNO A;  1CPR A;  2M64 A;  3S29 A;  2J9V A;  1AEP A;  2KSF A;  4WJ0 A;  2EIM C;  1HW2 A;  4W8K A;  1MMG A;  4K7B A;  5KYN A;  4CSA A;  3ZG1 A;  1D1A A;  1ZHY A;  1ZHX A;  2L7A A;  3EGD B;  4P9F A;  4U5C E;  2LP4 A;  4CS7 A;  3UGO A;  3RQF A;  5EK0 A;  4O7G A;  3W2W A;  1RJ9 A;  2G3V A;  5F28 E;  4IB4 A;  1JOG A;  4HFF B;  3EZI A;  5T3W A;  4DXW A;  4JEB A;  2NPU A;  3F46 A;  4CBE A;  3GOR A;  2AP3 A;  1GGQ A;  2ZXR A;  3O6X A;  2WZL A;  5AC5 A;  4CSA C;  4PFP A;  4ULW A;  2C03 A;  1E2X A;  3SXZ A;  2VH3 A;  3RIP A;  4CS8 A;  1M2V B;  4J7T A;  3Q7G A;  3DMD A;  1CGN A;  3GM2 A;  1OCO C;  2IXP A;  3A9C A;  4E0I A;  4MVQ A;  1HW1 A;  4KI2 A;  2ZXO A;  5JT4 A;  2HSQ A;  2P61 A;  3PCV A;  4IAQ A;  3H2V A;  2DYS C;  2XL6 A;  3DJU B;  2OKU A;  4RDA A;  2NUP A;  4EUK B;  2R7R A;  2R7S A;  2ZXP A;  2MYS A;  3AG1 C;  3ZQV A;  3K1I A;  4DVZ A;  4MW3 A;  4E17 A;  3AG3 C;  1QQ3 A;  2ETS A;  5KYX B;  1BR4 A;  3GM3 A;  3FAJ A;  4FWV A;  4N6H A;  4C3D A;  1F1M A;  3DE8 A;  1C03 A;  3ITF A;  1A7V A;  2A0U A;  2Q3T A;  3T6J A;  1APC A;  3JTL O;  1BBH A;  2XLV A;  1CPQ A;  1JAF A;  2YLD A;  3JRT A;  2R25 A;  3V5Y A;  4ZLD A;  4F4B A;  2ZXW C;  3LS0 A;  1D1C A;  3DZA A;  3SXM A;  3SXK A;  3VF0 A;  1ZU5 A;  2LQG A;  4JEA A;  1HE9 A;  2YL3 A;  1H7I A;  3HNI A;  3O10 A;  1IZM A;  5CIV A;  1RKE B;  3AQB A;  1SR2 A;  1FR0 A;  2A68 F;  2P6V A;  3U3F A;  3X2Q C;  3BRJ A;  5F5F A;  2YL7 A;  1QPU A;  3EFO B;  2HJM A;  1QSP A;  3IQ5 A;  4DVY P;  1W2W A;  2V26 A;  3EGD A;  4MW8 A;  3JSE O;  3LNR A;  4EWC A;  1WWP A;  3LLK A;  1MND A;  1HY5 A;  1ZU4 A;  2ZPA A;  1TQG A;  5L0D A;  2VB6 A;  1OXK A;  2E87 A;  4HEA J;  4NTB A;  4E0H A;  3U0C A;  2GWW A;  1Q0D A;  2H7V C;  3LES A;  4XQ1 A;  2KK1 A;  2P0N A;  4I1M A;  4B6I A;  1KTM A;  3DXJ F;  1A0B A;  4XPX A;  1I4Y A;  2JX0 A;  2P7V A;  3FAP B;  3RF3 A;  4PFO A;  3T6B A;  4D4N A;  4PJJ A;  4LLC A;  3TJ5 A;  4O6Y A;  2P1A A;  1M2V A;  4H4K C;  4YT5 A;  4C7O B;  2OQM A;  4QI2 A;  4WAB A;  2NSF A;  4BJ6 A;  2XLD A;  3AJM A;  3FHD A;  3IQ6 A;  4BEJ A;  3WHN A;  2EIJ C;  2I8B A;  3DJN B;  4IGG A;  4Q4Z F;  1TWC A;  3HNK A;  3C62 A;  3WG7 C;  1HMD A;  2XS8 A;  3R7C A;  4CDA A;  5A6J A;  2KGO A;  1J8Y F;  3S90 A;  3PHF 2;  4BJ5 A;  1SF8 A;  2NUT A;  1S7Z A;  1MQV A;  4LAC B;  4EKW A;  5KYX A;  2L6F A;  3ZTM A;  5JUA A;  3AGU A;  5KYW B;  1Z23 A;  5B3S C;  1Y6D A;  2LK4 A;  1OW7 A;  2XM0 A;  1U6H A;  3DE9 A;  1V74 B;  1YLM A;  3C8G B;  3C8Z A;  4JUR I;  3SYN A;  2A6H F;  3U2M A;  4CS9 C;  2KC3 A;  2Y3G A;  3TK0 A;  3JZ0 A;  1ZHW A;  2JPU A;  3ABM C;  5COG A;  4BJ1 A;  3JSZ A;  3RVZ A;  1EKY A;  2HZ8 A;  4JW1 A;  2OJQ A;  2EIK C;  1WN0 A;  1ZW3 A;  5JLI A;  1RKE A;  1LI5 A;  2KNH A;  3W2V A;  4XLP F;  3V5Z A;  1L7C A;  4I1O B;  1NFN A;  2ASR A;  4KNW A;  1O5H A;  2YL1 A;  2CDQ A;  2LD6 A;  4N06 A;  5AGF A;  3EFO A;  5B1A C;  3OEO A;  4YN0 B;  1SYQ A;  1TFK B;  3B29 A;  3L0I A;  3LAY A;  3VRC A;  4CIH A;  3FMS A;  2CGE A;  2AU5 A;  1K40 A; 
#chains in the Genus database with same CATH homology
 3HNJ A;  4JEB A;  4EIY A;  4JKV A;  4CIP A;  1S05 A;  3QVY A;  2XLM A;  4WGZ A;  5JVE A;  1CGN A;  3QW0 A;  4CDV A;  1YYX A;  1GQA A;  5JT4 A;  4IAQ A;  4U9E A;  2XL6 A;  3C63 A;  2XLH A;  1E85 A;  3ZQV A;  3NMK A;  4ULV A;  1QQ3 A;  2BC5 A;  4N6H A;  3DE8 A;  3M4B A;  1A7V A;  4JE9 A;  4U9D A;  1APC A;  1BBH A;  4CX9 A;  1YZA A;  1CPQ A;  1JAF A;  2XLV A;  2YLD A;  2YLI A;  1CGO A;  4L6R A;  4JEA A;  2YL3 A;  2YLG A;  5JSL A;  3HNI A;  3FOP A;  2YL0 A;  4ER9 A;  1LM3 B;  2CCY A;  1QPU A;  2YL7 A;  2XLE A;  3IQ5 A;  1E83 A;  4CJO A;  5B3I A;  5JP7 A;  4IAR A;  4NC3 A;  4D4X A;  1YZC A;  4D4N A;  3L1M A;  2XM4 A;  256B A;  4CJG A;  5JS5 A;  3HNL A;  2XLD A;  3IQ6 A;  3ZTZ A;  1E84 A;  2YKZ A;  3HNK A;  3C62 A;  3FOO A;  4CDA A;  1NBB A;  4N4W A;  4CDY A;  4WGY A;  2XLW A;  1MQV A;  2J8W A;  3M4C A;  3ZTM A;  1RCP A;  5JUA A;  1M6T A;  3ZQY A;  2XM0 A;  1YYJ A;  3DE9 A;  3M15 A;  3TOL A;  3U8P A;  3ZWI A;  3NMI A;  1CPR A;  1EKY A;  3TOM A;  2J9B A;  5JLI A;  1E86 A;  3M79 A;  3QW1 A;  2XLO A;  2YL1 A;  5AGF A;  2QLA A;  3NMJ A;  3QVZ A;  5JRA A;  2XL8 A;  3VRC A;  4IB4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...