5JLIA

Nitric oxide complex of the l16a mutant of cytochrome c prime from alcaligenes xylosoxidans
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
127
structure length
127
Chain Sequence
EFAKPEDAVKYRQSAATLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c'
publication title Engineering proximal vs. distal heme-NO coordination via dinitrosyl dynamics: implications for NO sensor design.
pubmed doi rcsb
source organism Alcaligenes xylosoxydans xylosoxydans
molecule tags Electron transport
total genus 50
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2016-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 5jliA00
5JSLA 1APCA 4N6HA 1BBHA 4WGYA 5JT4A 2QLAA 3DE8A 2XLWA 4NC3A 3IQ6A 5JP7A 3M79A 4JKVA 5JUAA 3C63A 3DE9A 1E84A 4WGZA 3NMIA 5JS5A 3QVZA 3TOMA 2YKZA 2YLDA 3ZQVA 4CJGA 1YZCA 2YL1A 3M4BA 1JAFA 2YL0A 3NMKA 256BA 3TOLA 2XL8A 3QW0A 1YZAA 3IQ5A 2XLMA 3NMJA 3HNLA 1CGOA 3QW1A 3L1MA 4ULVA 3ZTZA 1CGNA 1YYXA 4CX9A 4IB4A 1E85A 2CCYA 2YL3A 4JEAA 3ZWIA 1E86A 2XLOA 3HNJA 4CDAA 1CPRA 4CDVA 1RCPA 3M4CA 3VRCA 1MQVA 2XL6A 4N4WA 4U9DA 5JRAA 4U9EA 2XM0A 1GQAA 1LM3B 3FOOA 1EKYA 2YLIA 2XLEA 3FOPA 5B3IA 4EIYA 4D4NA 1QQ3A 4IARA 3M15A 4JE9A 1CPQA 3QVYA 4CIPA 2YL7A 1E83A 2XLVA 5AGFA 1M6TA 2YLGA 1NBBA 1YYJA 5JLIA 4CJOA 1A7VA 3U8PA 3ZTMA 2XLHA 2J8WA 1QPUA 2XLDA 3C62A 3HNIA 4D4XA 4JEBA 4IAQA 3HNKA 3ZQYA 4ER9A 4L6RA 2BC5A 2XM4A 2J9BA 4CDYA 5JVEA 1S05A
chains in the Genus database with same CATH superfamily
5JSLA 1LE4A 5F28E 4WGYA 2EPLX 4NC3A 1ZHTA 3IQ6A 3QZCA 3ABLC 2NSGA 4Z9JA 3EGXA 3KH2A 3KKBA 5E2QA 4E7ZA 3C8GB 3RKOF 1J8YF 2GFHA 4JKVA 1WTYA 2QY9A 4LDRA 4XWJA 3MFNA 4EWCA 4JRZA 4WGZA 2DGJA 2PFDA 1D0XA 2B0JA 4OD5A 5EK0A 3NYJA 3S28A 2YRFA 3BRJA 4Q4ZF 4XEVA 1UG7A 5BUOA 1HMOA 3QVZA 3DAGA 4FESA 2YKZA 4MVQA 1OW8A 3E70C 2FFHA 5KYXB 4NTBA 4E7SA 1NU7D 5HV9A 2ASRA 4PFOA 1KNYA 1A0BA 5A6AA 3Q7LA 3LJBA 2XSEA 4XEFA 2DYSC 1JAFA 2EILC 3DJNB 3EG9B 4QDLA 3FAJA 2LCHA 3IQCA 1T5OA 3FAPB 4WABA 3W8IA 4FAPB 3ASNC 1SZIA 5KYUA 4K1OA 2YWAA 4K0DA 4J7TA 3HJCA 3O6XA 3QW0A 2Y3HA 5E3CA 1MMNA 2OU6A 3UMHA 1A41A 2W9YA 3DWWA 3EHMA 2Q9CA 3GM3A 4I44A 4R32A 3X2QC 2J7PD 1Q0MA 3EGXB 3JRTA 3DM5A 3R7CA 1BDJB 2J45A 1C02A 3LUTB 1FTSA 1K40A 2PNOA 4G78A 1YYXA 4XEKA 4PR9A 2KNHA 2WL8A 1PD1A 4XQ1A 2XLOA 1NZEA 2VH3A 1Z23A 4G7HF 4JW1A 1YVIA 4MTFA 5CI9A 2YVKA 2Q9AA 1F1MA 5COGA 3RIPA 3DAFA 3M4CA 2YEVA 4YN0B 2DYRC 4X0RA 2G3KA 2WVOA 3MX3A 3SXZA 3TJ5A 1VLTA 3WHNA 1JR8A 3JZ0A 5JRAA 2A0BA 3ZC4A 3GEEA 2R25A 2E87A 3FHDA 3DD7A 4XPWA 1WOLA 2AVKA 1TWGA 2YLIA 3F47A 2CDQA 3RW0A 4OIRF 1Q0FA 3JYYA 4E17A 4E0HA 5KYYA 3S84A 1C03A 1LS1A 4EIYA 4DXWA 1BR1A 3M15A 4W8PA 1U0BB 3JRMO 1GS9A 5KYUB 3HLZA 1WWPA 3GEIA 5CI8A 1T6QA 3SP1A 3U2LA 1ZW2A 1SF8A 2QNLA 3K1IA 1SYQA 3NKEA 4LERA 3MYIA 1QVXA 2R7OA 2WVQA 3JSEO 4H54A 1QKRA 4YL0A 3LS1A 3EZIA 2J0WA 3RQEA 1RMVA 1LS4A 4U5EE 2NUTA 3GWLA 1OKKD 3U8PA 5DS6A 4MW8A 2LQGA 3H2UA 3NRHA 4KNWA 4LACB 4G7OF 1TKNA 2R02A 3A9CA 2NSFA 2IXNA 1QPUA 5DVWA 5B1AC 1D1CA 4C3BA 2WVNA 3HTKC 3V5XA 3RFYA 3HNIA 3UNGC 2X51A 1D1AA 1LPEA 2C04A 1EQ1A 5BQHA 2AWCA 3V5YA 4EBBA 3LAYA 3B71A 3C8ZA 3AGTA 3IQTA 1FMWA 4CDYA 5KYYB 1WN0A 4BJTA 3H65A 1TFKB 1APCA 3AG3C 3N0TA 1BBHA 4MVUA 1G4US 4YJWA 4IRUA 3ZG1A 4N06A 5K0IA 1JMWA 3Q7GA 3DE8A 2XLWA 3LESA 4YL3A 4GEHA 3EGDA 3FMSA 2Q9BA 1JPNA 5A6KA 2J0XA 3IPMO 3FXHA 3KPHA 3UMKA 5JUAA 1LI5A 4U5HA 1LKXA 4CS8C 5EHHA 2L7AA 1M56C 2Y39A 4G0HA 3B29A 2NUTB 3C18A 3NMIA 4U5FE 4YWQA 3JT1A 4DVYP 2Y3BA 5D92A 3CZ6A 4O6MA 5JS5A 3I5PA 2HZ8A 3JCUQ 1IZMA 3EJNA 4EHPA 3RVYA 2JD3A 4BEMJ 1OCRC 3ZQVA 1V54C 4PK4A 3RH3A 5DS5A 1ZHWA 2OOCA 3I5QA 1M2VA 2KGOA 3O10A 2IBFA 1CGME 4W8KA 2I15A 2XL4A 3VM6A 1H9GA 2YL0A 1Q0GA 3SYNA 3NMKA 3B0VC 4N6CA 2BE5F 1VYKA 1DOVA 3NDBB 1LIHA 1FNTc 2I8BA 2XL8A 2LFFA 3E9VA 3I4UA 1U6HA 2ZXPA 2IYLD 5GPGB 2WB7A 3W2WA 5A6BA 2A69F 1ST6A 2HFIA 2DI3A 2V3CC 4OIOF 3B0UX 3ZVRA 4JJGA 3EGDB 3PMRA 4U5GA 3QW1A 4KNVA 2LIGA 3L1MA 1Z63A 1HW1A 1PV3A 2XS1A 3AG2C 2R7SA 3C8GD 4DBQA 2G62A 2Z15A 2EPNA 3ZTZA 2R7QA 1R5ID 1H6GA 1G4WR 4CX9A 5COFA 4IB4A 4CBEA 3N2ZB 3OA1A 1YDIA 2YL3A 4JEAA 1E86A 3W4YA 1VTMP 3U0CA 2WZLA 3VRCA 2VASA 5A6JA 3C7JA 3G50A 3W8HA 2XL6A 3FVYA 4YT5A 1V55C 2NG1A 4PJLA 4BJ1A 2H7VC 3T6GB 4DOZA 3J06A 1ZW3A 2HSQA 1M2VB 3F46A 4CS9A 4MTGA 1K05A 2C03A 2XLEA 1FR0A 2ZPAA 4YT8A 2P1AA 3HKKA 1QQ3A 4D4NA 1OR3A 1MMAA 4PJNA 2A68F 3EFOA 3G4XA 2EIJC 2YL7A 5L0DA 3B9QA 2EPMX 1E83A 2LP4A 2L6GA 1YARO 4RBNA 4MVMA 2CW0F 4KC9A 2YLGA 3RYLA 1OQCA 2J9WA 2A6EF 1N1CA 2AWYA 3U3FA 4I1OB 5DS4A 4YL1A 2LSEA 3TQOA 4BJ6C 5L0JA 5B3SC 1A7VA 1WASA 3ZTMA 4AE4A 4C3DA 2XLHA 3U5SA 5CIVA 1M2OA 2Q00A 4E0IA 2HV6A 2NPUA 5A69A 2L6FA 1RKCA 2PF4E 3QMKA 1ZVZA 4IWBA 1ZHXA 4AL0A 2FGYA 3ITFA 1OXBA 3T4RA 4I3MA 4IAQA 2W45A 3HNKA 1TQGA 3ZQYA 4L6RA 5T1DB 2M4EA 2R7VA 2JX0A 4MVZA 2BC5A 2IOQA 4PJJA 4BJ5C 3ZDLA 5D91A 2LFDA 2OJED 3PCVA 4MVRA 1MNDA 2H7BA 4AX2A 1H9TA 2MYSA 4AL1A 3DM9B 5JT4A 2OEVA 3GM2A 2QLAA 5L0IA 1OR2A 4M63A 1S7ZA 3LNRA 3OWTA 3EFOB 4ONSA 3SZRA 5F5FA 2BL2A 4XLNF 5JP7A 3ZSUA 1H7IA 1HW2A 4Q7CA 2G3VA 3ZIBA 3WG7C 1PCXA 1E2XA 1L7CA 2GDCA 1DOWA 1U89A 2CNWA 2MHRA 3A11A 2VCBA 4BPMA 5L0GA 5L3VA 2R7WA 4RDAA 4XTKA 1YLMA 4JJFA 4AE4B 2ETSA 4FWVA 3T6BA 2A0UA 3JTLO 1ORYA 3S9OA 3TOMA 1TR2A 3SNHA 4MNDA 4BJ6A 1AUEA 2YLDA 1LI7A 1YZCA 1BR2A 2LD6A 1OCZC 4JTDB 3ABMC 4A4AA 3M1CB 3LS0A 3T9OA 3US6A 3PHF2 5L3QA 3M4BA 1YA7O 3SXYA 4PFPA 3MLGA 3VF0A 2YZSA 1RXQA 2HS5A 2KK1A 2VC9A 2EINC 3G4ZA 1Z7Qc 4JIOA 2OG2A 2Q3TA 3KYJA 2QTVA 5DLJA 4KI2A 4G7ZF 3NYLA 256BA 3GORA 2H8AA 2XXAB 4B6IA 1VMAA 3L8JA 1JPJA 4ZLDA 1MMGA 3NKDA 2XRHA 3R2PA 4DJ9A 4BJ5A 3IQ5A 1D1BA 4HFKB 3AOUA 4ZLCA 1PD0A 2PX3A 4JURI 3U9JA 5FCLA 5L0FA 3Q6MA 1O87A 3AQBA 3NYMA 1LE2A 3T6JA 4YT2A 5DQZA 1O5HA 3K6BA 2LK4A 1V74B 3VAYA 4OIPF 1CGNA 1M57C 4PJMA 2KQ9A 3AG1C 3X1OA 1ZHZA 2J9VA 2J46A 3WODF 1QZXA 2QUPA 1XZQA 3GWNA 2KJGA 3KMIA 4O7GA 4DVZA 4C3EA 4EKWA 4CDAA 3U9MA 2R7TA 4BG0A 4CDVA 1C17M 2KYHA 1T01A 1VYIA 2HJMA 1MQVA 3UMIA 1QLEC 3EHNA 4LLCA 4N4WA 1HMDA 3ATPA 4LDKA 2IM8A 4U9DA 5COMA 3QTHA 2OEXA 5T3WA 4U9EA 2XM0A 3ECSA 1LM3B 3FOOA 1EKYA 2P0NA 3FOPA 1BZ4A 1WATA 1ZHYA 1YA9A 1A7EA 3O55A 5F5HA 4CS7A 5B3IA 2HUJA 4IARA 3AG4C 2X0CA 2J7PA 2EPKX 3B0PA 1CPQA 1AVOB 2L81A 5AC4A 4CIPA 5EGYA 3U8VA 5B1BC 2Y69C 2GWWA 2XLVA 4NTAA 1I4YA 4XPYA 2L9JA 4KBLA 2J9UA 4WJ0A 1M6TA 1Z6AA 1V4AA 5BQIA 1NBBA 1Q0DA 2FAPB 4JC7A 1OCCC 1W2WA 2NUPA 4NCQA 3V7OA 5JLIA 4HE8D 4NY3A 3TD7A 1TWAA 3GANA 4CS8A 2ZXOA 3CEXA 3TJ6A 2R7RA 3S90A 4P6IC 5FZTA 2P6VA 1NU9C 3CSKA 3L8IA 4Z9HA 3GODA 5BQGA 4E18A 1NFOA 4F4BA 2L6HA 3N24A 1B68A 3JSZA 2IXMA 2P61A 3S27A 2A1DD 4NTFA 2JPUA 4YT4A 2EIMC 3TULA 2EPOA 4MVSA 2V26A 1G5ZA 4D4XA 4JEBA 4LLEA 2UUHA 4RD9A 4U5CE 4C7OA 4ER9A 3IHUA 4FX5A 4I1MA 1OXKA 1RJ9A 1TFOB 1OW6A 2WZFA 4YK5A 4CIHA 4DRJB 1A7DA 1L3PA 2J9BA 4HEAJ 1T6IA 4QI2A 1WGWA 3GEHA 2KW3C 3SEOA 5JVEA 2IXPA 4K7BA 1QSPA 3SXMA 3DKAA 3DZAA 3K1HA 1JRAA 1YAUO 2GA0A 3MYFA 4JCZA 4N6HA 4O6NA 2A6HF 2OJQA 2HKVA 3K1IC 4OIQF 3RF3A 3RVZA 5DQTA 2M64A 1OKKA 2MWQA 3M79A 4ANJA 4GYTA 1ORJA 1GM5A 2TMVP 4MQ9F 4P9FA 2P7VA 4ULWA 5TJ5E 2R05A 3C63A 3DE9A 3SXKA 1E84A 2R03A 2NUPB 2PX0A 5A6BD 5KYNA 4XLPF 2R9RB 3Q6NA 2PP4A 3EPVA 4LDQA 4JZAA 5KYWA 5HSWA 3UGPA 1R4TA 1ZU5A 2RSEB 2Y3GA 3EZHA 1D0ZA 1Y6DA 4DBRA 1SR2A 4JVSA 4CJGA 5IY5C 2ZD9A 3CAXA 1J8MF 1O3UA 1K04A 1MMDA 1Z3IX 2YL1A 4JTCB 3KYIA 1UFBA 3U3BA 1T6UA 5L0HA 2XXAA 1ZZPA 2XS8A 2YHSA 1VB5A 4C7OB 4JTAB 2D4UA 2OQMA 3LLKA 3EH2A 4UDVA 3GM1A 1RJ9B 1T9KA 2OKUA 1D0YA 4Z9IA 4MTOA 5AC5A 1TWHA 1FFTC 1NSGB 5E33A 3DMDA 4U5DE 3NG1A 2UUIA 3TOLA 1BR4A 1RKEA 1VLSA 2DB4A 2W4BA 1NG1A 3AGUA 1AEPA 3RQGA 4OD4A 1ORSC 1YZAA 3S29A 2W4MA 2OCCC 3DJUB 2XLMA 3CQZA 1NFNA 3NMJA 1YJGA 3HNLA 1EI7A 4JCHA 4MW3A 2KSFA 4J30B 2WZGA 3LEOA 1CGOA 4IJJA 4PACA 1ZU4A 1HE1A 3DI5A 4DRIB 4ULVA 3BEHA 4A2NB 4EUKB 1Y4CA 1JOGA 1TWCA 2CGEA 3L0IA 5L0CA 2HV7A 3W2VA 1E85A 1VK5A 2CCYA 1FFHA 2AU5A 2VB6A 3ZWIA 5KYWB 3PDMP 3HNJA 1I4ZA 4MS2A 4CSAC 2Y3DA 1CPRA 2HSBA 3EQLF 4MVOA 3O39A 3FDQA 1RCPA 4J7YA 2HMZA 2VCAA 3K66A 3JYHA 3LEVA 3K33A 1IW7F 2ICWG 3V5ZA 1EA8A 1SMYF 4J32B 5E3AA 3U2MA 1GQAA 1KU2A 2YQYA 1OW7A 4O79A 2KC3A 3LNMB 4BEJA 2EIKC 2H7OA 3H2VA 2RD9A 1OCOC 3UR3C 4JE9A 5T3TA 3QVYA 1RKEB 3WAQA 4IGGA 2CYDA 3C8GA 5AGFA 2Q7RA 1I5NA 1Z5ZA 1NLXA 2AP3A 2HMQA 1YYJA 2ZXWC 2D5RB 3KL4A 4P9TA 4QI0A 3TK0A 4CJOA 2R7XA 1VOMA 2B0HA 1KTMA 4HFFB 4XPXA 1FAPB 2QE9A 4NQFA 3MBGA 3RQFA 1FMVA 4DRHB 3K7DA 3OEOA 2GAQA 4O6YA 3VYWA 4GQHA 4AK9A 1Q0KA 3S0XA 2J8WA 1G8XA 2F22A 1GGQA 2CNWD 2IXOA 3AQCA 5KYXA 3UGOA 3ASOC 4Q5SF 1XWJA 2XLDA 1XZPA 3EH1A 4EBJA 4H4KC 2O9XA 4EBKA 1LVKA 3C62A 4IAOA 3LLIA 3POVA 2PBEA 2Q4FA 3IEEA 3EG9A 2VCCA 3ABKC 4U5BE 4CS9C 4CSAA 3L34A 1MNEA 2XM4A 4OINF 1HY5A 1ZYRF 3AJMA 2R7UA 2ZXRA 3DXJF 2HJ3A 1HE9A 1S05A
chains in the Genus database with same CATH topology
5JSLA 1APCA 4N6HA 1BBHA 4WGYA 5JT4A 2QLAA 3DE8A 2XLWA 4NC3A 3IQ6A 5JP7A 3M79A 4JKVA 5JUAA 3C63A 3DE9A 1E84A 4WGZA 3NMIA 5JS5A 3QVZA 3TOMA 2YKZA 2YLDA 3ZQVA 4CJGA 1YZCA 2YL1A 3M4BA 1JAFA 2YL0A 3NMKA 256BA 3TOLA 2XL8A 3QW0A 1YZAA 3IQ5A 2XLMA 3NMJA 3HNLA 1CGOA 3QW1A 3L1MA 4ULVA 3ZTZA 1CGNA 1YYXA 4CX9A 4IB4A 1E85A 2CCYA 2YL3A 4JEAA 3ZWIA 1E86A 2XLOA 3HNJA 4CDAA 1CPRA 4CDVA 1RCPA 3M4CA 3VRCA 1MQVA 2XL6A 4N4WA 4U9DA 5JRAA 4U9EA 2XM0A 1GQAA 1LM3B 3FOOA 1EKYA 2YLIA 2XLEA 3FOPA 5B3IA 4EIYA 4D4NA 1QQ3A 4IARA 3M15A 4JE9A 1CPQA 3QVYA 4CIPA 2YL7A 1E83A 2XLVA 5AGFA 1M6TA 2YLGA 1NBBA 1YYJA 5JLIA 4CJOA 1A7VA 3U8PA 3ZTMA 2XLHA 2J8WA 1QPUA 2XLDA 3C62A 3HNIA 4D4XA 4JEBA 4IAQA 3HNKA 3ZQYA 4ER9A 4L6RA 2BC5A 2XM4A 2J9BA 4CDYA 5JVEA 1S05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JSL A;  1APC A;  4N6H A;  1BBH A;  4WGY A;  5JT4 A;  2QLA A;  3DE8 A;  2XLW A;  4NC3 A;  3IQ6 A;  5JP7 A;  3M79 A;  4JKV A;  5JUA A;  3C63 A;  3DE9 A;  1E84 A;  4WGZ A;  3NMI A;  5JS5 A;  3QVZ A;  3TOM A;  2YKZ A;  2YLD A;  3ZQV A;  4CJG A;  1YZC A;  2YL1 A;  3M4B A;  1JAF A;  2YL0 A;  3NMK A;  256B A;  3TOL A;  2XL8 A;  3QW0 A;  1YZA A;  3IQ5 A;  2XLM A;  3NMJ A;  3HNL A;  1CGO A;  3QW1 A;  3L1M A;  4ULV A;  3ZTZ A;  1CGN A;  1YYX A;  4CX9 A;  4IB4 A;  1E85 A;  2CCY A;  2YL3 A;  4JEA A;  3ZWI A;  1E86 A;  2XLO A;  3HNJ A;  4CDA A;  1CPR A;  4CDV A;  1RCP A;  3M4C A;  3VRC A;  1MQV A;  2XL6 A;  4N4W A;  4U9D A;  5JRA A;  4U9E A;  2XM0 A;  1GQA A;  1LM3 B;  3FOO A;  1EKY A;  2YLI A;  2XLE A;  3FOP A;  5B3I A;  4EIY A;  4D4N A;  1QQ3 A;  4IAR A;  3M15 A;  4JE9 A;  1CPQ A;  3QVY A;  4CIP A;  2YL7 A;  1E83 A;  2XLV A;  5AGF A;  1M6T A;  2YLG A;  1NBB A;  1YYJ A;  5JLI A;  4CJO A;  1A7V A;  3U8P A;  3ZTM A;  2XLH A;  2J8W A;  1QPU A;  2XLD A;  3C62 A;  3HNI A;  4D4X A;  4JEB A;  4IAQ A;  3HNK A;  3ZQY A;  4ER9 A;  4L6R A;  2BC5 A;  2XM4 A;  2J9B A;  4CDY A;  5JVE A;  1S05 A; 
#chains in the Genus database with same CATH topology
 5JSL A;  1LE4 A;  5F28 E;  4WGY A;  2EPL X;  4NC3 A;  1ZHT A;  3IQ6 A;  3QZC A;  3ABL C;  2NSG A;  4Z9J A;  3EGX A;  3KH2 A;  3KKB A;  5E2Q A;  4E7Z A;  3C8G B;  3RKO F;  1J8Y F;  2GFH A;  4JKV A;  1WTY A;  2QY9 A;  4LDR A;  4XWJ A;  3MFN A;  4EWC A;  4JRZ A;  4WGZ A;  2DGJ A;  2PFD A;  1D0X A;  2B0J A;  4OD5 A;  5EK0 A;  3NYJ A;  3S28 A;  2YRF A;  3BRJ A;  4Q4Z F;  4XEV A;  1UG7 A;  5BUO A;  1HMO A;  3QVZ A;  3DAG A;  4FES A;  2YKZ A;  4MVQ A;  1OW8 A;  3E70 C;  2FFH A;  5KYX B;  4NTB A;  4E7S A;  1NU7 D;  5HV9 A;  2ASR A;  4PFO A;  1KNY A;  1A0B A;  5A6A A;  3Q7L A;  3LJB A;  2XSE A;  4XEF A;  2DYS C;  1JAF A;  2EIL C;  3DJN B;  3EG9 B;  4QDL A;  3FAJ A;  2LCH A;  3IQC A;  1T5O A;  3FAP B;  4WAB A;  3W8I A;  4FAP B;  3ASN C;  1SZI A;  5KYU A;  4K1O A;  2YWA A;  4K0D A;  4J7T A;  3HJC A;  3O6X A;  3QW0 A;  2Y3H A;  5E3C A;  1MMN A;  2OU6 A;  3UMH A;  1A41 A;  2W9Y A;  3DWW A;  3EHM A;  2Q9C A;  3GM3 A;  4I44 A;  4R32 A;  3X2Q C;  2J7P D;  1Q0M A;  3EGX B;  3JRT A;  3DM5 A;  3R7C A;  1BDJ B;  2J45 A;  1C02 A;  3LUT B;  1FTS A;  1K40 A;  2PNO A;  4G78 A;  1YYX A;  4XEK A;  4PR9 A;  2KNH A;  2WL8 A;  1PD1 A;  4XQ1 A;  2XLO A;  1NZE A;  2VH3 A;  1Z23 A;  4G7H F;  4JW1 A;  1YVI A;  4MTF A;  5CI9 A;  2YVK A;  2Q9A A;  1F1M A;  5COG A;  3RIP A;  3DAF A;  3M4C A;  2YEV A;  4YN0 B;  2DYR C;  4X0R A;  2G3K A;  2WVO A;  3MX3 A;  3SXZ A;  3TJ5 A;  1VLT A;  3WHN A;  1JR8 A;  3JZ0 A;  5JRA A;  2A0B A;  3ZC4 A;  3GEE A;  2R25 A;  2E87 A;  3FHD A;  3DD7 A;  4XPW A;  1WOL A;  2AVK A;  1TWG A;  2YLI A;  3F47 A;  2CDQ A;  3RW0 A;  4OIR F;  1Q0F A;  3JYY A;  4E17 A;  4E0H A;  5KYY A;  3S84 A;  1C03 A;  1LS1 A;  4EIY A;  4DXW A;  1BR1 A;  3M15 A;  4W8P A;  1U0B B;  3JRM O;  1GS9 A;  5KYU B;  3HLZ A;  1WWP A;  3GEI A;  5CI8 A;  1T6Q A;  3SP1 A;  3U2L A;  1ZW2 A;  1SF8 A;  2QNL A;  3K1I A;  1SYQ A;  3NKE A;  4LER A;  3MYI A;  1QVX A;  2R7O A;  2WVQ A;  3JSE O;  4H54 A;  1QKR A;  4YL0 A;  3LS1 A;  3EZI A;  2J0W A;  3RQE A;  1RMV A;  1LS4 A;  4U5E E;  2NUT A;  3GWL A;  1OKK D;  3U8P A;  5DS6 A;  4MW8 A;  2LQG A;  3H2U A;  3NRH A;  4KNW A;  4LAC B;  4G7O F;  1TKN A;  2R02 A;  3A9C A;  2NSF A;  2IXN A;  1QPU A;  5DVW A;  5B1A C;  1D1C A;  4C3B A;  2WVN A;  3HTK C;  3V5X A;  3RFY A;  3HNI A;  3UNG C;  2X51 A;  1D1A A;  1LPE A;  2C04 A;  1EQ1 A;  5BQH A;  2AWC A;  3V5Y A;  4EBB A;  3LAY A;  3B71 A;  3C8Z A;  3AGT A;  3IQT A;  1FMW A;  4CDY A;  5KYY B;  1WN0 A;  4BJT A;  3H65 A;  1TFK B;  1APC A;  3AG3 C;  3N0T A;  1BBH A;  4MVU A;  1G4U S;  4YJW A;  4IRU A;  3ZG1 A;  4N06 A;  5K0I A;  1JMW A;  3Q7G A;  3DE8 A;  2XLW A;  3LES A;  4YL3 A;  4GEH A;  3EGD A;  3FMS A;  2Q9B A;  1JPN A;  5A6K A;  2J0X A;  3IPM O;  3FXH A;  3KPH A;  3UMK A;  5JUA A;  1LI5 A;  4U5H A;  1LKX A;  4CS8 C;  5EHH A;  2L7A A;  1M56 C;  2Y39 A;  4G0H A;  3B29 A;  2NUT B;  3C18 A;  3NMI A;  4U5F E;  4YWQ A;  3JT1 A;  4DVY P;  2Y3B A;  5D92 A;  3CZ6 A;  4O6M A;  5JS5 A;  3I5P A;  2HZ8 A;  3JCU Q;  1IZM A;  3EJN A;  4EHP A;  3RVY A;  2JD3 A;  4BEM J;  1OCR C;  3ZQV A;  1V54 C;  4PK4 A;  3RH3 A;  5DS5 A;  1ZHW A;  2OOC A;  3I5Q A;  1M2V A;  2KGO A;  3O10 A;  2IBF A;  1CGM E;  4W8K A;  2I15 A;  2XL4 A;  3VM6 A;  1H9G A;  2YL0 A;  1Q0G A;  3SYN A;  3NMK A;  3B0V C;  4N6C A;  2BE5 F;  1VYK A;  1DOV A;  3NDB B;  1LIH A;  1FNT c;  2I8B A;  2XL8 A;  2LFF A;  3E9V A;  3I4U A;  1U6H A;  2ZXP A;  2IYL D;  5GPG B;  2WB7 A;  3W2W A;  5A6B A;  2A69 F;  1ST6 A;  2HFI A;  2DI3 A;  2V3C C;  4OIO F;  3B0U X;  3ZVR A;  4JJG A;  3EGD B;  3PMR A;  4U5G A;  3QW1 A;  4KNV A;  2LIG A;  3L1M A;  1Z63 A;  1HW1 A;  1PV3 A;  2XS1 A;  3AG2 C;  2R7S A;  3C8G D;  4DBQ A;  2G62 A;  2Z15 A;  2EPN A;  3ZTZ A;  2R7Q A;  1R5I D;  1H6G A;  1G4W R;  4CX9 A;  5COF A;  4IB4 A;  4CBE A;  3N2Z B;  3OA1 A;  1YDI A;  2YL3 A;  4JEA A;  1E86 A;  3W4Y A;  1VTM P;  3U0C A;  2WZL A;  3VRC A;  2VAS A;  5A6J A;  3C7J A;  3G50 A;  3W8H A;  2XL6 A;  3FVY A;  4YT5 A;  1V55 C;  2NG1 A;  4PJL A;  4BJ1 A;  2H7V C;  3T6G B;  4DOZ A;  3J06 A;  1ZW3 A;  2HSQ A;  1M2V B;  3F46 A;  4CS9 A;  4MTG A;  1K05 A;  2C03 A;  2XLE A;  1FR0 A;  2ZPA A;  4YT8 A;  2P1A A;  3HKK A;  1QQ3 A;  4D4N A;  1OR3 A;  1MMA A;  4PJN A;  2A68 F;  3EFO A;  3G4X A;  2EIJ C;  2YL7 A;  5L0D A;  3B9Q A;  2EPM X;  1E83 A;  2LP4 A;  2L6G A;  1YAR O;  4RBN A;  4MVM A;  2CW0 F;  4KC9 A;  2YLG A;  3RYL A;  1OQC A;  2J9W A;  2A6E F;  1N1C A;  2AWY A;  3U3F A;  4I1O B;  5DS4 A;  4YL1 A;  2LSE A;  3TQO A;  4BJ6 C;  5L0J A;  5B3S C;  1A7V A;  1WAS A;  3ZTM A;  4AE4 A;  4C3D A;  2XLH A;  3U5S A;  5CIV A;  1M2O A;  2Q00 A;  4E0I A;  2HV6 A;  2NPU A;  5A69 A;  2L6F A;  1RKC A;  2PF4 E;  3QMK A;  1ZVZ A;  4IWB A;  1ZHX A;  4AL0 A;  2FGY A;  3ITF A;  1OXB A;  3T4R A;  4I3M A;  4IAQ A;  2W45 A;  3HNK A;  1TQG A;  3ZQY A;  4L6R A;  5T1D B;  2M4E A;  2R7V A;  2JX0 A;  4MVZ A;  2BC5 A;  2IOQ A;  4PJJ A;  4BJ5 C;  3ZDL A;  5D91 A;  2LFD A;  2OJE D;  3PCV A;  4MVR A;  1MND A;  2H7B A;  4AX2 A;  1H9T A;  2MYS A;  4AL1 A;  3DM9 B;  5JT4 A;  2OEV A;  3GM2 A;  2QLA A;  5L0I A;  1OR2 A;  4M63 A;  1S7Z A;  3LNR A;  3OWT A;  3EFO B;  4ONS A;  3SZR A;  5F5F A;  2BL2 A;  4XLN F;  5JP7 A;  3ZSU A;  1H7I A;  1HW2 A;  4Q7C A;  2G3V A;  3ZIB A;  3WG7 C;  1PCX A;  1E2X A;  1L7C A;  2GDC A;  1DOW A;  1U89 A;  2CNW A;  2MHR A;  3A11 A;  2VCB A;  4BPM A;  5L0G A;  5L3V A;  2R7W A;  4RDA A;  4XTK A;  1YLM A;  4JJF A;  4AE4 B;  2ETS A;  4FWV A;  3T6B A;  2A0U A;  3JTL O;  1ORY A;  3S9O A;  3TOM A;  1TR2 A;  3SNH A;  4MND A;  4BJ6 A;  1AUE A;  2YLD A;  1LI7 A;  1YZC A;  1BR2 A;  2LD6 A;  1OCZ C;  4JTD B;  3ABM C;  4A4A A;  3M1C B;  3LS0 A;  3T9O A;  3US6 A;  3PHF 2;  5L3Q A;  3M4B A;  1YA7 O;  3SXY A;  4PFP A;  3MLG A;  3VF0 A;  2YZS A;  1RXQ A;  2HS5 A;  2KK1 A;  2VC9 A;  2EIN C;  3G4Z A;  1Z7Q c;  4JIO A;  2OG2 A;  2Q3T A;  3KYJ A;  2QTV A;  5DLJ A;  4KI2 A;  4G7Z F;  3NYL A;  256B A;  3GOR A;  2H8A A;  2XXA B;  4B6I A;  1VMA A;  3L8J A;  1JPJ A;  4ZLD A;  1MMG A;  3NKD A;  2XRH A;  3R2P A;  4DJ9 A;  4BJ5 A;  3IQ5 A;  1D1B A;  4HFK B;  3AOU A;  4ZLC A;  1PD0 A;  2PX3 A;  4JUR I;  3U9J A;  5FCL A;  5L0F A;  3Q6M A;  1O87 A;  3AQB A;  3NYM A;  1LE2 A;  3T6J A;  4YT2 A;  5DQZ A;  1O5H A;  3K6B A;  2LK4 A;  1V74 B;  3VAY A;  4OIP F;  1CGN A;  1M57 C;  4PJM A;  2KQ9 A;  3AG1 C;  3X1O A;  1ZHZ A;  2J9V A;  2J46 A;  3WOD F;  1QZX A;  2QUP A;  1XZQ A;  3GWN A;  2KJG A;  3KMI A;  4O7G A;  4DVZ A;  4C3E A;  4EKW A;  4CDA A;  3U9M A;  2R7T A;  4BG0 A;  4CDV A;  1C17 M;  2KYH A;  1T01 A;  1VYI A;  2HJM A;  1MQV A;  3UMI A;  1QLE C;  3EHN A;  4LLC A;  4N4W A;  1HMD A;  3ATP A;  4LDK A;  2IM8 A;  4U9D A;  5COM A;  3QTH A;  2OEX A;  5T3W A;  4U9E A;  2XM0 A;  3ECS A;  1LM3 B;  3FOO A;  1EKY A;  2P0N A;  3FOP A;  1BZ4 A;  1WAT A;  1ZHY A;  1YA9 A;  1A7E A;  3O55 A;  5F5H A;  4CS7 A;  5B3I A;  2HUJ A;  4IAR A;  3AG4 C;  2X0C A;  2J7P A;  2EPK X;  3B0P A;  1CPQ A;  1AVO B;  2L81 A;  5AC4 A;  4CIP A;  5EGY A;  3U8V A;  5B1B C;  2Y69 C;  2GWW A;  2XLV A;  4NTA A;  1I4Y A;  4XPY A;  2L9J A;  4KBL A;  2J9U A;  4WJ0 A;  1M6T A;  1Z6A A;  1V4A A;  5BQI A;  1NBB A;  1Q0D A;  2FAP B;  4JC7 A;  1OCC C;  1W2W A;  2NUP A;  4NCQ A;  3V7O A;  5JLI A;  4HE8 D;  4NY3 A;  3TD7 A;  1TWA A;  3GAN A;  4CS8 A;  2ZXO A;  3CEX A;  3TJ6 A;  2R7R A;  3S90 A;  4P6I C;  5FZT A;  2P6V A;  1NU9 C;  3CSK A;  3L8I A;  4Z9H A;  3GOD A;  5BQG A;  4E18 A;  1NFO A;  4F4B A;  2L6H A;  3N24 A;  1B68 A;  3JSZ A;  2IXM A;  2P61 A;  3S27 A;  2A1D D;  4NTF A;  2JPU A;  4YT4 A;  2EIM C;  3TUL A;  2EPO A;  4MVS A;  2V26 A;  1G5Z A;  4D4X A;  4JEB A;  4LLE A;  2UUH A;  4RD9 A;  4U5C E;  4C7O A;  4ER9 A;  3IHU A;  4FX5 A;  4I1M A;  1OXK A;  1RJ9 A;  1TFO B;  1OW6 A;  2WZF A;  4YK5 A;  4CIH A;  4DRJ B;  1A7D A;  1L3P A;  2J9B A;  4HEA J;  1T6I A;  4QI2 A;  1WGW A;  3GEH A;  2KW3 C;  3SEO A;  5JVE A;  2IXP A;  4K7B A;  1QSP A;  3SXM A;  3DKA A;  3DZA A;  3K1H A;  1JRA A;  1YAU O;  2GA0 A;  3MYF A;  4JCZ A;  4N6H A;  4O6N A;  2A6H F;  2OJQ A;  2HKV A;  3K1I C;  4OIQ F;  3RF3 A;  3RVZ A;  5DQT A;  2M64 A;  1OKK A;  2MWQ A;  3M79 A;  4ANJ A;  4GYT A;  1ORJ A;  1GM5 A;  2TMV P;  4MQ9 F;  4P9F A;  2P7V A;  4ULW A;  5TJ5 E;  2R05 A;  3C63 A;  3DE9 A;  3SXK A;  1E84 A;  2R03 A;  2NUP B;  2PX0 A;  5A6B D;  5KYN A;  4XLP F;  2R9R B;  3Q6N A;  2PP4 A;  3EPV A;  4LDQ A;  4JZA A;  5KYW A;  5HSW A;  3UGP A;  1R4T A;  1ZU5 A;  2RSE B;  2Y3G A;  3EZH A;  1D0Z A;  1Y6D A;  4DBR A;  1SR2 A;  4JVS A;  4CJG A;  5IY5 C;  2ZD9 A;  3CAX A;  1J8M F;  1O3U A;  1K04 A;  1MMD A;  1Z3I X;  2YL1 A;  4JTC B;  3KYI A;  1UFB A;  3U3B A;  1T6U A;  5L0H A;  2XXA A;  1ZZP A;  2XS8 A;  2YHS A;  1VB5 A;  4C7O B;  4JTA B;  2D4U A;  2OQM A;  3LLK A;  3EH2 A;  4UDV A;  3GM1 A;  1RJ9 B;  1T9K A;  2OKU A;  1D0Y A;  4Z9I A;  4MTO A;  5AC5 A;  1TWH A;  1FFT C;  1NSG B;  5E33 A;  3DMD A;  4U5D E;  3NG1 A;  2UUI A;  3TOL A;  1BR4 A;  1RKE A;  1VLS A;  2DB4 A;  2W4B A;  1NG1 A;  3AGU A;  1AEP A;  3RQG A;  4OD4 A;  1ORS C;  1YZA A;  3S29 A;  2W4M A;  2OCC C;  3DJU B;  2XLM A;  3CQZ A;  1NFN A;  3NMJ A;  1YJG A;  3HNL A;  1EI7 A;  4JCH A;  4MW3 A;  2KSF A;  4J30 B;  2WZG A;  3LEO A;  1CGO A;  4IJJ A;  4PAC A;  1ZU4 A;  1HE1 A;  3DI5 A;  4DRI B;  4ULV A;  3BEH A;  4A2N B;  4EUK B;  1Y4C A;  1JOG A;  1TWC A;  2CGE A;  3L0I A;  5L0C A;  2HV7 A;  3W2V A;  1E85 A;  1VK5 A;  2CCY A;  1FFH A;  2AU5 A;  2VB6 A;  3ZWI A;  5KYW B;  3PDM P;  3HNJ A;  1I4Z A;  4MS2 A;  4CSA C;  2Y3D A;  1CPR A;  2HSB A;  3EQL F;  4MVO A;  3O39 A;  3FDQ A;  1RCP A;  4J7Y A;  2HMZ A;  2VCA A;  3K66 A;  3JYH A;  3LEV A;  3K33 A;  1IW7 F;  2ICW G;  3V5Z A;  1EA8 A;  1SMY F;  4J32 B;  5E3A A;  3U2M A;  1GQA A;  1KU2 A;  2YQY A;  1OW7 A;  4O79 A;  2KC3 A;  3LNM B;  4BEJ A;  2EIK C;  2H7O A;  3H2V A;  2RD9 A;  1OCO C;  3UR3 C;  4JE9 A;  5T3T A;  3QVY A;  1RKE B;  3WAQ A;  4IGG A;  2CYD A;  3C8G A;  5AGF A;  2Q7R A;  1I5N A;  1Z5Z A;  1NLX A;  2AP3 A;  2HMQ A;  1YYJ A;  2ZXW C;  2D5R B;  3KL4 A;  4P9T A;  4QI0 A;  3TK0 A;  4CJO A;  2R7X A;  1VOM A;  2B0H A;  1KTM A;  4HFF B;  4XPX A;  1FAP B;  2QE9 A;  4NQF A;  3MBG A;  3RQF A;  1FMV A;  4DRH B;  3K7D A;  3OEO A;  2GAQ A;  4O6Y A;  3VYW A;  4GQH A;  4AK9 A;  1Q0K A;  3S0X A;  2J8W A;  1G8X A;  2F22 A;  1GGQ A;  2CNW D;  2IXO A;  3AQC A;  5KYX A;  3UGO A;  3ASO C;  4Q5S F;  1XWJ A;  2XLD A;  1XZP A;  3EH1 A;  4EBJ A;  4H4K C;  2O9X A;  4EBK A;  1LVK A;  3C62 A;  4IAO A;  3LLI A;  3POV A;  2PBE A;  2Q4F A;  3IEE A;  3EG9 A;  2VCC A;  3ABK C;  4U5B E;  4CS9 C;  4CSA A;  3L34 A;  1MNE A;  2XM4 A;  4OIN F;  1HY5 A;  1ZYR F;  3AJM A;  2R7U A;  2ZXR A;  3DXJ F;  2HJ3 A;  1HE9 A;  1S05 A; 
#chains in the Genus database with same CATH homology
 5JSL A;  1APC A;  4N6H A;  1BBH A;  4WGY A;  5JT4 A;  2QLA A;  3DE8 A;  2XLW A;  4NC3 A;  3IQ6 A;  5JP7 A;  3M79 A;  4JKV A;  5JUA A;  3C63 A;  3DE9 A;  1E84 A;  4WGZ A;  3NMI A;  5JS5 A;  3QVZ A;  3TOM A;  2YKZ A;  2YLD A;  3ZQV A;  4CJG A;  1YZC A;  2YL1 A;  3M4B A;  1JAF A;  2YL0 A;  3NMK A;  256B A;  3TOL A;  2XL8 A;  3QW0 A;  1YZA A;  3IQ5 A;  2XLM A;  3NMJ A;  3HNL A;  1CGO A;  3QW1 A;  3L1M A;  4ULV A;  3ZTZ A;  1CGN A;  1YYX A;  4CX9 A;  4IB4 A;  1E85 A;  2CCY A;  2YL3 A;  4JEA A;  3ZWI A;  1E86 A;  2XLO A;  3HNJ A;  4CDA A;  1CPR A;  4CDV A;  1RCP A;  3M4C A;  3VRC A;  1MQV A;  2XL6 A;  4N4W A;  4U9D A;  5JRA A;  4U9E A;  2XM0 A;  1GQA A;  1LM3 B;  3FOO A;  1EKY A;  2YLI A;  2XLE A;  3FOP A;  5B3I A;  4EIY A;  4D4N A;  1QQ3 A;  4IAR A;  3M15 A;  4JE9 A;  1CPQ A;  3QVY A;  4CIP A;  2YL7 A;  1E83 A;  2XLV A;  5AGF A;  1M6T A;  2YLG A;  1NBB A;  1YYJ A;  5JLI A;  4CJO A;  1A7V A;  3U8P A;  3ZTM A;  2XLH A;  2J8W A;  1QPU A;  2XLD A;  3C62 A;  3HNI A;  4D4X A;  4JEB A;  4IAQ A;  3HNK A;  3ZQY A;  4ER9 A;  4L6R A;  2BC5 A;  2XM4 A;  2J9B A;  4CDY A;  5JVE A;  1S05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...