5JLIA

Nitric oxide complex of the l16a mutant of cytochrome c prime from alcaligenes xylosoxidans
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
127
structure length
127
Chain Sequence
EFAKPEDAVKYRQSAATLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Cytochrome c'
publication title Engineering proximal vs. distal heme-NO coordination via dinitrosyl dynamics: implications for NO sensor design.
pubmed doi rcsb
source organism Alcaligenes xylosoxydans xylosoxydans
total genus 50
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2016-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 5jliA00
3IQ5A 2XLWA 3L1MA 1RCPA 4N6HA 3FOPA 4CX9A 2XLVA 2XM4A 5JSLA 4JEAA 5AGFA 3M4CA 1QQ3A 3QW0A 1JAFA 4EIYA 1YYXA 2XLHA 1EKYA 1LM3B 3ZTMA 3IQ6A 3VRCA 4L6RA 2YLDA 1CPRA 2J8WA 3NMJA 4WGYA 3ZQYA 5JP7A 2XLMA 2YL3A 3FOOA 4U9EA 3QVYA 2CCYA 4CIPA 3NMIA 5JLIA 3ZQVA 3DE9A 2XL6A 3HNKA 3U8PA 2XLDA 1CPQA 3NMKA 3C62A 1YZCA 1S05A 1NBBA 4N4WA 3M15A 3M4BA 1E85A 3DE8A 1E86A 1A7VA 1YZAA 4WGZA 1MQVA 5JRAA 4IAQA 5JVEA 5B3IA 2YKZA 4U9DA 2J9BA 2YL1A 3C63A 3ZTZA 2XLEA 2XM0A 1E84A 4D4XA 3QVZA 4CDAA 1CGNA 4IARA 2YLIA 2BC5A 4JEBA 3HNJA 2XLOA 1YYJA 4CDYA 256BA 3TOLA 4CJOA 4NC3A 4CDVA 4CJGA 2YL0A 4ER9A 4D4NA 2QLAA 4IB4A 1GQAA 2YL7A 3ZWIA 5JS5A 1M6TA 2YLGA 4JKVA 5JT4A 1E83A 1BBHA 3M79A 4JE9A 2XL8A 1QPUA 4ULVA 1CGOA 3TOMA 3HNLA 3QW1A 3HNIA 5JUAA 1APCA
chains in the Genus database with same CATH superfamily
3SNHA 2BE5F 3PCVA 4Z9IA 1M56C 1YA9A 3RH3A 2DGJA 1GGQA 2MWQA 4LLCA 2ASRA 2LFDA 4H54A 4EBKA 3FOPA 4CX9A 1MMDA 1WN0A 2WVQA 3E70C 5JSLA 4BG0A 4BJ5A 4JJFA 2A68F 4Q5SF 1M57C 3O55A 5FCLA 4QI0A 5EHHA 4MVSA 2EIJC 3DM5A 3AG3C 2ZPAA 3ZG1A 1M2VA 1U0BB 1YAUO 3GANA 3RKOF 2QUPA 1YYXA 1NG1A 2WL8A 1HMDA 2OEVA 2MYSA 2Y3HA 1QLEC 2R7XA 5KYUA 2DB4A 4XEKA 3DWWA 4JRZA 4U5CE 3VRCA 5CIVA 3CSKA 3O39A 3FXHA 1RKCA 3NMJA 3S9OA 3U2MA 3JSEO 2EPOA 4N6CA 4XEFA 3U9MA 3US6A 3ZQYA 4DOZA 2HSQA 5T3WA 4I1MA 5D92A 2CCYA 3GORA 3H2VA 4XWJA 3NYLA 1HMOA 5A69A 4QI2A 1IZMA 1MNDA 3T6GB 2W4BA 1B68A 1MMAA 2IYLD 2XS1A 3ZQVA 1T6IA 5IY5C 3EFOA 3FAJA 3O6XA 3RVYA 2J7PA 3B9QA 5L0HA 5KYXA 1TWCA 1SF8A 3KPHA 3U8PA 3VF0A 1CPQA 3HKKA 2VC9A 2XRHA 1HW1A 3NMKA 1OW6A 5E2QA 2XS8A 1WASA 3V5YA 5A6BA 1YZCA 2I8BA 2J46A 1H9GA 2C03A 3RQGA 3M15A 4Q7CA 1Q0KA 4YL0A 4MTOA 4MS2A 3JYYA 3AGTA 4J30B 5L3QA 1Z6AA 3RF3A 3U0CA 1ZHXA 2CNWD 4KI2A 1NFNA 4ULWA 2E87A 4GQHA 1JPNA 1WGWA 1YVIA 2A69F 2J9WA 4IAQA 2YVKA 5JVEA 4QDLA 3C8ZA 3LNRA 3SXZA 3NDBB 2OQMA 4O6YA 5BQGA 4RD9A 2J9BA 2YL1A 2IXOA 1D1BA 3ZTZA 4NCQA 3W2VA 3S84A 2R05A 2B0HA 5K0IA 2A6EF 4C3EA 3ABLC 4IWBA 1A7DA 3GM1A 3VYWA 2OG2A 3S90A 3JCUQ 2P61A 4JW1A 2Q4FA 3JYHA 3W4YA 3I5QA 1OR3A 3MYFA 1SZIA 1K40A 2HS5A 5BQHA 4HE8D 3Q7GA 1Z7Qc 3LEOA 2PX3A 1XZQA 1OKKD 3DJUB 3GODA 3LNMB 1LE4A 2HV6A 1KNYA 2Q7RA 3JSZA 1E2XA 3RQFA 3TOLA 3U5SA 4C7OA 1RKEB 4CDVA 3EGDB 4PFPA 4OIRF 1YA7O 3AQBA 5HSWA 1FAPB 4WABA 4NTFA 4U5EE 4A2NB 2IBFA 4D4NA 4IB4A 4OD4A 2ZD9A 1EI7A 1Q0FA 2YRFA 3ZWIA 3C18A 4JCZA 5A6AA 1MMNA 3L0IA 1M6TA 3AG1C 3MYIA 3FVYA 4X0RA 5GPGB 5JS5A 1OW7A 1C03A 3DAGA 3QZCA 1E83A 1N1CA 1RJ9A 3G4ZA 3BEHA 3BRJA 1S7ZA 1LPEA 2XL8A 4K1OA 3DAFA 4XEVA 4HFFB 4C7OB 2GWWA 3TOMA 3WAQA 3N24A 4JC7A 5F28E 5L3VA 1YJGA 5JUAA 3TULA 4P9TA 5E3AA 3UGOA 2Y3DA 3EG9B 4PFOA 4LDRA 4LDQA 4DRJB 2VH3A 2DI3A 3L1MA 4O6MA 2HV7A 2Q9AA 5L0DA 3F46A 2O9XA 3GWNA 4G7ZF 4N6HA 4XPXA 3T4RA 2XXAB 1KU2A 2XM4A 3TQOA 2A6HF 1JRAA 3LLIA 2LIGA 3I4UA 2L7AA 1DOWA 3M4CA 1OKKA 3FDQA 1Z63A 1VK5A 2M64A 3DJNB 4EUKB 5E33A 3T6JA 1GS9A 1SMYF 3B0UX 2ZXPA 4ZLDA 4DJ9A 3RYLA 4CSAC 4R32A 2Q00A 1TQGA 2YEVA 1EKYA 3DZAA 1MMGA 2RSEB 3KYJA 2Q9CA 1LM3B 1NFOA 3LS0A 3AQCA 3R2PA 1I5NA 1V54C 2M4EA 2PBEA 2YLDA 2L6HA 2J8WA 3JRMO 1H9TA 1T6UA 2NG1A 1OCOC 4KC9A 3K7DA 5JP7A 3U9JA 2YHSA 2NSFA 3EHNA 3N0TA 4U5FE 3QVYA 4U9EA 3S29A 3NKEA 3FMSA 3MFNA 4N06A 2NUTB 2W9YA 4U5BE 1ZZPA 2QTVA 3U3FA 4A4AA 5COGA 3ZIBA 3S28A 4XLNF 3GEIA 3L8IA 4CS9C 2R7OA 1LIHA 4J7YA 3DE9A 1PV3A 2PP4A 5JLIA 3AG4C 2L81A 2XL6A 3IQCA 1G4WR 2YQYA 5CI8A 1L7CA 3KL4A 4BJ6C 5F5FA 3NYMA 3L8JA 4DVYP 2Y3BA 5KYXB 4MTFA 3ZSUA 1DOVA 2Q9BA 2R7QA 4FX5A 5AC5A 2EPKX 5DLJA 1Z5ZA 5DS5A 1NBBA 3WODF 3I5PA 2OU6A 4YN0B 4K7BA 2Z15A 2AWYA 3DXJF 3QTHA 1E85A 1YLMA 5B1AC 1C02A 3DE8A 2W45A 1YZAA 1FTSA 4MQ9F 5JRAA 1W2WA 5DQZA 1OXKA 2CDQA 1G5ZA 4XPWA 2D5RB 4U9DA 4KBLA 2V3CC 3U2LA 5L0FA 2HKVA 3DM9B 2KW3C 3K33A 4OINF 1BR4A 3AOUA 3ZDLA 1OCCC 4CDAA 3F47A 3NG1A 2G3KA 2EINC 4AL1A 2BL2A 4XPYA 5DQTA 2H7BA 1R4TA 1A0BA 4LDKA 1HY5A 1QKRA 5EGYA 2BC5A 1AUEA 2DYRC 2UUHA 1EA8A 3V5ZA 5F5HA 3W2WA 4DBRA 3IPMO 1ZW3A 2XLOA 3SXKA 4CS8C 1K05A 3DD7A 1YDIA 4HEAJ 3EZIA 5E3CA 4CJOA 4PJNA 4W8KA 2L6GA 4NC3A 1VB5A 1FMWA 3OA1A 3O10A 1VLSA 4E0HA 4JIOA 2UUIA 2Q3TA 1G8XA 1ZW2A 1XZPA 2IM8A 1PD1A 3R7CA 1GQAA 1TR2A 3OEOA 1SR2A 3DI5A 4MVZA 1QSPA 4BEJA 1LI5A 2YLGA 4JKVA 2V26A 3SZRA 2J9VA 2HMZA 2P7VA 3M79A 3S27A 5AC4A 1KTMA 5HV9A 1TKNA 2QNLA 2OEXA 3ASNC 3N2ZB 3SXMA 4G0HA 1VTMP 1XWJA 3K66A 3LLKA 2WZFA 3UGPA 5CI9A 1RKEA 3HLZA 3HNLA 3EGDA 4OIPF 4ONSA 4PR9A 2R03A 4JTDB 1FFHA 3UMIA 3IQ5A 3KH2A 1F1MA 3NRHA 4E18A 1OW8A 1Y4CA 3K1HA 3LS1A 3E9VA 1RCPA 4NQFA 3RQEA 3SEOA 2XLVA 4EWCA 4IGGA 3C8GD 4MVRA 2KC3A 1MNEA 4NTAA 3UMHA 2NPUA 4LERA 3HTKC 1NSGB 3Q7LA 4MVUA 2VB6A 3FHDA 5L0GA 4EKWA 2JD3A 2NSGA 3QW0A 5BQIA 3EG9A 1O5HA 2CNWA 3V7OA 4EIYA 1L3PA 4OD5A 1VYKA 2C04A 2CGEA 1A7EA 3K1IC 3LUTB 1I4ZA 3IEEA 4BJTA 1M2OA 3VAYA 4BEMJ 3EQLF 1YARO 2G3VA 4DRHB 2WVOA 2XXAA 3IQ6A 4L6RA 2IXNA 1OCZC 2KYHA 2G62A 3EH1A 3V5XA 4IAOA 1FR0A 1TFOB 4P9FA 3DMDA 2XLMA 2EIMC 2AP3A 4OIOF 1AVOB 1D0YA 2OCCC 4J7TA 4DVZA 4U5GA 3X2QC 2IOQA 4F4BA 2YZSA 4I44A 4CIHA 1J8MF 2VCBA 3NMIA 4DBQA 4IJJA 3A11A 1LVKA 2FFHA 2Y3GA 4CBEA 2OKUA 3Q6NA 1ZU4A 1I4YA 1Z23A 2F22A 1D1CA 2LFFA 2PF4E 2WB7A 4G7OF 1LS1A 2A1DD 3C8GA 5KYWB 2GDCA 4YL3A 1BZ4A 1SYQA 4RDAA 2J45A 4J32B 5DVWA 5L0IA 1K04A 2OJQA 2X0CA 1Q0DA 4LACB 1JR8A 4JZAA 2GA0A 4PJMA 4N4WA 2NUTA 1FFTC 2B0JA 3IQTA 3MX3A 1Q0GA 1C17M 4MTGA 4FWVA 4YWQA 3KMIA 1J8YF 3VM6A 2KSFA 1EQ1A 3C8GB 1JOGA 4EBJA 4E7ZA 3B0VC 4FESA 4W8PA 3SP1A 2HUJA 4ZLCA 2LK4A 1MQVA 1QVXA 2ICWG 1D1AA 1V74B 3A9CA 4YT5A 2HJMA 3TD7A 2EPLX 5A6JA 4BJ5C 5KYNA 2J0XA 3OWTA 2EPMX 3C63A 2PX0A 2KJGA 5D91A 2XLEA 3T6BA 2KK1A 4GEHA 3H2UA 4MW3A 1E84A 1ORSC 3KYIA 2R9RB 4YL1A 2JX0A 4D4XA 1PCXA 2IXMA 4JCHA 2JPUA 4CSAA 1QZXA 3WHNA 2HZ8A 2NUPB 4PJLA 3UMKA 1ZHTA 3GEEA 4O6NA 1H7IA 3CZ6A 3JZ0A 4IARA 2YLIA 3CEXA 3UNGC 2ZXRA 4YT4A 1CGME 2HFIA 3RVZA 3RIPA 2QY9A 2CW0F 1TWAA 4E0IA 4M63A 1JMWA 3H65A 1YYJA 3JTLO 2EPNA 1JPJA 2LD6A 256BA 4CDYA 2J7PD 1Z3IX 4HFKB 1OXBA 1VLTA 2FGYA 3PDMP 3G4XA 4CJGA 3G50A 2YL0A 1LS4A 2QLAA 2GFHA 4CS9A 1VMAA 2YL7A 5A6BD 2YWAA 2GAQA 3J06A 1GM5A 5BUOA 5JT4A 2KQ9A 4JVSA 5L0JA 2L6FA 1WTYA 4BJ6A 1BBHA 1LI7A 1ORYA 3HJCA 3TJ6A 2H7OA 1IW7F 3ABMC 4ULVA 2R7SA 1U6HA 3B0PA 3QW1A 3TJ5A 3ABKC 3S0XA 1PD0A 3Q6MA 4AX2A 5DS6A 1M2VB 2VASA 2HSBA 2XL4A 2J9UA 2XLWA 2P1AA 2IXPA 1T6QA 2EILC 1NU9C 2LP4A 4NTBA 2LQGA 3EJNA 2MHRA 2A0BA 4MVMA 2R25A 5KYUB 4PJJA 1FMVA 1Q0MA 3GM3A 3KKBA 4YT2A 4JEAA 4YK5A 4EHPA 2WVNA 5AGFA 4XLPF 1OQCA 1U89A 2PNOA 4JJGA 4XQ1A 4EBBA 2H7VC 4YJWA 4K0DA 4U5HA 1QQ3A 2OOCA 3LESA 2ETSA 3QMKA 2HMQA 3DKAA 3PHF2 3X1OA 1WOLA 1JAFA 4G7HF 3EHMA 2L9JA 2DYSC 1RXQA 4AL0A 2XLHA 3GEHA 5TJ5E 4BPMA 4JURI 4DRIB 4FAPB 2WZGA 2J0WA 1ZHYA 4O7GA 5COFA 2Y39A 2EIKC 5COMA 4YT8A 3MLGA 3ZTMA 3GM2A 4CS8A 3EFOB 4E7SA 1UFBA 4G78A 2AWCA 5EK0A 5A6KA 3PMRA 3U3BA 4E17A 1CPRA 1LKXA 3CAXA 4WGYA 3SXYA 1OCRC 4PK4A 4ANJA 4Z9HA 2P6VA 2RD9A 1V4AA 2YL3A 3FOOA 1VYIA 3WG7C 1FNTc 2FAPB 1ZYRF 1HE9A 2R7TA 1RMVA 1OR2A 1T9KA 4IRUA 1TFKB 4CIPA 3RFYA 3RW0A 3JT1A 4OIQF 4JTAB 4AK9A 2A0UA 4B6IA 3POVA 4Q4ZF 5L0CA 4PACA 3HNKA 4CS7A 2TMVP 3ITFA 1AEPA 2D4UA 2XLDA 2ZXWC 3U8VA 3UR3C 3AJMA 3B71A 4AE4A 3ATPA 2W4MA 1ST6A 3C62A 4MVQA 3SYNA 4Z9JA 1S05A 4H4KC 3TK0A 3ZC4A 3JRTA 4BJ1A 3M4BA 1NZEA 1ZHWA 3AGUA 3T9OA 1G4US 3IHUA 1D0ZA 1BR1A 1E86A 1A7VA 1D0XA 1T5OA 4AE4B 1BR2A 5B3SC 4XTKA 4WGZA 2R7UA 5KYWA 2VCAA 5B3IA 3W8HA 1R5ID 2YKZA 4UDVA 2I15A 1ZHZA 1H6GA 1WWPA 1ZU5A 4JTCB 2XM0A 2ZXOA 2KNHA 4WJ0A 3NKDA 1VOMA 5T1DB 1UG7A 3QVZA 3ZVRA 2R7WA 4KNVA 3K1IA 1V55C 2PFDA 1TWGA 1LE2A 3L34A 2H8AA 1O87A 2KGOA 1CGNA 3EPVA 4C3DA 2XSEA 5T3TA 1BDJB 1ORJA 2AU5A 2QE9A 3HNJA 3LAYA 4JEBA 4P6IC 3B29A 1Y6DA 3ECSA 3EGXA 3EZHA 1RJ9B 4I3MA 3LJBA 3M1CB 3W8IA 4GYTA 1A41A 4MW8A 2OJED 2NUPA 1TWHA 1HE1A 3EH2A 4MNDA 4U5DE 4ER9A 5B1BC 2HJ3A 4I1OB 2X51A 4LLEA 1WATA 3FAPB 3EGXB 5KYYA 2LCHA 2R7RA 4NY3A 2AVKA 2R7VA 1T01A 4C3BA 5FZTA 1O3UA 2WZLA 3ASOC 3MBGA 4JE9A 5DS4A 1HW2A 3LEVA 1QPUA 2CYDA 3AG2C 3C7JA 4O79A 4DXWA 1CGOA 3GWLA 3NYJA 2R02A 2P0NA 1NU7D 3CQZA 4KNWA 3HNIA 4MVOA 3K6BA 2Y69C 4RBNA 5KYYB 2LSEA 1APCA 2VCCA 1ZVZA 1NLXA
chains in the Genus database with same CATH topology
3IQ5A 2XLWA 3L1MA 1RCPA 4N6HA 3FOPA 4CX9A 2XLVA 2XM4A 5JSLA 4JEAA 5AGFA 3M4CA 1QQ3A 3QW0A 1JAFA 4EIYA 1YYXA 2XLHA 1EKYA 1LM3B 3ZTMA 3IQ6A 3VRCA 4L6RA 2YLDA 1CPRA 2J8WA 3NMJA 4WGYA 3ZQYA 5JP7A 2XLMA 2YL3A 3FOOA 4U9EA 3QVYA 2CCYA 4CIPA 3NMIA 5JLIA 3ZQVA 3DE9A 2XL6A 3HNKA 3U8PA 2XLDA 1CPQA 3NMKA 3C62A 1YZCA 1S05A 1NBBA 4N4WA 3M15A 3M4BA 1E85A 3DE8A 1E86A 1A7VA 1YZAA 4WGZA 1MQVA 5JRAA 4IAQA 5JVEA 5B3IA 2YKZA 4U9DA 2J9BA 2YL1A 3C63A 3ZTZA 2XLEA 2XM0A 1E84A 4D4XA 3QVZA 4CDAA 1CGNA 4IARA 2YLIA 2BC5A 4JEBA 3HNJA 2XLOA 1YYJA 4CDYA 256BA 3TOLA 4CJOA 4NC3A 4CDVA 4CJGA 2YL0A 4ER9A 4D4NA 2QLAA 4IB4A 1GQAA 2YL7A 3ZWIA 5JS5A 1M6TA 2YLGA 4JKVA 5JT4A 1E83A 1BBHA 3M79A 4JE9A 2XL8A 1QPUA 4ULVA 1CGOA 3TOMA 3HNLA 3QW1A 3HNIA 5JUAA 1APCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IQ5 A;  2XLW A;  3L1M A;  1RCP A;  4N6H A;  3FOP A;  4CX9 A;  2XLV A;  2XM4 A;  5JSL A;  4JEA A;  5AGF A;  3M4C A;  1QQ3 A;  3QW0 A;  1JAF A;  4EIY A;  1YYX A;  2XLH A;  1EKY A;  1LM3 B;  3ZTM A;  3IQ6 A;  3VRC A;  4L6R A;  2YLD A;  1CPR A;  2J8W A;  3NMJ A;  4WGY A;  3ZQY A;  5JP7 A;  2XLM A;  2YL3 A;  3FOO A;  4U9E A;  3QVY A;  2CCY A;  4CIP A;  3NMI A;  5JLI A;  3ZQV A;  3DE9 A;  2XL6 A;  3HNK A;  3U8P A;  2XLD A;  1CPQ A;  3NMK A;  3C62 A;  1YZC A;  1S05 A;  1NBB A;  4N4W A;  3M15 A;  3M4B A;  1E85 A;  3DE8 A;  1E86 A;  1A7V A;  1YZA A;  4WGZ A;  1MQV A;  5JRA A;  4IAQ A;  5JVE A;  5B3I A;  2YKZ A;  4U9D A;  2J9B A;  2YL1 A;  3C63 A;  3ZTZ A;  2XLE A;  2XM0 A;  1E84 A;  4D4X A;  3QVZ A;  4CDA A;  1CGN A;  4IAR A;  2YLI A;  2BC5 A;  4JEB A;  3HNJ A;  2XLO A;  1YYJ A;  4CDY A;  256B A;  3TOL A;  4CJO A;  4NC3 A;  4CDV A;  4CJG A;  2YL0 A;  4ER9 A;  4D4N A;  2QLA A;  4IB4 A;  1GQA A;  2YL7 A;  3ZWI A;  5JS5 A;  1M6T A;  2YLG A;  4JKV A;  5JT4 A;  1E83 A;  1BBH A;  3M79 A;  4JE9 A;  2XL8 A;  1QPU A;  4ULV A;  1CGO A;  3TOM A;  3HNL A;  3QW1 A;  3HNI A;  5JUA A;  1APC A; 
#chains in the Genus database with same CATH topology
 3SNH A;  2BE5 F;  3PCV A;  4Z9I A;  1M56 C;  1YA9 A;  3RH3 A;  2DGJ A;  1GGQ A;  2MWQ A;  4LLC A;  2ASR A;  2LFD A;  4H54 A;  4EBK A;  3FOP A;  4CX9 A;  1MMD A;  1WN0 A;  2WVQ A;  3E70 C;  5JSL A;  4BG0 A;  4BJ5 A;  4JJF A;  2A68 F;  4Q5S F;  1M57 C;  3O55 A;  5FCL A;  4QI0 A;  5EHH A;  4MVS A;  2EIJ C;  3DM5 A;  3AG3 C;  2ZPA A;  3ZG1 A;  1M2V A;  1U0B B;  1YAU O;  3GAN A;  3RKO F;  2QUP A;  1YYX A;  1NG1 A;  2WL8 A;  1HMD A;  2OEV A;  2MYS A;  2Y3H A;  1QLE C;  2R7X A;  5KYU A;  2DB4 A;  4XEK A;  3DWW A;  4JRZ A;  4U5C E;  3VRC A;  5CIV A;  3CSK A;  3O39 A;  3FXH A;  1RKC A;  3NMJ A;  3S9O A;  3U2M A;  3JSE O;  2EPO A;  4N6C A;  4XEF A;  3U9M A;  3US6 A;  3ZQY A;  4DOZ A;  2HSQ A;  5T3W A;  4I1M A;  5D92 A;  2CCY A;  3GOR A;  3H2V A;  4XWJ A;  3NYL A;  1HMO A;  5A69 A;  4QI2 A;  1IZM A;  1MND A;  3T6G B;  2W4B A;  1B68 A;  1MMA A;  2IYL D;  2XS1 A;  3ZQV A;  1T6I A;  5IY5 C;  3EFO A;  3FAJ A;  3O6X A;  3RVY A;  2J7P A;  3B9Q A;  5L0H A;  5KYX A;  1TWC A;  1SF8 A;  3KPH A;  3U8P A;  3VF0 A;  1CPQ A;  3HKK A;  2VC9 A;  2XRH A;  1HW1 A;  3NMK A;  1OW6 A;  5E2Q A;  2XS8 A;  1WAS A;  3V5Y A;  5A6B A;  1YZC A;  2I8B A;  2J46 A;  1H9G A;  2C03 A;  3RQG A;  3M15 A;  4Q7C A;  1Q0K A;  4YL0 A;  4MTO A;  4MS2 A;  3JYY A;  3AGT A;  4J30 B;  5L3Q A;  1Z6A A;  3RF3 A;  3U0C A;  1ZHX A;  2CNW D;  4KI2 A;  1NFN A;  4ULW A;  2E87 A;  4GQH A;  1JPN A;  1WGW A;  1YVI A;  2A69 F;  2J9W A;  4IAQ A;  2YVK A;  5JVE A;  4QDL A;  3C8Z A;  3LNR A;  3SXZ A;  3NDB B;  2OQM A;  4O6Y A;  5BQG A;  4RD9 A;  2J9B A;  2YL1 A;  2IXO A;  1D1B A;  3ZTZ A;  4NCQ A;  3W2V A;  3S84 A;  2R05 A;  2B0H A;  5K0I A;  2A6E F;  4C3E A;  3ABL C;  4IWB A;  1A7D A;  3GM1 A;  3VYW A;  2OG2 A;  3S90 A;  3JCU Q;  2P61 A;  4JW1 A;  2Q4F A;  3JYH A;  3W4Y A;  3I5Q A;  1OR3 A;  3MYF A;  1SZI A;  1K40 A;  2HS5 A;  5BQH A;  4HE8 D;  3Q7G A;  1Z7Q c;  3LEO A;  2PX3 A;  1XZQ A;  1OKK D;  3DJU B;  3GOD A;  3LNM B;  1LE4 A;  2HV6 A;  1KNY A;  2Q7R A;  3JSZ A;  1E2X A;  3RQF A;  3TOL A;  3U5S A;  4C7O A;  1RKE B;  4CDV A;  3EGD B;  4PFP A;  4OIR F;  1YA7 O;  3AQB A;  5HSW A;  1FAP B;  4WAB A;  4NTF A;  4U5E E;  4A2N B;  2IBF A;  4D4N A;  4IB4 A;  4OD4 A;  2ZD9 A;  1EI7 A;  1Q0F A;  2YRF A;  3ZWI A;  3C18 A;  4JCZ A;  5A6A A;  1MMN A;  3L0I A;  1M6T A;  3AG1 C;  3MYI A;  3FVY A;  4X0R A;  5GPG B;  5JS5 A;  1OW7 A;  1C03 A;  3DAG A;  3QZC A;  1E83 A;  1N1C A;  1RJ9 A;  3G4Z A;  3BEH A;  3BRJ A;  1S7Z A;  1LPE A;  2XL8 A;  4K1O A;  3DAF A;  4XEV A;  4HFF B;  4C7O B;  2GWW A;  3TOM A;  3WAQ A;  3N24 A;  4JC7 A;  5F28 E;  5L3V A;  1YJG A;  5JUA A;  3TUL A;  4P9T A;  5E3A A;  3UGO A;  2Y3D A;  3EG9 B;  4PFO A;  4LDR A;  4LDQ A;  4DRJ B;  2VH3 A;  2DI3 A;  3L1M A;  4O6M A;  2HV7 A;  2Q9A A;  5L0D A;  3F46 A;  2O9X A;  3GWN A;  4G7Z F;  4N6H A;  4XPX A;  3T4R A;  2XXA B;  1KU2 A;  2XM4 A;  3TQO A;  2A6H F;  1JRA A;  3LLI A;  2LIG A;  3I4U A;  2L7A A;  1DOW A;  3M4C A;  1OKK A;  3FDQ A;  1Z63 A;  1VK5 A;  2M64 A;  3DJN B;  4EUK B;  5E33 A;  3T6J A;  1GS9 A;  1SMY F;  3B0U X;  2ZXP A;  4ZLD A;  4DJ9 A;  3RYL A;  4CSA C;  4R32 A;  2Q00 A;  1TQG A;  2YEV A;  1EKY A;  3DZA A;  1MMG A;  2RSE B;  3KYJ A;  2Q9C A;  1LM3 B;  1NFO A;  3LS0 A;  3AQC A;  3R2P A;  1I5N A;  1V54 C;  2M4E A;  2PBE A;  2YLD A;  2L6H A;  2J8W A;  3JRM O;  1H9T A;  1T6U A;  2NG1 A;  1OCO C;  4KC9 A;  3K7D A;  5JP7 A;  3U9J A;  2YHS A;  2NSF A;  3EHN A;  3N0T A;  4U5F E;  3QVY A;  4U9E A;  3S29 A;  3NKE A;  3FMS A;  3MFN A;  4N06 A;  2NUT B;  2W9Y A;  4U5B E;  1ZZP A;  2QTV A;  3U3F A;  4A4A A;  5COG A;  3ZIB A;  3S28 A;  4XLN F;  3GEI A;  3L8I A;  4CS9 C;  2R7O A;  1LIH A;  4J7Y A;  3DE9 A;  1PV3 A;  2PP4 A;  5JLI A;  3AG4 C;  2L81 A;  2XL6 A;  3IQC A;  1G4W R;  2YQY A;  5CI8 A;  1L7C A;  3KL4 A;  4BJ6 C;  5F5F A;  3NYM A;  3L8J A;  4DVY P;  2Y3B A;  5KYX B;  4MTF A;  3ZSU A;  1DOV A;  2Q9B A;  2R7Q A;  4FX5 A;  5AC5 A;  2EPK X;  5DLJ A;  1Z5Z A;  5DS5 A;  1NBB A;  3WOD F;  3I5P A;  2OU6 A;  4YN0 B;  4K7B A;  2Z15 A;  2AWY A;  3DXJ F;  3QTH A;  1E85 A;  1YLM A;  5B1A C;  1C02 A;  3DE8 A;  2W45 A;  1YZA A;  1FTS A;  4MQ9 F;  5JRA A;  1W2W A;  5DQZ A;  1OXK A;  2CDQ A;  1G5Z A;  4XPW A;  2D5R B;  4U9D A;  4KBL A;  2V3C C;  3U2L A;  5L0F A;  2HKV A;  3DM9 B;  2KW3 C;  3K33 A;  4OIN F;  1BR4 A;  3AOU A;  3ZDL A;  1OCC C;  4CDA A;  3F47 A;  3NG1 A;  2G3K A;  2EIN C;  4AL1 A;  2BL2 A;  4XPY A;  5DQT A;  2H7B A;  1R4T A;  1A0B A;  4LDK A;  1HY5 A;  1QKR A;  5EGY A;  2BC5 A;  1AUE A;  2DYR C;  2UUH A;  1EA8 A;  3V5Z A;  5F5H A;  3W2W A;  4DBR A;  3IPM O;  1ZW3 A;  2XLO A;  3SXK A;  4CS8 C;  1K05 A;  3DD7 A;  1YDI A;  4HEA J;  3EZI A;  5E3C A;  4CJO A;  4PJN A;  4W8K A;  2L6G A;  4NC3 A;  1VB5 A;  1FMW A;  3OA1 A;  3O10 A;  1VLS A;  4E0H A;  4JIO A;  2UUI A;  2Q3T A;  1G8X A;  1ZW2 A;  1XZP A;  2IM8 A;  1PD1 A;  3R7C A;  1GQA A;  1TR2 A;  3OEO A;  1SR2 A;  3DI5 A;  4MVZ A;  1QSP A;  4BEJ A;  1LI5 A;  2YLG A;  4JKV A;  2V26 A;  3SZR A;  2J9V A;  2HMZ A;  2P7V A;  3M79 A;  3S27 A;  5AC4 A;  1KTM A;  5HV9 A;  1TKN A;  2QNL A;  2OEX A;  3ASN C;  3N2Z B;  3SXM A;  4G0H A;  1VTM P;  1XWJ A;  3K66 A;  3LLK A;  2WZF A;  3UGP A;  5CI9 A;  1RKE A;  3HLZ A;  3HNL A;  3EGD A;  4OIP F;  4ONS A;  4PR9 A;  2R03 A;  4JTD B;  1FFH A;  3UMI A;  3IQ5 A;  3KH2 A;  1F1M A;  3NRH A;  4E18 A;  1OW8 A;  1Y4C A;  3K1H A;  3LS1 A;  3E9V A;  1RCP A;  4NQF A;  3RQE A;  3SEO A;  2XLV A;  4EWC A;  4IGG A;  3C8G D;  4MVR A;  2KC3 A;  1MNE A;  4NTA A;  3UMH A;  2NPU A;  4LER A;  3HTK C;  1NSG B;  3Q7L A;  4MVU A;  2VB6 A;  3FHD A;  5L0G A;  4EKW A;  2JD3 A;  2NSG A;  3QW0 A;  5BQI A;  3EG9 A;  1O5H A;  2CNW A;  3V7O A;  4EIY A;  1L3P A;  4OD5 A;  1VYK A;  2C04 A;  2CGE A;  1A7E A;  3K1I C;  3LUT B;  1I4Z A;  3IEE A;  4BJT A;  1M2O A;  3VAY A;  4BEM J;  3EQL F;  1YAR O;  2G3V A;  4DRH B;  2WVO A;  2XXA A;  3IQ6 A;  4L6R A;  2IXN A;  1OCZ C;  2KYH A;  2G62 A;  3EH1 A;  3V5X A;  4IAO A;  1FR0 A;  1TFO B;  4P9F A;  3DMD A;  2XLM A;  2EIM C;  2AP3 A;  4OIO F;  1AVO B;  1D0Y A;  2OCC C;  4J7T A;  4DVZ A;  4U5G A;  3X2Q C;  2IOQ A;  4F4B A;  2YZS A;  4I44 A;  4CIH A;  1J8M F;  2VCB A;  3NMI A;  4DBQ A;  4IJJ A;  3A11 A;  1LVK A;  2FFH A;  2Y3G A;  4CBE A;  2OKU A;  3Q6N A;  1ZU4 A;  1I4Y A;  1Z23 A;  2F22 A;  1D1C A;  2LFF A;  2PF4 E;  2WB7 A;  4G7O F;  1LS1 A;  2A1D D;  3C8G A;  5KYW B;  2GDC A;  4YL3 A;  1BZ4 A;  1SYQ A;  4RDA A;  2J45 A;  4J32 B;  5DVW A;  5L0I A;  1K04 A;  2OJQ A;  2X0C A;  1Q0D A;  4LAC B;  1JR8 A;  4JZA A;  2GA0 A;  4PJM A;  4N4W A;  2NUT A;  1FFT C;  2B0J A;  3IQT A;  3MX3 A;  1Q0G A;  1C17 M;  4MTG A;  4FWV A;  4YWQ A;  3KMI A;  1J8Y F;  3VM6 A;  2KSF A;  1EQ1 A;  3C8G B;  1JOG A;  4EBJ A;  4E7Z A;  3B0V C;  4FES A;  4W8P A;  3SP1 A;  2HUJ A;  4ZLC A;  2LK4 A;  1MQV A;  1QVX A;  2ICW G;  1D1A A;  1V74 B;  3A9C A;  4YT5 A;  2HJM A;  3TD7 A;  2EPL X;  5A6J A;  4BJ5 C;  5KYN A;  2J0X A;  3OWT A;  2EPM X;  3C63 A;  2PX0 A;  2KJG A;  5D91 A;  2XLE A;  3T6B A;  2KK1 A;  4GEH A;  3H2U A;  4MW3 A;  1E84 A;  1ORS C;  3KYI A;  2R9R B;  4YL1 A;  2JX0 A;  4D4X A;  1PCX A;  2IXM A;  4JCH A;  2JPU A;  4CSA A;  1QZX A;  3WHN A;  2HZ8 A;  2NUP B;  4PJL A;  3UMK A;  1ZHT A;  3GEE A;  4O6N A;  1H7I A;  3CZ6 A;  3JZ0 A;  4IAR A;  2YLI A;  3CEX A;  3UNG C;  2ZXR A;  4YT4 A;  1CGM E;  2HFI A;  3RVZ A;  3RIP A;  2QY9 A;  2CW0 F;  1TWA A;  4E0I A;  4M63 A;  1JMW A;  3H65 A;  1YYJ A;  3JTL O;  2EPN A;  1JPJ A;  2LD6 A;  256B A;  4CDY A;  2J7P D;  1Z3I X;  4HFK B;  1OXB A;  1VLT A;  2FGY A;  3PDM P;  3G4X A;  4CJG A;  3G50 A;  2YL0 A;  1LS4 A;  2QLA A;  2GFH A;  4CS9 A;  1VMA A;  2YL7 A;  5A6B D;  2YWA A;  2GAQ A;  3J06 A;  1GM5 A;  5BUO A;  5JT4 A;  2KQ9 A;  4JVS A;  5L0J A;  2L6F A;  1WTY A;  4BJ6 A;  1BBH A;  1LI7 A;  1ORY A;  3HJC A;  3TJ6 A;  2H7O A;  1IW7 F;  3ABM C;  4ULV A;  2R7S A;  1U6H A;  3B0P A;  3QW1 A;  3TJ5 A;  3ABK C;  3S0X A;  1PD0 A;  3Q6M A;  4AX2 A;  5DS6 A;  1M2V B;  2VAS A;  2HSB A;  2XL4 A;  2J9U A;  2XLW A;  2P1A A;  2IXP A;  1T6Q A;  2EIL C;  1NU9 C;  2LP4 A;  4NTB A;  2LQG A;  3EJN A;  2MHR A;  2A0B A;  4MVM A;  2R25 A;  5KYU B;  4PJJ A;  1FMV A;  1Q0M A;  3GM3 A;  3KKB A;  4YT2 A;  4JEA A;  4YK5 A;  4EHP A;  2WVN A;  5AGF A;  4XLP F;  1OQC A;  1U89 A;  2PNO A;  4JJG A;  4XQ1 A;  4EBB A;  2H7V C;  4YJW A;  4K0D A;  4U5H A;  1QQ3 A;  2OOC A;  3LES A;  2ETS A;  3QMK A;  2HMQ A;  3DKA A;  3PHF 2;  3X1O A;  1WOL A;  1JAF A;  4G7H F;  3EHM A;  2L9J A;  2DYS C;  1RXQ A;  4AL0 A;  2XLH A;  3GEH A;  5TJ5 E;  4BPM A;  4JUR I;  4DRI B;  4FAP B;  2WZG A;  2J0W A;  1ZHY A;  4O7G A;  5COF A;  2Y39 A;  2EIK C;  5COM A;  4YT8 A;  3MLG A;  3ZTM A;  3GM2 A;  4CS8 A;  3EFO B;  4E7S A;  1UFB A;  4G78 A;  2AWC A;  5EK0 A;  5A6K A;  3PMR A;  3U3B A;  4E17 A;  1CPR A;  1LKX A;  3CAX A;  4WGY A;  3SXY A;  1OCR C;  4PK4 A;  4ANJ A;  4Z9H A;  2P6V A;  2RD9 A;  1V4A A;  2YL3 A;  3FOO A;  1VYI A;  3WG7 C;  1FNT c;  2FAP B;  1ZYR F;  1HE9 A;  2R7T A;  1RMV A;  1OR2 A;  1T9K A;  4IRU A;  1TFK B;  4CIP A;  3RFY A;  3RW0 A;  3JT1 A;  4OIQ F;  4JTA B;  4AK9 A;  2A0U A;  4B6I A;  3POV A;  4Q4Z F;  5L0C A;  4PAC A;  3HNK A;  4CS7 A;  2TMV P;  3ITF A;  1AEP A;  2D4U A;  2XLD A;  2ZXW C;  3U8V A;  3UR3 C;  3AJM A;  3B71 A;  4AE4 A;  3ATP A;  2W4M A;  1ST6 A;  3C62 A;  4MVQ A;  3SYN A;  4Z9J A;  1S05 A;  4H4K C;  3TK0 A;  3ZC4 A;  3JRT A;  4BJ1 A;  3M4B A;  1NZE A;  1ZHW A;  3AGU A;  3T9O A;  1G4U S;  3IHU A;  1D0Z A;  1BR1 A;  1E86 A;  1A7V A;  1D0X A;  1T5O A;  4AE4 B;  1BR2 A;  5B3S C;  4XTK A;  4WGZ A;  2R7U A;  5KYW A;  2VCA A;  5B3I A;  3W8H A;  1R5I D;  2YKZ A;  4UDV A;  2I15 A;  1ZHZ A;  1H6G A;  1WWP A;  1ZU5 A;  4JTC B;  2XM0 A;  2ZXO A;  2KNH A;  4WJ0 A;  3NKD A;  1VOM A;  5T1D B;  1UG7 A;  3QVZ A;  3ZVR A;  2R7W A;  4KNV A;  3K1I A;  1V55 C;  2PFD A;  1TWG A;  1LE2 A;  3L34 A;  2H8A A;  1O87 A;  2KGO A;  1CGN A;  3EPV A;  4C3D A;  2XSE A;  5T3T A;  1BDJ B;  1ORJ A;  2AU5 A;  2QE9 A;  3HNJ A;  3LAY A;  4JEB A;  4P6I C;  3B29 A;  1Y6D A;  3ECS A;  3EGX A;  3EZH A;  1RJ9 B;  4I3M A;  3LJB A;  3M1C B;  3W8I A;  4GYT A;  1A41 A;  4MW8 A;  2OJE D;  2NUP A;  1TWH A;  1HE1 A;  3EH2 A;  4MND A;  4U5D E;  4ER9 A;  5B1B C;  2HJ3 A;  4I1O B;  2X51 A;  4LLE A;  1WAT A;  3FAP B;  3EGX B;  5KYY A;  2LCH A;  2R7R A;  4NY3 A;  2AVK A;  2R7V A;  1T01 A;  4C3B A;  5FZT A;  1O3U A;  2WZL A;  3ASO C;  3MBG A;  4JE9 A;  5DS4 A;  1HW2 A;  3LEV A;  1QPU A;  2CYD A;  3AG2 C;  3C7J A;  4O79 A;  4DXW A;  1CGO A;  3GWL A;  3NYJ A;  2R02 A;  2P0N A;  1NU7 D;  3CQZ A;  4KNW A;  3HNI A;  4MVO A;  3K6B A;  2Y69 C;  4RBN A;  5KYY B;  2LSE A;  1APC A;  2VCC A;  1ZVZ A;  1NLX A; 
#chains in the Genus database with same CATH homology
 3IQ5 A;  2XLW A;  3L1M A;  1RCP A;  4N6H A;  3FOP A;  4CX9 A;  2XLV A;  2XM4 A;  5JSL A;  4JEA A;  5AGF A;  3M4C A;  1QQ3 A;  3QW0 A;  1JAF A;  4EIY A;  1YYX A;  2XLH A;  1EKY A;  1LM3 B;  3ZTM A;  3IQ6 A;  3VRC A;  4L6R A;  2YLD A;  1CPR A;  2J8W A;  3NMJ A;  4WGY A;  3ZQY A;  5JP7 A;  2XLM A;  2YL3 A;  3FOO A;  4U9E A;  3QVY A;  2CCY A;  4CIP A;  3NMI A;  5JLI A;  3ZQV A;  3DE9 A;  2XL6 A;  3HNK A;  3U8P A;  2XLD A;  1CPQ A;  3NMK A;  3C62 A;  1YZC A;  1S05 A;  1NBB A;  4N4W A;  3M15 A;  3M4B A;  1E85 A;  3DE8 A;  1E86 A;  1A7V A;  1YZA A;  4WGZ A;  1MQV A;  5JRA A;  4IAQ A;  5JVE A;  5B3I A;  2YKZ A;  4U9D A;  2J9B A;  2YL1 A;  3C63 A;  3ZTZ A;  2XLE A;  2XM0 A;  1E84 A;  4D4X A;  3QVZ A;  4CDA A;  1CGN A;  4IAR A;  2YLI A;  2BC5 A;  4JEB A;  3HNJ A;  2XLO A;  1YYJ A;  4CDY A;  256B A;  3TOL A;  4CJO A;  4NC3 A;  4CDV A;  4CJG A;  2YL0 A;  4ER9 A;  4D4N A;  2QLA A;  4IB4 A;  1GQA A;  2YL7 A;  3ZWI A;  5JS5 A;  1M6T A;  2YLG A;  4JKV A;  5JT4 A;  1E83 A;  1BBH A;  3M79 A;  4JE9 A;  2XL8 A;  1QPU A;  4ULV A;  1CGO A;  3TOM A;  3HNL A;  3QW1 A;  3HNI A;  5JUA A;  1APC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...