5JLIA

Nitric oxide complex of the l16a mutant of cytochrome c prime from alcaligenes xylosoxidans
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
127
structure length
127
Chain Sequence
EFAKPEDAVKYRQSAATLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering proximal vs. distal heme-NO coordination via dinitrosyl dynamics: implications for NO sensor design.
pubmed doi rcsb
source organism Alcaligenes xylosoxydans xylosoxydans
molecule tags Electron transport
molecule keywords Cytochrome c'
total genus 50
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2016-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 5jliA00
3VRCA 5JT4A 3FOPA 3ZTMA 4JEAA 5JS5A 1YZCA 1LM3B 2XL8A 4IAQA 2XLEA 4JEBA 2XLHA 4CDAA 4N4WA 4U9DA 1NBBA 3DE8A 3L1MA 3M15A 3C63A 4WGYA 1E86A 3ZQVA 3NMIA 2XLWA 4ULVA 3M79A 2XLDA 2XM4A 1JAFA 3HNJA 3IQ6A 4CJOA 1E83A 3QW1A 3ZQYA 1CPRA 2QLAA 1MQVA 4D4NA 4IB4A 1M6TA 1CGNA 256BA 2XL6A 4ER9A 3HNIA 1CGOA 5JSLA 3QW0A 3FOOA 3M4BA 4CJGA 4JE9A 2XLOA 4CIPA 4U9EA 4CX9A 2XLVA 4D4XA 3DE9A 2YL0A 5JRAA 2YLIA 4N6HA 2BC5A 3U8PA 1E84A 1CPQA 1S05A 2YLDA 2XM0A 3HNKA 5JUAA 4CDVA 1A7VA 1YYJA 2YL1A 5AGFA 3C62A 3M4CA 3HNLA 1BBHA 3TOMA 3IQ5A 2CCYA 2YKZA 4NC3A 1GQAA 5JLIA 5JVEA 4IARA 1APCA 4WGZA 3ZWIA 4L6RA 4CDYA 2YL7A 5JP7A 1YZAA 3QVYA 3QVZA 1RCPA 2YL3A 3ZTZA 4EIYA 5B3IA 1QPUA 1QQ3A 2J9BA 2XLMA 2YLGA 1YYXA 1EKYA 1E85A 3TOLA 2J8WA 4JKVA 3NMJA 3NMKA
chains in the Genus database with same CATH superfamily
2VC9A 4H54A 1PD0A 3FDQA 2R7SA 2J9VA 3GEHA 4BJ1A 3JYHA 4DOZA 4E0HA 5AC4A 5JT4A 5L3QA 2EILC 4BJTA 1S7ZA 3L0IA 1TKNA 2G3KA 2HSBA 3N2ZB 1SR2A 2WZFA 3RW0A 3X2QC 1XWJA 2IYLD 3N0TA 1YA9A 2R7RA 1VOMA 4U5EE 2L9JA 3U3FA 3FHDA 2L7AA 2R03A 3JZ0A 4EBJA 2W4BA 3GM1A 4JEBA 2IXPA 3Q6NA 1ZW2A 4CIHA 1OR2A 5KYUB 1A0BA 1C17M 5D92A 3POVA 1B68A 3H2VA 3RVZA 4CDAA 4PK4A 3PHF2 2PBEA 1KTMA 2W45A 4AX2A 3ITFA 4BJ6A 4MQ9F 4MVUA 2B0HA 4Q7CA 1ZU5A 3M15A 2DYSC 1J8YF 2Q00A 3QTHA 3ZQVA 1G8XA 3K1IC 2M64A 2XLWA 3K66A 3S29A 1OCRC 1HMOA 4ULVA 1OW6A 3GODA 3ZIBA 3ECSA 4DBRA 4N6CA 3EHNA 2J0XA 2YRFA 4CJOA 1OCZC 5D91A 2VB6A 2NSGA 4PFPA 1CPRA 1MQVA 4GQHA 4PFOA 2L81A 2KNHA 2GAQA 3PCVA 1N1CA 3HLZA 1HW2A 3AQBA 4WJ0A 4LDRA 2V3CC 4E7ZA 1Z63A 3NKEA 2HJMA 4J7TA 2Y3HA 5A6JA 5T3TA 256BA 1IW7F 3G4ZA 1EI7A 1CGOA 1PV3A 3ASNC 4LACB 2ZXRA 3O55A 1T6IA 3C8GD 5E3CA 4BJ5A 2H8AA 2EINC 4GYTA 4CS9A 1ZZPA 4MVQA 5B3SC 1ZU4A 1L7CA 1D1BA 2NUTB 2Y3GA 4JTCB 4JRZA 4C3DA 2O9XA 4JTAB 2ZXWC 3SEOA 2J46A 2LK4A 4CX9A 4E7SA 1PD1A 2CNWA 3NYMA 3E9VA 1D0ZA 3IQCA 3V5XA 3W4YA 4D4XA 3KKBA 2TMVP 2R7WA 1JOGA 1OCCC 4DXWA 1FR0A 1D1AA 3DE9A 5KYWB 4XLNF 4KNWA 1GS9A 1QSPA 2KK1A 2A1DD 2QUPA 2KYHA 2AVKA 4N6HA 5KYYA 4LDKA 3SXYA 1NFOA 2VASA 4EWCA 1E84A 1LE2A 3LNRA 4HFKB 1CGME 4MVOA 1U89A 2OJED 5L0IA 1Q0DA 1YARO 3HNKA 3IPMO 4IRUA 4Q4ZF 1A7EA 3EHMA 2IOQA 2YL1A 1KU2A 4KI2A 3NYJA 2BE5F 4B6IA 1WTYA 3UR3C 3HNLA 3I4UA 2W9YA 3I5QA 2Z15A 4XWJA 3DJUB 2OG2A 2R9RB 1J8MF 1BBHA 3MLGA 3SYNA 3TOMA 5L0GA 2CCYA 3I5PA 2YKZA 3JSEO 1LE4A 5BUOA 2A6EF 3H65A 3EFOB 4I1OB 4Z9HA 3PDMP 2LCHA 2EPOA 4IARA 4QDLA 3RQEA 2J9WA 2ZXOA 1K40A 2Q3TA 2AP3A 5DS5A 3MYIA 3AG4C 2NSFA 3U9JA 2Y3BA 3EH1A 3KYJA 3UMKA 1HE9A 2LD6A 3FAPB 5JP7A 2WVOA 1RCPA 2F22A 3EGXB 1OQCA 1WGWA 5B3IA 4NQFA 4YJWA 3C8ZA 3ABLC 4YL1A 1T6UA 4G7HF 3JRTA 3B9QA 1O87A 2L6GA 4W8PA 4XEKA 4C3EA 4EUKB 1Z7Qc 3X1OA 2JD3A 4DRJB 1EKYA 3JT1A 2XL4A 3T6GB 1ZHXA 4BPMA 2EPKX 1TQGA 4JKVA 2ETSA 4P6IC 1E2XA 2CW0F 1MMGA 2KJGA 1M2OA 2NG1A 2WVNA 3NMKA 5F5FA 2VH3A 4HEAJ 5F5HA 3VRCA 2Q4FA 4BG0A 1OKKA 2HZ8A 3ABKC 1VB5A 4CSAC 3FOPA 3AOUA 3RKOF 4BJ6C 1U0BB 2OKUA 1M57C 1D1CA 4FX5A 2QNLA 1D0YA 1VMAA 2QE9A 2R05A 1HY5A 3LJBA 3CSKA 4G7ZF 1JR8A 1BR1A 1LM3B 2XLEA 4CS7A 1RKEB 4J32B 4JURI 5DS6A 2YVKA 1ZHYA 4EBKA 2XLHA 1QLEC 1OXKA 1YVIA 1LI7A 2WL8A 4BEMJ 2J0WA 3DE8A 1C03A 1ZVZA 2HMQA 2YZSA 4R32A 5KYYB 2NUPA 3TD7A 3C63A 3KYIA 2R7TA 1LIHA 1E86A 1Z6AA 3GM2A 5L0DA 3NMIA 1MMAA 2P61A 1I4ZA 4A4AA 5CIVA 3SNHA 2R7UA 1WWPA 3RVYA 4BJ5C 4XLPF 1Y4CA 1A41A 1AEPA 1NSGB 2NPUA 2PFDA 3SZRA 5A6BD 2MWQA 2XLDA 5DQZA 2KSFA 2XS8A 3UMHA 3Q7LA 3HNJA 3IQ6A 1EQ1A 4LLCA 3QW1A 3CQZA 4LDQA 3FVYA 2LQGA 1JMWA 2QLAA 4PR9A 3W2WA 2HS5A 4IB4A 3ZQYA 2OJQA 5A6BA 2ZD9A 5GPGB 4X0RA 3UGPA 1CGNA 3ZVRA 4AL1A 3JRMO 3DD7A 4KNVA 1BDJB 3OEOA 3VYWA 3TQOA 3DAGA 4ER9A 3U0CA 1IZMA 2I8BA 3AQCA 3M4BA 4CJGA 1YDIA 1OCOC 2ASRA 4JE9A 3B71A 1OXBA 3T4RA 1R4TA 2FFHA 2P0NA 2XLOA 1ZW3A 4KC9A 2Q7RA 2Q9BA 1Z23A 2XLVA 4MNDA 1BR2A 2Y69C 3LLIA 1FTSA 2WVQA 1JPNA 2AWCA 4JC7A 4YK5A 1HE1A 2X0CA 5JRAA 3B0UX 3W8IA 2R02A 3LLKA 4O79A 1ZHZA 4OIPF 1L3PA 1I4YA 4JTDB 2BC5A 3A9CA 3BRJA 3RQFA 3TK0A 2Q9CA 1S05A 1V74B 4JW1A 3GORA 5KYUA 5L0CA 4ANJA 5KYXA 2XRHA 4CS8A 4DRHB 4G78A 4ULWA 1OR3A 3TJ5A 4YT8A 2XM0A 2EIKC 3CAXA 3TJ6A 2BL2A 5JUAA 3GWLA 5CI8A 4NTBA 1QKRA 5COGA 1ORYA 2DB4A 2OQMA 1H9GA 2CGEA 3ABMC 3FXHA 4XEFA 2Q9AA 3EFOA 3ZSUA 5EGYA 3A11A 5DS4A 3IQ5A 1VYIA 2A68F 2J7PA 4I1MA 3DM5A 3LEVA 1MNDA 1K04A 2OOCA 3HKKA 3U8VA 2HJ3A 3W8HA 2R25A 2MYSA 4O7GA 2YEVA 3T6JA 2YL7A 2R7XA 1YZAA 3QVYA 2YL3A 3QMKA 4N06A 2MHRA 3EPVA 3EZIA 1QVXA 3MBGA 3EJNA 2EIMC 3VM6A 3NYLA 2XLMA 4OINF 4MTGA 2OEVA 3KH2A 2H7VC 1M2VB 4DRIB 1M2VA 3LS1A 2HV7A 3DAFA 1ORSC 5DQTA 1H9TA 1RMVA 1G4US 3C7JA 3MFNA 4K1OA 4OIQF 2RD9A 4GEHA 4H4KC 3RIPA 3Q6MA 2XSEA 4F4BA 3HTKC 2KQ9A 4U5DE 4NTAA 1GGQA 2KGOA 4U5GA 4XQ1A 3ZTMA 3SXMA 3UNGC 1WASA 1YZCA 3DKAA 3DMDA 5COFA 4MVZA 4OD5A 4IAQA 1G5ZA 3V7OA 1JPJA 4CS9C 3S84A 4J30B 3CZ6A 4W8KA 1VK5A 2G3VA 3K1HA 4E18A 2L6HA 3GWNA 4U9DA 3UGOA 1RJ9B 5E2QA 5L3VA 3FAJA 2NUPB 2CNWD 2YHSA 4XPWA 2FGYA 1NU9C 4IWBA 2R7QA 4A2NB 2GA0A 5FZTA 5COMA 2B0JA 5B1AC 1MMDA 1TWCA 1FAPB 1MMNA 2P1AA 4O6NA 3C8GA 1K05A 2HMZA 3LNMB 3R2PA 4AK9A 1JAFA 3DWWA 4JJGA 5DVWA 3S0XA 3AJMA 4NCQA 3AGTA 1E83A 3JCUQ 3RYLA 2A6HF 4D4NA 4XEVA 1OKKD 1Q0GA 1TFOB 4ZLDA 1M6TA 3NRHA 3DM9B 3PMRA 4Z9IA 1LS1A 1Q0FA 4EBBA 1FNTc 4HFFB 3K33A 4WABA 4RBNA 2KC3A 1OW8A 3VAYA 4DBQA 5EHHA 2JPUA 1YAUO 3CEXA 4NTFA 3HNIA 3KMIA 4RDAA 2C04A 4O6YA 5JSLA 3L8IA 3ZG1A 5L0HA 4YT2A 5IY5C 4ONSA 1UG7A 4LERA 3GEEA 1YLMA 4AE4B 2RSEB 3WODF 4JVSA 1H7IA 2D5RB 3K6BA 1GM5A 1ZHWA 3EG9B 1O3UA 4MVRA 2YL0A 5K0IA 1T6QA 3EGDB 1SZIA 2W4MA 3F46A 3N24A 2C03A 2YLIA 4C7OA 4C7OB 4P9TA 3WG7C 3AG2C 3EGDA 1YJGA 4EHPA 5BQHA 5HV9A 5L0FA 1CPQA 3ATPA 2M4EA 4JIOA 1TR2A 1WATA 1RKEA 4XTKA 2OU6A 3DJNB 3U9MA 2E87A 1A7VA 3SP1A 3B0PA 3MYFA 4C3BA 1ST6A 5AC5A 2J45A 2PP4A 2GDCA 4YT5A 4MW8A 3AG3C 2IBFA 1FFHA 1T9KA 2J9UA 3QZCA 3S27A 2OEXA 4G0HA 4MS2A 1DOVA 2LFFA 1TWHA 3KL4A 4MTOA 1JRAA 4QI2A 4NC3A 5JLIA 4DJ9A 2FAPB 1FFTC 3EH2A 3F47A 4PJLA 3U3BA 2HFIA 5A6KA 2P6VA 3SXKA 3GM3A 4WGZA 4YT4A 2IM8A 3HJCA 4MVSA 4U5BE 1HMDA 3ZWIA 5FCLA 3J06A 1TFKB 1ORJA 4CDYA 2HV6A 2EPNA 3ZDLA 3ZC4A 4XPYA 3QVZA 4EIYA 1RKCA 1VYKA 4MW3A 2ZXPA 1WN0A 1A7DA 3FMSA 3C18A 1SYQA 1QPUA 1QQ3A 1SMYF 1YA7O 2YWAA 4NY3A 3JSZA 3EQLF 1ZHTA 4EKWA 1LI5A 2PF4E 1YYXA 3O6XA 2NUTA 1E85A 1O5HA 3TOLA 1Z5ZA 1TWAA 4OIOF 4XPXA 2AU5A 1LS4A 4LLEA 4RD9A 3M1CB 5KYWA 1R5ID 1ZYRF 2YQYA 3K1IA 1Q0KA 2DGJA 3IHUA 2GFHA 2HSQA 3O10A 1NU7D 4YL3A 1Q0MA 2QY9A 1V55C 2KW3C 2WB7A 1XZQA 4JEAA 5JS5A 3WAQA 3US6A 2G62A 4BEJA 3DXJF 2XL8A 3OWTA 5HSWA 3V5ZA 4O6MA 2HUJA 3GEIA 4PJNA 1VLTA 3S90A 1VTMP 5E33A 3O39A 2ICWG 3UMIA 4CSAA 4FESA 1PCXA 4AL0A 5E3AA 4DVYP 2IXNA 3W2VA 5KYXB 1FMVA 1LPEA 1U6HA 2XS1A 3KPHA 3DI5A 4N4WA 1NBBA 3RFYA 1AUEA 3L1MA 4E0IA 1LVKA 1H6GA 4OD4A 2JX0A 4JCHA 1KNYA 4WGYA 1V4AA 2I15A 2H7OA 2PNOA 4I44A 2GWWA 3M79A 2XXAB 4FAPB 2XXAA 3C8GB 3NG1A 2XM4A 1MNEA 2IXOA 3EGXA 5BQGA 4U5CE 1Z3IX 4MVMA 4QI0A 4ZLCA 4KBLA 1RXQA 5DLJA 4PJMA 4DVZA 3B29A 1AVOB 1LKXA 1UFBA 3G50A 3LEOA 4I3MA 3LESA 3RH3A 3L8JA 3EZHA 4M63A 4MTFA 1RJ9A 3K7DA 2DYRC 4YN0B 2J7PD 4OIRF 1EA8A 1NLXA 3LUTB 2EPLX 2R7OA 3MX3A 4K7BA 1NG1A 2XL6A 3QW0A 1F1MA 1C02A 3FOOA 5T1DB 3U2LA 2VCCA 4AE4A 4UDVA 3RQGA 1HW1A 3G4XA 2HKVA 1Y6DA 4E17A 4CIPA 2IXMA 4U9EA 4PACA 5L0JA 3B0VC 3JYYA 4Z9JA 3SXZA 3U2MA 2VCAA 3LAYA 4P9FA 1XZPA 1BR4A 3V5YA 2PX3A 1M56C 2LP4A 1WOLA 3L34A 4U5FE 5T3WA 3LS0A 3U5SA 4CS8C 2DI3A 2CYDA 4YL0A 2R7VA 1T5OA 3T9OA 3NDBB 3U8PA 2VCBA 1SF8A 2UUIA 3Q7GA 5TJ5E 1G4WR 1FMWA 1BZ4A 2Y3DA 2LSEA 3AGUA 1D0XA 1NFNA 2WZGA 2EPMX 2YLDA 3JTLO 5F28E 5B1BC 4G7OF 1I5NA 3OA1A 2D4UA 4IJJA 4CDVA 4IAOA 1VLSA 4U5HA 4HE8D 1YYJA 5CI9A 4IGGA 2A0BA 5AGFA 3RF3A 3NKDA 3C62A 2A69F 3ASOC 3H2UA 3M4CA 3TULA 2QTVA 1DOWA 4Q5SF 2LFDA 1V54C 2EIJC 2WZLA 3AG1C 2H7BA 4YWQA 4JZAA 2ZPAA 1GQAA 1W2WA 3R7CA 1OW7A 5JVEA 4K0DA 5EK0A 5A6AA 3S9OA 4CBEA 1APCA 1QZXA 3IEEA 2Y39A 3E70C 4PJJA 4L6RA 2V26A 2AWYA 3T6BA 2L6FA 3WHNA 1NZEA 3ZTZA 5KYNA 1T01A 5A69A 2OCCC 2P7VA 4J7YA 3DZAA 3IQTA 4JJFA 2J9BA 2YLGA 2X51A 3S28A 3VF0A 2PX0A 2UUHA 2LIGA 5BQIA 4JCZA 2CDQA 1TWGA 3GANA 2J8WA 3NMJA 2A0UA 3BEHA 4FWVA 3EG9A
chains in the Genus database with same CATH topology
3VRCA 5JT4A 3FOPA 3ZTMA 4JEAA 5JS5A 1YZCA 1LM3B 2XL8A 4IAQA 2XLEA 4JEBA 2XLHA 4CDAA 4N4WA 4U9DA 1NBBA 3DE8A 3L1MA 3M15A 3C63A 4WGYA 1E86A 3ZQVA 3NMIA 2XLWA 4ULVA 3M79A 2XLDA 2XM4A 1JAFA 3HNJA 3IQ6A 4CJOA 1E83A 3QW1A 3ZQYA 1CPRA 2QLAA 1MQVA 4D4NA 4IB4A 1M6TA 1CGNA 256BA 2XL6A 4ER9A 3HNIA 1CGOA 5JSLA 3QW0A 3FOOA 3M4BA 4CJGA 4JE9A 2XLOA 4CIPA 4U9EA 4CX9A 2XLVA 4D4XA 3DE9A 2YL0A 5JRAA 2YLIA 4N6HA 2BC5A 3U8PA 1E84A 1CPQA 1S05A 2YLDA 2XM0A 3HNKA 5JUAA 4CDVA 1A7VA 1YYJA 2YL1A 5AGFA 3C62A 3M4CA 3HNLA 1BBHA 3TOMA 3IQ5A 2CCYA 2YKZA 4NC3A 1GQAA 5JLIA 5JVEA 4IARA 1APCA 4WGZA 3ZWIA 4L6RA 4CDYA 2YL7A 5JP7A 1YZAA 3QVYA 3QVZA 1RCPA 2YL3A 3ZTZA 4EIYA 5B3IA 1QPUA 1QQ3A 2J9BA 2XLMA 2YLGA 1YYXA 1EKYA 1E85A 3TOLA 2J8WA 4JKVA 3NMJA 3NMKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VRC A;  5JT4 A;  3FOP A;  3ZTM A;  4JEA A;  5JS5 A;  1YZC A;  1LM3 B;  2XL8 A;  4IAQ A;  2XLE A;  4JEB A;  2XLH A;  4CDA A;  4N4W A;  4U9D A;  1NBB A;  3DE8 A;  3L1M A;  3M15 A;  3C63 A;  4WGY A;  1E86 A;  3ZQV A;  3NMI A;  2XLW A;  4ULV A;  3M79 A;  2XLD A;  2XM4 A;  1JAF A;  3HNJ A;  3IQ6 A;  4CJO A;  1E83 A;  3QW1 A;  3ZQY A;  1CPR A;  2QLA A;  1MQV A;  4D4N A;  4IB4 A;  1M6T A;  1CGN A;  256B A;  2XL6 A;  4ER9 A;  3HNI A;  1CGO A;  5JSL A;  3QW0 A;  3FOO A;  3M4B A;  4CJG A;  4JE9 A;  2XLO A;  4CIP A;  4U9E A;  4CX9 A;  2XLV A;  4D4X A;  3DE9 A;  2YL0 A;  5JRA A;  2YLI A;  4N6H A;  2BC5 A;  3U8P A;  1E84 A;  1CPQ A;  1S05 A;  2YLD A;  2XM0 A;  3HNK A;  5JUA A;  4CDV A;  1A7V A;  1YYJ A;  2YL1 A;  5AGF A;  3C62 A;  3M4C A;  3HNL A;  1BBH A;  3TOM A;  3IQ5 A;  2CCY A;  2YKZ A;  4NC3 A;  1GQA A;  5JLI A;  5JVE A;  4IAR A;  1APC A;  4WGZ A;  3ZWI A;  4L6R A;  4CDY A;  2YL7 A;  5JP7 A;  1YZA A;  3QVY A;  3QVZ A;  1RCP A;  2YL3 A;  3ZTZ A;  4EIY A;  5B3I A;  1QPU A;  1QQ3 A;  2J9B A;  2XLM A;  2YLG A;  1YYX A;  1EKY A;  1E85 A;  3TOL A;  2J8W A;  4JKV A;  3NMJ A;  3NMK A; 
#chains in the Genus database with same CATH topology
 2VC9 A;  4H54 A;  1PD0 A;  3FDQ A;  2R7S A;  2J9V A;  3GEH A;  4BJ1 A;  3JYH A;  4DOZ A;  4E0H A;  5AC4 A;  5JT4 A;  5L3Q A;  2EIL C;  4BJT A;  1S7Z A;  3L0I A;  1TKN A;  2G3K A;  2HSB A;  3N2Z B;  1SR2 A;  2WZF A;  3RW0 A;  3X2Q C;  1XWJ A;  2IYL D;  3N0T A;  1YA9 A;  2R7R A;  1VOM A;  4U5E E;  2L9J A;  3U3F A;  3FHD A;  2L7A A;  2R03 A;  3JZ0 A;  4EBJ A;  2W4B A;  3GM1 A;  4JEB A;  2IXP A;  3Q6N A;  1ZW2 A;  4CIH A;  1OR2 A;  5KYU B;  1A0B A;  1C17 M;  5D92 A;  3POV A;  1B68 A;  3H2V A;  3RVZ A;  4CDA A;  4PK4 A;  3PHF 2;  2PBE A;  1KTM A;  2W45 A;  4AX2 A;  3ITF A;  4BJ6 A;  4MQ9 F;  4MVU A;  2B0H A;  4Q7C A;  1ZU5 A;  3M15 A;  2DYS C;  1J8Y F;  2Q00 A;  3QTH A;  3ZQV A;  1G8X A;  3K1I C;  2M64 A;  2XLW A;  3K66 A;  3S29 A;  1OCR C;  1HMO A;  4ULV A;  1OW6 A;  3GOD A;  3ZIB A;  3ECS A;  4DBR A;  4N6C A;  3EHN A;  2J0X A;  2YRF A;  4CJO A;  1OCZ C;  5D91 A;  2VB6 A;  2NSG A;  4PFP A;  1CPR A;  1MQV A;  4GQH A;  4PFO A;  2L81 A;  2KNH A;  2GAQ A;  3PCV A;  1N1C A;  3HLZ A;  1HW2 A;  3AQB A;  4WJ0 A;  4LDR A;  2V3C C;  4E7Z A;  1Z63 A;  3NKE A;  2HJM A;  4J7T A;  2Y3H A;  5A6J A;  5T3T A;  256B A;  1IW7 F;  3G4Z A;  1EI7 A;  1CGO A;  1PV3 A;  3ASN C;  4LAC B;  2ZXR A;  3O55 A;  1T6I A;  3C8G D;  5E3C A;  4BJ5 A;  2H8A A;  2EIN C;  4GYT A;  4CS9 A;  1ZZP A;  4MVQ A;  5B3S C;  1ZU4 A;  1L7C A;  1D1B A;  2NUT B;  2Y3G A;  4JTC B;  4JRZ A;  4C3D A;  2O9X A;  4JTA B;  2ZXW C;  3SEO A;  2J46 A;  2LK4 A;  4CX9 A;  4E7S A;  1PD1 A;  2CNW A;  3NYM A;  3E9V A;  1D0Z A;  3IQC A;  3V5X A;  3W4Y A;  4D4X A;  3KKB A;  2TMV P;  2R7W A;  1JOG A;  1OCC C;  4DXW A;  1FR0 A;  1D1A A;  3DE9 A;  5KYW B;  4XLN F;  4KNW A;  1GS9 A;  1QSP A;  2KK1 A;  2A1D D;  2QUP A;  2KYH A;  2AVK A;  4N6H A;  5KYY A;  4LDK A;  3SXY A;  1NFO A;  2VAS A;  4EWC A;  1E84 A;  1LE2 A;  3LNR A;  4HFK B;  1CGM E;  4MVO A;  1U89 A;  2OJE D;  5L0I A;  1Q0D A;  1YAR O;  3HNK A;  3IPM O;  4IRU A;  4Q4Z F;  1A7E A;  3EHM A;  2IOQ A;  2YL1 A;  1KU2 A;  4KI2 A;  3NYJ A;  2BE5 F;  4B6I A;  1WTY A;  3UR3 C;  3HNL A;  3I4U A;  2W9Y A;  3I5Q A;  2Z15 A;  4XWJ A;  3DJU B;  2OG2 A;  2R9R B;  1J8M F;  1BBH A;  3MLG A;  3SYN A;  3TOM A;  5L0G A;  2CCY A;  3I5P A;  2YKZ A;  3JSE O;  1LE4 A;  5BUO A;  2A6E F;  3H65 A;  3EFO B;  4I1O B;  4Z9H A;  3PDM P;  2LCH A;  2EPO A;  4IAR A;  4QDL A;  3RQE A;  2J9W A;  2ZXO A;  1K40 A;  2Q3T A;  2AP3 A;  5DS5 A;  3MYI A;  3AG4 C;  2NSF A;  3U9J A;  2Y3B A;  3EH1 A;  3KYJ A;  3UMK A;  1HE9 A;  2LD6 A;  3FAP B;  5JP7 A;  2WVO A;  1RCP A;  2F22 A;  3EGX B;  1OQC A;  1WGW A;  5B3I A;  4NQF A;  4YJW A;  3C8Z A;  3ABL C;  4YL1 A;  1T6U A;  4G7H F;  3JRT A;  3B9Q A;  1O87 A;  2L6G A;  4W8P A;  4XEK A;  4C3E A;  4EUK B;  1Z7Q c;  3X1O A;  2JD3 A;  4DRJ B;  1EKY A;  3JT1 A;  2XL4 A;  3T6G B;  1ZHX A;  4BPM A;  2EPK X;  1TQG A;  4JKV A;  2ETS A;  4P6I C;  1E2X A;  2CW0 F;  1MMG A;  2KJG A;  1M2O A;  2NG1 A;  2WVN A;  3NMK A;  5F5F A;  2VH3 A;  4HEA J;  5F5H A;  3VRC A;  2Q4F A;  4BG0 A;  1OKK A;  2HZ8 A;  3ABK C;  1VB5 A;  4CSA C;  3FOP A;  3AOU A;  3RKO F;  4BJ6 C;  1U0B B;  2OKU A;  1M57 C;  1D1C A;  4FX5 A;  2QNL A;  1D0Y A;  1VMA A;  2QE9 A;  2R05 A;  1HY5 A;  3LJB A;  3CSK A;  4G7Z F;  1JR8 A;  1BR1 A;  1LM3 B;  2XLE A;  4CS7 A;  1RKE B;  4J32 B;  4JUR I;  5DS6 A;  2YVK A;  1ZHY A;  4EBK A;  2XLH A;  1QLE C;  1OXK A;  1YVI A;  1LI7 A;  2WL8 A;  4BEM J;  2J0W A;  3DE8 A;  1C03 A;  1ZVZ A;  2HMQ A;  2YZS A;  4R32 A;  5KYY B;  2NUP A;  3TD7 A;  3C63 A;  3KYI A;  2R7T A;  1LIH A;  1E86 A;  1Z6A A;  3GM2 A;  5L0D A;  3NMI A;  1MMA A;  2P61 A;  1I4Z A;  4A4A A;  5CIV A;  3SNH A;  2R7U A;  1WWP A;  3RVY A;  4BJ5 C;  4XLP F;  1Y4C A;  1A41 A;  1AEP A;  1NSG B;  2NPU A;  2PFD A;  3SZR A;  5A6B D;  2MWQ A;  2XLD A;  5DQZ A;  2KSF A;  2XS8 A;  3UMH A;  3Q7L A;  3HNJ A;  3IQ6 A;  1EQ1 A;  4LLC A;  3QW1 A;  3CQZ A;  4LDQ A;  3FVY A;  2LQG A;  1JMW A;  2QLA A;  4PR9 A;  3W2W A;  2HS5 A;  4IB4 A;  3ZQY A;  2OJQ A;  5A6B A;  2ZD9 A;  5GPG B;  4X0R A;  3UGP A;  1CGN A;  3ZVR A;  4AL1 A;  3JRM O;  3DD7 A;  4KNV A;  1BDJ B;  3OEO A;  3VYW A;  3TQO A;  3DAG A;  4ER9 A;  3U0C A;  1IZM A;  2I8B A;  3AQC A;  3M4B A;  4CJG A;  1YDI A;  1OCO C;  2ASR A;  4JE9 A;  3B71 A;  1OXB A;  3T4R A;  1R4T A;  2FFH A;  2P0N A;  2XLO A;  1ZW3 A;  4KC9 A;  2Q7R A;  2Q9B A;  1Z23 A;  2XLV A;  4MND A;  1BR2 A;  2Y69 C;  3LLI A;  1FTS A;  2WVQ A;  1JPN A;  2AWC A;  4JC7 A;  4YK5 A;  1HE1 A;  2X0C A;  5JRA A;  3B0U X;  3W8I A;  2R02 A;  3LLK A;  4O79 A;  1ZHZ A;  4OIP F;  1L3P A;  1I4Y A;  4JTD B;  2BC5 A;  3A9C A;  3BRJ A;  3RQF A;  3TK0 A;  2Q9C A;  1S05 A;  1V74 B;  4JW1 A;  3GOR A;  5KYU A;  5L0C A;  4ANJ A;  5KYX A;  2XRH A;  4CS8 A;  4DRH B;  4G78 A;  4ULW A;  1OR3 A;  3TJ5 A;  4YT8 A;  2XM0 A;  2EIK C;  3CAX A;  3TJ6 A;  2BL2 A;  5JUA A;  3GWL A;  5CI8 A;  4NTB A;  1QKR A;  5COG A;  1ORY A;  2DB4 A;  2OQM A;  1H9G A;  2CGE A;  3ABM C;  3FXH A;  4XEF A;  2Q9A A;  3EFO A;  3ZSU A;  5EGY A;  3A11 A;  5DS4 A;  3IQ5 A;  1VYI A;  2A68 F;  2J7P A;  4I1M A;  3DM5 A;  3LEV A;  1MND A;  1K04 A;  2OOC A;  3HKK A;  3U8V A;  2HJ3 A;  3W8H A;  2R25 A;  2MYS A;  4O7G A;  2YEV A;  3T6J A;  2YL7 A;  2R7X A;  1YZA A;  3QVY A;  2YL3 A;  3QMK A;  4N06 A;  2MHR A;  3EPV A;  3EZI A;  1QVX A;  3MBG A;  3EJN A;  2EIM C;  3VM6 A;  3NYL A;  2XLM A;  4OIN F;  4MTG A;  2OEV A;  3KH2 A;  2H7V C;  1M2V B;  4DRI B;  1M2V A;  3LS1 A;  2HV7 A;  3DAF A;  1ORS C;  5DQT A;  1H9T A;  1RMV A;  1G4U S;  3C7J A;  3MFN A;  4K1O A;  4OIQ F;  2RD9 A;  4GEH A;  4H4K C;  3RIP A;  3Q6M A;  2XSE A;  4F4B A;  3HTK C;  2KQ9 A;  4U5D E;  4NTA A;  1GGQ A;  2KGO A;  4U5G A;  4XQ1 A;  3ZTM A;  3SXM A;  3UNG C;  1WAS A;  1YZC A;  3DKA A;  3DMD A;  5COF A;  4MVZ A;  4OD5 A;  4IAQ A;  1G5Z A;  3V7O A;  1JPJ A;  4CS9 C;  3S84 A;  4J30 B;  3CZ6 A;  4W8K A;  1VK5 A;  2G3V A;  3K1H A;  4E18 A;  2L6H A;  3GWN A;  4U9D A;  3UGO A;  1RJ9 B;  5E2Q A;  5L3V A;  3FAJ A;  2NUP B;  2CNW D;  2YHS A;  4XPW A;  2FGY A;  1NU9 C;  4IWB A;  2R7Q A;  4A2N B;  2GA0 A;  5FZT A;  5COM A;  2B0J A;  5B1A C;  1MMD A;  1TWC A;  1FAP B;  1MMN A;  2P1A A;  4O6N A;  3C8G A;  1K05 A;  2HMZ A;  3LNM B;  3R2P A;  4AK9 A;  1JAF A;  3DWW A;  4JJG A;  5DVW A;  3S0X A;  3AJM A;  4NCQ A;  3AGT A;  1E83 A;  3JCU Q;  3RYL A;  2A6H F;  4D4N A;  4XEV A;  1OKK D;  1Q0G A;  1TFO B;  4ZLD A;  1M6T A;  3NRH A;  3DM9 B;  3PMR A;  4Z9I A;  1LS1 A;  1Q0F A;  4EBB A;  1FNT c;  4HFF B;  3K33 A;  4WAB A;  4RBN A;  2KC3 A;  1OW8 A;  3VAY A;  4DBQ A;  5EHH A;  2JPU A;  1YAU O;  3CEX A;  4NTF A;  3HNI A;  3KMI A;  4RDA A;  2C04 A;  4O6Y A;  5JSL A;  3L8I A;  3ZG1 A;  5L0H A;  4YT2 A;  5IY5 C;  4ONS A;  1UG7 A;  4LER A;  3GEE A;  1YLM A;  4AE4 B;  2RSE B;  3WOD F;  4JVS A;  1H7I A;  2D5R B;  3K6B A;  1GM5 A;  1ZHW A;  3EG9 B;  1O3U A;  4MVR A;  2YL0 A;  5K0I A;  1T6Q A;  3EGD B;  1SZI A;  2W4M A;  3F46 A;  3N24 A;  2C03 A;  2YLI A;  4C7O A;  4C7O B;  4P9T A;  3WG7 C;  3AG2 C;  3EGD A;  1YJG A;  4EHP A;  5BQH A;  5HV9 A;  5L0F A;  1CPQ A;  3ATP A;  2M4E A;  4JIO A;  1TR2 A;  1WAT A;  1RKE A;  4XTK A;  2OU6 A;  3DJN B;  3U9M A;  2E87 A;  1A7V A;  3SP1 A;  3B0P A;  3MYF A;  4C3B A;  1ST6 A;  5AC5 A;  2J45 A;  2PP4 A;  2GDC A;  4YT5 A;  4MW8 A;  3AG3 C;  2IBF A;  1FFH A;  1T9K A;  2J9U A;  3QZC A;  3S27 A;  2OEX A;  4G0H A;  4MS2 A;  1DOV A;  2LFF A;  1TWH A;  3KL4 A;  4MTO A;  1JRA A;  4QI2 A;  4NC3 A;  5JLI A;  4DJ9 A;  2FAP B;  1FFT C;  3EH2 A;  3F47 A;  4PJL A;  3U3B A;  2HFI A;  5A6K A;  2P6V A;  3SXK A;  3GM3 A;  4WGZ A;  4YT4 A;  2IM8 A;  3HJC A;  4MVS A;  4U5B E;  1HMD A;  3ZWI A;  5FCL A;  3J06 A;  1TFK B;  1ORJ A;  4CDY A;  2HV6 A;  2EPN A;  3ZDL A;  3ZC4 A;  4XPY A;  3QVZ A;  4EIY A;  1RKC A;  1VYK A;  4MW3 A;  2ZXP A;  1WN0 A;  1A7D A;  3FMS A;  3C18 A;  1SYQ A;  1QPU A;  1QQ3 A;  1SMY F;  1YA7 O;  2YWA A;  4NY3 A;  3JSZ A;  3EQL F;  1ZHT A;  4EKW A;  1LI5 A;  2PF4 E;  1YYX A;  3O6X A;  2NUT A;  1E85 A;  1O5H A;  3TOL A;  1Z5Z A;  1TWA A;  4OIO F;  4XPX A;  2AU5 A;  1LS4 A;  4LLE A;  4RD9 A;  3M1C B;  5KYW A;  1R5I D;  1ZYR F;  2YQY A;  3K1I A;  1Q0K A;  2DGJ A;  3IHU A;  2GFH A;  2HSQ A;  3O10 A;  1NU7 D;  4YL3 A;  1Q0M A;  2QY9 A;  1V55 C;  2KW3 C;  2WB7 A;  1XZQ A;  4JEA A;  5JS5 A;  3WAQ A;  3US6 A;  2G62 A;  4BEJ A;  3DXJ F;  2XL8 A;  3OWT A;  5HSW A;  3V5Z A;  4O6M A;  2HUJ A;  3GEI A;  4PJN A;  1VLT A;  3S90 A;  1VTM P;  5E33 A;  3O39 A;  2ICW G;  3UMI A;  4CSA A;  4FES A;  1PCX A;  4AL0 A;  5E3A A;  4DVY P;  2IXN A;  3W2V A;  5KYX B;  1FMV A;  1LPE A;  1U6H A;  2XS1 A;  3KPH A;  3DI5 A;  4N4W A;  1NBB A;  3RFY A;  1AUE A;  3L1M A;  4E0I A;  1LVK A;  1H6G A;  4OD4 A;  2JX0 A;  4JCH A;  1KNY A;  4WGY A;  1V4A A;  2I15 A;  2H7O A;  2PNO A;  4I44 A;  2GWW A;  3M79 A;  2XXA B;  4FAP B;  2XXA A;  3C8G B;  3NG1 A;  2XM4 A;  1MNE A;  2IXO A;  3EGX A;  5BQG A;  4U5C E;  1Z3I X;  4MVM A;  4QI0 A;  4ZLC A;  4KBL A;  1RXQ A;  5DLJ A;  4PJM A;  4DVZ A;  3B29 A;  1AVO B;  1LKX A;  1UFB A;  3G50 A;  3LEO A;  4I3M A;  3LES A;  3RH3 A;  3L8J A;  3EZH A;  4M63 A;  4MTF A;  1RJ9 A;  3K7D A;  2DYR C;  4YN0 B;  2J7P D;  4OIR F;  1EA8 A;  1NLX A;  3LUT B;  2EPL X;  2R7O A;  3MX3 A;  4K7B A;  1NG1 A;  2XL6 A;  3QW0 A;  1F1M A;  1C02 A;  3FOO A;  5T1D B;  3U2L A;  2VCC A;  4AE4 A;  4UDV A;  3RQG A;  1HW1 A;  3G4X A;  2HKV A;  1Y6D A;  4E17 A;  4CIP A;  2IXM A;  4U9E A;  4PAC A;  5L0J A;  3B0V C;  3JYY A;  4Z9J A;  3SXZ A;  3U2M A;  2VCA A;  3LAY A;  4P9F A;  1XZP A;  1BR4 A;  3V5Y A;  2PX3 A;  1M56 C;  2LP4 A;  1WOL A;  3L34 A;  4U5F E;  5T3W A;  3LS0 A;  3U5S A;  4CS8 C;  2DI3 A;  2CYD A;  4YL0 A;  2R7V A;  1T5O A;  3T9O A;  3NDB B;  3U8P A;  2VCB A;  1SF8 A;  2UUI A;  3Q7G A;  5TJ5 E;  1G4W R;  1FMW A;  1BZ4 A;  2Y3D A;  2LSE A;  3AGU A;  1D0X A;  1NFN A;  2WZG A;  2EPM X;  2YLD A;  3JTL O;  5F28 E;  5B1B C;  4G7O F;  1I5N A;  3OA1 A;  2D4U A;  4IJJ A;  4CDV A;  4IAO A;  1VLS A;  4U5H A;  4HE8 D;  1YYJ A;  5CI9 A;  4IGG A;  2A0B A;  5AGF A;  3RF3 A;  3NKD A;  3C62 A;  2A69 F;  3ASO C;  3H2U A;  3M4C A;  3TUL A;  2QTV A;  1DOW A;  4Q5S F;  2LFD A;  1V54 C;  2EIJ C;  2WZL A;  3AG1 C;  2H7B A;  4YWQ A;  4JZA A;  2ZPA A;  1GQA A;  1W2W A;  3R7C A;  1OW7 A;  5JVE A;  4K0D A;  5EK0 A;  5A6A A;  3S9O A;  4CBE A;  1APC A;  1QZX A;  3IEE A;  2Y39 A;  3E70 C;  4PJJ A;  4L6R A;  2V26 A;  2AWY A;  3T6B A;  2L6F A;  3WHN A;  1NZE A;  3ZTZ A;  5KYN A;  1T01 A;  5A69 A;  2OCC C;  2P7V A;  4J7Y A;  3DZA A;  3IQT A;  4JJF A;  2J9B A;  2YLG A;  2X51 A;  3S28 A;  3VF0 A;  2PX0 A;  2UUH A;  2LIG A;  5BQI A;  4JCZ A;  2CDQ A;  1TWG A;  3GAN A;  2J8W A;  3NMJ A;  2A0U A;  3BEH A;  4FWV A;  3EG9 A; 
#chains in the Genus database with same CATH homology
 3VRC A;  5JT4 A;  3FOP A;  3ZTM A;  4JEA A;  5JS5 A;  1YZC A;  1LM3 B;  2XL8 A;  4IAQ A;  2XLE A;  4JEB A;  2XLH A;  4CDA A;  4N4W A;  4U9D A;  1NBB A;  3DE8 A;  3L1M A;  3M15 A;  3C63 A;  4WGY A;  1E86 A;  3ZQV A;  3NMI A;  2XLW A;  4ULV A;  3M79 A;  2XLD A;  2XM4 A;  1JAF A;  3HNJ A;  3IQ6 A;  4CJO A;  1E83 A;  3QW1 A;  3ZQY A;  1CPR A;  2QLA A;  1MQV A;  4D4N A;  4IB4 A;  1M6T A;  1CGN A;  256B A;  2XL6 A;  4ER9 A;  3HNI A;  1CGO A;  5JSL A;  3QW0 A;  3FOO A;  3M4B A;  4CJG A;  4JE9 A;  2XLO A;  4CIP A;  4U9E A;  4CX9 A;  2XLV A;  4D4X A;  3DE9 A;  2YL0 A;  5JRA A;  2YLI A;  4N6H A;  2BC5 A;  3U8P A;  1E84 A;  1CPQ A;  1S05 A;  2YLD A;  2XM0 A;  3HNK A;  5JUA A;  4CDV A;  1A7V A;  1YYJ A;  2YL1 A;  5AGF A;  3C62 A;  3M4C A;  3HNL A;  1BBH A;  3TOM A;  3IQ5 A;  2CCY A;  2YKZ A;  4NC3 A;  1GQA A;  5JLI A;  5JVE A;  4IAR A;  1APC A;  4WGZ A;  3ZWI A;  4L6R A;  4CDY A;  2YL7 A;  5JP7 A;  1YZA A;  3QVY A;  3QVZ A;  1RCP A;  2YL3 A;  3ZTZ A;  4EIY A;  5B3I A;  1QPU A;  1QQ3 A;  2J9B A;  2XLM A;  2YLG A;  1YYX A;  1EKY A;  1E85 A;  3TOL A;  2J8W A;  4JKV A;  3NMJ A;  3NMK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...