5JLIA

Nitric oxide complex of the l16a mutant of cytochrome c prime from alcaligenes xylosoxidans
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
127
structure length
127
Chain Sequence
b'EFAKPEDAVKYRQSAATLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c'
publication title Engineering proximal vs. distal heme-NO coordination via dinitrosyl dynamics: implications for NO sensor design.
pubmed doi rcsb
source organism Alcaligenes xylosoxydans xylosoxydans
molecule tags Electron transport
total genus 50
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2016-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 5jliA00
4CDYA 1CGNA 3IQ6A 4D4XA 3NMIA 3M4BA 1EKYA 1BBHA 1CPQA 2BC5A 3HNIA 3L1MA 4N6HA 1GQAA 3ZWIA 5JLIA 1JAFA 1E83A 2CCYA 2YL3A 3HNJA 2XLWA 1LM3B 4WGYA 2QLAA 2YLGA 3HNLA 2XLOA 2XLMA 2YL1A 2XM4A 2J8WA 4WGZA 3QVYA 4IB4A 1E84A 4CJGA 256BA 2YLDA 4JKVA 1YYXA 1E86A 4ER9A 3NMJA 3TOLA 5B3IA 4CX9A 1RCPA 3DE8A 1APCA 4D4NA 4JE9A 1YZCA 4CDAA 4JEAA 1YZAA 2XL6A 2XLEA 3M4CA 2YLIA 2J9BA 3FOPA 5JVEA 3ZQYA 1A7VA 1CGOA 2XLDA 3DE9A 5AGFA 3C62A 1E85A 4IAQA 4L6RA 1MQVA 2XLHA 3M79A 2YL7A 3VRCA 2YKZA 1QQ3A 3IQ5A 4CIPA 2XLVA 3ZQVA 2XL8A 5JS5A 1S05A 1YYJA 3HNKA 4EIYA 5JUAA 4U9EA 4JEBA 3M15A 4U9DA 2YL0A 3FOOA 3QVZA 4CJOA 3TOMA 4N4WA 3ZTZA 3C63A 3U8PA 3ZTMA 4NC3A 1QPUA 1M6TA 1CPRA 3NMKA 3QW1A 4CDVA 1NBBA 4IARA 5JRAA 5JSLA 5JP7A 4ULVA 3QW0A 5JT4A 2XM0A
chains in the Genus database with same CATH superfamily
1NLXA 3V5ZA 3G4XA 3NYLA 4P6IC 4E7ZA 2HV6A 1I4YA 1HE9A 2L6HA 5KYXB 2VB6A 1HW1A 1M2OA 1QVXA 1V4AA 2HS5A 1VLTA 2ZXWC 2NUTB 3LEOA 4XQ1A 1BBHA 2BC5A 2Q4FA 2ZD9A 2HKVA 3NKEA 1YAUO 1LS1A 2D5RB 2KC3A 4DBQA 3EGXB 3JRTA 3LESA 2AVKA 4P9FA 3EZHA 1WN0A 1Q0MA 1I4ZA 4JVSA 4ANJA 3DD7A 4U5CE 1AUEA 3IQTA 2HMZA 3LUTB 3WODF 1ST6A 1TKNA 3VYWA 3W4YA 3UGOA 2DGJA 1XWJA 1PV3A 3EFOA 3NKDA 3C18A 4WGZA 4GYTA 3S9OA 3AG1C 1J8YF 2RD9A 4DXWA 2Y69C 4YT4A 3POVA 5L3VA 1E84A 5KYXA 2IXOA 4M63A 4G0HA 4AX2A 1LIHA 1OCOC 4PJJA 4PJNA 3T6BA 4HFKB 4EBKA 3CEXA 2NUTA 3AQBA 1TWHA 2Q00A 2PF4E 4Z9HA 3DMDA 3TJ6A 4CS9C 4YK5A 3EGXA 1D1AA 2IXPA 2XL4A 4NTAA 3U3FA 1MMAA 4BEMJ 3S28A 3U2LA 2OJED 4U5GA 2J9WA 4KC9A 1LPEA 3JRMO 5DS6A 2J7PD 3GEIA 1Q0GA 1WGWA 2F22A 2Q9AA 3ASNC 4PJMA 1QSPA 2GA0A 4JJGA 4JZAA 2Y3DA 4OIPF 2MYSA 4XEKA 4JURI 1GM5A 4BJ6A 2HZ8A 2R7WA 2R7SA 1ZW2A 3O6XA 4LACB 1YZAA 4PK4A 1VLSA 1Z3IX 2RSEB 2YEVA 1UFBA 3M4CA 3NYMA 4EHPA 1BR1A 2PX0A 2YLIA 1ZU4A 3FMSA 3MLGA 5KYUB 5BQIA 2ZXRA 5JVEA 1AVOB 1M57C 1SF8A 3ZQYA 3I5PA 4J30B 5E33A 1O3UA 3JSEO 2GAQA 2KNHA 3H2VA 3K1IC 1MQVA 3SZRA 2XLHA 3DJNB 3JYHA 3L0IA 2KW3C 3QZCA 2A0UA 2J0XA 1QQ3A 4JTDB 2AU5A 5D91A 3H2UA 3TJ5A 2EPKX 4GEHA 3DJUB 4JJFA 3ZQVA 5JS5A 1Q0FA 1YYJA 3KMIA 4YN0B 3RIPA 2CNWA 4XLNF 2XXAB 3V5YA 3DXJF 1RXQA 2WB7A 4XTKA 4ZLCA 5KYYB 1FFHA 3AOUA 1GGQA 1YLMA 2J45A 5EK0A 3SXYA 2KJGA 4DVYP 2G3VA 1ORYA 2YL0A 5KYUA 3EZIA 2A0BA 3ZTZA 2VCBA 3V5XA 1YA7O 1MMDA 4YT2A 1MMNA 3OWTA 3LJBA 3ZTMA 1FMWA 4NC3A 1QPUA 2DYRC 1OW6A 1BR4A 1CPRA 4MVOA 3GEHA 4HFFB 2QUPA 3IEEA 1A41A 2FGYA 4EUKB 2OU6A 2D4UA 4XPWA 4CS8A 1OCRC 2B0JA 5JP7A 3TULA 4ULVA 4CIHA 4E18A 5L0DA 4I1MA 3L8IA 3QW0A 3SXKA 4EWCA 2EIJC 2YHSA 5KYYA 4QDLA 4DRHB 3H65A 2CYDA 2NSGA 3VAYA 1ZU5A 4MVSA 1CGNA 2CW0F 2ZXOA 1BDJB 5DLJA 1C02A 2X0CA 1NZEA 4D4XA 1JMWA 2O9XA 4Z9IA 2HSBA 3U9MA 3J06A 3S29A 4KI2A 3RQFA 3F47A 5L0FA 1GQAA 3ATPA 4CSAC 1H9GA 1V74B 4Q5SF 2GDCA 1F1MA 4XEVA 3SXMA 3ABMC 3NRHA 3T6GB 1LM3B 5A69A 2QLAA 2WZLA 2OQMA 2J9VA 4EBJA 3AG4C 2OCCC 4MS2A 1D1CA 3S90A 5T1DB 1Z5ZA 1DOWA 4YL0A 4NQFA 4BJ5A 1YJGA 3E9VA 5FCLA 1LI5A 2PBEA 3EQLF 4FX5A 3PMRA 2Q7RA 1NU7D 4OD5A 1T6IA 1D0ZA 1FMVA 2LK4A 1S7ZA 3ABLC 3HLZA 4MW3A 3V7OA 4MVRA 3WHNA 1M2VB 3FXHA 4CS7A 1O5HA 2LD6A 1KU2A 3Q6MA 5T3TA 1VTMP 2L6GA 3WG7C 3DAGA 4JKVA 4JW1A 1AEPA 1E2XA 1L3PA 1ZHXA 4MTOA 1YYXA 2QNLA 4KNVA 4Q7CA 5FZTA 1E86A 2EILC 1ZYRF 4JIOA 1VB5A 4IGGA 2WVNA 4JCHA 2X51A 1D0XA 4IAOA 5E2QA 4EKWA 5HSWA 1RCPA 1TWGA 1VOMA 1YDIA 2R02A 2VCCA 1HE1A 1XZPA 2HJMA 3FVYA 4GQHA 1U89A 2OG2A 3K66A 3N24A 1TFKB 4MVUA 3DE8A 5D92A 3B0VC 2OKUA 1T5OA 4N6CA 5TJ5E 1PD1A 2EPMX 5EHHA 5F5FA 1HW2A 4K0DA 3AGUA 2P6VA 5IY5C 2IM8A 1BZ4A 1LKXA 5E3CA 4BJTA 2IOQA 1VMAA 2J7PA 2EIKC 1M2VA 4IRUA 3TK0A 1RJ9B 1OW7A 1VYKA 2XLDA 4K1OA 3HTKC 3DE9A 3U9JA 3C62A 3MBGA 1LE4A 3KL4A 5T3WA 5COFA 2YQYA 3JCUQ 1PCXA 3GWNA 1NFNA 2DI3A 2W9YA 4O6NA 2MHRA 1HY5A 4W8PA 2KK1A 2LFFA 3GORA 3K7DA 5L3QA 2C04A 1YARO 2H7OA 5COGA 4DJ9A 2Z15A 1TFOB 4WABA 2HJ3A 3HNKA 4CS9A 2YVKA 4IWBA 1JPNA 1Q0DA 3LNMB 3ZC4A 1IW7F 1ZHWA 4Z9JA 2OOCA 1SMYF 4YJWA 4OIQF 2HV7A 4U9EA 1VYIA 4E0IA 4JEBA 1V55C 2Q9CA 3S27A 4C3DA 3NDBB 3MX3A 3NYJA 1ORJA 3DI5A 2IYLD 4MVQA 3UMIA 1RJ9A 2YZSA 1YVIA 1SR2A 3IHUA 2R25A 5L0JA 2R03A 3C63A 1FAPB 1SZIA 1WOLA 3BEHA 3LEVA 3CZ6A 3T6JA 3X1OA 3S0XA 4OD4A 3ABKC 3K33A 3NMKA 1HMOA 3QW1A 4I1OB 4G7ZF 3C7JA 1FNTc 2Y3GA 4PJLA 1RMVA 2H7VC 3FHDA 5F5HA 1JOGA 2A69F 4JTCB 3JT1A 3E70C 1U0BB 3K1IA 3U2MA 1TQGA 1WWPA 2LCHA 4MVMA 3SNHA 2A6EF 2M4EA 2XM0A 3CSKA 3JSZA 1ZVZA 2HFIA 5JT4A 4CDYA 4QI2A 2KGOA 2V26A 1LI7A 3B71A 5A6KA 3C8GB 4F4BA 3IQ6A 4O7GA 2AP3A 2G3KA 4U5DE 2R7XA 4H4KC 4G7HF 2R7VA 2VCAA 1N1CA 4WJ0A 3HNIA 4PFPA 1G4WR 5JLIA 4BPMA 3ZSUA 1JAFA 2VC9A 4QI0A 2FAPB 1NSGB 2CCYA 2YL3A 3HNJA 3IPMO 4K7BA 3UNGC 5AC4A 3GM2A 3Q6NA 1OW8A 2J46A 4UDVA 1CGME 2ASRA 3DAFA 3EH1A 2PP4A 3W2VA 1JRAA 2WZGA 2R05A 3BRJA 3N2ZB 3HNLA 4DOZA 4O6MA 1ZHYA 2DYSC 5DQZA 2XLOA 3F46A 1C17M 2V3CC 1I5NA 1QZXA 4NTFA 2J9UA 3C8GA 3KPHA 5AC5A 3T4RA 1UG7A 3K6BA 3L34A 4U5BE 3U8VA 4NTBA 4BJ1A 1R4TA 2CDQA 1T01A 2YRFA 3I5QA 3RKOF 3T9OA 3ZVRA 1OCZC 2L81A 3UMHA 2Q9BA 4CJGA 1OKKD 3EPVA 4E17A 5A6JA 256BA 4HEAJ 4MNDA 2JPUA 4J32B 3CQZA 5K0IA 2PFDA 4PACA 3ASOC 1R5ID 1TR2A 3K1HA 4LDRA 1OQCA 1C03A 4LDKA 4ER9A 3NMJA 4C3BA 3SXZA 3HKKA 4CX9A 4E0HA 3G50A 3AG2C 3DZAA 2EIMC 3U5SA 4CSAA 2BL2A 3TD7A 1D1BA 5EGYA 2OJQA 1VK5A 3SP1A 5B1BC 4XEFA 4D4NA 4JE9A 4XWJA 1YZCA 3ZDLA 3ZG1A 4B6IA 4CDAA 2HMQA 4JRZA 1LVKA 3DM5A 2WVOA 2L9JA 2XL6A 3RQGA 2IXNA 1T6UA 3US6A 5DS5A 4OIOF 3W8HA 3LAYA 1U6HA 2J9BA 2IXMA 3AG3C 3LNRA 2ZPAA 2M64A 4U5EE 1K40A 4OINF 2VASA 2WZFA 2QTVA 4ONSA 1M56C 5AGFA 2I15A 5B1AC 1E85A 1Y4CA 3O39A 4G78A 3B29A 2YWAA 3M79A 4LLEA 2WVQA 2YL7A 2YKZA 3ITFA 1NG1A 4W8KA 2GWWA 4J7TA 3IQ5A 1JPJA 4CIPA 4FESA 4PR9A 4MTFA 3RQEA 2VH3A 4YWQA 1Z63A 1E83A 3NG1A 1S05A 2ETSA 4OIRF 4LERA 1FTSA 2XSEA 5KYWB 5DVWA 3GM3A 1IZMA 1L7CA 4BEJA 4C3EA 4EIYA 4YT8A 2LIGA 4G7OF 1GS9A 2A1DD 4JC7A 5BQHA 4E7SA 5A6BD 2A6HF 1Q0KA 4P9TA 1JR8A 1DOVA 1RKCA 2DB4A 3FOOA 2EINC 3O55A 4MW8A 4YL3A 2UUIA 5CI9A 3TOMA 3W8IA 2LFDA 3VF0A 2HSQA 4DVZA 1A7EA 3QMKA 1ZHTA 1TWCA 1G5ZA 3JYYA 3R2PA 3Q7GA 4I44A 1WATA 4CDVA 2XS1A 4IARA 4KBLA 1Z7Qc 5JSLA 1EQ1A 2R7UA 5L0IA 4FAPB 3RVZA 1MNEA 2WL8A 3WAQA 4I3MA 1OCCC 4AL0A 5KYWA 2JX0A 2XRHA 5GPGB 4ULWA 3CAXA 3PCVA 3UR3C 3A9CA 2W45A 3TOLA 2LSEA 2KYHA 4FWVA 2Y39A 5DQTA 2QY9A 2H7BA 1FFTC 3MFNA 1W2WA 3RVYA 4BG0A 1V54C 2R7QA 1HMDA 1RKEB 3NMIA 3L8JA 3M4BA 4XLPF 4R32A 2EPOA 4MQ9F 3AGTA 1H6GA 1CPQA 3KKBA 2Q3TA 3L1MA 4N6HA 3ZWIA 1PD0A 4A2NB 3DWWA 4EBBA 2R7RA 5BUOA 1A0BA 1WTYA 3MYIA 4KNWA 3RH3A 2XLWA 2HUJA 3GWLA 4O6YA 4BJ6C 4RDAA 4WGYA 4N06A 2YLGA 1D0YA 2JD3A 3B9QA 3I4UA 2P0NA 5COMA 4JTAB 1Z6AA 4LLCA 4NY3A 5BQGA 3RYLA 4MTGA 5HV9A 1B68A 1MMGA 1XZQA 2PNOA 4HE8D 4J7YA 1EI7A 3KH2A 3KYIA 3OA1A 3UMKA 3EG9B 2NPUA 1Y6DA 2UUHA 1Z23A 4YL1A 5B3SC 4RD9A 2G62A 2XLMA 2YL1A 2XM4A 3LLKA 4NCQA 1KTMA 4C7OB 2J8WA 3EGDB 4U5FE 3QVYA 2P7VA 3RFYA 1OR3A 4IB4A 1WASA 5E3AA 4AK9A 5L0GA 4Q4ZF 1RKEA 3U0CA 1O87A 1QLEC 2QE9A 4YT5A 1A7DA 3R7CA 2NUPB 1ORSC 2XS8A 3GANA 3W2WA 2YLDA 2R9RB 4AE4B 2A68F 5KYNA 5CI8A 4RBNA 1ZZPA 4PFOA 3X2QC 2XXAA 2IBFA 3KYJA 1K05A 5B3IA 3GODA 3FDQA 3QTHA 3C8ZA 4A4AA 1QKRA 2GFHA 3AJMA 1OKKA 3EHNA 3EG9A 4XPXA 1APCA 1OR2A 3EHMA 3Q7LA 2NG1A 4JEAA 1T6QA 2ZXPA 4C7OA 3EGDA 2XLEA 2MWQA 2EPNA 2AWCA 5F28E 2C03A 5L0CA 2H8AA 3FOPA 2W4BA 3SYNA 1NFOA 5CIVA 1NU9C 2R7OA 1A7VA 1CGOA 2J0WA 3B0PA 1EA8A 2CNWD 4JCZA 2NUPA 4CS8C 2E87A 3IQCA 4IAQA 4AE4A 3N0TA 4CBEA 3LLIA 4L6RA 3JTLO 2PX3A 3JZ0A 2Y3BA 3VRCA 4ZLDA 1BR2A 3OEOA 4O79A 1G8XA 3VM6A 4IJJA 2XLVA 2B0HA 3ECSA 2XL8A 3PHF2 2ICWG 1LE2A 5L0HA 1ZHZA 2LP4A 4DRJB 3M1CB 2FFHA 3SEOA 3ZIBA 4X0RA 1OXKA 5JUAA 3GEEA 2NSFA 2R7TA 1EKYA 5DS4A 3M15A 2EPLX 1SYQA 3MYFA 4U9DA 4DBRA 1TWAA 3EH2A 3B0UX 3QVZA 2Y3HA 4CJOA 2P61A 2AWYA 3AQCA 3FAJA 3TQOA 2L6FA 4DRIB 3PDMP 1ZW3A 3FAPB 1J8MF 3U8PA 1KNYA 3RF3A 1FR0A 1M6TA 3DM9B 3A11A 3LS1A 4LDQA 2BE5F 3EJNA 3HJCA 1MNDA 1H9TA 2P1AA 3C8GD 4U5HA 4XPYA 1YA9A 1NBBA 2OEXA 4BJ5C 5JRAA 1H7IA 2I8BA 2L7AA 3LS0A 5A6BA 3RW0A 1G4US 3UGPA 4AL1A 3G4ZA 3DKAA 1LS4A 1OXBA 2CGEA 3GM1A 2KQ9A 4MVZA 3U3BA 2OEVA 5A6AA 3S84A 1K04A 2TMVP 2W4MA 1T9KA 2LQGA 3O10A 4N4WA 4H54A 2KSFA 3EFOB
chains in the Genus database with same CATH topology
4CDYA 1CGNA 3IQ6A 4D4XA 3NMIA 3M4BA 1EKYA 1BBHA 1CPQA 2BC5A 3HNIA 3L1MA 4N6HA 1GQAA 3ZWIA 5JLIA 1JAFA 1E83A 2CCYA 2YL3A 3HNJA 2XLWA 1LM3B 4WGYA 2QLAA 2YLGA 3HNLA 2XLOA 2XLMA 2YL1A 2XM4A 2J8WA 4WGZA 3QVYA 4IB4A 1E84A 4CJGA 256BA 2YLDA 4JKVA 1YYXA 1E86A 4ER9A 3NMJA 3TOLA 5B3IA 4CX9A 1RCPA 3DE8A 1APCA 4D4NA 4JE9A 1YZCA 4CDAA 4JEAA 1YZAA 2XL6A 2XLEA 3M4CA 2YLIA 2J9BA 3FOPA 5JVEA 3ZQYA 1A7VA 1CGOA 2XLDA 3DE9A 5AGFA 3C62A 1E85A 4IAQA 4L6RA 1MQVA 2XLHA 3M79A 2YL7A 3VRCA 2YKZA 1QQ3A 3IQ5A 4CIPA 2XLVA 3ZQVA 2XL8A 5JS5A 1S05A 1YYJA 3HNKA 4EIYA 5JUAA 4U9EA 4JEBA 3M15A 4U9DA 2YL0A 3FOOA 3QVZA 4CJOA 3TOMA 4N4WA 3ZTZA 3C63A 3U8PA 3ZTMA 4NC3A 1QPUA 1M6TA 1CPRA 3NMKA 3QW1A 4CDVA 1NBBA 4IARA 5JRAA 5JSLA 5JP7A 4ULVA 3QW0A 5JT4A 2XM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CDY A;  1CGN A;  3IQ6 A;  4D4X A;  3NMI A;  3M4B A;  1EKY A;  1BBH A;  1CPQ A;  2BC5 A;  3HNI A;  3L1M A;  4N6H A;  1GQA A;  3ZWI A;  5JLI A;  1JAF A;  1E83 A;  2CCY A;  2YL3 A;  3HNJ A;  2XLW A;  1LM3 B;  4WGY A;  2QLA A;  2YLG A;  3HNL A;  2XLO A;  2XLM A;  2YL1 A;  2XM4 A;  2J8W A;  4WGZ A;  3QVY A;  4IB4 A;  1E84 A;  4CJG A;  256B A;  2YLD A;  4JKV A;  1YYX A;  1E86 A;  4ER9 A;  3NMJ A;  3TOL A;  5B3I A;  4CX9 A;  1RCP A;  3DE8 A;  1APC A;  4D4N A;  4JE9 A;  1YZC A;  4CDA A;  4JEA A;  1YZA A;  2XL6 A;  2XLE A;  3M4C A;  2YLI A;  2J9B A;  3FOP A;  5JVE A;  3ZQY A;  1A7V A;  1CGO A;  2XLD A;  3DE9 A;  5AGF A;  3C62 A;  1E85 A;  4IAQ A;  4L6R A;  1MQV A;  2XLH A;  3M79 A;  2YL7 A;  3VRC A;  2YKZ A;  1QQ3 A;  3IQ5 A;  4CIP A;  2XLV A;  3ZQV A;  2XL8 A;  5JS5 A;  1S05 A;  1YYJ A;  3HNK A;  4EIY A;  5JUA A;  4U9E A;  4JEB A;  3M15 A;  4U9D A;  2YL0 A;  3FOO A;  3QVZ A;  4CJO A;  3TOM A;  4N4W A;  3ZTZ A;  3C63 A;  3U8P A;  3ZTM A;  4NC3 A;  1QPU A;  1M6T A;  1CPR A;  3NMK A;  3QW1 A;  4CDV A;  1NBB A;  4IAR A;  5JRA A;  5JSL A;  5JP7 A;  4ULV A;  3QW0 A;  5JT4 A;  2XM0 A; 
#chains in the Genus database with same CATH topology
 1NLX A;  3V5Z A;  3G4X A;  3NYL A;  4P6I C;  4E7Z A;  2HV6 A;  1I4Y A;  1HE9 A;  2L6H A;  5KYX B;  2VB6 A;  1HW1 A;  1M2O A;  1QVX A;  1V4A A;  2HS5 A;  1VLT A;  2ZXW C;  2NUT B;  3LEO A;  4XQ1 A;  1BBH A;  2BC5 A;  2Q4F A;  2ZD9 A;  2HKV A;  3NKE A;  1YAU O;  1LS1 A;  2D5R B;  2KC3 A;  4DBQ A;  3EGX B;  3JRT A;  3LES A;  2AVK A;  4P9F A;  3EZH A;  1WN0 A;  1Q0M A;  1I4Z A;  4JVS A;  4ANJ A;  3DD7 A;  4U5C E;  1AUE A;  3IQT A;  2HMZ A;  3LUT B;  3WOD F;  1ST6 A;  1TKN A;  3VYW A;  3W4Y A;  3UGO A;  2DGJ A;  1XWJ A;  1PV3 A;  3EFO A;  3NKD A;  3C18 A;  4WGZ A;  4GYT A;  3S9O A;  3AG1 C;  1J8Y F;  2RD9 A;  4DXW A;  2Y69 C;  4YT4 A;  3POV A;  5L3V A;  1E84 A;  5KYX A;  2IXO A;  4M63 A;  4G0H A;  4AX2 A;  1LIH A;  1OCO C;  4PJJ A;  4PJN A;  3T6B A;  4HFK B;  4EBK A;  3CEX A;  2NUT A;  3AQB A;  1TWH A;  2Q00 A;  2PF4 E;  4Z9H A;  3DMD A;  3TJ6 A;  4CS9 C;  4YK5 A;  3EGX A;  1D1A A;  2IXP A;  2XL4 A;  4NTA A;  3U3F A;  1MMA A;  4BEM J;  3S28 A;  3U2L A;  2OJE D;  4U5G A;  2J9W A;  4KC9 A;  1LPE A;  3JRM O;  5DS6 A;  2J7P D;  3GEI A;  1Q0G A;  1WGW A;  2F22 A;  2Q9A A;  3ASN C;  4PJM A;  1QSP A;  2GA0 A;  4JJG A;  4JZA A;  2Y3D A;  4OIP F;  2MYS A;  4XEK A;  4JUR I;  1GM5 A;  4BJ6 A;  2HZ8 A;  2R7W A;  2R7S A;  1ZW2 A;  3O6X A;  4LAC B;  1YZA A;  4PK4 A;  1VLS A;  1Z3I X;  2RSE B;  2YEV A;  1UFB A;  3M4C A;  3NYM A;  4EHP A;  1BR1 A;  2PX0 A;  2YLI A;  1ZU4 A;  3FMS A;  3MLG A;  5KYU B;  5BQI A;  2ZXR A;  5JVE A;  1AVO B;  1M57 C;  1SF8 A;  3ZQY A;  3I5P A;  4J30 B;  5E33 A;  1O3U A;  3JSE O;  2GAQ A;  2KNH A;  3H2V A;  3K1I C;  1MQV A;  3SZR A;  2XLH A;  3DJN B;  3JYH A;  3L0I A;  2KW3 C;  3QZC A;  2A0U A;  2J0X A;  1QQ3 A;  4JTD B;  2AU5 A;  5D91 A;  3H2U A;  3TJ5 A;  2EPK X;  4GEH A;  3DJU B;  4JJF A;  3ZQV A;  5JS5 A;  1Q0F A;  1YYJ A;  3KMI A;  4YN0 B;  3RIP A;  2CNW A;  4XLN F;  2XXA B;  3V5Y A;  3DXJ F;  1RXQ A;  2WB7 A;  4XTK A;  4ZLC A;  5KYY B;  1FFH A;  3AOU A;  1GGQ A;  1YLM A;  2J45 A;  5EK0 A;  3SXY A;  2KJG A;  4DVY P;  2G3V A;  1ORY A;  2YL0 A;  5KYU A;  3EZI A;  2A0B A;  3ZTZ A;  2VCB A;  3V5X A;  1YA7 O;  1MMD A;  4YT2 A;  1MMN A;  3OWT A;  3LJB A;  3ZTM A;  1FMW A;  4NC3 A;  1QPU A;  2DYR C;  1OW6 A;  1BR4 A;  1CPR A;  4MVO A;  3GEH A;  4HFF B;  2QUP A;  3IEE A;  1A41 A;  2FGY A;  4EUK B;  2OU6 A;  2D4U A;  4XPW A;  4CS8 A;  1OCR C;  2B0J A;  5JP7 A;  3TUL A;  4ULV A;  4CIH A;  4E18 A;  5L0D A;  4I1M A;  3L8I A;  3QW0 A;  3SXK A;  4EWC A;  2EIJ C;  2YHS A;  5KYY A;  4QDL A;  4DRH B;  3H65 A;  2CYD A;  2NSG A;  3VAY A;  1ZU5 A;  4MVS A;  1CGN A;  2CW0 F;  2ZXO A;  1BDJ B;  5DLJ A;  1C02 A;  2X0C A;  1NZE A;  4D4X A;  1JMW A;  2O9X A;  4Z9I A;  2HSB A;  3U9M A;  3J06 A;  3S29 A;  4KI2 A;  3RQF A;  3F47 A;  5L0F A;  1GQA A;  3ATP A;  4CSA C;  1H9G A;  1V74 B;  4Q5S F;  2GDC A;  1F1M A;  4XEV A;  3SXM A;  3ABM C;  3NRH A;  3T6G B;  1LM3 B;  5A69 A;  2QLA A;  2WZL A;  2OQM A;  2J9V A;  4EBJ A;  3AG4 C;  2OCC C;  4MS2 A;  1D1C A;  3S90 A;  5T1D B;  1Z5Z A;  1DOW A;  4YL0 A;  4NQF A;  4BJ5 A;  1YJG A;  3E9V A;  5FCL A;  1LI5 A;  2PBE A;  3EQL F;  4FX5 A;  3PMR A;  2Q7R A;  1NU7 D;  4OD5 A;  1T6I A;  1D0Z A;  1FMV A;  2LK4 A;  1S7Z A;  3ABL C;  3HLZ A;  4MW3 A;  3V7O A;  4MVR A;  3WHN A;  1M2V B;  3FXH A;  4CS7 A;  1O5H A;  2LD6 A;  1KU2 A;  3Q6M A;  5T3T A;  1VTM P;  2L6G A;  3WG7 C;  3DAG A;  4JKV A;  4JW1 A;  1AEP A;  1E2X A;  1L3P A;  1ZHX A;  4MTO A;  1YYX A;  2QNL A;  4KNV A;  4Q7C A;  5FZT A;  1E86 A;  2EIL C;  1ZYR F;  4JIO A;  1VB5 A;  4IGG A;  2WVN A;  4JCH A;  2X51 A;  1D0X A;  4IAO A;  5E2Q A;  4EKW A;  5HSW A;  1RCP A;  1TWG A;  1VOM A;  1YDI A;  2R02 A;  2VCC A;  1HE1 A;  1XZP A;  2HJM A;  3FVY A;  4GQH A;  1U89 A;  2OG2 A;  3K66 A;  3N24 A;  1TFK B;  4MVU A;  3DE8 A;  5D92 A;  3B0V C;  2OKU A;  1T5O A;  4N6C A;  5TJ5 E;  1PD1 A;  2EPM X;  5EHH A;  5F5F A;  1HW2 A;  4K0D A;  3AGU A;  2P6V A;  5IY5 C;  2IM8 A;  1BZ4 A;  1LKX A;  5E3C A;  4BJT A;  2IOQ A;  1VMA A;  2J7P A;  2EIK C;  1M2V A;  4IRU A;  3TK0 A;  1RJ9 B;  1OW7 A;  1VYK A;  2XLD A;  4K1O A;  3HTK C;  3DE9 A;  3U9J A;  3C62 A;  3MBG A;  1LE4 A;  3KL4 A;  5T3W A;  5COF A;  2YQY A;  3JCU Q;  1PCX A;  3GWN A;  1NFN A;  2DI3 A;  2W9Y A;  4O6N A;  2MHR A;  1HY5 A;  4W8P A;  2KK1 A;  2LFF A;  3GOR A;  3K7D A;  5L3Q A;  2C04 A;  1YAR O;  2H7O A;  5COG A;  4DJ9 A;  2Z15 A;  1TFO B;  4WAB A;  2HJ3 A;  3HNK A;  4CS9 A;  2YVK A;  4IWB A;  1JPN A;  1Q0D A;  3LNM B;  3ZC4 A;  1IW7 F;  1ZHW A;  4Z9J A;  2OOC A;  1SMY F;  4YJW A;  4OIQ F;  2HV7 A;  4U9E A;  1VYI A;  4E0I A;  4JEB A;  1V55 C;  2Q9C A;  3S27 A;  4C3D A;  3NDB B;  3MX3 A;  3NYJ A;  1ORJ A;  3DI5 A;  2IYL D;  4MVQ A;  3UMI A;  1RJ9 A;  2YZS A;  1YVI A;  1SR2 A;  3IHU A;  2R25 A;  5L0J A;  2R03 A;  3C63 A;  1FAP B;  1SZI A;  1WOL A;  3BEH A;  3LEV A;  3CZ6 A;  3T6J A;  3X1O A;  3S0X A;  4OD4 A;  3ABK C;  3K33 A;  3NMK A;  1HMO A;  3QW1 A;  4I1O B;  4G7Z F;  3C7J A;  1FNT c;  2Y3G A;  4PJL A;  1RMV A;  2H7V C;  3FHD A;  5F5H A;  1JOG A;  2A69 F;  4JTC B;  3JT1 A;  3E70 C;  1U0B B;  3K1I A;  3U2M A;  1TQG A;  1WWP A;  2LCH A;  4MVM A;  3SNH A;  2A6E F;  2M4E A;  2XM0 A;  3CSK A;  3JSZ A;  1ZVZ A;  2HFI A;  5JT4 A;  4CDY A;  4QI2 A;  2KGO A;  2V26 A;  1LI7 A;  3B71 A;  5A6K A;  3C8G B;  4F4B A;  3IQ6 A;  4O7G A;  2AP3 A;  2G3K A;  4U5D E;  2R7X A;  4H4K C;  4G7H F;  2R7V A;  2VCA A;  1N1C A;  4WJ0 A;  3HNI A;  4PFP A;  1G4W R;  5JLI A;  4BPM A;  3ZSU A;  1JAF A;  2VC9 A;  4QI0 A;  2FAP B;  1NSG B;  2CCY A;  2YL3 A;  3HNJ A;  3IPM O;  4K7B A;  3UNG C;  5AC4 A;  3GM2 A;  3Q6N A;  1OW8 A;  2J46 A;  4UDV A;  1CGM E;  2ASR A;  3DAF A;  3EH1 A;  2PP4 A;  3W2V A;  1JRA A;  2WZG A;  2R05 A;  3BRJ A;  3N2Z B;  3HNL A;  4DOZ A;  4O6M A;  1ZHY A;  2DYS C;  5DQZ A;  2XLO A;  3F46 A;  1C17 M;  2V3C C;  1I5N A;  1QZX A;  4NTF A;  2J9U A;  3C8G A;  3KPH A;  5AC5 A;  3T4R A;  1UG7 A;  3K6B A;  3L34 A;  4U5B E;  3U8V A;  4NTB A;  4BJ1 A;  1R4T A;  2CDQ A;  1T01 A;  2YRF A;  3I5Q A;  3RKO F;  3T9O A;  3ZVR A;  1OCZ C;  2L81 A;  3UMH A;  2Q9B A;  4CJG A;  1OKK D;  3EPV A;  4E17 A;  5A6J A;  256B A;  4HEA J;  4MND A;  2JPU A;  4J32 B;  3CQZ A;  5K0I A;  2PFD A;  4PAC A;  3ASO C;  1R5I D;  1TR2 A;  3K1H A;  4LDR A;  1OQC A;  1C03 A;  4LDK A;  4ER9 A;  3NMJ A;  4C3B A;  3SXZ A;  3HKK A;  4CX9 A;  4E0H A;  3G50 A;  3AG2 C;  3DZA A;  2EIM C;  3U5S A;  4CSA A;  2BL2 A;  3TD7 A;  1D1B A;  5EGY A;  2OJQ A;  1VK5 A;  3SP1 A;  5B1B C;  4XEF A;  4D4N A;  4JE9 A;  4XWJ A;  1YZC A;  3ZDL A;  3ZG1 A;  4B6I A;  4CDA A;  2HMQ A;  4JRZ A;  1LVK A;  3DM5 A;  2WVO A;  2L9J A;  2XL6 A;  3RQG A;  2IXN A;  1T6U A;  3US6 A;  5DS5 A;  4OIO F;  3W8H A;  3LAY A;  1U6H A;  2J9B A;  2IXM A;  3AG3 C;  3LNR A;  2ZPA A;  2M64 A;  4U5E E;  1K40 A;  4OIN F;  2VAS A;  2WZF A;  2QTV A;  4ONS A;  1M56 C;  5AGF A;  2I15 A;  5B1A C;  1E85 A;  1Y4C A;  3O39 A;  4G78 A;  3B29 A;  2YWA A;  3M79 A;  4LLE A;  2WVQ A;  2YL7 A;  2YKZ A;  3ITF A;  1NG1 A;  4W8K A;  2GWW A;  4J7T A;  3IQ5 A;  1JPJ A;  4CIP A;  4FES A;  4PR9 A;  4MTF A;  3RQE A;  2VH3 A;  4YWQ A;  1Z63 A;  1E83 A;  3NG1 A;  1S05 A;  2ETS A;  4OIR F;  4LER A;  1FTS A;  2XSE A;  5KYW B;  5DVW A;  3GM3 A;  1IZM A;  1L7C A;  4BEJ A;  4C3E A;  4EIY A;  4YT8 A;  2LIG A;  4G7O F;  1GS9 A;  2A1D D;  4JC7 A;  5BQH A;  4E7S A;  5A6B D;  2A6H F;  1Q0K A;  4P9T A;  1JR8 A;  1DOV A;  1RKC A;  2DB4 A;  3FOO A;  2EIN C;  3O55 A;  4MW8 A;  4YL3 A;  2UUI A;  5CI9 A;  3TOM A;  3W8I A;  2LFD A;  3VF0 A;  2HSQ A;  4DVZ A;  1A7E A;  3QMK A;  1ZHT A;  1TWC A;  1G5Z A;  3JYY A;  3R2P A;  3Q7G A;  4I44 A;  1WAT A;  4CDV A;  2XS1 A;  4IAR A;  4KBL A;  1Z7Q c;  5JSL A;  1EQ1 A;  2R7U A;  5L0I A;  4FAP B;  3RVZ A;  1MNE A;  2WL8 A;  3WAQ A;  4I3M A;  1OCC C;  4AL0 A;  5KYW A;  2JX0 A;  2XRH A;  5GPG B;  4ULW A;  3CAX A;  3PCV A;  3UR3 C;  3A9C A;  2W45 A;  3TOL A;  2LSE A;  2KYH A;  4FWV A;  2Y39 A;  5DQT A;  2QY9 A;  2H7B A;  1FFT C;  3MFN A;  1W2W A;  3RVY A;  4BG0 A;  1V54 C;  2R7Q A;  1HMD A;  1RKE B;  3NMI A;  3L8J A;  3M4B A;  4XLP F;  4R32 A;  2EPO A;  4MQ9 F;  3AGT A;  1H6G A;  1CPQ A;  3KKB A;  2Q3T A;  3L1M A;  4N6H A;  3ZWI A;  1PD0 A;  4A2N B;  3DWW A;  4EBB A;  2R7R A;  5BUO A;  1A0B A;  1WTY A;  3MYI A;  4KNW A;  3RH3 A;  2XLW A;  2HUJ A;  3GWL A;  4O6Y A;  4BJ6 C;  4RDA A;  4WGY A;  4N06 A;  2YLG A;  1D0Y A;  2JD3 A;  3B9Q A;  3I4U A;  2P0N A;  5COM A;  4JTA B;  1Z6A A;  4LLC A;  4NY3 A;  5BQG A;  3RYL A;  4MTG A;  5HV9 A;  1B68 A;  1MMG A;  1XZQ A;  2PNO A;  4HE8 D;  4J7Y A;  1EI7 A;  3KH2 A;  3KYI A;  3OA1 A;  3UMK A;  3EG9 B;  2NPU A;  1Y6D A;  2UUH A;  1Z23 A;  4YL1 A;  5B3S C;  4RD9 A;  2G62 A;  2XLM A;  2YL1 A;  2XM4 A;  3LLK A;  4NCQ A;  1KTM A;  4C7O B;  2J8W A;  3EGD B;  4U5F E;  3QVY A;  2P7V A;  3RFY A;  1OR3 A;  4IB4 A;  1WAS A;  5E3A A;  4AK9 A;  5L0G A;  4Q4Z F;  1RKE A;  3U0C A;  1O87 A;  1QLE C;  2QE9 A;  4YT5 A;  1A7D A;  3R7C A;  2NUP B;  1ORS C;  2XS8 A;  3GAN A;  3W2W A;  2YLD A;  2R9R B;  4AE4 B;  2A68 F;  5KYN A;  5CI8 A;  4RBN A;  1ZZP A;  4PFO A;  3X2Q C;  2XXA A;  2IBF A;  3KYJ A;  1K05 A;  5B3I A;  3GOD A;  3FDQ A;  3QTH A;  3C8Z A;  4A4A A;  1QKR A;  2GFH A;  3AJM A;  1OKK A;  3EHN A;  3EG9 A;  4XPX A;  1APC A;  1OR2 A;  3EHM A;  3Q7L A;  2NG1 A;  4JEA A;  1T6Q A;  2ZXP A;  4C7O A;  3EGD A;  2XLE A;  2MWQ A;  2EPN A;  2AWC A;  5F28 E;  2C03 A;  5L0C A;  2H8A A;  3FOP A;  2W4B A;  3SYN A;  1NFO A;  5CIV A;  1NU9 C;  2R7O A;  1A7V A;  1CGO A;  2J0W A;  3B0P A;  1EA8 A;  2CNW D;  4JCZ A;  2NUP A;  4CS8 C;  2E87 A;  3IQC A;  4IAQ A;  4AE4 A;  3N0T A;  4CBE A;  3LLI A;  4L6R A;  3JTL O;  2PX3 A;  3JZ0 A;  2Y3B A;  3VRC A;  4ZLD A;  1BR2 A;  3OEO A;  4O79 A;  1G8X A;  3VM6 A;  4IJJ A;  2XLV A;  2B0H A;  3ECS A;  2XL8 A;  3PHF 2;  2ICW G;  1LE2 A;  5L0H A;  1ZHZ A;  2LP4 A;  4DRJ B;  3M1C B;  2FFH A;  3SEO A;  3ZIB A;  4X0R A;  1OXK A;  5JUA A;  3GEE A;  2NSF A;  2R7T A;  1EKY A;  5DS4 A;  3M15 A;  2EPL X;  1SYQ A;  3MYF A;  4U9D A;  4DBR A;  1TWA A;  3EH2 A;  3B0U X;  3QVZ A;  2Y3H A;  4CJO A;  2P61 A;  2AWY A;  3AQC A;  3FAJ A;  3TQO A;  2L6F A;  4DRI B;  3PDM P;  1ZW3 A;  3FAP B;  1J8M F;  3U8P A;  1KNY A;  3RF3 A;  1FR0 A;  1M6T A;  3DM9 B;  3A11 A;  3LS1 A;  4LDQ A;  2BE5 F;  3EJN A;  3HJC A;  1MND A;  1H9T A;  2P1A A;  3C8G D;  4U5H A;  4XPY A;  1YA9 A;  1NBB A;  2OEX A;  4BJ5 C;  5JRA A;  1H7I A;  2I8B A;  2L7A A;  3LS0 A;  5A6B A;  3RW0 A;  1G4U S;  3UGP A;  4AL1 A;  3G4Z A;  3DKA A;  1LS4 A;  1OXB A;  2CGE A;  3GM1 A;  2KQ9 A;  4MVZ A;  3U3B A;  2OEV A;  5A6A A;  3S84 A;  1K04 A;  2TMV P;  2W4M A;  1T9K A;  2LQG A;  3O10 A;  4N4W A;  4H54 A;  2KSF A;  3EFO B; 
#chains in the Genus database with same CATH homology
 4CDY A;  1CGN A;  3IQ6 A;  4D4X A;  3NMI A;  3M4B A;  1EKY A;  1BBH A;  1CPQ A;  2BC5 A;  3HNI A;  3L1M A;  4N6H A;  1GQA A;  3ZWI A;  5JLI A;  1JAF A;  1E83 A;  2CCY A;  2YL3 A;  3HNJ A;  2XLW A;  1LM3 B;  4WGY A;  2QLA A;  2YLG A;  3HNL A;  2XLO A;  2XLM A;  2YL1 A;  2XM4 A;  2J8W A;  4WGZ A;  3QVY A;  4IB4 A;  1E84 A;  4CJG A;  256B A;  2YLD A;  4JKV A;  1YYX A;  1E86 A;  4ER9 A;  3NMJ A;  3TOL A;  5B3I A;  4CX9 A;  1RCP A;  3DE8 A;  1APC A;  4D4N A;  4JE9 A;  1YZC A;  4CDA A;  4JEA A;  1YZA A;  2XL6 A;  2XLE A;  3M4C A;  2YLI A;  2J9B A;  3FOP A;  5JVE A;  3ZQY A;  1A7V A;  1CGO A;  2XLD A;  3DE9 A;  5AGF A;  3C62 A;  1E85 A;  4IAQ A;  4L6R A;  1MQV A;  2XLH A;  3M79 A;  2YL7 A;  3VRC A;  2YKZ A;  1QQ3 A;  3IQ5 A;  4CIP A;  2XLV A;  3ZQV A;  2XL8 A;  5JS5 A;  1S05 A;  1YYJ A;  3HNK A;  4EIY A;  5JUA A;  4U9E A;  4JEB A;  3M15 A;  4U9D A;  2YL0 A;  3FOO A;  3QVZ A;  4CJO A;  3TOM A;  4N4W A;  3ZTZ A;  3C63 A;  3U8P A;  3ZTM A;  4NC3 A;  1QPU A;  1M6T A;  1CPR A;  3NMK A;  3QW1 A;  4CDV A;  1NBB A;  4IAR A;  5JRA A;  5JSL A;  5JP7 A;  4ULV A;  3QW0 A;  5JT4 A;  2XM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...