4U5BE

Crystal structure of glua2 a622t, con-ikot-ikot snail toxin, partial agonist ka and postitive modulator (r,r)-2b complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
85
structure length
85
Chain Sequence
GPADCCRMKECCTDRVNECLQRYSGREDKFVSFCYQEATVTCGSFNEIVGCCYGYQMCMIRVVKPNSLSGAHEACKTVSCGNPCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein/toxin
molecule keywords Glutamate receptor 2
publication title X-ray structures of AMPA receptor-cone snail toxin complexes illuminate activation mechanism.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 25
structure length 85
sequence length 85
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1800 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4u5bE00
4U5CE 4U5FE 4U5EE 4U5GA 4U5DE 4U5HA 4U5BE
chains in the Genus database with same CATH superfamily
1S7ZA 2JD3A 1TWAA 3GANA 2J45A 4WABA 4CJOA 3NKEA 1AUEA 1CPQA 3K1IC 4A2NB 3GORA 4G78A 3IQ5A 4CIPA 4EWCA 3U8PA 1NFOA 1Q0DA 3T6JA 2AU5A 1TR2A 3CZ6A 3U3BA 4W8KA 3DAGA 3KYIA 2PNOA 5AC5A 5A6BD 1TWGA 5K0IA 1LI7A 2OJED 2XLOA 4JE9A 4XEVA 1VLTA 2RSEB 3ZTMA 2G3KA 3EHMA 4F4BA 4PFOA 1PD0A 2I8BA 2NUPA 4IARA 1FR0A 2KJGA 5CIVA 1DOVA 5L0HA 3LS0A 5A6KA 1RJ9A 1BDJB 2G3VA 3RW0A 3HTKC 5B1BC 3W4YA 3LEOA 4NQFA 2LQGA 1VLSA 4E17A 3A11A 1R5ID 5E2QA 4JTAB 4EHPA 5A69A 1WN0A 2JX0A 3NRHA 3S29A 3JYYA 2R05A 2P61A 1Q0MA 2EILC 4PJJA 4K0DA 3S9OA 1WASA 2HSQA 1V4AA 3U2LA 2NUPB 2EIKC 4KBLA 2LP4A 2L6FA 4OD4A 1EQ1A 3LJBA 1GM5A 5JUAA 5CI9A 1RJ9B 2H7BA 2IXOA 3ZVRA 4DJ9A 3UMHA 1BR2A 2A6HF 3HNLA 4ER9A 3ZG1A 3ASOC 1CGNA 1JMWA 1OKKA 1YJGA 2OU6A 4N4WA 2OG2A 1QPUA 1VOMA 4XWJA 3S0XA 2XLMA 1TQGA 3GWNA 4Q7CA 4Z9JA 1JPNA 4C7OB 2HMZA 2KNHA 2W9YA 1XZPA 2OEXA 3DM5A 4LDKA 3A9CA 5EGYA 2MYSA 1I4ZA 3UGOA 4Q5SF 3JSZA 2PFDA 4JZAA 3VF0A 3AG3C 4JCHA 2LK4A 1APCA 2L9JA 3DJNB 1Q0GA 1TFKB 2GA0A 4HFFB 1AVOB 4XTKA 3RQEA 1M6TA 4FWVA 5AC4A 3U0CA 2XS8A 256BA 3HNKA 2XSEA 3JT1A 4G7HF 5DQTA 4XLPF 2QNLA 4CS8C 2I15A 3KMIA 4HEAJ 2WL8A 4MQ9F 2W4BA 3EZIA 1YA7O 4J7TA 3AOUA 1KNYA 1EI7A 4I1OB 4U5GA 4IRUA 3DMDA 2Q7RA 4MS2A 1FMWA 5KYUB 4U5FE 4JTDB 4QI2A 1A7VA 5IY5C 1JRAA 1IZMA 2J46A 2ASRA 2WZFA 2Q9CA 4LERA 4G7OF 1GS9A 4JRZA 1NFNA 1OCRC 2H8AA 5BQGA 3LAYA 3SZRA 1H6GA 2A68F 1HE1A 5JLIA 2XLHA 3QW1A 4IAQA 2J9BA 1C02A 2VCCA 2HUJA 4ULVA 2DYRC 2L81A 2LCHA 1VYIA 4CS9A 3RF3A 1H9GA 4X0RA 1T5OA 1L7CA 3EH2A 2Y39A 3GEEA 4G0HA 4NCQA 4JEBA 4R32A 4Z9IA 2GAQA 4DRIB 4E18A 3I4UA 3WAQA 4ULWA 2HJMA 2CDQA 1OCCC 1UG7A 1V74B 3T6BA 4JEAA 5FCLA 2H7OA 5T3TA 1SZIA 3AJMA 3C8ZA 1TWHA 3GM1A 1ZZPA 1Q0KA 1WWPA 5D91A 3LEVA 2J9WA 2A6EF 4LACB 3PHF2 3GEIA 2ICWG 3CSKA 3GEHA 1Z23A 2KGOA 1LM3B 2KSFA 5COFA 3N0TA 3HNJA 3FVYA 1VMAA 3KL4A 4MW8A 4BEMJ 2YZSA 3FHDA 2XL8A 1ZHTA 2YL7A 1GQAA 3DWWA 3IEEA 3JTLO 4KC9A 2W4MA 5A6JA 1YLMA 2CGEA 3ZSUA 4BJ5C 1YYXA 1G5ZA 4K1OA 5HSWA 3EGXB 3LUTB 3EPVA 1NBBA 3C63A 2R7UA 1Z63A 1SYQA 3M15A 1NSGB 2BE5F 3MLGA 5L0FA 5COGA 2QUPA 5JVEA 4B6IA 2CW0F 3MBGA 3OEOA 4CDVA 3V5XA 5DS4A 2YVKA 3T6GB 1E86A 3G50A 4LDRA 1OR2A 3DE9A 3V5YA 4XEFA 3O55A 4FESA 2NSFA 1U89A 3JSEO 4OIQF 4N6CA 1OKKD 1OW8A 3NYMA 4KI2A 4MVSA 3L8IA 1YYJA 3LNMB 3AQCA 1B68A 3F47A 1FMVA 2BC5A 2Y69C 2R7VA 3SXZA 2ZXPA 3AG2C 2HJ3A 2YEVA 4U9DA 4MVQA 4JCZA 3TOMA 1L3PA 3AQBA 2J7PA 1OR3A 1U6HA 3FOPA 1A0BA 2Q00A 4DBQA 3NMIA 3DKAA 2PP4A 3U3FA 3U9MA 1ZVZA 3HJCA 2AVKA 3WODF 4D4XA 2C04A 1HMDA 3KKBA 4I1MA 1TKNA 2J0WA 2L7AA 1T6QA 1I4YA 3B0PA 4MVOA 4YT5A 4BJ5A 2R25A 1SMYF 2YKZA 4CBEA 1ZW2A 2L6GA 2KYHA 2UUHA 2EINC 2WZLA 3QVYA 4BEJA 3TQOA 3RQFA 1YZAA 1JPJA 2ZXRA 3ABMC 1C17M 3Q7LA 4KNVA 2OCCC 3M4BA 4NY3A 3TK0A 1G4WR 4C7OA 5JS5A 2XS1A 4QDLA 3L8JA 4CJGA 2WVOA 3H2UA 3X1OA 2HFIA 3F46A 4CDAA 3H2VA 1LS1A 1ZHZA 4NTFA 1WOLA 2J0XA 2QY9A 1LE2A 4KNWA 2R03A 1HW1A 4U5BE 4AX2A 3ECSA 1R4TA 3KYJA 5JSLA 2HS5A 4P6IC 4QI0A 4BJ6A 3Q6NA 3ATPA 4J30B 2XLDA 4CS9C 1MMAA 1HE9A 4YT8A 1SF8A 2IM8A 3M79A 3LNRA 1U0BB 4AL1A 2Y3GA 1T6IA 1ZHXA 4MTOA 2OJQA 4JTCB 3RQGA 4NTAA 2HMQA 1OW7A 3RYLA 1E84A 1QZXA 1WTYA 4ONSA 3R7CA 4I44A 3IHUA 1O5HA 1D0ZA 4MTFA 2Q3TA 2QTVA 4PJMA 3DZAA 3QW0A 3L34A 4PJLA 2OQMA 1SR2A 3UR3C 2B0HA 4EBBA 2TMVP 2QLAA 2A0UA 2EPKX 2EPLX 3C8GB 3AG1C 3K7DA 2Q9AA 4PACA 2M4EA 1NU9C 3SXYA 1CGME 2NUTB 1FAPB 2A69F 2YHSA 3GM3A 4ANJA 5KYNA 2AWCA 1ORYA 1RKCA 5L0JA 3AG4C 3K1HA 3QVZA 3BEHA 5EK0A 2KW3C 3EFOB 2R7WA 1CGOA 1OXKA 1A41A 4MVMA 5TJ5E 2XM4A 4P9TA 3S90A 2ETSA 5COMA 5B1AC 1F1MA 1FFHA 3O39A 2EPMX 4L6RA 5L3VA 2YLGA 3GODA 5F5HA 1O3UA 3H65A 2V26A 2EPNA 1BZ4A 2Q9BA 3RKOF 3MFNA 1PV3A 4GEHA 4AK9A 2R9RB 4FX5A 4AL0A 2F22A 2AWYA 4J7YA 2HZ8A 4GQHA 1V54C 4WGZA 1TFOB 1YDIA 1NU7D 3N24A 2J9VA 1KTMA 2XL4A 1MNDA 5BQIA 1JR8A 3B9QA 3ZQYA 4I3MA 4DXWA 1NZEA 5DS5A 5F28E 4U5EE 3O10A 3RVYA 2MHRA 2IXNA 2NPUA 2WVNA 3ABLC 1G8XA 4OD5A 2XLVA 1Q0FA 3E9VA 3LS1A 3VAYA 1A7EA 3FXHA 2A0BA 1LIHA 1LI5A 4N6HA 5KYUA 4AE4A 4E0IA 4WGYA 1MMDA 2X51A 3DE8A 1MNEA 1ZYRF 2HSBA 3EGXA 3I5QA 4U5CE 4EIYA 3WHNA 3EG9B 3SNHA 2J8WA 2EPOA 3FAPB 3US6A 4XQ1A 1VTMP 3HLZA 3B29A 5BQHA 2DYSC 4EKWA 2V3CC 2KC3A 5EHHA 3PMRA 2ZPAA 3AGUA 2P1AA 4ZLDA 4C3EA 1M2OA 5KYWB 1E85A 2VASA 3G4ZA 3OWTA 1WATA 2XLEA 1A7DA 3EGDA 4AE4B 2VC9A 3QMKA 1QKRA 1D1CA 1QSPA 3O6XA 1K05A 1NLXA 4O6YA 2YLDA 3GWLA 1LE4A 3T9OA 3IPMO 3S27A 1FFTC 3ASNC 4U5HA 1NG1A 1EA8A 1OCZC 4PR9A 1LKXA 4LLEA 1H7IA 4C3DA 2WB7A 2JPUA 2OEVA 3K66A 4XPXA 5JP7A 4DRJB 5A6AA 4OIPF 1I5NA 1AEPA 3FOOA 1ZHYA 4D4NA 1BR1A 2G62A 1YVIA 2OOCA 3M4CA 4MVRA 4OIOF 1DOWA 2R02A 3EGDB 4XPYA 3W8IA 2KQ9A 3S28A 5T3WA 1VB5A 2P6VA 2R7OA 3W8HA 3LLKA 3U9JA 4UDVA 4PK4A 1Y4CA 3EQLF 2AP3A 4BJ6C 2XLWA 5KYYB 4MVZA 2HV6A 3CQZA 2IYLD 5DLJA 5GPGB 3Q6MA 4DVZA 5L0CA 3M1CB 4O7GA 3MYFA 1Z7Qc 1RCPA 3W2VA 3NKDA 3B0UX 1ZU4A 5L0DA 2Y3BA 3NYLA 3JZ0A 3LLIA 3SEOA 4YT4A 3I5PA 4ZLCA 5DQZA 1YA9A 3DJUB 3ZC4A 3RIPA 2C03A 1OCOC 3B0VC 2YQYA 3T4RA 1M2VB 5T1DB 3ABKC 1D1BA 3TJ6A 5F5FA 1Z3IX 3RVZA 3Q7GA 5HV9A 3RH3A 3U5SA 2LIGA 4BPMA 2GFHA 2PBEA 3PCVA 2IXPA 1MMNA 3EH1A 1ST6A 3IQCA 3LESA 2LFDA 2WZGA 3C18A 2PX0A 4MVUA 3JRMO 5E33A 2VCAA 4CDYA 3FAJA 3NDBB 4W8PA 3U2MA 4G7ZF 4J32B 2YL3A 4NTBA 4YK5A 3BRJA 4OIRF 2WVQA 3C8GA 3IQTA 4N06A 1Y6DA 2YL1A 4O6NA 3RFYA 2CNWA 3CAXA 3KH2A 4YL3A 3TULA 4JW1A 3ZDLA 2NUTA 1H9TA 3L1MA 3IQ6A 4XLNF 1VYKA 1S05A 3C62A 3TJ5A 2B0JA 3UGPA 3EFOA 3FMSA 2R7TA 4DRHB 4HE8D 4HFKB 4P9FA 2XM0A 2ZXOA 1BR4A 2E87A 1PD1A 4NC3A 4C3BA 3POVA 1Z5ZA 4JURI 3X2QC 5B3SC 4YL1A 3NMKA 2XXAA 3HKKA 2EIJC 3K1IA 2YWAA 2LFFA 3K6BA 4A4AA 2BL2A 1XWJA 4U5DE 1D1AA 2X0CA 2YL0A 4MTGA 3UMKA 3EHNA 2IOQA 2J9UA 5DS6A 1ZU5A 4CSAC 2HKVA 3TOLA 5B3IA 4MNDA 4CX9A 1OXBA 2O9XA 3JYHA 5CI8A 2FAPB 3DAFA 3NYJA 3JCUQ 3DXJF 4IGGA 2QE9A 3AGTA 5DVWA 3WG7C 5A6BA 1WGWA 1YAUO 3K33A 4H4KC 4RDAA 4JIOA 1MQVA 4IJJA 4RBNA 4CIHA 4WJ0A 5AGFA 2XXAB 4LLCA 2ZD9A 1HW2A 2NG1A 1G4US 4YL0A 3UNGC 4JVSA 3SYNA 3UMIA 4E7ZA 1K04A 4EBKA 5L0IA 3EG9A 1N1CA 4YWQA 4Q4ZF 3EZHA 3U8VA 1QVXA 3PDMP 2EIMC 2R7XA 5L0GA 3V5ZA 2R7RA 4EUKB 1FTSA 2YRFA 3ZTZA 5KYXA 1M56C 2Z15A 3GM2A 2XRHA 3JRTA 4H54A 3CEXA 4IB4A 1T9KA 5KYWA 1YARO 1Z6AA 2IXMA 4JJFA 4IAOA 4FAPB 3J06A 1TWCA 2R7QA 3NG1A 2IBFA 3ITFA 2MWQA 1RXQA 4XPWA 3ZWIA 1ORSC 4IWBA 4E0HA 4EBJA 2GDCA 5JRAA 1K40A 2VB6A 1GGQA 2VH3A 4JC7A 5JT4A 1E83A 2H7VC 5FZTA 1FNTc 2J7PD 3QTHA 2Y3HA 3MX3A 1VK5A 3B71A 4CSAA 2PX3A 1LPEA 2L6HA 2RD9A 3QZCA 3W2WA 5KYXB 4YJWA 4BJTA 3SP1A 2CCYA 3L0IA 3OA1A 3SXMA 2D5RB 2KK1A 3ZIBA 1KU2A 1RKEA 1ZHWA 2DI3A 2YLIA 1QQ3A 3DD7A 4JJGA 3SXKA 4E7SA 3N2ZB 2Y3DA 4DVYP 2ZXWC 2FGYA 4K7BA 1EKYA 4XEKA 3ZQVA 4LDQA 2M64A 4U9EA 1IW7F 2R7SA 1O87A 1ZW3A 4YT2A 5BUOA 1RMVA 1XZQA 2DGJA 2LD6A 3C7JA 3DI5A 5KYYA 2DB4A 3TD7A 2UUIA 3G4XA 4DBRA 4CS7A 2XL6A 3V7OA 3NMJA 1MMGA 2P0NA 2W45A 2P7VA 4RD9A 2VCBA 1J8MF 4GYTA 4BG0A 4CS8A 2FFHA 1E2XA 4PJNA 3S84A 1RKEB 3E70C 4BJ1A 2OKUA 1PCXA 3EJNA 4M63A 3R2PA 5E3CA 3VRCA 1M57C 5L3QA 3FDQA 5E3AA 3C8GD 1V55C 3DM9B 1C03A 2CNWD 1HMOA 4OINF 1D0XA 4JKVA 3VM6A 1T01A 1LVKA 4O6MA 1OQCA 1M2VA 1T6UA 4MW3A 1QLEC 3MYIA 4YN0B 2CYDA 4PFPA 1W2WA 2D4UA 1HY5A 2LSEA 1OW6A 3VYWA 3HNIA 1LS4A 1BBHA 1ORJA 5D92A 1YZCA 3KPHA 4O79A 4Z9HA 1J8YF 2A1DD 2NSGA 1CPRA 1UFBA 2GWWA 2HV7A 1JAFA 2Q4FA 4DOZA 1D0YA 1JOGA 2PF4E
chains in the Genus database with same CATH topology
1S7ZA 2JD3A 1TWAA 3GANA 2J45A 3NKEA 3K1IC 4A2NB 4EWCA 3T6JA 1TR2A 3CZ6A 4W8KA 3DAGA 1TWGA 2G3KA 3EHMA 4F4BA 4PFOA 1PD0A 2I8BA 2NUPA 2KJGA 3LS0A 1RJ9A 2G3VA 3HTKC 5B1BC 5E2QA 3NRHA 3S29A 2EILC 4PJJA 4K0DA 2NUPB 2EIKC 4KBLA 4OD4A 3LJBA 5CI9A 1RJ9B 2H7BA 2IXOA 3ZVRA 3UMHA 1BR2A 2A6HF 3ZG1A 3ASOC 1OKKA 2OG2A 1VOMA 4XWJA 3S0XA 4Q7CA 1JPNA 4C7OB 2KNHA 2W9YA 3DM5A 5EGYA 4Q5SF 2MYSA 3JSZA 2PFDA 4JZAA 3AG3C 4JCHA 2L9JA 3DJNB 4HFFB 4XTKA 4FWVA 2XSEA 3JT1A 4G7HF 5DQTA 4XLPF 4CS8C 3KMIA 4HEAJ 2WL8A 4MQ9F 2W4BA 3EZIA 4I1OB 4U5GA 4IRUA 3DMDA 1FMWA 4U5FE 4QI2A 5IY5C 1IZMA 2J46A 2WZFA 2Q9CA 4LERA 4G7OF 1OCRC 3LAYA 3SZRA 2A68F 2DYRC 2L81A 1VYIA 4CS9A 4X0RA 3EH2A 2Y39A 4G0HA 3I4UA 4ULWA 2CDQA 1OCCC 3T6BA 5FCLA 2H7OA 5T3TA 1SZIA 1TWHA 5D91A 3LEVA 2J9WA 2A6EF 4LACB 3PHF2 3CSKA 1Z23A 2KGOA 3N0TA 3KL4A 3FVYA 1VMAA 2YZSA 1ZHTA 5KYUB 3IEEA 4KC9A 2W4MA 3NDBB 2CGEA 3ZSUA 4BJ5C 5HSWA 3EGXB 3EPVA 2R7UA 1Z63A 2BE5F 3MLGA 4B6IA 2CW0F 3OEOA 5DS4A 4FESA 4OIQF 1OKKD 3NYMA 4KI2A 3AQCA 3F47A 1FMVA 2Y69C 2R7VA 2ZXPA 3AG2C 2YEVA 3AQBA 2J7PA 4DBQA 2PP4A 3HJCA 3WODF 2C04A 3KKBA 4I1MA 1TKNA 2J0WA 3B0PA 4YT5A 4BJ5A 1SMYF 4CBEA 2EINC 2WZLA 4BEJA 2ZXRA 1JPJA 3ABMC 3Q7LA 4KNVA 2OCCC 4NY3A 4C7OA 4QDLA 2WVOA 3X1OA 3F46A 1LS1A 1ZHZA 2J0XA 2QY9A 4KNWA 4U5BE 4AX2A 3ECSA 4P6IC 4BJ6A 4QI0A 3Q6NA 4J30B 4CS9C 1MMAA 4YT8A 1SF8A 3LNRA 2Y3GA 3RYLA 1ZHXA 3UGOA 1QZXA 4I44A 4PJMA 1O5HA 1D0ZA 2Q3TA 2QTVA 3DZAA 3L34A 4PJLA 3UR3C 4EBBA 3AG1C 3K7DA 2Q9AA 2M4EA 1NU9C 2NUTB 2A69F 2YHSA 5KYNA 4ANJA 3B0VC 3AG4C 3K1HA 2R7WA 2KW3C 3EFOB 2PF4E 5B1AC 3O39A 1FFHA 5L3VA 3GODA 5F5HA 3H65A 2V26A 3RKOF 2Q9BA 4AK9A 4GEHA 4FX5A 1V54C 1NU7D 3N24A 2J9VA 2XL4A 1MNDA 3B9QA 4I3MA 1NZEA 5DS5A 4U5EE 2IXNA 2WVNA 3ABLC 1G8XA 4OD5A 3E9VA 3LS1A 3VAYA 5KYUA 4AE4A 1MMDA 2X51A 1MNEA 1ZYRF 3EGXA 3I5QA 4U5CE 3EG9B 3SNHA 3HLZA 2DYSC 2V3CC 5EHHA 3PMRA 2ZPAA 4ZLDA 4C3EA 1M2OA 5KYWB 2VASA 3OWTA 3EGDA 4AE4B 3QMKA 1D1CA 3O6XA 4O6YA 3S27A 1FFTC 3ASNC 4U5HA 1NG1A 1OCZC 1LKXA 4LLEA 4C3DA 2WB7A 3K66A 4OIPF 1ZHYA 1BR1A 2G62A 4OIOF 3EGDB 3W8IA 2KQ9A 3S28A 5T3WA 2P6VA 2R7OA 3W8HA 3LLKA 4PK4A 3EQLF 4BJ6C 5KYYB 2HV6A 3CQZA 2IYLD 5DLJA 4DVZA 3Q6MA 3M1CB 4O7GA 3W2VA 3NKDA 3B0UX 1ZU4A 2Y3BA 3NYLA 3LLIA 4YT4A 3SEOA 4ZLCA 3I5PA 5DQZA 3DJUB 3ZC4A 3RIPA 2C03A 1OCOC 3T4RA 1M2VB 5T1DB 3ABKC 1D1BA 5F5FA 1Z3IX 3Q7GA 3RH3A 2GFHA 2IXPA 1MMNA 3EH1A 1ST6A 3LESA 2WZGA 2PX0A 5E33A 3FAJA 4G7ZF 4J32B 4OIRF 2WVQA 4N06A 4O6NA 3RFYA 2CNWA 3KH2A 4JW1A 2NUTA 4XLNF 1VYKA 2B0JA 3UGPA 3EFOA 2R7TA 4HE8D 4HFKB 2ZXOA 1BR4A 2E87A 1PD1A 4C3BA 3POVA 1Z5ZA 4JURI 3X2QC 5B3SC 2XXAA 2EIJC 3K6BA 4U5DE 1D1AA 3UMKA 3EHNA 2IOQA 2J9UA 5DS6A 1ZU5A 4CSAC 4MNDA 2O9XA 3JYHA 5CI8A 3DAFA 3NYJA 3JCUQ 3DXJF 5DVWA 3WG7C 1WGWA 3K33A 4H4KC 4RDAA 4IJJA 4RBNA 4CIHA 4WJ0A 2XXAB 4LLCA 2NG1A 3UNGC 4JVSA 3SYNA 3UMIA 4E7ZA 4Q4ZF 3EG9A 1N1CA 4YWQA 3EZHA 2EIMC 2R7XA 2R7RA 1FTSA 5KYXA 1M56C 2Z15A 3JRTA 2XRHA 5KYWA 1Z6AA 2IXMA 4JJFA 4IAOA 1TWCA 2R7QA 3NG1A 3ITFA 2MWQA 4IWBA 2VB6A 2VH3A 2H7VC 2J7PD 2Y3HA 3MX3A 1VK5A 4CSAA 2PX3A 3QZCA 5KYXB 3W2WA 4YJWA 4BJTA 3SP1A 3ZIBA 3L0IA 3OA1A 2D5RB 1KU2A 1ZHWA 4JJGA 4E7SA 3DD7A 3N2ZB 2Y3DA 4DVYP 2ZXWC 2FGYA 4K7BA 2R7SA 1IW7F 1O87A 5BUOA 4YT2A 5KYYA 2DGJA 3TD7A 4DBRA 4CS7A 3V7OA 1MMGA 2W45A 4RD9A 2P7VA 4BG0A 1J8MF 4GYTA 4CS8A 2FFHA 4PJNA 3E70C 4BJ1A 1PCXA 3EJNA 4M63A 5E3CA 3FDQA 5L3QA 1M57C 5E3AA 1V55C 3DM9B 2CNWD 4OINF 1D0XA 1LVKA 4O6MA 1M2VA 1QLEC 4YN0B 4PFPA 1W2WA 2LSEA 3VYWA 5D92A 4O79A 1J8YF 2A1DD 2HV7A 4DOZA 1D0YA 3FHDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U5C E;  4U5F E;  4U5E E;  4U5G A;  4U5D E;  4U5H A;  4U5B E; 
#chains in the Genus database with same CATH topology
 1S7Z A;  2JD3 A;  1TWA A;  3GAN A;  2J45 A;  4WAB A;  4CJO A;  3NKE A;  1AUE A;  1CPQ A;  3K1I C;  4A2N B;  3GOR A;  4G78 A;  3IQ5 A;  4CIP A;  4EWC A;  3U8P A;  1NFO A;  1Q0D A;  3T6J A;  2AU5 A;  1TR2 A;  3CZ6 A;  3U3B A;  4W8K A;  3DAG A;  3KYI A;  2PNO A;  5AC5 A;  5A6B D;  1TWG A;  5K0I A;  1LI7 A;  2OJE D;  2XLO A;  4JE9 A;  4XEV A;  1VLT A;  2RSE B;  3ZTM A;  2G3K A;  3EHM A;  4F4B A;  4PFO A;  1PD0 A;  2I8B A;  2NUP A;  4IAR A;  1FR0 A;  2KJG A;  5CIV A;  1DOV A;  5L0H A;  3LS0 A;  5A6K A;  1RJ9 A;  1BDJ B;  2G3V A;  3RW0 A;  3HTK C;  5B1B C;  3W4Y A;  3LEO A;  4NQF A;  2LQG A;  1VLS A;  4E17 A;  3A11 A;  1R5I D;  5E2Q A;  4JTA B;  4EHP A;  5A69 A;  1WN0 A;  2JX0 A;  3NRH A;  3S29 A;  3JYY A;  2R05 A;  2P61 A;  1Q0M A;  2EIL C;  4PJJ A;  4K0D A;  3S9O A;  1WAS A;  2HSQ A;  1V4A A;  3U2L A;  2NUP B;  2EIK C;  4KBL A;  2LP4 A;  2L6F A;  4OD4 A;  1EQ1 A;  3LJB A;  1GM5 A;  5JUA A;  5CI9 A;  1RJ9 B;  2H7B A;  2IXO A;  3ZVR A;  4DJ9 A;  3UMH A;  1BR2 A;  2A6H F;  3HNL A;  4ER9 A;  3ZG1 A;  3ASO C;  1CGN A;  1JMW A;  1OKK A;  1YJG A;  2OU6 A;  4N4W A;  2OG2 A;  1QPU A;  1VOM A;  4XWJ A;  3S0X A;  2XLM A;  1TQG A;  3GWN A;  4Q7C A;  4Z9J A;  1JPN A;  4C7O B;  2HMZ A;  2KNH A;  2W9Y A;  1XZP A;  2OEX A;  3DM5 A;  4LDK A;  3A9C A;  5EGY A;  2MYS A;  1I4Z A;  3UGO A;  4Q5S F;  3JSZ A;  2PFD A;  4JZA A;  3VF0 A;  3AG3 C;  4JCH A;  2LK4 A;  1APC A;  2L9J A;  3DJN B;  1Q0G A;  1TFK B;  2GA0 A;  4HFF B;  1AVO B;  4XTK A;  3RQE A;  1M6T A;  4FWV A;  5AC4 A;  3U0C A;  2XS8 A;  256B A;  3HNK A;  2XSE A;  3JT1 A;  4G7H F;  5DQT A;  4XLP F;  2QNL A;  4CS8 C;  2I15 A;  3KMI A;  4HEA J;  2WL8 A;  4MQ9 F;  2W4B A;  3EZI A;  1YA7 O;  4J7T A;  3AOU A;  1KNY A;  1EI7 A;  4I1O B;  4U5G A;  4IRU A;  3DMD A;  2Q7R A;  4MS2 A;  1FMW A;  5KYU B;  4U5F E;  4JTD B;  4QI2 A;  1A7V A;  5IY5 C;  1JRA A;  1IZM A;  2J46 A;  2ASR A;  2WZF A;  2Q9C A;  4LER A;  4G7O F;  1GS9 A;  4JRZ A;  1NFN A;  1OCR C;  2H8A A;  5BQG A;  3LAY A;  3SZR A;  1H6G A;  2A68 F;  1HE1 A;  5JLI A;  2XLH A;  3QW1 A;  4IAQ A;  2J9B A;  1C02 A;  2VCC A;  2HUJ A;  4ULV A;  2DYR C;  2L81 A;  2LCH A;  1VYI A;  4CS9 A;  3RF3 A;  1H9G A;  4X0R A;  1T5O A;  1L7C A;  3EH2 A;  2Y39 A;  3GEE A;  4G0H A;  4NCQ A;  4JEB A;  4R32 A;  4Z9I A;  2GAQ A;  4DRI B;  4E18 A;  3I4U A;  3WAQ A;  4ULW A;  2HJM A;  2CDQ A;  1OCC C;  1UG7 A;  1V74 B;  3T6B A;  4JEA A;  5FCL A;  2H7O A;  5T3T A;  1SZI A;  3AJM A;  3C8Z A;  1TWH A;  3GM1 A;  1ZZP A;  1Q0K A;  1WWP A;  5D91 A;  3LEV A;  2J9W A;  2A6E F;  4LAC B;  3PHF 2;  3GEI A;  2ICW G;  3CSK A;  3GEH A;  1Z23 A;  2KGO A;  1LM3 B;  2KSF A;  5COF A;  3N0T A;  3HNJ A;  3FVY A;  1VMA A;  3KL4 A;  4MW8 A;  4BEM J;  2YZS A;  3FHD A;  2XL8 A;  1ZHT A;  2YL7 A;  1GQA A;  3DWW A;  3IEE A;  3JTL O;  4KC9 A;  2W4M A;  5A6J A;  1YLM A;  2CGE A;  3ZSU A;  4BJ5 C;  1YYX A;  1G5Z A;  4K1O A;  5HSW A;  3EGX B;  3LUT B;  3EPV A;  1NBB A;  3C63 A;  2R7U A;  1Z63 A;  1SYQ A;  3M15 A;  1NSG B;  2BE5 F;  3MLG A;  5L0F A;  5COG A;  2QUP A;  5JVE A;  4B6I A;  2CW0 F;  3MBG A;  3OEO A;  4CDV A;  3V5X A;  5DS4 A;  2YVK A;  3T6G B;  1E86 A;  3G50 A;  4LDR A;  1OR2 A;  3DE9 A;  3V5Y A;  4XEF A;  3O55 A;  4FES A;  2NSF A;  1U89 A;  3JSE O;  4OIQ F;  4N6C A;  1OKK D;  1OW8 A;  3NYM A;  4KI2 A;  4MVS A;  3L8I A;  1YYJ A;  3LNM B;  3AQC A;  1B68 A;  3F47 A;  1FMV A;  2BC5 A;  2Y69 C;  2R7V A;  3SXZ A;  2ZXP A;  3AG2 C;  2HJ3 A;  2YEV A;  4U9D A;  4MVQ A;  4JCZ A;  3TOM A;  1L3P A;  3AQB A;  2J7P A;  1OR3 A;  1U6H A;  3FOP A;  1A0B A;  2Q00 A;  4DBQ A;  3NMI A;  3DKA A;  2PP4 A;  3U3F A;  3U9M A;  1ZVZ A;  3HJC A;  2AVK A;  3WOD F;  4D4X A;  2C04 A;  1HMD A;  3KKB A;  4I1M A;  1TKN A;  2J0W A;  2L7A A;  1T6Q A;  1I4Y A;  3B0P A;  4MVO A;  4YT5 A;  4BJ5 A;  2R25 A;  1SMY F;  2YKZ A;  4CBE A;  1ZW2 A;  2L6G A;  2KYH A;  2UUH A;  2EIN C;  2WZL A;  3QVY A;  4BEJ A;  3TQO A;  3RQF A;  1YZA A;  1JPJ A;  2ZXR A;  3ABM C;  1C17 M;  3Q7L A;  4KNV A;  2OCC C;  3M4B A;  4NY3 A;  3TK0 A;  1G4W R;  4C7O A;  5JS5 A;  2XS1 A;  4QDL A;  3L8J A;  4CJG A;  2WVO A;  3H2U A;  3X1O A;  2HFI A;  3F46 A;  4CDA A;  3H2V A;  1LS1 A;  1ZHZ A;  4NTF A;  1WOL A;  2J0X A;  2QY9 A;  1LE2 A;  4KNW A;  2R03 A;  1HW1 A;  4U5B E;  4AX2 A;  3ECS A;  1R4T A;  3KYJ A;  5JSL A;  2HS5 A;  4P6I C;  4QI0 A;  4BJ6 A;  3Q6N A;  3ATP A;  4J30 B;  2XLD A;  4CS9 C;  1MMA A;  1HE9 A;  4YT8 A;  1SF8 A;  2IM8 A;  3M79 A;  3LNR A;  1U0B B;  4AL1 A;  2Y3G A;  1T6I A;  1ZHX A;  4MTO A;  2OJQ A;  4JTC B;  3RQG A;  4NTA A;  2HMQ A;  1OW7 A;  3RYL A;  1E84 A;  1QZX A;  1WTY A;  4ONS A;  3R7C A;  4I44 A;  3IHU A;  1O5H A;  1D0Z A;  4MTF A;  2Q3T A;  2QTV A;  4PJM A;  3DZA A;  3QW0 A;  3L34 A;  4PJL A;  2OQM A;  1SR2 A;  3UR3 C;  2B0H A;  4EBB A;  2TMV P;  2QLA A;  2A0U A;  2EPK X;  2EPL X;  3C8G B;  3AG1 C;  3K7D A;  2Q9A A;  4PAC A;  2M4E A;  1NU9 C;  3SXY A;  1CGM E;  2NUT B;  1FAP B;  2A69 F;  2YHS A;  3GM3 A;  4ANJ A;  5KYN A;  2AWC A;  1ORY A;  1RKC A;  5L0J A;  3AG4 C;  3K1H A;  3QVZ A;  3BEH A;  5EK0 A;  2KW3 C;  3EFO B;  2R7W A;  1CGO A;  1OXK A;  1A41 A;  4MVM A;  5TJ5 E;  2XM4 A;  4P9T A;  3S90 A;  2ETS A;  5COM A;  5B1A C;  1F1M A;  1FFH A;  3O39 A;  2EPM X;  4L6R A;  5L3V A;  2YLG A;  3GOD A;  5F5H A;  1O3U A;  3H65 A;  2V26 A;  2EPN A;  1BZ4 A;  2Q9B A;  3RKO F;  3MFN A;  1PV3 A;  4GEH A;  4AK9 A;  2R9R B;  4FX5 A;  4AL0 A;  2F22 A;  2AWY A;  4J7Y A;  2HZ8 A;  4GQH A;  1V54 C;  4WGZ A;  1TFO B;  1YDI A;  1NU7 D;  3N24 A;  2J9V A;  1KTM A;  2XL4 A;  1MND A;  5BQI A;  1JR8 A;  3B9Q A;  3ZQY A;  4I3M A;  4DXW A;  1NZE A;  5DS5 A;  5F28 E;  4U5E E;  3O10 A;  3RVY A;  2MHR A;  2IXN A;  2NPU A;  2WVN A;  3ABL C;  1G8X A;  4OD5 A;  2XLV A;  1Q0F A;  3E9V A;  3LS1 A;  3VAY A;  1A7E A;  3FXH A;  2A0B A;  1LIH A;  1LI5 A;  4N6H A;  5KYU A;  4AE4 A;  4E0I A;  4WGY A;  1MMD A;  2X51 A;  3DE8 A;  1MNE A;  1ZYR F;  2HSB A;  3EGX A;  3I5Q A;  4U5C E;  4EIY A;  3WHN A;  3EG9 B;  3SNH A;  2J8W A;  2EPO A;  3FAP B;  3US6 A;  4XQ1 A;  1VTM P;  3HLZ A;  3B29 A;  5BQH A;  2DYS C;  4EKW A;  2V3C C;  2KC3 A;  5EHH A;  3PMR A;  2ZPA A;  3AGU A;  2P1A A;  4ZLD A;  4C3E A;  1M2O A;  5KYW B;  1E85 A;  2VAS A;  3G4Z A;  3OWT A;  1WAT A;  2XLE A;  1A7D A;  3EGD A;  4AE4 B;  2VC9 A;  3QMK A;  1QKR A;  1D1C A;  1QSP A;  3O6X A;  1K05 A;  1NLX A;  4O6Y A;  2YLD A;  3GWL A;  1LE4 A;  3T9O A;  3IPM O;  3S27 A;  1FFT C;  3ASN C;  4U5H A;  1NG1 A;  1EA8 A;  1OCZ C;  4PR9 A;  1LKX A;  4LLE A;  1H7I A;  4C3D A;  2WB7 A;  2JPU A;  2OEV A;  3K66 A;  4XPX A;  5JP7 A;  4DRJ B;  5A6A A;  4OIP F;  1I5N A;  1AEP A;  3FOO A;  1ZHY A;  4D4N A;  1BR1 A;  2G62 A;  1YVI A;  2OOC A;  3M4C A;  4MVR A;  4OIO F;  1DOW A;  2R02 A;  3EGD B;  4XPY A;  3W8I A;  2KQ9 A;  3S28 A;  5T3W A;  1VB5 A;  2P6V A;  2R7O A;  3W8H A;  3LLK A;  3U9J A;  4UDV A;  4PK4 A;  1Y4C A;  3EQL F;  2AP3 A;  4BJ6 C;  2XLW A;  5KYY B;  4MVZ A;  2HV6 A;  3CQZ A;  2IYL D;  5DLJ A;  5GPG B;  3Q6M A;  4DVZ A;  5L0C A;  3M1C B;  4O7G A;  3MYF A;  1Z7Q c;  1RCP A;  3W2V A;  3NKD A;  3B0U X;  1ZU4 A;  5L0D A;  2Y3B A;  3NYL A;  3JZ0 A;  3LLI A;  3SEO A;  4YT4 A;  3I5P A;  4ZLC A;  5DQZ A;  1YA9 A;  3DJU B;  3ZC4 A;  3RIP A;  2C03 A;  1OCO C;  3B0V C;  2YQY A;  3T4R A;  1M2V B;  5T1D B;  3ABK C;  1D1B A;  3TJ6 A;  5F5F A;  1Z3I X;  3RVZ A;  3Q7G A;  5HV9 A;  3RH3 A;  3U5S A;  2LIG A;  4BPM A;  2GFH A;  2PBE A;  3PCV A;  2IXP A;  1MMN A;  3EH1 A;  1ST6 A;  3IQC A;  3LES A;  2LFD A;  2WZG A;  3C18 A;  2PX0 A;  4MVU A;  3JRM O;  5E33 A;  2VCA A;  4CDY A;  3FAJ A;  3NDB B;  4W8P A;  3U2M A;  4G7Z F;  4J32 B;  2YL3 A;  4NTB A;  4YK5 A;  3BRJ A;  4OIR F;  2WVQ A;  3C8G A;  3IQT A;  4N06 A;  1Y6D A;  2YL1 A;  4O6N A;  3RFY A;  2CNW A;  3CAX A;  3KH2 A;  4YL3 A;  3TUL A;  4JW1 A;  3ZDL A;  2NUT A;  1H9T A;  3L1M A;  3IQ6 A;  4XLN F;  1VYK A;  1S05 A;  3C62 A;  3TJ5 A;  2B0J A;  3UGP A;  3EFO A;  3FMS A;  2R7T A;  4DRH B;  4HE8 D;  4HFK B;  4P9F A;  2XM0 A;  2ZXO A;  1BR4 A;  2E87 A;  1PD1 A;  4NC3 A;  4C3B A;  3POV A;  1Z5Z A;  4JUR I;  3X2Q C;  5B3S C;  4YL1 A;  3NMK A;  2XXA A;  3HKK A;  2EIJ C;  3K1I A;  2YWA A;  2LFF A;  3K6B A;  4A4A A;  2BL2 A;  1XWJ A;  4U5D E;  1D1A A;  2X0C A;  2YL0 A;  4MTG A;  3UMK A;  3EHN A;  2IOQ A;  2J9U A;  5DS6 A;  1ZU5 A;  4CSA C;  2HKV A;  3TOL A;  5B3I A;  4MND A;  4CX9 A;  1OXB A;  2O9X A;  3JYH A;  5CI8 A;  2FAP B;  3DAF A;  3NYJ A;  3JCU Q;  3DXJ F;  4IGG A;  2QE9 A;  3AGT A;  5DVW A;  3WG7 C;  5A6B A;  1WGW A;  1YAU O;  3K33 A;  4H4K C;  4RDA A;  4JIO A;  1MQV A;  4IJJ A;  4RBN A;  4CIH A;  4WJ0 A;  5AGF A;  2XXA B;  4LLC A;  2ZD9 A;  1HW2 A;  2NG1 A;  1G4U S;  4YL0 A;  3UNG C;  4JVS A;  3SYN A;  3UMI A;  4E7Z A;  1K04 A;  4EBK A;  5L0I A;  3EG9 A;  1N1C A;  4YWQ A;  4Q4Z F;  3EZH A;  3U8V A;  1QVX A;  3PDM P;  2EIM C;  2R7X A;  5L0G A;  3V5Z A;  2R7R A;  4EUK B;  1FTS A;  2YRF A;  3ZTZ A;  5KYX A;  1M56 C;  2Z15 A;  3GM2 A;  2XRH A;  3JRT A;  4H54 A;  3CEX A;  4IB4 A;  1T9K A;  5KYW A;  1YAR O;  1Z6A A;  2IXM A;  4JJF A;  4IAO A;  4FAP B;  3J06 A;  1TWC A;  2R7Q A;  3NG1 A;  2IBF A;  3ITF A;  2MWQ A;  1RXQ A;  4XPW A;  3ZWI A;  1ORS C;  4IWB A;  4E0H A;  4EBJ A;  2GDC A;  5JRA A;  1K40 A;  2VB6 A;  1GGQ A;  2VH3 A;  4JC7 A;  5JT4 A;  1E83 A;  2H7V C;  5FZT A;  1FNT c;  2J7P D;  3QTH A;  2Y3H A;  3MX3 A;  1VK5 A;  3B71 A;  4CSA A;  2PX3 A;  1LPE A;  2L6H A;  2RD9 A;  3QZC A;  3W2W A;  5KYX B;  4YJW A;  4BJT A;  3SP1 A;  2CCY A;  3L0I A;  3OA1 A;  3SXM A;  2D5R B;  2KK1 A;  3ZIB A;  1KU2 A;  1RKE A;  1ZHW A;  2DI3 A;  2YLI A;  1QQ3 A;  3DD7 A;  4JJG A;  3SXK A;  4E7S A;  3N2Z B;  2Y3D A;  4DVY P;  2ZXW C;  2FGY A;  4K7B A;  1EKY A;  4XEK A;  3ZQV A;  4LDQ A;  2M64 A;  4U9E A;  1IW7 F;  2R7S A;  1O87 A;  1ZW3 A;  4YT2 A;  5BUO A;  1RMV A;  1XZQ A;  2DGJ A;  2LD6 A;  3C7J A;  3DI5 A;  5KYY A;  2DB4 A;  3TD7 A;  2UUI A;  3G4X A;  4DBR A;  4CS7 A;  2XL6 A;  3V7O A;  3NMJ A;  1MMG A;  2P0N A;  2W45 A;  2P7V A;  4RD9 A;  2VCB A;  1J8M F;  4GYT A;  4BG0 A;  4CS8 A;  2FFH A;  1E2X A;  4PJN A;  3S84 A;  1RKE B;  3E70 C;  4BJ1 A;  2OKU A;  1PCX A;  3EJN A;  4M63 A;  3R2P A;  5E3C A;  3VRC A;  1M57 C;  5L3Q A;  3FDQ A;  5E3A A;  3C8G D;  1V55 C;  3DM9 B;  1C03 A;  2CNW D;  1HMO A;  4OIN F;  1D0X A;  4JKV A;  3VM6 A;  1T01 A;  1LVK A;  4O6M A;  1OQC A;  1M2V A;  1T6U A;  4MW3 A;  1QLE C;  3MYI A;  4YN0 B;  2CYD A;  4PFP A;  1W2W A;  2D4U A;  1HY5 A;  2LSE A;  1OW6 A;  3VYW A;  3HNI A;  1LS4 A;  1BBH A;  1ORJ A;  5D92 A;  1YZC A;  3KPH A;  4O79 A;  4Z9H A;  1J8Y F;  2A1D D;  2NSG A;  1CPR A;  1UFB A;  2GWW A;  2HV7 A;  1JAF A;  2Q4F A;  4DOZ A;  1D0Y A;  1JOG A;  2PF4 E; 
#chains in the Genus database with same CATH homology
 1S7Z A;  2JD3 A;  1TWA A;  3GAN A;  2J45 A;  3NKE A;  3K1I C;  4A2N B;  4EWC A;  3T6J A;  1TR2 A;  3CZ6 A;  4W8K A;  3DAG A;  1TWG A;  2G3K A;  3EHM A;  4F4B A;  4PFO A;  1PD0 A;  2I8B A;  2NUP A;  2KJG A;  3LS0 A;  1RJ9 A;  2G3V A;  3HTK C;  5B1B C;  5E2Q A;  3NRH A;  3S29 A;  2EIL C;  4PJJ A;  4K0D A;  2NUP B;  2EIK C;  4KBL A;  4OD4 A;  3LJB A;  5CI9 A;  1RJ9 B;  2H7B A;  2IXO A;  3ZVR A;  3UMH A;  1BR2 A;  2A6H F;  3ZG1 A;  3ASO C;  1OKK A;  2OG2 A;  1VOM A;  4XWJ A;  3S0X A;  4Q7C A;  1JPN A;  4C7O B;  2KNH A;  2W9Y A;  3DM5 A;  5EGY A;  4Q5S F;  2MYS A;  3JSZ A;  2PFD A;  4JZA A;  3AG3 C;  4JCH A;  2L9J A;  3DJN B;  4HFF B;  4XTK A;  4FWV A;  2XSE A;  3JT1 A;  4G7H F;  5DQT A;  4XLP F;  4CS8 C;  3KMI A;  4HEA J;  2WL8 A;  4MQ9 F;  2W4B A;  3EZI A;  4I1O B;  4U5G A;  4IRU A;  3DMD A;  1FMW A;  4U5F E;  4QI2 A;  5IY5 C;  1IZM A;  2J46 A;  2WZF A;  2Q9C A;  4LER A;  4G7O F;  1OCR C;  3LAY A;  3SZR A;  2A68 F;  2DYR C;  2L81 A;  1VYI A;  4CS9 A;  4X0R A;  3EH2 A;  2Y39 A;  4G0H A;  3I4U A;  4ULW A;  2CDQ A;  1OCC C;  3T6B A;  5FCL A;  2H7O A;  5T3T A;  1SZI A;  1TWH A;  5D91 A;  3LEV A;  2J9W A;  2A6E F;  4LAC B;  3PHF 2;  3CSK A;  1Z23 A;  2KGO A;  3N0T A;  3KL4 A;  3FVY A;  1VMA A;  2YZS A;  1ZHT A;  5KYU B;  3IEE A;  4KC9 A;  2W4M A;  3NDB B;  2CGE A;  3ZSU A;  4BJ5 C;  5HSW A;  3EGX B;  3EPV A;  2R7U A;  1Z63 A;  2BE5 F;  3MLG A;  4B6I A;  2CW0 F;  3OEO A;  5DS4 A;  4FES A;  4OIQ F;  1OKK D;  3NYM A;  4KI2 A;  3AQC A;  3F47 A;  1FMV A;  2Y69 C;  2R7V A;  2ZXP A;  3AG2 C;  2YEV A;  3AQB A;  2J7P A;  4DBQ A;  2PP4 A;  3HJC A;  3WOD F;  2C04 A;  3KKB A;  4I1M A;  1TKN A;  2J0W A;  3B0P A;  4YT5 A;  4BJ5 A;  1SMY F;  4CBE A;  2EIN C;  2WZL A;  4BEJ A;  2ZXR A;  1JPJ A;  3ABM C;  3Q7L A;  4KNV A;  2OCC C;  4NY3 A;  4C7O A;  4QDL A;  2WVO A;  3X1O A;  3F46 A;  1LS1 A;  1ZHZ A;  2J0X A;  2QY9 A;  4KNW A;  4U5B E;  4AX2 A;  3ECS A;  4P6I C;  4BJ6 A;  4QI0 A;  3Q6N A;  4J30 B;  4CS9 C;  1MMA A;  4YT8 A;  1SF8 A;  3LNR A;  2Y3G A;  3RYL A;  1ZHX A;  3UGO A;  1QZX A;  4I44 A;  4PJM A;  1O5H A;  1D0Z A;  2Q3T A;  2QTV A;  3DZA A;  3L34 A;  4PJL A;  3UR3 C;  4EBB A;  3AG1 C;  3K7D A;  2Q9A A;  2M4E A;  1NU9 C;  2NUT B;  2A69 F;  2YHS A;  5KYN A;  4ANJ A;  3B0V C;  3AG4 C;  3K1H A;  2R7W A;  2KW3 C;  3EFO B;  2PF4 E;  5B1A C;  3O39 A;  1FFH A;  5L3V A;  3GOD A;  5F5H A;  3H65 A;  2V26 A;  3RKO F;  2Q9B A;  4AK9 A;  4GEH A;  4FX5 A;  1V54 C;  1NU7 D;  3N24 A;  2J9V A;  2XL4 A;  1MND A;  3B9Q A;  4I3M A;  1NZE A;  5DS5 A;  4U5E E;  2IXN A;  2WVN A;  3ABL C;  1G8X A;  4OD5 A;  3E9V A;  3LS1 A;  3VAY A;  5KYU A;  4AE4 A;  1MMD A;  2X51 A;  1MNE A;  1ZYR F;  3EGX A;  3I5Q A;  4U5C E;  3EG9 B;  3SNH A;  3HLZ A;  2DYS C;  2V3C C;  5EHH A;  3PMR A;  2ZPA A;  4ZLD A;  4C3E A;  1M2O A;  5KYW B;  2VAS A;  3OWT A;  3EGD A;  4AE4 B;  3QMK A;  1D1C A;  3O6X A;  4O6Y A;  3S27 A;  1FFT C;  3ASN C;  4U5H A;  1NG1 A;  1OCZ C;  1LKX A;  4LLE A;  4C3D A;  2WB7 A;  3K66 A;  4OIP F;  1ZHY A;  1BR1 A;  2G62 A;  4OIO F;  3EGD B;  3W8I A;  2KQ9 A;  3S28 A;  5T3W A;  2P6V A;  2R7O A;  3W8H A;  3LLK A;  4PK4 A;  3EQL F;  4BJ6 C;  5KYY B;  2HV6 A;  3CQZ A;  2IYL D;  5DLJ A;  4DVZ A;  3Q6M A;  3M1C B;  4O7G A;  3W2V A;  3NKD A;  3B0U X;  1ZU4 A;  2Y3B A;  3NYL A;  3LLI A;  4YT4 A;  3SEO A;  4ZLC A;  3I5P A;  5DQZ A;  3DJU B;  3ZC4 A;  3RIP A;  2C03 A;  1OCO C;  3T4R A;  1M2V B;  5T1D B;  3ABK C;  1D1B A;  5F5F A;  1Z3I X;  3Q7G A;  3RH3 A;  2GFH A;  2IXP A;  1MMN A;  3EH1 A;  1ST6 A;  3LES A;  2WZG A;  2PX0 A;  5E33 A;  3FAJ A;  4G7Z F;  4J32 B;  4OIR F;  2WVQ A;  4N06 A;  4O6N A;  3RFY A;  2CNW A;  3KH2 A;  4JW1 A;  2NUT A;  4XLN F;  1VYK A;  2B0J A;  3UGP A;  3EFO A;  2R7T A;  4HE8 D;  4HFK B;  2ZXO A;  1BR4 A;  2E87 A;  1PD1 A;  4C3B A;  3POV A;  1Z5Z A;  4JUR I;  3X2Q C;  5B3S C;  2XXA A;  2EIJ C;  3K6B A;  4U5D E;  1D1A A;  3UMK A;  3EHN A;  2IOQ A;  2J9U A;  5DS6 A;  1ZU5 A;  4CSA C;  4MND A;  2O9X A;  3JYH A;  5CI8 A;  3DAF A;  3NYJ A;  3JCU Q;  3DXJ F;  5DVW A;  3WG7 C;  1WGW A;  3K33 A;  4H4K C;  4RDA A;  4IJJ A;  4RBN A;  4CIH A;  4WJ0 A;  2XXA B;  4LLC A;  2NG1 A;  3UNG C;  4JVS A;  3SYN A;  3UMI A;  4E7Z A;  4Q4Z F;  3EG9 A;  1N1C A;  4YWQ A;  3EZH A;  2EIM C;  2R7X A;  2R7R A;  1FTS A;  5KYX A;  1M56 C;  2Z15 A;  3JRT A;  2XRH A;  5KYW A;  1Z6A A;  2IXM A;  4JJF A;  4IAO A;  1TWC A;  2R7Q A;  3NG1 A;  3ITF A;  2MWQ A;  4IWB A;  2VB6 A;  2VH3 A;  2H7V C;  2J7P D;  2Y3H A;  3MX3 A;  1VK5 A;  4CSA A;  2PX3 A;  3QZC A;  5KYX B;  3W2W A;  4YJW A;  4BJT A;  3SP1 A;  3ZIB A;  3L0I A;  3OA1 A;  2D5R B;  1KU2 A;  1ZHW A;  4JJG A;  4E7S A;  3DD7 A;  3N2Z B;  2Y3D A;  4DVY P;  2ZXW C;  2FGY A;  4K7B A;  2R7S A;  1IW7 F;  1O87 A;  5BUO A;  4YT2 A;  5KYY A;  2DGJ A;  3TD7 A;  4DBR A;  4CS7 A;  3V7O A;  1MMG A;  2W45 A;  4RD9 A;  2P7V A;  4BG0 A;  1J8M F;  4GYT A;  4CS8 A;  2FFH A;  4PJN A;  3E70 C;  4BJ1 A;  1PCX A;  3EJN A;  4M63 A;  5E3C A;  3FDQ A;  5L3Q A;  1M57 C;  5E3A A;  1V55 C;  3DM9 B;  2CNW D;  4OIN F;  1D0X A;  1LVK A;  4O6M A;  1M2V A;  1QLE C;  4YN0 B;  4PFP A;  1W2W A;  2LSE A;  3VYW A;  5D92 A;  4O79 A;  1J8Y F;  2A1D D;  2HV7 A;  4DOZ A;  1D0Y A;  3FHD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...