3DM9B

Structures and conformations in solution of the signal recognition particle receptor from the archaeon pyrococcus furiosus
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
319
structure length
305
Chain Sequence
SMFGKLREKLKSFVKRVEEEVEKETVEIKEKDVDKALDELEIDLLEADVALEVVDALREKIKQKLVGKKVRIGTDKGKIIEEAVKEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTAGRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPILFVGVGQGYDDLRPFEKEWFLERIFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the Signal Recognition Particle Receptor from the Archaeon Pyrococcus furiosus: Implications for the Targeting Step at the Membrane.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transport protein
molecule keywords Signal recognition particle receptor
total genus 105
structure length 305
sequence length 319
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00448 SRP54 SRP54-type protein, GTPase domain
B PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3dm9B01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3dm9B02
1P4SA 5AJZA 3W3ZB 2VYFA 1OH5A 4E09A 4PSVA 5EP4A 3AVXA 4BLSA 3VU9B 4QJ4A 1RPZA 2C9YA 1RW4A 2AR7A 5FPHA 2GEDA 4DLWA 4EDHA 1WBDA 3PEYA 4URXR 1HH4A 4WIAA 1OHHA 4MGZR 3TQCA 4BFZA 4B3GA 1MO3A 2W6JA 2EVWX 3KTAA 3TK1A 1WRBA 3CNLA 1A2KC 1NN3A 1VPLA 2QI9C 3ND9A 5SZHB 2DPXA 4D82A 1II9A 3MG9A 2CJWA 4KFRA 1GIAA 2CE2X 4NBSA 4J0QA 1ZC4A 4GOXA 5KNDA 2I4IA 2ZUDA 2C77A 3U3KA 1BIFA 1FNNA 4NYMR 2GDJA 1A1VA 3TRFA 2QT1A 4ESVA 3CKLA 2NIPA 1GKYA 3K9LA 2BBSA 1K6MA 1LF0A 2HJVA 3WHLA 1RE0A 1CULC 4JLAA 3JZMA 4ARZB 3LXRA 1S1CA 1G8HA 1YZKA 3OE7A 3WMGA 4B76A 4RFVA 1IOZA 1A5TA 2CJWB 4R98A 3HU3A 1HV8A 1XCPA 1Z2AA 2ZJZA 3B6EA 1BKDR 1K5GA 2C9CA 3KFXA 1DELA 2ZREA 2WMOB 3MWKA 1R0ZA 4KVGA 1RC8A 1XTQA 4FI3C 4A8JB 3QBVA 4PANA 2LKCA 4R9UC 3EC2A 2P6NA 4CF7A 4PQFA 2GK7A 4RVCA 1VTKA 1H65A 5EE0A 2IK8A 2YOGA 1ZP6A 1OE0A 3CB4A 5KSZA 4B74A 4DVGA 2DFLA 1AQUA 5HZHA 2F55A 1AKEA 3GJ8A 5JSZA 5KUTA 3TQFA 1N25A 4CZ2A 4B6EA 1Z07A 3EIEA 4Z51A 1G1MA 1IXZA 5SZIA 4YMSA 2WWWA 2CE7A 4URYR 1E4VA 2I1VB 4PHFA 1G7SA 2GJSA 3QXCA 4N1AA 4QG7A 1XXHB 4ZDIA 2ZI4A 1Z29A 1FQJA 4XD7A 3RS3A 2VSFA 4AG5A 4NMMA 4P4UA 5BWMA 4I1OA 4HSEA 4NPHA 1E0AA 2GJ9A 3QF4B 3U44A 2QENA 3UANA 1G20E 3IEUA 2IC5A 2CHVA 4EJSB 1KJYA 1XTSA 3FKQA 1Z6TA 1F2UA 2IYUA 4XWOA 4NTZA 1DAFA 4POAA 1M34E 1Z6XA 2N1BA 3KKNA 4Q03A 3BH6A 3I1FA 4TN1A 4KBFA 2CMKA 2IA5A 3IO3A 4BGDA 5FL7D 4ASUD 1GRRA 3OEEA 3S1AB 1UKEA 4EFNA 5CB6A 5KPJA 4K8OA 2MMCA 3GLGE 3U7HB 2OBMA 2ZIAA 3CH4B 1HQCA 3WY9A 1G21E 4QOSA 1ZM4A 5DLQC 1CLUA 4LHVA 1N6HA 3B7GA 1R8SA 1HQYE 1DAIA 3QKRB 1G7RA 3A1WA 4CEIB 3DEFA 3C41J 2G77B 4F7WA 1W48A 4KU4A 1XTJA 1E2IA 1NMZA 1U99A 1XEXB 2IEYA 3CZQA 3AF2A 1RVDA 4IVRA 4MYUA 1D2MA 1N5LA 3TLXA 2GILA 4EQ6B 4NZYA 2QU8A 2J41A 1W5SA 2IYZA 3DVLA 2YZ2A 3ZYCA 2NMVA 3GLFE 4TL6A 3ND8A 2IYYA 1E6CA 2F1JA 1SVWA 1BOFA 1XXHA 2QP4A 1EWQA 4KJZA 1Z0KA 4V02A 3CX8A 1OLOA 2IYXA 5C18A 4NE2A 2JLUA 4ZI3A 2P5TB 2HJGA 2GA8A 1VIYA 1DO2A 3NIBA 1D6JA 2AHOA 4FIDA 4M1SA 3ZD6A 1QHGA 2FOLA 2VBCA 3ZVLA 2J87A 4UKDA 2BBOA 4B3FX 2NO7A 4ZCMA 3PENA 2QQEA 3K09C 1XJCA 2LWIA 2VP5A 3RWMB 2GXSA 3VAAA 1SVMA 1KSJA 2VP0A 3KJHA 4LJ8A 4NYJR 3EXAA 1COWD 2C9OA 4K46A 4JT2A 5FR2A 4B3BA 2JLZA 4QBIA 2GJAA 3PITA 2WTUA 3MLEA 2HCJB 2HUPA 4BLTA 2XB2A 1ZM9A 1ZBDA 3AGPA 2B8WA 1L4UA 3SFVA 4A0RA 3TVTA 2IXEA 1RFLA 1I4LD 1U81A 4FINA 2Z6VA 4V0NA 4HLUC 4MH0R 3BE4A 3IPXA 3QKRA 2RH5A 4OQLA 5FOTA 2JLYA 1G8FA 4Q9HA 5TY0A 1QF9A 2ZU6A 2X1VA 1TQ6A 4F38A 1N6NA 5D3MA 4FMBB 3HYRA 1T6NA 2FSHA 2QP3A 5CDFE 2YC2C 4M9ZA 1C4OA 4DWJA 1A4RA 2YNMA 1U0LA 2ORVA 1KK2A 2X77A 4MKGA 2AK2A 4Q18A 4HZIA 1CRQA 2PLFA 4Q00A 4TTRA 2EWVA 1NY6A 4DC9A 2GF9A 2A5JA 3OIVA 4U5XA 3BC1A 4M1YA 2ZJ2A 1BYUA 2BKUA 5B58C 1ZUHA 3WMFA 2QRZA 3BB4A 5CM8B 4Q1BA 3LBIA 3CLVA 4C9BA 1KY2A 4RCYA 4B34A 1N6KA 2OSBA 4DLXA 3S1AA 3K09A 4TTPA 2GJKA 4EFLA 2G83A 2H18A 1DADA 2QMUA 2FDCA 1AM4D 1ANKA 3TNFA 1EFCA 4UJ3A 2ZR0A 2JA1A 1DAHA 4W5JA 1X8KA 3N70A 1U2RA 1P61B 2D7DA 1OSNA 3DM5A 1NVWQ 4LJ7A 5C4GB 2OILA 4JLOA 4Q1FA 4DCTA 5JBQA 2A7QA 4JLMA 3U3MA 1R2QA 4PPGA 1ZIOA 5KNCA 3L0IB 5J5CA 2D06A 4AG6A 1QRAA 1S8FA 5FBWB 2NG1A 1KHTA 2O0JA 4Q1AA 3HR8A 4P4SA 1RZ3A 2R6GA 2VHCA 2O8EB 3Q72A 4CEJB 3GJXC 4M1KA 2QSZA 4QRHA 2BHRA 4Z1MD 4M9QA 4XIGS 2Q6TA 3G0HA 1E0SA 4TMKA 2QTFA 5E7MA 1Q12A 5FI1B 1A82A 2BC9A 2RHMA 3EASA 1JBKA 4BLPA 3U4QA 2ODBA 1KYIA 2QM8A 5J4LA 1IY0A 1KMHA 1G3RA 3EZ9A 5CLLA 2XGJA 1RJ9A 1IN4A 3ZH9B 4GOKA 3T1VA 3TBKA 3EWAA 4DLYA 1ZU5A 3GFOA 3IBGA 2CXXA 4A8JC 4HZUA 2A2ZA 3TKLA 2BIFA 5JRZA 1U0JA 3MWYW 3LW7A 3ZVMA 3IBYA 2HCBA 3IQXA 1E2LA 1GNPA 2ZE8A 5AUQA 4OHYA 1G291 2WJJA 2OAQ1 3QG5A 3T35A 5FOXA 5B64A 4OI2A 5FOUA 2XAUA 2WKQA 3ZJYA 4C0BA 3REFA 4BQSA 1I2MA 4H1VA 2J9RA 4HZUB 1NMYA 4Q02A 4PXAA 1DAGA 4QGHA 4Z8YA 4LHZA 3P26A 2CEAA 5AJVB 2D3WA 2O8FA 3WHKA 2H1LA 1TL7C 2PEZA 2JDIA 2A5FA 5B57C 3TSOA 4WOPA 1UADA 2ZRIA 3LVRE 3EPKA 1P2UA 4MGKR 4YMVA 2MSEB 1F60A 1E9FA 1S96A 4AKEA 1XU4A 4Y0VA 3H1TA 2ZM5A 821PA 3RS5A 1TAGA 3AH8A 4FMDF 4UNRA 1IM2A 1ZUNB 2PH1A 3B9PA 1ZM7A 4BASA 3KUCA 1FFHA 4DXAA 3QENA 1P60A 1X8LA 4Q4JA 2AWNA 1XPOA 4ZIRA 4II7A 2IBMA 2G88A 2HT6A 3W90A 3WNBA 4ZPXA 2J0UA 3RRNA 3LQRA 1Q57A 4OQMA 3V00A 1KTVA 2ZJOA 3LX5A 4C0KA 1Q44A 2J59A 1KK3A 1U94A 2EYQA 4HDQB 4A1FA 4E22A 3PUXA 3QIAA 1GG2A 3IGFA 4U00A 3UMRA 2V8OA 1C9KA 3KL4A 1LF5A 4B3CA 4D26A 5FR1A 2ZVPX 3AP3A 3AKDA 3G82C 4FCWA 4JJZA 2D74A 4LYJA 1XEXA 1AGRA 4CT5A 1CJMA 1G41A 3HPQA 3SDZA 2YVUA 3QY0A 2PMDA 1M7GA 3PFIA 2ZRDA 3K0AB 3I73A 1E96A 1RYHA 1US8B 1LFDB 1TEXA 5AWFC 1UF9A 2ORIA 1P2TA 1MABA 3W34A 5LB4A 1UKYA 3N5CA 2ZETA 2GAOA 4MKIA 4QBGB 4BPBA 1MT0A 1E4YA 3LBHA 1E0JA 1QHIA 4R7ZA 2UZIR 4LCBA 2KJQA 1SVSA 1MRSA 5EUMA 2BBTA 3ASYA 3AV0B 2V55B 3I92A 3E5HA 4IVQA 1ZMXA 3AVYA 2WSSA 3AVWA 3EZFA 5KDOA 1YR9A 3NH9A 3TAUA 2IS4A 3NXSA 4C0QC 1KO5A 2ZJYA 1TU4A 3NBXX 1JAHA 4HEJA 1IY1A 4QHSA 3DKVA 2AD5A 4PTLA 1ONBA 1TEVA 2O8EA 1T0HB 2HV8A 2RB4A 4RKFA 4AKGA 1W4BA 1PZNA 3C14C 3SC3A 3QKTA 5HPYB 2GTPA 3GJ4A 1N5KA 2F1HA 2MSCB 4RD3A 4KSCA 2OAP1 2QPAA 5P21A 3TGPA 3SU8A 3ZQJA 1NSTA 2QA5A 3PIRA 1ODFA 4V0LA 2W2VA 4JL6A 4O25A 4YC7A 1UEJA 2VHTA 4MKHA 2JIZA 3FKSD 1X1SA 2H7VA 3O47A 4RY2A 1GM5A 1FUUA 4DT1B 2ZPTX 2JJ2D 1SKQA 1I4TD 2GK6A 4N3NA 1XEWX 3O8BA 2FZLA 2VP2A 3C8UA 2C98A 1H8ED 3OFND 3LW8A 1JR6A 2FEMA 2W2TA 2G0NA 2JIZD 1NN5A 2IHBA 1DPFA 2OLKA 2WKRA 4QKQA 1UAAA 5L3QA 2ZR9A 3BS4A 3ZVRA 1QDEA 2CCKA 3K8YA 4ZCIA 4HB3A 2PX3A 4I81A 2RGDA 3UG7A 3W6NA 4WXRA 4F91B 1DAEA 3UKDA 2NGRA 5DO9A 3SJCA 2JGNA 1YJ5A 1TTTA 4ZIRB 1YHNA 1NI3A 4IDNA 4H1UA 2CL0X 2O8BB 1Z0JA 1VCNA 5FTLA 5EE9A 4XSHA 5JJIA 1MO5A 3IIKA 3WNCA 1ZINA 4ABYA 1OFTA 2ATXA 2AFHE 1U0HC 5HCIA 4NKRA 3ZS9A 1Q21A 3C7KA 3CNOA 1AA9A 3NEYA 1E9CA 2CDNA 1XBTA 3GQBA 5HR5A 1KMHB 4HDCA 4WVFA 4BFYA 2RGBA 3U60B 1XD2A 2FN4A 4C3ZA 1XMJA 3CRQA 3GEIA 4TLCA 2ONKA 1KI6B 3ASZA 1Z47A 1FP7A 1OFIA 2WICA 3ZD7A 3HJNA 2C96A 2WOOA 3OEHD 1UBEA 4M8NE 4MYHA 2ZI7A 1AS3A 4M0LA 3R7WB 2OUKA 3WRYC 2VF8A 3KDSE 3LBNA 1S1MA 3KXKA 1NIJA 3PCRB 1HT1E 2ANBA 1XMSA 2FGKA 4LBZA 3F3YA 2ODEA 4PZYA 4TL9A 4GT1A 2JCSA 1SHZA 5M04A 3THXB 2OZEA 1P3JA 2XJ9A 1W44A 5BXQC 2QEQA 3C5CA 4RJLA 2IYTA 2IWHA 4XTCS 3WBJA 4ACAA 3VR3A 3KXIA 5JWRA 2DYKA 4NHOA 2OFXA 2P3SA 4RD4A 4TL8A 1EWRA 2DWPA 1BH2A 1P73A 2BM0A 4TWZA 3LDAA 4IKEA 4OKSA 3FTQA 3I8SA 4LRWA 1S9DA 3NDBB 3MFYA 2BV3A 3TAHA 4B2LA 3HR7A 5TXGA 4IFEA 1Q1EA 3KQHA 2V3CC 4WBSA 5DI9A 4EUNA 1P75A 1QBKC 1KSHA 2FSIA 1QVRA 1SXJB 4HYYA 3QXHA 4OQNA 121PA 4G3XA 1US8A 4HI0E 4IDPA 4W9MC 1YZTA 1YZGA 4W5WA 4LJAA 5EUQB 5K8LA 3ADDA 4DSOA 3BAFA 5EXTA 3FFBA 1NIPA 3RS7A 4B32A 4E5UA 3KQUA 2MMGA 4E07A 2IX3A 3CH5A 2OCYC 2ZI9A 3B2EA 1KNQA 4M21A 4TT3D 2R8RA 3QEOA 3C4JA 2O0HA 5CIWA 3K9NA 1NVVQ 3ZIAD 1E94E 1OH6A 2VPPA 1XD2B 2B92A 4PQRA 2ZYVX 4XVUA 1DG3A 1JR3D 1QHHB 2CBZA 3ADCA 3GLIB 3FYHA 3U61B 3Q9LA 5FBRB 4TYNA 4LYFA 1OFHA 2RHDA 1ZD8A 2N42A 2QY9A 1YRAA 3KKQA 4PO8A 3IPYA 2YWGA 2IYSA 1Z3IX 2WM9B 2QAJA 4PHHA 1RRCA 1T3LA 2WMNB 4ZKDA 2QGNA 2W6JD 1G3UA 4DCVA 5F98A 3PQCA 1KKLA 5EJEA 1IN7A 1OB5A 2QNRA 2PZGA 2CK3A 4BZPA 1P9WA 4RCZA 4F4CA 3T61A 2UZ3A 2J7PD 3R20A 621PA 5FL3A 2F6RA 3K0AA 4KFUA 4PO1A 3DM9B 4JLJA 5AUNB 5KU1A 2CLSA 4YLGA 1JQLB 3PVSA 4XSGA 2XNSA 2IL1A 1JI0A 1GL9B 2WSSD 2ZUCA 3DL0A 1O87A 3IKJA 1NL3A 5CYPA 2JLVA 1YZUA 3I62A 5JRJA 1CR4A 1S0UA 5HKKD 2GHIA 1G3QA 3WYFA 1UKVY 2PCJA 2IT1A 2ZTSA 3LV8A 4NYJQ 3A37A 2XNDA 3KQKA 5J4YA 1UFQA 1U90A 3L8YA 2NZ8A 4IVPA 2A30A 2AX4A 1D9XA 2FX3A 4B3DA 1Z6AA 1IAQA 3QSYA 4B33A 4IHQA 3PEVA 1N5JA 2ZEJA 3TJZA 4DDTA 1QHHA 2H8KA 4G1UC 4ITRC 2WWXA 2OO7A 2O8DA 1GNQA 3B1VA 1XRJA 2ZS7A 1NVXQ 1Q1BA 2IS6A 1L7VC 3TUJC 3D3QA 4JLBA 3NKVA 1R8QA 1V5WA 3U6KA 3EZ6A 1FX0A 3WYGA 3CBQA 2FPKA 1WA5A 1Z08A 4KODA 3EW9A 4C0AC 1LW7A 1CF4A 4PQYA 3K1JA 4ERNA 3LFUA 3X1XA 4A0FA 3B85A 5GJBA 3NC1C 1G3MA 2RGXA 3QXJA 1Z0IA 4Q21A 1EESA 5EE3A 1FL9A 4KI0A 1NBMD 4IDHA 4ACBA 5TDHA 1FX0B 1R0WA 4Q7LA 1H8HA 3BJIC 4BFUA 5KDDA 3U3JA 3AVOA 1CS4C 1ELOA 3RANA 3Q3JB 5C2JB 3HPRA 1HE8B 4URVR 2KB0A 2C8VA 4D2IA 3EPLA 2JJ1D 2R6FA 5H68A 3HDTA 4MDEA 1KZGB 3L2OB 2RGNA 5BN3A 5JS8A 4TYWA 4XWAA 4AYXA 3P32A 4EKDA 2QMOA 4KAXA 1W36C 3BIFA 1GKUB 3L43A 2OXCA 3TVDA 5FBQB 1IJEA 1KDRA 2REBA 3A8TA 1T4GA 4ILEA 1HEIA 1GTVA 1SVIA 3UG6A 3J81k 3HU2A 4G5GA 2FH5B 3F5FA 4L15A 5LD2B 2DY1A 3I32A 4NCNA 3K70B 3F8TA 1RRFA 5LB2A 4G01B 4TSFD 3CRVA 1Q22A 2BJWA 2VSOA 2XB4A 4LI0A 4D4LA 3K70D 2R9VA 4MA4A 4PSAA 3QUSA 2R6CA 1II8A 2WPDD 5FH9A 1IHUA 1EFRD 3RC8A 4JT4A 4FW9A 4KYIB 1DE0A 2H17A 3CPHA 1ZD9A 4BFXA 3B13B 3PUWA 3CR8A 5F9FA 3CM0A 1E1QD 3GFTA 1FQKA 1HE1C 5FPYA 1DTSA 4GRAA 1QG4A 4KO8A 3A4MA 5FOSA 1OFUX 3BGWA 2GBLA 2XOKD 3L0OA 1B23P 3GMTA 1ESMA 4QHTA 3SJZA 2G0TA 4B44A 4QL3A 5AJWA 1Z0FA 3H4MA 3FMOB 5DISB 5TARA 3VHXA 4CW7A 4L5BA 4XH9B 1AZSC 4TMTA 2FGJA 2YHSA 4V03A 2OXRA 4NCIA 1KI1A 1EXMA 2DWOA 1J7KA 2V7QA 2GAAA 2HEIA 3GLHE 1ZM2A 2ZQ5A 5LBIA 2B8TA 4MITA 2Z4RA 3M1IA 3LLMA 4BEBA 4QXAA 4CIDA 3C5HA 1CP2A 1L4YA 4M1WA 3LH5A 3QJYA 4OHVA 4QM6A 2QP9X 3CZPA 3NHBA 3QEJA 4PPNA 1NNEA 1KOFA 3W5JA 1PJRA 4NCKA 3CR7A 4ZCLA 1G16A 1OXSC 1JR3E 3R9IA 2P0EA 2ZAMA 3D31A 3W8NA 1GRNA 2WJVA 1IY2A 1HYQA 2WJIA 2W0SA 4Q9KA 4I1UA 4LUCA 1UBFA 3UWOA 2NTYC 4HLDA 2WIBA 5JHHB 4GZMA 5JS7A 4I4LA 3A36A 2WJYA 1MR3F 1UJ2A 4OK6A 4PR0A 2FE4A 2IF0A 3SR0A 2QMEA 2CVFA 4RSGA 3L0PA 4UXHA 2JLWA 1IONA 5K8IA 1PUJA 2JATA 3OAAD 2RGNC 4B3XA 5JEEA 3MWJA 3B1YA 1IJFA 4FCVA 1XPUA 1F2TB 4G5QA 1Q20A 3IHLA 1WBBA 3K0FB 5DYIA 4RZUA 2YYZA 4Z54A 1ZU4A 3AP2A 3A1TA 5H8WA 1W47A 1TF7A 3QQ5A 4UJ5A 5CIQA 3LWNA 1DS6A 4KITB 3W3AA 1O3YA 4PC2A 3Q5DA 4DUGD 3THWA 3VX4A 2C95A 4B71A 5F9HA 1JALA 3QNUA 3UIEA 3N2IA 3LLUA 2QAGC 3BK7A 4PPQA 2W00A 3ZZ0A 4AKHA 1AQYA 3OEHA 4LJ9A 2B7BA 3RSOA 5CM9C 3B1ZA 5C4MA 5FPKA 2C2HA 1HY3A 3L0SA 3KKOA 4XTRA 1CR2A 1H8HD 1RIFA 1TX4B 4O3MA 1U8YA 4LYHA 4EJSA 1KK0A 2GVZC 2RGEA 2FZ4A 4LK2A 2OM2A 1N0VC 3CX7A 3ZLJA 1YR7A 2B21A 2ZJAA 4TLBA 3AEZA 5ELXA 3T12A 1G6OA 2NQ2C 2DB3A 5IF9A 2BDTA 1AN0A 2AL7A 1RJ9B 4YMUA 4GL2A 1GAJA 2PL3A 4FMCF 4FCTA 4DCNA 2XXAA 2PX0A 1AKYA 5FUWA 3R9WA 2IUSA 5JWHA 1KIMA 4D80A 3PXGA 1DEKA 1MH1A 2DR3A 2I1QA 1QZXA 4GP6A 2X2EA 2GNOA 4MGIR 2CNWA 1V43A 2PEYA 1T0JB 5K8TA 2XZPA 2VEDA 3RAPR 4BRWA 2DFKB 5J47A 1J8MF 2W6ID 3CWQA 1PV4A 2WHXA 2FSFA 2EFEB 3GLFB 1CJVC 1OXXK 1D9ZA 1D2EA 4LGMA 2LKDA 1R6BX 1ZNXA 2F9MA 3AVQA 3PUYA 4LBWA 2OEPA 2W6IA 4RFSB 1OJLA 2ZSFA 3OIWA 4KV9A 4K81B 1SXJD 4M22A 4P33A 1ZNWA 2LCFA 4X8MA 1IBRA 5B2ZA 1TF2A 2ZAOA 3THWB 4IDQA 2KBEA 1JR3A 2QQ0A 2ZSAA 3DMNA 1ZIPA 1ZM3A 3VQTA 2BEJA 4PFSA 3KQNA 2PZFA 1E32A 1NRJB 2JJ2A 1E9DA 2WOJA 4M1MA 5E4FA 2KWIA 2HYIC 1I4DD 1G19A 2JJ1A 2AKYA 4UNPA 3NTUA 4UNQA 5BYKA 1KNXA 3Q8XB 3CF0A 4M9XA 3EZ2A 1P5ZB 4DLRA 1QHSA 4GFDA 4F92B 3TUZC 4TLAA 4DB4A 1AK2A 3BRWD 4IRUB 2F43B 2V9PA 1N6IA 1DVRA 4RD1A 2QTVB 4A36A 1N2CE 3O8DA 3RS2A 4DEXA 1UDXA 2V6JA 5DHAA 4L16A 4R2HA 4H9GA 2VP9A 2GZHA 1ZRHA 1YR6A 3P4YA 3L82B 5SZJA 1X8JA 2O8CB 2GXUA 2PJZA 2ZITA 2ZSEA 2GXAA 4ZI2A 2D7CA 3UMFA 3RLFA 4FD2A 1T9HA 1XTRA 2OCPA 2OFWA 1E1RA 2ZE6A 4A0HA 1FZQA 1E2PA 1XXHE 1LVGA 2QGZA 2OV2A 2XTZA 1DARA 1Z5ZA 4LY6A 1UKZA 3LXXA 3BFKA 4M2LA 2ANCA 4LJ4A 1CRPA 4Q48A 1IN5A 5ANRB 2G9NA 4BZXA 2CCJA 4LC0A 4UXJA 4B6FA 1Z63A 4CYMA 1E2GA 3OFNA 3FE2A 3EIQA 3UATA 1OIWA 5EP2A 1S3GA 1WMSA 4HLUA 4S35A 2ZRAA 4JYCA 4DLTA 3CW2A 3OHMA 4IJMA 4IEEA 1XZQA 2OBLA 2JLRA 2C5LA 4HAYA 3I3SR 1KMQA 1G8PA 1SVOA 4TQUS 4V0OA 3TSWA 4ESHA 2J0QA 4NYIQ 4NCHA 4OBEA 5KSPA 3GCGA 4BFWA 3KQLA 1YZLA 2NO9A 5KTYA 4JLNA 3W8RA 2H57A 1N3BA 3SYKA 2G1KA 3Q7PA 1XPRA 2IYQA 2QROA 4A2PA 2WWIA 1G9XA 1XF9A 3BBPA 5A5GA 3EZ7A 2ZRMA 1G5RA 3IIMA 2XEXA 4BLOA 2AKAB 2QRNA 1MKYA 5EZ5A 1JXMA 4DLSA 3AUXA 2WIAA 3QI2A 1VHLA 2AK3A 3AUYA 4LHXA 5JJKA 1E2FA 3NEJA 2J1LA 2FFHA 5D3QA 5UKDA 4CEHA 4OHZA 3KX2A 3LRPA 4OQXA 2QMHA 1XCMA 4JKIA 5E95A 3GPLA 1FUKA 2ZU0C 4JBXA 3SNHA 3T5DA 1OHHD 1W36D 2BVNA 3W6PA 4QGAA 1IXRC 1MRNA 2D62A 4ZO4A 3MMPA 1BS1A 1W1WA 3QXXA 3E1SA 4GMDA 5CLQA 1T8UA 4OI0A 4DEYA 4MYCA 4MQBA 2H5EA 1F2TA 4DDUA 3U5ZB 1AJEA 1R7RA 4Q66C 2GRJA 2YOFA 2CLDX 4YXWA 3FHTA 1KJZA 2ZVQX 3KB1A 2GXQA 4DLZA 4C0HA 3PR1A 2QAGA 2EWWA 1JQJC 2ATVA 2G1JA 5LDDC 3RRYA 1KI7A 1G3IA 1EG7A 1HURA 1HTWA 2Q9CA 3PV0A 4HATA 4EPTA 3GJ3A 4HB0A 1CEEA 5KPDA 3AF0A 5EE1A 1E3MA 2JASA 2A78A 1R0YA 4LYAA 4NP6A 4TL7A 4TYPA 2JLSA 5EP1A 3E70C 1TNDA 4B2IA 2N46A 4PAOA 4FMDB 2ONJA 3WP1B 3X1ZA 3DZDA 2HDNB 4AIIA 1XP8A 2A5DA 1SHKA 1XTIA 3N2EA 4NYMQ 5JECA 4EFMA 1AS0A 5GJWC 5JLJA 4IOJA 3ADKA 1XWIA 3BWDD 3KKMA 2ZI3A 3ZZUA 4ZV4A 4Z8XA 2R44A 4LWZA 3QKSA 3MUFA 1NBME 1OXVA 2XX3A 3X1DA 3ZGXA 1H8EA 1TQDA 1GL7A 4TYYA 3D6TB 4EPXA 4EQ6A 4A8JA 2W83A 721PA 4EPYA 2J3EA 3IILA 1WF3A 5DE3A 3G5UA 4TZ0A 1GITA 2OESA 4NYIR 2B7CA 3RWOA 1KKMA 2Z0MA 2PBRA 4UQOA 4ASUA 3RRZA 1W5TA 4C0LA 3GLFA 2C78A 1KO8A 1KZ7B 1TADA 1NP6A 1K8RA 3CUEF 2ERYA 3T34A 5TV2A 4KLZA 1D5CA 3HYTA 3UMSA 3QXSA 1FMLA 4HUQA 3B9QA 3M0EA 4PC6A 4TSFA 3VX3A 4C0JA 2ZS8A 4C2TA 2OE2A 2HYDA 3ECCA 3CO5A 1ZCAA 4IXMA 4C0SA 2EFGA 4PAMA 3C15C 3T1QA 1X6VA 4BRUA 3VTKA 4W7SA 1YZQA 3ZQ6A 5TVKA 1XEWY 2PLRA 4KCGA 4JVLA 1AIPA 1TUEA 4C4PA 1S9HA 4JMPA 2KBFA 3ADBA 4AYTA 2FV8A 2FF7A 1E79A 2DFTA 2HF9A 2VSXA 5GJVC 4OI1A 2FU5C 3MD0A 2GEUA 3KTAB 1SGWA 3EWSA 2FFAA 4ZKEA 4DJTA 3U6BA 4D81A 2H92A 3AKEA 3KKPA 2FG5A 1VHTA 1KI8A 3NC0C 5D3MB 3QOFA 2O8BA 2WWFA 4AURA 2ORWA 3CRW1 1YRBA 3QPUA 4Z1MA 1RKBA 1KSGA 4R71A 1NY5A 1Z0DA 3CPJB 3UK6A 1G18A 1TPZA 2Q9AA 1F5NA 2BMEA 2GVDC 3WBKA 2A3RA 4GNKA 2EQBA 2OBNA 4LV5B 2BCJQ 2YWHA 1MOZA 5A0FA 4FWTA 1YZNA 2IHYA 2IS1A 4A0GA 1NSFA 4NDZA 1Q3TA 3AQ4A 1E9RA 1G6HA 2VHQA 3GD7A 4L8GA 4DBLC 4P4SB 1X3SA 4BFSA 1TMKA 5A4JA 3K0CA 3THOA 1Z6YA 4LV8B 1XTKA 2F43A 1KI6A 3GEEA 4Q7KA 2L0XA 3IEVA 2W58A 2GJ8A 2NOAA 4AD8A 4DLVA 3FGNA 4LC1A 5FTJA 5JCZA 3T1OA 2I3BA 2ZYTX 1J70A 3ETLA 1X86B 2AN9A 2Q21A 1WB9A 3QE0A 2D2FA 5FOWA 1VIAA 3BERA 4N0DA 4DDWA 2ZSDA 1W49A 1YU9A 4B35A 4MRRA 4F93B 1S2MA 2F7SA 1KY3A 2WAXA 4LSGA 4KFSA 5AJXA 2ZROA 1FOEB 2ZJ8A 2AXPA 4QC2A 3EA0A 3AKYA 3ICQB 3K0CC 1VG1A 4JKYA 5DH9A 5DI3A 4LJYA 1HT2E 2ZJ5A 1E9BA 4O2LA 4HUTA 2YOHA 3GLGA 2Z4SA 1P62B 4BUJA 4BLQA 4NU0A 4XOIA 3FWYA 1GILA 1FMJA 1VG0B 3NDPA 5B30A 3B1WA 1MABB 2EFDB 3IUYA 1VYUA 4QJ3A 1E9SA 1IN6A 1A7JA 3SJBA 2FFBA 4KHZA 1UBGA 2VP6A 5IK2D 3PUVA 3SQWA 3CONA 1T8TA 4PZZA 5JJLA 2R2AA 2ZRPA 3TW8B 3NVAA 4DIEA 3R8CA 4FN5A 5G3ZA 1XDBA 2ODNA 3TE6A 2BKEA 1VKJA 4Q19A 5EXXA 1PLKA 4G5SA 2QBYB 1XJ0A 1XMIA 4PO9A 4OHWA 4NH0A 4IOLA 2GCNA 1YKSA 2IWRA 3ZVNA 4D4JA 6Q21A 3T15A 2XSZD 3KUDA 2AD1A 2IS2A 2QL6A 5FI0B 5GVRA 1MV5A 1QHYA 1TQ4A 2BOVA 2BMJA 4JLDA 2W2XA 4WZAE 3T06B 4AK9A 4JBWA 2F9LA 1DOAA 5IRCD 3IO5A 2CCGA 4DSNA 1QHXA 4PC7A 3X2SA 2Q3FA 1ZVQA 5KSOA 2J0SA 5DNYB 1U98A 1R5BA 4PHGA 5G53C 3UWKA 1SKYB 1JXOA 4RZ2A 2WV9A 4YMWA 2F1IA 4C7OA 4HAWA 1GRQA 2BM1A 4LHYA 4B75A 4DB2A 2QAGB 5FTKA 3AM1A 5JFGA 4AKIA 4XD7D 2QPTA 1EK0A 5KDLA 3VHLB 1VCOA 1Z22A 2DCUA 2XOKA 2Q0HA 4AI6A 2QPOA 4Q4AA 5BW8A 2EYUA 3OAAA 4YONB 2OCAA 4TTQA 3RHFA 4F4JA 3U4QB 1U8ZA 2REXB 1JNYA 1G7CA 2OFOA 1E79D 2A9KA 4DSTA 4DLUA 3ZZTA 1SQ5A 1XD9A 2GBLC 1CXZA 1G8YA 2KE5A 1F2UB 4DT1A 1T91A 3JVUA 2WPDA 4P4TA 2ZJBA 4C30A 2ZE7A 3IIJA 1Z0AA 4JIMA 1Z8FA 4MDFA 5FTNA 4A6PA 1M2OB 3WP0A 4RZ3A 1E2JA 3LD9A 2Y8EA 4E03A 2FPMA 1WE2A 2P6RA 1VCMA 1NKTA 1T5LA 1XMVA 1E98A 1N6LA 5JI3E 2C03A 1P72A 4QBFA 4GZLA 1G7TA 2EFHB 2QE7D 2VHJA 1CR0A 3FHOA 5DN6A 2JEOA 2ASEA 2ZRFA 5E3HA 3P20A 3VKHA 4BWYA 2QTHA 1XX6A 3DOEA 4ZDWA 3DHWC 4B48A 5L3SB 521PA 1MO6A 4CEHB 4EAQA 2GKSA 2F3RA 1KI9A 3GLHB 3I5YA 4Q1DA 4IDOA 1SVLA 4I99A 2R6AA 3LO5A 3AF1A 1N5IA 2J46A 2E9SA 4Q01A 3PUZA 1GZSA 4HAZA 5FUVA 1EFHA 1JAIA 2X8AA 1OXTA 2RMKA 1Q1ZA 1GVNB 1C1YA 4G0NA 1GSIA 4TMZA 2VQSA 1CBUA 4MUAA 5HKKA 1KI2A 1OYYA 4G5RA 2E1RA 2NO0A 1D8TA 1R0XA 1IN8A 1IQPA 5FUYA 2YKGA 1CTQA 1JJ7A 2CHQA 4GOJA 1D2NA 2FEOA 2YC4C 4O0MA 3VR1A 1OXUA 3LVQE 4BFTA 2XSZA 2EW1A 3RS4A 2IUTA 2RGCA 2W0MA 1NLYA 3ZS8A 2GEVA 4DCUA 1CJTC 1CJUC 2J0VA 4A4DA 4CDGA 4DCSA 1YVDA 2PT7A 3WNDA 2IYLD 1SXJC 4RKEA 1W0KA 4WXPA 3THXA 1CR1A 3AF3A 3ZDQA 1NN0A 3QG1A 3DO6A 4HAUA 4HB2A 2VHUA 4D6PA 2AXNA 5GJCA 1BO6A 3A58B 2VH5R 4CVNA 2HXSA 1J8YF 2A5YB 1G5PA 2NO6A 3QKSB 4V0ME 3VNVA 3D8BA 5GADl 3SBDA 3CWZA 1L2TA 3X1WA 3AVTA 2EFCB 1FPMA 3CPEA 3VR6A 1OYWA 3ZIAA 1W4RA 1W36B 2XNDD 2D2EA 3BH0A 3VKWA 2C04A 2BEKA 1GFIA 3JZAA 1VYTA 2PMKA 4IFBA 3SN6A 4EPRA 4MRPA 3NG1A 1ZJ6A 1U8AA 1PVOA 4JSTA 4KVAA 3FKSA 4PC1A 3TR5A 2BMFA 2P6UA 2R62A 4HDOB 4BECA 1T3HA 1GWNA 2VLIA 1M7BA 4BLRA 1GKIA 3NBFA 1M7HA 1KAGA 1FTSA 2VO1A 5J4KA 3FMFA 1ZD1A 4GSYA 3RRMA 3IQWA 1P9RA 3GLGB 3VMFA 2BJVA 1UDWA 4P3YA 2RKOA 1GUAA 5H1YA 1II0A 5KNBA 2O8FB 2OCBA 4YMTA 1COWA 5HTKA 1OH7A 2GWHA 3AP1A 1JB1A 1PLJA 3NWJA 3Q85A 5CJPA 3SE0A 5HZKA 2DWQA 3KFVA 4URUR 3R9XA 4KXFB 1E99A 1N0WA 4B2PA 5JMTA 3QVUA 1G4AE 1RYFA 4US2R 4Q4HB 4A9AA 2IEZA 3VNUA 2IW3A 4MRNA 1E2MA 8OHMA 4LPSA 1WGWA 1EFRA 2GETA 3H86A 4GMXA 2WKPA 1FTNA 3RABA 5DYGA 5H70A 1KO1A 1LS6A 4QFMA 3TH5A 3AVUA 1KI4A 1LS1A 4GBMA 4BZQA 4PPFA 3GLHA 2XZLA 4TT3A 5KYKA 4KBGA 4TMVA 2CVHA 1PLLA 5KSYA 4TZ6A 1FP6A 4IEIA 2AFIE 3AB3A 1MO4A 2ZSBA 4X8HA 1UM8A 3D7MA 1YQTA 5BN5A 1RRPA 2ERXA 2FNAA 3DKPA 1S4QA 2KSQA 1LTQA 2WJHA 1VDZA 4LHWA 3R7WA 3WXMA 2CHGA 5JCPA 2PT5A 5FTMA 2CL6X 3A4LA 4OK3A 4ZDKA 4ZDJA 3PEUA 2JLQA 3H0KA 5AK0A 1KSFX 5CK4A 1NKSA 2E87A 1E2DA 1ETUA 1R5OA 4JVMA 2V6IA 1R4AA 5EQTA 1G4UR 3Q5EA 1KO4A 1CU1A 4X8OA 3P4XA 4MRSA 2GCOA 1LY1A 2YV5A 3EIHA 3U7GA 1JECA 2C99A 1E9AA 1QG2A 1R10A 3CF2A 3H84A 1JPNA 1BMFA 1II8B 2ODWA 4M9SA 1Y63A 4XJXA 2QBYA 1W2HA 3THYA 4NCJA 2QM7A 2CK3D 5IT5A 3SHWA 5KOYA 3A1SA 1M74A 3KZ1E 3B8HA 5TB5A 5CDFA 2NO1A 1GP2A 2O8DB 3E2IA 5G40A 3BFXA 4OK5A 4PZLA 4TLDA 2ECKA 5J40A 3VR5A 5DGXA 1VG8A 4X8LA 5F2EA 2CL7X 3TSZA 4TQAA 3PG5A 1J99A 5L3QB 3A1UA 4Q4HA 4B43A 2P65A 2J7KA 3SI7A 5IK2A 3IDQA 3BH7A 3U2QA 4BEJA 3THYB 2PCLA 1NN1A 3W6OA 4C7OB 1W46A 2Q3MA 4P0TA 4WAUA 5HCNA 1FW6A 3BXZA 4A92A 2H16A 1QVAA 1ZNYA 2VA8A 1E69A 4URZR 3P1JA 1KJWA 4Q4AB 4EIWA 4DUGA 2A5GA 4WA7A 2P2LA 1OW3B 2Q3HA 1QHNA 2WSMA 4CT4B 2Z83A 3T5GA 5C46F 2XITA 2VRWA 3EAQA 2CNWD 1LV7A 2B6HA 2D4HA 4JLKA 1OIXA 1WP9A 5CYOA 4LPKA 4RD2A 3I61A 2ZRNA 1VG9B 2HT1A 3VU9A 2J7PA 4U02A 5C1BA 1UEIA 2O52A 3K0FA 2QG6A 5F3WB 2FJUA 4D0LB 1XD8A 3FPAA 1G17A 1OKKA 5JHGB 2ZI6A 1U9IC 1Y3AA 5AR1A 3ONWA 3GP8A 1WXQA 4IW3B 1LB1B 4JVSB 1KGDA 3GJ5A 1CKEA 1KO7A 2GF0A 2O0KA 1XJQA 1WQ1R 2RGAA 2ZYWX 4JS0A 1FNMA 4R2IA 3K70C 4HLQB 1SULA 2ZRHA 4LDJA 2YINC 2NZJA 2FWRA 2GZAA 2JJ8A 1S3SA 4HB4A 2VL7A 5L3SA 1ZAKA 3WRXC 3FHCB 3R8FA 3SZRA 3B1XA 2GCPA 5IHPA 3C16C 4ARZA 3QKUA 4JLVA 1UPTA 1ZNZA 4DZZA 3GJ6A 3SS8A 3DOFA 5FFMA 1JEDA 2WWYA 1Z06A 3X1YA 3GEHA 2J5XA 1K5DA 1N0UA 2QSYA 4L9WA 1SXJA 5KO2A 2V7QD 1W0JD 2V1XA 1EX6A 1TUIA 5JEDA 1F48A 2DBYA 3KJIA 1W4AA 3EARA 1M8PA 2ZRBA 1KI3A 3AGQA 2JAQA 2BCGY 3I72A 3CF6R 4Q7JB 5DI3B 2ZS9A 4LOAA 4HAXA 3L8ZA 1GDDA 2RAPA 2WZQA 2QT0A 4UNSA 3VFDA 3U3RA 1GOTA 3NHAA 2SHKA 4JBYA 2NPIA 5DIFA 2FMXA 3V4FA 4WW0A 5DSZA 1IXSB 1VCIA 5EE5B 4M53A 2VF7A 2F3TA 4UXIA 5FPSA 4LJ5A 5FBLB 3O8RA 3GLIA 4D25A 1PUIA 5BQ5A 3TIFA 3HP1A 2BMDA 3KB2A 3LX8A 1W0JA 4BFVA 2VP4A 4QHYA 2XJ4A 3MRSA 1NJFA 4Y0AA 3RS0A 5FOVA 2FSGA 3AVVA 2GESA 4JYBA 5HE8A 2PJRA 2QZ4A 5JWOA 1OF1A 4LV6A 3BORA 1XNJA 3OE7D 2HF8A 4M1OA 1NJGA 3CRRA 2MSDB 2J0UB 1L8QA 3EA5A 3DZ8A 3VR4A 1OB2A 3SOPA 4BE7B 1XFAA 4EJSC 2XTNA 4IOMA 3TR0A 1Q1QA 3SFZA 1AS2A 4QNRA 1XEFA 1DAKA 3H2YA 4GP7A 1EFUA 1HUQA 3RSLA 5BN4A 3O8CA 1YE8A 3Q7QA 1E1RD 4GI7A 4N0EA 1HA3A 221PA 1T5IA 4GDFA 1DG1G 2AWOA 4F4IA 3EC1A 1BYIA 4V0MA 2QE7A 4OYHA 5GVSA 1G64A 1NG1A 1NVUQ 1CIPA 1VYVA 1Z6GA 3RNLA 3FOZA 1OKKD 2X2FA 3EX7C 5JZVA 2J45A 1E0KA 3B5JA 2Z43A 3NBYC 4PC3A 2V4ZA 5FL7A 4EPWA 5EXSA 5KHOC 1UBCA 1E2HA 2REOA 3K9GA 3DMDA 1RRGA 4XVQA 2UKDA 2WWGA 5CJ2A 3GJ0A 2ZRGA 1M6NA 1ESNA 1WDTA 4QNMA 5LD2C 1XCGB 4KYUA 2WWHA 2ZRCA 4YDHB 4KLNA 5E7JA 1ZW6A 3HWSA 3MSXA 5CITA 2IYWA 4QJ5A 1N6OA 5J4HA 3VR2A 2FFQA 2ZRLA 2QN6A 4GPTA 1NLFA 4US0R 4P32A 5EP3A 1JPJA 4LZZA 5DHFA 2V1UA 3GJ7A 4OJQA 4OQFA 2VTKA 2PZEA 4Q9IA 2G6BA 2ZI5A 4DHEA 3K9HA 4D4KA 3AVPA 2P67A 4XWKA 3B60A 3BB3A 1E9EA 4V0KA 1JJVA 2XXAB 1SKYE 5BYJA 3TMKA 1EX7A 2QORA 3KJEA 3SYLA 4QGGA 5DN6D 3T1TA 1ZUIA 3M4YA 1W7AA 1G5TA 4Q9LA 5L8VA 2FA9A 2ZR7A 3A4NA 1NLZA 2V54A 4DIDA 3QPVA 3A6PC 4QM7A 3DDCA 2GCOB 4Q1CA 3MJRA 4FWIB 4Q4LA 1M1YE 5HE9A 1W4CA 1TQ2A 4OL0A 1VMAA 5TMPA 4JVNA 3AKCA 1XZPA 3VKGA 4LBVA 2RCNA 4PAQA 3A1VA 5E7IA 4RFSA 1J90A 3M6AA 3NH6A 1WCV1 3RVBA 1E1QA 3HU1A 1P2VA 2OHFA 3K53A 4URWR 3REGA 3W9YA 4MRVA 2ZANA 4WZ6A 1NG9A 3RYTC 4TLEA 3P27A 1Q0UA 2JDID 3BD9A 1F6BA 3MGCA 3OESA 3TUIC 1JEEA 4CGZA 3PEWA 2ZUBA 3KJGA 2IXFA 3JVVA 1OIVA 1P7CA 3WYAA 5EXPA 4HUQB 1TU3A 4RD0A 3PJRA 3IHWA 3I8XA 3LNCA 2IUUA 4Q1EA 4XVRA 4AY2A 3U44B 1W0KD 2OT3B 1OPXA 2O8CA 3SJAA 3LY5A 2YWFA 4I1VA 3B82A 2XZOA 3QBTA 3U7EB 1AZTA 4TQ9A 4AYWA 2X19A 4S2EA 3UXMA 1E2QA 1DO0A 1U9IA 4LBYA 3OIYA 2BWJA 2WAYA 421PA 4UNNA 4OI4A 5FUXA 1Q3HA 4MYTA 3MJHA 2R6DA 4NL4H 4YXWD 5SZKB 3K0SA 1J2JA 4JJKA 1LNZA 1GL6A 3LAWA 4P31A 3V4RA 1X1RA 4TMXA 3FDIA 4LJ6A 4JL5A 1AGPA 1BMFD 1VECA 3LA6A 3OIUA 2QUZA 4OHXA 1OV4A 3B78A 1KDTA 3QF4A 4JLPA 1T3SA 3WMEA 5AUOB 1OT3A 3U7FB 4RZXA 4A6XA 3KXLA 4I1SA 4D0NA 1Z83A 2WJGA 4Q47A 4QGFA 4CEIA 1P9NA 2VIIA 1EGAA 2CLCX 2OG2A 4DDVA 1P2SA 4MUBA 1YR8A 5CK5A 1I2DA 5EZ6B 5G3YA 2OLJA 2Q9BA 2ZYUX 3CNNA 3MCAA 1A2BA 2ZRKA 4KFTA 4US1R 3TW4A 1ZYUA 3LQQA 4PHTA 2IYVA 4JZKA 2P5SA 3ICEA 3GLIE 3FMIA 1ZC3A 2XTMA 3MAAC 2EU8A 4RD6A 3V9PA 4DRZA 2Z5FA 3SHFA 4CRWB 4B47A 2WBLC 4D0GA 2WVJA 3W5IA 3AF4A 4DKXA 5JSZB 3FMPB 1N6RA 3FFAA 1NMXA 5J4VA 4FXPA 1KAOA 2HLDD 4L9SA 1TF5A 5LPNA 4IXNA 3SBEA 3OEED 4TYQA 3UPUA 1B0UA 4YDSA 3BOSA 1DBSA 4PX9A 2NPFA 4YQFA 3DPUA 3EPHA 2IXGA 2TMKA 2GZDA 3K0EA 2R65A 4OJKA 3RC3A 2ZE5A 1R5NA 2BBWA 2F1RA 4AWXA 1SXJE 1OH8A 2HXYA 3I4LA 4W5HA 5IDVA 5L3VA 3CIOA 3NBZC 1ZCBA 1SZPA 3GFPA 2ZXUA 3EPJA 3SYNA 3FVQA 1P6XA 1G8GA 1Z2CA 3RDPA 4L4UA 3QPWA 2K5UA 2IYRA 1Z28A 2HLDA 3BB1A 1W2GA 2UVQA 2ZRJA 3QVVA 4HLCA 5CB8A 1XB2A 1F3OA 4PSKA 4A15A 4IOKA 2RGGA 4KSBA 4AC9A 4MKFA 1KDPA 4JL8A 4QBHA 2DFNA 2IF2A 4B73A 4C2UA 2JLXA 4FMCB 3F0TA 4D4MA 2O5VA 4Q4JB 4EPVA 4A2WA 1GNRA 3QF7A 2G3YA 2YJTD 4JSYA 1N6PA 3U3OA 2FPLA 5AUPB 3CRMA 1DAMA 4U7DA 5AJYA 1KK1A 2YWEA 3MWLA 4NONA 4O2RA 5FPTA 4CEJA 1E2KA 4MGYR 4Q5IA 1NF3A 3OF5A 3BFVA 4ON9A 5JI2E 4M4SA 4Q9JA 3OZXA 3CX6A 1NVVR 5K8UA 2DHRA 1SVKA 3SQXA 4LX0A 1NBMA 4DSUA 1E2EA 4A82A 1EFTA 4Q7MB 5FBVB 3EG5A 4A2QA 4WZBE 4G5OA 3FB4A 4HAVA 1KDOA 1E2NA 2KI5A 4TMWA 4M1TA 3I5XA 5L3RA 5G41A 1CJKC 3SEAA
chains in the Genus database with same CATH superfamily
4LDQA 2F4VB 3X1OA 3ZXIA 1OH5A 3PYMA 4KAJA 4BLSA 3OPYI 4J16C 3II6X 3Q87B 3VU9B 4K86A 4DNPA 4ZJPA 2BAGA 5KJFA 4N3AA 2B6NA 2GLXA 1T35A 5CX4A 2AWYA 2GEDA 4ZC8A 7MDHA 1ZJWA 1HH4A 3BA1A 3R09A 2W6JA 2VNJA 2QX7A 1NBBA 3NPMA 3CNLA 2EKZA 3L06A 4BQNA 1NN3A 2DPGA 5B1DA 1ADFA 3FHLA 4P5EA 2QI9C 3IBFA 3ND9A 2DPXA 3ZQKA 1PWEA 3BVPA 4FHZA 2HHHB 2CJWA 3FOCA 4ND8A 4I4IA 1HDXA 1JKJB 4NBSA 4ZN6A 5JNUA 3HDQA 1MMFB 3G9QA 1QYVA 4DHWA 2QW1A 1RI1A 2P6VA 2FRDC 4EQZA 2IHUA 3RVNA 3EAGA 2C3YA 3CO0S 3L8IA 1WP4A 2ZT7A 3PQDA 3Q7IA 1GKYA 4LCJA 5FDFA 5JASA 1LF0A 4LMRA 1RABA 4EENA 4TZKA 1RE0A 2DFVA 3V3TA 3C97A 4PBRA 2VG8A 5BNFA 3NHZA 4ARZB 3WMGA 1L7XA 2JGRA 1H6CA 3OPVA 2CJWB 4ZZ3A 3HU3A 3HXLA 4L0DA 1IZ9A 1OCOC 2VQEB 1K5GA 3DQQA 1XTVA 5LOVB 4HQOA 4QQKA 2JI7A 4MS1A 2P40A 4WFKA 4UARA 1R0ZA 4ENUA 1PDWA 4KVGA 1JPVA 3FNBA 1V5FA 2DC1A 3A9UA 1ODSA 3ICCA 4PANA 1A41A 2LKCA 3QVGA 3HCFA 4R9UC 5TMDA 3TJRA 4Q16A 1VTKA 1PD0A 2OR3A 3IOEA 4X97A 2GAQA 1KU6A 2ORYA 5EE0A 2IK8A 1ZI9A 3WLKX 1ZP6A 3GARA 3ASUA 4KMRA 4YGYA 5JSZA 1JTEA 3MS4A 2PWZA 3IR5A 3TQFA 3Q8WA 1BWRA 1DRUA 1ESDA 3D64A 3DBVO 3PQ8A 2RCYA 2OP0A 5LA6F 3WK7A 1GFZA 4KQWA 4EL0A 1Q0DA 1PFKA 1G20A 1V5GA 4YMSA 2PSJA 3D2CA 2AVDA 3IB6A 4MQ4A 1DBQA 1MTZA 1XDWA 1YBHA 5JSQA 5TGTA 1OYOA 5JD3A 3GBPA 4N1AA 4QG7A 1KAHA 5C4IA 1KTIA 4BVAA 1MVOA 5C8DA 1PNQA 1XXHB 4M83A 5FI3A 2ZI4A 1Y6RA 4RANA 1Z29A 2R6JA 2PR2A 2ZJ7A 1T0BA 4AG5A 1PSWA 1MJNA 3PSAA 5HRAA 2TECE 3MYYA 5AK6A 4BKPA 5HGJA 4NPHA 3VC1A 1NJ6A 4G5HA 5TS2A 1H5NA 1OMOA 1E0AA 1EINA 3QF4B 5KC8A 4A8TA 1A5ZA 1QP8A 4CL8A 2DH6A 4OD4A 1G20E 3HWX1 3IEUA 3QVSA 3T9FA 3CNQS 3TCXB 2VZ0A 2P9CA 1BW9A 3B3JA 1XTSA 3FZQA 4ZCRA 4U7GA 2KGOA 2IYUA 1F2UA 1E6EA 2AIRA 2XIJA 3ZTWA 2XQGA 5FP0A 1CWUA 2ZUFA 4L08A 4POAA 1QXSA 2FW7A 4OXRA 2BSXA 3T3IA 4PG8A 3KKNA 2F8TA 1AKQA 3VO2A 4JBLA 3ZDBA 2YLIA 4QYMA 5LN1A 2JFGA 2IA5A 3A1FA 1FVOA 3PPIA 5KBYA 3OEEA 4RD9A 2CBGA 3CLRC 4N5DA 4OQEA 3S1AB 4B8YA 4EFNA 5CB6A 3U7HB 1QS0A 1T43A 3I2KA 4JMLA 4LYEA 1VQ1A 1TI7A 3P97A 3FZEA 1Z5WA 2F22A 1DUSA 3JZDA 1EVYA 4WRRA 4LDNA 2H4WA 3QEAZ 1H2HA 1JU3A 1CLUA 4LHVA 5DLQC 4FJ2A 3DD7A 1N6HA 4ZV7A 5K3FB 4K9NA 1RCUA 3O73A 5K0BA 1G7RA 1LE4A 1O96A 4O1MA 4F7WA 4J1QA 1TYDE 4QUJA 1WMAA 2HLNA 4G65A 1CHNA 1NMZA 4ND3A 4OPMA 1JIXA 1UMCA 3AF2A 5LBTA 3WO1A 1Y4AE 4M7PA 2VRBA 4JI0B 3TLXA 2GILA 2OHGA 3IALA 5TQ0A 2Y4NA 5JALA 2PRSA 2J0EA 3WG9A 4AICA 2GN1A 1U3WA 3KZCA 2O2EA 4BE9A 1E6CA 1SVWA 1R6VA 4XUCA 3WLOA 1P6QA 4BNKA 1O6GA 1U5BB 4KJZA 1Z0KA 3DLBA 1W2WA 1AHHA 1B3BA 1K6IA 2FK8A 1QIMA 1DX6A 1TM4E 2QE9A 2VJDA 3WTCA 1C9EA 1QLHA 4ULVA 4KLAA 4ZI3A 2IJGX 1CY1A 1X9IA 3FG9A 2CXPA 3HRIA 3JAKB 1GCAA 3K9WA 3OD1A 1CY6A 2HV6A 2AHOA 4HYTA 4W5OA 2VBCA 5BURA 1EFKA 3LUPA 4JUFA 2MU1A 1XYVA 1Q3KA 2W11A 3MTBA 1TA0A 5EMKA 3H75A 4EDFA 3Q41A 2NO7A 5ESXA 4ZCMA 1O58A 1VBMA 3KHSA 3VAAA 3F71A 3DDZX 3DLCA 4JEUA 3EN0A 2I29A 1K4YA 4NYJR 5K4HA 1WMEA 1G5IA 1VJ0A 1ITZA 1Z7GA 2PGOA 3BIWA 2I03A 3FPKA 1GZHB 4YHBA 2JFUA 1C7EA 4W8PA 3PITA 1JEOA 1XN1A 3QH4A 2C5FA 4KGZA 5AKLA 4B9EA 1O94A 2PWAA 2XB2A 2FMUA 5HSWA 5C37A 1XMQB 3ET4A 3VR3D 4V3CA 4K26A 1KS9A 4RVHA 4KW7A 2DECA 2OQIA 2IXEA 3TVTA 4FINA 3AG4C 1I4LD 3RVSA 4MWTA 3KFLA 3QKRA 4RY0A 4JH0A 4ND5A 1G8FA 4JUIA 2Q3CA 3N2NA 3ZLVA 1Y7PA 1RHQA 3ANYB 3E3OA 5DNWA 5A9SB 2H7VC 1W4LA 4MS4B 5AW0A 2HSGA 1CUVA 3GGCA 4JX8A 4O4JF 2AP3A 4Q4CA 4KK3A 4BJ5A 1B0AA 5AW9A 4NBLA 1WB5A 1TCUA 4C2BA 3B0VC 3TQIA 3OLYA 4F11A 4LVOA 1C4OA 3VR4D 3A2KA 2XUDA 4PLWA 4YBRA 2DGDA 2MTBA 3NOQA 4XB1A 1U0LA 4MKGA 4O6MA 2CYBA 1XL0A 1NW3A 1Z5GA 4QOIA 1JDBC 1CRQA 3FUUA 4U2KA 3U9LA 3UHAA 4R3WA 3LZ6A 1Q14A 1GCIA 5LSAA 1M2VB 2GF9A 2RONA 1SBTA 2P2CA 1MN6A 3NEPX 4JODA 5T3YA 4WBNF 2IX9A 3HB9A 3KJXA 4M1YA 5C3MA 3FXHA 2BKUA 5DYWA 2ROQA 1ZUHA 1F0NA 3P9YA 1WPXA 3WMFA 4CM8A 3BB4A 1WQ3A 4MICA 1ZQ1A 4BNXA 2EJBA 3I9JA 4C4OA 4R5HA 5CM8B 9MHTA 4XR4A 1VYIA 1DDGA 2XQKA 2JIDA 3FYUA 3LBIA 5ALLA 5SY4A 3MCUA 3PDIB 3ZWWA 1M6VB 1N6KA 3KKLA 2GM9A 1TMOA 2QUHA 2V8BA 1IBCA 5E2AA 4TTPA 3NPAA 2GJKA 3AZQA 1EVZA 1DV1A 3UWPA 5C34B 1TQHA 1A9QA 4J32B 3FNHA 1NDUA 2OEVA 4K40A 1DAHA 4RH1A 4LFAB 3ZQUA 3M5WA 1QPZA 3HI6A 3O3OB 3G3EA 4CCWA 1E5DA 5KKNB 3DM5A 3EHNA 1L4KA 4O4JB 4FP9A 4BVEA 1V3QE 1FJ2A 1R2QA 4H6VA 1ZIOA 4LQLA 3L0IB 5DCUA 1M0TA 4PAWA 5KNCA 5TT1A 5IKXA 5FBWB 2NG1A 1KHTA 2O0JA 1MJGM 2ORED 1N78A 1XROA 4Q1AA 3BXFA 4P92A 3AIIA 1QK5A 2CYCA 1SBHA 2PSEA 4CEJB 5TLSA 1E8NA 1FS4A 3L6CA 3IP7A 3VR6D 5GINE 4QRHA 2VYQA 4UM9D 1HE2A 4PIMA 4WCVA 5EZSA 5DCYA 4MWCA 3TZKA 3WQSB 3G0HA 3WGLA 2X51A 4AJJA 1N2XA 1SAYA 4PYRA 5FI1B 2XLMA 4EY6A 2BC9A 2RHMA 2MINA 1UXHA 3EASA 3ZDDA 3JD4A 4BLPA 1NAIA 1KYYA 4IWYA 1SKAA 1HT3A 2VDPB 1J2UA 3V8NA 4WZAB 1A9OA 5LMNB 4ZHQB 2C2BA 1TKCA 1XKXA 5D86A 4AMVA 5HTOA 1IN4A 3LT4A 4GOKA 3TBKA 2WG0A 2UU9B 3CVWA 4MEBA 2VJCA 1EA7A 3TKLA 2BIFA 4MO9A 2LCQA 3EEQA 3UAOA 3CJTA 3PYXA 3ZEIA 2NADA 3H83A 2HMQA 2HCBA 2JIRA 3CE9A 4HNGA 1GNPA 1NXXA 1E4EB 2LPMA 2ZE8A 3R6LA 4BNZA 5AUQA 1EA8A 3OX1A 1Z74A 2ZSHA 3VZSA 2OAQ1 3HA7A 2DMRA 3OOJA 1XCBA 3I37X 3QG5A 1T5OA 3A2NA 3WIDA 1HE4A 2QLJA 2AJTA 4HWPA 4OI2A 2XAUA 3T3GA 3ZJYA 3K6SA 5HIKA 3REFA 3SXZA 2CNKA 1I2MA 2Q6OA 4YRPA 2PX5A 3M6IA 4MPDA 3F98A 5JMOA 2B5OA 1GXSB 1TE2A 4PXAA 3T9OA 3GG2A 4MWEA 3QLVA 4HBGA 3P26A 3DT9A 2YQZA 4QJIA 1PR4A 4ZI7B 1H0KA 1Y89A 2E4AA 1FY2A 2GM3A 2WYHA 3E82A 4ZRDA 1I7NA 1R6DA 2H1LA 4F84A 2QTAA 4YDQA 5B57C 1JVSA 4WOPA 1RHUA 1UADA 3HWRA 2ZRIA 5ERYA 3LVRE 4BWVA 1PK8A 4MVZA 3O26A 4YMVA 2MSEB 3WIEA 3F49S 5IM4F 4QDTA 2C54A 4GVPA 4B3SB 2PGIA 2QSUA 3RS5A 2KYHA 2O2XA 1BDJA 3AH8A 5FPQA 3EPRA 2O8NA 1IM2A 3NHPA 2EZ8A 3OQJA 2PTGA 1BFDA 1AXRA 2JCGA 3ROKA 4BASA 4DXAA 3EBLA 3CAXA 4HDKA 1TQ8A 3Q5GA 4R8RA 4Q4JA 5LZ8A 2AWNA 1KDYA 3VOSA 3EEBA 1VOMA 1QYDA 2M6SA 3FLAA 4II7A 1ECJA 4NZMA 5JADA 4KIWA 2J0UA 3HB1A 3N2KA 4QO7A 5DX0A 4YMLA 1Q57A 2PLAA 1FFAA 1G38A 4LDZA 4E7PA 4C0KA 3HJRA 1Q44A 1U94A 3UXYA 3PUXA 4J29A 3M79A 5M3BA 2QK4A 1D0ZA 4J03A 1ZXXA 1G5FA 2V8OA 4ZEVA 1RWPA 3PK0A 2WJAA 3AFHA 2I4NA 3AFMA 5ESWA 1QE3A 1IG3A 3G82C 4FCWA 3RBAA 1IEVA 5DWVA 2J4CA 2Q4BA 3EOAI 2X42A 3KO8A 1XEXA 1AGRA 4UATA 1HDRA 3RJMA 1GZ7A 3T3HA 5C5DA 2QL9A 3HNOA 3D2LA 5AM3A 4Q3DA 3WWYA 2XSEA 3HJCA 4HX9A 3HEMA 4WEQA 4YJ2F 3R7SA 5I3CA 1E96A 1US8B 5E4TA 4LNUB 1W88A 2ORIA 1WXEA 2VQDA 4FILA 3R7CA 3EVEA 4OCZA 1UKYA 1L8AA 3N5CA 2GAOA 3G2IA 2G7ZA 4MKIA 3GM3A 4CKBA 1H4SA 2LRHA 2HKVA 1E0JA 2IY9A 1QHIA 4GZ5A 5E3IA 4R7ZA 2UZIR 3O0TA 4Z3OA 4IDGA 3AV0B 5HKOA 3G50A 1C1XB 1EP9A 4NICA 5EKUA 3ELUA 4FYJA 4PM4A 3NC4A 2ALJA 1EKXA 1GSHA 2VDRB 1ZUNA 5SYNA 4G9EA 3ZNOA 5G4KB 2XGOA 4PPYA 4MPRA 3S70A 4HDMB 5KDOA 3H5RA 3AVWA 1DB3A 1P5HA 2ZWAA 1NBHA 4I3MA 4PHCA 5JCJD 2IS4A 1WY7A 1B00A 3B20A 3M6UA 3OHPA 1IY1A 2P6OA 3T7EA 4AS1A 1H5UA 2J9UA 5KVCA 1E4OA 1T0HB 1CG6A 3H8JA 4AZ0B 3OOHA 2O8EA 3FPEA 1NXVA 1RLIA 3OFJA 2X1LA 7AT1A 3PRKE 3VH3A 4C06A 4WOJA 2FPRA 1L4EA 4KSCA 3TGPA 5P21A 1N7HA 3NO4A 3RBXA 1EE1A 4L78A 1X15A 3T7JA 5CA0B 4WFQA 4V0LA 1ODFA 3JTMA 4YC7A 5K6AA 4CMGA 1NXWA 1B6RA 1YC2A 2A8YA 2VHTA 2P41A 3DTVA 4C7VA 1IJBA 1JYFA 1GM5A 3AQBA 1X1SA 2D4AA 2H7VA 3FKSD 4RY2A 4DT1B 3W2IA 2PUGA 4C3OB 4MWBA 3BWYA 1UANA 3P9XA 3V4PB 2GASA 2GK6A 4N3NA 4EZEA 5AW2A 1IUOA 2IP4A 2I34A 4ALKA 4XCXA 4BGEA 1H8ED 4E1VA 1BG6A 1SCKA 3OFND 3LW8A 1JR6A 2G5GX 4OQ4A 2R7LA 3ZUGA 4HDNA 2YEVA 1DZ3A 4N49A 4TTIA 1HEUA 1GQ2A 2H11A 1B74A 4P2GA 5G0UA 4C01A 4OIPF 1T5HX 3AQCA 2NSYA 2OLKA 2WKRA 2WNHA 4XLLA 5DM0A 1UAAA 3R4CA 3SG0A 1XDZA 2QV7A 4YR7A 3BS4A 1X1TA 3WGTA 1DIRA 4PG5A 1QDEA 1PO7A 1CX9B 4HB3A 3GVPA 2Q1XA 1GGMA 2QMZA 4P34A 4X20B 3UG7A 3MCZA 3ER8A 4GEGA 1TC2A 1K4MA 2BZSA 1ID1A 1YJ5A 2V6BA 2I80A 4AVYA 4ZIRB 5JRDS 3BRJA 2EJVA 2GZ3A 5HOQA 1AGNA 1CRZA 1QX4A 1A3CA 4XQEA 3TDNA 2VDLB 4AMUA 1Z45A 3K7DA 1ENPA 3GK3A 1Z4QA 5EE9A 4CLHA 2XDYA 3IIKA 4M63A 1HNNA 3ONDA 2H5IA 3WNCA 4BGUA 1X80A 3INYA 3S7TA 4CLDA 3GZNA 3EOBI 4WD3A 1OGYA 6ADHA 5CXSA 2ZXRA 4AG6A 4NKRA 1YGYA 2BDEA 1EWTA 3I4CA 3PDUA 3C7KA 4ZRNA 3WTBA 2NYVA 3HJGA 1M1XB 5G02A 4AJNA 1NVAA 1L5HB 2CDNA 4K1LA 2Z2IA 5DRYA 1BFUA 3NBUA 3ZE2B 4NK4A 1ZWLA 3P9ZA 2RGBA 4CTNA 1UWCA 5KNCH 4PN3A 3DBLA 1M8JA 1XMJA 2GPYA 3CRQA 1VMEA 2EV9A 4UULA 2E18A 1Z47A 1FP7A 1Q0PA 2WICA 3KAKA 1UMDA 3JRWA 5BN5B 1X80B 1O5TA 3OEHD 4EWLA 4M8NE 4RC9A 2AEFA 3ENQA 1AS3A 2BT4A 4M0LA 3ZBUA 4A0QA 2VAXA 3R7WB 3ZUPA 2PL9A 3EVNA 3UGTA 1UFVA 3T5AA 4ETWA 1MXFA 3KXKA 1BX0A 1MUUA 1BQ3A 2GBCA 4PZYA 2NPUA 2AS0A 2L18A 2XGGA 2OECA 3ORQA 5AK4A 1SMKA 2QEQA 3C5CA 4RJLA 2R7SA 1A27A 4IGAA 1KXJA 4GRDA 1NPTO 3LT0A 3W77A 4ZZIA 1HSZA 1V7ZA 2DYKA 1HDYA 2P3SA 3G8DA 2CC2A 2XH8A 4FC6A 1U0OC 4GSLA 1Z62A 3OETA 4H60A 5DBEX 1BH2A 1P73A 2BM0A 2YXLA 4TWZA 3BA6A 4LVNA 1N2CA 1PN3A 4OKSA 5EIHA 4PJJA 4WV3A 3P5SA 5IASA 1S9DA 3NDBB 4ZVUA 1X77A 2QUAA 3HR7A 2LD4A 4N4AA 1V7PC 3PNMA 3L9WA 2H6EA 5F23A 1KP3A 2BFEB 4EUNA 1F4VA 1QIDA 5F7XA 2FSIA 4OLAA 4KDEA 2JAOA 3RFYA 2JBWA 4DMCA 4N48A 2GS9A 2PZBA 2RHGB 3KOXA 121PA 1R4ZA 4HFJA 1SC9A 5D5PA 5HNKA 4W9MC 2XCOA 1YZTA 4W7IA 1CFZA 4W5WA 2Z9BA 1IW7F 1DEHA 3C5VA 5F64A 4Q05A 4A23A 2EP8A 3ADDA 1BEEA 3NIDB 4XX0A 1ZK2A 4CFZA 3KQUA 3QUCA 3MXTA 1OCEA 4RK7A 4M21A 3SYMA 1P8JA 2BMWA 2DBQA 1SD1A 1YV9A 3A1CA 3QEOA 2Q6LA 3K9NA 3NWOA 3ZIAD 5G0WA 4P86A 1PZHA 2VPPA 1FYWA 4Y9UA 4B40A 4QQFA 4ED9A 1JDVA 2ZYVX 1KS2A 4LW8A 4QLAA 1CF9A 3BD8A 3TNDA 4ZO6A 2CBZA 3TZHA 3D2BA 4L73A 3ADCA 2C4HA 3GLIB 3NWEA 1SA0A 3FYHA 1WV1A 1ZD2P 5M2QA 3U61B 3QPCA 3LUFA 3Q9LA 3PWZA 1RCPA 3QEMA 3QVLA 2NZ2A 1EP3B 1ZNQO 4XX0B 4W5NA 2PZAA 3EISA 3KKQA 3OU2A 1YRAA 5DIZA 1H1LA 5DNAA 5KMGB 3IPYA 2PUCA 3JTEA 2YWBA 3CEJA 4MA0A 3BRCA 4M0PA 2FZCA 2WM9B 4Q7EA 2C82A 1I2CA 1W85A 4P3NA 1T3LA 5AXCA 1A77A 1KYVA 1JIJA 1G3UA 5F98A 2VB6A 2R8OA 3J7AC 2GPWA 1O0BA 1KKLA 1IN7A 2WHPB 3ROFA 3UJCA 1OB5A 2YMPA 1JE1A 2BFBA 2WWTA 5DTEA 1TFUA 2OZPA 3ZK8A 4FUQA 3KCQA 3C1AA 1P9WA 4R9NA 3F97A 4F4CA 3T61A 3L46A 2J7PD 3R20A 3DFZA 2RAUA 5FL3A 4PO1A 1OBOA 3G2KA 2YCLA 4N5IX 1ZICA 5GTDA 4YLGA 1JQLB 1QVZA 3G0BA 3PVSA 4GYJA 4TWBA 3SSAA 1H3NA 3FNFA 2IL1A 3DEYX 1JI0A 4IRXA 4LXHA 4M7RA 2ZUCA 4I5GA 2R8EA 4P82A 4DV5B 3ZDAA 3ETHA 1YZUA 1GYPA 1CR4A 4C76A 5HKKD 5K05A 2NT3A 2PVCA 1F8UA 1M67A 1PHRA 1NI4B 2HBYA 3BMNB 1EE9A 3IYLW 2IT1A 1VKHA 3HUTA 2PGXA 4LRQA 4B9AA 1ZESA 5IJ9B 1WJGA 2Q1UA 3CVOA 3WGGA 2VBIA 4KQ2A 2PNOA 1VLHA 2NVOA 1PVDA 1V74B 3UMIA 1D9XA 4MW3A 3E27A 3UCEA 1LDNA 1Z6PA 2FX3A 2VHYA 2P6PA 3IJPA 3M9WA 4OU5A 5AJUA 5DTRA 2NSFA 3VJKA 1QB7A 1E1DA 3W2TA 2PBZA 3I5UA 1SXGA 5AXDA 2HKIA 1SU8A 2H2WA 2WWXA 4MA5A 4X61A 2OC9A 4WA8A 1LI4A 1RAFA 1VL2A 1XRJA 3GBSA 4YRRA 2R85A 2VZ8A 1B73A 4B80A 1OXBA 3OOEA 1OREA 5BQGA 1NVXQ 3W8IA 1B8NA 1Q1BA 4NHEA 2P0NA 2IS6A 3RVYA 1ZEJA 3D3QA 1N8KA 3LVBA 1YA9A 1X19A 4JLBA 1SZCA 1YB6A 2DSTA 3EZ6A 2CLMB 4YV0A 1A71A 3ECAA 2J31A 2C9MA 2ZDQA 2J48A 1RBZA 2FPKA 4Y1FA 4D41A 3O2JA 1KHHA 1CF4A 1LW7A 1C30A 1UDBA 3C4QA 3KD3A 4P84A 2ZIUB 3QUBA 4NCXA 4PQYA 3PP8A 4QYIB 1I9GA 4GWLA 4A0FA 2AR0A 4DDHA 1VP3A 3GZJA 3B85A 5BSKA 5JH7B 1RS0A 1QPGA 2OHJA 1PV2A 4UTZA 4YI3A 5KWSA 4MTFA 5EE3A 5ILGA 4DMFA 3UT5B 1T01A 1FL9A 1DC5A 5CCEA 3DNMA 4ND8B 2EGUA 4YEDA 4EW6A 4TV8B 2GH1A 3OICA 3EPPA 4KO1S 4QBTA 4P36A 3PXCX 1ESZA 3LQ1A 5TDHA 1FX0B 2DJIA 3JD1A 4XEHA 1EYZA 1R0WA 3WK5A 3GUUA 2WQ7A 2GPTA 2X0KA 2I33A 3BJIC 3QU2A 3H8VA 3U37A 2V5VA 3BULA 2MHCA 4C4RA 3ZW8A 1TW2A 3F5SA 4URVR 1A5BB 3OTHA 4S1PA 3EQ9A 2G4VA 4RMNA 2R6FA 3S2UA 3FI9A 3HDTA 4N18A 1AVTA 4G1CA 3HUFA 2RSLA 3MPOA 4GU5A 4HVLA 3PNPA 3TTWA 5BN3A 1JR4A 2ZKIA 4CHTA 4OJYA 4AYXA 1RKXA 2PAFA 2WMDA 2QMOA 1K3FA 1I3MA 1I33A 1GKUB 2I3ZA 4F3NA 5JPDA 3RIHA 5FBQB 4DA8A 3A8TA 5BPHA 1T4GA 2K7FA 1PUXA 4D42A 3D4LA 1E1YA 3RQSA 3BIXA 2C42A 4G5GA 5DF1A 2VDWB 3GQBB 2H7YA 2YXBA 4DUYB 3K1AB 3I32A 2WAOA 1W1IA 1I5EA 2XYRA 3ZZMA 3RAEC 4L5IA 2H4ZA 3OOYA 4UM8B 4YV1A 2BJWA 5HMMA 1UPFA 4WLOA 4DBQA 2FEXA 3HG7A 3MTGA 3P71T 3SEQA 4ZICA 4HVCA 4H7HA 2R6CA 4GWGA 3I45A 2Y67A 4G0WA 2WPDD 4NPAA 1IHUA 4UU7A 4IAOA 3K1ZA 2X15A 2NXEA 2B0HA 4JT4A 4F2DA 4N41A 4ETIA 1QHEA 4L5JA 3UMMA 3JAMA 1ZD9A 3MJ4A 2V59A 3B13B 3PUWA 3CR8A 3DUFA 3ANMA 1E1QD 3CM0A 5FULA 1SEPA 4O4HB 3LJBA 3HRHA 3IAEA 1U04A 1OV6A 3KOUA 5FOSA 4NSNA 2GBLA 4Q3KA 2Y3BA 5JS7A 3R5FA 2XVZA 2Y1CA 2Y6VA 1ESMA 3SJZA 3MCVA 4ZCQA 1UXGA 4B44A 4WXEA 1PJQA 3N7TA 4LXQA 4R7TA 3H4MA 3VHXA 1PJSA 2XXJA 1E85A 1MCZA 4CM7A 2QD4A 4W99A 2J9WA 2ID4A 3HVRA 1YDIA 5IVDA 4G7OF 2JIOA 4IRMA 1N0IA 1HBJA 1V7CA 4F4HA 2C5GA 3BHJA 3FN4A 4ZHQF 4RHEA 3FUWA 5AVQA 1MNQA 1HI9A 2GAAA 3L7CA 3GLHE 5MHTA 2B69A 3VM6A 3AR8A 4EG7A 2NN3C 3D6MA 4LF7B 1YZYA 4E13A 4CIDA 2GA0A 3WWOA 1RI4A 4M1WA 9GPBA 3I23A 2R11A 4OHVA 1PHPA 2QP9X 3CZPA 3J7TA 3I5AA 4V1CA 4YP0A 3A0UA 5KX5A 2PR7A 3R0QA 5DXAA 1VHJA 1F7VA 2H1SA 1YMVA 2RGRA 1I01A 2FN7A 1RYNA 5TMEA 1LXCA 5J63A 2BFNA 1Q0KA 4Y6OA 1HDOA 5ALHA 2VCBA 4OO3A 3R9IA 5I9LA 4RDXA 3M6MD 1SXQA 1PE0A 4N6NA 3ZV6A 1TWHA 2HH9A 2AF4C 1GRNA 1S02A 1IY2A 2HJWA 3D31A 3RF6A 3T7DA 3CUTA 4C4YA 2L6GA 3BL8A 1JWAB 3NUGA 2QTTA 1Q77A 5EKXA 3QW4B 4IIJA 4I1UA 4Q93A 4RIFA 2JW5A 3VZCA 4HLDA 2NUAB 4JI2B 4LKRA 4BO9A 4J0FA 3C1TA 2P9JA 2XWSA 1UJ2A 1EVQA 2F59A 4OK6A 4AM8A 2O3SA 2FE4A 1M8FA 2IF0A 3DTNA 3HEBA 3DMRA 4CNBA 4D46A 3GRUA 4NBNA 1ZN2A 3ABMC 1AN9A 1ZJYA 4O33A 3LZCA 1PUJA 1VHQA 3N53A 2X1HA 2P7VA 4BV3A 2OO3A 1FTGA 3IHLA 2O3TA 4HWTA 3K0FB 1OX4A 3D43A 3LQ2A 1E3QA 3MOIA 4HJRA 5BSTA 3U3ZA 2YYZA 3V7FA 1ZU4A 4AZ0A 2Q50A 5C5IA 5H8WA 4ZMBA 3AX6A 3P2KA 5CIQA 1QAMA 1DS6A 2ZGVA 4KITB 1O3YA 5JAHA 1P0CA 1Y1LA 1RBYA 4B71A 5F9HA 1Z3CA 2WTMA 1RCFA 3N6RA 3N2IA 3UIEA 5JARA 3MOGA 1GG5A 2YL7A 4PPQA 4U2BA 4NXMB 3GYBA 4PWYA 1AQYA 4FDTA 1C3EA 1MPXA 4ODIA 4DSAA 3HKDA 1CUIA 4UPDA 5C4MA 5FPKA 3JSXA 2QMYA 3L0CA 3B6JA 1A7AA 2F4NA 4LSWA 3L0SA 4TVOA 4WINA 3RJTA 2ZR8A 1UZMA 2HDHA 1H8HD 3UMGA 1TX4B 1YS4A 3AU8A 4G7HF 3E3LA 5FUQA 2RGEA 1JLKA 1DWPA 2FZ4A 4LK2A 3SJUA 3VPCA 4Z0HO 1J56A 2H2DA 1JZTA 4WOKA 5CEFA 2R66A 1T5SA 3W7AA 5BORA 3F6RA 1Z7YA 2NQ2C 4M49A 4GBED 4DNFA 1AN0A 1ORHA 3BGSA 1N7GA 3JQ9A 4RKYA 4YMUA 5IUJC 4GL2A 1C8BA 1GAJA 3KYIA 1GGJA 2PL3A 4KMMA 5CH3A 1DDIA 2EINC 4Q9DA 1TVKA 3GRRA 5H4HA 3RC2A 3TSCA 5FUWA 1TLTA 1OXKB 1K40A 1YVEI 2IUSA 5E2BA 3CF4G 2G28A 2QZZA 1DEKA 2I1QA 2BGWA 3ORYA 1R0BA 4BB6A 4MB6A 3HXOA 3NHMA 1UKAA 2IZZA 1V43A 2PEYA 3EOZA 3PC8C 3ZDXB 5K8TA 3CKMA 3R8XA 1OU4A 3RAPR 1BCSA 1A8QA 2DFKB 1QV6A 2Q29A 2W6ID 1VCHA 3C48A 3H9QA 2FX5A 3N74A 3UZUA 3TLCA 1S7ZA 5I4KA 4BN4A 1Z15A 2QT9A 4JTCB 1TAUA 5AYVA 5L51A 1D2EA 4LGMA 2LKDA 3KSDO 5JVDB 2H8AA 4R3NA 3P2IA 4LBWA 2WVNA 2KNHA 2W9XA 4B3IA 3PC7A 2ZSFA 1Z26A 3OIWA 3L7JA 1APCA 1ZNWA 3AG1C 2HLPA 3VPGA 3OA0A 3L6EA 2ZAOA 1N2EA 2HU2A 1LKXA 4V0QA 4BVLA 2KBEA 1LRKA 4FZJA 4PLZA 4BMXA 3S9OA 1P7ZA 3EEOA 1UPCA 3IQ5A 1ZM3A 3DBLB 1W2WB 1E32A 1NRJB 1WU8A 2G70A 4ZZ2A 3UC9A 2WDZA 2KWIA 2H2HA 3VU8A 2C8JA 2A33A 1OAOC 1G19A 1I0ZA 5DHSA 3UMKA 4A0SA 4PYIA 4LDRA 4S1WA 2UYOA 4UNQA 1KNXA 2LUOA 2HA3A 3Q8XB 2FN8A 5AOBA 3HCWA 2XB6A 5B7QA 1HFWA 4DJ9A 2WE8A 4YQYA 5ESRA 2FSPA 1J2TA 4L0CA 4RCVA 2JFNA 4WEOA 4DLRA 4HMQA 1HPLA 1GY8A 3BRWD 5JAZA 1GJRA 4CKYA 4RD1A 2EKDA 3GNTA 3H9CA 4KN5A 4Y0NA 5EZQA 3SZ3A 1UDXA 3KRTA 4MQ9F 5BW6B 4G0YA 4L16A 4DQXA 4CG3A 5DHQA 1IQ0A 1ZRHA 3FCAA 3FRJA 2XGSA 4OH1A 3P4YA 4JV5B 2CEKA 2YIVX 3L82B 1DFIA 3I01A 3UWMA 2X7JA 5CH5A 2QR2A 2WIDA 3I64A 5T1DB 1AH2A 4UDYX 1TVCA 2Q1TA 1D0SA 2PQ6A 2J8WA 1CEQA 2D7CA 2QLBA 3QFFA 1YCDA 1V4AA 1E1RA 1UMKA 2OFWA 3R77A 4M89A 4MS2A 4A0HA 1KEZA 1PJZA 4C22A 5KX5F 1S2OA 2IQ5A 1LVGA 4RTNA 2WU1A 4MS4A 1K88A 1Z9BA 2F17A 1HYHA 5ANRB 2YS7A 4JP1A 2CCJA 5EIAA 4LC0A 5IKMA 4FOOA 3JU3A 3FRIA 1YZAA 1SXHA 1T4CB 4CYMA 3CH7A 4EB6B 5LJIA 2D1QA 1E2GA 2XBLA 3BKXA 4C7BA 2O6HA 3FTDA 3K5IA 3A4VA 4ZYLA 1YZVA 3CVYA 3GT3A 1E7YA 3HCRA 1OIWA 1S3GA 3GRVA 1EP1B 2ZRAA 2VRNA 3E2MA 1P19A 3O94A 1OBVA 4LOIA 3KOZA 3OHMA 4PCVA 5KKAA 4IEEA 1DXYA 3TOVA 3C43A 2AFIA 1V41E 3T7TA 2IXBA 3TQQA 3W5BA 4O4LB 3L0IA 1F9EA 4OBEA 2FZWA 5B3KA 1MMGA 1Y5IA 5ALJA 1G6Q1 3ABOB 4RLSA 2BDUA 5TGZA 1F2VA 4K6FA 2ABWA 1NF2A 3QVMA 2H57A 2YZSA 1Y6GA 4ENSA 2J5KA 4BAZA 4QOJA 2QROA 3JYHA 3TDMA 5IJWA 2XPCA 1A7VA 1XR3A 2LV8A 1PFYA 4DG5A 5A5GA 1HEYA 3SGLA 4D4IA 6NULA 8ADHA 3L07A 2AH5A 4OSPA 1G5RA 3TPCA 4LE2A 4BX8A 3CEXA 2AA3A 2X0DA 1MKYA 1QFJA 4EAAA 4DLSA 2GAJA 1WCIA 2L82A 3QI2A 1IHDA 3OQMA 2BZGA 1U0RA 2AK3A 4DS3A 1J20A 1Q15A 4LHXA 3ZGOA 1E2FA 4U63A 3LBAA 3L8GA 5ER6A 2UVPA 5IBRA 3RADC 4CEHA 3FMVA 5K0ZA 1PJTA 2WC1A 3KX2A 3QHAA 1GTMA 1NMQA 2QVCA 4M76B 5E95A 3VV2A 1OC4A 4KGVA 5JXHA 2E21A 5H59A 1Y34E 4M99A 4MRAA 5TEVA 1W36D 1L4LA 3IURA 1H2FA 2RARA 4FM9A 4ZQFA 4CWAA 4F60A 4N0MA 2H2IA 2BN4A 4QGAA 1IXRC 4U2FA 2PUDA 2D62A 3GV0A 4ZO4A 1G9TA 3A4TA 1J25A 1YGPA 1YDEA 3QXXA 4NAUA 2P1DA 2E4UA 1VBNA 2Y9PB 1M33A 3OJOA 1UJMA 5A06A 2Q2VA 1HT0A 3NGXA 4U2DA 4DEYA 3O4JA 4MYCA 4OI0A 1YK1A 2XUKA 4UE6A 2H5EA 2PA0A 3WHPA 4DDUA 3HKEB 1M6HA 3I28A 3ZXYA 3BFPA 4CL2A 3HJFA 2YHAA 2AZDA 2CLDX 4E1BA 5A9SA 1GCOA 2Y1EA 2ZVQX 3SFTA 1JQ3A 1R6AA 4IJ5A 2OV8A 2QAGA 3IT2A 3PR1A 1DOHA 4C0HA 4BO1A 4R1SA 4IO0A 2G1JA 1ATZA 2Z8YA 3JR3A 2DKOA 5TF4A 1L5WA 3ESRA 3JQFC 3MIIA 4U9DA 1DIGA 1HTWA 1OAAA 3O92A 3R3YA 5ER9A 4EPTA 1TCVA 3GJ3A 3HXMA 4MWGA 5EGNA 5DP2A 3WL5A 1E3MA 1SG0A 5JCJA 2QRPA 1DT5A 3CY6A 3KYBA 5EP1A 2JLSA 3E70C 3P94A 4PAOA 4FMDB 2ONJA 1YVRA 4I36A 3X1ZA 3G88A 2D0DA 3DDHA 5A04A 1HNZB 4Q6WA 2A5DA 2XUAA 3OT5A 4AB1A 3PNKA 3SMVA 4B6EA 3EGOA 2C7OA 1AS0A 5JLJA 2JGLA 4HDKB 1UPXA 4IOJA 4FW8A 3B5IA 4CV1A 1XWIA 3KKMA 1JXQA 1DINA 1M1NB 3LT2A 2PUBA 2UXBB 3K4QA 1RQPA 1XAIA 4EJ0A 2GQ0A 5IZCC 3RAFC 1V45E 3ZGXA 1RLUA 2R6R1 3AR4A 3PDIA 5ERXA 1T5TA 1M1YA 4DR6B 1TQDA 4O0LA 1FMWA 3D6TB 1P29A 2CXHA 4EPXA 2IIBA 4EQ6A 2GX6A 2NYRA 1BCRA 3RIYA 3JPWA 1GAXA 1KPHA 1KZ1A 3U4HA 2J3EA 3IILA 1WF3A 5T4BA 1XWWA 3OO1A 3IKVA 3NYWA 4TZ0A 3GLKA 5LQNA 4MJLA 5KYWA 1Z7WA 3NR2A 3OO0A 3QGMA 3DGEC 2B7CA 1YR3A 3C3CA 2EKBA 2HRQA 1EH5A 4IZOA 3RWOA 1IEQA 4UC0A 1IUPA 1YDHA 3V1UA 5T5QA 3FPGA 1H94A 5K0LA 4CDMA 1EQ1A 4HRXA 3Q3EA 5F4Z