3DM9B

Structures and conformations in solution of the signal recognition particle receptor from the archaeon pyrococcus furiosus
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
319
structure length
305
Chain Sequence
SMFGKLREKLKSFVKRVEEEVEKETVEIKEKDVDKALDELEIDLLEADVALEVVDALREKIKQKLVGKKVRIGTDKGKIIEEAVKEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTAGRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPILFVGVGQGYDDLRPFEKEWFLERIFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the Signal Recognition Particle Receptor from the Archaeon Pyrococcus furiosus: Implications for the Targeting Step at the Membrane.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transport protein
molecule keywords Signal recognition particle receptor
total genus 105
structure length 305
sequence length 319
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00448 SRP54 SRP54-type protein, GTPase domain
B PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3dm9B01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3dm9B02
2R6DA 3UANA 4TYNA 2ZS9A 2XEXA 4Z8YA 2G88A 4KV9A 4M2LA 3I8SA 4LJ5A 4RZXA 2NMVA 2GF0A 4OYHA 1A2KC 1GKUB 2GVZC 2AK2A 2EWVA 3CRRA 1VECA 1II8A 3NEJA 3FMOB 4P33A 2WKRA 3B13B 1S1MA 1XXHE 3C5CA 4KO8A 3CONA 2WICA 4KITB 1ZNZA 4DSUA 4YMUA 2WSMA 1JALA 1Z22A 3ADDA 5CYOA 1XWIA 1W0KA 4HZIA 3KQLA 1BH2A 3C7KA 4IRUB 3RS5A 2NO1A 4XD7A 4DHEA 1E2DA 1G7TA 2ZYWX 3E2IA 2ZJAA 4PFSA 5CJPA 4Y0VA 3P27A 1HY3A 4A1FA 4G5GA 1ANKA 4CT5A 3A36A 2UVQA 3VKHA 4ZCMA 2ATXA 4OI0A 4ARZB 5DI3B 4M1WA 2W2TA 2GXSA 1H8HD 2J45A 2Z4RA 5E7JA 4HLDA 4CEHA 1NMZA 6Q21A 3O8RA 2PJRA 4C0AC 1N5IA 4PAOA 4FMCB 1L2TA 1SXJA 4TMZA 2QG6A 4X8LA 4JLDA 2WJVA 2PLFA 2DB3A 4Q9HA 4Q18A 1HTWA 1E9EA 1EG7A 1JEDA 4KAXA 5FL7A 3EIEA 1P6XA 1IY2A 2G9NA 3KQNA 3B6EA 2PMDA 4A0RA 3EX7C 2VRWA 2NO7A 4OI2A 2NO0A 4RKFA 1TQ2A 3L0IB 1BO6A 5L3VA 3THXA 5BQ5A 2AWNA 1HT2E 2CVHA 3EWSA 2A9KA 4UXJA 3LVRE 5DO9A 4LBWA 4NCKA 1W36D 2GF9A 3VAAA 2OG2A 4LC1A 3AGPA 1ZIOA 1CR0A 2P3SA 3A6PC 5KTYA 4A8JC 1KDPA 3DZ8A 3SN6A 1T6NA 4OKSA 1W0JA 4I1SA 5GJCA 3LFUA 3CZPA 3KKMA 1U90A 2GCPA 4EDHA 2RGDA 1ZM2A 3TKLA 1WE2A 3CR7A 3IHLA 2YINC 2IW3A 3THWB 4DLRA 2G6BA 3L43A 2V6IA 1P9RA 4C4PA 3VHLB 1KHTA 1JR3E 1AIPA 2FPLA 2R8RA 2YJTD 3I32A 4HEJA 3I72A 3REFA 1KI8A 3TBKA 5K8UA 3KKNA 3ZH9B 2AK3A 1QRAA 4KFRA 2CDNA 1XF9A 4MGIR 1XJ0A 4DVGA 4DLSA 4FMBB 4URYR 5IRCD 4H1VA 3FPAA 2QNRA 3W5JA 2ZE5A 4WA7A 4K8OA 2R62A 1T3HA 3GLHB 1OKKA 1I2MA 3MAAC 4KU4A 2PCLA 4ZDWA 2YWHA 2GJKA 1DG3A 1KSHA 2BKUA 2ZUDA 4TMKA 2AD5A 3VR3A 5EJEA 4JLNA 1FTSA 2QZ4A 3Q7PA 1XJCA 4P4TA 2XTNA 721PA 2DWPA 3WXMA 4DJTA 1R10A 2CEAA 1ZD9A 621PA 2QAGA 4HLCA 2IT1A 3EZ6A 3T61A 4JZKA 1P9NA 5FOVA 4DKXA 2WJHA 3GJ0A 4IOLA 1SKYB 1GITA 3MWYW 2XJ9A 1H8EA 1MRSA 1RPZA 5DISB 4P3YA 3EXAA 4OQMA 5FTLA 3R9IA 3ZJYA 1CBUA 3WMGA 2D3WA 1N0UA 2G0NA 3FWYA 4B48A 2V55B 2YNMA 2NGRA 3U7EB 3GLGE 4B75A 1U9IC 2NO6A 3GJ8A 2GK7A 1ZU4A 3A58B 4BLTA 3WNBA 1KAGA 1E2PA 4PZZA 2G1KA 1VHTA 4BRUA 5FI0B 3ADCA 1GNQA 5DE3A 1E96A 3EZ9A 3IEUA 4P31A 5LDDC 4TYWA 2QORA 5FPKA 1CJTC 1QHHB 2B8TA 4HDCA 3KL4A 3FYHA 4LBYA 4B74A 1D6JA 2JEOA 1XTQA 2QPOA 4J0QA 2Z5FA 3TK1A 1XZPA 3EPLA 1E9CA 1WBDA 3KKQA 4U02A 3QPWA 2Y8EA 1AS0A 2BMJA 2HYIC 2C9CA 5C18A 1G8PA 4ZDIA 2FFBA 5CM9C 3FB4A 3LX8A 3PEUA 4MRSA 3EWAA 2DCUA 3LAWA 2ZRHA 1ZUIA 3NHBA 1G3MA 2D4HA 4G5SA 1LVGA 4IW3B 221PA 3FMFA 3A4MA 3G0HA 2YC2C 5DI3A 2FX3A 4V0NA 3SYLA 3GEEA 4O3MA 1N6IA 5AK0A 4IHQA 1A5TA 4LUCA 1J99A 4HB2A 3SE0A 3P4XA 1EGAA 2GZAA 1KO8A 4FMDB 3SJBA 2J0UB 5FTNA 4URUR 3RYTC 2IS2A 3CBQA 2CE7A 4IVPA 1HA3A 3P1JA 4QFMA 3U3RA 1G7RA 3IIMA 5DH9A 2ZUBA 4XTRA 4DLZA 3BOSA 5JJKA 1YR8A 1Q1BA 5J5CA 2IX3A 1P72A 3MD0A 1PUJA 3K70D 4PZLA 4DC9A 4YXWD 3OEHA 2NPIA 3K1JA 3QY0A 4PC2A 1E9RA 4P32A 4KYUA 5K8IA 3CUEF 3VU9B 1UBFA 1G16A 4XJXA 4TL6A 5L3RA 2PCJA 1QG2A 3B2EA 1GG2A 1TUEA 2FSIA 1TF2A 1Q3HA 1U81A 3A1UA 3W9YA 4GSYA 4CGZA 2ZJYA 4P0TA 5AUPB 3JVUA 1X86B 4TMXA 5EXXA 3QUSA 4HATA 2AXNA 4TLBA 5AJZA 3VFDA 3GP8A 2W6ID 3PR1A 1UDXA 3EA0A 4TMWA 1FP6A 4BECA 1UKYA 1Z2CA 2BEJA 2RGNC 2WPDA 2ZRGA 3FKQA 2IXGA 5FUWA 2ODNA 3SC3A 2BM1A 4A82A 1P2VA 2HCJB 3WMFA 3H4MA 1RFLA 5C46F 2Q0HA 5FFMA 4EQ6A 2XXAA 1R5OA 1E2QA 2ZI9A 2OCPA 2ORIA 4C7OA 1Q1ZA 1YRAA 4QL3A 4DB2A 1I4TD 2VO1A 3SYKA 2XOKA 1FZQA 3RS4A 3NH6A 3WY9A 5J4KA 1DEKA 4BFXA 1U0LA 1YZLA 2P6UA 4KBFA 2J7PD 2QBYB 4FWIB 2ZSBA 5GVSA 3J81k 1AKYA 2F1RA 3BAFA 3QJYA 4UNSA 2CCKA 3AKCA 3BH6A 1AA9A 3W3ZB 2IL1A 1FOEB 4QRHA 4EFLA 1S2MA 2Q3HA 4TMVA 1CJKC 4JLJA 2FWRA 4I81A 5LB4A 1X8LA 1SGWA 4DRZA 2G1JA 1E1RA 2WWYA 2I4IA 4L8GA 3TUIC 5JWRA 4MKIA 4B3BA 4LHZA 3ND8A 3C5HA 5HE8A 2XJ4A 4RD4A 4A0HA 1YVDA 1Z6GA 3JZAA 2A5GA 1XFAA 4NPHA 5EXSA 4D26A 1KGDA 2O8EB 3PQCA 5KPDA 1UBEA 5CDFE 5D3MA 1M74A 1DE0A 1SKYE 3LQQA 2O8EA 1ZIPA 4AI6A 3B78A 521PA 2ZRKA 4Q7JB 3VR6A 4NYMQ 5JFGA 4WIAA 4K46A 2IYVA 2FA9A 3VQTA 2AX4A 1WP9A 2GJ8A 1XMSA 3QBVA 2IWRA 2A5YB 2HJVA 2GKSA 1VG1A 1RW4A 5G3YA 2A5FA 3TSWA 3MRSA 3SBEA 2CJWB 5HPYB 1V43A 1A2BA 4Q5IA 3MMPA 1GWNA 1SXJB 3EW9A 4HUQB 4MQBA 2AN9A 2GDJA 1KI6B 4LYJA 3K9HA 1NLZA 3DL0A 4QHYA 2HCBA 3W8RA 4AIIA 3WHKA 2QGZA 2W6JA 4D4JA 2A78A 2Q3MA 1NY5A 4ZI2A 5A4JA 1B23P 1OXVA 1GL7A 2J9RA 2QTVB 5FUXA 2JATA 1A7JA 2C03A 1VPLA 1KYIA 1VTKA 4MGYR 1HE1C 4DWJA 2CNWA 4GZLA 2ZJOA 3KKOA 4LI0A 2CLCX 2ZI3A 4IVRA 3K70C 4US0R 4C30A 2QU8A 1KI1A 5SZHB 5GJBA 1K5GA 1Q21A 3TVTA 1FUKA 2EFEB 2GCOA 5H1YA 4ASUA 4DDWA 4Q9LA 4PC1A 2JCSA 5FPYA 2DBYA 1DAEA 1G8GA 3I5YA 5AR1A 2MSDB 3TH5A 3B1VA 3QXHA 3W3AA 1NN3A 1CIPA 5B2ZA 1UDWA 2AFHE 1DO0A 3Q5EA 4JSTA 2HT1A 2IS1A 5FI1B 4II7A 3BH0A 3AVUA 1TU4A 1FL9A 1Z0FA 5DYIA 4PXAA 3QEOA 1JNYA 3LLMA 4URWR 2WV9A 3IGFA 1Z6TA 1QBKC 1AJEA 2MSCB 1IXZA 1XTJA 2OCAA 3QXSA 3ZQ6A 2PT5A 2JLZA 4B2IA 3QF4A 1GFIA 2J59A 1M8PA 1MO4A 2J1LA 1FMLA 3PENA 3VNUA 1E0KA 3ZVMA 1N6LA 4A6XA 4A36A 2UKDA 3L8YA 1KIMA 1GUAA 1UF9A 3K0FB 4YLGA 5E95A 4TT3A 3MGCA 4PTLA 4HDQB 3QKTA 3TW4A 3VU9A 1RRGA 4KXFB 2GHIA 4DSTA 3L0OA 2FV8A 3K9LA 1JBKA 3HR8A 4XVQA 1LB1B 4IEEA 1W0KD 2YV5A 2HF9A 1PLJA 1E6CA 4N0EA 3VR5A 2XZOA 3X1DA 3FGNA 3GPLA 3B5JA 2Z43A 2DWOA 4TLDA 5GJVC 5B57C 1WBBA 1FTNA 1G4UR 5GVRA 2FSFA 1BMFD 4GOKA 1XMJA 4HAYA 4B2PA 1HYQA 3IPXA 2VLIA 4BUJA 3NHAA 1M7GA 4D2IA 2PLRA 2VHQA 3NC0C 4KSBA 4QM7A 4D82A 4WVFA 1DAKA 1NRJB 2HF8A 5EE1A 1R0XA 3KFVA 2ZYVX 2CE2X 3DEFA 3JZMA 3IKJA 1Z63A 3QE0A 3GCGA 1SVLA 1IJFA 1MO5A 2QPAA 2EFCB 3ADKA 2J7KA 3B7GA 1MV5A 2KI5A 4TN1A 4Q66C 2XNSA 2DFKB 4G5QA 2F43A 3BJIC 4BEJA 1E9SA 1ZYUA 3OEHD 1ZJ6A 2H18A 4QGHA 4DLYA 4V0KA 1QDEA 2JLYA 3W5IA 1U0JA 4M1SA 1G21E 1IJEA 4YQFA 4WZ6A 1W36C 3DM9B 2ZR0A 4LYHA 3RABA 2FJUA 2XB4A 1F60A 1OT3A 5FBLB 2BIFA 3BGWA 4LZZA 2GK6A 1L8QA 3KJGA 4QXAA 1XCMA 3AVWA 1NVVQ 1KY3A 1W48A 2F9LA 4DCNA 4BLSA 3U61B 5FBVB 1OE0A 1E2FA 1EFRA 1GKIA 1JAIA 1ZW6A 2DFLA 4C0QC 2P0EA 2CBZA 3X1XA 4BLQA 2AD1A 4EAQA 4NMMA 1O87A 3TMKA 2IC5A 3U44A 1Z8FA 1E3MA 3GEHA 4QOSA 4CEIB 2A5JA 4FWTA 4PPQA 3B9QA 2NZ8A 2OHFA 5FTKA 4TT3D 2QY9A 4OL0A 2C98A 3QG5A 3OAAD 2JLWA 1XEXA 1HE8B 3DO6A 4TTQA 4NYMR 3LVQE 4CZ2A 4KYIB 3VX3A 1XMIA 4D4LA 2WWXA 1MABB 3CF0A 4MGZR 2O5VA 1H65A 4GNKA 3A1TA 4O0MA 2BHRA 1VCIA 2QUZA 4JVSB 5J40A 1ZVQA 1S1CA 5A5GA 2MMGA 1U8AA 4AYTA 1TU3A 1NVXQ 3KB1A 4HLUC 3N5CA 1G3QA 2QENA 1XTIA 4RKEA 1NG1A 4JT2A 4RZ3A 4DIDA 3FMIA 4CEHB 3E70C 1N5JA 4YMTA 2QTHA 3DKPA 3TIFA 1G17A 2XTZA 4DCSA 1SXJC 2KSQA 5FOSA 1KO1A 4WZBE 2WKQA 5K8LA 4PO1A 4Q00A 4RFVA 3NIBA 4JMPA 1VIAA 1RKBA 1YU9A 2FSHA 1KDRA 2OT3B 3E1SA 3KUCA 4NYIR 3I5XA 1G64A 2ZROA 1LW7A 3UG7A 1IM2A 1UM8A 3CWZA 1UKVY 2OUKA 3CPHA 1Q1QA 1FX0A 2XSZA 3KFXA 4MITA 4NBSA 5FPTA 3VTKA 1DTSA 4UXIA 4DDUA 4JLAA 3M1IA 1SVKA 1KTVA 3SYNA 1P9WA 3QVUA 1VMAA 3D3QA 2QM8A 1X8KA 4IDNA 1Q44A 5JS7A 1OFIA 1DG1G 1KNQA 3UATA 5CITA 2IS4A 4BZXA 4XD7D 2QA5A 3GLHE 3ZZUA 3PEYA 3T1OA 1E2EA 4LJ6A 1W44A 2VP6A 1XX6A 2SHKA 4MRPA 2BVNA 3KX2A 2GBLC 3SDZA 4IEIA 5KSZA 4LV8B 2ZI4A 4C0JA 5BWMA 5KSOA 1AQUA 3P4YA 1VG9B 3NEYA 3W8NA 4NCNA 5CDFA 3I8XA 2VF8A 2JLRA 3VR1A 4C0LA 2IYQA 2BMEA 4KFUA 1GZSA 4OK6A 3TGPA 3AVTA 1RYFA 5BYJA 4ACBA 3RSLA 4E09A 3FMPB 1XPRA 4PC3A 2CVFA 3TLXA 3OIUA 4G1UC 4EPWA 1T8UA 3ZVNA 4OJKA 4L15A 4G5RA 1LFDB 2PL3A 3PUYA 5AUOB 2OBMA 2JJ2A 4QNMA 4HAUA 1T3SA 3CX8A 4IOJA 1Z2AA 1GKYA 2AKAB 3E5HA 1XXHB 1Z0KA 2D7CA 4R98A 1E0JA 1KZGB 2HDNB 4TSFD 5KU1A 3GLHA 3ZIAD 2PJZA 2ERXA 2QAGC 4RSGA 3DHWC 1MH1A 4XWKA 3DZDA 1XMVA 1OFUX 3NG1A 2QN6A 2NZJA 3W90A 4Q9JA 1JR6A 4UNNA 4AKEA 3PUXA 1NSFA 4JKYA 3UWKA 1XD8A 3KXLA 3CW2A 3NH9A 5JSZB 1SVWA 3IILA 4OQXA 5HE9A 5JCZA 5EUMA 3B1YA 4TYPA 4PC6A 4DLTA 2VP9A 2HXYA 2BBWA 5C4MA 1YRBA 3AUXA 4XWAA 4KHZA 4A2PA 1NBMA 3EIQA 3EZ2A 1P2TA 1R2QA 4L16A 5FOXA 1ETUA 5EXTA 3SBDA 4KFSA 1WRBA 3R7WB 4AWXA 2ODEA 3TSOA 2ZI6A 3ZVLA 5FUVA 2AR7A 4KODA 3X2SA 4ZDJA 4TLEA 1K8RA 2W0MA 4A15A 1XEXB 1Z08A 2FZ4A 4JL8A 4ZIRA 3DMDA 1ZCAA 2P6NA 4MYTA 2GJAA 2CK3A 2OSBA 4FMCF 5TV2A 2KBEA 1S3SA 1ZAKA 4LX0A 4XSGA 4B3FX 2IYSA 4OHWA 3M6AA 1BKDR 5EP1A 5EZ6B 3AF4A 4BLOA 2ZRFA 3QSYA 4JS0A 5L3QA 1W7AA 3N70A 1ZC3A 4ACAA 1NKTA 2R65A 2JJ8A 4JVLA 3RRMA 4EPXA 2IUSA 4JBXA 1DELA 3GLFA 2FEMA 2JLSA 4C2TA 1E9FA 2V8OA 2ZETA 4O25A 4PPGA 5DHAA 3GQBA 1RZ3A 3RDPA 4Q03A 2ZVPX 2QM7A 3MFYA 3LW8A 3DOFA 5AJWA 3X1YA 4BRWA 4CIDA 2WTUA 4LBZA 2ZS8A 2N42A 2RHMA 3LA6A 5C1BA 5TB5A 1YJ5A 3CPEA 3K0SA 4HAWA 2EFHB 1PLLA 4B43A 2XTMA 3S1AB 2J7PA 1EFHA 1FQJA 4Q48A 5D3MB 4OQLA 1W4AA 5P21A 4JLPA 4CYMA 1RVDA 5KUTA 2J0SA 1Z06A 3SJZA 5BN5A 3AH8A 2GJ9A 3ZIAA 3AF0A 4DT1B 3RAPR 2IUTA 3K9NA 4A92A 5SZJA 4OI1A 1JR3A 3CR8A 2P67A 4D25A 4Q4AA 1TX4B 4BE7B 4BFSA 3UKDA 5IK2A 1GP2A 3AVVA 3HR7A 1KJYA 2OXRA 2GXUA 4A2WA 4IVQA 4RCYA 2WM9B 1F2UA 5EE0A 2KJQA 4S35A 1GL9B 4JSYA 1AN0A 5HKKA 1I4DD 5JRJA 3LXXA 1OF1A 4ABYA 2ZRIA 1A1VA 2BEKA 2A5DA 4QJ3A 2DWQA 2QP9X 3EAQA 3M4YA 3U7GA 1AZTA 3TW8B 4QM6A 1Z83A 3GLFE 1IN5A 1WA5A 5FOUA 2J46A 2V1UA 1JB1A 1ZM9A 3MUFA 2GEVA 2HUPA 3WHLA 5IF9A 4C7OB 4RZ2A 2ZS7A 4PSAA 4XOIA 1P5ZB 1GAJA 3K70B 1G5TA 1VG8A 1E2MA 2GWHA 2CK3D 2ZAOA 1CU1A 4ZO4A 4B32A 1OXSC 4NTZA 3NBFA 5JEDA 1Q3TA 1G7SA 1YR6A 1DO2A 3HWSA 1K6MA 2WJYA 4BQSA 4ZI3A 3VKGA 2WJJA 3AGQA 2FZLA 3T35A 1N6OA 2OE2A 4A0GA 1WB9A 5FTJA 1DPFA 4TL7A 4ZDKA 4LRWA 1NN1A 5D3QA 3K09C 1J8MF 3UMFA 4HUTA 2EFGA 2ANCA 1T4GA 2PMKA 2V3CC 1OH5A 4OHZA 4G0NA 3NDBB 1E1QA 4LYAA 3SS8A 5FL3A 3SNHA 1P2SA 3AB3A 2J0QA 1GTVA 5JJLA 3WP1B 2B21A 3UMRA 1CXZA 1JXOA 3Q85A 4LSGA 4QJ4A 4ERNA 4C0KA 2QPTA 4NDZA 1NLFA 3NVAA 1NIPA 2H7VA 3L2OB 2FH5B 2OBNA 2BDTA 2ERYA 4H1UA 1P7CA 1WMSA 2XZPA 1ZP6A 5AWFC 1HURA 1NN5A 1W4CA 4LHXA 1E79A 1GOTA 5UKDA 2J41A 3AP1A 3U6KA 2H16A 2R44A 2K5UA 1KMQA 3GFOA 4D4KA 3CX7A 3RRNA 4GFDA 4HUQA 3L8ZA 3I62A 1IBRA 3GJ5A 2W2XA 3A4LA 4PX9A 5BN4A 3Q5DA 1OXXK 2A7QA 3QI2A 4ASUD 4MH0R 1T3LA 4B73A 2F1IA 1VYVA 3HJNA 3DM5A 3LD9A 4PO9A 4D0GA 1N6HA 2BM0A 2XXAB 4IKEA 5GJWC 4PC7A 2BBSA 1MT0A 2C95A 3QENA 2FEOA 3B60A 3PEVA 4V02A 5AUQA 1W49A 3QKUA 1YR9A 1DADA 2QSZA 4OHXA 2XAUA 3RWOA 1U99A 3IQWA 1EX7A 2QE7A 1UBGA 1UKZA 1K5DA 5EE5B 4B47A 1Q20A 1OPXA 4IDOA 4N0DA 4HI0E 2UZ3A 5B30A 5LBIA 3QKSB 2CCGA 3KQKA 3MWLA 4ARZA 2VP5A 3OF5A 5DSZA 1NY6A 1SULA 4HZUB 3VR2A 3O8BA 3F8TA 2Q9BA 4YMSA 5C4GB 1I4LD 3OHMA 2OAQ1 1OH7A 4HB4A 3CF2A 2DR3A 1E9BA 2FPMA 2YZ2A 4AURA 1P75A 3MWKA 1QHHA 2ZE7A 4GZMA 1E1QD 4X8HA 2DY1A 2QRZA 5CM8B 4IDQA 3ZS8A 4GP7A 3T06B 4M8NE 1CLUA 2FN4A 3QXJA 4BFTA 3LY5A 1ZBDA 5E7IA 2VH5R 2O8CB 2QAJA 2JIZA 2ZR9A 2V6JA 1E4VA 3OEEA 4TQAA 4FCTA 3H0KA 1AQYA 1G41A 1N5KA 2RH5A 2FDCA 2JLQA 4RJLA 4EPVA 2WAYA 2YC4C 3PIRA 5FOWA 1SXJD 4JVMA 4Z54A 2X2FA 1HEIA 2ZTSA 5J47A 3EIHA 3SI7A 4QBFA 2AFIE 2G0TA 2NPFA 2IUUA 5IT5A 1RE0A 4L5BA 5H70A 3THYB 1A82A 4DLUA 4C2UA 1EWQA 1W5TA 1ZNXA 3FTQA 1U8YA 4GDFA 4TQUS 4BPBA 1QHIA 2PX3A 3LO5A 4MA4A 2ORWA 2GBLA 2X8AA 3ICEA 3KJIA 1AM4D 2HJGA 2VP4A 1ZUHA 5EP3A 2QMOA 3KTAB 1S8FA 1ZNWA 2WJGA 2ZRBA 1QZXA 5E3HA 4KBGA 2VTKA 4W5WA 4WAUA 5JECA 3OE7D 4N1AA 3QG1A 4PHGA 4TSFA 4EJSA 2AKYA 2OFXA 5E7MA 1MABA 1XCGB 1GSIA 2OFOA 1JJVA 3PCRB 4L9WA 4OBEA 4OJQA 4Q19A 4YMVA 2WWIA 1IN4A 3BFXA 4TYYA 4EFNA 2WSSD 3BFVA 1Z5ZA 3LLUA 3MJHA 3WBJA 5EQTA 2FFHA 2H1LA 4NU0A 3B1ZA 5LPNA 2OEPA 1E2NA 4AK9A 1XEWX 4M1TA 4DLWA 4BASA 1J8YF 3ASYA 2V1XA 2J5XA 4F4IA 2ZE6A 4AY2A 4FMDF 5K8TA 1VYTA 4PANA 1Z6YA 1II8B 2D06A 3AVPA 1XZQA 3VHXA 1CRQA 4RFSB 4GOJA 2ZJ8A 1CRPA 5BW8A 4F4CA 1OHHD 4M9QA 3CRMA 1U8ZA 3CKLA 4B3XA 2WWWA 3AKEA 3BB4A 3KZ1E 5TXGA 5A0FA 4R9UC 1E2HA 3P20A 1CR1A 3IQXA 5DNYB 2YVUA 3GEIA 4TYQA 1OHHA 2C99A 1NNEA 2VHTA 3U2QA 1VYUA 4CVNA 3NDPA 1UEJA 4LPKA 5LB2A 1NKSA 4I1OA 2OBLA 1TUIA 2W6JD 3NC1C 3QEJA 4QHTA 1DS6A 2YKGA 5HCNA 1E0AA 3OEED 5B58C 4ESHA 4KLNA 4HDOB 3HPRA 1R6BX 3LQRA 2ZRPA 4LYFA 4Q7KA 4URXR 3LW7A 4HAVA 3ZQJA 4AKGA 3Q7QA 3IPYA 5J4YA 2R2AA 2J0VA 3ADBA 3H86A 1T5LA 1YR7A 3IO3A 5KDOA 121PA 2KBFA 2MSEB 4EFMA 3DKVA 1G291 4JBWA 4BWYA 2V7QA 5EP4A 1S96A 3FDIA 5FH9A 1J2JA 4D81A 2X19A 4PQYA 1CJVC 4CEIA 3GMTA 4B3CA 5KDDA 1X1RA 3FHTA 2XNDA 4HLUA 5FBWB 4XSHA 1W47A 2CHGA 2LKDA 3P26A 1G6HA 1SKQA 3M0EA 4IXNA 1IAQA 1GRNA 2W0SA 1L4UA 4Q1FA 4JYCA 5JLJA 1CP2A 4DLVA 4B44A 4Q7LA 1EK0A 2IF2A 2EYQA 2ASEA 3SU8A 3BRWD 3C4JA 5CYPA 5F98A 1P2UA 2OESA 5DI9A 1MOZA 4Z8XA 4DBLC 1KZ7B 4A4DA 2DHRA 2Q21A 2ZXUA 1W5SA 4NYJQ 1KSGA 2VEDA 2ZYTX 2OM2A 4EPRA 4GL2A 1BS1A 1ODFA 1R8QA 2EQBA 3QBTA 3R8FA 2MMCA 4C0SA 1WXQA 3DOEA 2YWEA 4NCJA 2ZUCA 4Q4LA 3T5DA 4WZAE 1RRCA 1Q57A 1U2RA 2GRJA 2BMFA 1OJLA 2JIZD 1LNZA 4MKGA 2JDIA 1JECA 3BC1A 3FVQA 1KK0A 3WNCA 4AYXA 3AM1A 4U00A 2ZANA 1VHLA 1VKJA 4UNQA 1WF3A 1R5NA 2GZHA 2FNAA 2ZRCA 5KNCA 2IXEA 5IK2D 1OV4A 4QJ5A 2IYTA 2GCNA 1G3UA 3RHFA 2ZYUX 3RC8A 3RVBA 1F2TA 2O8DB 1DAIA 3C15C 1T91A 2O8BA 2IEZA 4X8MA 4DSOA 4M1OA 4R7ZA 3U3JA 5JWOA 1KKMA 2BC9A 2AHOA 2JAQA 4PHTA 3ZDQA 3NBXX 1NF3A 4ILEA 3SQWA 3VMFA 4LHYA 3QIAA 4UNRA 4E07A 1OIWA 3GLIB 1S9DA 3FOZA 2XGJA 4FCWA 1C9KA 2ZAMA 3BERA 4FXPA 1UKEA 4F92B 5F3WB 4M1MA 2G77B 4YDSA 3PUZA 1CTQA 3F5FA 1WCV1 1ZRHA 2RB4A 3EC1A 1IONA 5G40A 1F2TB 1CULC 3K0FA 3T15A 5JBQA 4BLPA 3K0AB 4M22A 1ZNYA 1E32A 1UBCA 2HT6A 3B9PA 5KYKA 2XZLA 2VSFA 2R6CA 3FHOA 3O8CA 3VNVA 1RRFA 1TL7C 1KI4A 3QF4B 1OB5A 2ODBA 5CJ2A 1MKYA 3IHWA 3K0CC 4QGAA 1D9XA 5CIQA 3GLIE 1AZSC 1J70A 2A30A 2DFTA 4OK3A 1W4RA 5J4VA 1HH4A 1MO3A 4JJKA 1IN8A 2B6HA 4LWZA 1E1RD 2NQ2C 3NBYC 2A2ZA 4TL8A 4DCUA 2JASA 4FCVA 2CL7X 4BFWA 2BMDA 4C0HA 3EZ7A 4LHVA 3FHCB 5DLQC 2FSGA 3ICQB 3HU3A 1F48A 5JWHA 3BBPA 4E03A 4LOAA 1J90A 1IQPA 3PFIA 4B34A 2CJWA 1Y3AA 2WIAA 4PR0A 4KVAA 4UXHA 1UJ2A 1Z6AA 4QBHA 2ZSEA 2O8BB 2RAPA 4LHWA 2FG5A 2P5TB 3BD9A 1QVRA 3EC2A 2FU5C 1XCPA 3QXCA 2Q9CA 2GILA 3CRW1 5M04A 2QGNA 2ZSDA 3A37A 3EZFA 4TQ9A 2R6GA 4JLBA 1AS2A 4EUNA 2CCJA 1G7CA 2ZJ2A 1XD9A 2JLVA 2QE7D 4IDHA 3AVYA 4QHSA 1JR3D 4M21A 1ZM7A 2R6AA 2YOHA 4XIGS 1KDOA 4JLOA 1QHGA 1G20E 1EFTA 1B0UA 1G6OA 4CEJA 3H2YA 3LBIA 4PHHA 3GLFB 5HTKA 2BV3A 1HUQA 4HSEA 2JJ2D 2IA5A 2HLDA 2ZE8A 4QGGA 2Z6VA 1N0WA 1G3IA 2C9YA 2QQ0A 2IBMA 3CLVA 2REOA 3ECCA 5FR1A 3OIYA 1D9ZA 2DPXA 1GVNB 1CJMA 1W0JD 2VP2A 3C41J 3KKPA 3OFND 2AL7A 1KY2A 1F5NA 3LRPA 4NHOA 1XP8A 2CMKA 3T1QA 1X1SA 2BBTA 4XVUA 1F2UB 2IYLD 2P65A 2WMNB 2WOOA 4I1UA 5DN6D 1JQJC 1CR2A 4YDHB 4TZ0A 5DHFA 3KUDA 4ON9A 3RS0A 1G8YA 1ESMA 2DYKA 4AKIA 2PH1A 4B6EA 3CNLA 1BOFA 4Z51A 3Q72A 2CLDX 4OI4A 4LDJA 3TSZA 4JVNA 4ZPXA 3N2IA 4NONA 3QPUA 1PJRA 3SEAA 3BXZA 2WZQA 4WW0A 5SZKB 1S4QA 4MRVA 1YZNA 2B92A 2JJ1A 1LTQA 1XB2A 4NYJR 3TUJC 3SFZA 2IYRA 2RGAA 2C78A 4RY2A 1DAFA 4B76A 2O8FA 3AVXA 1NLYA 2L0XA 2EW1A 4TL9A 2QBYA 1SVSA 3U4QA 3TJZA 2WOJA 3RS2A 1KDTA 3U3OA 3A8TA 2ONKA 4D0LB 1QVAA 3ZD7A 1MRNA 4B6FA 2Z4SA 4MDFA 5FBRB 2NG1A 3AP2A 4DCVA 2G83A 3R8CA 3KQUA 2F43B 3S1AA 3LWNA 4KSCA 1PVOA 2PT7A 2ZRNA 2X2EA 1E94E 2RGBA 5JHGB 1MR3F 1U0HC 1XRJA 1UADA 1T8TA 3I92A 1XNJA 3K0AA 5KO2A 1TEXA 2WWFA 5E4FA 4RD1A 1E9AA 1YE8A 3IBYA 3V4FA 3GFTA 2H8KA 3RNLA 4P4SA 3I3SR 1TF7A 3SHFA 2IK8A 1XTSA 4DEXA 4LJ9A 1HQCA 3QNUA 2ZEJA 1W2HA 2D7DA 3T5GA 2QRNA 1P60A 1TNDA 2IHBA 3A1VA 2JJ1D 5AJYA 4JLVA 5JZVA 1YZGA 2B8WA 2V9PA 4TLCA 1Q12A 4JKIA 2WPDD 3C16C 2IYWA 1ZINA 3ZYCA 4B2LA 4B33A 3ZLJA 1KSFX 4ZKEA 2FE4A 4JL5A 3THXB 1NBME 1YZUA 2VL7A 3B1XA 3BS4A 3W6NA 1M1YE 2RMKA 1Q22A 1Z0IA 3V00A 1OSNA 5BYKA 1KI2A 1KK3A 1EFUA 4I1VA 4M53A 1JI0A 3U4QB 2CNWD 3PG5A 2XX3A 4GOXA 4NP6A 1YHNA 1R4AA 3IUYA 5L3SB 2IWHA 1XXHA 4RZUA 1TQ4A 2OLJA 1E4YA 1HQYE 2ZRLA 3CH4B 3TNFA 5JRZA 5HZHA 3CH5A 1T5IA 1NSTA 2B7BA 2PZGA 1RYHA 3F0TA 3EG5A 5C2JB 2WBLC 4CDGA 4NH0A 4JYBA 4KFTA 2QI9C 1Q0UA 1Z07A 2ZRDA 4DDVA 1KI9A 2ODWA 4YMWA 4AD8A 4HAXA 3GLGA 2JLXA 3H1TA 2OXCA 4BFUA 1SHZA 3I1FA 3WYAA 4PO8A 1OH6A 1F3OA 2WWGA 5JEEA 1US8A 3KDSE 4IFBA 1G18A 2EFDB 3ASZA 3AF3A 4F93B 5BXQC 5FL7D 2BJVA 2ZU6A 3LXRA 1BYIA 1OIXA 2I1QA 4LJ4A 3U7HB 1KMHB 3MG9A 4OHYA 3D31A 1FNMA 2OO7A 3KJEA 3ZS9A 2JA1A 3CF6R 1SVMA 5ELXA 3IIJA 1E2JA 1NBMD 4EPTA 4V03A 4F38A 1LS6A 2YOGA 4NCIA 4Q1EA 3QKSA 2AXPA 3RS7A 4TWZA 2HYDA 2ZSAA 1TQ6A 5CIWA 1ZD1A 3UWOA 3CX6A 1E2KA 1OYYA 421PA 4A2QA 5JCPA 1E2GA 1KMHA 4CW7A 2GAOA 1IXSB 3W6OA 4U7DA 4WXPA 5KNDA 4O2RA 2EU8A 1JJ7A 5F2EA 4V0ME 1DAMA 1EXMA 1SVOA 2QTFA 1Y63A 4YC7A 3SFVA 1RRPA 1S9HA 3HYTA 4Q1CA 5F9HA 2OAP1 3EASA 3I4LA 4A8JA 4XTCS 2REBA 3BB3A 4M9SA 4MUAA 3AUYA 3U60B 3THWA 1W2GA 3K09A 2VF7A 1WQ1R 1Z0AA 3Q3JB 2C77A 1OFTA 4LPSA 1X3SA 3ZZTA 2Z83A 4ZCLA 3RLFA 4F7WA 2VIIA 1X8JA 3ND9A 3OAAA 2FOLA 1ELOA 3GJ4A 1C4OA 1G3RA 5JMTA 3CZQA 4W7SA 4UJ3A 1D2MA 1QHSA 3NXSA 4GBMA 1P73A 4K81B 4R2HA 4HLQB 3K0EA 5H68A 1FMJA 2O0HA 3FKSD 4AG6A 5L3QB 3B8HA 2W83A 4MUBA 5F9FA 3JVVA 2GJSA 3QVVA 2VP0A 3LX5A 4AG5A 1KJWA 2Q3FA 3OFNA 2BJWA 1OYWA 2OV2A 3Q8XB 2OZEA 1NMYA 1NJGA 4JIMA 1ZCBA 4LJ8A 4JL6A 3F3YA 4S2EA 1P3JA 1Z29A 4BZQA 4MRNA 1WGWA 1E98A 1VIYA 4BLRA 1IN7A 2WWHA 5JI3E 3SR0A 2GEDA 3T34A 3U44B 5DGXA 4B3DA 3QPVA 2IF0A 4GMDA 1N6PA 4MYCA 1XEWY 1P62B 5KNBA 5H8WA 3AKDA 3PUWA 1XPOA 4BGDA 2V4ZA 4CT4B 2IHYA 2ZRJA 2I3BA 2J87A 1G5PA 1Z28A 1L4YA 3WBKA 2P5SA 1JAHA 1GNRA 2H17A 3CM0A 3SHWA 4URZR 4E22A 3HP1A 4XH9B 1NI3A 4O2LA 3MJRA 1OB2A 3R20A 3G82C 2ONJA 4G5OA 2CHQA 3EPHA 3U6BA 3MSXA 3TAUA 2W58A 3UK6A 3TUZC 2QT1A 4DIEA 1TTTA 3D7MA 3GJ3A 1C1YA 5EUQB 2PX0A 1UEIA 5KOYA 2ZPTX 4D6PA 4A0FA 2VHUA 2N46A 2C2HA 5KPJA 2QP3A 2O0KA 1P4SA 3VR4A 2XB2A 2VYFA 2IYXA 5CB8A 5JI2E 1EESA 1Z6XA 1CKEA 3DVLA 3AF2A 5FUYA 4L4UA 3C14C 3FFBA 1KO5A 1TQDA 3GFPA 2EVWX 3TR5A 1OXTA 4GPTA 2D62A 1H8HA 5JSZA 2X1VA 3U3MA 1CR4A 4ZKDA 4MDEA 4JJZA 3CPJB 1J7KA 4UQOA 1D2EA 3UXMA 2O52A 2XITA 3IEVA 1S3GA 4FI3C 5KSYA 3ONWA 4L9SA 1XJQA 1E69A 2ANBA 4UJ5A 3C8UA 2YWGA 1KOFA 5B64A 1RJ9A 4DLXA 3PUVA 4WXRA 2KWIA 2HV8A 4Q4HB 4JLMA 2TMKA 2KB0A 4OQFA 1GILA 2W6IA 2WVJA 4LV6A 4POAA 3I73A 4WOPA 4ZV4A 1E2IA 1SHKA 3MCAA 2Q9AA 1DBSA 4NYIQ 1TEVA 3HYRA 3GJ7A 2B7CA 3TQCA 1JPJA 2F1HA 1CF4A 3ETLA 3WRXC 1D8TA 2QL6A 5GADl 4OK5A 3TR0A 1FX0B 1PV4A 2H57A 3CO5A 1KNXA 2ZJBA 3PVSA 4DXAA 1CS4C 3ZZ0A 1ESNA 1KI7A 2LCFA 5DN6A 1AS3A 1F6BA 1HT1E 3NBZC 3GJXC 2YHSA 1ZC4A 4LBVA 3LV8A 4PAMA 4OHVA 5AJVB 5TMPA 3I61A 5LD2C 8OHMA 2HEIA 4ZIRB 3LBNA 2RGNA 3T1VA 1CJUC 5HKKD 5EE9A 1JXMA 3PV0A 2ZJZA 4IJMA 3X1ZA 2O8DA 2JGNA 2R6FA 3QXXA 2BCGY 4DUGD 2QQEA 1KJZA 4KCGA 5EP2A 2PZEA 2C9OA 3TVDA 1E79D 4R2IA 2ATVA 1SVIA 1OFHA 1G8FA 2PEZA 4H9GA 3TE6A 1GM5A 4DDTA 1VCOA 4GT1A 4Q4JB 2QEQA 4GMXA 4DZZA 1EFCA 2QT0A 3AVQA 5IDVA 4HB3A 1RC8A 1R7RA 1XDBA 1NIJA 3G5UA 2ZRAA 5LD2B 3OESA 2GAAA 3RSOA 2LKCA 4MKHA 2AWOA 1QF9A 1W4BA 2WIBA 1M2OB 3HU1A 1TADA 1NMXA 1U98A 2E1RA 2V7QD 1A4RA 2RGEA 1G8HA 3ZVRA 4I4LA 2YOFA 3BB1A 2E9SA 1BMFA 1DOAA 2QMUA 2R9VA 1KK1A 1R8SA 1XEFA 2E87A 3P32A 5AJXA 3THYA 2BCJQ 3K0CA 4Q7MB 4BFZA 2ECKA 2C8VA 5FPHA 1TAGA 5FTMA 4RD2A 1GL6A 2DFNA 4M1YA 5J4LA 3RWMB 1QHYA 1Z0JA 4TZ6A 1QG4A 4TLAA 1XTRA 1YKSA 3QKRB 2ZREA 2F3RA 2NIPA 3AP3A 4Z1MA 2G3YA 1HV8A 1N2CE 5G53C 1PLKA 4RFSA 5FPSA 4QBIA 4RD6A 3RRZA 1XU4A 2BBOA 3CRQA 2RHDA 4BZPA 4JLKA 4E5UA 3TAHA 4V0LA 3SQXA 3L0PA 1KI6A 3AKYA 1SQ5A 1LY1A 5EXPA 1OH8A 2IXFA 1KO7A 3CB4A 3O8DA 2ZI5A 4PPNA 1H8ED 2H92A 4IDPA 5SZIA 1GDDA 4A8JB 3UIEA 1JQLB 2CL0X 1G9XA 2GZDA 2N1BA 3QQ5A 3EPJA 3IIKA 4US1R 3BORA 4GRAA 2OILA 2F9MA 3B1WA 4UNPA 4ESVA 1UAAA 1NP6A 1TPZA 1DAHA 1WDTA 1N5LA 1R5BA 4R71A 4IXMA 4X8OA 3LDAA 5EZ5A 2YWFA 2QMHA 1II0A 2CHVA 1IHUA 4Q4AB 3WRYC 2GVDC 1ZM3A 4F91B 1LF0A 4US2R 4KI0A 2QSYA 4JBYA 4FD2A 2GCOB 4AKHA 1T9HA 2FFAA 2WSSA 4MGKR 5G3ZA 1AGRA 2ZITA 3VKWA 3A4NA 5CK4A 1COWA 3PEWA 2IS6A 2ORVA 1DAGA 3LH5A 4M4SA 4TTPA 1IY0A 1M34E 3WNDA 1RIFA 3B85A 2RGCA 4LCBA 4D4MA 1VDZA 5DYGA 3OE7A 1KK2A 1PUIA 4JT4A 5AUNB 4LC0A 2ZM5A 1COWD 4QG7A 1KI3A 1N6RA 1XBTA 1YQTA 4IFEA 1JPNA 3R9XA 1V5WA 4Q01A 1R0ZA 4EQ6B 2F7SA 4F4JA 1TMKA 3BFKA 4Q47A 4P4SB 2C04A 4GP6A 4I99A 1GNPA 2ZR7A 4CRWB 1G19A 1IOZA 2IYUA 2F6RA 4Q02A 1XD2A 3BK7A 2ZI7A 2P6RA 3U7FB 2GA8A 1E99A 3NKVA 3RC3A 3OIVA 3LNCA 2O8CA 3RS3A 2NO9A 5TVKA 4MKFA 1ZU5A 3FKSA 1II9A 2OFWA 2GNOA 4BFYA 4PQFA 3BIFA 3REGA 1T0JB 4URVR 1YZTA 4P4UA 1N0VC 1NL3A 3PITA 2NTYC 1W36B 5TDHA 2D2EA 3D6TB 1T0HB 4BFVA 2QMEA 2VBCA 1OXUA 2VA8A 4HYYA 3A1WA 4NCHA 2VPPA 3AEZA 3V4RA 3A1SA 2GETA 2HLDD 3IDQA 3K9GA 1NVWQ 1FP7A 1NG9A 1E9DA 1FFHA 4DSNA 3FE2A 4ZCIA 3IBGA 1KO4A 4MYHA 4NKRA 4YONB 3CNNA 5HZKA 3RANA 5JS8A 4QKQA 5KDLA 5JJIA 1IN6A 2XSZD 3Q9LA 4LGMA 4EPYA 4B71A 1KKLA 2XNDD 4M0LA 1YZKA 2X77A 4AC9A 2JLUA 5KSPA 1M7HA 4RCZA 1RJ9B 2O8FB 2OLKA 2WJIA 2ZSFA 4NZYA 1E2LA 3B82A 3DDCA 3GD7A 3GLGB 1XPUA 2QP4A 2RKOA 1N3BA 4LY6A 3WYGA 4KJZA 2GXAA 1CEEA 4W5JA 5BN3A 1UFQA 2GESA 1R0WA 2BKEA 1QHXA 1OLOA 4Q1DA 2OCBA 4FIDA 1VCNA 2PZFA 3FFAA 1N6NA 4W5HA 1I2DA 4Q4HA 2RCNA 4IOMA 2IYZA 2J3EA 2WAXA 4PZYA 4Y0AA 2PBRA 4D80A 3EARA 4LK2A 4EJSC 5DIFA 3KB2A 1Q1EA 1S0UA 1OIVA 2FGJA 3SJCA 3TRFA 2ZJ5A 1U94A 1L7VC 4M9ZA 4Q9KA 3WP0A 2WMOB 1N25A 2O0JA 1LF5A 1OKKD 2Q6TA 5FR2A 3GLIA 5L3SA 4ITRC 3AF1A 1DVRA 821PA 3QOFA 2BWJA 5HCIA 5EE3A 2CLSA 2C5LA 2ZQ5A 4HZUA 4M1KA 4RD3A 3V9PA 2FMXA 2EYUA 3CRVA 3WYFA 2H5EA 1N6KA 1Z3IX 2RGGA 4EJSB 2C96A 5CB6A 4U5XA 3D8BA 1LS1A 4D0NA 4XVRA 1BIFA 4OQNA 3VX4A 4QGFA 2F1JA 2D2FA 5ANRB 5CK5A 5J4HA 3AV0B 4V0MA 4EKDA 4TTRA 4WBSA 5KHOC 2FF7A 3W34A 1DARA 3QF7A 3AQ4A 4NL4H 4G3XA 3SZRA 1M6NA 4Q1BA 2WKPA 4MRRA 3QKRA 2W2VA 2KE5A 1QHNA 4M9XA 1U9IA 5JHHB 1KSJA 3AVOA 5FOTA 3UPUA 4CEJB 1G4AE 3EA5A 1E0SA 1KAOA 4B35A 5L8VA 3LBHA 2FGKA 3KXKA 1P61B 1VCMA 4LJYA 4PSVA 4PQRA 4A9AA 1FUUA 2ZVQX 2FFQA 4LJ7A 1ZM4A 1IY1A 4LV5B 2GEUA 1YZQA 2JDID 3ZGXA 1UPTA 2NOAA 3T1TA 1G1MA 4TMTA 1AGPA 4RD0A 3WMEA 1GRQA 1OW3B 1ZD8A 3TQFA 4Q9IA 3W6PA 2HXSA 2ZIAA 2UZIR 4KLZA 3L0SA 3KQHA 2I1VB 3MWJA 3IO5A 3SOPA 4W9MC 1D2NA 2QAGB 4PPFA 5CLQA 3ZD6A 1NVVR 2IEYA 3CIOA 3KJHA 3N2EA 2VHJA 4FW9A 5TARA 3THOA 1MO6A 3OIWA 4C3ZA 2D74A 3K53A 3BWDD 4BEBA 5FBQB 1X6VA 4MYUA 1XD2B 4QBGB 2LWIA 2PEYA 1FPMA 4LJAA 3BE4A 4QC2A 4DB4A 4GI7A 5HR5A 3R9WA 3L82B 1SXJE 1SZPA 3CNOA 2VHCA 1Z0DA 4PHFA 3KTAA 1ONBA 4KVGA 2A3RA 4RVCA 1GIAA 4Z1MD 5TY0A 3U5ZB 1ZUNB 3PXGA 1M7BA 1TF5A 4DT1A 3CWQA 3U3KA 3R7WA 4Q4JA 3K8YA 4Q21A 2YYZA 2XOKD 4AYWA 3DPUA 1NVUQ 3UG6A 1LV7A 1US8B 4DCTA 2GXQA 4CF7A 3EPKA 1EFRD 2VSXA 1W46A 2J0UA 1G5RA 3SJAA 2W00A 4DEYA 2P2LA 1NN0A 1NJFA 2IYYA 3NTUA 1EX6A 4NE2A 2RGXA 3MLEA 4Q1AA 3RRYA 1ZMXA 2VSOA 2WHXA 2ZU0C 4HAZA 2V54A 4FN5A 1FW6A 3T12A 4XWOA 1AK2A 4N3NA 2FPKA 5G41A 2F55A 1FQKA 2Z0MA 1Z47A 3OZXA 3O47A 4IOKA 4G01B 4A6PA 2GTPA 4QNRA 4UKDA 2CL6X 2REXB 3H84A 2QROA 3HU2A 1AKEA 2F3TA 3HDTA 4V0OA 2VQSA 1O3YA 3UMSA 4PAQA 3PJRA 3KXIA 1IXRC 3NWJA 4PSKA 1BYUA 1GRRA 2ZRMA 3GJ6A 4FINA 4YXWA 4C0BA 1D5CA 1FNNA 2OCYC 2BOVA 1W1WA 4HB0A 4DUGA 5CLLA 3X1WA 1JEEA 2EWWA 2CXXA 3HPQA 1VG0B 1PZNA 1R0YA 3DMNA 5IHPA 1XTKA 4B3GA 4EIWA 3BH7A 4C9BA 1EWRA
chains in the Genus database with same CATH superfamily
4TKVB 1SCKA 4ARUA 4TYNA 1SUCA 3HDVA 3T9DA 1KF0A 2XEXA 1XAIA 2ZS9A 3LC1O 4XYMA 1ZN9A 3UGPA 1NC3A 2GF0A 1XEAA 3KRTA 2XGOA 1ZICA 2BRUA 4ZODA 2W98A 3TIIA 3FB1A 4ZT4A 1TA4A 3LLIA 1VECA 2Q3EA 2AOWA 3IT2A 4N06A 3OCVA 5EAIA 4EB6B 5DM70 2I7CA 3BSSA 4KO8A 1ZNZA 4DSUA 5CG1A 4ZQGA 5E2IA 2JFQA 3I5PA 3DOCA 2HMUA 1W0KA 4HZIA 4R7TA 4NQZA 4F6RA 4FKBA 4YRZA 5E38A 5JBNA 1ORJA 4DLNA 1PR4A 4ZC8A 1E2DA 1SJ9A 1W5BA 2ZYWX 4MV8A 5C1DA 5KTSA 4ZVVA 4WXMA 4H6WA 1WXHA 4D45A 4U5HA 4GLBA 5IYZF 4BVJA 5BSFA 5IZ4A 3HNPA 3PHGA 4G9GA 3VKHA 4ZCMA 1JAYA 4OI0A 2O3QA 2RK4A 3KP1A 2FPGA 4M1WA 2WD9A 2FRVA 2DHEA 3WL5A 2GXSA 1GSAA 1R9JA 4RH0A 2O9XA 2Y68A 2Z4RA 1OWOA 1QK4A 3AUFA 3I23A 4TTIA 1ZISA 2Y1KA 3PFCA 5KNCH 2EG9A 1P4HA 2I6XA 1F8GA 1RXUA 2XKJE 4IFIA 1FFDA 1R4ZA 3AHHA 3U62A 4I1RA 4C0AC 1JEJA 4CI9A 4FMCB 1SXJA 4MO2A 1THGA 3HR4A 1UKBA 2DB3A 2XL8A 3FBTA 3GK3A 4Q9HA 4JTCB 4UHKA 2IHKA 1EG7A 2NXWA 3D4IA 3LDUA 4KAXA 2NVOA 3KSBC 2ONCA 3V7YA 1P6XA 2H4JA 4KWCA 4X7MA 3ITEA 2G9NA 3CVXA 5BWCA 2C9BA 3T9EA 5T6BA 4CIYA 3R0ZA 2QE9A 1YQ9A 1EHYA 5FLXA 1H9TA 3ZNOA 3L0IB 1CGME 1BO6A 2ILTA 2G0AA 3LBYA 3F5MA 2NU7A 5CYFA 3T5PA 5BQ5A 3THXA 5KYYA 1OX5A 2JGRA 2CVHA 2BL2A 3EWSA 2A9KA 4OM8A 5E9AA 1K98A 2ENUA 4MYSA 3LIPA 4RPKA 4UAJA 4GXNA 4X8MA 5JOQA 2OG2A 2V7UA 2QW1A 1NR1A 3I6YA 4MB0A 3TM4A 5LZ9A 4I9FA 1V1MB 1Q7BA 1PNQA 4LYYA 3TTSA 2REQA 4A8JC 3SN6A 3HCOA 3JARB 4FPXA 1W0JA 1A5ZA 3WGLA 3QVTA 5GJCA 4HTFB 4BWFB 1U90A 1HG0A 1D7OA 1GKLA 2G40A 2GSDA 2VRNA 4EDHA 1NI5A 3V46A 4CS9A 1BE1A 3NTVA 1Y7TA 3DUFB 2YINC 2G5CA 3DBRA 4EX7A 3F7OA 3BD8A 3OLXA 5TNXA 1I24A 1HEUA 4HO1X 4M38A 4PWZA 4C4PA 2NO4A 2Z2ZA 4LSZA 1HDGO 1JR3E 4HEJA 1Q2XA 2R8RA 4QA9A 1C9YA 4GC5A 5BSWA 4WERA 4Y2QA 3QJGA 1JDBC 1BDJB 4TVBA 3SKYA 4CMCA 1N36B 1J9GA 2QUPA 1P80A 4IDGA 4IHAA 1RWBA 1D4FA 4E1BA 3FIJA 2QNRA 2HIAA 4Y2UA 2QUKA 3VV2A 2P7HA 2ZD9A 1GCOA 2C7GA 4K8OA 5DX0A 1EK2A 1GGFA 1GSHA 3MMSA 2QTTA 2V3WA 1QP8A 2CD9A 4UUNA 5D00A 2YWHA 5DYNA 1KSHA 1HBJA 2BKUA 1YB5A 1B6GA 4BO9A 5EJEA 5ICCA 2L69A 3TZHA 4JB3A 1T1GA 3GNLA 5I7WA 2CEAA 3T5BA 5CTAA 5BV1A 1OGIA 1ZH8A 2F64A 1NYQA 5B3KA 3KLPX 3T61A 1EGHA 2XYVA 4IX1A 4S1TA 1DV1A 1P9NA 2EILC 5IEJA 5FOVA 3WGNA 2XT9A 1EQ2A 3FFXA 5I3CA 1L5YA 3KYJA 2ZDGA 3ZWIA 2PUCA 4IOLA 4UEKA 2P9YA 2X5NA 4LDPA 4KO2S 4B82A 3NYJA 3IEEA 1JSLA 3U4DA 2WYVA 1FYFA 3VR4H 2NTEA 2C58A 4P3YA 4OQMA 3ILHA 4REQB 2YLIA 5FTLA 1CBUA 1PV2A 3IOYA 2L17A 3U17A 1N0UA 2ZZMA 3N3BC 2QZ9A 5AQ1A 4GYYA 2YNMA 3LYAA 1GZ4A 3P2IA 3WQRA 1LPOA 2YIVX 4EKIA 1YVEI 4BLTA 2ZDQA 1H5UA 3WNBA 4H7HA 3NHMA 2W9XA 1KQFA 3G68A 4JP2A 4PZZA 4WRRA 2G1KA 1XZBA 4FVTA 4HK4A 3BWVA 4IGEA 1YKFA 1KR5A 5FI0B 1SIBE 2RH8A 4TYWA 1G6KA 3OZVA 1Z74A 4RIEA 2AZ4A 4J0QA 4MQFA 3WDLA 5DRTA 3C3CA 3NAGA 2GWWA 3A1NA 3WK7A 2PX8A 1AS0A 2BMJA 2ALJA 3VR3D 2YZNA 2C9CA 3SMVA 1HO3A 4U9EA 2GPWA 3Q9SA 5SY4A 2FFBA 5CM9C 3OEOA 4FM9A 3T7JA 3HY3A 3Q3HA 3EAGA 1GLNA 4GQBA 1C0LA 5I9SA 2H7CA 1JT9A 3EWAA 1FE8A 3GU3A 4WACA 1JLLB 4CCYA 1KRHA 3F9CA 5I5GA 4R2WA 1LVGA 1T4BA 4HHEA 2HJ3A 3A4MA 4W7IA 3GIDA 4L27A 2GZMA 3T4XA 1C14A 2YC2C 5DI3A 1E7WA 3D6AA 4OHPA 1P1HA 2J6CA 3EISA 4V0NA 4BB5A 3OETA 4KQIA 1R6AA 4N5DA 4IHQA 4L4RA 1A5TA 2I7TA 1J99A 1YNSA 2IP1A 3BGOS 4L5CA 4QPCA 2J0UB 5FTNA 4URUR 3V5NA 3CBQA 4RIIA 4IVPA 4QFMA 2B4YA 4EH1A 5CA0A 1DDGA 3PC8A 1HFEL 1G7RA 3IMCA 3QOWA 4L7VA 5DH9A 3V55A 3IT0A 2KYRA 3MRVA 4L8YA 1QO9A 1AC5A 1YR8A 4W5QA 3HCEA 3PJEA 5J5CA 3RC7A 1G59A 4RIGA 1XZNA 2PBFA 5CCEA 5E2AA 1RQNA 1SQ6A 4K87A 3S1LA 2L81A 3H2HA 2ATEA 1LK0A 2J30A 2IOFK 4PTYA 2FY8A 5HIJA 2R96A 3OEHA 4ZJZA 2D2IA 3RSFA 3VPXA 1ND5A 3UNXA 4B3TB 4KJXA 5DSTA 4P32A 1TW3A 3AW9A 5AW8A 4KYUA 5K8IA 3CUEF 3VU9B 1G16A 1WN0A 2J9UA 1QG2A 5JSLA 2MOKA 2D0IA 2G8LA 1TUEA 3A9SA 3MTEA 5DTJA 1Q3HA 1SHTX 1KOLA 1EP1B 3G4XA 3KQQA 4X0EA 3W9YA 5I8WA 1WW3A 4FGLA 4GSYA 2CUKA 4PJLA 1L7BA 2QQ5A 4YQYA 2Y69C 3WICA 1X86B 4RDXA 3OPXA 4LVUA 4G4SP 4TLBA 3WWDA 1L4BA 2PYZA 2W6ID 3DQQA 1JVSA 2BR5A 4NS1A 2GFHA 4J32B 2OXFA 4FU0A 6REQB 1Z2CA 2BEJA 1PFQA 1NW9B 1XJ5A 2A7XA 2RGNC 3QFFA 2ODNA 1USVA 4GBED 4L7QA 3X44A 1S7CA 4U2FA 1MFZA 1R5OA 3G79A 2ZI9A 1C02A 3COPA 1EWTA 1NPYA 1CR6A 3PS9A 3PEEA 3RUIA 1A3CA 5HUHA 2XOKA 1FZQA 2WNIA 3MB5A 3NH6A 4QD3A 4L6CA 2FYTA 3ANSA 3U5TA 1U0LA 2H2FA 3MVEA 4JP3A 4V2IA 4KBFA 2J7PD 3OMXA 3P9IA 2WG1A 2MSNA 3MUOA 2QBYB 4DZTA 4MTFA 5GVSA 2EL9A 4UMVA 3N6RA 3KV1A 3UO8B 4X44A 1AKYA 1Y4ZA 3EGDA 7YASA 4KNWA 2GCGA 3DHEA 4TXHA 4UNSA 1K89A 3BH6A 4K9DA 2IL1A 3NDIA 4HP8A 4YQZA 3GMDA 2A14A 1WCIA 3MD9A 2XD4A 3DJNB 2CY0A 3PQ5A 1L5ZA 3P5SA 1E1RA 3W9SA 3C8DA 3DYVA 4H31A 5L0FA 3S2SA 4O4HB 1DV2A 3WNZA 3GBSA 1Y1PA 5DM1A 1DXOA 5JWRA 1ZSYA 1F0YA 4RD4A 2FUCA 2ID8A 4TS4A 1UFVA 1YVDA 2XMRA 3JZAA 4FYPA 2PMEA 1XFAA 4MR9A 4NPHA 3STHA 1KE1A 4BMVA 5KPDA 5KOHA 1VLVA 4CTKA 1ZIPA 1ZK2A 3AHCA 3Q3IA 1FS4A 4KZPA 2G70A 4RGBA 1I5OA 1IRIA 2XDQA 3VR6A 4NYMQ 2I9KA 1CETA 2Q50A 3L7YA 2NYRA 4WIAA 4K46A 5LN1A 5LWHA 1JQ3A 2X9QA 2Q5HA 1WP9A 2Z1DA 3GF4A 3MLGA 1NSYA 2A5YB 1WQ3A 4WXHA 1JZSA 4IYRA 3SWWA 3R5FA 5TQVA 3CH7A 3SBEA 3CEXA 3QELA 1ZZGA 4CV3A 2B0CA 1GWNA 3Q40A 1CLEA 3E84A 3GH1A 3ZDZB 2Q6LA 3ZNNA 1GPDG 1VA5A 2GDJA 4MEAA 1ZFNA 3N5KA 2XUDA 3F5QA 3H1GA 1IUKA 1NLZA 5AM4A 4JFAA 2P27A 5THKA 2CW5A 3K7DA 4OB7A 4ZI7F 1U0EA 4QOFA 4TRMA 2C5SA 2QGZA 4RE5A 1NU7D 1Y4SA 3JQAB 4D4JA 3L7LA 5JSHA 5EVJA 2LXNA 3S81A 1JXAA 2DHCA 2FMTA 1NY5A 1Y4AE 3QYFA 3FCOA 4F4UA 1YZYA 2ZCJA 5TIIA 2D4UA 3H1BA 3K92A 4B45A 1HDZA 2J9RA 3ESDA 3RWBA 3LXMA 1JFLA 1PFGA 4XWWA 4QYSA 2RHWA 2XWQA 4JGBA 1VPLA 2HBRA 3K8QA 3FAKA 2YMQA 2I91A 4CIBA 1C9EA 1YNOA 5ALNA 1O7JA 2SKCA 3GLFE 3GCXA 3G0IA 4FSXA 1HR0B 3OLQA 3TPCA 4P5PA 5H82A 3W3AD 2GBCA 5JYEA 3KHUA 3ZHUA 2GCOA 4L1KA 3WWEA 3U1TA 5D87A 4WOCA 4KACA 5A2QA 4Q9LA 1O1YA 4X7BA 4XWYA 4XCVA 4ZGBA 4YCLA 2O4UX 2CYBA 4PNPA 1WZUA 5JDCC 1EFAA 1BAPA 1NN3A 2FWIA 2Y0PA 3DBHA 3QFSA 4X45A 4BO2A 4ER7A 3H5TA 1AUEA 5CD1A 1YB1A 2C88A 4DYDA 3MTAA 3RC2A 2NZWA 4DN6A 4L8VA 1I1OA 1P1FA 1Z5OA 4LQCA 1IQRA 1O97D 2XUQA 4OXYA 1R9NA 5IVIA 4I8XA 3AEQA 3E3OA 4QOEA 3IGFA 1QBKC 2QRJA 3H5OA 3P0HA 1N7HA 2FEXA 1RYZA 3JQ8B 1OWMA 1LX7A 3C70A 4IIEA 1ZQ1A 3IESA 4LY9A 2OCAA 4YJ2B 2JLZA 5K09A 1DQPA 2POCA 2NQ8A 3LYLA 1C8LA 3LHFA 1MO4A 2J59A 4Z2YA 2J1LA 2AZTA 3PENA 5BN3B 1EA5A 2IODA 1E0KA 3BVPA 3AV3A 4A6XA 1E5QA 2C2KA 3U7RA 4ZU1X 1N8TA 5F64A 1IQ0A 2V4UA 3PHIA 1GUAA 5IHXA 1Q6ZA 3GY0A 4UVHA 4CG3A 1A4IA 5FB3A 4X20A 3MGCA 4AU1A 2AJBA 1WS6A 4HNSA 4HDQB 1G8KA 4E7PA 4J16C 1SH7A 5I7EA 2CWWA 2DERA 1E0AA 1I8TA 2GHIA 3L0OA 5C3UA 1C1XB 5IY5C 3LUFA 4OIRF 1JBKA 5A5EA 3WX0A 1JP7A 2YV5A 2ENWA 1PLJA 1E6CA 3EEYA 3K30A 4URFA 2XZOA 1DX6A 1VLZA 4KUHA 1VRCA 3B5JA 4GKBA 4FYWA 2GNAA 4JZYA 5JFOA 2BR3A 5IT0A 3CSKA 3M1CB 2NACA 5GVRA 1BMFD 2Y0BA 3O4GA 4RLHA 2RCYA 3RRXA 5CFPA 3F78A 3ZLUA 3G7SA 1HNXB 3N53A 2GD0A 4KV7A 4HCJA 3NLLA 2C2XA 4D2IA 1K68A 5K7SA 4ZCQA 3SXJA 3TX2A 2FW1A 2R6ZA 3OWXA 4WVFA 5EESA 4CMHA 5D5PA 2FP4B 2Z9CA 3QUAA 1PS0A 3TGLA 3SSAA 1XZCA 1VL8A 3QE0A 5GM2A 5FPPA 3QNWA 2QPAA 4RY0A 2XUIA 2YEVA 2VAMA 1Q0KA 1MV5A 3DXFA 1HY5A 3GZNA 4OU4A 2XNSA 2YICA 3B6MA 4G5QA 2F43A 4IXDA 3UK1A 3IUQA 2Q2QA 1EUDB 2CJFA 3DOJA 3JSZA 3PRHA 4MKZA 1CW2B 2EIHA 4H08A 5HV9A 1K2VN 3WLIA 1LJLA 3AZPA 3B6JA 1KY4A 4N41A 3G5MA 3W5IA 3ZX4A 1U0JA 2R8OA 2PA3A 1WB6A 5EKDA 2OBXA 1IJEA 1BCSA 1NZEA 4WZ6A 3QU9A 4YJHA 2XLEA 3RABA 3C1OA 2XM0A 1USUA 1F60A 1KBOA 1OT3A 1CQJB 2CJPA 2XB4A 5BRNA 3WGZA 4D46A 5ED4A 1JV2B 1YZAA 3MTBA 4QASA 4YAGA 1XQVA 4OQ4A 1DKLA 5JQGF 5L7WA 3E2PA 1JIQA 3V48A 4CGYA 4D0SA 3QVKA 2Y99A 1IXKA 1W0CA 4XM2A 4RA6B 4TV9F 3PBKA 1QYXA 4BLSA 3U61B 3TLYA 5I9MA 5DQZA 3IERA 1K4YA 4U7JA 4EAQA 1DCKA 1AF4A 5CCXA 2WYHA 2IC5A 1YAHA 3SKVA 3TTWA 1T5OA 4UCXA 2ZKIA 1WZCA 2HK8A 1OXMA 1Z8FA 2EX0A 1KVQA 3SZOA 3N2ZB 4YP6A 3OPVA 4WNCA 3B9QA 1AT1A 3ROFA 2AKEA 1KOJA 5FTKA 1EDEA 2PKQO 2C98A 1GZDA 2R7NA 3TE7A 1RQPA 2C2BA 1PR2A 1I3MA 4NYMR 4EYEA 1E5XA 2P7IA 4LN1A 4YMHA 1LKXA 1DC4A 1ULZA 4KYIB 4MAFA 4LY0A 4PU0A 3LHDA 3MFNA 4AN1A 1RPJA 1SVUA 3ZWAA 3Q88A 1UH5A 4JC7A 2HFKA 1IZ9A 1PW7A 3ICCA 5IM4F 1GS9A 1BGWA 4XD2A 5BN4B 3BMCA 4FYKA 2GLUA 1QNLA 1NQVA 4TRNA 3A1TA 4M8LA 4O0MA 2I7DA 3N9IA 5L4SA 1V6AA 4GL4A 3OTIA 4DNOA 5EJ2A 2MMGA 4W4TA 3ZCUA 4AYTA 5BPFA 3KB1A 5BUSA 2BFMA 2PPVA 5JSQA 1FFSA 3AUSA 3N5CA 1G3QA 2EP5A 3SXMA 5SYNA 1Q0RA 5JAUA 1IG3A 4RZ3A 4HNTA 4B7CA 2CXSA 4BFUA 5JU6A 4CEHB 2QTHA 3KZKA 2PQ0A 1G17A 2X22A 5DOZA 5B2FA 4RY8A 3TLZA 1D8AA 3WOVA 2Q7XA 3JVEA 2D0PB 1L3PA 2B36A 3IP8A 3QH4A 4WZBE 4PO1A 2PIAA 1JWBB 4RFVA 3PUHA 3QPAA 3KUCA 1KDRA 3SC4A 3ZQKA 3S29A 2FW6A 1PYDA 4I50F 1R6VA 3Q2KA 2M6LA 3UG7A 1IM2A 4MULA 3UUWA 4BP3A 4QI2A 1UKVY 1YS4A 2QPLA 1E1CA 1VMDA 3FIUA 3OQIB 1FX0A 5FPTA 3T54A 1YTLA 3H7IA 1Z4KA 4HJRA 4CMJA 4M6WA 4UMFA 1DTSA 3CG0A 3MWEA 1NXQA 2IQ5A 4JXJA 3EOAI 4LDNA 4RVGA 5CXSA 1VMAA 1JLHA 3L0ZA 4AY3A 4G97A 3OF2A 1KNQA 2PWYA 2Q41A 3GLHE 1R0KA 3HXLA 3ZC3A 3PEYA 5D2CA 4JJ7A 1ECPA 4ZVOA 5A3RA 1E2EA 1KOGA 3N58A 4LJ6A 3RTGA 2IPLA 3QV1A 1MAAA 2SHKA 4IQ4A 3KX2A 2W2LA 4I8IA 4TKZA 5DGCA 4A03A 3LUTB 4DGSA 2QWXA 5KREA 3H65A 4NMHA 4C0JA 1Y7PA 5AOBA 5KSOA 4LFBB 1ZL0A 3GUHA 5KNBH 3D3JA 1TD9A 4L3VA 3RO7A 1A7KA 3W8NA 2GDZA 5ARCA 2PRYA 3I8XA 1QLEC 1FTYA 3H2KA 4OGWA 3VR1A 3A7EA 4BVBA 2IEDA 4XLLA 4P6IC 3SSNA 1HDXA 4KFUA 5AHKA 4OH7A 4FLMA 3EXHC 4B17A 4P81A 1QPUA 4PAWA 4REMA 1C9MA 3G2JA 1JR2A 5KYUA 3KXPA 5BSTA 2IJGX 3P2EA 1ZQ9A 3UGTA 1H0HA 1TXGA 3HSKA 2HL6A 4UDYX 1IJBA 2CVFA 1W2WA 1Y42X 5J5VA 2H1VA 3OIUA 4TPKA 4C7JA 1NVDA 2YIDA 3J06A 4HADA 4OJKA 4BKOA 1P39A 1DKPA 1YFKA 2JAOA 4OX9B 2X0RA 4MPDA 3SE7A 5HF5A 1SCIA 5COMA 4IMJB 2Q3TA 4J2TA 2H4FA 4CHGA 3MBOA 2XAAA 3QWBA 2L6FA 4PE5B 3ZEIA 4A1OA 2H1SA 3UAOA 1Z2AA 4BQRA 2E55A 3MEQA 1K7CA 1E0JA 2TMGA 1U2QA 4X62B 1Z73A 2V26A 1C4WA 3LU1A 2C1XA 5ENZA 3AG1C 1U0TA 3FMGA 3WWPA 4RSGA 2QAGC 4XWKA 3EVFA 1V9CA 1OFUX 3NG1A 2C97A 2QN6A 2ZBVA 3IELA 4BX2A 4I46A 2CXOA 1CCWA 2C92A 1VA4A 5FHQA 4YN0B 2CFOA 4KPUA 4UNNA 4DR2B 3QEBZ 3CW8X 1UXIA 3KEFA 1NSFA 3PJGA 4CKEA 5ALOA 4DR5B 4DDHA 1Y3DE 3IODA 3ZBQA 2JCXA 3KXLA 2RJNA 2G9QA 5TJ5E 4EAAA 3NH9A 3TOSA 5I7FA 3I5UA 3AFMA 3IILA 4O0LA 5JSZB 2JVIA 5EUMA 5LQAA 4PC6A 1L5KA 4X84A 4DLTA 2BFFB 1FFAA 1DRVA 2HXYA 5C4MA 1C7QA 1J6UA 3AUXA 4XWAA 4Y2XA 4RK5A 1CVRA 4LRQA 3IH5A 1R2QA 2LUOA 4AP9A 3NDRA 2UVDA 1ETUA 4MAAA 3DFKA 4AWXA 1CUDA 1QH1A 2ERCA 2G8NA 2ODEA 3CPSA 1TIPA 3MGKA 1BXRB 4X1IA 2HXGA 2WTMA 4JUCA 1XTUA 4KODA 5FUVA 3ZVLA 3A6HA 2FPOA 5A7GA 3UV6A 4EZEA 3D8UA 3L40A 4GPIB 1ULBA 1Q19A 3WLSA 4FMCF 2TMYA 1DSSG 2KBEA 3EFOB 1S3SA 4G5FA 4XSGA 1DMSA 2P3LA 2QVZX 4B3FX 4CDNA 1H9CA 2R7QA 1U1DA 4ANJA 5GZ3A 1UJ5A 5EP1A 4ZAWA 3MHTA 5EJ7A 4U5DE 1ICIA 2CMHA 4BBJA 3AF4A 5FX2A 4AJIA 3IUEA 2AS0A 4R9SA 3VO9A 3HUEA 3OKAA 5ALDA 1MMGA 1W7AA 3IULA 2FW0A 2B69A 3GGSA 4K9PA 1E3JA 1W19A 5LLSA 4BAUA 1MUUA 3DDSA 3JQ6A 4P82A 5E1OA 1C0PA 1E8NA 1RHKA 1UOPA 2VF2A 3I9JA 5G0VA 1JLRA 1MAWA 1YKGA 1CY8A 3RRMA 4AXBA 3EXEA 1DELA 4NSNA 3B89A 1Z12A 1BKYA 2X3YA 4UZSA 4UDXX 4O25A 5DHAA 1NONA 3VA7A 3GQBA 5IXSA 1VKHA 1A71A 3OZGA 4NU6A 3T5CA 1SBYA 1VJTA 2BR4A 1O03A 2NXNA 2I2DA 3DOFA 3ZGLA 2VJPA 4BRWA 3KQVA 4ND7A 2R8BA 4CIDA 5L53A 3HCAA 2ZS8A 4PZ9A 2N42A 1X1EA 1Z75A 4CMIA 4MW3A 2EW2A 3CPEA 3OFKA 4JI6B 1Y9EA 2R25B 4FFDA 4B43A 1IWBB 3ITKA 4IWXA 4XX0B 3ZE1B 4D9GA 5D3MB 4Q48A 4R68A 2J0SA 4LDZA 3GVPA 3E18A 4YCAA 4J30B 2WKSA 3IKLA 3IE2A 4UM9B 2GJ9A 3UWMA 3ZIAA 2VHZA 2HCTA 4HNVA 2R751 1F0PA 2G5TA 1NW6A 5KYVA 1PNTA 3GJTA 1RM4A 4ZT3A 5LZ4A 1NR7A 3CR8A 2P67A 4RFLA 1A9SA 4UOZA 3PZRA 3P0JA 3IIEA 2PFDA 3NTQA 3UKDA 5DBHX 5DM4A 2H1OA 1RI1A 2HA3A 3QLJA 2GXUA 4JKOA 5JE8A 3S2FA 3BCUA 3HJUA 3CVVA 1I1QB 4IPTA 1KZ9A 5HMLA 5ICMA 1GTL1 1VCHA 2HK9A 1BG6A 4FT4A 1ZGHA 4J0KA 3WJ1A 2RK6A 4F2GA 5GINE 2BEKA 2WV7A 1DWUA 3EAQA 2QP9X 4EY4A 3K5IA 2ZYDA 4C3BA 4M46A 3C45A 4BVFA 3ZWXA 1JB1A 1RTKA 2R4QA 3AY6A 3D8NA 5AI6A 3C1TA 3EH2A 2GEVA 2HUPA 3T94A 2A1TR 5IF9A 1CRWG 5AKEA 5EIBD 1F7VA 4XOIA 4JYMA 3A25A 1TYZA 2WIFA 6ABPA 1P5ZB 5D84A 1GAJA 4KYTA 2ZSUA 3VO2A 2FZCA 4QZVA 1G1AA 2XWPA 1QF7A 2XKKA 4QYTA 1T9CA 3NBFA 5JDIA 1T25A 4MUKA 2C4NA 3ZQVA 2WU4A 1DO2A 4F3TA 4I1IA 4WN3A 1OZAA 1K6MA 1TT5B 5IJAA 4XPWA 4D3DA 3LBAA 1JMYA 3LL4A 3CGWA 4O33A 2CXRA 2ZXFA 1JDJA 1HLGA 3K0BA 2FWBA 1P0PA 1YO6A 1VLQA 5DGDA 2PSEA 3C3DA 4Q1VA 4EGSA 1N6OA 2VBFA 3BJZA 1WB9A 1IN1A 2KLHA 4IHJF 4ZDKA 4LRWA 1NN1A 2X9GA 3DL2A 3EVNA 3CYFA 4BYGA 2WKWA 5LMCA 1A8QA 3CEPB 3EYWA 4C14A 3E3AA 4DBRA 4FKZA 3JQBA 3KCQA 4JBGA 3NDBB 1KFKB 3U3ZA 3AJMA 1E1QA 1OH5A 4I9GA 3RV4A 2P1RA 1BSVA 3TX6A 2PSDA 3IPLA 5DW3A 3LC0A 5E4YA 4CSAA 1JW9B 1Q77A 2XYRA 2WE8A 1GTVA 3N8KA 4OUDB 1V7CA 4R2JA 4BCCA 2QG9A 4EEKA 1M1XB 2EBHX 3Q85A 4QJ4A 1GCGA 3PNLA 4NDZA 1QB7A 4WECA 1HT0A 2B7LA 3DONA 1N5MA 2QV0A 3VC1A 1Y48E 1B74A 4JUIA 2OBNA 1P7CA 1VKRA 4M0UA 4UREA 4EFKA 1RLTA 1RR6A 4XIFA 4D92A 1YT5A 1TZJA 1JHMA 3G8YA 4A2CA 1L5FA 1RKQA 5CIYA 3WB9A 1B41A 2D5AA 3AP1A 4N03A 3U6KA 2VQEB 1O96A 2OGZA 2XMSA 2WNSA 2R6R1 2HRDA 2GRUA 3CX7A 5DULA 4GFDA 4JVOA 4E14A 1JR8A 1FNSA 3GDWA 4ENRA 1CUXA 3L8ZA 3G2KA 3I62A 3O6VA 4UBJA 3LP6A 1WZEA 1SO8A 5TT0A 3GJ5A 1RI5A 2QXYA 1M3SA 4KN6A 1NW7A 4R69A 3A4LA 1BHO1 3CXUA 3L41A 5T4HA 2LD4A 3PHBE 4Q0MA 1OXXK 2FFJA 5LQJA 3QM1A 1OWNA 4DMFA 1MT3A 1VYVA 1C0IA 1PK7A 3CLKA 3F67A 4H7JA 5B2EA 1JDSA 4EQ6B 3C3MA 2DX7A 2A86A 1W4ZA 2BBSA 4PC7A 3RIYA 2LE0A 3QENA 3GWGA 4MQ5A 3K5PA 4AIRA 4KXWA 1U3FA 4WGGA 4AUEA 3B60A 1CZNA 3EVEA 5B37A 1KC3A 4E15A 1R0CA 9LDBA 5HGXA 1IK4A 1MD9A 3GLVA 1OXKB 3F6SA 3MMXA 5P8WA 3SHOA 1TVKA 2XAUA 5E3CA 1D6NA 1ZZEA 3IQWA 1UBGA 1ZHTA 2JA2A 2Y67A 3CGGA 5E0KB 5EE5B 2I8BA 1HDOA 2AJCA 4N0DA 5T4EA 4RAOA 3SEOA 5JJBA 4PYKA 3E7XA 3I6MA 1W9MA 3USCS 1WBJB 4ETWA 2E85A 3D43A 3ZDYB 1PG0A 4FC6A 3SIRA 3MWLA 2VP5A 3H1EA 4Y0NA 2WHPB 4HZUB 1ICEA 3S0JA 3Q6NA 4E7SA 4X3OA 3ROZA 5C4GB 2HMQA 1I4LD 4Q3CA 4ZOLB 4BNKA 5L3ZA 3L4JA 2XOXA 4LF7B 1JQKA 2DR3A 3QK7A 2FPMA 3WDSA 2NXEA 4ZQHA 4WOBA 3SZUA 1P75A 1NYLA 3QTHA 1JZQA 2R66A 1QR6A 2PX6A 1T9BA 3BDIA 4GZMA 2R79A 4AX2A 1E1QD 2FB9A 2QRZA 2XUKA 4F1KA 3ZS8A 1QLWA 4GP7A 1XZFA 4GEKA 4M8NE 1TPYA 6LDHA 4RZSA 4NAUA 3GVIA 4UD2A 3AL2A 3PDHA 2VH5R 3WV5A 4HVLA 5F7ZA 2ZR9A 2W6QA 3JARA 2NP7A 2V6JA 4EO7A 4M55A 1D7AA 1PDOA 2HC9A 4FCTA 1GZ7A 3ROPA 1NWCA 3ZNQA 1TZBA 1N5KA 4CM6A 3EH1A 3H9CA 5IJ9A 5J2UA 3IUJA 1X7GA 3EEIA 3PIRA 4ER0A 1B7GO 1SXJD 4JVMA 3HCWA 2VYCA 2ZTSA 1U7WA 2Y0EA 4TVOA 2XRMA 5IANA 5A4KA 5BW6B 4V3CA 2R7KA 3EIHA 1UBOS 2R68A 1XA3A 3U26A 1MP0A 4G7HF 2NPFA 2CZGA 3VOBA 4ITVA 5H70A 4UULA 2XB8A 4QNNA 2OHXA 2PGNA 3COWA 5FWDA 1ZNXA 2B4RO 3FTQA 3SXPA 1N2JA 4FYVA 1QHIA 5MDHA 4ZICA 3OX3A 4MA4A 1XGKA 1TFOB 2ORWA 3AM5A 5K03A 4XPXA 3KJIA 2Q62A 1NU8A 2EEZA 1NYTA 5AW1A 3PGLA 5WRFA 5T8KA 3TWOA 2VP4A 1UM9A 5TPWA 4F5ZA 3GFFA 3HFGA 1D1SA 2JPDA 3KTAB 2OV1A 1OW6A 3B2NA 1PS8A 2ZRBA 1EVLA 3A26A 5E3HA 2VTKA 4GWLA 1PFWA 5JECA 1Y81A 3SQMA 1HT3A 3QG1A 2OGUA 1ZW2A 4RL6A 4EJSA 3ISVA 3DXYA 3VBEA 3WL3A 5E7MA 2FVXA 1MABA 1JJVA 1QGED 1OGJA 1QH0A 3DAYA 4U6SA 4XOUA 3RVOA 2WWIA 5GP1A 4GGPA 2GT1A 4TYYA 5CA1A 4KLAA 4YCBA 4U5CE 3KR1A 4FGZA 4KOEC 3MJHA 4DR6B 3DZIA 3IAXA 3QFCA 4I9NA 4AJ4A 4ZI7B 4X0RA 3R7BA 5HDBB 4C07A 2VPTA 4DILA 2RGRA 3FZQA 3WE7A 5A3QA 4IJ5A 3UH0A 1EIZA 1ADGA 4EBKA 2QTZA 1JKJB 4WFQA 1BDHA 1J8YF 1KR2A 4F4IA 4IINA 4C4RA 1EVKA 4C2BA 4LTDA 3AG3C 4AY2A 3FBWA 3AUKA 3FPKA 3KPJA 2AFIA 4S1VA 2XCUA 1Z6YA 1O08A 4CIXA 4HL6A 4TV9B 1II8B 1CIJA 4RFSB 5JNWA 2IZ6A 5EYPA 1YRHA 4PO3X 4X5OA 4LXUA 1XLWA 1GAEO 1OHHD 5JQGB 1TCVA 3CRMA 5CDTA 3M82A 1L0BA 1T8WA 3CX4A 1AUOA 4AQ7A 4B3XA 1V5FA 4YJGA 3PYLA 5TXGA 4JTDB 2NVWA 2NSJA 3OIFA 4N82A 3FPEA 1YR1A 3NP7A 3P20A 2BTOA 5BR4A 4DJ9A 1FY2A 1DB3A 1KQ3A 2E89A 3TQOA 3H1PA 2PXXA 4XR9A 5CXUA 2YVUA 5DNYB 2FR8C 5CHYA 4YRBA 1OHHA 4LCJA 3U2QA 1UJBA 1VYUA 3NASA 4CMEA 3P71T 3NDPA 4LVOA 2BFPA 1J5PA 2EG5A 4WKOA 4H1WA 2B0HA 2QXTA 4FESA 1Q7CA 2W6JD 4PZEA 4QHTA 3BF8A 1DS6A 2YKGA 3FNBA 3PQ6A 3SK0A 3OEED 3AQCA 4ESHA 2WZCA 2YJ5A 2RDMA 2WJ4A 4HDOB 3OX2A 2WIKA 5HILA 4FW8A 5BR1A 2Y2VA 3LQRA 2FSPA 2EINC 2VDRB 3IR7A 2LV8A 4EF6A 3LW7A 1CYDA 2GEJA 4UFPA 4JQCA 5J2TA 3RU2A 1N2ZA 3ADBA 5HBGA 5LWQA 1T5LA 4I5GA 1NI4B 2MSEB 3Q8MA 2Q6KA 4BWYA 1Z8NA 1U11A 5EP4A 2Q5IA 4YAOA 4WDRA 4PQYA 4POOA 3IHKA 1SA0B 5FBWB 4XSHA 4BGIA 2VCBA 1TFKB 3H04A 3M0EA 4RHCA 1IAQA 4WQMA 2FP4A 3TVYA 3BPSA 2UZ1A 1X7XB 2ICWG 2JI8A 4P6VF 5FJJA 4C5BA 2V6GA 2VT7A 2E5LB 3KQWA 4EO4A 1XPJA 2I3AA 4L22A 5CR9A 2EYQA 3BL8A 5JXGA 2IZ1A 4PYMA 2QUBA 2XR1A 2BC5A 1I3CA 1TJ4A 2YXBA 3JQGB 4L50A 5G1PA 3SU8A 3V4PB 4RKQA 1V4BA 4CIAA 4EFDA 2H9IA 3W6ZA 1JG6A 4LNAA 3G0OA 2OESA 1QH8B 4QXRA 3NYIA 4RXTA 3I01A 5I8ZA 5KAMA 1S2GA 2DH6A 2B8NA 2CFRA 1KZ7B 1GNVA 2DHRA 2RGWA 4IMRA 4JJ8A 3WL6A 4A4DA 4D56A 2OM2A 1B26A 4GL2A 1XT6A 1BS1A 2EQBA 2JI4A 1PUXA 3DLPX 3RAJA 1V74B 4C0SA 3BJMA 2YWEA 3ZH2A 3DCJA 4ZYLA 5IKOA 4ZO6A 3T5DA 2FWMX 4HXYA 4QPNA 1HDIA 3G3EA 4MWBA 3AY3A 3BAZA 5DWDA 4F84A 5CGQB 5ELLA 1SM4A 1O6ZA 3W8IA 3X2QC 1R0RE 3S70A 3Q8LA 1A9RA 3UWPA 1WHSA 3SHQA 2XOEA 2HRCA 1YVIA 3QTLA 1EUYA 3WNCA 1UJ6A 4AYXA 4DF3A 4FYYA 1JIIA 1GUDA 1D1BA 2ID4A 3V34A 4ISBA 1D1PA 2Z5VA 4UU7A 4B87A 3LTNC 1Z4PX 2GZHA 1XL1A 1OGYA 2FNAA 2V6FA 3HV2A 5KNCA 5J2TB 1FUIA 2WD8A 1OV4A 2J3KA 1UT8A 3Q4GA 5ENVA 2IYTA 2QLMA 2KYHA 3VPGA 1TFUA 3RHFA 2ZYUX 1F17A 3GUUA 2NXJA 3SSMA 3C15C 4ZAYA 4EHAA 4F3KA 3HVUA 2I67A 1YRQA 1AVOB 1K7XB 1DKQA 1TAHA 4K40A 4RHEA 2EQAA 1XRSB 3DDZX 2H00A 1UXGA 4PHTA 3GJZA 3NBXX 1X87A 2CKDA 3BQNB 3HVJA 2BFWA 2ZTVA 3KYDB 4ILEA 4LHSA 4R8VA 5LIRA 3DWWA 2XXBA 1YFLA 5TEWA 4E5YA 3AIMA 4FNAA 5C8DA 4FXPA 3STXA 1U5CA 3ZYZA 2J8ZA 2A3NA 4E5VA 3PUZA 2PUBA 3FOOA 1ONPA 3F5FA 4PGGA 3OZ7A 2SCUA 4AJKA 5H80A 5G40A 2IW1A 1CULC 1JFVA 3GYGA 3T15A 5JBQA 3K0AB 5ICEA 1IMOA 3MRXA 1PSWA 1E32A 1YJCA 4JJIA 4AE4B 4JBLA 5KYKA 2EKPA 2VSFA 3IKMB 5NLLA 3K8OE 2BKXA 3FFWA 4E21A 4X63A 1VL2A 3A1EA 1RRFA 4FUTA 2DM6A 4AO6A 2Q3LA 2XADA 5F2KA 4NE7A 3B12A 1MKYA 3K0CC 5CH5A 5IAEA 1D9XA 2OZPA 2W90A 4OK3A 1W4RA 1SZC