3DM9B

Structures and conformations in solution of the signal recognition particle receptor from the archaeon pyrococcus furiosus
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
319
structure length
305
Chain Sequence
b'SMFGKLREKLKSFVKRVEEEVEKETVEIKEKDVDKALDELEIDLLEADVALEVVDALREKIKQKLVGKKVRIGTDKGKIIEEAVKEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTAGRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPILFVGVGQGYDDLRPFEKEWFLERIFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Signal recognition particle receptor
publication title Structures of the Signal Recognition Particle Receptor from the Archaeon Pyrococcus furiosus: Implications for the Targeting Step at the Membrane.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transport protein
total genus 105
structure length 305
sequence length 319
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00448 SRP54 SRP54-type protein, GTPase domain
B PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3dm9B01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3dm9B02
1TU4A 2GJKA 3IPYA 4DLYA 3WMEA 1XNJA 1KO5A 1GRNA 1YQTA 2JJ2A 2LKDA 4JLJA 2ZRKA 1OLOA 5K8LA 3DM5A 1D9ZA 3W3ZB 4G5SA 5HZHA 2KJQA 4UXHA 3HR8A 3K53A 2P6NA 2J5XA 1KMHB 1VCIA 3NDBB 4O2LA 4A9AA 3MGCA 5DE3A 4FWTA 2IS6A 2FEMA 4AKHA 3AGQA 1RYFA 4LYAA 4LJ8A 2F43A 2C9CA 1OFTA 2QG6A 3KJHA 3QNUA 4WOPA 4ABYA 5FOTA 3TW4A 1XEFA 4KBGA 4BZPA 3MJRA 1KO7A 1E2FA 1XBTA 3F3YA 3KDSE 3O8BA 3UATA 2AK3A 4RSGA 4D82A 3U6KA 4OHZA 4PHHA 4LY6A 4JSYA 4XIGS 3KXLA 4PO1A 4KSCA 3VFDA 1MO6A 4HB3A 1XX6A 5JI3E 4FINA 4MYCA 4QFMA 3CRVA 1J90A 4TYWA 3WRYC 2ZI5A 2KBEA 4Q48A 3PJRA 2IXEA 2ZITA 4C0AC 421PA 1WMSA 2B7BA 1KI9A 3FMFA 1KSHA 1YR8A 3QF4B 4BWYA 3RHFA 4EFNA 2DWPA 2IUTA 4IXMA 4IVQA 4UXIA 3BFKA 3E5HA 4RD4A 3GLFB 2BEJA 5TB5A 2FN4A 1N25A 1M8PA 3P4YA 4IDOA 2WOJA 4TMVA 5FOSA 4C0LA 5HZKA 2AFHE 1R0YA 1A5TA 1UAAA 5LD2C 1GM5A 2W00A 4D25A 2QT1A 4QXAA 4II7A 1XTRA 4JSTA 4WXPA 2HCBA 4OYHA 1NBMD 4DLRA 5BN4A 2HV8A 4NCKA 2NZ8A 1JPNA 3ZQJA 1P9NA 3AF2A 1R8QA 2AKAB 3C4JA 1GIAA 3SU8A 2R65A 4ESVA 1C4OA 4LUCA 1MO5A 3BXZA 3K9GA 4CGZA 2ZSAA 3SE0A 3U44A 2QP9X 1DO2A 4OBEA 1ZM3A 1NBME 2ANCA 1UBCA 2GRJA 4DLSA 1BH2A 4KFSA 2WSMA 1SGWA 4AWXA 1W0JA 4JL6A 4JKYA 4C0KA 4DCNA 4MKIA 5DHFA 4LBYA 1UFQA 1YR9A 4OHVA 3CH5A 3RLFA 4DLTA 1WF3A 2KI5A 2G83A 1DARA 3DO6A 3M6AA 3CPEA 4JT2A 2QTHA 3EX7C 3REFA 2WM9B 3REGA 2JLQA 3HYTA 2V6IA 4G5OA 3QENA 4FCTA 4TZ0A 2YC4C 4KO8A 1XZQA 1RJ9B 4GPTA 3K0FA 5AUNB 3KXIA 1GDDA 1CKEA 2WV9A 2GEUA 2O8EB 2QA5A 3ZVLA 4NMMA 3QKSA 1NNEA 2ATXA 1W0JD 2GZDA 4DDTA 3ZVMA 1BMFA 1BKDR 1WCV1 2O0HA 1QF9A 2GEDA 2Z83A 2C03A 1JXOA 4LRWA 4MQBA 1IY0A 4K81B 4F4CA 4X8HA 1NVUQ 3U3JA 4EJSB 1C1YA 2FPMA 2G0TA 5J4VA 4FIDA 1G3QA 4BGDA 3UXMA 5FR1A 4QBGB 3EZ2A 2OCPA 3T15A 1ZM2A 3AUXA 1S3SA 3B9QA 2C78A 3NBZC 4PQRA 5DNYB 4XVQA 3GFPA 2CVFA 1DO0A 3CRQA 4L16A 3T06B 2ODWA 1LF0A 1VKJA 3VKHA 2VHUA 4XH9B 1P6XA 4BLPA 4LJ7A 5JI2E 4L8GA 4D6PA 5KTYA 4M9SA 3RRNA 2AN9A 4BLOA 4EPXA 4KAXA 1CXZA 5UKDA 2PCJA 4A0HA 2WKPA 1VCMA 1TTTA 4MGYR 2WJGA 3TBKA 4AKEA 4ARZA 4QL3A 1UKVY 2RGBA 4U00A 2C99A 1YVDA 2GILA 2FOLA 4B3BA 3QXXA 3MLEA 4HDCA 2P5TB 2QPOA 1ZNXA 3CF2A 3LH5A 2C2HA 1OB2A 3F5FA 3VR1A 1ZP6A 2BBOA 3KTAB 4PC3A 2NO9A 1VDZA 2Q6TA 2J45A 3ZLJA 1G5RA 2J0QA 3LX5A 3NEYA 1OSNA 3TR0A 2A78A 1EG7A 3SR0A 3TE6A 3LBIA 2VP0A 2XZLA 1KY2A 3KQUA 3DMNA 1OT3A 3LDAA 5JS8A 2OXCA 3PIRA 2W6ID 1GNRA 1Q0UA 2VHCA 1X3SA 2D62A 1R4AA 2XNDD 3TMKA 2HLDD 1XB2A 3TJZA 1RKBA 1VCOA 2XTZA 4NE2A 2QQ0A 4MH0R 4BE7B 4UKDA 2IYSA 1QG4A 3LFUA 4DLXA 5L3SB 4HATA 1NSTA 1TEVA 1IY2A 3U60B 4A82A 3LWNA 3W8NA 4EPWA 3BC1A 3UWKA 3NHAA 3IBYA 2ONJA 1E1QA 2ORIA 4EQ6A 3PENA 3I72A 3Q7QA 5GJCA 2FSGA 1OE0A 3ZQ6A 5FH9A 2CE2X 1XCGB 4JLDA 1IN8A 4JVSB 4M21A 4E03A 4RD6A 3B6EA 4M22A 4UNNA 3VR5A 1P5ZB 5CM9C 2EFEB 3I61A 2HJGA 1ZUNB 3U3RA 2BCGY 2NO0A 1A2BA 5D3MA 2A5DA 2ZE7A 4FMDF 5J4HA 3I4LA 2IK8A 2BBTA 4QM7A 1NG1A 2ZYVX 3ZZUA 1G8HA 5DYIA 3CPJB 2N1BA 4NKRA 3M1IA 5M04A 3N70A 2ZI7A 3QXJA 3ZH9B 1ZUIA 2J46A 4IDPA 1G8FA 1OXUA 4OL0A 4DIDA 3U3KA 1W47A 3W90A 2RGEA 1ZC4A 3CPHA 2BM0A 1G19A 1Z0KA 4L4UA 5J47A 4PPFA 2ZR9A 4JL5A 2OLJA 3RSOA 5CIQA 4BZQA 1R7RA 2JLSA 3R9WA 5CJPA 1KI2A 4JJZA 4HAVA 4LHXA 1S9HA 2PZGA 3QJYA 5SZJA 1OJLA 1S0UA 1T8TA 1IXZA 3KB2A 4JLKA 3PEYA 3QG5A 5JEEA 1W0KA 5EZ6B 2WKQA 3GLIA 2CCGA 3KZ1E 2UZIR 2BHRA 4NPHA 2ZJYA 3A8TA 4KBFA 5FUVA 2V55B 1CJKC 4K8OA 4HLQB 1CJTC 4YC7A 4D4JA 3GEHA 5A0FA 3K70B 1N6HA 4FN5A 1CBUA 3EIEA 2WSSD 1DAFA 1I4DD 3B13B 3QPWA 4Q21A 1ESMA 4AG5A 1W1WA 4QBIA 1PJRA 1Z2AA 4FCVA 3HWSA 2QM8A 5AJYA 4G5GA 5B2ZA 2ZRNA 1VMAA 1NLFA 4Q1DA 1UKZA 1VHTA 3ND9A 1KI8A 1ZU4A 1UADA 1W0KD 1G3UA 1E2PA 3AF0A 4RCYA 3FMOB 4M9QA 1G4AE 4JVNA 3V4FA 5DLQC 1F5NA 3ONWA 3CO5A 1CR0A 2Y8EA 2RKOA 2IA5A 2WJVA 4OQXA 3U7GA 3MG9A 4QHSA 2QEQA 4LC1A 3SJZA 5KU1A 5KNBA 4LHWA 1ZM7A 2FWRA 2CJWA 1K8RA 1LTQA 3ZGXA 2ZRGA 3AF1A 4PHTA 1BO6A 5FOWA 5CYPA 2ZS9A 3T35A 4E07A 3ZVRA 1E1RA 2REXB 3IPXA 2RB4A 1LV7A 2F9LA 2A5YB 1NF3A 5FPYA 4RY2A 3FMPB 2VYFA 2J7KA 3BBPA 3KTAA 4IVRA 4Q4AB 4A0GA 4B2PA 4BFWA 5TDHA 1EFRD 2CHGA 1AKEA 1UPTA 2GK6A 3B2EA 3NDPA 4LBVA 4MGIR 3D8BA 4Q9HA 2RGNA 2ONKA 1WA5A 3OFNA 4NCHA 1XD2B 3ZIAD 4OQMA 4DZZA 2QY9A 4QGFA 4Q7MB 1WP9A 5EQTA 5CDFA 5KSPA 5KNCA 1P3JA 3NEJA 5JJLA 1OPXA 1NKSA 5AJVB 1QHSA 3L0IB 2RGNC 2J7PD 3LBHA 4JL8A 5EE3A 1XPUA 1O87A 1J2JA 3PUYA 2XX3A 3ASZA 3LVQE 4GL2A 1LY1A 4GMDA 4LJYA 4TMWA 1G6HA 2UKDA 1DELA 1P2UA 3RWOA 3E1SA 4CEIA 4R2IA 2O8FB 4MDFA 2IYUA 2VP5A 4WAUA 4LJAA 3WP1B 1YZKA 2TMKA 3AKEA 4OI4A 2R8RA 4L9WA 1TQ2A 3FB4A 5EXXA 1AN0A 5IHPA 1U98A 4US1R 1ZCBA 3SZRA 2QBYB 4W5WA 2YC2C 1TADA 4D80A 3PEWA 4B3GA 1XJQA 1WBBA 4B47A 3EARA 1WQ1R 1G5PA 5DI3B 3I1FA 2BKEA 1M7BA 4LBWA 3WNCA 4YDSA 4KI0A 4RFSA 3L82B 5DN6D 4NYIQ 1Z83A 3GEIA 4AD8A 1X8LA 2CHVA 1JALA 4URXR 2MMCA 4PXAA 2OCAA 3CB4A 3TK1A 5JS7A 1DE0A 3B60A 1KI4A 3EZ6A 5JFGA 1QHGA 4RVCA 3O8CA 2H1LA 3CRW1 3Q5DA 1AS2A 2WWHA 2MMGA 4C7OB 1U0LA 1XXHB 2X8AA 4RZ2A 4Q9IA 2WWWA 5G3YA 3KUCA 2FFBA 2GNOA 2W6JA 5JWOA 4Q47A 3GJ5A 4D0NA 2ZEJA 1I2MA 2GBLA 2F3TA 1XD9A 2VIIA 3THWB 1CR4A 4BFVA 4Z1MA 2WMNB 2GF9A 4JLOA 4ZDWA 4WVFA 3A37A 5L8VA 5FTMA 1N5JA 2ZJAA 2JA1A 2GBLC 4F38A 4ZI3A 3B1VA 5FOVA 1FUKA 2J0VA 2VO1A 4B76A 2EYUA 1NSFA 2WJYA 1BIFA 2J59A 2V6JA 4JT4A 4TQAA 1KDRA 2C8VA 5TY0A 3TW8B 1DVRA 1KOFA 2JEOA 1KIMA 2RMKA 1JJ7A 1M1YE 1YZLA 1X8KA 2PBRA 5CYOA 1GSIA 4BLTA 1XEXA 5J5CA 2C04A 4B35A 2WHXA 2ZE6A 4BLRA 1F48A 4HEJA 3T5DA 2GF0A 1G5TA 1MO3A 3W6PA 1GITA 1S96A 3NBXX 2IWRA 2FJUA 2HDNB 1X8JA 4Z1MD 3VU9A 2V1UA 2HYDA 1P9WA 3X2SA 4QBFA 4ASUD 3IUYA 4KVAA 4I99A 5HCNA 4PO8A 4QM6A 3AF3A 5JHGB 5FPTA 3TSOA 3B1XA 1R0XA 3K9LA 4OQFA 3K70D 1HEIA 1U2RA 2Q0HA 4QNRA 1G21E 5JBQA 1JEEA 2P3SA 5JHHB 3RSLA 2IYLD 1G291 3N5CA 3RRMA 2UVQA 3EPHA 1XWIA 5J4KA 2ZRIA 2WWFA 2W58A 3AV0B 3ZS8A 2IYTA 4KFTA 4PQFA 3B1WA 1HA3A 2CLCX 2ZYUX 4PZYA 4A4DA 4PR0A 4A36A 2R6FA 3QXHA 3VAAA 3F0TA 1NMZA 1DAEA 2FNAA 3I32A 1OXXK 3QPUA 1VYVA 3TIFA 4EFLA 2PL3A 4A2WA 4EPVA 3IIMA 1V43A 2WKRA 3CONA 2H7VA 3I8XA 1N0WA 4GZMA 3QBTA 3OIUA 3FFAA 4ON9A 1A4RA 2VPPA 3G0HA 1ETUA 3D3QA 4PHFA 2QM7A 4NYJR 5CB6A 1KI6A 3TVDA 4B2IA 3C5HA 4AIIA 2O5VA 3BE4A 3KL4A 1KNXA 4IFBA 1DAGA 3U7HB 4M1MA 4AC9A 3R7WB 3S1AB 4BFXA 2BIFA 5KHOC 1ODFA 4BUJA 2OV2A 2PZFA 4D4KA 4ACBA 3DOFA 1NIPA 3AP2A 1NY6A 3RYTC 4IHQA 3HU2A 1HH4A 4TYPA 1KO8A 2C95A 2HUPA 2ZJBA 2XTMA 3ND8A 5F3WB 4LHYA 4N0EA 1T3SA 1W48A 1E2MA 5HKKA 3NWJA 1LB1B 5DSZA 4BEBA 5H70A 1UM8A 3QXSA 1J70A 1ELOA 1F2TB 3GLGB 2I3BA 2VH5R 2VP4A 2R2AA 1U8ZA 1P9RA 2GHIA 1CJUC 4A8JB 4DJTA 1JJVA 2OSBA 4LI0A 5AUOB 2EFGA 5B57C 4AKIA 1JQJC 5F9HA 1MABB 3SNHA 3MAAC 3LQRA 1K6MA 1LVGA 2OO7A 3VR3A 4A0RA 4B71A 5KSYA 2AK2A 4BEJA 1FQKA 4C0SA 4ZO4A 3MRSA 2IWHA 1P75A 4D2IA 3AF4A 5LDDC 1PLJA 2ZYTX 2OBNA 1L7VC 3NKVA 5HKKD 2ZVPX 1W4CA 1CF4A 1R0ZA 3NVAA 1NN5A 2C9OA 4KXFB 4EDHA 2EVWX 3BB3A 5JRJA 4C30A 1BYUA 5JZVA 2Q3FA 3MD0A 4M1OA 3BGWA 1SVSA 3THWA 1HURA 2F3RA 2REOA 2V9PA 3MFYA 2DWOA 3SEAA 3I3SR 4FXPA 2P2LA 4FMBB 3T12A 3EAQA 4IOLA 3SFZA 2ZXUA 2HCJB 1IN5A 1FX0B 2OBLA 3VNVA 1AJEA 3AVPA 4Q66C 1TNDA 5EXSA 4YXWA 3WXMA 1QHHA 3AP3A 4GOXA 1E98A 4XTCS 1WDTA 1FPMA 1K5GA 4BQSA 2PLRA 4NYMR 2R6AA 1NMXA 1DPFA 1KTVA 1WRBA 2FFQA 1SXJE 4Q4JB 1E9RA 5FL7A 3V4RA 1VG9B 1D8TA 1HT2E 3EC2A 1NRJB 2BMJA 4TMZA 4OK3A 2XOKD 1W36C 3DOEA 2F1JA 1KHTA 3LBNA 1TUEA 4CDGA 1W4BA 5SZKB 4NCNA 1DADA 3TGPA 1EX6A 1MKYA 2EWWA 5G41A 3QG1A 1TU3A 1N5IA 4POAA 1N6IA 1OYYA 4M8NE 4PPNA 2C77A 5F2EA 2CVHA 2VSXA 4FMDB 1OB5A 5DHAA 4GMXA 2D7CA 1ZINA 5TARA 1CRQA 4PAOA 1U81A 3GCGA 4YLGA 5FL7D 4BLQA 4DC9A 2JATA 4YMVA 3MMPA 4D4MA 3J81k 4DHEA 3BH6A 3ICQB 5C4GB 3T1OA 2XB2A 5IF9A 3GFOA 1C9KA 1D2EA 3CM0A 4H1VA 4NL4H 4XOIA 1W49A 1IQPA 1AM4D 1DEKA 1E9FA 3HP1A 4QOSA 4B33A 5IRCD 3DPUA 1UBGA 4GOKA 3ADCA 1B0UA 4GFDA 5G53C 2VSFA 2WICA 3CRRA 3LW7A 2Z4SA 5KO2A 4YMUA 2QMUA 4QNMA 3UIEA 2WTUA 2GXAA 1NVVQ 2OXRA 2JLZA 3B5JA 4XSGA 3RVBA 2WWYA 4B43A 4Q1FA 4LYJA 1OFIA 3AVUA 1Q12A 1AQYA 3MWLA 3T5GA 4KODA 3UWOA 1NI3A 4B6FA 2FGJA 2DFTA 2B21A 1KMQA 3EWAA 3UKDA 5K8UA 1Z3IX 2K5UA 2ZUCA 4RFVA 2ZIAA 3A58B 3BFVA 2O0JA 2AX4A 2X19A 3LNCA 2ZTSA 3KX2A 5SZHB 5GVSA 4OI1A 2Z43A 4C0QC 5A5GA 4KSBA 5FBQB 5E7MA 1NBMA 3P27A 2ERXA 1AA9A 3L8YA 2OE2A 3RABA 1TQ4A 1QZXA 5AK0A 2OESA 3LLMA 3QKRA 1E94E 4G0NA 4M53A 3SYLA 3GLHA 1AS0A 4X8MA 1YZUA 4WW0A 2YINC 1DAIA 1RPZA 3CR7A 5L3RA 5JCZA 2IYWA 2DR3A 3FHCB 4GRAA 4ZCIA 2YWGA 4MA4A 3RS2A 4DUGA 5BWMA 3KKQA 2WVJA 2DFLA 3FKQA 5CITA 1F2TA 4QJ3A 2YJTD 3DZ8A 2CCJA 4IRUB 4WZBE 3PXGA 3SS8A 2OG2A 1EK0A 1Y63A 4IW3B 2XNSA 2ZYWX 3LD9A 4B3CA 1Q3HA 4MRPA 1G6OA 1H8HD 4C0HA 1W4AA 2GJ8A 1KGDA 3OIYA 2ZRPA 4IDHA 4PC7A 3AVTA 2V7QD 4UNPA 4Q1CA 3K09A 1OH8A 1EXMA 4DUGD 4I1VA 3CX6A 1JQLB 5H1YA 4PPGA 3GJ8A 4XTRA 2KE5A 2XXAA 2PMDA 4MDEA 2HF8A 2NZJA 3PCRB 1W4RA 1Z6GA 1YHNA 4OJKA 4URWR 3K09C 5KYKA 1Q20A 2QPTA 3RWMB 4MYUA 3IKJA 5GVRA 1K5DA 2GAAA 3W9YA 1GRRA 4UJ5A 1AK2A 3I8SA 5G40A 3VX3A 4B32A 2QAGA 3EIQA 1T6NA 1Z07A 2MSCB 2WPDA 3NIBA 4Q7LA 4BRWA 1SKQA 1XMJA 4S2EA 1D6JA 3VQTA 4AY2A 1FX0A 3GLGE 1UBEA 2QPAA 2FPLA 1N6NA 3U4QB 1ONBA 2GJ9A 2HT6A 5HE8A 2QAGC 4UQOA 3THYB 2RAPA 3RANA 3W3AA 3L43A 2WAYA 1GNQA 2OFOA 4B6EA 3EA0A 2GCOB 1AGRA 3C7KA 3OE7D 1N6LA 3O8RA 3PQCA 3D31A 3BRWD 2D2FA 4F4JA 3QKUA 1E2IA 4LJ9A 4F4IA 3NC0C 2QORA 1EESA 1E0JA 1ZRHA 4KYIB 4CYMA 4O25A 4CEJB 2WPDD 2RGCA 3I73A 3IO3A 1T4GA 2ZAMA 2QL6A 1NY5A 4CEHB 2PT5A 4LC0A 4MGZR 3BH7A 1ZJ6A 4E22A 3SJCA 3CRMA 2R62A 1U94A 3CUEF 3WNBA 4DT1B 4LHZA 3M4YA 2IHYA 5AUPB 1XMVA 1NMYA 4ZIRB 2ZJ2A 2EFCB 2W2VA 4PANA 2D4HA 2GCNA 2QN6A 3B82A 3QEOA 2JDID 4DSTA 4PO9A 2IYQA 5BN5A 3K0AB 4DCSA 4LV5B 2G1KA 5FPSA 1GP2A 2W6IA 3TRFA 3UG7A 4PC1A 2XNDA 2ORVA 2VA8A 4LOAA 3SJBA 5HE9A 1E2LA 2HLDA 1W44A 1IN4A 4I81A 1KMHA 4MRRA 1SHKA 2WWXA 3WP0A 1R0WA 1OH7A 2ZUBA 2QGNA 3BWDD 1MRSA 3LLUA 1D5CA 3MSXA 1R8SA 3KFVA 4HB0A 2BWJA 3FOZA 2X1VA 4B3XA 1R6BX 5EE9A 4ZI2A 3NXSA 1JNYA 3U5ZB 5KUTA 3QQ5A 5DISB 3WYAA 4DLWA 1PZNA 3IHLA 4JLMA 3IHWA 2IF2A 4I1UA 4XSHA 3Q7PA 1HY3A 3UMFA 5K8TA 4DLZA 3SQWA 1JECA 2ZETA 2PJRA 4Z51A 1D2MA 5EE0A 4B75A 2IYZA 4AYTA 4AG6A 2ZRJA 2G6BA 3VTKA 1II9A 2AD5A 2JJ8A 4JLNA 3QF4A 3NHBA 4D81A 1HQYE 5FPHA 3CNOA 1RRGA 2EU8A 2FSHA 3GLFA 2WIAA 4I1OA 3ZD6A 4TMKA 2ZI9A 4R2HA 3SHFA 2DFNA 4M4SA 4PHGA 2CXXA 2VHQA 4XD7A 1ZM9A 3ADKA 4JJKA 3CR8A 2ZI6A 2JLVA 3VR4A 2CLDX 1E69A 1KDOA 1WB9A 2OFXA 3W8RA 2XJ4A 4LSGA 5KSZA 2OAP1 5JWRA 1E2DA 1PLKA 2ZI4A 4AI6A 1F6BA 4JLAA 2QAJA 1PUIA 5TXGA 2QSYA 1UKEA 4G5QA 4F93B 4QGGA 3WBKA 1G1MA 2ZR0A 1OFUX 5EP4A 3CLVA 4A1FA 2EFHB 3Q85A 4XD7D 1HE1C 4ZV4A 2JCSA 5HR5A 1W5TA 5KDDA 3K1JA 4RKFA 1ZU5A 3TQFA 2OAQ1 2WSSA 4HSEA 5FUXA 3TLXA 2QUZA 4GSYA 4DCVA 1CLUA 3AVQA 2MSDB 2AFIE 2P67A 2BMEA 1QHYA 121PA 4MUAA 5D3QA 1T3LA 5EXTA 1SVWA 4OHWA 1P60A 1S1MA 3IO5A 1Z5ZA 2O8CB 1RJ9A 5L3QB 1Z0DA 4LPKA 1FUUA 2BOVA 3THYA 2WJIA 4X8LA 2O8EA 3BIFA 4V0MA 4HZIA 3SFVA 5F9FA 4HAXA 4A0FA 4DB4A 1G64A 1NVXQ 1ZVQA 2GCOA 4Q03A 4CT4B 4Q19A 1RRCA 1QHNA 4GI7A 5EZ5A 3VHXA 4WBSA 4EJSA 2DPXA 1CR2A 1Z06A 2QENA 4FCWA 1Z08A 4IEIA 4MUBA 1XTQA 2EWVA 1FNMA 1CEEA 1RRFA 1ZIPA 1XP8A 1NL3A 4Q7JB 4C3ZA 5HPYB 2RGDA 3NG1A 2EFDB 4EJSC 3SQXA 1VIAA 3AUYA 1S9DA 3RS4A 2ZRCA 3GMTA 4KV9A 2R6DA 1VIYA 1CJVC 1R5BA 5EE1A 1WXQA 1S4QA 3GJ7A 4JVMA 4YQFA 2C5LA 1EFRA 5JJKA 4LPSA 1QDEA 1QG2A 2VP2A 2OUKA 4JYCA 2GESA 3WHKA 3BFXA 3ZVNA 1M6NA 3W5JA 1CIPA 3AVOA 4OI0A 3ZIAA 3NC1C 2IBMA 2RGAA 1IXSB 3CWQA 3EZ7A 4MKGA 4L15A 3FWYA 1UF9A 1KJWA 5KPJA 2CE7A 4KVGA 3P1JA 1MT0A 4Q1BA 1ZC3A 2J7PA 3EW9A 1ZBDA 1FTSA 4GNKA 4HLDA 2NOAA 2FE4A 3NH9A 5FI1B 1F3OA 2P6UA 3K9HA 3VR2A 3EPJA 2ZSDA 1T9HA 2PX0A 2PEYA 2B92A 4Z54A 4M1TA 2AWOA 4TYQA 3ZJYA 1KZ7B 1GKUB 1U99A 4MRVA 4WZ6A 4IOJA 3U7EB 2IW3A 2W83A 3HJNA 2ZROA 3AEZA 1IY1A 3THXB 3QE0A 2FEOA 5SZIA 3HYRA 4KFUA 3QKTA 1RZ3A 4B74A 1E99A 2NO7A 1E9BA 3JZMA 3PR1A 5B58C 4URVR 5IK2D 5AR1A 3PUWA 1N6RA 3WMGA 2ODBA 4NYJQ 4DDVA 2VL7A 2O8BB 4B34A 4A2PA 3WRXC 3IBGA 3D6TB 5DN6A 3PITA 5L3SA 2HYIC 1OH5A 1CULC 1KZGB 4N1AA 3QF7A 2OBMA 2XSZD 3QXCA 4Q02A 3SYKA 4R98A 2J0UB 3MWKA 1XTSA 4NCJA 4QGHA 1GILA 3OF5A 1G3RA 1VCNA 2ECKA 2QRZA 5E3HA 4S35A 3T1VA 1MH1A 3SDZA 4C9BA 1X86B 2ZU0C 4V0NA 1N5LA 2WOOA 5GJBA 2AKYA 3IEVA 4C2TA 4CW7A 5FBLB 4TTPA 4NHOA 1RYHA 1MO4A 3RS3A 4GP6A 4YDHB 5BYKA 4Q9KA 4O3MA 1YJ5A 4JLPA 2ODNA 1SXJB 2GVZC 4KITB 4PSKA 1Q1EA 1KK0A 1SVOA 2C96A 1NP6A 2GDJA 1GFIA 4H1UA 5CIWA 1S3GA 2YNMA 3GFTA 1OF1A 5CJ2A 4DB2A 3KJGA 2GA8A 2P65A 3LAWA 2REBA 3VX4A 1G3MA 1J99A 4RZUA 2G3YA 4D0GA 3DKPA 3LV8A 1N5KA 1V5WA 4RD1A 2F1RA 2ZSEA 1NN0A 3ZZTA 2OT3B 4Q4HB 3GJXC 5FR2A 3RAPR 2A7QA 2AHOA 2HXYA 2FMXA 1IBRA 1MV5A 2VHJA 4TT3D 1UEIA 4ASUA 4DDWA 4GDFA 4ERNA 1WGWA 4HZUB 1IN7A 3A1TA 1ZNYA 3I62A 3AP1A 4RKEA 1RFLA 3Q9LA 2ZREA 3DL0A 4EPRA 1TF2A 4I4LA 1N3BA 5JCPA 4LYHA 3K8YA 1II8B 4R7ZA 1LF5A 3AKCA 2W0MA 2WBLC 4Q18A 4AKGA 2O52A 1E2KA 3C14C 2P0EA 3K70C 2Q9AA 2C98A 3FPAA 1FQJA 3H1TA 4YMSA 2O8DB 1W2GA 5TMPA 1Z47A 3KB1A 2B7CA 1OXTA 2QTFA 3KUDA 1GAJA 1KYIA 1EFTA 1T0JB 3ZYCA 3MWYW 4IDNA 1OHHD 3X1YA 4B48A 1F2UB 2ZRMA 1OW3B 2JLRA 3A36A 5EP1A 1MOZA 1FP7A 3NBFA 4JZKA 5ELXA 5C2JB 1XPOA 1KSJA 3DKVA 3UMRA 4UNSA 2OM2A 2QMOA 5DO9A 3U61B 2CMKA 2V4ZA 1LS6A 2W2XA 5LBIA 2ZANA 4TYNA 1PVOA 2ERYA 2XJ9A 1EX7A 1X1RA 1N2CE 5EJEA 3EA5A 1KK2A 4JIMA 4JBWA 4KLZA 4M9ZA 4NZYA 2OFWA 3TAUA 5DI9A 1TUIA 2GXQA 2CDNA 1PV4A 2FX3A 3MJHA 5BQ5A 5CK5A 3ZS9A 1W46A 3LW8A 2Q9BA 2IXGA 4B2LA 4IOKA 2RGGA 2FFAA 4Q4AA 4FW9A 4D0LB 1DG3A 3H84A 1DTSA 4P3YA 1RIFA 2NTYC 3W34A 4EUNA 3BJIC 3A4LA 1XD2A 4TLAA 4JBXA 1RW4A 4XWKA 3PEVA 4O0MA 5EUMA 4IXNA 5B64A 8OHMA 3IEUA 1ZMXA 1VHLA 2Z5FA 5CLLA 4PAQA 5CM8B 1JAHA 4OHYA 4A15A 2O8FA 4ILEA 4TYYA 3Q3JB 2VTKA 4NCIA 2P5SA 4OK5A 2GXUA 1IOZA 2ZRFA 3AGPA 1E79D 4P31A 4Q01A 4ZDJA 1Z6YA 5EP2A 3PVSA 2QBYA 3GEEA 1XU4A 3IIJA 3BB1A 3B7GA 4GOJA 2FFHA 2XGJA 1LW7A 2FDCA 5C1BA 1IM2A 4JBYA 5DI3A 1WBDA 4FI3C 1ZNZA 1XFAA 5CLQA 2GCPA 4V0OA 3GJ4A 4XWAA 2AWNA 3AVWA 1A2KC 4PSVA 1EGAA 1G4UR 1SXJA 1NIJA 1CS4C 3SJAA 1M2OB 3VNUA 4FMCF 1VYUA 4A2QA 4A6PA 1KSFX 1P2SA 4Q1AA 5LD2B 4H9GA 1ESNA 2ASEA 1R10A 1CR1A 4NYIR 3MCAA 2JAQA 1O3YA 5FUWA 1E4VA 4C7OA 3EG5A 1XXHA 4V0LA 4Q4LA 4LV8B 3IIKA 4OKSA 3WYGA 1HT1E 1QHIA 2R44A 3KXKA 2Q3MA 1Z0AA 4FWIB 2H17A 3BERA 2XOKA 2I1QA 1AKYA 3UANA 1I4LD 1SXJD 2E9SA 1DAHA 3W6NA 2Z6VA 2QQEA 5FPKA 4BFYA 5AJWA 4IFEA 3SBDA 5BXQC 1G17A 2F1HA 3U44B 3A6PC 3PUXA 2PH1A 2IF0A 3H4MA 4NP6A 1S8FA 2V1XA 2V8OA 1FFHA 2FSIA 3A1UA 4PC2A 2ZSBA 3FTQA 4HAZA 4DVGA 4EIWA 4CF7A 5J4LA 3TSZA 2W2TA 4FD2A 1E9SA 2IYYA 3C15C 1Z63A 2X77A 1U9IA 4G01B 3KQLA 3TNFA 3R8FA 2CNWD 1JR3E 1DAMA 1KAOA 4A92A 1J8YF 4TL9A 4IVPA 1ZUHA 1VPLA 1NN1A 3WMFA 3KKPA 3TUJC 1IONA 3EPKA 1OXSC 3ZD7A 2ZVQX 4MRNA 1F2UA 3K0FB 4JMPA 2XZOA 1GRQA 3B1ZA 2VF8A 4BFTA 2NMVA 3RNLA 2CL6X 2IEZA 4MYTA 1NKTA 1FZQA 2YZ2A 4BFUA 3QKSB 1G20E 3QIAA 2HEIA 3EXAA 1IAQA 1E2JA 2B6HA 4ZKDA 2OCBA 4DSUA 4ITRC 3OIWA 1RC8A 2N46A 1OYWA 2VSOA 2CBZA 3MWJA 2ZM5A 2JLWA 2LCFA 1JPJA 1NLZA 1TF7A 2DBYA 5TV2A 2JLUA 3BOSA 3AVVA 3VR6A 1E2HA 4BFZA 2ZRHA 3SN6A 2G88A 2HT1A 1Q1ZA 2DY1A 2H18A 1GTVA 1P73A 1UJ2A 3H0KA 1AZTA 1Z0JA 3EASA 1F60A 1NVWQ 1NJFA 3THOA 1FP6A 5FBVB 3W6OA 3TUZC 3PG5A 1SULA 3HDTA 1ZM4A 2XB4A 3EZ9A 3QVVA 4ARZB 3UG6A 1G7SA 4KLNA 4LK2A 2QGZA 3JVVA 1XTIA 4LCBA 2GJSA 3CKLA 1J7KA 2WJJA 2P6RA 3R7WA 3S1AA 5H68A 2F1IA 2KB0A 1G3IA 5FL3A 1M7HA 2LKCA 4RD0A 5HCIA 1EWQA 1VYTA 3QVUA 3DDCA 4G5RA 1TAGA 1XJ0A 4V03A 3A4MA 4N3NA 3T34A 1H8HA 4P0TA 1A1VA 1SVMA 4QJ4A 2N42A 3N2IA 2QE7A 3L2OB 1P72A 3QPVA 2V7QA 5FUYA 1CRPA 3CZPA 2QMHA 4GBMA 4Q00A 5GJWC 4PAMA 3SHWA 2XITA 4BASA 2RHDA 4G1UC 1GUAA 1SQ5A 2JJ2D 3FYHA 3GLGA 1VG0B 2OHFA 2ZSFA 2ZAOA 3Q72A 3SI7A 4A8JA 2G0NA 2PZEA 1GOTA 2H5EA 1MABA 2ZPTX 2A5FA 2NO1A 1T3HA 4JKIA 1XMSA 2EYQA 4A8JC 3VKGA 2CEAA 4HLUA 5JLJA 4NH0A 4LWZA 1W5SA 4B3FX 4WXRA 3Q8XB 2LWIA 2H16A 2HXSA 2PT7A 3GJ3A 4DCUA 2QE7D 4HB2A 3LA6A 3ECCA 1I4TD 1FW6A 4ZCMA 4W9MC 4EQ6B 2FH5B 2D3WA 4HLUC 1B23P 2ZS7A 1KAGA 3HPQA 2KBFA 4OHXA 5BW8A 2O0KA 4HYYA 1U90A 2WWGA 3CNLA 3PFIA 3SOPA 3FHOA 2IUSA 4CIDA 3OE7A 2C9YA 5FOXA 2BV3A 5FTNA 5J40A 2A5JA 1XCMA 1VG8A 2QNRA 1P4SA 3A1WA 4W5JA 5DIFA 4DKXA 5D3MB 3R9IA 1G7RA 3PEUA 4RZXA 1SVLA 3AB3A 3HPRA 1P62B 3B78A 3HR7A 3R8CA 2WJHA 3IDQA 3TSWA 3X1XA 4BECA 4EPYA 5HTKA 3F8TA 3KQHA 3QUSA 1R5NA 4M2LA 1Z6TA 2QRNA 4HI0E 2OCYC 1E2EA 1E96A 4OJQA 1S2MA 3GLHE 4Q4JA 5C46F 2E87A 4OK6A 4JS0A 2Q3HA 5DYGA 1YRBA 2JDIA 5L3VA 3RRZA 2DFKB 1AS3A 1GVNB 2YOGA 5AJXA 1L4YA 2GVDC 3K0EA 4WA7A 5EXPA 4D4LA 2VP9A 3UMSA 4TLBA 1ZD9A 3VHLB 1FOEB 3QOFA 3GLIB 2FZLA 2JIZA 4V02A 1KO1A 4PX9A 1IJFA 1ZIOA 2VRWA 1SKYB 3CW2A 4HDQB 2IS2A 4TL8A 4TZ6A 4Z8XA 1LNZA 3KQKA 3CBQA 4TL7A 2GAOA 2IYXA 4TQUS 2FGKA 5JSZB 1TX4B 1OKKA 1YZNA 2DB3A 3BB4A 3T1QA 2GXSA 1YZTA 3LVRE 2D2EA 3KQNA 2BC9A 1A7JA 3AVYA 5P21A 1CU1A 3AVXA 4MKFA 2JGNA 1Q1QA 4DEYA 3C5CA 1T0HB 821PA 1N6OA 3GPLA 2JIZD 1HYQA 3FDIA 4QGAA 3ADBA 4Y0VA 4HB4A 4GP7A 6Q21A 1UEJA 3E2IA 1XTJA 1YZQA 3TQCA 4B44A 4XJXA 1Q57A 1GKIA 4TWZA 3V9PA 1EFCA 1BMFD 5EE5B 2VF7A 1GL7A 2YYZA 2XAUA 4XVRA 1G8YA 2G77B 4RCZA 1D9XA 1OKKD 2FG5A 4J0QA 4QG7A 5FBWB 3ETLA 3LX8A 1NVVR 2A9KA 4YMWA 2CJWB 3RDPA 3AKDA 2VP6A 4M1YA 1DBSA 2I1VB 3ADDA 3TAHA 4Q9JA 2D7DA 3KJEA 1IJEA 3EC1A 5KNDA 3K0CA 3P4XA 1E2NA 2V54A 1T5IA 4QKQA 1XD8A 3PUVA 2CLSA 221PA 2YV5A 3U2QA 2RHMA 3K0CC 5KOYA 2AXNA 3FFBA 1JAIA 1I2DA 2KWIA 3FE2A 1QHXA 4PQYA 4V0KA 2L0XA 1DG1G 2H92A 2D06A 2Z4RA 3K9NA 2QTVB 3W5IA 4ZDIA 4DLVA 1AQUA 4OI2A 5C4MA 1FNNA 1UBFA 1N0UA 4PFSA 4M1WA 5G3ZA 3C16C 5J4YA 4M1SA 1BOFA 2FU5C 1ZD8A 2NIPA 4URUR 4ZKEA 1KK3A 1ZNWA 3X1WA 4B73A 3NBYC 3CNNA 1TMKA 4LYFA 1WE2A 1JXMA 3C41J 2CL7X 1JI0A 2PEZA 2F55A 2ZE8A 3X1ZA 2G9NA 2RH5A 1PUJA 3DZDA 4CEIB 4MRSA 4KYUA 2PCLA 1M74A 3EWSA 1N0VC 1W2HA 5K8IA 4C2UA 4GZLA 1CP2A 1Q22A 4TLCA 1YRAA 3LXRA 3RS7A 4HAUA 3B9PA 2GZHA 2NO6A 2RCNA 4KFRA 4QBHA 4BRUA 2OZEA 1COWA 3U3MA 1T5LA 4P4UA 4CT5A 3HU1A 4JLBA 4TQ9A 4LGMA 1KI7A 5CB8A 2R6GA 1FL9A 1Z0FA 4KHZA 1VTKA 1UDXA 4P32A 2OEPA 2F7SA 4LJ5A 2IEYA 2R9VA 1YE8A 4LX0A 2GZAA 3EIHA 4RFSB 1E9EA 4HAWA 1OIVA 1XZPA 1IHUA 5FI0B 1XF9A 3B8HA 3L0OA 1ZYUA 3OESA 4TLDA 2IS4A 1KDPA 2ZRLA 1KI1A 4N0DA 3U4QA 1E1QD 1P7CA 2W0SA 2WZQA 2YWHA 3I5YA 2HJVA 4F7WA 5JEDA 3EZFA 1GG2A 1COWD 4PC6A 4ZPXA 1E0KA 1II0A 3T61A 3M0EA 4AYWA 1EFHA 3NTUA 3GLFE 3G82C 4HUQB 4IDQA 4NBSA 1ZAKA 3T1TA 4CEJA 3BORA 5DH9A 5GJVC 2XTNA 4HDOB 4Y0AA 2BVNA 3OIVA 3FKSA 1DOAA 4CEHA 3VKWA 4DBLC 5FTLA 1JR6A 2XZPA 5H8WA 1YU9A 2J0SA 4JVLA 4DT1A 2E1RA 1ANKA 2YHSA 1T91A 1G16A 3IGFA 5DGXA 1P2TA 2H57A 3C8UA 2IUUA 4FMCB 3CX8A 1Z29A 3CZQA 4AYXA 4ZIRA 4NU0A 1GL6A 4DSNA 1XEXB 3LRPA 5JSZA 2FV8A 2FZ4A 5E7IA 5C18A 4BPBA 5FOUA 3LQQA 5A4JA 1XMIA 2ZUDA 3HU3A 1GNPA 2ZU6A 3A1VA 2PLFA 721PA 3QY0A 1TQDA 1CJMA 3K0AA 2BCJQ 2AL7A 2NPIA 2GETA 4MYHA 2Z0MA 2B8WA 3VU9B 4CRWB 3B85A 1PLLA 3H2YA 3SBEA 4CZ2A 3Q5EA 1MR3F 3O47A 4UXJA 2BJVA 3FKSD 5IK2A 1SZPA 2FA9A 2G1JA 2AXPA 1A82A 3ICEA 2CK3A 4LJ4A 1ZW6A 3U6BA 4TLEA 5TVKA 1OFHA 1TEXA 3P20A 3BAFA 2IHBA 4Q5IA 2XSZA 1JBKA 4Q7KA 3GLIE 1OV4A 2WWIA 1TQ6A 2QSZA 4ZDKA 2J9RA 5EP3A 3QI2A 2YOHA 5JJIA 1RE0A 1GWNA 1SKYE 3H86A 1X1SA 3LY5A 3N2EA 4V0ME 3L0SA 1E9AA 1H65A 4DCTA 5EUQB 2ZJZA 1G8GA 1RRPA 1N6KA 4LZZA 1M34E 4KCGA 4P4TA 2Q9CA 4EAQA 4QC2A 3P26A 4UJ3A 4XWOA 2WAXA 1SVKA 2CK3D 5KSOA 1KSGA 5E95A 1OH6A 2QZ4A 4YONB 4TMTA 1RVDA 3AQ4A 4PPQA 2UZ3A 3CH4B 3LO5A 4CVNA 2FF7A 4D26A 1NN3A 1XEWY 3E70C 2BMDA 4C4PA 2VHTA 1UDWA 3CWZA 3IILA 4ESHA 5CK4A 3ZDQA 4US0R 1KI6B 4TSFA 4TL6A 1E1RD 5BYJA 1E2QA 2IS1A 5B30A 3I5XA 1E0AA 1YR7A 1HTWA 2QT0A 4P33A 1W7AA 1U8YA 3EPLA 2PX3A 2A5GA 3RC3A 1D2NA 1IXRC 4TT3A 1S1CA 2CL0X 3OFND 2GWHA 1NLYA 4DWJA 4EPTA 4DLUA 1ZD1A 4U7DA 5AWFC 3PUZA 2OILA 2IYVA 1XEWX 3GQBA 3QSYA 2J87A 1TF5A 3DM9B 4TSFD 4DIEA 1XPRA 3RS0A 3GP8A 1US8B 2J41A 2ZI3A 4DDUA 4M9XA 1YZGA 1KKLA 2EW1A 2GK7A 2A30A 1G8PA 1GL9B 2ZE5A 5CDFE 5BN3A 5JRZA 3PV0A 1HQCA 4ZCLA 1QBKC 4MGKR 2NGRA 2ZS8A 2FSFA 5FBRB 1OHHA 1KY3A 1KI3A 1T8UA 2O8CA 5L3QA 3FGNA 1Z2CA 3TKLA 3GJ0A 4F92B 2IT1A 4PTLA 4Q1EA 4NDZA 3RS5A 2DWQA 3VMFA 1E2GA 5IT5A 1Q44A 4LHVA 4K46A 5E4FA 4W7SA 1KJYA 2F9MA 2HF9A 4HUQA 2DCUA 2GEVA 3B1YA 4TMXA 1Z6AA 1E6CA 3SC3A 4BZXA 4GT1A 4QHTA 4EFMA 4P4SB 5GADl 3R20A 4DSOA 2ZRBA 2ZJ8A 4NYMQ 3BS4A 3ZZ0A 4BLSA 1TL7C 3OAAA 5IDVA 1G18A 1QHHB 1R5OA 2GKSA 3WBJA 2D74A 1G7TA 1Q21A 1W36B 2FPKA 2IL1A 2BM1A 1KK1A 2W6JD 4LBZA 4JYBA 3KKMA 4RD3A 2KSQA 2BBSA 2SHKA 5AJZA 1Z8FA 2EQBA 1OXVA 1Z22A 3DVLA 4LDJA 3BK7A 4PSAA 4U02A 2VQSA 3KFXA 4DXAA 5LB2A 2QU8A 2ZRDA 2H8KA 2NG1A 3CF0A 4MITA 1IN6A 3U3OA 2F6RA 1XJCA 3ASYA 3OAAD 1GKYA 2NQ2C 1EWRA 2IC5A 4C0BA 2I4IA 4M1KA 3GJ6A 1JEDA 2IX3A 2BEKA 4QHYA 5E7JA 3WYFA 1P61B 4A6XA 4HUTA 3FMIA 4L5BA 2ATVA 2JASA 2JLXA 3OEHA 4TTRA 1AIPA 3O8DA 1E79A 5JMTA 3G5UA 4US2R 3UPUA 2ZJ5A 3THXA 1SVIA 4IEEA 1Y3AA 1KJZA 1XDBA 1R2QA 4ACAA 3CX7A 2QMEA 521PA 1YKSA 1LS1A 3IQWA 3L8ZA 1XTKA 4NTZA 4URZR 3CIOA 1E3MA 3QBVA 1U0HC 1E0SA 3WY9A 3FHTA 1OIXA 1NJGA 1VG1A 2O8BA 4WIAA 1JB1A 2GJAA 3QEJA 1KKMA 1KO4A 3IQXA 1KDTA 1J8MF 2F43B 2J0UA 3TR5A 3TVTA 4G3XA 5F98A 1U8AA 621PA 3OEHD 3L0PA 4IJMA 3TH5A 1FTNA 3RC8A 1Z0IA 2MSEB 2ZQ5A 2Q21A 1SHZA 2YOFA 3K0SA 2AR7A 2YWFA 4C0JA 1GZSA 4AK9A 3CF6R 4LV6A 4O2RA 1DS6A 3QKRB 1Q3TA 3FVQA 3GLHB 2YKGA 5KPDA 2R6CA 4YMTA 2ZRAA 1BS1A 4RJLA 5ANRB 1Z28A 1G41A 2WIBA 1JR3A 3U7FB 1UKYA 3LXXA 3AKYA 3AH8A 5JECA 4MKHA 1SXJC 1AGPA 1YR6A 4X8OA 4AURA 3BH0A 3UK6A 1FMLA 2JLYA 1US8A 1CTQA 3A1SA 1L4UA 2VEDA 4L9SA 3X1DA 1KNQA 2IYRA 2OLKA 4KU4A 2QI9C 4LJ6A 4UNQA 2QP3A 3TUIC 4E5UA 2X2FA 4Q4HA 4EKDA 1E9DA 1M7GA 1XCPA 2QROA 2ODEA 1L8QA 4QRHA 3A4NA 1Q1BA 2CNWA 4I1SA 2B8TA 2ANBA 5LB4A 1VECA 4NONA 4WZAE 4TTQA 1HE8B 2PJZA 2YWEA 4DEXA 4HZUA 5FFMA 3RRYA 5KDOA 4URYR 1JR3D 2CCKA 4IKEA 4TN1A 2DHRA 3JVUA 1BYIA 4W5HA 4HAYA 3P32A 2J1LA 3OZXA 4Z8YA 2XXAB 1P2VA 1LFDB 3NH6A 1II8A 3OEEA 1E32A 3KJIA 2V3CC 3I92A 1H8EA 4Q9LA 5LPNA 4IOMA 4F91B 1G7CA 4XVUA 4HLCA 4PZZA 2NPFA 2CHQA 3SYNA 4JLVA 4KJZA 2O8DA 1EFUA 3V00A 4RZ3A 1NG9A 2BJWA 4P4SA 5FTKA 1E4YA 2QAGB 3GD7A 1HUQA 1ZCAA 2DYKA 2YVUA 4BFSA 3R9XA 1QVRA 3KKNA 4B3DA 2QP4A 1U9IC 5JWHA 2JJ1A 2XEXA 1L2TA 4M0LA 2BDTA 4OQLA 3OEED 1MRNA 3WHLA 1H8ED 2BKUA 2PMKA 3WNDA 2A3RA 2VBCA 2ZR7A 1G9XA 3AM1A 4E09A 2IXFA 3KKOA 2J3EA 3DMDA 2ZJOA 5FTJA 1AZSC 4PZLA 1N6PA 2ORWA 2WMOB 2BMFA 1XXHE 1XRJA 2VLIA 5KDLA 4U5XA 4YXWD 2JJ1D 4OQNA 4RD2A 4DRZA 3D7MA 3DHWC 1QVAA 1TPZA 2A2ZA 2GTPA 1QRAA 3OHMA 5AUQA 1U0JA 1W36D 3DEFA 1X6VA 2BBWA 3JZAA 4R71A 4R9UC 3MUFA 2AD1A 1HV8A 2X2EA 1FMJA 1DAKA 3BD9A 4UNRA 1Z6XA 2RGXA 1E9CA 4QJ5A 1OIWA
chains in the Genus database with same CATH superfamily
4YRZA 1GRNA 4FGWA 1GLVA 1KMHB 4A9AA 1Y3BE 5K0CA 1NASA 1CEYA 4YP1A 4DV5B 3OLXA 5IUNC 4RSGA 3DOHA 1J20A 2P91A 4MYCA 4ZAVA 4DE5A 2QLTA 4I2VA 2B7BA 3WQQA 1KDZA 4YR7A 3TSAA 5IM4A 4CE6A 2WAMA 3WIBA 5CEEA 3SVZA 1P8JA 1R0YA 1LTHR 2O2DA 1T9KA 2H51A 4JSTA 1NBMD 2YHUA 3G1UA 1XZBA 4FT2A 3SU8A 3K0KA 2O2ZA 4DANA 2DHEA 2ANCA 2BGNA 3S2SA 4O3FA 2BEUB 4C0KA 3O94A 5F7JA 3PGJA 4R8VA 2DJIA 4C7XA 1NXWA 4UATA 3QENA 4C7VA 3K0FA 4B85A 1IMOA 2ZPAA 4HFMA 1FFSA 1NUUA 3KR0A 1G4US 4K81B 3U3JA 4MSUA 1HZJA 3GP3A 3Q8WA 2JGIA 3GFPA 2P4HX 1MMGA 4HN9A 2DFDA 4KIJA 3LWBA 1C30B 4CLHA 1ADFA 2YXNA 4OGKA 3KOXA 3CF2A 5DM1A 1R00A 3LX5A 4QOHA 4BV8A 5JH7B 1OAOA 4HTAA 3IMFA 4XD2A 5K8VA 3V1YA 2CUKA 1FA9A 3FTEA 5CFRA 2QQ0A 3AM3A 2HRQA 3P0JA 3DEYX 4DLXA 3VH2A 4C78A 1TEVA 4Z49A 5JJBA 2BDEA 1ZXLA 3DTVA 2ORIA 1PJ8A 1V0JA 5TGDA 3LPNA 2VQDA 3IDFA 1B8OA 1NKVA 1P5ZB 3PUIA 2J9GA 5CVEA 2DT8A 5D7NA 2BN4A 2K2WA 1AE1A 1RI5A 5EJ6A 1Z45A 1YAJA 3GPIA 2XLBA 1XQ1A 2PPLA 4K05A 1NNSA 3OPYA 5FUVA 4YC7A 4MDHA 4ZQBA 4RPLA 4V38A 1PCXA 4R3WA 1UADA 3AINA 4BMYA 3HKCA 4N03A 4H18A 2QNIA 2I4OA 3IQZA 1SC3A 1TKCA 1VKNA 4P8RA 5KU1A 1APCA 4REQA 4YL1A 1XN1A 2CJWA 3I2HA 3PIDA 4FUQA 2P9QA 2X51A 4JUFA 1X1AA 2J85A 2GPYA 1PYGA 1IDN1 2RSLA 5JAZA 3WRXA 2XMPA 1P39A 4OHUA 1AK9A 4FC7A 2RHHA 4NMHA 3GO4A 4BC1A 4EFKA 4WAUA 4LJAA 4O0LA 3AKEA 4C87A 4AJJA 1W76A 2OYCA 2HNKA 4JU8A 1DC3A 4D3YA 3V42A 4B47A 1XA4A 1PFUA 3IAS1 5DI3B 4ENWA 3E8XA 1Z4IA 3T4UA 4NYIQ 4Z9XA 2MMCA 4QYMA 5JS7A 3M3HA 4KYVA 1T0IA 3WB1A 5LIPA 2MINA 5G3YA 5K3FA 4QD3A 4RF5A 1M5TA 4LE1A 1F8GA 3VU3A 3SZLA 1TMGE 4F38A 3V2UA 3B1VA 2IOFK 3GUZA 4GPD1 2GASA 1JHMA 1H2HA 4MQ6A 2GF0A 1AKWA 2EERA 4D9IA 4XAQA 3LCJA 3IUYA 5BNFA 4ZVNA 4OQFA 2Q0HA 1U2RA 4RBNA 4UAUA 4JROA 1DFHA 2IUYA 4NE7A 1U4OA 3SQMA 4F2DA 1EP1B 2IYTA 3DCJA 4MI9A 4PR0A 5H59A 3VAAA 3F0TA 3TIFA 1GFSA 4KWCA 5HKOA 1QO0A 1A9YA 1QKIA 4HDKA 5FAKA 3KCQA 2G25A 4S1TA 3ZU2A 1K7CA 1NY6A 3RFYA 4TYPA 1NQAO 2V7TA 3AR9A 4MO9A 2IBTA 3EOBI 1EH5A 4WGYA 4KPEC 1CUCA 3WWYA 5AUOB 2OSBA 2D8MA 4HV4A 2VAXA 4WXYB 2JL1A 3GL9A 3ZCXA 4AZ3B 4XLNF 1T6BY 2GEJA 3NVAA 3T4RA 1L7EA 4KXFB 2RKWA 2EVWX 4DNPA 4XLTA 1G63A 1YV9A 3KR2A 4LDRA 1HURA 4OJYA 1KQPA 5DTRA 2FPPA 3K9FC 4H7IA 2O20A 1TNDA 2FVYA 1F6WA 4FEGA 1QH1B 1OBVA 3QFTA 4R7TA 2FFQA 1SXJE 2O6HA 3FOPA 2A59A 1Z5GA 1ACMA 3P9RA 3DMTC 3RV3A 1HT2E 4U8GA 4OK3A 1OI3A 3S70A 1JDZA 1W4BA 3B2NA 3QU9A 1DADA 2Y71A 3T7SA 3DFZA 4JI6B 1YIAA 5TARA 4J2OA 1QTNA 4MCAA 4BVGA 3V5XA 4H1VA 4XOIA 4IIUA 4B33A 3BMCA 3ZWDA 5ICEA 2BEVA 3MTIA 4KQ9A 3S3TA 4X1YA 2DFTA 1JEAA 3O10A 3EIXA 1Z34A 2MDTA 4G24A 4L08A 3P27A 2ERXA 1FFAA 4DCOA 3ANLA 3Q3IA 4H59A 2EKDA 2OESA 2NVBA 1JI3A 3SYLA 2WU8A 5KYWA 1CIJA 2Y76A 2FOXA 5ALPA 1WULS 4MVJP 2QV7A 4DYDA 3OIYA 1EVKA 4G26A 5DBIA 2D00A 2FQWA 3GJ8A 1W4LA 4U7HA 1YF3A 4U2BA 4Y30A 4ONEA 1T6ZA 1QVXA 4AY2A 4K9PA 5JLAA 1Q3KA 3NHPA 1TKBA 1QGAA 1RT9A 1GNQA 4O2BA 4C43A 5EIHA 2HWYA 4Z0PA 1M8KA 3EGXB 4ZTUB 8LDHA 4WA8A 3Q1LA 1TT5B 2QL6A 1Y3FE 3GJYA 3W7VA 1RZUA 1M73E 4O7GA 3TXAA 3D54D 4DT1B 4IZOA 2Y1XA 3QNMA 4B6RA 4MS4B 3L7YA 4TS1A 3B82A 1VL0A 4PO9A 5MGNA 4XDGA 3ELBA 1E1DA 2OZKA 3SNKA 3OH8A 2ORVA 2P40A 4Y2JA 2WWXA 1R0BA 5I7OA 2I87A 4XB1A 3FOOA 1O96B 1XMXA 3KFVA 2BCEA 3BQMB 3STYA 2Y2VA 4JLMA 4Q4CA 1JFRA 3C8DA 1S3FA 3UMFA 5MFZA 4Z51A 4JCHA 2JG3A 2BPOA 1BQEA 2ODQA 4ZQCB 3UV3A 2DUUA 3BIWA 4XD7A 3VHRA 3ADKA 5A7GA 1JHXA 2R7RA 1TMYA 2G8LA 4JLAA 4MMXB 3CX4A 4RV9A 2BR5A 2WU4A 3OETA 3E9YA 1FMFA 5KDDA 1JBQA 3K1JA 4RKFA 4HJXA 2WSSA 3N6XA 3AVQA 2VA9A 3WA6A 4N5NA 4AVYA 3MGAA 1FIUA 1WATA 3D2CA 5CA0B 3N8GA 1VQ1A 2MHRA 3O4FA 3KPYA 4N48A 2HK8A 1T1JA 5BYAA 3ZWWA 3N87A 4FHCA 4L5AA 1V8FA 2PKQO 1MMFB 2QENA 4S0ZA 4NQRA 1YOVA 1NL3A 3B6MA 1H22A 2D1YA 2Z56A 4IH4A 2WFLA 5BUZA 2BUBA 3GMTA 1BX3A 4EEXA 5EE1A 3EEBA 4ULWA 1A95A 3NVDA 2N0SA 1ECLA 3SXJA 1FDVA 2ZUUA 1U3DA 1FTSA 5AHOA 4GNKA 2PR7A 2P6UA 3NHUA 2YXDA 4BMSA 3FWPA 4OKNA 1JHZA 2B92A 3DZGA 2PGIA 4QIHA 3SC4A 1Q2XA 3IQ5A 2OV8A 4WOCA 1R0SA 2MSWA 5E9QA 4UE6A 2VL7A 1YZFA 1VA4A 2OBMA 2XSZD 3N2KB 3LESA 4R98A 4YR9A 4TWJA 4HVCA 4YRPA 1EGQA 2BFEA 1QHEA 4C2TA 1IB0A 4FTWA 4KITB 1E4EA 4A3SA 3D4PA 5CJ2A 2XT6A 1QB7A 2OKCA 1LGYA 4D0GA 4MTOA 2ZSEA 2YL2A 2QLNA 1CY2A 3WHIA 2A7QA 2FMXA 1QFJA 2Y1DA 4KL8S 1UP6A 3VGPA 3A1TA 4PCVA 2ZREA 1FRZA 3NDIA 2XTAA 4Z4IA 1SBNE 3M6VA 4JBLA 3W9BA 4R9VA 5GIOE 4QWMA 4HN2A 5LNK1 1IVNA 3JZIA 3MWYW 5A0VA 3U81A 2FJPA 2XD4A 2JFWA 5EP1A 2QZSA 3NBFA 3DKVA 1M8FA 1OC4A 2P11A 1K86A 2EJWA 3BSWA 5CM2Z 2ZFUA 2MCFA 1L7XA 5BQ5A 4XI9A 3DEJA 2RGGA 4D0LB 5DP2A 1RLTA 1DTSA 3NNSA 4M88A 2C3YA 2WSIA 3ZCRA 1JU4A 1QV7A 1MIHA 4JJAA 3L3BA 3L4BA 4WGGA 1VHLA 1SR8A 3NYIA 2L81A 5BVGA 1M2EA 2VTKA 2HK7A 4O63O 2HB6A 3PVSA 1SEVA 2QN3A 4C7JA 3GEEA 2GM9A 1WBDA 3GJ4A 4MS3A 1GG8A 4JLUA 4QPCA 4JP8A 5EL0A 4AX2A 3LX6A 3R77A 4XIYA 5JG7A 1LVKA 3SJAA 4NU8X 4A2QA 3PK0A 4M63A 1SUCA 3CTMA 3H2GA 3IIKA 4YRIA 4HH1A 3RS9A 1TWCA 3WL8A 1XDSA 2H31A 5HRUA 2W70A 1VJGA 5BXQC 4TROA 5TPWB 3TW8A 5HUQA 1FXWA 2IYYA 1JR3E 1DAMA 3P96A 2V7VA 3R6DA 4DFDA 1F2UA 2ZTMA 2FR0A 1Q0RA 1MC8A 4AMZA 5HIMA 5B2FA 4FC6A 5B7GA 1RC8A 2OK8A 2N46A 2DBYA 5JAHA 3AVVA 3TLEA 1XHEA 2H18A 4DWOA 3GDHA 1QFMA 1G0NA 2WM8A 4DDMA 3BGSA 4NDAA 3TJRA 2QGZA 3W8DA 1FUYB 1IEQA 3VOAA 1G3IA 3KYIB 1WHTA 1I6KA 2R7WA 3K1ZA 2AGVA 3T34A 5CA1F 3BZUA 3OF2A 2P8JA 2V7QA 4Z7QB 3EDQA 1IZZA 3JAMA 4DR2B 2JJ2D 1GTG1 1GOTA 4F46A 4FIZA 4F84A 4PAWA 1T3HA 3SG0A 4N82A 4OGFA 3PEFA 1SYQA 3M49A 2QVBA 3CLSC 1A27A 4KQ1A 4LVNA 1Q19A 4RYLA 1KAGA 4HYYA 4RK1A 5M7EA 1OLUB 1PW5A 5FOXA 4N4AA 5E2QA 1P4SA 4W5JA 5D3MB 3F8TA 1OI2A 1RD4A 2OCYC 1E96A 3CNBA 1GFZA 3FOWA 2OB2A 1Z75A 3VVMA 4JS0A 2JDIA 1T25A 4XJSA 5A9RA 5EJ5A 2W2LD 1V1RA 5BVHA 4QEZA 2QX7A 1T5BA 3CT6A 1KO1A 4LRTB 1IJFA 5A4DA 4FB5A 4UMVA 1OKKA 1YZNA 3TQRA 4BNHA 4YK5A 4X61A 5B3AA 5THKA 3A3NA 4Z2AA 2QS9A 4NOMA 2C2BA 2FW1A 3EDCA 1B00A 3MF4A 1XAIA 3USZA 4XQ9A 2H4WA 3TD6A 3UT0A 2Y0CA 5AKEA 1J42A 2C4KA 4GDMA 3A9VA 4CODB 1Y1KE 3AKDA 4HY3A 4QBKA 1F0NA 3EC1A 2V54A 1OX6A 1OD6A 4QKQA 3I9MA 4WLFA 1NR1A 2FCAA 3AJEA 1HYGA 3GHHA 3CZRA 3CSKA 2H92A 1M76A 1QKKA 2QTVB 3FIUA 1F6DA 5C4MA 5IEJA 1RWOA 5F1KA 3C16C 4IWYA 4BP3A 5JZSA 4D5EA 3M4JA 2DQZA 3C41J 5ESWA 3BMXA 3DV0A 4QT4A 3LQ4A 1PZXA 1ADBA 1I80A 1Q83A 2QGFA 2XEDA 5A6JA 3B9PA 4PRLA 2NO6A 4P4UA 2FWBA 1IE3A 1L1FA 1K7YA 2F7SA 2H7YA 3L7DA 1QNFA 4QUDA 1ZO8A 1E1QD 1P7CA 5LCXA 3IP8A 3WHNA 1G2QA 3M0EA 4JRZA 1WTCA 2YHIA 1E1YA 3G82C 2QDXA 3HSSA 3V1MA 4EG5A 2IHTA 4PZDA 5GJVC 2XTNA 1P45A 4MJ3A 2VDRB 2E1RA 5DYTA 1P2TA 3CX8A 4YHHB 3HM9A 1V37A 1JFFB 2WYHA 2ZUDA 4MYHA 2OJQA 2NUTA 2DKFA 3F4BA 3WZMA 3HO1A 4ITUA 4IJQA 2PBFA 4DJEC 5HUJA 2XLDA 4F72A 5ADWA 4RTOA 1ID8A 2VUHB 3HVUA 3LDGA 2VRCD 1E9AA 1LLDA 4S05A 1HYEA 3N59A 3WOHA 1EVQA 3MLGA 3ZXIA 5EHQA 2BEWB 1FBTA 2OBBA 2FQ1A 1JLKA 2VHTA 3CINA 3CWZA 3DBRA 3N6RA 4YJ2B 3KB8A 1OILA 4WK4B 1Y6GA 2AJ8A 1ZDMA 3WC4A 1NLYA 4DR5B 2OILA 1J1ZA 3GQBA 5DJ5A 1VKRA 3WS7A 4ZCRA 3PNKA 5CDFE 4G2TA 4AO8A 1AH2A 1RBYA 1PNTA 5FLXA 2EP5A 3SCZA 2D0PB 1JJBA 3EDOA 3AXSA 3UMBA 1JEYA 2F9MA 3AIOA 2BMWA 1D2RA 3SC3A 3M6LA 1R9GA 4MW6A 1N2IA 1FFTC 3SEQA 2IUFA 3NAZA 1TL7C 3PRKE 2XE4A 2XKAA 3NRHA 2H2HA 2AUTA 2BM1A 4AW9A 3V2IA 2X0FA 3MZ0A 4MUFA 1NGSA 2VDWA 2HSDA 4ZFNA 1USKA 1TR2A 3FLAA 4DXAA 4ZC8A 2NG1A 3DXXA 5BUOA 4Q05A 4C0BA 4E12A 4EI8A 1JEDA 2A35A 5C7IO 3MUEA 1QU3A 1G38A 4CMCA 4IEEA 5DW3A 2Z2IA 3FF1A 1VG1A 3IQXA 1KDTA 2YV4A 3RT7A 3WDKA 1URPA 3MBGA 1IQUA 3EVEA 5JSKA 5L0DA 2Z8ZA 5K4AA 2BHNA 2YOFA 4M46A 2KQUA 4KXVA 5KPDA 2VNJA 1P7YA 2JZOA 3FYDA 5LA6F 2I80A 1GZ3A 3WGHA 3ON5A 1B43A 4HUJA 1PYDA 4DWWA 4QO8A 5AKYA 4WGZA 1OWNA 3UVEA 5BSKA 4HAYA 4JXJA 3R8XA 3U7QB 1P2VA 2RBGA 5FV7A 2C00A 5JBNA 3AY3A 4CMEC 2JAHA 1GGHA 5KQLA 4HNQA 1VMKA 5COBA 4H16A 4D3XA 1N5DA 3RJMA 4HMOA 5FTKA 1TM5E 3CZCA 1ILEA 2KW3C 1T4MA 3CAXA 1SELA 3S0XA 4JUCA 4OLFA 1M5UA 3MYIA 4AUNA 1MRNA 5DCLA 3QW2A 1G9XA 3L1IA 3P2MA 1WIWA 1AZSC 1GQQA 4YCDA 3GRRA 4CV3A 4UC0A 1LD3A 5DOZA 2V6MA 4YJ3B 1P1RA 2DFPA 2I0FA 5LQSA 1ADYA 2FMFA 5B3SC 1OIWA 1NYQA 3F2IA 1MFZA 4U7PB 3WMEA 3PQDA 1VFPA 2Q28A 4UXHA 1AO0A 1C4KA 3O6VA 5IN4A 3MX3A 4O4IB 2BR4A 3UATA 4G0WA 4OHZA 3MGBA 4PHHA 4XIGS 4OJMX 3GOHA 3VFDA 3S8YA 3HS3A 2AEJA 4TN5A 1YYXA 3GLFB 4EECA 5TB5A 1D2GA 4J1SA 3UK1A 4EHIA 1V11B 2QT1A 3T8YA 2EDCA 2QTGA 3R1IA 3PD7A 3FDZB 4UUQA 1WW8A 1DO2A 4OBEA 2QLFA 3A27A 3V2GA 3WZLA 2DUMA 3W4YA 3MPUA 3K96A 3AYXB 3M6AA 2QTHA 2VYNA 4FW8A 3FPBA 1N9GB 1JRLA 4IXTA 1N75A 4FHEA 3PL1A 1T5TA 3ZVMA 4F8YA 2SKCA 3UUEA 4RE5A 4U8HA 5IUKC 1C1YA 4RHFA 3GV0A 3ZJTA 4FIDA 3N53A 1YVEI 1QO7A 3UQZA 5JVDA 4REMA 1FVHA 3W8HA 4XVQA 2CVFA 3TIGA 2X8BA 3DS8A 4QTXA 4V1CA 4KAXA 4A0HA 2NYVA 1UJ4A 1NUPA 4LDKA 4BRSA 4QYSA 2IV2X 2GILA 2P75A 1G5ZA 1J8FA 1HW2A 1ZGGA 4MMZB 5CNJA 1ZP6A 1SUIA 5IASA 5AVRA 1J1IA 3E15A 3QRWA 3RUHA 1R4MB 3HMKA 1EG7A 3FGOA 3DAFA 3VBCA 1UXIA 2CDQA 3DWIA 3IEMA 1IN1A 3GBVA 3VSCA 1VCOA 3UGJA 2XIQA 1ISSA 3U1BA 5JYEA 5HIKA 5A69A 5LM3A 1QDLB 3QW1A 1R5ID 1BVUA 1QGUA 1WG8A 4E1AA 1J00A 1HQDA 5HRCA 2BFFA 3EVDA 3LA8A 5J2UA 4GNRA 1W34A 4S1PA 2CV0A 1ZJZA 3ML1A 3DLBA 3UK7A 1U89A 2XDWA 2ZUFA 2LDXA 4ECAA 4HOYA 3O4HA 5F5NA 3BWMA 4HRAA 2JLSA 1DWPA 4HAVA 1H1TA 3QJYA 2ISCA 4WJKB 3KB2A 1JU3A 1HTBA 4RY8A 5A1TA 2PP4A 2ZJYA 4KBFA 3RSZA 2V55B 2JFBA 3GEHA 3IPCA 3HBNA 3RJTA 4WNCA 4FCVA 4KGVA 3HL4A 4CLOB 1NTRA 2QUHA 3INYA 1OLSA 1T5SA 1KI8A 5AESA 1K3TA 5AKZA 1YC5A 3I1IA 3RKOF 1ZM7A 2HU2A 4REOA 4R2MA 5CYPA 1UFBA 3ZVRA 1YZYA 2RB4A 5KREA 4G4GA 2IE8A 2A9VA 2VYFA 2YRFA 3NDPA 1AKEA 3G1WA 3R6LA 4R05A 5EQTA 2CN1A 1LQUA 1AC5A 3KYDB 2A1TS 1J2JA 4GMDA 2WG0A 1VC2A 4KN5A 1S2NA 4P81A 4KLCA 4FGJA 4MAMA 4OI4A 4JGGA 4Q3KA 2WFZA 2QBYB 2NTEA 1WBBA 4QTZA 4KMOA 2AMYA 4ZQGA 2XYVA 1NYTA 3OWTA 5J5AA 4GP9A 4LBWA 4ZYZA 2PMCA 3N28A 4WN9A 2JBAA 4OHPA 1J5XA 3CB4A 1UK6A 3ZYZA 4RVCA 1UG7A 3AIMA 1E5TA 1U0LA 2G4VA 2X8AA 2FFBA 3VHQA 1DDOA 3W5VA 5K4GA 1L5QA 3HCWA 3EBLA 2HPVA 4KVZA 1DVRA 1BX0A 2AI2A 4FBMA 3AG3C 4XB2A 1NPYA 4RKWA 1B3RA 1L5RA 2FSVC 2LGJA 1DUSA 3CZ5A 1E85A 4EGCB 3A9UA 1WCYA 2R4TA 1U0EA 5DGTA 1VBKA 3L4EA 1KYZA 3BBLA 5JSQA 1OOEA 4G0PA 3QSGA 2TS1A 2WTMA 5B7NA 3EPHA 1VXOA 2P78A 4KFTA 3KAQA 4A4DA 3ZV6A 2R6FA 1QGYA 2HNAA 3T52A 1FTYA 3I8XA 1GDHA 1P7VA 3IEPA 3ZKWB 5CDSA 3TVDA 4IIXA 3OT1A 4AIIA 5HJEA 2ACVA 1LRLA 4AC9A 2OV2A 3AP2A 3RYCA 3MB8A 2OJED 3HU2A 4U7GA 2C95A 2IXTA 5JIBA 1J2UA 2ZYSA 1HQKA 1QGZA 2VCYA 3WMRA 2AFVA 2R2AA 1T34A 5M2QA 1K6MA 2FAPB 3KQTA 4KGDA 2HIMA 3UKOA 5CB4A 3FNHA 4AP9A 3E9MA 3ZIDA 4E31A 2WI8A 4M83A 2L18A 3JQQA 3EFEA 1FFGA 4X6LA 4BXOA 2EPNA 1K5GA 4NYMR 3T1HB 3MTEA 5FL7A 2IP1A 2DFVA 3JQ7A 5IKEA 4XCXA 3HO6A 4WABA 1SBIA 3LBNA 4XFKA 5EZYB 3DBLB 2ZJ0A 3PDIA 4J49A 1OYYA 2OXTA 3MTQA 4OA8A 5DKFA 5DHSA 1U9CA 4F6RB 4CSAC 1LBIA 4HP8A 4W8GA 3PNMA 1E60A 1PDVA 1UPXA 3CRRA 2ID9A 3VRCA 1WNFA 2AFHA 5I4IA 5GM2A 4XWJA 2DTXA 4WFJA 5GIPE 4INAA 1UM9B 4RFVA 5FQOA 4EJFA 3M5CA 3ZV3A 1QR6A 5A3SA 4PYKA 4B6IA 3ZNPA 3OZDA 3ZWAA 3D6NB 3I5QA 2SNIE 2Y6VA 3TTWA 5EHIA 2VT6A 1K4MA 3GUYA 2DFLA 2R751 1F2TA 2PLWA 4QJ3A 3N0VA 3PXGA 4KO2S 1CY4A 2ZYWX 3N24A 4ZV9A 3D6MA 3RC7A 3R7SA 4QQFA 3MT9A 2BGLA 1XZJA 3OLQA 5DX1A 4Q1CA 4XTRA 2KE5A 2TSYB 4URWR 3DAPA 1RLJA 3VX3A 3EIQA 4UAGA 3ENWA 4KAFA 4KREA 3U4QB 3A06A 1X1EA 1CUIA 4UQOA 1SH7A 4MQ9F 1RQGA 2IIVA 3W1VA 4Z4CA 3VGJA 2D2FA 1G55A 3QKUA 3VHXB 3ZPXA 4CF4A 3OU6A 4CEHB 2G67A 2IZOA 2JD1A 2ZJ2A 1DV1A 5AOBA 3EJNA 4B6PA 1KZ4A 1UWKA 1TTPB 3T7CA 1FMWA 3VO1A 3K9WA 1Q1GA 2PV0A 2Z2YA 1GP2A 3TRFA 1SHKA 1Z0ZA 2P2SA 2BMVA 1E66A 1WN0A 4NOKA 1R8SA 4YPFA 3QW0A 2FG6C 5B4VA 3U5ZB 1S89A 4TRNA 1RS0A 3D81A 3GVXA 1F0KA 4PN3A 3ZH2A 2V4UA 5EE0A 1MCZA 3MRXA 2X6TA 5KZMB 1II9A 1VLMA 3DQPA 4CM7A 2FSHA 1UC9A 3VPAA 1RZVA 3DZFA 4I1OA 2P9YA 5CFOA 1Y3HA 1V4AA 2JLVA 3ICOA 1LA2A 5A6BA 3T1NA 1JMYA 1YQUA 5CCEA 2QVYX 5FHQA 2QAJA 4G5QA 3JQCA 3OCCA 3NVMB 3WBKA 4CBVA 3ROGA 4P9TA 3HB1A 2FG7C 4EZEA 2ONCA 2WYVA 2MSDB 2R7VA 1QHYA 1Y8CA 3EWIA 1WV1A 3RU3A 3E3OA 3UGPA 2W2QA 1ONPA 1RJ9A 1MORA 3KKLA 1Z4QA 3DTYA 2ODPA 4OQYA 2B69A 2KQ9A 1RRCA 3E7WA 4GRIA 4EJSA 2QX4A 4FCWA 3NVKI 4IEIA 5TQ0B 2QE9A 2IYEA 4B3MB 1RJEA 2R6DA 1YL7A 1SCJA 3EZNA 3LBYA 1ZJWA 4YP6A 2IBMA 1SPBS 2J9BA 2XRZA 3U48A 1ZBDA 3W8FA 5CAEB 1Y1PA 2PX0A 2VC2B 4KO1S 1U99A 4IRMA 1ZXBA 3JQ8B 2AH5A 1Q0QA 1A5ZA 2QY6A 5L3SA 1OH5A 3SYKA 1TCCA 1I7DA 5TQVA 5H5JA 3UCXA 4DHWA 2AKYA 3IVGA 4BB6A 1NDQA 2OPHA 3WYCA 1UBMS 3BEHA 2HKVA 5BOSA 1NP6A 4GOOD 4UVIA 5ALJA 2Q2NA 5FLYA 2UZ0A 3ONDA 1M56C 2HH9A 2HQBA 2Y92A 1GGNA 4CF6A 2B82A 1MV5A 2GK3A 5EIOA 3E9DA 3WLJA 4RETA 4HZUB 5CEJA 5DIZA 4K6CA 5IP5A 4F4BA 2Q6KA 3JQPA 2L6GA 2I6XA 3WIUA 1E8NA 2OHGA 1MUUA 4PR9A 1KY4A 4LOIA 5EA2A 4UM9B 5K3DA 1OHHD 2ZRMA 1KSJA 1DCMA 3LVBA 1JIXA 5AHXA 4FBGA 3GRAA 1SBHA 4RVFA 3Q0EA 3A1CA 4GZ5A 2VKTA 3L7NA 4JBWA 1V6SA 2HDOA 3IV9A 5CK5A 2V59A 1W46A 4NZPA 1BRMA 3L84A 2FQXA 3O8QA 4P3YA 4XSVA 1F2VA 3FF4A 4EY4A 4Z86A 4G67A 4R9NA 3AERB 4PVCA 3AW9A 4XWKA 4HGQA 1C1DB 4I50B 1ZGCA 1UZMA 1OWPA 2CXSA 5T67A 3H16A 1UBSB 1M2NA 2M4EA 2AJLI 1KSFX 2R00A 2IXBA 3U9LA 1R10A 4NYIR 4ND1A 2JAQA 3BAZA 1UXGA 3U8PA 1FC0A 5AQ1A 5BWBA 1LIHA 3JWIA 3NFYA 4B5LA 2P2CA 4KBYA 2JFGA 3TLBA 1GNSA 4XUCA 1PKEA 3DF7A 5BYBA 2V9CA 3D8SA 2Y1LA 2OD7A 3DLPX 4ND3A 4LXQA 3OE5A 4MYTA 1X1TA 1GTMA 3QKSB 3Q6MA 3AG2C 3ZWIA 1P91A 3AW8A 3MCVA 3SYMA 1L6IA 1OYWA 3BEOA 4GI5A 3BOSA 4B5KA 2ZRHA 2GBFA 1AHNA 4D6YA 2DY1A 1AZTA 4OO3A 1E8MA 3IVRA 5FBVB 2WP0A 2NSDA 3F6SA 1XTIA 2G71A 3GEBA 4E3WA 1J7KA 2GDCA 1Y33E 4B4VA 5HCIA 2ZT5A 4KR2A 2BGKA 3K15A 4LF9B 1KQFA 3I39X 1ZH4A 3COYA 2EARA 5CD9A 2ZP1A 3R3YA 2QMHA 4DA7A 5GJWC 3TLGB 1GUAA 1W88B 2G0NA 1YQXA 2ACKA 3SHVA 3IBCA 2GPTA 4KNYA 1I4TD 1L5VA 1V16B 3P0RA 2A14A 2DQ4A 3OTOB 2Y1EA 4IJ5A 1U90A 5KKNB 1QO9A 5J40A 4OAOA 3TLCA 3C4VA 1G7RA 3PBKA 4PLFA 3W2IA 4UVEA 1D1SA 4M2LA 3E3LA 1L4KA 5IKXA 3GLHE 3THSA 4H7KA 4IYRA 5L3VA 5K0EA 4TTSA 2DFKB 3RRZA 4JI4B 1IY8A 4YFYA 2VP9A 1PTJA 3WGYA 4BX2A 1L7NA 2CWWA 2PLAA 3B8EA 4OOFA 4RZSA 1VE3A 1PQYA 4HDQB 1P1IA 4Y2SA 3B6ZA 1EAMA 3AY6A 5IJAA 3VM6A 1YDIA 2JGNA 4BUZA 2P9EA 3QVKA 2PMWB 1RI1A 3JD0A 4C1NA 1XTJA 2HRRA 1A9RA 3V9PA 3GRKA 4G4JA 4XVRA 2G77B 3TZQA 3OQ6A 2A9KA 1GKKA 2Q1UA 2F1OA 1WKCA 2D6FA 3CLHA 4K9DA 3B3JA 4E7SA 2W5UA 3RC9A 4AZWA 2D06A 1GUZA 2VQ6A 3WISA 1FRVA 4DLVA 1FNNA 1YB1A 2VB6A 4PIPA 4HX2A 1Q5PA 1M1NB 4DIBA 1KYYA 2G9NA 4G5HA 2EJTA 4RWZA 4O4HB 2DE0X 2WYUA 2A1IA 2GZHA 3TM5A 1P7PA 4F4UA 5K1ZA 1H3FA 4C4TA 1JDUA 1DKOA 2QF7A 3GEMA 3INNA 5BR8B 2C07A 1QRRA 3TM4A 1XF9A 4CV0A 4TVOA 3FBTA 1W25A 3UUGA 1IHOA 1HE9A 5D91A 3PSAA 1WZ2A 4DGSA 2ZCUA 4MVJH 3T1TA 2MHCA 3CUKA 3PGLA 4WJZA 4QFDA 4OP1A 4K87A 1JR6A 2OHVA 4L4SA 4ESOA 3JALA 3FBGA 4TXHA 2PMBA 3ANMA 3S2GA 3CLUC 5JSZA 4CFZA 4WQMA 2WIFA 4RVSA 3W5AA 4IV5A 3O47A 4UXJA 4JZAA 3OICA 3JXEA 1A82A 1PBTA 3ILXA 3SF8B 2E18A 3IMCA 5AT1A 1H6AA 2YFYA 3M9XA 5KJCA 1RRPA 2JCVA 2I8BA 5FDFA 2VDPB 5KNBD 2BSQA 2YYSA 3AQ4A 1SKBA 2Z2XA 3V80A 3N07A 5B3JA 1KI6B 3PWKA 5BYJA 1NJ8A 4QUIA 1E2QA 2IS1A 4YXFA 1YR7A 4RJJA 3BQ9A 1SUSA 3O2QB 1M1YA 5A5DA 2GWHA 4ZT5A 1NSYA 4J6FA 4QQ8A 1KU2A 2IEBA 1EGMB 1QPBA 4UBNA 1QLWA 1L7QA 5LZ5A 1SD5A 1VL6A 3A6JA 1ZYRF 1C7RA 2FR8C 4JP3A 4I4TB 3I1YA 2ZBVA 3BMNB 2GN4A 3LDHA 3OAAA 3WBJA 5JC1A 2OGUA 3R4VA 2IL1A 1DDIA 3W2GA 1BR4A 3QWAA 5K3CA 5HZGA 3DVLA 2V6BA 4R41A 1YR2A 2H8KA 5I7RA 1NR5A 1XR3A 2D1SA 3Q7LA 5IS2A 2FZGA 1AQIA 1GGEA 2YMQA 2ZIGA 4HNVA 4L5BA 1R15A 2DH6A 1NW6A 4Z0HO 2XVAA 4ZI7F 1I51A 3UPUA 2ZJ5A 2Z8YA 2O7RA 1R2QA 2FW6A 2QMEA 4QOGA 1HXHA 4LDAA 3I6ZA 2A9QA 1VSVA 1WQ3A 5IWAB 3WFIA 4X1IB 3JASA 3K0BA 2X6RA 1AGNA 1KO4A 3D6HA 1P2FA 1Q0KA 4V2IA 2GMWA 4FJ1A 1I6LA 4WT7A 5AVKA 4KACA 1NI4B 2OK7A 2DYSC 3MJCA 3SOZA 4H7JA 1OCZC 1RABA 3UJBA 3EZIA 3VVCA 4MP3A 2E49A 1OWLA 1CTQA 3EQ6A 2QI9C 4P82A 3G7NA 4KJXA 2QROA 2Y77A 2B8TA 5JAPA 2FMKA 3TF5A 3DE2X 2PJZA 2XUFA 2YWEA 3PXBA 3QMVA 2H4JA 1VHJA 3CJRA 4IOMA 2I15A 4P7FA 1NG9A 1QVRA 1JYSA 4GBJA 3N2LA 4Q7EA 2VF5X 4G37A 1PG5A 2IJGX 3LSTA 2ZR7A 2GCIA 2RC5A 4TXNA 4J91A 2HO4A 3AG5A 1D1BA 1IEXA 3AGUA 3NTQA 3FSJX 2A2ZA 3TLYA 1YUMA 4WX2B 1E3SA 3QKIA 4MUIA 2ECFA 4Y9SA 3K2IA 4K26A 1XOIA 2OCGA 2VF4X 4M49A 1GPJA 1QIFA 2Z3ZA 3ECSA 4G5SA 2VK2A 2P6NA 3D02A 4O2LA 4XEKA 1R6XA 4WOPA 2ZUSA 3TW4A 5C5EA 4GX5A 1YYJA 3A31A 1G66A 1NULA 4FINA 4IDDA 2X4GA 5DXJA 5EWJA 5B12A 3GPCA 2QTZA 1YR8A 5KWVA 5FNVA 1SBTA 3NASA 2H1HA 5I9NA 4TSRA 1M8PA 1KOJA 4KE6A 4M87A 5LD2C 4BQNA 2WHPB 4JXKA 1INLA 2WWTA 4NCKA 1UZUA 3K66A 4LWOA 3L41A 2PWPA 2BI4A 1RKUA 1DIOB 4TUYF 3RAFC 3KVRA 1R6VA 4ARSA 4OLHA 5DHFA 1RWPA 4BMDA 1UFQA 3UK0A 4OHVA 1WF3A 3DO6A 3EX7C 1JAFA 3REGA 4Y6OA 3C3YA 4W8PA 4N7MA 4TZ0A 3G9TA 4NE9A 2CNBA 1AVTA 1ADGA 1V41E 4DDTA 1BKDR 3C39A 1LLQA 4BVEA 2QR5A 4DXWA 3B9BA 3TG8A 4DF3A 5KYYA 3FNFA 3ZXYA 2G7ZA 3VNSA 5KTYA 1TYCA 1RXWA 4NR0A 4NDNE 1VL2A 2C99A 5JZ9A 3PKIA 3NJ8A 2QPOA 3Q9SA 4QDLA 2C2HA 3NJ4A 3F5FA 2R7AA 1CZHA 3ZHCA 2A78A 4N6GA 5HILA 1D3AA 2X2OA 2B4YA 5JJ5A 2J3MA 3KAJA 1RKBA 4M76B 5HV9A 3E6AA 4LSZA 3JZFA 2UYQA 1B8NA 5AM5A 1RXSA 5CH8A 4XRGA 5LP6C 5ILOA 5E7QA 7REQA 3KDPA 2Y4NA 1IN8A 4D96A 3VR5A 5AP9A 4ALNA 1ZUNB 5E6RB 1VJ5A 2HO5A 2BBTA 2NSGA 5JS2A 1G8HA 2ZI7A 2VZLA 3WAJA 4GKVA 4HNTA 4DMCA 3ZK7A 1L7OA 2WC1A 4YYEA 4PPFA 4Y98A 4FFDA 1PO7A 4UTNA 4P3OA 2IU6A 3M34A 1XRSB 1X94A 4XLZA 2MSNA 2J9FA 1YSCA 4QBIA 2VCAA 5EUCA 2ZRNA 2IKSA 4U4AA 4C5BA 3RPEA 1FFCA 2AWCA 4RO0A 4BQOA 1CR0A 4KN9S 4QHSA 4MUEA 1Z82A 2F3SA 3PR3A 3IPXA 4H1HA 4JW1A 1Y42X 3WWDA 3HB0A 1O5TA 2QY9A 3L0IB 4K88A 1P1JA 3EK2A 1R50A 3LVQE 4DYVA 3IA7A 2RHGB 9ATCA 5IJZA 1CETA 2R4UA 4R2IA 4ZYUA 4MRMA 3EARA 3OQIA 4Q1VA 4PYQA 1M7BA 4JGIA 3A11A 2VXCA 4PXAA 4EW1A 2SKEA 1RQNA 4S1VA 3NV7A 4Q9IA 2A8YA 2VCCA 4MV4A 2R6ZA 1CZUA 3BL8A 1V71A 3LT0A 4B7XA 3IUJA 2TMYA 3ZWBA 1N2JA 2F3PA 2X1LA 3U4MA 3SM3A 3ZWMA 1YB5A 5TY0A 1KDRA 4DRXB 4X0RA 1YZLA 2FUG6 3NDRA 2IWRA 1RRMA 5EHNA 4E0BA 3KMIA 4QM6A 4G1FA 5HCUA 1U4SA 3B1XA 3BFJA 3ASUA 1RYYA 4IHAA 1A7EA 3RSLA 4WPGA 4Y18A 3BJEA