3DM9B

Structures and conformations in solution of the signal recognition particle receptor from the archaeon pyrococcus furiosus
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
319
structure length
305
Chain Sequence
b'SMFGKLREKLKSFVKRVEEEVEKETVEIKEKDVDKALDELEIDLLEADVALEVVDALREKIKQKLVGKKVRIGTDKGKIIEEAVKEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTAGRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPILFVGVGQGYDDLRPFEKEWFLERIFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Signal recognition particle receptor
molecule tags Transport protein
source organism Pyrococcus furiosus
publication title Structures of the Signal Recognition Particle Receptor from the Archaeon Pyrococcus furiosus: Implications for the Targeting Step at the Membrane.
pubmed doi rcsb
total genus 105
structure length 305
sequence length 319
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00448 SRP54 SRP54-type protein, GTPase domain
B PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3dm9B01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3dm9B02
4Z1MA 3H84A 1UJ2A 4NYJQ 2F3RA 1GOTA 1XCGB 1T9HA 3CH5A 2VQSA 2VL7A 3I5YA 2WZQA 3QVVA 4UKDA 4B35A 4Q21A 1DAFA 2ZUDA 3RS4A 3TW4A 5KOYA 2MMCA 3KJHA 2J45A 1TQ4A 1GVNB 4I1SA 1AKEA 3AVWA 3F8TA 1ZM7A 4B34A 2A5YB 1FFHA 4Q9LA 4QG7A 4EJSA 3AVYA 2J41A 1VCMA 3UXMA 4P4SA 3PEVA 2GK7A 2V8OA 5F3WB 2IF2A 2HV8A 5DHFA 1T3LA 2IEYA 4UJ5A 3TBKA 3LVQE 1UKEA 6Q21A 3THWA 1IONA 1COWA 2F9MA 3T06B 3IQXA 3HU3A 3ZIAA 4OQLA 2NO0A 1XD8A 1OFIA 4M0LA 4DSOA 4D25A 2VHTA 2FNAA 2WTUA 2GKSA 2UKDA 5LPNA 2IS1A 1CR0A 4BRWA 4MKIA 1W47A 3SNHA 4DJTA 1H8HD 5EXTA 4URXR 3TVDA 1N5JA 4LUCA 1W4AA 3C5CA 2YWHA 4Z54A 3GLIB 1GRRA 2FH5B 1L2TA 1NJFA 2GA8A 1IBRA 4M9SA 4IHQA 4YDHB 4MYUA 2QAGA 5FL7D 4EPYA 1FNNA 4QGGA 4C7OA 1NSFA 4GOJA 3CW2A 4EPXA 2CJWB 3OAAA 2AWOA 3QPVA 4PQRA 4US2R 2ORVA 1VYUA 1QHXA 4DLTA 1D8TA 1NMZA 5J47A 2C77A 1E94E 3QNUA 4DCVA 1P5ZB 5AUNB 4PQFA 3IUYA 4UJ3A 5DE3A 3TIFA 3S1AA 5CIWA 4GT1A 4GMXA 5FOVA 5LB2A 2ZYTX 2REBA 1MV5A 1S9DA 2VP2A 2WPDA 2CK3D 4YDSA 1G64A 1XRJA 5KNBA 1ZUHA 3OIUA 2CL7X 3GEHA 5JS8A 4ITRC 2IWHA 2BJVA 1OE0A 5BXQC 1T3HA 1G41A 5EE3A 5AUOB 2ZI4A 4RD6A 2V54A 1OH6A 2ZR0A 4F92B 3CZQA 3DKVA 4QC2A 3L8YA 4LJ6A 4EUNA 1YKSA 2OCYC 4H9GA 1HTWA 3U5ZB 3FDIA 1XEXA 2ODEA 4XH9B 1AKYA 2CDNA 5CJPA 2BMJA 1FL9A 3SJCA 3OEED 5K8TA 1DADA 4Q66C 2D62A 2XOKA 1C4OA 4WXRA 1KDOA 3W3ZB 3GFPA 2CNWA 5HZKA 1NG1A 3H0KA 3I61A 2UZIR 4LHZA 3B6EA 2JLSA 4KYUA 1T0JB 4URUR 1G7SA 2VLIA 3CX8A 3WBJA 2W0MA 1Z29A 2WSSD 3JVVA 3M4YA 1Z6AA 2JAQA 3VTKA 1MOZA 3N5CA 4WIAA 1U8AA 4PZLA 5FUYA 4DSUA 2HF8A 1P7CA 2DWOA 1G8YA 1U90A 1N6HA 3BAFA 1YQTA 1YZUA 5E7MA 1GNQA 5FI0B 1OXXK 1UDWA 1XCPA 1Q57A 3O8RA 2ZI7A 1COWD 5EE5B 4TT3A 5CDFA 1KI8A 2YC4C 2ZRBA 4UNSA 3M6AA 5AJXA 2GF0A 3FWYA 2QMHA 2XJ4A 1RIFA 3CPHA 2EFCB 1PV4A 5FOXA 1N2CE 4OHYA 2HT1A 3VR4A 2G77B 4LDJA 2EWVA 2ZSBA 2IYWA 1ZBDA 5JI3E 1P3JA 2ZVQX 3EAQA 5D3MA 4ZKDA 1T4GA 2WIAA 1DS6A 4D0NA 2WKRA 1QHHA 1P72A 5BQ5A 1KZGB 3GJ5A 5JS7A 4EJSC 2ZUCA 4OI2A 3EARA 3GJ8A 2ZJBA 3WMEA 4TYQA 3RWMB 4AYTA 2ZJAA 3AQ4A 3DM5A 1WF3A 3FGNA 3PEUA 3ICEA 1IXSB 1N6IA 2RGCA 2VA8A 5IT5A 2WKPA 4Q4LA 4NHOA 5KNCA 1KO5A 2FFAA 4G5QA 4OK6A 2CHQA 1VYTA 1XMIA 1QZXA 4BRUA 2GK6A 5KHOC 1G4AE 1SXJC 2CLCX 2VP9A 3RRMA 3EIQA 1HEIA 5J4YA 1QHYA 1XF9A 4Q7KA 2Z4RA 1CF4A 5CJ2A 3TVTA 1KZ7B 1XXHE 2WMOB 2O8CA 2FN4A 2YVUA 3PENA 1NKTA 2ZAMA 4MKFA 1W36D 4M53A 2QGZA 2BV3A 3BBPA 1YRAA 1YHNA 4FWTA 1WP9A 5FBVB 2JGNA 5DI9A 5JBQA 2FX3A 3OEHD 4BFWA 2IXFA 5KDOA 5KUTA 1RKBA 2BCJQ 2V7QA 1T5IA 5CYOA 3TSZA 3AF0A 1ZM2A 3EASA 1KKLA 4TLBA 2P6NA 1UM8A 2DFKB 2G6BA 4HLQB 4RCYA 3TSWA 3U3RA 1GKUB 4Q9KA 2R65A 4M4SA 2B92A 3NH6A 1JR3A 5GJCA 4FMCF 3AEZA 3HU2A 2WAYA 1ZNXA 3ZJYA 5HE9A 2Z4SA 3LQQA 3U7FB 4NZYA 3ZVNA 4KV9A 4QKQA 3SC3A 1UEJA 4P31A 4N0DA 4TMTA 1YR7A 1OT3A 2HLDD 3O8BA 3P32A 3D3QA 1I2MA 2C9CA 3GJXC 4PHGA 4LYHA 3EZ7A 2NZJA 3D31A 4TLEA 3GLGA 1D9XA 1FQJA 3ZVRA 2XB2A 5H8WA 2QY9A 1Z0KA 2ZAOA 1UF9A 3W6NA 2DWQA 4DZZA 1WCV1 4R9UC 4Q4AB 1I4DD 5JZVA 4BECA 3CX7A 1OF1A 1WB9A 1KHTA 2R9VA 1DAMA 4KJZA 1KO4A 3GCGA 1NBMD 1GNRA 3C16C 1E4VA 3KX2A 5B64A 1JPNA 3RWOA 2RGNA 2RAPA 4Q48A 2BHRA 3PEWA 1XPOA 4CEIA 3P4XA 4AC9A 3FKQA 3QKUA 3RAPR 2GDJA 1C9KA 2BBOA 5KSPA 4BUJA 4FWIB 4HAWA 2ODBA 4QHYA 2YOHA 4QL3A 2QT1A 1F3OA 1KI2A 1G3UA 3CO5A 4KXFB 4TT3D 621PA 2JLUA 2IL1A 2OSBA 4B3GA 5L3QA 2O52A 3RRYA 4A2QA 3THXA 5JLJA 1DVRA 1YVDA 2O8DB 2G0TA 5FL3A 2YZ2A 1IN8A 1Z06A 5K8UA 1OXSC 4A1FA 1QHHB 1X8KA 3F0TA 3W3AA 4D6PA 1VHLA 1FX0B 1EFUA 2QG6A 5A4JA 4URZR 4XOIA 3BB1A 1D2NA 3RC8A 2JEOA 3LAWA 4I1OA 3AVTA 1DAEA 1G18A 2XOKD 4TYNA 4M9XA 1AM4D 1U0HC 3E1SA 2O0KA 1RFLA 1VG0B 3OEEA 1WXQA 3TUZC 3C7KA 2LWIA 3BORA 4WVFA 4B74A 2JLXA 2QP9X 3IBGA 4DHEA 4DLZA 3LRPA 4RVCA 1N6NA 1KI1A 3ZD7A 3R9WA 2WWWA 2OE2A 1X1SA 2QAJA 1KY2A 1YRBA 2AFIE 1SXJB 1A82A 2QSYA 4TL6A 3QUSA 1E0JA 1HQCA 1N25A 2FZLA 2J7PD 2IYYA 1Z28A 1XMSA 5FFMA 3WY9A 3MWYW 3HR8A 2ZJYA 3BWDD 2WJYA 1H8ED 1MO5A 1XDBA 3T34A 4LCBA 2VYFA 4B2LA 1ZD8A 3KJGA 4A0FA 4Q1CA 4C0KA 3P20A 1R0XA 3WNCA 3GLFB 4JJZA 1VIAA 2FSHA 2ZUBA 2QM8A 2G1KA 2Q9BA 5JWOA 1TEXA 4JBWA 2VP0A 3LD9A 1N6RA 3K09A 4Q02A 3R8CA 5JJKA 1G6HA 4HDOB 3RANA 4V03A 2CL6X 3OAAD 4EPTA 4JLNA 3SQXA 2ZE7A 4QBGB 3X1ZA 4MGYR 3T12A 1VCIA 3L82B 3QEJA 4N0EA 1P6XA 2EVWX 3SN6A 3GJ7A 2QE7A 4EDHA 3FTQA 2JLRA 3EWAA 2AXPA 4LV6A 1P9RA 2F9LA 2OFOA 3OHMA 4CDGA 5GJWC 4KITB 1H8HA 4XVQA 2ORIA 4R2HA 4F4JA 1KO8A 1SXJE 2WAXA 4B2IA 2XZLA 3FB4A 1IQPA 4RD0A 4EPRA 1E2MA 3QKSB 1Q1EA 3QF4B 4OI1A 2QP4A 3MRSA 4MUBA 2OUKA 4NDZA 4GZLA 4TYYA 1NF3A 1Q20A 2FGKA 5KSZA 3DZ8A 3W90A 2NOAA 5CLQA 1E2JA 3A1WA 2JLZA 3BH6A 3IDQA 3ND8A 3T1OA 1E9CA 1MABB 1RVDA 2GCOA 2D06A 3TK1A 1AQUA 1K8RA 1Z83A 4I99A 4NONA 2B7BA 2FV8A 4BLOA 1XNJA 1GNPA 2LKDA 3BB3A 3VKHA 5C18A 1W36B 2R6AA 1KI3A 1QG4A 2H16A 2RGGA 3U3MA 5A5GA 4DWJA 1IY1A 1GM5A 3MLEA 2ZRNA 1RW4A 1S1CA 1VDZA 2BJWA 3B2EA 3H2YA 3R7WA 4Q5IA 3THOA 4CT4B 4O3MA 4P4TA 1E32A 3AGQA 1HA3A 1R2QA 4GI7A 2ZROA 3FKSA 3THWB 1NLFA 4NCJA 1E99A 4NPHA 4BZPA 3B9QA 1B0UA 4C0HA 3SFVA 1KK2A 1LVGA 1UBCA 2BOVA 1W49A 3Q7PA 4PPFA 4MKHA 4OL0A 1OB5A 3I3SR 1KI7A 2MSDB 3AF2A 3DKPA 3UMRA 2FOLA 2ZIAA 4DIEA 2H1LA 1XTRA 4JT2A 2RHMA 4HAZA 2ZJZA 4YXWD 5FPSA 1VTKA 5D3QA 3MWKA 2VTKA 1IN5A 1SKYB 2A2ZA 1N6KA 1CS4C 3FHCB 4DDTA 3HPRA 5CK5A 4QBFA 1N5LA 4IFBA 1CTQA 4M2LA 3FHTA 4A8JC 4LYAA 1E2GA 2IYZA 3GLHB 2RKOA 2WBLC 2W2XA 2XJ9A 3VHLB 3ZVLA 4B6FA 2H5EA 1Z0AA 1II9A 4Z8XA 3O8CA 1EFRD 2HDNB 4KODA 4RD2A 3MG9A 2JIZD 5HCIA 1DAGA 4F91B 2GVDC 3GJ3A 4MUAA 2QEQA 3AKCA 4OJKA 3QE0A 1ZIOA 4D82A 4BZXA 2R6GA 5K8IA 1XXHB 4GFDA 2F43B 3W5JA 4ZDIA 4LC0A 5JEDA 1EWQA 3S1AB 1R10A 2DHRA 4IOJA 1G7CA 2D3WA 4TL8A 4QHTA 1R8QA 1W0JD 2EWWA 5LD2B 2BMFA 2XX3A 3I1FA 1OSNA 4ZDJA 2CLSA 3NBZC 3OIVA 5AJYA 3T35A 3LW8A 4XIGS 4LRWA 1DAIA 1EFRA 5CM8B 1CKEA 2A5FA 1FOEB 2F1IA 4IKEA 3G0HA 1ZCBA 1SQ5A 4O25A 2J46A 1UKYA 3EXAA 4BWYA 1M2OB 1DELA 1CJTC 3L0IB 1HH4A 2QTHA 4QRHA 5EXSA 3RYTC 2E9SA 1H65A 4IDQA 421PA 1M34E 2C2HA 1P73A 2DFNA 2DB3A 1ZVQA 1NLZA 5IHPA 4KVAA 2GETA 4ZCMA 5J4LA 2ZRIA 5JWRA 2ZQ5A 3PEYA 5GADl 1E9DA 2GAOA 1TTTA 4Q4JA 4RZ3A 3T1VA 1EG7A 2WJVA 3HYTA 2V3CC 2ZREA 3AV0B 4YXWA 4B3CA 4ASUD 2EU8A 1WE2A 1JR6A 2J59A 5BYJA 1O3YA 721PA 2ZSDA 3GFTA 2W6JD 1M7BA 3VKGA 2JCSA 2IS4A 4PO8A 3GJ4A 2HXSA 4PQYA 3VU9B 1Z0DA 3GJ0A 5J40A 3Q85A 3U3KA 4UXHA 3WXMA 2RMKA 1FUUA 1KDRA 2FWRA 3QXJA 4RY2A 3GEIA 2GJ8A 3SBDA 5GJBA 3R8FA 4OKSA 4QJ5A 2QAGB 5DISB 4DCUA 5L3QB 1PLKA 4C7OB 4YMTA 3A8TA 4WXPA 5FH9A 2EQBA 1R0WA 1J2JA 4IVPA 2ZRMA 3QKSA 1X8LA 1EXMA 2MMGA 2I4IA 4YLGA 3B1ZA 4A2WA 3QQ5A 4G5GA 4DVGA 3I8XA 4M22A 4ZIRB 3U44A 2WWFA 3KQKA 2ERYA 1F5NA 2JLWA 3GEEA 4LJ4A 4CW7A 4PANA 4NKRA 1JQLB 2IXEA 3B85A 5E7JA 2AK3A 1PUIA 3NBXX 2NMVA 4AKHA 4UQOA 1PUJA 2ZSAA 1KNXA 2J7KA 4JJKA 4KBFA 2GESA 4M1TA 2JLQA 1NVUQ 2ZEJA 4AKEA 1DBSA 2BKUA 1M1YE 1FQKA 3ZGXA 3FFBA 3OFND 3LX5A 1IOZA 5M04A 1UEIA 3U7GA 4EQ6B 4PC7A 4LZZA 4A0GA 2ZS7A 3SJZA 1Z47A 2D4HA 4YMVA 4K81B 1XTQA 1QF9A 4V02A 4JIMA 1BO6A 2ZI6A 3B1YA 3AP1A 2WOOA 4X8LA 3W8RA 5G41A 4BZQA 1XPUA 2HCBA 1TNDA 4FINA 4W5JA 1W7AA 2N42A 3PFIA 3ND9A 3TNFA 4B3XA 2XTMA 4W7SA 1FZQA 4PAOA 1ODFA 2CCJA 2OBMA 1EX6A 2XNDD 4M21A 2PT5A 1F2TB 5JCPA 4MGKR 3TR5A 5EXPA 2CLDX 4FMBB 2QTVB 4BFZA 1OXVA 4AURA 4KYIB 4HZUB 5KU1A 4M1WA 2HYIC 2H57A 3K70D 5JJIA 3K0FA 2JDIA 5FUVA 4LV8B 4LBWA 3KL4A 5DN6A 1J90A 4URYR 5G40A 2R2AA 3CR7A 3REFA 4WW0A 3SS8A 2IWRA 2NZ8A 2A5JA 1RRPA 4LOAA 1NNEA 2V6JA 1JJ7A 3LY5A 4BEJA 2AR7A 2QQEA 2AHOA 3EPLA 5FOSA 1MO6A 5HE8A 1AJEA 1IY2A 1US8A 2C9YA 2OCPA 3K0AB 4PPGA 2WWYA 3KDSE 3PXGA 4IOMA 3GLGB 1RPZA 3IO3A 4OI4A 2AK2A 3QXHA 4G0NA 5FI1B 4FN5A 4LYFA 5HR5A 2NPIA 1NVXQ 1RRGA 1KO1A 1XMVA 1BS1A 4II7A 3N2EA 3CIOA 1NI3A 3KXKA 4D0LB 1B23P 2ZR7A 2GCOB 1Q1QA 3BFKA 1E79A 2P5SA 2QA5A 3QPWA 3CNNA 1PZNA 2L0XA 4CT5A 2RGEA 5JHGB 3C41J 1TUIA 3MJHA 2ZSEA 2HXYA 5TMPA 4TQUS 1XD2B 3W6OA 3TUIC 1D2EA 1OKKD 1E1QD 1EFHA 4LJ7A 1Q1ZA 2BEJA 1ELOA 4OJQA 2ZRAA 4TTRA 1KI6B 4CYMA 2XTNA 4PTLA 3K9HA 4NCIA 5E95A 4JVLA 2J3EA 5FPKA 3NEYA 4MKGA 1G8HA 1C1YA 3K0EA 3WMGA 3AF1A 3A1VA 3THYB 2GXQA 2BMEA 2JJ8A 1QDEA 2BWJA 1NKSA 2Z0MA 2ZJOA 1HE8B 2F1HA 3CF2A 2YOFA 3A1UA 2KI5A 4E22A 1YR8A 4A4DA 2H18A 4JZKA 3LLUA 1OHHD 4Q1FA 2H8KA 1JQJC 1IN6A 1E2DA 1E1RA 2ZE8A 3MFYA 5EUQB 5HPYB 1BYUA 2YYZA 4EIWA 2OCBA 3LA6A 5C46F 3WP1B 4NCKA 4ZCIA 3TRFA 1W0KD 3WMFA 3MUFA 5EP2A 3IO5A 4C3ZA 1ZYUA 4E5UA 2V55B 4IFEA 2FSFA 4NYIR 4JL8A 1N6PA 2ZE6A 2OXCA 2KWIA 4P32A 4UNNA 5JCZA 5L3SA 4F7WA 4QNRA 2A9KA 1G7TA 4AKIA 4M1KA 5DHAA 2GXAA 1JB1A 1TF2A 2NO1A 4TSFA 3NBFA 4PO9A 5F98A 5KSYA 1F2UB 1E9RA 4M1SA 4BLPA 3K1JA 2H7VA 4Q4HB 3QEOA 1ZJ6A 4MYHA 1I2DA 2ZYVX 3RSLA 5ANRB 5KNDA 1DPFA 1E0SA 4KI0A 1KIMA 3ZZTA 4ZI3A 1A5TA 3NXSA 2GXUA 2IXGA 5FOUA 1KAGA 1R4AA 3EZ6A 5DH9A 5J4KA 1AQYA 5FBLB 1BMFD 3CUEF 5DIFA 1W44A 4M1OA 5JJLA 3K9LA 2OZEA 4HLUA 4PAQA 1MRNA 2V7QD 2VRWA 2X19A 4E07A 4EKDA 1AS0A 3CF6R 2AN9A 1WBDA 3K9NA 4PSVA 2D7DA 1BMFA 1I4TD 4YMSA 5H70A 3B13B 4JBYA 4IXNA 3VNUA 4LJ9A 5FPTA 3SI7A 1XD2A 3CRVA 2WJIA 3V00A 2ECKA 1F6BA 3ADCA 1ESMA 3B8HA 1OYYA 2ZYUX 2GWHA 1NP6A 2IYQA 3OE7A 3PJRA 1DAKA 3CLVA 2NQ2C 3AVVA 4TSFD 3WP0A 4ARZB 2FJUA 2Q9AA 1GITA 3KTAB 1FW6A 1Q1BA 3CBQA 5TV2A 1XFAA 4RD4A 4MRVA 1XZQA 1MO4A 2GRJA 1G19A 1SXJD 4BFYA 4A6XA 1YU9A 2OLKA 1W0KA 1FPMA 3D6TB 5CK4A 1UBFA 1XJQA 1DG3A 1N6OA 1IXZA 2IBMA 4Q9IA 3BIFA 4EPVA 1NJGA 4GP6A 3RVBA 1E1RD 3VR6A 5P21A 1OHHA 1KO7A 3I5XA 1LTQA 4A0HA 5AUPB 1MH1A 1XBTA 2BMDA 3IBYA 5C4MA 1J7KA 4WZAE 2YKGA 3IEUA 3NC0C 4M1YA 4LHYA 3GJ6A 2VBCA 2WM9B 5AK0A 2J87A 1LS1A 1P2SA 1VIYA 3B78A 3TJZA 4D4KA 3U6BA 2IUSA 2NG1A 4O2LA 1R7RA 4KO8A 4HUQA 2CJWA 1G3MA 2NTYC 4HATA 3HR7A 4N1AA 1OKKA 1E1QA 3DO6A 4BLRA 3GPLA 2Y8EA 2J0UA 1OIVA 1YR6A 2W58A 1TMKA 1K5GA 4ZDWA 2H92A 3LNCA 4FMDB 2F1RA 4US0R 4OHZA 2QMOA 1T0HB 2Z6VA 4LJ5A 4PPNA 3SEAA 1SKYE 1W48A 1EFTA 3HYRA 2NPFA 121PA 2QRNA 1MR3F 4A9AA 3THYA 2X77A 5BYKA 3FPAA 4IOKA 3WNBA 1MABA 3JVUA 4U7DA 1NIPA 3F5FA 5KO2A 4JLVA 3I92A 2PX0A 2D74A 1WA5A 1RJ9B 1M7GA 1G20E 2IEZA 2A3RA 2N1BA 4Q1AA 2B8TA 4GL2A 2DWPA 4LBVA 2FFBA 3QSYA 3QIAA 4Q4AA 2B8WA 3U4QB 4TYWA 1LS6A 4OHVA 1IY0A 2PZGA 3C5HA 4R98A 4JBXA 2VP6A 1BKDR 1FTNA 2UVQA 2W6ID 3AUXA 1Z5ZA 4FI3C 4C0LA 2IYXA 1BIFA 1ZRHA 3GMTA 1R8SA 1OYWA 3IPXA 1JR3E 3P26A 4G5SA 3UWOA 3RLFA 2V9PA 1NMYA 3Q5DA 1SHZA 1L4UA 4DB2A 1QHIA 2CK3A 4KCGA 2A5DA 1PLLA 3KUCA 3BERA 4D80A 2JDID 1BYIA 2C95A 2VP5A 2F1JA 3CONA 5JFGA 3UPUA 1OH8A 2IYSA 4QOSA 2IA5A 1XXHA 2RGXA 1KK3A 4S2EA 2D7CA 2ZI3A 3U7HB 2OILA 2RGAA 3DOFA 2IYVA 3IIJA 4A2PA 2C78A 2Q21A 3N70A 1DAHA 1S9HA 2XNDA 3LO5A 4NBSA 4GNKA 4AI6A 3OESA 2WJHA 4TZ0A 2TMKA 2P2LA 3A4MA 1HV8A 3BB4A 4M8NE 4I4LA 5B30A 4JVNA 1GP2A 4BEBA 4QM7A 4AY2A 2GJAA 3V4RA 5TXGA 4JKIA 4RSGA 5FL7A 4ZCLA 5JSZB 3QOFA 5L3VA 3UKDA 1PVOA 1TU4A 4V0LA 2PCJA 1UAAA 3ZZ0A 2GILA 1W4BA 1S2MA 2ZANA 1R0ZA 3QPUA 1DARA 4XVUA 4HAVA 4DRZA 3QENA 4EPWA 2QUZA 1ZM4A 4DLSA 1SVLA 4JLBA 4JYCA 3WYFA 2BIFA 2VIIA 3KKQA 4HUQB 1OH5A 1G1MA 2CCGA 2DR3A 3FE2A 3KQUA 1WBBA 4QGAA 1ANKA 2JJ1D 4LBZA 2GZDA 4NU0A 4TYPA 3ZQJA 4DB4A 4L15A 1GL6A 1XZPA 1XX6A 1YZQA 4DLRA 1OXUA 3NVAA 1TU3A 3CH4B 1NN0A 4HB2A 3ZIAD 3VNVA 4NYMQ 4ACAA 1JEEA 3ZH9B 3EW9A 3EPHA 3CRMA 1OH7A 2PT7A 4ARZA 2NO6A 4QJ3A 2ZRJA 1R5NA 3LBNA 4IVQA 2K5UA 3GLFE 2ANCA 3GLHE 1Q0UA 2QU8A 2BEKA 2JATA 3UG6A 3KZ1E 1G8GA 4DCSA 1HYQA 2ZSFA 1G9XA 5SZHB 4AWXA 3IGFA 1HURA 4QHSA 821PA 1Z0IA 4GOXA 3E2IA 2GCNA 2JASA 2YWEA 1ZNZA 2O8FB 1LNZA 4CF7A 3A37A 1J8MF 3ADDA 4TL7A 3K0CA 3H4MA 1KKMA 3EPJA 4MGIR 3OF5A 3SU8A 2SHKA 3Q9LA 2P5TB 2RGNC 3TUJC 1U0LA 1WDTA 1DEKA 2PH1A 4PSKA 2DYKA 2WWHA 1ZNWA 1S3GA 2OEPA 4HAUA 2CMKA 4IVRA 4LV5B 1DO0A 2FSIA 3EA0A 2J5XA 1VMAA 2REOA 5CIQA 5DYGA 1U9IC 3QKTA 2W6JA 3B82A 2QBYB 5EQTA 3CF0A 5FPYA 1RJ9A 1MO3A 2V1XA 2VP4A 3T5DA 4MRSA 2P67A 1S96A 5EP4A 4ASUA 1K5DA 1OFHA 4URVR 4D26A 2CL0X 1CXZA 4Q4HA 3BOSA 4O0MA 1HT2E 3B1XA 2B6HA 2QQ0A 3TAHA 2ZE5A 1CRQA 5K8LA 3DVLA 2WV9A 3NHBA 4UNRA 4RKFA 4DLUA 4HLCA 3QVUA 4F4IA 3AF4A 2CXXA 4YONB 3AP2A 3CNLA 3ZYCA 4MITA 5DI3B 3CNOA 4TZ6A 4URWR 3B9PA 3G5UA 3BJIC 1X1RA 2IS2A 2C9OA 2ZU0C 3WYGA 4AIIA 3FMIA 1NBME 1Z6GA 4A15A 2W83A 3AKYA 3W6PA 1KK1A 1TPZA 2HCJB 3NDBB 3BXZA 3LX8A 2V6IA 2JIZA 5FTMA 3TR0A 4BGDA 4X8OA 4HSEA 4AD8A 3QF7A 1T8UA 2B7CA 1NVWQ 3BH0A 4WZ6A 1GILA 4KFRA 3TE6A 2YINC 3DHWC 1U0JA 5LBIA 4PZYA 2YWGA 4C0BA 4P33A 4RZ2A 1G16A 1P62B 2C99A 3Q8XB 5J4HA 2Z5FA 1X6VA 3THXB 3DZDA 4TWZA 3EZ9A 4X8HA 2BDTA 1JXMA 3R20A 3U3JA 3LXXA 2OAQ1 4PC2A 4A0RA 2EYQA 3GFOA 4XD7D 1KI4A 3EWSA 4V0KA 4B48A 2E1RA 2R44A 4I1VA 3AP3A 4LC1A 2X8AA 3Q5EA 2QRZA 3SJAA 4NCHA 3KB2A 2QMEA 2RGBA 4H1VA 4TMVA 2QL6A 1G6OA 1NLYA 5G3ZA 4X8MA 3WRYC 4IOLA 1JECA 1SULA 3D8BA 2PZEA 4ABYA 1MKYA 1JJVA 2Q3FA 3E5HA 1R6BX 3FKSD 3SHWA 3A58B 5HKKD 4F4CA 1G5RA 1U99A 1ZC4A 4R71A 3LDAA 2XSZA 1AZTA 4LGMA 1XEXB 2PEYA 1GUAA 4HB3A 4K8OA 3Q7QA 3B1WA 2H17A 1T5LA 1OW3B 1NVVR 1KK0A 3NTUA 1M8PA 3VX3A 2O0JA 1AGRA 4G1UC 4LJ8A 3FMFA 1P2TA 3A1TA 2GZHA 3OIYA 4WA7A 5C1BA 5FTNA 3NBYC 4NL4H 3Q72A 3UK6A 2WWIA 2CE2X 1KAOA 2CBZA 2X1VA 3RHFA 5JMTA 3ONWA 4MQBA 3EIEA 3AB3A 5IF9A 4DT1B 1Z07A 1P75A 1VG9B 2LKCA 2VSOA 2VPPA 1LF0A 3U7EB 3VR2A 3K8YA 4K46A 1CRPA 3ZS8A 3AGPA 1P4SA 2HYDA 2W2VA 2OBLA 2JJ1A 4IRUB 4XSHA 1Z3IX 2XB4A 1LW7A 2FU5C 1R0YA 4GOKA 1S0UA 4DEYA 4CGZA 3EX7C 3I72A 4ZDKA 4Q19A 1LB1B 2Q9CA 1FX0A 2QE7D 2G3YA 2OO7A 5G3YA 1CJMA 2EYUA 4EJSB 5AJWA 3W8NA 4DCTA 2QBYA 4RFSB 3RDPA 3GLGE 2PEZA 4B32A 4V0ME 2G83A 4W5WA 3U3OA 4POAA 2FDCA 5JRZA 2GNOA 3J81k 1E69A 5CB8A 2F6RA 1U2RA 1SVSA 2AKYA 1CULC 1CJKC 1AK2A 521PA 1FNMA 2OT3B 1KI9A 3QG1A 4ACBA 4PO1A 1JXOA 4M9QA 5FBRB 1J70A 3V9PA 3I62A 5JHHB 2PX3A 3HU1A 4DEXA 4DLWA 5A0FA 1CR1A 1NVVQ 2AX4A 3DOEA 1G8PA 1OV4A 1GZSA 4LX0A 1E4YA 4BFXA 3CX6A 1E2KA 2J7PA 2B21A 4FIDA 4B2PA 4KU4A 3ICQB 3FYHA 1Z8FA 4UNQA 2C03A 3RABA 3WHLA 3HWSA 4BPBA 3KJIA 1QVRA 1BOFA 1OJLA 3RRZA 3RRNA 4FCTA 3VMFA 1TL7C 1GG2A 4PAMA 4ILEA 4C4PA 5KDLA 3Q3JB 2REXB 2J9RA 3KKMA 1N5KA 3K0SA 4PC1A 2BVNA 3T5GA 3EG5A 4A8JA 5F9HA 1ZM9A 4XJXA 4KHZA 2GF9A 2DBYA 3C14C 1P61B 2QENA 2BBTA 4D0GA 3KXIA 5BWMA 3LLMA 1ETUA 5KTYA 2QAGC 3WRXC 2DCUA 2RH5A 2VHUA 3K09C 2GEUA 2DY1A 1SZPA 2KB0A 1E2FA 5FTJA 1CLUA 1KMQA 3UATA 2FEMA 2VHCA 4Q4JB 3RS0A 2GAAA 1EWRA 2G88A 1NIJA 2XNSA 2ZJ5A 4DUGD 1TUEA 2VO1A 1NG9A 4MGZR 2KE5A 2IYLD 2IS6A 1D9ZA 2Z83A 3KUDA 4PZZA 4B44A 2XSZD 3TGPA 3U60B 1K6MA 4NTZA 3VU9A 1Q12A 2XZOA 4D4LA 1UDXA 2NGRA 2WIBA 3K70C 1XTKA 1AN0A 1G3QA 4HAXA 3KKNA 3AH8A 4DLYA 1CEEA 2OV2A 1KDPA 2IYUA 4D81A 4JLAA 4PHFA 3PUVA 2UZ3A 4F93B 1YZLA 2ODNA 1QBKC 2VEDA 3GLIA 3PR1A 2QI9C 2XITA 4IDOA 4Q18A 3BS4A 1Z08A 3CR8A 1LY1A 4XTCS 2EFGA 3IILA 1SVOA 1GL7A 5B2ZA 2A7QA 2QZ4A 4LPKA 1TX4B 4I81A 2OBNA 1D5CA 1WRBA 5BN4A 3EC1A 1HQYE 1T3SA 1AZSC 4CEIB 5J4VA 1XWIA 4C0JA 3U44B 1JAHA 3C15C 1NBMA 2RB4A 3F3YA 4IDPA 4TMWA 3IIMA 5JI2E 1JI0A 5HCNA 2J0UB 1SVKA 1Q44A 1ZD9A 1UKVY 2YHSA 3A36A 4JLKA 5BN3A 2WMNB 2RGDA 3CM0A 5TB5A 4NYIQ 3N2IA 5EZ5A 1WMSA 3PCRB 2C5LA 1EESA 1W2HA 2PMDA 2ZR9A 4AYWA 2QTFA 1W2GA 4TLCA 3ASYA 1G5TA 1M7HA 4MRRA 1RE0A 1YZTA 2BM1A 1ZD1A 1YZNA 1XCMA 2ZS8A 2WOJA 4DT1A 4EFLA 3HP1A 4RZXA 3VQTA 4GBMA 1NRJB 4BFUA 4CEJB 3OE7D 4RKEA 1E2IA 4JLDA 1U98A 1VG1A 1FMJA 3BH7A 1D6JA 4ESVA 4WAUA 2OG2A 3SBEA 5LDDC 1HUQA 2CVFA 3FMPB 3D7MA 1N3BA 1VCNA 1Q3HA 3AVPA 1Q3TA 1L8QA 4MYCA 3UMSA 1T8TA 4DSTA 3W9YA 2J0QA 1IJEA 1W4RA 4D4JA 5E7IA 2YWFA 1E9FA 2JLVA 4GMDA 1Z0JA 5JWHA 1MT0A 3K53A 4L8GA 4U00A 4RD3A 3BC1A 2ZRCA 4Y0AA 4IDHA 2E87A 2ZYWX 4LY6A 2EFDB 2PLRA 1DTSA 1XJ0A 3FFAA 2VSFA 3LXRA 1E2PA 4L16A 4PSAA 4C2UA 4LJAA 2ZU6A 4I1UA 5G53C 5B57C 2XXAB 1E0AA 4WZBE 1GWNA 3FHOA 1EFCA 1Q21A 4XWAA 3W34A 1NN3A 4C0QC 2PCLA 2A30A 2DFTA 4FCVA 4IEIA 2KBFA 3L0PA 2ODWA 2R62A 4KLZA 2C04A 3TQFA 2YC2C 2GEVA 2G0NA 1T91A 3O8DA 3RS2A 3X1YA 1E2NA 1L7VC 3IIKA 1TAGA 3SFZA 3IQWA 4MRPA 4QGFA 1EGAA 4D4MA 2FG5A 3I8SA 5FPHA 2J0SA 3BGWA 2N46A 3SE0A 1KSFX 1RRFA 4O2RA 3EPKA 2ZRGA 1OXTA 3CZPA 4P4UA 1E3MA 1SVIA 3DMDA 1A2BA 2O0HA 3ZD6A 4ESHA 2WSMA 4HZIA 3NHAA 1W46A 3A6PC 4RFSA 1GKIA 2YOGA 4JSYA 4JT4A 3IHLA 2YV5A 1NY6A 4AG6A 2OESA 2EW1A 2VF8A 3CWQA 1VKJA 3PVSA 4PXAA 2QROA 3E70C 1L4YA 1WQ1R 3QI2A 5IK2A 5SZKB 3T61A 4DSNA 4L9WA 5FOTA 2O8EB 3DM9B 4MA4A 4V0MA 3CKLA 4JLMA 5E3HA 4GZMA 4CIDA 1N6LA 2ONJA 4A8JB 3LQRA 4EQ6A 1PLJA 4FCWA 3DPUA 5BW8A 4A6PA 4TL9A 4MDFA 1N0WA 3MSXA 3PG5A 2OFWA 3VR5A 1KDTA 5H68A 2ZM5A 2BM0A 3KQHA 2P3SA 2ZITA 4KSBA 3ZQ6A 3VX4A 4AYXA 3AVXA 2I1QA 1ZMXA 2ZJ8A 3LBIA 1Z22A 2ZRLA 2O8FA 1KTVA 4PHTA 5AJZA 5E4FA 2WSSA 1TF5A 5FOWA 5AJVB 221PA 1II0A 1XEWY 3K0FB 2GTPA 3K9GA 5KSOA 3QKRA 1ZUNB 1QG2A 1IHUA 1F60A 4PC3A 3UMFA 3QJYA 3QXSA 4RD1A 2CNWD 4F38A 2AKAB 3PUXA 4G01B 5LB4A 2IHBA 4AG5A 3CRW1 5GVSA 4ZIRA 1ZUIA 2F3TA 5JSZA 1GTVA 4E09A 1G5PA 1HE1C 2PL3A 3QXXA 1IM2A 3ADKA 1U94A 4QM6A 2KBEA 2QPAA 1KYIA 2JJ2D 4TLAA 1OIWA 2FZ4A 2OAP1 2P65A 3CWZA 3M1IA 4TMZA 5CYPA 5EE1A 4LHVA 4H1UA 4CEJA 4BASA 1US8B 2ERXA 3R7WB 2AD5A 2PBRA 3DMNA 2HEIA 1KNQA 1CBUA 1G21E 2ZVPX 4LWZA 1J8YF 4DDWA 3ETLA 4LPSA 5B58C 1E9BA 1YZGA 3WNDA 2FFHA 3KFXA 4W9MC 4OQFA 4W5HA 4JLPA 1QHGA 2WJGA 1BH2A 1ZU5A 1HY3A 4NCNA 4B3DA 3MAAC 3U6KA 3P27A 3OZXA 1SGWA 1E2QA 5DN6D 1F2UA 4KAXA 2WPDD 2GJSA 5EJEA 1CU1A 2ANBA 1U9IA 4BE7B 3RC3A 1A1VA 4JKYA 1DG1G 1GIAA 4GDFA 1Y63A 2IYRA 3KKPA 4JL5A 1XEFA 1NN5A 1Q22A 2CVHA 3SJBA 3TSOA 2W6IA 4R2IA 2XXAA 2ZRFA 5DYIA 1KJZA 1T6NA 2AXNA 2XTZA 5SZJA 4EFNA 2ORWA 5CITA 3ZDQA 4Q9HA 2WWXA 4NYMR 4NH0A 1SVMA 2VF7A 4UNPA 4XSGA 1JNYA 4UXJA 3WHKA 3NEJA 4BLSA 4TTQA 1XTSA 2JJ2A 1GRQA 4P4SB 3TAUA 5EE0A 2CEAA 5EP1A 3BFVA 3KQLA 3OIWA 4U02A 5JEEA 5ELXA 4KLNA 3CRQA 4PHHA 2Z43A 8OHMA 3GLFA 1KSHA 4A92A 3EA5A 4PR0A 3TMKA 4DLVA 1E0KA 1G4UR 3GQBA 5DI3A 3SYNA 5CDFE 5JRJA 4OHWA 4ZKEA 3L43A 1S1MA 4TQ9A 1II8A 4G5RA 3SYLA 1W1WA 1OPXA 3AUYA 1QRAA 4MRNA 4C9BA 1HT1E 2QPTA 4OQNA 1NL3A 3U4QA 3IKJA 1DOAA 2X2FA 5KYKA 2HF9A 2F7SA 1QVAA 1FP7A 5EZ6B 3ZS9A 2JA1A 3T1TA 4AK9A 3NC1C 3VAAA 1FTSA 4TQAA 4A82A 2IYTA 3DEFA 3TH5A 1UADA 2GZAA 2P6UA 2ZXUA 1IAQA 5EE9A 3R9IA 1F48A 4Q03A 4U5XA 2R6FA 1KJYA 2LCFA 5C2JB 1DO2A 2KSQA 3SDZA 1RC8A 2GBLA 3PV0A 4HDQB 5DSZA 5D3MB 4B75A 5TVKA 3FVQA 2ZI9A 3SQWA 1KMHB 3T1QA 4HAYA 4HLDA 3SYKA 5IK2D 3PQCA 3L2OB 2WHXA 3C8UA 1ZCAA 1X3SA 4OBEA 1XU4A 1W36C 1XTIA 1GFIA 4QFMA 3UG7A 3GLHA 4AKGA 1JAIA 1ZC3A 1UBGA 1SXJA 4M9ZA 4JYBA 4HB0A 1E2HA 4NE2A 4QBHA 4IJMA 3NWJA 3SHFA 3LW7A 2G1JA 4KSCA 4Z1MD 3QBTA 4CEHA 2OHFA 2W00A 1QHNA 2NIPA 1XTJA 1GSIA 5GVRA 2Q6TA 2V4ZA 2I3BA 5CB6A 4ERNA 3G82C 2BKEA 4BFVA 5KPDA 2DPXA 2IW3A 3I4LA 4Q00A 3PIRA 3TKLA 2NO7A 3LBHA 4JS0A 2D2EA 4GP7A 5HTKA 5EXXA 2GHIA 2QM7A 2RHDA 2ZRDA 4NMMA 2BBSA 3EC2A 1TF7A 4PPQA 2FSGA 2O8EA 4LYJA 3L0OA 2MSEB 1W5TA 5EUMA 1TADA 2DFLA 3HPQA 1UKZA 1DE0A 5CLLA 4OQXA 2JLYA 1OB2A 1SHKA 5FR2A 3CRRA 3QXCA 3HJNA 1RYFA 2WJJA 4OK3A 4OI0A 4V0NA 4UXIA 1E9SA 2IHYA 3KJEA 4XWKA 4NYJR 2FPKA 1NSTA 2C98A 1CR2A 2HJVA 1AIPA 3TLXA 1W0JA 1AS3A 2GJ9A 2W0SA 4B76A 1Z6YA 5AR1A 2ATVA 2Q3MA 4HEJA 4KFUA 1VG8A 4QNMA 5HZHA 4DBLC 2ZETA 3NKVA 3I73A 5H1YA 3UWKA 3LWNA 4LHXA 2ASEA 2OLJA 3IHWA 2GVZC 3ECCA 2XZPA 1P2UA 3R9XA 4OYHA 3B7GA 1AS2A 4CZ2A 4Y0VA 1WGWA 2ZJ2A 1IXRC 1FP6A 2QP3A 4NP6A 3LH5A 1LF5A 3MGCA 4JSTA 3WBKA 1CJVC 5DNYB 4HLUC 1AA9A 1TQ2A 1II8B 1G17A 1IJFA 4RCZA 3BFXA 4R7ZA 3ZVMA 2IUTA 1OFTA 4HZUA 4CRWB 1UPTA 2FFQA 4JLJA 2OXRA 4MDEA 2XEXA 2V1UA 2VSXA 1TQ6A 3KB1A 2IT1A 2BBWA 5FR1A 4L9SA 2CHGA 2Q0HA 4BLQA 2R6CA 2EFEB 4Q9JA 5FBQB 3O47A 5IDVA 5L3SB 1V5WA 4ZI2A 1XD9A 4JLOA 1I4LD 1XEWX 3B1VA 2QNRA 4P3YA 1SKQA 5GJVC 3BE4A 4GRAA 4LHWA 1N0UA 1ZW6A 2ATXA 4TTPA 1CIPA 3PITA 4C0SA 2GBLC 3DL0A 1P9WA 1VECA 4PX9A 4QXAA 2ZRPA 3M0EA 4IDNA 1JALA 2ZS9A 4JL6A 2O8CB 1GRNA 2O8BB 4BFSA 2FA9A 4DUGA 4Q47A 2I1VB 1XMJA 4J0QA 5CM9C 1ZAKA 4DKXA 1E79D 3CPEA 3QBVA 1VHTA 4G5OA 4KFTA 4QBIA 5FTKA 1J99A 3RNLA 3RS3A 3X2SA 2CHVA 5TY0A 4C0AC 4FW9A 5FTLA 4CEHB 4G3XA 1P9NA 1S3SA 3QG5A 1G3RA 4KFSA 2GEDA 3KFVA 3KQNA 4HI0E 2AL7A 1N0VC 4IEEA 4RFVA 2PLFA 2YJTD 4LI0A 3QF4A 4ON9A 4HB4A 2ZTSA 1KMHA 1P2VA 3H1TA 4FXPA 5KPJA 1ZU4A 1VCOA 1XB2A 2QMUA 3FMOB 4S35A 5KDDA 3BRWD 3GD7A 4BLTA 1RYHA 3IEVA 4L4UA 1Z63A 2F43A 4MH0R 1V43A 4B3BA 3ASZA 3SOPA 1A7JA 4FMDF 3P4YA 2QPOA 3MWJA 4A36A 4PFSA 1A4RA 4WBSA 1PJRA 4Q7LA 1FUKA 1NY5A 4M1MA 1YE8A 3EIHA 4C2TA 3CB4A 1JEDA 2HT6A 3NH9A 5LD2C 1CP2A 4DDUA 2ZPTX 4LSGA 3JZMA 4QJ4A 3PUZA 2FMXA 4FD2A 3LFUA 3MCAA 3B60A 2O5VA 3ZZUA 5C4GB 2XGJA 3NG1A 3C4JA 1QHSA 1YR9A 1GAJA 3IPYA 1GDDA 2P0EA 2IUUA 4BFTA 3UIEA 1U8ZA 4LK2A 4Q1BA 1TEVA 4Z8YA 4JVSB 3VKWA 4CVNA 1AGPA 2J1LA 1UBEA 5L3RA 2J0VA 4TMKA 1N5IA 2FE4A 4YQFA 2FF7A 3B5JA 3UANA 2OFXA 3SZRA 4Q1EA 4ZPXA 2CCKA 3AVUA 1GL9B 1ONBA 4FMCB 1RRCA 1H8EA 5DLQC 4TLDA 1JBKA 1LFDB 2ONKA 2X2EA 1KGDA 2WWGA 4QGHA 2EFHB 4DCNA 4HUTA 2O8DA 1TQDA 1SVWA 1U81A 4XVRA 3OFNA 4HYYA 4JVMA 1KI6A 5F2EA 2ZRKA 3MWLA 3PUYA 2C96A 3NIBA 2FPMA 5FUXA 3QY0A 3REGA 1W4CA 3WYAA 4HDCA 1IN7A 1XJCA 4IXMA 1F2TA 2AD1A 1E2EA 3MMPA 2A5GA 2ZI5A 4V0OA 2A78A 2XAUA 1G3IA 4TMXA 3KXLA 1KOFA 2FPLA 2G9NA 3W5IA 3U61B 1E9AA 3AF3A 4EFMA 2VHQA 3GLIE 1ESNA 2IC5A 3ZLJA 1E2LA 4ZV4A 1EK0A 2MSCB 3BK7A 3EZ2A 2QN6A 1A2KC 1ZNYA 5SZIA 2BC9A 1CR4A 2Q3HA 2IF0A 1ZP6A 1EX7A 4P0TA 4B3FX 3BD9A 3MJRA 1S4QA 1Z2AA 2PJZA 2QORA 4E03A 4XWOA 5AUQA 3H86A 2GXSA 3U2QA 1FMLA 4KBGA 3KTAA 5HKKA 4B43A 3TQCA 3A4NA 4L5BA 3A1SA 4B6EA 3VFDA 1VYVA 2ZRHA 4DC9A 1E9EA 4EAQA 3GP8A 4B47A 2C8VA 3AVQA 1VPLA 1RZ3A 4BQSA 1O87A 1OFUX 5TDHA 1XP8A 2AFHE 1Y3AA 5FUWA 4C30A 5EP3A 3AKEA 1YZKA 4MYTA 3AM1A 1X86B 4US1R 5J5CA 4XD7A 3JZAA 3AVOA 1ZM3A 3QKRB 3ADBA 1UFQA 2QT0A 2R6DA 5AWFC 1U8YA 1NN1A 3NDPA 5TARA 2IK8A 2W2TA 4B71A 2PMKA 3FOZA 4TN1A 3KKOA 4LJYA 1Z6XA 2GJKA 1G291 3HDTA 3P1JA 1Z0FA 1GKYA 2WVJA 1LV7A 1E96A 1ZIPA 4OK5A 2HJGA 2D2FA 4RJLA 3LV8A 5DGXA 4Q01A 3RSOA 2OM2A 5FBWB 3X1WA 4Q7JB 3VR1A 2KJQA 4Q1DA 3SR0A 2VHJA 2HLDA 1KSJA 4N3NA 4DIDA 4WOPA 2PJRA 4OQMA 4YMWA 3LVRE 3K70B 3TW8B 4B73A 1W5SA 3VR3A 5JECA 1R5BA 5DO9A 3K0CC 4GPTA 5L8VA 2YNMA 1JR3D 4JMPA 4KVGA 3EZFA 2O8BA 5BN5A 2R8RA 3V4FA 4DLXA 1G7RA 2VH5R 1KY3A 2QSZA 1NMXA 3T15A 1X8JA 3K0AA 5IRCD 4ZO4A 4XTRA 2HUPA 4LBYA 1MRSA 2IX3A 3PUWA 1JPJA 1M74A 4Z51A 3CPJB 1R5OA 2P6RA 4DXAA 1M6NA 1YJ5A 3OEHA 2OCAA 4PC6A 1KJWA 3A4LA 4OHXA 1P60A 1D2MA 3I32A 2FGJA 2GCPA 2NO9A 5UKDA 2CE7A 3AKDA 1E6CA 1Z2CA 1IN4A 4D2IA 4GSYA 3DDCA 2AWNA 3L8ZA 2WICA 3MD0A 1XPRA 1Z6TA 1OIXA 3RS5A 2QGNA 4YC7A 3RS7A 1OLOA 1KSGA 2F55A 1S8FA 1CJUC 3X1XA 5F9FA 4RZUA 1E98A 3VHXA 2BCGY 4IW3B 4B33A 4YMUA 2WKQA 2FEOA 4Q7MB 1G8FA 1ZINA 2RCNA 3L0SA 3X1DA 2PZFA 4DDVA
chains in the Genus database with same CATH superfamily
1QPUA 2XVAA 1A0OA 4Z1MA 1V6CA 3W2EA 2OQMA 2F3RA 1NNSA 2XCLA 3AT1A 4UVIA 1T9HA 3ZE2B 3KYIA 2NVBA 2VL7A 2QLFA 4UKDA 1SURA 4ZVVA 3T41A 3I5YA 1CQXA 3C87A 1HFWA 1T2FA 2C31A 3C48A 1L3BA 4GC9A 2MMCA 1HE4A 3ON5A 4JC7A 5ADVA 3HXKA 3KJHA 3PP8A 2J45A 1TQ4A 4JNCA 4ENSA 3QU2A 1ZXLA 3F8TA 4I2VA 4B34A 3BULA 2WZDA 3B1JA 3WK7A 4G4SO 4Y2PA 2EZ8A 1WZ2A 1GNSA 1JSLA 3G0IA 3GAAA 3PCXA 4IQ8A 4Q9LA 2J41A 3IVAA 2UYCA 3AVYA 1VCMA 4OMFG 4G36A 2NM0A 3PEVA 3SF8B 3SGLA 4RLFA 3L1JA 1FCJA 1O95C 2HV8A 2IF2A 3P9IA 3PC3A 1T3LA 2IEYA 4UJ5A 4AMYA 2R25B 3RIGA 2FOXA 6Q21A 2OV3A 3C98A 1SB8A 1ZBQA 2WUFA 2OVFA 2MYPA 5IANA 3LVFO 3NIDB 2X5KO 4NATA 5C37A 2NO0A 2WE8A 5L51A 1LDYA 4M9CA 4DBLE 4DSOA 2L2QA 4M46A 3LXMA 4D25A 1PJQA 4TWRA 5JUAA 1I24A 1Y4UA 1DWPA 2FNAA 3BK2A 3GCXA 4RVUA 4EL5A 1NFOA 4F11A 3OH8A 4AJKA 4H1HA 4MUXA 3WNZA 2HQRA 1GG5A 1WW8A 2I3GA 4E3WA 4XVCA 4RKQA 2EV9A 4QOJA 3SNHA 5IJ9B 4URXR 3NDIA 4LUCA 4MTFA 1W4AA 4Z54A 1GRRA 2HSEA 2G67A 2Q6OA 1F0PA 4HRVA 4KQGA 4M9SA 1KOLA 2HNKA 3NVMB 4JSRA 1UK6A 4Q9NA 3TLAA 3V2IA 2E21A 4OSEA 1XLTC 3EGVA 4MYUA 4OHMA 2A35A 1FNNA 2WJWA 4C7OA 1IH8A 3GDHA 4EPXA 1JIXA 3ZDZB 5KQSA 3OAAA 1AK1A 2FPRA 3NCTA 1LWOA 2PSFA 3HM2A 3HNLA 3VGPA 3Q7EA 3THRA 5FI3A 4US2R 2I03A 1QP4A 2P4EA 2ORVA 2NPUA 3EYAA 3NCHA 4QXOA 1VYUA 1QHXA 2ZWVA 3ZZNA 4U2FA 5KCZA 2WDPA 5KDDA 1QQAA 1G9TA 1D8TA 1S7CA 3DMPA 3N2YA 2C77A 4N76A 2OMEA 4ZVLA 3RUDA 3QNUA 1M2VA 4JI0B 1P5ZB 5AUNB 2DTEA 4PQFA 2W93A 5EJ8A 1NI5A 3IUYA 4DL9A 3KOYA 3UK0A 4UJ3A 2W2PA 1SUWA 3BMQB 1CQZA 4BMCA 2XQKA 1UWVA 5CIWA 1VSBA 4LFCB 3KT6A 5HF8A 1CUDA 2BEVB 3H0EA 1XT6A 3VPHA 1WHSB 3NHMA 1MV5A 4ARCA 1OVMA 1SBIA 3K9FC 4YDSA 1G64A 1XRJA 1G4WR 3LPMA 4FHGA 3ZE7A 2O5EA 4V3CA 4EG4A 3L84A 3G7SA 2CL7X 5JS8A 1ILEA 3DUFB 3STYA 3OQ6A 1LPEA 2OHIA 3NTQA 3GZNB 4D7AA 1G0NA 2BFCA 3ZDAA 2R6HA 1DQZA 3PKZA 2VDLB 4PYKA 4RD6A 2CZQA 1C9MA 3AW9A 3FMGA 4HN9A 5EPOA 4MW4A 4ZQBA 4OGWA 4BMOB 5JYCA 4YJ3F 3CZMA 5AD1A 1WDMA 2AOXA 3BZUA 3L8YA 4P2GA 4DR1B 5B3SC 1HTWA 2PGNA 2R1VB 3IQFA 3AY7A 1XEXA 2ODEA 3OWTA 2RHGB 4MV1A 3P71T 3CMCO 1T5TA 3OG9A 4XH9B 1TIPA 3V8NA 2XUIA 3LLCA 3NHSA 2H1IA 4FDLA 2ZWPA 1K97A 3HKEA 4HWPA 3EYWA 4BY9E 2CDQA 2J3KA 3DSRA 3S55A 2JPUA 1GV0A 3RYFA 2UUBB 3AI1A 5JSHA 4EHDA 5B3KA 1Z62A 2CZCA 6NULA 3NKFA 1O2DA 1C4OA 3KQYA 2FW1A 1RLOA 3W3ZB 4LZWA 5EWLA 2XQVA 4IAOA 2G7MC 4BP8A 2YHIB 2AR9A 1LS4A 3NMKA 1VJCA 3H0KA 4LQDA 4IG4A 5EFOA 1Q15A 3F98A 3MTAA 1WKVA 4U7TB 5H3CA 4EEZA 4URUR 1M76A 2FG7C 2REQB 4RYDA 9ATCA 4ETNA 4G0VA 2WU0A 4CM5A 3ZBTA 3TQTA 2ZTMA 1YJQA 2OL4A 2R1UA 4AKSA 3VZPA 3N5CA 3TTVA 3JWEA 3OTHA 1I51A 3P2OA 4WY2A 5EZYF 1P7CA 3P52A 2H3EA 2FETA 1G8YA 5KYUA 1IUNA 3BAFA 5EKSA 5FP0A 1YQTA 4CQLB 3FVYA 1OXXK 3JSAA 3K6JA 1Q57A 3TW6A 1COWD 4EB6A 3GN2A 1RKUA 2QNLA 1EBFA 3AHJA 4DMFA 3BFPA 2JF0A 5E33A 2Y9PB 2IPLA 2W6OA 4UNSA 3UAWA 2ZYRA 2OZKA 5L6LB 1P4JA 1CB0A 1X1BA 1KJIA 1LSOA 4MVJP 5A4FS 1Z2EA 1N2CE 2HI0A 4FYYA 4OHYA 2HT1A 4P8RA 3I28A 1KEEB 3EGWA 4Y9RA 5DS4A 5DBGA 4NU6A 5U1PA 4ARUA 4DE5A 5BUQA 1N2ZA 4QDTA 1U9YA 1QR2A 4U5DE 1ZBDA 5LSAA 1CY0A 2ZVQX 3EAQA 5D3MA 2BFFB 1PBTA 4URFA 3DD7A 2WKRA 4CM8B 3GJ5A 5B2FA 5JS7A 3IH5A 3P97A 1PDVA 3M82A 3EQ2A 4E08A 2PUBA 4CS9C 1PEYA 3W8HA 4AYTA 4F4FA 3ONNA 3S6JA 3FGNA 3EMDA 1CY2A 1LQ2A 4JEBA 4E7SA 2VXOA 4HWGA 4EFKA 1NU6A 2IIPA 2P0YA 1FQWA 4FSHA 3D4OA 4OUDA 1R50A 1FLDA 2FFAA 2RSLA 1B73A 2G40A 3A3NA 3FW1A 3KTDA 1WX1A 1A69A 2LSEA 4G5QA 2JI7A 3B6ZA 3O82A 4QYIA 3TWOA 2GM5A 3WISA 4B6SA 4EX7A 1SXJC 2DSNA 3OJWA 3L40A 4G0MA 3EIQA 2L6FA 1ZH0A 4U7PB 4H3VA 5J4YA 1RBMA 3W3AH 4Q7KA 2C00A 5K0SA 4ZICA 5CJ2A 4QDZA 1CF4A 4MKFA 5AI9A 2XVYA 4ULWA 3EQ8A 1BRTA 5AK5A 4BB0A 4BMXA 1YRAA 4QXRA 2QUJA 3EMVA 3RSSA 3GEGA 3AI7A 1TECE 2JGNA 1P80A 1TCBA 3PRKE 5DI9A 2P9QA 2FX3A 3UHJA 4IDDA 2SCUB 3QUQA 3MFQA 5KDOA 2B4AA 4MVJE 4XPIA 5EQDA 2BCJQ 3TSZA 2YHUA 1Y42X 1DIAA 1ULAA 3R7CA 1NBAA 2BUAA 1U28A 4Q4ZF 4TLBA 3TIXB 3BD7A 5GVRA 1GKUB 3DKKA 3MUOA 4OJNA 1H66A 5FWXB 5HSWA 3KHSA 2X7HA 4OIOF 3NH6A 5LR6A 3F7OA 3GEBA 3AEZA 3HU2A 3ZJYA 4D02A 4JI8B 5HE9A 2Z4SA 1W2WA 1JFRA 3ACCA 1TEHA 2O2ZA 4ND7A 2WSIA 4NZYA 3SZGA 5E9JA 3WFIA 1HNXB 1UEJA 1IUOA 3VYWA 1M3SA 1RHRA 1M1YA 2ABWA 2RGWA 1YR7A 3GLSA 5FUBA 3TIGA 5LA6F 5CHYA 5EC8A 1E6MA 4ZYXA 4E7OA 1ZGAA 1ZQ9A 2GCIA 2OOSA 3KD2A 2VNHA 3WAQA 1D2GA 2PNFA 1BKYA 5DS6A 2M4EA 2XI4A 4JUCA 4GM1A 1CVIA 1DQSA 1F2DA 1R3DA 2R7MA 3IVRA 4KLNA 4WCVA 2B4TO 1UF9A 2MWMA 2ZAOA 3IRUA 3ZU2A 4F3RA 5K0EA 1WCV1 5BSKA 1WETA 4X7RA 4Q4AB 4QUGA 5JD5A 3CX7A 2FJ0A 4F4DA 1M1NA 4DMGA 1DAMA 5JZSA 2ZAYA 5LMUB 1ZCFA 2Y99A 4KJZA 1SG6A 1PJAA 2JFVA 5FWDA 2DG2A 3MYRA 4I1RA 3C16C 1N7IA 4JITA 4UDYX 3KX2A 3ZEIA 3L6EA 2DZDA 3O4FA 1VC2A 5CGZA 1NTOA 1C9DB 4UE6A 5ERGB 3RWOA 3C8GB 1O03A 2C4UA 3PEWA 3FNBA 1T9KA 5ALQA 2O3QA 4W8PA 2VG8A 3FDZB 1P44A 3KS9A 4IGEA 1E1NA 4F3YA 1WO8A 1X7XA 3WJ1A 3ROTA 5DBFA 1PZHA 1SOMA 1P0QA 1CC1S 1USWA 2Y67A 3C0KA 3QITA 3A0RB 3HTKC 5CA1B 5AW4A 1YMQA 1OX5A 4F2WA 1F3OA 2PN1A 1G3UA 3UFBA 5F7ZA 1CS0B 3MS2A 621PA 4AS3A 2AWYA 1VTMP 3JQPA 2M9MA 4JHLA 4MS1B 3RRYA 1W1UA 1UXJA 3AJAA 2Y6UA 3EZYA 2WAOA 1LE2A 5L0FA 1TZJA 1DVRA 4JLUA 1U65A 2G25A 2O1EA 4O6MA 2G0TA 3PVZA 5FL3A 1WUHS 2CEKA 3ZK7A 4W6QA 1B4DA 2WPNA 1Z06A 2DQKA 3MS4A 3PFBA 4FR5A 5AVUA 4O8CA 5JJBA 5K8UA 1OXSC 4A1FA 1QHHB 1UJMA 3BMCB 3I58A 3AX6A 3QW4B 3VYRB 4F1WA 4UTPA 4DV0B 2ZCJA 4OBWA 4GXRA 2LIVA 2JEOA 3G5TA 1CUHA 3O3NB 4PV7A 5DJ5A 3UPTA 3QUTA 3BIOA 3VU1A 1C0LA 3OLWA 4D3FA 4N5NA 5CVJA 4ZC1A 1U0HC 3E1SA 3SX2A 1CEXA 4HAOA 5BXYA 5JMWA 4TVOA 4H4CA 1T9AA 2OD7A 2VBFA 2YXNA 4IPTA 3TUZC 3C7KA 1VQ1A 3HO8A 1HMPA 4WGGA 4B74A 3LSTA 2QP9X 4MUIA 2Y66A 3QVMA 4JEAA 3OOWA 3Q3HA 1GA1A 1WUYA 2EZ4A 3LRPA 2WWWA 4CLEA 4BX9A 2VR1A 2Y77A 5KVAA 3QVGB 1OU0A 5KYNA 1WEKA 2O6HA 1GTG1 3K6KA 1KDZA 5BRAA 4Z3KA 4YT5A 2NVOA 1WXXA 2FZLA 5KQPA 5IRCD 1Z28A 3WLJA 4NTBA 5LQKA 3TF5A 3O8CA 2O8VA 1ZG3A 2OYSA 3WY9A 1WQ4A 2HNAA 2WB7A 2FFRA 1D2CA 2LD4A 3FTNA 4YRZA 2FWBA 1GGNA 1SIBE 3DYIA 3KJGA 4RPHA 4MCAA 1SXHA 5L95A 4EABA 1J06A 1CB7A 3FG9A 3KYBA 4JGIA 1YOVB 4N49A 4PZAA 5HF9A 4N0PA 3CA8A 4BJTA 3WV5A 3LEVA 4JJZA 1ICIA 4TV9A 1WHTA 4JJ8A 4K6KA 2RJ3A 3D02A 1VIAA 2ZUBA 3VDQA 4ZGGA 4DY4A 3D4PA 2G1KA 5C3MA 1NASA 1N0HA 1DI0A 2Q9BA 4GEGA 4E5PA 1AUEA 2HJ3A 1LH0A 4AF6A 2JNWA 2VP0A 2Y1DA 4Q02A 5JJKA 3G2KA 2YBDA 2C9ZA 1TD1A 4BU0A 3RF3A 2AMYA 4F06A 4AROA 2C7PA 1UP7A 3LECA 5BSFA 3V5YA 2PL1A 4PRYA 3LLIA 4MGYR 2SBTA 3QEJA 1U7TA 4N0EA 5AVVA 4DLBA 1LZLA 2Q5FA 2O2DA 4Z3OA 3GJ7A 1VSTA 1K66A 2AG0A 3WDLA 1P9RA 1CR6A 3O3OB 1HDIA 1QNLA 4KITB 5LU9A 1H8HA 3CAXA 1GPJA 3IDOA 2AA3A 3G8BA 2IQ5A 3STUA 3PD0A 3M4JA 4IJKA 3I5PA 5T3YA 4FSXA 3TW8A 3FB4A 3TQIA 4RD0A 4X7PA 4PGHA 1A8UA 1DC7A 1RWBA 4X1KB 4OI1A 1KAMA 2FPWA 3IBSA 3OZCA 5ICCA 3X3HA 4NDZA 1I32A 4I5GA 4GZLA 3TPCA 2H1SA 1TYEB 4K2HA 3OJFA 2QTWB 5EINA 4CQMB 1Q20A 5KSZA 2D5BA 3DZ8A 1VL0A 5DYYA 4AUMA 3IUPA 4EAAA 4DSAA 3CV3A 1JSRA 3BH6A 3X0DA 2HAEA 3T1OA 3UC9A 3HDHA 4OBXA 3VHXB 5DNWA 3K5HA 3MQ4A 4INAA 1MABB 2I4LA 2GCOA 4EY5A 1J39A 2O3UA 2RD2A 2H29A 4RMGA 3ZCPA 4JBGA 1E66A 4AMZA 1WBJB 3BQMB 1LE4A 4MRMB 4NONA 4YR7A 2P1ZA 1AV6A 2FV8A 2A5LA 5AKJA 4Y6GB 3ICCA 2PSSA 4BLOA 4F86A 3VKHA 1WOLA 2M64A 3PCVA 1FDVA 2Q41A 1M2GA 3A1EA 5C18A 1W36B 4OLBA 4EI8A 2PBZA 5E1OA 4BNMA 1AKNA 3GRCA 3EVEA 6GPBA 4O4HF 1RWOA 3MLEA 2JANA 4RGQA 2WQ6A 4KI2A 3B8EA 2HMQA 1VDZA 3WKDA 3B2EA 3KRTA 5JDIA 4Q5IA 4KXXA 4ZQFA 3F8WA 3ZLUA 2J48A 3RU7A 4C1NA 2IH5A 2GFHA 1M8FA 3AG2C 1CYDA 2FY8A 5ALJA 1E99A 4NPHA 5A05A 3B9QA 2ZJ6A 3T7CA 3K1AA 4YJWA 1H2AS 2V0NA 3JW8A 4C0HA 1JAZA 1LVGA 2VSYA 2BOVA 3GZJA 1W49A 4LXYA 4MB6A 4X7MA 4LSZA 4NNOA 4Q3KA 1EIZA 4OL0A 4Z7NB 4E30A 3I3SR 2WAMA 2JCVA 2XA9A 1CCWA 2MSDB 2YWXA 3QY9A 4MS1A 3BILA 4Y2RA 2ZIAA 2WLTA 4C20A 4YP5A 2ODPA 1YCDA 5AW9A 3ZY5A 2H1LA 4JT2A 3O03A 3TLBA 2ZJZA 4O2AA 4YXWD 3BGSA 5D3QA 3WKBA 5IFKA 4JYAB 1AZLA 1N1EA 3MWKA 4H17A 1E6UA 1CGME 4L1KA 4O5OA 1T2DA 4EFDA 4RKYA 1M0TA 1J42A 4KQJA 1PJ4A 2VDRB 3BYZA 4KN6A 4PZUA 1IJBA 4R1PA 2VJNA 3ZZMA 2QLAA 1NQXA 3L49A 1CTQA 4IFBA 4M2LA 4AO7A 5JO0A 2EG9A 5FBZA 1HYHA 5C7LO 1FLNA 3JX9A 2F3QA 5F28E 3CUKA 2RKOA 3GLHB 3HWWA 2Q62A 5IH3A 3VHLB 4G8BA 1WZCA 3MG9A 3K6RA 1BHQ1 2JJQA 3FGPA 5HCIA 2FDXA 4HWRA 3M1YA 1PTKA 1K7FB 2PFKA 4TXJA 3GJ3A 4MUAA 4EKGA 4KN9S 3MJTA 3DE2X 4HDMB 3OCVA 4CHTA 1N8KA 3CLUC 1DJMA 2I4NA 4GFDA 3W5JA 2O9JA 4ZAVA 3T1YB 3S1AB 4F8YA 2DHRA 4G37A 3VF0A 2HBQA 5IT4A 4L02A 2I4MA 1Z7EA 5A6JA 1W85B 2XDQB 2YEVA 3H2IA 3BTUA 3ER8A 4D9KA 4F1JA 1Y34E 3IIEA 2CLSA 2YMMA 3OIVA 3SCZA 3EGXB 1CUJA 4OJMX 1SCKA 4ZT7A 5FO0A 3T35A 1PJ3A 1DAIA 1EFRA 2X8JA 3OLXA 4TN5A 1CKEA 1F4PA 2MWQA 3E27A 1MEJA 2X0EA 4CU2A 1FS5A 3PQ6A 4UEOA 4ZZIA 4O25A 2WQ7A 1KXZA 4CIVA 1DELA 1AO3A 1HH4A 2QTHA 2OWEA 3RYTC 421PA 4B35A 2OAEA 4MV6A 3QLUC 5I4KA 4J7AA 4Z49A 3U0CA 4PHCA 2WZCA 5IHPA 3EVBA 5MN5A 4I1IA 2GETA 1MU0A 2EWMA 3R3SA 2Z15A 4MK4A 3SK0A 3ZBQA 2X8BA 1Z6PA 1E9DA 3V8VA 3MGGA 2VJYA 3E9EA 2KHZA 3OOEA 2ZSKA 4NZOA 5ILGA 1FU7A 2ZIUB 4IRXA 3AV0B 2F4VB 4LY9A 3MT9A 4OKIA 1A9YA 3OQIB 3BX1A 3UK7A 5EG5A 2W6JD 1ES9A 1M7BA 3GORA 3BTOA 3CRZA 4P9NA 3MWEB 3OD1A 2VCCA 2YZKA 3OOSA 2IXOA 1Z0DA 1LRKA 3GJ0A 4HXEB 4PQYA 3VU9B 4OM8A 3WXMA 2RMKA 4FNAA 2FWRA 3X1ZA 3QXJA 5GJBA 1ML3A 3ASVA 1XN4A 3R8FA 3OQBA 2ZXEA 4N7BA 4IWBA 1Y8QA 1JWLA 1XAGA 1NFQA 2G9UA 4OKSA 4OQDA 3WL3A 2VDMB 5ITSA 1PLKA 4O4JF 3VPFA 4WXPA 1XHFA 2NZUG 4WNAB 2BHLA 5DMHA 4D3ZA 5JZBA 4UATA 2FN3A 3ZGVA 3JRMO 1R0WA 3R9KA 3CNEA 2ZRMA 3QLVC 1EFLA 4AO6A 5G1NA 4DMLA 4MJ3A 2UXBB 3FAJA 1MAAA 5E0OA 3B1ZA 1JJFA 4G5GA 3T38A 1L7OA 3MK31 2E4AA 4MGHA 5EXDA 4DLLA 1KU0A 3ZXXA 2HU7A 4CF4A 2BGUA 2JLWA 4BOYA 1FLAA 2BZ1A 2X14A 3B85A 3QFHA 3B89A 3HA2A 3RFYA 2Q4FA 3IC5A 4KBFA 1KNXA 4JK3A 5JNRA 1NUHA 1UBKS 3QI7A 5JE8A 1JZSA 3WSWA 1FFBA 1HT0A 2ZEJA 4GPD1 3OO0A 4XASA 3M4ZA 3N3AC 3VNAA 1EM6A 3I5UA 4HKTA 4CX9A 1VE1A 2CLHB 2WNSA 2BKUA 1M1YE 1JUDA 2WA2A 2YUIA 4RHYA 3EMKA 3RQSA 4BBJA 4ER7A 1HFKA 1L5RA 3M9LA 2IU0A 4E5NA 1IOZA 2C5HA 3JYPA 2XOXA 3U7GA 3KQPA 3QE4A 3D2LA 1LEHA 3DWFA 3P2KA 3SJZA 1EDEA 4Q3NA 4YMVA 4AWBA 4KNWA 5GONB 4KQ9A 4K81B 5AJTA 5I8WA 2C4KA 1GUDA 2ZWAA 2OA0A 3ZPXA 4U6NA 4V02A 4J0IA 4MR9A 4TV8F 2H1OA 1PI3A 2ZI6A 6REQA 3F96A 4BZQA 4M0PA 5AJHA 3QX3A 3WJ7A 3ZCSA 5CFQA 1CP3A 3ZXSA 1XZMA 1KTIA 2AC4A 4N6CA 1DKOA 2RBKA 1X1TA 2CJFA 2I54A 5E9WA 3VPSA 1WXFA 4W7SA 3L7OA 4AU1A 4DWVA 1FZQA 2H0AA 4PAOA 4DC0A 3G0DA 1MG0A 4M21A 2BPOA 4OA8A 3HLZA 3RVDA 4BVFA 4MW8A 3TR5A 1F4VA 1NM5A 1SUPA 3C7DB 3N53A 2QTVB 1Z6ZA 5CFLA 4RMJA 3ESBA 1GU1A 1XZNA 3N76A 4G4GA 4HZUB 2CLKB 2HYIC 3UGQA 1WB5A 3EGEA 5K3DA 3H13A 3K0FA 3C3AA 4M0MA 2X6RA 3IOMA 4DPKA 3K6SB 5AVJA 5A0TA 1LSUA 5G0TA 5FUVA 3KL4A 4P5DA 1J90A 2FPSA 3QKWA 2QTTA 3V6LA 2GI4A 4DGSA 5IN4A 5A6BA 1DC8A 4DJAA 5HXAA 5I7EA 1TYZA 3AOGA 3DLAA 1H9TA 4XD2A 2IWRA 5HTKA 3M7IA 2TMYA 1YL5A 2NZ8A 4HFRA 3NATA 4NBWA 4DJJA 3BDAA 1Y1KE 3PLAE 1XPJA 4P36A 4KJXA 2ZTUA 2QQEA 3OUUA 3EPLA 3GLRA 1HMDA 3VSCA 3L7IA 4OHCA 5C0OE 2OCPA 1KDVA 3GXOA 3UOWA 3VO1A 4NQZA 2XDQA 3HB5X 4IOMA 1SZIA 3I0NA 3IO3A 4G1EB 3PXGA 3GLGB 1DOHA 1QB7A 1V8ZA 2AE2A 3WXBA 4BC0A 4BDTA 3DVRX 1XAJA 4MQ6A 5E2AA 1NVXQ 4YL1A 1KO1A 5LP6F 5D6NA 1XMVA 3ZU6A 4KLCA 1E3JA 1KORA 4LY3A 4YQZA 3U44A 3PJFA 2TSYB 3KXKA 5CB4A 4D4GA 2HZ7A 1JDJA 4UULA 4DHWA 5EJ6A 2A0XA 1E79A 1NVGA 4OHUA 3M6FA 2FPGA 3CNNA 2L0XA 3D8SA 2Q46A 3MINB 4R31A 3C41J 4PS1A 5CEEA 5JHGB 3QUBA 1QRTA 2A7XA 2D1YA 3W3AD 5JD6A 4RKWA 4RQTA 5DK4A 3ZWQA 2XB6A 4TQUS 3Q41A 3U17A 3KPWA 4IF4A 3RBVA 5C7OO 2DLCX 1Z39A 1OKKD 1Z5NA 2LVBA 4LJ7A 2J5BA 2RGUA 3G8DA 3PRYA 3VNSA 5T5QA 4EYEA 3CC8A 1A9RA 3OHPA 4WASA 1EQ2A 3VV2A 4IUDS 3B7PA 1KEZA 4RM3A 5ALGA 2XTNA 4CYMA 5IEJA 4QPDA 3LCCA 3KVVA 2G3VA 4BCBA 3WMGA 3AF1A 4K5QA 4Z86A 3UFXB 1ZY2A 1HYEA 1WXHA 5CMLA 3ORRA 5CIVA 2C4NA 3H1EA 4JQYA 4XUEA 3R6GA 3KSAC 3QMPA 5GAJA 3T7EA 4I9FA 3EHDA 1YZVA 1NHWA 2VWGA 2Y76A 4W99A 3IQZA 4QPJC 3LC2O 4O6YA 1AGYA 5AC4A 4WK2B 2H18A 4A4DA 1QTRA 4JZKA 1VMIA 2NVUB 2GSWA 3IP9A 3AEYA 4O08A 4OHOA 1E2DA 2VP3A 1QBGA 2ZE8A 5HPYB 4BATA 1D4OA 4WNIA 1DEXA 2M98A 3TJMA 2KS6A 4LVNA 3E9QA 4QXQA 3OZ7A 4JN6B 3C6XA 2GLTA 2ZT5A 2ZYHA 1G55A 1JAXA 4C3EA 4NCKA 4XB6B 5EP2A 4ZWNA 5CA1F 1TPYA 3M5CA 4XCVA 2BP7B 1Y8RB 3WK4A 3AL0C 3G5LA 2OXCA 3AR4A 1RRKA 3FFTA 5JCZA 4F7WA 4QNRA 1V4NA 2E4XA 5HQ3A 1JB1A 1FP4A 1AMOA 1E58A 1K40A 1M66A 2OC4A 3L8CA 5IC4A 1MP0A 3VH3A 4D9CA 3NBFA 5EIXA 3PFGA 5F98A 1LKZA 2QRMA 1NR7A 4N3GA 2WJ6A 3G02A 3GCDA 3K1JA 1BJTA 3REOA 3RVKA 3WK9A 4CLRA 2O8NA 2HM7A 2WHEA 3QEOA 2WIJA 3ENNA 3JRNA 4R8LA 5HIMA 4YPOA 2HK7A 3FETA 3ZZTA 4ZI3A 2A92A 3FVVA 4XE5A 5DQZA 1GGQA 1KAGA 2R6ZA 3EZ6A 4BNFA 2D0PB 2MYSA 1AQYA 5J4KA 2AQKA 3BJRA 5DIFA 5HQTA 4D0RA 4A03A 2WD8A 3ICPA 5JJLA 4GUDA 1VJ5A 5TX7A 3UJNA 3AETB 2V7QD 3ZCTA 1HSOA 5THXA 4OTZA 4E07A 3UGOA 1JGTA 3EH2A 4MS3A 3NWPA 4AUKA 2D3TA 1AS0A 2J3MA 2AN9A 1WBDA 1H2YA 1U3GA 1LM3B 3JSZA 3K9NA 2D7DA 1C4KA 4GKJB 4M0CA 3B13B 3C74A 5HF6A 4JBYA 1U6KA 2IDJA 2YN2A 2QDXA 1Y6ZA 2F22A 1VHQA 3L93A 1AUVA 1UMDA 2UZAA 3CRVA 4WEOA 3VH1A 3INGA 3QE3A 2DUJA 1J0EA 4AL0A 4MW6A 4YJ2F 3V00A 1SUAA 2GZ3A 1LDMA 1P1RA 2R7NA 5AIBA 4OBBA 4EUKB 2ZTLA 5DM60 4XZ3A 1K75A 5L0DA 1H85A 2GAIA 3DO8A 1NRIA 1SWWA 1RHJA 2C97A 2ZATA 1NP6A 5JAQA 2IYQA 3HBMA 4FN4A 5SV2A 4YT4A 1ZZEA 3UHAA 2F8SA 5C8YA 5KREA 1FFGA 1PYGA 3QELA 1J1ZA 3M3HA 3BZBA 1GITA 2A58A 3KTAB 1BWRA 1KYTA 1Q1BA 1NV8A 2Y1FA 1HW2A 3CBQA 2OO5C 1VLMA 1MO4A 3FCSB 4RD4A 1ECCA 3UMCA 3B51X 4Y6LA 4HNHA 1YDMA 2EL9A 3AJEA 4B4DA 3OQ1A 4XXHA 5ICSA 3NIFB 1SXJD 2BI7A 1GQFA 5ERYA 1TTHA 4BFYA 4A6XA 1XVLA 1YU9A 1XROA 3BSFA 3PI7A 1IXKA 3S70A 1W0KA 1ULSA 3NHPA 1V7QA 1Q1GA 4BFCA 1SG9A 1XJQA 1N6OA 1X87A 3HUEA 4WFKA 1ICEA 4Q9IA 4PCAA 4L4SA 5F5LA 1NJGA 2D59A 4GP6A 3RVPA 4EPVA 1E1RD 3FTFA 2E2WA 5C31A 1FXWF 3VR6A 1QXSA 5P21A 1XKXA 4BO3A 1V9LA 5J2TA 5F7JA 4A0HA 1G20A 2IKSA 3NGLA 1U7PA 4N82A 1CJBA 3BXGA 3HN7A 3IP3A 2G5PA 1AKQA 2EZUA 1XBTA 3TPFA 4AJOA 4AQYB 3ZJVA 4WTOA 5LZ7A 5C4MA 1IG0A 2EZTA 3F1KA 3JVIA 4CIBA 1PNTA 3DMTA 2BFNA 4M1YA 2WM8A 1GTL1 2CLIB 5JCJD 4K6MA 3OPYB 4QGSA 5AGFA 1Y4DE 5DEIA 2WM9B 2J87A 1T8WA 3LK6A 3UEOA 2R05A 1JHOA 2JGEA 4WY5A 1T9ZA 3QX8A 4JZAA 1FX1A 4EB3A 1Q83A 4LN1A 4Y6RA 1VOMA 4AXBA 3CVWA 3D8HA 4N1AA 4B3JA 3OICA 2HIHA 3G2JA 4UW9A 5EJ9A 3A4TA 2XY4A 4MVJF 2VAWA 4H7PA 4J2OA 4M3NA 2PH7A 1L4MA 5IC6A 4KSYA 1KFEB 3LT4A 1KE2A 1TMKA 2OK7A 2YRWA 3L8MA 2H92A 3N59A 4JY7A 1BRMA 4U7GA 2F1RA 1A8IA 2P2ZA 3UT0A 3UAVA 4OHZA 4I4TF 3LS0A 2D2VA 1T0HB 1I2AA 4KP7A 5AK6A 1FIUA 5BSMA 1MW8X 4YN3A 1EFTA 1ZEJA 4NZZA 4PO3X 4WWHA 4G2TA 3EQZA 2RH9B 4XQGA 2NPFA 3U9SA 1C17M 1NU8A 2X77A 4MVWA 5BYKA 1LRJA 5IVHA 2CYAA 3JVUA 2JAUA 1J5PA 3G88A 2N1BA 3KJQA 2A3RA 4HE8D 3WGUA 3ZWXA 1B14A 5F4BA 2AB0A 1AKWA 2V0CA 4LBVA 2PUFA 1EYZA 2J6HA 4M7RA 3U4QB 1LS6A 1Z5VA 1IK6A 3PJEA 4ENWA 1VPWA 4ZP1A 1C3XA 2VP6A 4H31A 3VKFA 1KYVA 4UDXX 2UVQA 5ECWA 1PD1A 2VCYA 3GUUA 2B99A 1JWBB 2IYXA 1UFRA 2D5LA 5DW3A 3C5WP 3P26A 1JR3E 1BD4A 1KBOA 1ZXXA 4XEHA 3UWOA 2V9PA 5CPFA 5D6OA 1RI4A 2PWZA 3Q5DA 1L4HA 2P9BA 5D86A 3UH0A 5KNBD 1ODKA 2CK3A 1Z26A 2A5DA 3KSDO 4KCGA 4OF4A 3BERA 2OCGA 4GOOD 1A7KA 2X7JA 1E64A 3CT4A 3M3PA 2C95A 1UC9A 2F1JA 4OP2A 1KEPA 2B34A 4QOSA 3A0UA 1ZD4A 2RC5A 2RGXA 4G09A 4IEFB 4JASB 4TTIA 4XDHA 3PJDA 2OB1A 3L7KA 1BS9A 3LLSA 2NXJA 4NV1A 4JUDX 4RIEA 5BNFA 1PSWA 3IIJA 1V55C 4A2PA 2WA1A 2WINI 3AW8A 4OD4A 5KTMA 3LO5A 3PFKA 4NBSA 4GNKA 2HDWA 4H6VA 4KN5A 3AQCA 1B6TA 2TMKA 4TZ0A 3VU3A 3BB4A 4PTZA 5B30A 4JVNA 2OHJA 1SRQA 4EK9A 2YWRA 4JJEA 1ZAYA 4ZD6A 4JKIA 1U5BB 4ZCLA 4RA9B 1PVOA 5E6SB 4AL1A 3H97A 3MJCA 2PCJA 1UUFA 4V0LA 3F71A 1UAAA 3ZZ0A 1FPQA 1W4BA 2I6SA 2ZANA 1R0ZA 3NYQA 3QPDA 4JXKA 3KT0A 5LZ9A 3SN6A 2HMYB 4EDFA 1WY7A 4XVUA 4YRKA 4DRZA 3WYDA 4ER0A 1M67A 3ABIA 4JYCA 2BIFA 2IY9A 2Q50A 2OV1A 2BYTA 1OH5A 1PS0A 1F5SA 4NU0A 4DLNA 5EZYB 3Q6IA 4L15A 3AILA 3MLBA 5I5EA 2I7CA 4DLRA 1AQIA 1ECJA 3MW8A 4UEKA 1CF9A 3VR2D 4MCIA 3H9BA 4U2KA 3UENA 3DCYA 2BISA 1IPHA 2BSXA 3RUFA 2B4KA 3EW9A 4IZ6A 3KETA 2H4WA 2EFYA 3CTMA 3GJRA 3EPHA 1XLTA 3W8EA 4CDNA 3BREA 1ML4A 3GM1A 3VR5D 1DKRA 1SVNA 5IWCA 1V16B 2QJTA 3S27A 3OIDA 3D3NA 1I33A 4E32A 3LBNA 3U0BA 3JAMA 5FADA 3MTIA 1TA0A 1U2TA 5DP2A 3UHFA 1ZIDA 3EFHA 2BEKA 4F7DA 1UPCA 2O3JA 3O31A 4MR7A 1FMTA 4KK3A 1E1KA 1G9XA 2VRCD 2ZSFA 4Q34A 5FBKA 3V4OA 2WMYA 1OPRA 3IGFA 1J49A 1OR2A 1OTXA 4RCVA 1HURA 3RHTA 4G5XA 5B1DA 2NW6A 821PA 4GOXA 3I23A 5GMOA 4DDKA 1ZNZA 1GCIA 2O8FB 2Q2QA 1YS1X 1SG0A 4MJLA 5DTRA 3AEUB 5FD8A 4L0QA 1MFPA 3GLFB 4GEHA 3A37A 3BMXA 3PWKA 2WHPB 3PGKA 3EODA 3OQJA 3G79A 3QMKA 2AHRA 3OF5A 2IEAA 1K6EA 1KETA 2SHKA 5ENZA 3ZNNA 1OR3A 3H17A 3V1KA 2NXCA 4WKNA 1WDTA 1VLLA 4NE9A 3N0WA 1RCTE 1QYRA 1I0IA 1ZNWA 5KJCA 4NFLA 1IZ7A 2FSIA 2Z8ZA 3U26A 5LP6B 3AJMA 3EA0A 1FS4A 2REOA 1HRKA 2ZUEA 2FVYA 3ZWWA 2GT1A 3QEMB 4MEBA 4OY3A 4YRRA 3CF0A 4BTLA 2VP4A 2XSEA 5AVKA 4A23A 1GCGA 3H2SA 3QFFA 4INOA 4Q05A 1S96A 1TYAE 1OFHA 3HVUA 1EXNA 4BQFA 4WJKB 1Z23A 3R5FA 4IUBS 4X54A 3C63A 1SR8A 3QLVA 1W73A 1ADJA 3BOSA 4NV3A 4O0MA 3RQFA 5DNVA 3UJHA 4BKRA 4DY6A 1DQRA 1GGMA 4NMWA 4WACA 2QQ0A 3OX4A 2I66A 4FHEA 5HQ3B 2HFIA 3RS9A 2ZE5A 1CRQA 3SXKA 2WW8A 5JO9A 1H6CA 3EBLA 3DDZX 5G0SA 2EINC 4HK4A 2E4UA 3L0BA 3PFHA 2HW8A 2XQGA 3CLSD 1VXOA 4RKFA 5KKNB 3KYJB 4ZV7A 4HLCA 3QVUA 4KIJA 1K8YB 1EDBA 1T1EA 2CXXA 4B45A 1X94A 2FZGA 2PFSA 3DT6A 3PDIB 3CNLA 3I5QA 3IEKA 2RD9A 1YU6A 3I2YX 2AI3A 3OPYA 5K0LA 4BNNA 1IBSA 4URWR 4X24A 4KN8A 1OAOA 2ZG6A 4EF4A 2IPNA 2IS2A 2C9OA 3CZCA 3IKMB 4H18A 3IIIA 4HJXA 4NS1A 1T1SA 4ITVA 4WUTA 3FMIA 4TS1A 4HNTA 1Z68A 2HMTA 3PPWA 3GA5A 1U4SA 2P27A 2X0IA 3GVIA 1UK8A 1YQUA 5EERA 4DV7B 1P7WA 2VAXA 2W90A 3BWEA 4RMNA 4F8EA 3L07A 1NGSA 2DY0A 2WSBA 1ZGGA 2OQRA 2R7QA 4EUSA 3PQ5A 2AZTA 1H1DA 1MQSA 3QF7A 3HM9A 1T8UA 2B7CA 4MPDA 3BH0A 4QAJA 4WZ6A 5K20A 5KNBH 2PKQP 1NFRA 1PR6A 1TCUA 2QI9F 2YINC 4LXGA 3A7EA 5ALIA 3N6VA 3MVEA 2OKGA 1ZH6A 3C3DA 4P33A 1P62B 1ZJ4A 2C2GA 2C99A 2O2CA 3H11A 4FDTA 4W5RA 5CUQA 3A31A 4QUEA