3DM9B

Structures and conformations in solution of the signal recognition particle receptor from the archaeon pyrococcus furiosus
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
319
structure length
305
Chain Sequence
SMFGKLREKLKSFVKRVEEEVEKETVEIKEKDVDKALDELEIDLLEADVALEVVDALREKIKQKLVGKKVRIGTDKGKIIEEAVKEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTAGRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPILFVGVGQGYDDLRPFEKEWFLERIFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Signal recognition particle receptor
publication title Structures of the Signal Recognition Particle Receptor from the Archaeon Pyrococcus furiosus: Implications for the Targeting Step at the Membrane.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transport protein
total genus 105
structure length 305
sequence length 319
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00448 SRP54 SRP54-type protein, GTPase domain
B PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3dm9B01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3dm9B02
4P33A 4LY6A 1VYVA 3GJ6A 5EP2A 4EIWA 3IQWA 4QGAA 3GLIB 1PV4A 2XTZA 3CPEA 4WAUA 1W4AA 4Q9LA 3A37A 4P0TA 3GPLA 3EC1A 1XEWY 2ZQ5A 4FCVA 5LD2B 3THWA 3TK1A 4HZUA 3PUZA 3DZDA 3QE0A 3RDPA 1CBUA 2NPFA 1WA5A 5HR5A 1JB1A 3TH5A 3GD7A 1U90A 2Q21A 2ZTSA 4DSUA 1N25A 1KOFA 2G6BA 3AH8A 3NH6A 4D4LA 1HA3A 3CLVA 2TMKA 2IK8A 4UJ5A 4JLNA 1HQCA 5BXQC 2W0MA 5FPSA 2BV3A 1E1RD 4US0R 5LDDC 5JJIA 2P6UA 4AC9A 3NG1A 2GXSA 2IC5A 3E5HA 2CE7A 3G0HA 3CRQA 2IW3A 2V6IA 2Q9BA 1P2UA 1G3MA 1GOTA 4FCWA 5LB2A 1Q1ZA 3MFYA 2BEKA 4Z8XA 5KOYA 1KI9A 4FI3C 3LNCA 2VHCA 4CIDA 2AK2A 3K70D 2J87A 1SVLA 4ASUD 1SXJC 4RFSB 2FPMA 3X1YA 5FUXA 1II9A 1YJ5A 4Q4AA 5IDVA 1OLOA 3IILA 1F6BA 4P32A 3UG7A 1K6MA 5JZVA 3LAWA 3L0OA 3UK6A 3TAUA 1OF1A 4BRWA 2HDNB 3MWKA 3SJAA 3E1SA 5HZHA 1NNEA 1KJZA 3VR4A 3NIBA 1QVAA 4P4SB 3HR7A 2XXAA 1NJFA 2IXEA 5HE9A 4EPXA 2Q3FA 3T61A 1N0UA 2GWHA 2WSMA 4HB0A 4YC7A 3CZPA 1CR0A 4L8GA 3EPHA 1DAHA 1MABB 5F98A 1JXMA 2VO1A 1LF5A 2WJJA 1G3UA 1NN5A 2XNDD 2QU8A 2E87A 4IOKA 3B2EA 4URWR 1JEDA 3CKLA 1T3HA 1GSIA 3LLUA 1SXJA 5CK4A 4U00A 4I81A 1XPUA 4OQXA 3SI7A 3AF2A 1Y63A 1C1YA 2JGNA 3TUJC 2HT6A 3SJCA 4DLWA 4Q7KA 2IBMA 2RGEA 1OH8A 2G1KA 2WTUA 4KBFA 1O87A 1Z83A 3KL4A 1J90A 1OXTA 2QTFA 4RZUA 3WRYC 4B3CA 1L2TA 3OAAD 3QXCA 2C04A 1EK0A 2FZLA 2UVQA 4B43A 3I5XA 1KI6B 2P65A 1XTKA 1R0ZA 2GJKA 4Q1DA 5BWMA 5K8TA 2FG5A 4QBFA 2ZXUA 1X8LA 3U2QA 5KTYA 5EP3A 1M2OB 1OYWA 4DLVA 3CNOA 3QBVA 1IN4A 2G3YA 3VR6A 2CHGA 4M1OA 4BFVA 1ZCAA 4KI0A 2OCPA 4PZYA 5TY0A 4CDGA 5JJLA 2DBYA 4CRWB 4O3MA 5KU1A 1BO6A 2Q3HA 5FBRB 1DAFA 4TQ9A 4PHHA 2IYVA 3CNNA 2D3WA 4KFSA 3L2OB 1WP9A 1P3JA 1YR9A 2WWXA 4M9XA 5EZ6B 2CMKA 1JAHA 5J4HA 3SHFA 2NO6A 3ASZA 2F9LA 1FX0B 1AGPA 1MH1A 4BFWA 4IOLA 2ZS9A 5DHAA 1TU4A 2WWHA 3K0SA 3L8YA 2OZEA 4MGYR 1E98A 4KFRA 1CJUC 1FTSA 1G18A 1Q44A 5SZKB 3HR8A 3QKRB 4YLGA 3WHLA 3CPJB 3SBEA 1J2JA 1KK0A 1EFHA 3K0FA 2NPIA 2AFHE 3GJ7A 4RJLA 5D3QA 1YE8A 2BM1A 3ADKA 3FGNA 3TQCA 2GZHA 2BMEA 4FMDB 2C9YA 2VHQA 4BEJA 1DO2A 2H1LA 4HLUC 3RANA 4ARZA 1NLYA 4Q47A 3TVTA 4JIMA 3PEVA 1UBFA 3FMIA 2OBNA 3ZH9B 3ICEA 2IS4A 4WW0A 1AQUA 2VLIA 1G8GA 2DFLA 2H57A 3SYKA 2IWHA 2KSQA 1TF2A 3Q9LA 2PH1A 1AGRA 1IHUA 2QT0A 2ZRDA 1Q22A 4D0LB 2OXCA 3CRVA 5CYOA 4ZCLA 2GEUA 3OHMA 4JKIA 3ZD6A 2VYFA 2BKEA 2C2HA 1Z47A 4WZ6A 3LFUA 2J1LA 4AI6A 1NLFA 2G88A 5GADl 4PO9A 1VCNA 4US1R 3LBHA 4LGMA 2VF7A 2QI9C 4S2EA 2ZROA 3DM9B 5D3MA 1ZM9A 2GRJA 4DEYA 1N3BA 4OHVA 3ZLJA 2DB3A 5FPHA 2B6HA 2QORA 3VU9A 2GJ9A 1W0KA 4HZIA 2YJTD 3C4JA 4NCHA 2F7SA 1R5OA 2ZRJA 3LDAA 3TW4A 4GOKA 1LB1B 3CRW1 4HLUA 1ELOA 2EVWX 3DDCA 1YU9A 3QJYA 2NZ8A 2O8CB 4OKSA 2ZSAA 1AA9A 1KKLA 5ANRB 3SU8A 1CTQA 4YQFA 2YHSA 2KBEA 2ZRKA 3WY9A 2ZU0C 1A2KC 2QP4A 3ZIAA 1IXSB 3IBGA 3QKUA 4UNNA 4JS0A 1U94A 3DPUA 3AVYA 2A78A 1RJ9A 2FU5C 4YXWA 3AKYA 1EFUA 3TMKA 2WWGA 2YKGA 2VP5A 5GJWC 3D31A 3AGQA 3QVVA 2XB4A 1D5CA 3WYAA 3R9WA 3T1VA 3SFZA 5BYKA 1PJRA 2Z6VA 1N0VC 1AIPA 1G20E 1XX6A 3GLFE 1ZAKA 3UPUA 2JAQA 1YZTA 4RD4A 1DOAA 2ZREA 2G1JA 4JSYA 4A2PA 1W36D 1S9DA 2BWJA 3OE7D 4GZMA 4HB4A 4PQFA 4BFXA 4D0GA 4OYHA 4DDWA 5BN4A 1FUUA 1KJWA 2IYQA 3FHTA 2VHTA 3THOA 2BEJA 2O0KA 2Z4RA 2OLKA 4UNPA 4JYCA 1S4QA 1TQ4A 2QN6A 1KY2A 3RLFA 2G9NA 4Q00A 3RAPR 2QAGC 4DIDA 2RGDA 3PENA 4DEXA 3PCRB 3K70B 4B35A 1P62B 1ZM3A 1S1MA 1VYUA 1KDPA 3N2EA 5ELXA 1CJMA 5B57C 5FR1A 1H8EA 2CVFA 3DM5A 5FI0B 3BBPA 3NC1C 3TSWA 4Q21A 4D81A 2O8BA 3KKNA 4HEJA 1EX7A 4JKYA 3RHFA 2ZRCA 1Z6TA 1G8FA 3VKWA 1YZLA 1IJFA 1ZRHA 2J9RA 2WWFA 1G7RA 2H17A 5J4KA 4B2LA 5AJZA 2D7CA 3IEVA 1FMJA 1T8UA 4LBWA 4M22A 3B13B 3R7WA 1WDTA 3T5DA 4EPTA 2BBSA 4ZDJA 4GNKA 1KI2A 4M1MA 1ZC4A 4A0FA 1COWA 3NTUA 3KJGA 4IRUB 1LY1A 3T35A 2JJ2D 1NIJA 821PA 3GEIA 5KSOA 4NYIR 4W5HA 2B7CA 4LHXA 2XOKA 1V43A 4C0AC 4A6XA 1E0SA 3H4MA 2NQ2C 3N2IA 1Q0UA 4Q4HA 5JFGA 5L3SB 4R9UC 4KYIB 3A4LA 2JLYA 3W3AA 4URZR 3VR3A 3FHCB 1OB2A 1F2TA 5JCZA 1NMXA 4NDZA 1L7VC 2XB2A 2A5JA 2W83A 2HCBA 1SKYE 2HLDA 5EUQB 2PCLA 4EPWA 3KKOA 2GTPA 1Z0JA 3IIMA 4LI0A 2ZUDA 3K8YA 3LW7A 3EA0A 2ZRLA 2GCPA 1G7TA 3U6BA 4BFTA 3Q5DA 4DDUA 4JLMA 2FSGA 4NYJQ 4MRNA 3SC3A 4C0SA 1N5LA 2O8EB 4XD7A 4Y0VA 2OE2A 3FB4A 5H1YA 3ZYCA 1QHYA 3K9HA 4P4UA 2VSFA 3GLHE 3UXMA 1XMJA 3REFA 1FPMA 2O8FA 3FKSD 3B5JA 4XVRA 2KI5A 5L3VA 4YDSA 3QPWA 5AJYA 5B58C 2OCYC 3GJ5A 1CRQA 5B30A 4BLTA 1W0JD 3U3KA 2O5VA 4Q1AA 4UNRA 4QXAA 4CYMA 1EWQA 4C7OB 2O8DA 3PQCA 4PHGA 3C41J 3CX7A 4PR0A 4TMWA 5AJVB 3HWSA 3AVTA 2G77B 1DS6A 3RRMA 2Z83A 2ECKA 3CH5A 3VFDA 2EU8A 1TF7A 4YMSA 1E4VA 3U7EB 1QHHA 2EFCB 1PLLA 3HU1A 2GXQA 3B1ZA 4IHQA 3ZD7A 2MSCB 1XTJA 2J3EA 3AEZA 1P2VA 4Z8YA 4ZI3A 3DKPA 4PAMA 1SHKA 1J99A 3AF4A 4DBLC 3G82C 5DI9A 2E9SA 2GZAA 2AKYA 3P27A 2VP9A 5CLLA 3RS0A 2R44A 1SVWA 4S35A 3IEUA 1MABA 3GLHA 4FCTA 4EPYA 2JLRA 1VG0B 2AXNA 5KNBA 4LUCA 4TYQA 3HYRA 2FGJA 1XJ0A 4JLBA 1GL9B 2ZANA 4MRPA 4D82A 4ZI2A 2H18A 2YOHA 4HI0E 4OHYA 4KVAA 1Z6YA 4MGIR 521PA 2PLRA 2R65A 1ZM2A 1JI0A 2OFXA 3L0IB 1BOFA 2RGAA 2ODWA 3VX3A 1Z0AA 3QQ5A 1MV5A 4B32A 2R6CA 2GBLC 3H0KA 2JDID 3HP1A 3DEFA 3HPQA 1XEXB 1UBGA 3CF2A 2OSBA 1EX6A 4D4MA 2BKUA 1Q3TA 2B92A 1QHGA 4TTQA 4QC2A 2FPKA 4AKGA 2WZQA 1Z5ZA 5JWOA 1GNQA 2A5GA 4LJ5A 2N46A 1OHHA 4A6PA 1Z08A 2CBZA 1Z6XA 4ESHA 4OQNA 1ZNZA 2B21A 5DYIA 1GUAA 2ZYTX 3M0EA 1Z07A 2WIBA 1XTSA 4PPQA 1N6IA 1DO0A 4DLUA 4A92A 3LWNA 3KKMA 3PEWA 1B23P 1KDRA 1NRJB 1QDEA 1T3SA 3P26A 4V0ME 5KUTA 3VHXA 2CXXA 4Q4JA 2GJSA 4M1SA 1FX0A 1DELA 3EXAA 1KSGA 2GF9A 3A58B 1EFCA 5SZHB 1BMFD 2V9PA 1VKJA 1NVVR 1OV4A 3GJ3A 3OIYA 1W36B 2GBLA 1S9HA 3SJZA 5JMTA 2FFQA 3W5JA 2ZJBA 3P1JA 4P3YA 1OB5A 2JJ1D 1ZU5A 2I1QA 2PZGA 1KAOA 3K1JA 3L0PA 5HKKA 2C5LA 1TQ6A 2YYZA 1EFTA 1HTWA 4CF7A 1G3QA 4MGKR 5DI3B 4Z1MA 3AUXA 4JBWA 2SHKA 4K81B 4GBMA 1UFQA 4DLZA 1N6KA 1W1WA 3EIQA 3I3SR 4G3XA 1ZUIA 2DWQA 3PUWA 4KLZA 4PO1A 3MAAC 3C5CA 4IOMA 4DDTA 2PEZA 4N0EA 1Z8FA 3C16C 2F6RA 3NH9A 4C0QC 5G3YA 3KXLA 1XPRA 1J8YF 2Q9AA 2PX3A 4B73A 2HT1A 5E3HA 2GJAA 2PMDA 4DHEA 5IHPA 1SHZA 4D25A 1TEVA 2DWOA 1IN6A 4BPBA 4QM7A 4OI1A 1DAKA 2J0UA 1X3SA 1HE1C 2ZI5A 4I4LA 4C30A 4W5JA 2BCGY 3K0CC 5F2EA 5KDDA 3AP2A 1GNPA 3B1VA 4LJ4A 2WJGA 1JBKA 3S1AA 4QL3A 3V9PA 3OFND 3A4MA 1R0YA 1ZUHA 2FNAA 1UF9A 4GMXA 2PT7A 4GDFA 5IK2D 2IS1A 2O8CA 2XZOA 4OL0A 4HLCA 1G4UR 5H70A 2GK7A 2QE7A 5KDLA 4XTCS 3AVVA 2J7KA 1E2GA 3W90A 2RAPA 2WICA 2ORVA 3FKQA 2FPLA 3GJXC 1SQ5A 2FZ4A 1PUJA 3U3MA 3AVWA 1X8KA 4K8OA 1IN8A 3LQQA 4DWJA 4ZCMA 3SNHA 1U9IC 2AR7A 1K8RA 1KDOA 2V4ZA 3B6EA 4MQBA 4MUAA 1XD9A 2WKRA 1FW6A 3EPJA 5EUMA 3DKVA 3K0CA 3W8NA 5FOSA 4Q02A 3MUFA 4Q19A 1TX4B 1XXHA 3V00A 2ZRPA 3X1DA 3CO5A 3QXJA 1GDDA 1E1RA 1JR3E 1S2MA 4I1VA 1D2EA 1XU4A 3NXSA 5H68A 3T15A 4TMXA 4TMTA 2ZPTX 1JQLB 4A8JC 1QZXA 5L3RA 8OHMA 3CONA 2PZEA 4A0RA 4PC3A 3VR1A 3EG5A 3LO5A 4MKGA 2XGJA 1JQJC 1KMHB 4R98A 2RKOA 3RC3A 3THXB 1XPOA 5FOUA 1UAAA 1CU1A 4D80A 2ZYUX 3KDSE 2RH5A 2FJUA 5L3QA 3GCGA 3I61A 1XJQA 1G17A 4ESVA 2IYSA 2HXSA 2KJQA 4RY2A 3UATA 4ASUA 2JLXA 1QG2A 2XSZA 4A0GA 3W3ZB 4IVQA 3KTAA 1V5WA 3W34A 2WWYA 1U9IA 2XJ4A 4Q7JB 3AM1A 3QVUA 2ZI7A 1WF3A 4B3XA 4ZIRA 1I4DD 2IYWA 2FFAA 4CEHB 1IM2A 3RNLA 1U8YA 4C0BA 1W4BA 4XWKA 1G21E 3N70A 4BFSA 3GEEA 3PFIA 1K5DA 4IJMA 3AKCA 5HCIA 4D0NA 3Q7QA 4RSGA 3SYNA 4A8JA 5A0FA 1ZNXA 2F3RA 4TQUS 3TVDA 1WBDA 3BGWA 3TKLA 3UKDA 3EZ6A 4EQ6B 3TSZA 4KLNA 1T8TA 2PLFA 4TYPA 4QHTA 2XNDA 3GEHA 4RD0A 3LVRE 5JHGB 4LHZA 4I1UA 2ZRIA 3RABA 2DWPA 5FUWA 621PA 2MMGA 1VECA 2QP9X 5L3SA 2OV2A 4MYUA 4HUQB 5SZJA 1QHSA 2R6DA 3L82B 1KO8A 2W2TA 3SZRA 3JZAA 3BWDD 4ABYA 1I4LD 1R6BX 1ZW6A 1G3IA 3OAAA 3RSLA 2X77A 4HB3A 4TSFD 4IEEA 1U81A 4KXFB 4CT4B 3Q3JB 3THYB 2CNWD 1RVDA 4LSGA 3U60B 4ZDKA 4DSTA 1M8PA 4YONB 4DCSA 1N6HA 2X2EA 3AP1A 5J40A 4IDQA 3U3OA 4RD6A 2R6GA 2CK3D 4BRUA 2G0NA 1KAGA 2QUZA 1GKIA 4DLYA 2WIAA 4M1WA 1BH2A 3ZGXA 2RMKA 4HLDA 1XP8A 1YRAA 1TEXA 1P4SA 2DCUA 1GILA 2ZETA 1VPLA 3OEEA 3PIRA 4I99A 3F5FA 2F55A 2FGKA 4MKIA 2E1RA 2P6NA 2V7QD 3GFTA 2ZAMA 4UKDA 4G1UC 3RS3A 4AG5A 4B75A 4PSAA 1SXJE 2OXRA 4NYMR 2J0QA 2R6AA 1GG2A 2IHYA 4HYYA 4URUR 2EYQA 3D7MA 5JSZA 1RRFA 3K9LA 2OAP1 5DNYB 3MD0A 4M2LA 1Z3IX 2J0VA 1DPFA 3ZQ6A 5FTKA 3A1UA 5EE3A 2J7PD 1T9HA 1DEKA 1RYHA 2D4HA 4BQSA 5JWRA 1NKTA 4DLXA 3C8UA 3FHOA 5C4GB 2YWFA 4KFTA 4DT1B 4NH0A 1IAQA 3L0SA 4PTLA 4ZPXA 4Q01A 3AUYA 2OBLA 3O8RA 2EFDB 1WB9A 3KZ1E 5F9HA 2IF0A 3HJNA 2ZSBA 1C9KA 3OZXA 3LH5A 5FPTA 4TZ0A 4Q9KA 3O8DA 421PA 3U6KA 4PXAA 5CM8B 2GEDA 1HT1E 5KDOA 5F3WB 4BECA 1D9XA 1SKYB 2A30A 3GLGB 3U7HB 3KQKA 4QOSA 1E0JA 1JAIA 4KITB 1T0JB 1LFDB 3QUSA 1Z29A 3TLXA 1CP2A 4URVR 3BH6A 3NDBB 4FMCF 1II8B 4DCUA 1G64A 3B8HA 3BRWD 5CJ2A 5FBVB 1W2HA 1FQKA 1Z28A 4A82A 5L8VA 4RCYA 1L4UA 2EW1A 1JR3D 1KZGB 1YZGA 2NOAA 5J5CA 2C95A 1XEXA 2FV8A 1J7KA 2ZJ2A 2VF8A 3A36A 3EPLA 1LW7A 2GESA 5EZ5A 1IONA 5KNCA 5M04A 2XITA 1S3SA 1QVRA 4B3BA 2IEYA 4GT1A 1XCMA 2GJ8A 1HT2E 2I3BA 3PUXA 1FFHA 1G9XA 1Z6AA 3C5HA 1U0HC 2ERYA 4WVFA 1I4TD 1E0KA 2IT1A 3DMDA 5AK0A 5JBQA 1G41A 1KKMA 2VP6A 4C0KA 3LXRA 4NHOA 3RRNA 4OQLA 2R8RA 3ADBA 5DISB 3K0AB 1ESMA 5J47A 4Q03A 4MRRA 3RVBA 2F43A 1TL7C 1YR8A 3DOFA 5E95A 5CDFA 3B1YA 3OE7A 2ZI4A 1X6VA 4ZKDA 4AKEA 2OT3B 1VCOA 4NZYA 4TN1A 3W5IA 5AR1A 4GOXA 3BK7A 4C4PA 2QA5A 1P7CA 3ZZUA 4ACAA 3TBKA 1UKYA 5CLQA 1KTVA 1Z0KA 4OJQA 2IXGA 4LV5B 1N5IA 3IUYA 1R8SA 4TL6A 2IS6A 1HEIA 3VNVA 2D06A 2CHVA 3T1TA 5TXGA 2GETA 4OHXA 2G83A 5BN3A 1P2TA 1R0XA 1US8B 1NY6A 4WBSA 1Z2CA 3LX8A 1N0WA 2QRNA 1EFRA 5IRCD 3GJ0A 3BH7A 2BM0A 3HDTA 4A2WA 1OXUA 4XWAA 2FFHA 1KIMA 4A0HA 1OKKD 4DZZA 1RFLA 4RD1A 5TMPA 2WAYA 2WPDA 4N0DA 3PEUA 4MKHA 3SHWA 2BMJA 3U5ZB 2GKSA 1T6NA 2ZI6A 4DJTA 2I4IA 3HPRA 1XDBA 3Q8XB 5CK5A 4DUGA 1XZQA 2QSZA 3QY0A 4PPNA 1AS2A 1QBKC 2MSEB 4HAVA 4CVNA 3U7FB 2H7VA 3B9QA 4MITA 3KJHA 2JJ2A 2ANBA 2HF8A 1BKDR 1II0A 4MH0R 4V0OA 5FUYA 1VG1A 1G3RA 1BS1A 1P9RA 3LXXA 4QHSA 1R8QA 3ECCA 4URYR 4UXHA 3AVXA 2QM7A 4Y0AA 4GSYA 4BUJA 4BWYA 4JLKA 3R8CA 5HZKA 4IDHA 4V0KA 1H8HA 2NO7A 4JLVA 1KZ7B 1S3GA 3NC0C 4QJ5A 4LC0A 2IYTA 4WXPA 2VTKA 5EE5B 5JEEA 2ZI3A 3IO3A 1LVGA 4TL8A 1Z0IA 3BB3A 5KSYA 4QGFA 1HYQA 4QBGB 2W2VA 4AWXA 2AWNA 4F4IA 4RD2A 5GJBA 2QGZA 3E70C 2R9VA 3FPAA 4QFMA 1NKSA 5JS8A 4MDEA 4Q18A 3DVLA 2LKDA 4M9ZA 1KK3A 3UWKA 1IXZA 1LV7A 4C0JA 1KDTA 3BFVA 2F1RA 4I1SA 4LJ7A 5DN6D 1GNRA 3FMFA 3FKSA 4IDPA 2ONKA 1UKZA 1G1MA 1KMHA 1N6LA 1P9WA 1E2NA 2ZU6A 4KCGA 1H65A 2ZJOA 1D9ZA 4G5RA 1W7AA 1WRBA 1SVMA 3QXSA 1OH7A 2ZM5A 3V4RA 3AVUA 2A7QA 1M34E 4KHZA 3NBYC 1FOEB 4IFBA 2VHUA 4B6EA 1GL7A 1KYIA 2J46A 4HDQB 1JECA 1GRRA 4BZQA 4HDCA 2AKAB 3WBKA 4E09A 2P3SA 4EFLA 3W6OA 4JVSB 2HV8A 3AF3A 1DE0A 1R4AA 1F5NA 1KMQA 2WSSD 3L43A 4A2QA 5CB6A 1IJEA 2C9OA 2XAUA 3BJIC 1IY2A 3KX2A 1TUEA 2WV9A 5LD2C 3TR0A 3KKPA 4M8NE 1OXVA 2ORWA 2D62A 1NMZA 2JIZA 4YMUA 2QROA 5K8UA 3H86A 3NBFA 2X2FA 2WAXA 4OHWA 4CW7A 4OK3A 1F48A 3REGA 1P61B 3U44B 1E2KA 3LX5A 2JLVA 4OK6A 4UQOA 3VKHA 4B48A 5K8IA 4D26A 3AP3A 3NBZC 2W58A 1XMIA 4XSHA 3TUIC 1A5TA 1OYYA 3PXGA 1DARA 3T34A 4G0NA 3KQNA 2GCOA 4LHWA 1J8MF 1E2LA 4EAQA 4TYWA 1G8PA 4CEJA 1D8TA 4JJKA 2FSFA 4MYCA 1W49A 4WIAA 2ZR9A 3D3QA 5FTLA 4RZ3A 4CEIB 3GLIA 1XBTA 2REXB 4LHVA 4JLJA 2IA5A 2IYLD 3CRRA 3BORA 1CKEA 2JDIA 4EFMA 3ZVMA 1NY5A 3QKTA 3QSYA 3EZ9A 2HCJB 2VSOA 3NBXX 3GP8A 1OH6A 3AQ4A 4LV6A 1W0KD 2JCSA 4HAYA 4ILEA 4ZO4A 1R0WA 1KI4A 5DH9A 2A3RA 1T4GA 3B9PA 1NN3A 1S1CA 3QXXA 2Q0HA 3EASA 3TUZC 1OSNA 2QBYB 2QPOA 1RIFA 4Q9IA 3ZDQA 1UBCA 3SDZA 3A6PC 3WP0A 1UKEA 1NVVQ 1QF9A 3AV0B 4GP7A 2YNMA 4RZXA 5EXTA 2RGCA 3NDPA 4GPTA 3VQTA 2WWIA 3THWB 2IF2A 4HZUB 1E1QD 3ZVRA 1D2MA 2PX0A 1ZM7A 3CF0A 1XCGB 3UMRA 1BMFA 2PT5A 4OBEA 3QI2A 1YQTA 1IXRC 1ZIOA 4RFSA 2CL0X 4BE7B 3EIHA 1J70A 5EE9A 4JLDA 1G4AE 2VP2A 3I72A 4D6PA 1WGWA 1GZSA 3BAFA 4DSNA 3CB4A 3IHLA 2GXUA 1YZNA 4TTRA 4OI0A 5BQ5A 2IXFA 2UZIR 4ZKEA 1SVIA 1E2JA 4TLDA 1HE8B 2QT1A 1AM4D 2GDJA 4YMVA 1ZC3A 4UNSA 4B76A 4DCNA 4P4SA 3BC1A 1NG1A 3GJ4A 3SN6A 4KSBA 3EW9A 1UJ2A 3QF4B 2ANCA 2CL7X 2BMFA 2IYRA 3CF6R 1E9BA 2MMCA 5LB4A 4BFZA 1GTVA 2QMOA 2ZAOA 4IVPA 4JYBA 2XEXA 4IFEA 2OLJA 1UEJA 4LV8B 2QPTA 2C99A 1A2BA 2BDTA 2PMKA 4MYHA 3OEHA 1W48A 1VTKA 1XMSA 4Q4AB 1PLKA 2CE2X 1QHXA 2J59A 4DLSA 1DG3A 1VIAA 1YVDA 1KO5A 2JEOA 3LA6A 4LYJA 1E2FA 5DGXA 5E7IA 1G6OA 3BD9A 3TAHA 1II8A 4QBHA 2AK3A 4A1FA 3B7GA 1DAMA 2PJZA 2XXAB 1W5TA 4QG7A 1I2DA 3OFNA 4AYTA 1KO1A 3H84A 4LJ6A 4MYTA 3KQUA 1KI6A 2WM9B 5GJVC 5BN5A 3B82A 4BASA 2GCNA 3X2SA 3PITA 1HUQA 1YR6A 3VAAA 2OHFA 1DADA 1NF3A 2P5TB 1Z0FA 4XTRA 4QJ3A 1E69A 3KFXA 1T91A 2D74A 3A8TA 1Q21A 4TMKA 1FQJA 3RYTC 3AKDA 3MGCA 5IF9A 1NSFA 1GRQA 3QF7A 2GHIA 5GVSA 4MDFA 2RB4A 1NBMA 4X8HA 2HLDD 4NU0A 1E2PA 4XIGS 3O47A 4KAXA 3C14C 1E9AA 3SE0A 2LCFA 2BBTA 3U7GA 4KJZA 1D6JA 4BLPA 4BFYA 1N6NA 3L8ZA 3J81k 3I62A 3QKRA 2VP0A 4TL9A 5JI2E 2AL7A 4R7ZA 2XX3A 4XD7D 5E4FA 1W4RA 5C18A 1CRPA 3K0EA 2FX3A 3AVOA 3FFAA 5EP1A 4O25A 1G5PA 5FL7A 4TZ6A 1HURA 3SJBA 2JASA 2ODNA 3B1WA 3TNFA 1GAJA 2B8WA 3CR7A 4NYJR 1G8YA 2DFTA 2FF7A 4QHYA 4JLAA 2X8AA 2CDNA 2CL6X 3G5UA 1US8A 3KFVA 2Q9CA 2REBA 5JECA 1Q1BA 1W46A 2HXYA 3I32A 2O0HA 4W9MC 4NCKA 4OQFA 5EXPA 3QNUA 2KB0A 5FL3A 1ZIPA 4HAXA 1SVKA 2GA8A 3RS4A 4LJ9A 2N42A 2OFWA 1E0AA 4QJ4A 1ZJ6A 2O52A 2ZVPX 2FDCA 1XFAA 3RWOA 2FSIA 4G01B 5DIFA 3VMFA 1BYUA 1X86B 1P5ZB 1Q1QA 2ORIA 4OI4A 1XXHE 3F0TA 4P31A 3RS2A 3PUVA 2LWIA 2VEDA 4ARZB 5C1BA 1E99A 4POAA 3AVPA 1M7HA 4JVNA 2N1BA 3ZS8A 1R7RA 2W6JA 1KK1A 4HAUA 2Q6TA 2ZE5A 1WCV1 3IPXA 4OK5A 2NZJA 1BIFA 1XTQA 1Q12A 4N3NA 1KHTA 3FMPB 1XD2B 4FMDF 4DKXA 4DB2A 3ICQB 2RGXA 2PBRA 2OAQ1 3GFPA 1M1YE 3LY5A 3FMOB 4FIDA 4NE2A 4GMDA 4O2RA 1N2CE 5KNDA 5FTMA 3EWAA 4W5WA 1E79A 2OG2A 1O3YA 4AYWA 1G7SA 3F3YA 1IQPA 2AFIE 5UKDA 3SEAA 4B3DA 1YZKA 1GVNB 2WWWA 4KU4A 4LHYA 1EESA 3Q85A 5TARA 3K70C 1CJKC 3UWOA 5EQTA 2ZITA 5FH9A 1G6HA 2CNWA 1XRJA 3OF5A 4TLEA 3R9XA 1S8FA 3SOPA 1RYFA 4PQYA 3EZ7A 4QGGA 2CLSA 4WZAE 3OIWA 2ATXA 2A5DA 2C98A 3UG6A 2XNSA 2ZRMA 1YHNA 1NN0A 1E9FA 4KO8A 3ZQJA 1N6PA 4U5XA 4LC1A 3TJZA 3ZVLA 4DIEA 4W7SA 2OCBA 4C2UA 1OHHD 5CM9C 1NVUQ 3O8CA 1JNYA 4IKEA 4M53A 3U4QB 1EWRA 1F60A 1ZMXA 1RJ9B 3CWQA 3BOSA 1U99A 4DCTA 1TAGA 4JL6A 1DAEA 2ZS8A 3CR8A 2EFHB 5FBQB 2GILA 121PA 2ZE8A 3Q72A 4IXNA 1RPZA 3NWJA 3Q7PA 4JL5A 2JATA 5FOXA 2ERXA 1C4OA 1S96A 1IOZA 2OFOA 1NI3A 2QQEA 1JALA 4NKRA 2UKDA 3WMEA 1OH5A 1UADA 5J4LA 3RRZA 4CT5A 3CM0A 2R6FA 2ZE6A 3DL0A 5BW8A 2OUKA 2QTHA 3DZ8A 3K53A 2J7PA 2OCAA 3SQXA 4OI2A 4FWIB 4G5QA 1ZP6A 2FEMA 4BFUA 2WMOB 4HAWA 5HKKD 4AG6A 1U98A 4LYFA 2QAJA 3EC2A 4X8LA 5AUOB 3FWYA 4JT4A 4Z1MD 2BVNA 5FFMA 3O8BA 1CULC 1VDZA 3I8XA 4FWTA 1NMYA 4F91B 3UIEA 4QBIA 2BOVA 1FTNA 2MSDB 4H1VA 1T0HB 1HQYE 2YV5A 2JJ8A 1RZ3A 2BIFA 5A4JA 4QM6A 1FL9A 2IYUA 2HEIA 5A5GA 4GZLA 1HV8A 2I1VB 2WOJA 6Q21A 2GNOA 3WP1B 3ASYA 4IVRA 4EJSB 3C7KA 2F1JA 2H92A 4HB2A 4TYNA 4BLSA 5AWFC 2CEAA 1FP6A 4QNMA 1E4YA 4Q1EA 1R2QA 1KGDA 3GLFB 3R7WB 1E96A 2KE5A 2D2EA 2ZVQX 4RVCA 2YZ2A 3SYLA 5IT5A 3QENA 2VSXA 5CJPA 2FH5B 3W6NA 1UDXA 2DFNA 4LJAA 5JLJA 2ZJAA 2IL1A 1RE0A 3A1VA 1LS6A 3UANA 2QAGB 1FMLA 1UDWA 2ZRHA 2UZ3A 3LRPA 4PX9A 4R2HA 1OIVA 1XTIA 2W6ID 2GVZC 2QTVB 1SVSA 3W6PA 4TL7A 3AGPA 4Q4HB 2BBOA 3ND9A 2O8EA 3ETLA 1R5NA 5KPJA 3X1XA 1E2MA 1NVXQ 3CZQA 1F2TB 4TLBA 2QRZA 4MRSA 4WOPA 4HAZA 1TADA 2Q3MA 4E5UA 3FOZA 4KBGA 4L15A 1ZD8A 2R2AA 4BZXA 3VR5A 4AY2A 5FOWA 3B78A 4C7OA 2F3TA 4DLTA 1M7BA 1XD8A 3EARA 2CJWB 3BFXA 1BYIA 3CPHA 4LBYA 2ZRNA 3IBYA 5HCNA 1OIWA 2EWWA 3DMNA 2EWVA 4B2PA 2QEQA 5K8LA 2XZLA 3VR2A 1OE0A 3AF1A 3CUEF 1AJEA 5HE8A 2O8FB 2QM8A 4DCVA 2ONJA 4DB4A 3CH4B 2QMEA 4M0LA 4L4UA 5AUPB 5DSZA 3X1WA 3QF4A 1FZQA 2ZR7A 1DG1G 3CRMA 3IIJA 1T5IA 2VPPA 2R62A 2OILA 2O8DB 721PA 1X1RA 2IEZA 2XSZD 1MO4A 4DDVA 1KNQA 2VL7A 5JS7A 2B8TA 1PVOA 1TTTA 3ADCA 1OKKA 1ZINA 2QSYA 4LBVA 1NG9A 1Z0DA 3CWZA 1SGWA 2DHRA 3BB4A 1YRBA 1QHHB 2BMDA 1YKSA 1RC8A 1N6OA 3P4XA 4KYUA 4M1TA 3WBJA 4CZ2A 2H5EA 4EFNA 5CDFE 3QKSB 1TMKA 2CCJA 3M4YA 4Q1BA 1XTRA 1W5SA 2NGRA 1Q57A 2C9CA 2QZ4A 4PPGA 4XOIA 1HY3A 1G19A 4NL4H 3SBDA 1W36C 4MRVA 4E03A 3RWMB 4TT3D 4B71A 5JI3E 5G40A 3GLHB 1R10A 5G41A 1ODFA 5KHOC 1M74A 2YWHA 3C15C 3NVAA 1JPNA 1NN1A 1AZSC 4TLAA 5HTKA 2HYIC 2H8KA 2C8VA 4U7DA 3EZFA 3MSXA 1P60A 2HYDA 2QG6A 2WJIA 4RCZA 5DE3A 4XVQA 4U02A 3KB2A 5CB8A 1Q20A 3PV0A 1ZYUA 2EQBA 1XF9A 4LDJA 4L9SA 2PEYA 1ESNA 4LPKA 4EPRA 2AD5A 2H16A 5GVRA 4D2IA 5CYPA 1AKYA 3WNCA 1OFUX 3IIKA 3AVQA 1MOZA 2GAAA 2HJVA 4IXMA 4JLOA 3QEOA 1LF0A 2NO0A 3K9GA 4TTPA 5DN6A 2RGBA 3T12A 2JLWA 2VH5R 2FFBA 5G3ZA 3RS5A 1SVOA 1QHIA 4WZBE 1CLUA 3TGPA 1TQDA 4QNRA 4JJZA 1KI3A 2YOFA 5AUNB 4YMWA 4NP6A 2A5YB 1GKUB 1QRAA 4BZPA 1YR7A 4K46A 3OEED 4Q7MB 5DI3A 4YMTA 3LLMA 1CJTC 4LZZA 2J45A 2VIIA 3EA5A 3R9IA 1UBEA 4Q4JB 4A9AA 1Z06A 4I1OA 1VG9B 1U0LA 1G5RA 1E2DA 3BH0A 3I92A 5B2ZA 1P2SA 1OFHA 3X1ZA 1AZTA 1XZPA 2WSSA 5DO9A 4HUTA 2JLUA 5E7JA 1E9SA 1JJVA 4AURA 1E94E 1SULA 2Z5FA 3K9NA 3KXKA 3R20A 4N1AA 3KJIA 4EDHA 5KSZA 4GFDA 3KJEA 3PVSA 2BCJQ 2G0TA 3TQFA 4TMZA 4ACBA 5JEDA 4NYIQ 3VNUA 3LV8A 4PC7A 4HSEA 1KSHA 1RKBA 3P20A 4HATA 1N6RA 2NG1A 1NSTA 2W00A 1FP7A 1RRPA 3CW2A 3QPVA 4PAOA 4AK9A 1GM5A 2ZSEA 3B60A 2C96A 5HPYB 3CX8A 1WQ1R 4IEIA 2YWEA 4XJXA 1VMAA 4NPHA 3WYFA 5EXSA 2BJWA 5EXXA 5JWHA 1XD2A 1F2UB 2BHRA 4Q9HA 3JZMA 2O0JA 2P67A 4LYAA 4G5GA 3MMPA 1ZCBA 2J0UB 4IOJA 1SXJD 5EE0A 3LD9A 4BLOA 1G8HA 2KBFA 2WKPA 3E2IA 3IKJA 1GRNA 5G53C 5FI1B 1JJ7A 1UPTA 1KY3A 1S0UA 4Q9JA 4J0QA 4PC2A 3ZJYA 5CIQA 1P73A 5FUVA 1NL3A 3GFOA 3ND8A 1GP2A 3S1AB 4Q5IA 2CVHA 2LKCA 5TDHA 1T5LA 2ZI9A 3EZ2A 3M1IA 2IWRA 2GAOA 5TB5A 2V1XA 1Z6GA 3LQRA 2A9KA 2QP3A 2F1HA 4BEBA 2OO7A 5FPYA 2VP4A 3EIEA 1ZU4A 3EWSA 1P6XA 3QBTA 4TQAA 2REOA 1P9NA 3QPUA 3WYGA 4BLQA 1A82A 1WXQA 1Y3AA 1KO7A 3U4QA 3OIUA 3AKEA 1XMVA 3TSOA 4GL2A 1OIXA 2D2FA 4AYXA 3NHBA 5C4MA 1JXOA 2OBMA 5KSPA 3THXA 1E1QA 1W0JA 2FOLA 1CS4C 2JA1A 1VHTA 2DPXA 2ZYVX 5EE1A 5TV2A 3EX7C 3SQWA 3MG9A 3K09C 4JZKA 4M4SA 4B47A 2Z4SA 2ZS7A 2AXPA 4PHTA 3VTKA 3QIAA 2IHBA 1Z2AA 2WJVA 1KSJA 2RHMA 3HU2A 4KSCA 1WMSA 5FBLB 3NKVA 4ON9A 5AJWA 4DLRA 1XXHB 4EJSC 3UMSA 2C78A 3GLIE 1ZD1A 4V02A 4US2R 1FNMA 3I8SA 1E9DA 1OXSC 4CEHA 1E2HA 4IW3B 2VRWA 1P72A 4ITRC 3Q5EA 2PJRA 2AX4A 5C46F 3PJRA 3I5YA 3WXMA 1WE2A 3A1TA 2P5SA 2WJYA 3HYTA 3T1QA 3W8RA 1GFIA 4B3FX 4C9BA 3ZS9A 1G16A 3KB1A 3ONWA 4QKQA 5L3QB 4D4KA 1JR6A 1M6NA 2ZJYA 3CIOA 4BLRA 2KWIA 5JRZA 3QOFA 4TYYA 4PC6A 1AQYA 3KTAB 5FR2A 1JPJA 1AS0A 2HJGA 1IY1A 4EQ6A 2IUSA 2AWOA 5F9FA 4JVLA 3U3JA 1OJLA 5LBIA 4WA7A 1EFRD 3K09A 2IYYA 4KVGA 2WOOA 1E9EA 4ZIRB 1NLZA 1MO5A 4AKHA 1E3MA 1E9CA 2K5UA 2ZIAA 1GKYA 2ZJ8A 4RD3A 2YC4C 1MRSA 2EFGA 3UMFA 4EJSA 4HUQA 2WPDD 1XEFA 3F8TA 4PO8A 2GVDC 1Q3HA 5KPDA 2ATVA 3GLFA 3NEYA 5BYJA 4A8JB 2HF9A 3BE4A 1RW4A 3B1XA 1TQ2A 3T06B 4M1KA 4DUGD 1NIPA 3THYA 2NMVA 1OXXK 2RGNC 1I2MA 3LW8A 1VG8A 3I1FA 1ZD9A 2J41A 2QQ0A 4JVMA 1KI7A 4EKDA 3W9YA 2FSHA 2QAGA 3BERA 4O0MA 1IY0A 5KO2A 3P32A 2CLDX 3KXIA 2WKQA 2ZRGA 4L9WA 2P6RA 4C2TA 1Z22A 4MA4A 1CXZA 1WBBA 2WVJA 3NEJA 4M21A 4JBXA 4LWZA 4WXRA 1G5TA 4Q48A 1ONBA 1SKQA 1PUIA 1ETUA 1DAGA 3FE2A 4Q1CA 4E22A 1H8HD 1TF5A 4A4DA 2ZEJA 3ZIAD 4RZ2A 2W0SA 2F1IA 1W2GA 3TE6A 3GLGE 3GQBA 2GEVA 1NJGA 4YXWD 1CF4A 2J0SA 4NTZA 4B44A 2WHXA 3OIVA 2ZRBA 1KNXA 3CNLA 3V4FA 1A1VA 5P21A 4XVUA 1LTQA 3RRYA 2EFEB 2P0EA 2PZFA 4ERNA 2CJWA 3QG5A 1XNJA 2W2XA 3QEJA 3A1SA 3FTQA 1KI1A 2RGNA 3JVVA 1W44A 2Z0MA 1T3LA 1GITA 1XEWX 2CLCX 4H9GA 2QMHA 2JJ1A 2IYZA 1DVRA 5GJCA 1E2IA 2ZSDA 3T1OA 1AS3A 4FMBB 2QNRA 4X8OA 2CCGA 4B33A 1TPZA 4OJKA 1K5GA 4G5OA 3SFVA 4DT1A 1DTSA 3MLEA 1OFIA 1RRCA 3ADDA 1CEEA 2WJHA 2IUTA 3M6AA 4FMCB 4YDHB 4NBSA 3BB1A 3WNBA 2NO1A 1W47A 2AD1A 2X19A 1OT3A 4JMPA 5JSZB 4V0LA 2P2LA 4M9SA 3JVUA 1DAIA 2A2ZA 4ZCIA 2RHDA 1H8ED 1MO6A 1XWIA 3FYHA 4RKFA 4F4CA 5FOTA 1G291 4Z51A 1NBME 2QMUA 2FWRA 1UKVY 3GLGA 4BGDA 1KK2A 1TNDA 2XTNA 4FINA 2DYKA 2OEPA 3RS7A 5E7MA 2C77A 3IGFA 3MWYW 3QG1A 4EPVA 1E6CA 5B64A 1KO4A 3MJHA 3QKSA 3SR0A 2JIZD 2BBWA 4OQMA 2QY9A 2OESA 2F9MA 3NHAA 4UXIA 1U8AA 3I73A 4LX0A 1FUKA 3OESA 4ZDWA 4DXAA 1E32A 1EG7A 4LCBA 4UNQA 4PC1A 5AJXA 1VIYA 3TW8B 1COWD 1ZBDA 5IK2A 3MWLA 4RFVA 3VX4A 4PANA 1A4RA 4OHZA 1PZNA 2VA8A 4LK2A 1Q1EA 4H1UA 1LS1A 1EGAA 2QPAA 1LNZA 1MO3A 1SXJB 4UJ3A 2XOKD 2GXAA 2IYXA 3FDIA 2IS2A 2ZUBA 3H2YA 3RC8A 3IO5A 1NP6A 2WMNB 2QENA 1UM8A 3CX6A 1HH4A 4Q4LA 4TLCA 3RSOA 4F93B 1DBSA 4EUNA 2V55B 4QGHA 1XJCA 1GL6A 1VCMA 1RRGA 2JLSA 3MRSA 4F4JA 3VHLB 3WHKA 5FBWB 3FFBA 4PZZA 4LOAA 3D6TB 2FMXA 3K0AA 3ZZ0A 2GK6A 2RGGA 1IN7A 4C0LA 1OPXA 2ZYWX 2ZRAA 4GRAA 4URXR 4DRZA 1MRNA 2ZUCA 2JLQA 3B85A 3LBIA 1B0UA 1E2EA 2DFKB 3VKGA 1UEIA 4KV9A 1N5KA 3BIFA 3PR1A 4TMVA 4C3ZA 2YVUA 4V0NA 2FN4A 4Q66C 3IDQA 3DO6A 1XCPA 4GI7A 1QHNA 5AUQA 4AD8A 4DSOA 4V03A 4Z54A 4QRHA 2NIPA 2QGNA 4JL8A 4A36A 4II7A 5DLQC 5J4YA 3GJ8A 1E2QA 4HDOB 1SZPA 3KKQA 2F43B 221PA 3KQHA 3DHWC 4KODA 1CJVC 2ZR0A 4PAQA 4C0HA 1CR1A 1MR3F 3QXHA 1ANKA 4B6FA 1G7CA 1CR2A 4TWZA 3TIFA 3K0FB 3BXZA 3IHWA 4E07A 4XWOA 5JHHB 3DOEA 3EPKA 2V8OA 4PSVA 2QL6A 2ODEA 2L0XA 3EAQA 3WMGA 3WRXC 4M1YA 4PHFA 1PLJA 4FXPA 1AK2A 4XH9B 4JT2A 1ZM4A 3N5CA 4MKFA 1IN5A 2V6JA 3GMTA 3IPYA 1NVWQ 2X1VA 1D2NA 2VHJA 5TVKA 4MGZR 2ODBA 3A1WA 1F2UA 5FOVA 1TUIA 3OEHD 1L4YA 4LRWA 4AKIA 4V0MA 4DVGA 2IX3A 2XJ9A 4L5BA 2V1UA 1ZNYA 4P4TA 2NO9A 4TSFA 5D3MB 1MKYA 3SS8A 1KI8A 2C03A 2ASEA 3VU9B 2V3CC 4B3GA 3PG5A 2XTMA 2FE4A 5H8WA 4NCIA 3LBNA 2BJVA 2YOGA 5CIWA 3A4NA 4M9QA 5FPKA 2W6IA 1AKEA 5JRJA 1P75A 2CK3A 3KUDA 1ZNWA 2RCNA 2AN9A 2Z43A 1N5JA 4NYMQ 2YC2C 2J5XA 3R8FA 5LPNA 3LVQE 2CHQA 5EP4A 4HLQB 4GP6A 4LJYA 3CBQA 1X1SA 4JBYA 5FTNA 3MJRA 5DYGA 4ZDIA 5C2JB 2ZRFA 4DC9A 2ZSFA 4F7WA 2DY1A 3MWJA 3H1TA 2VQSA 2V7QA 4G5SA 4MUBA 4NONA 4LBZA 4F38A 1QG4A 1NBMD 1AN0A 5CITA 4ZV4A 3PEYA 2HUPA 1VHLA 2ZE7A 2EYUA 1EXMA 2IUUA 3I4LA 2ZJ5A 2JLZA 3HU3A 3ZZTA 5JCPA 1KSFX 1GWNA 1ZVQA 2AHOA 2NTYC 1R5BA 2B7BA 3PUYA 4LJ8A 3T5GA 4KFUA 1W4CA 2FA9A 4RKEA 3TR5A 1Z63A 4PQRA 3U3RA 4CGZA 4PZLA 4Q7LA 1U0JA 4R2IA 5FL7D 2YWGA 1VCIA 1GIAA 4LPSA 1VYTA 2GZDA 2Y8EA 2FEOA 5SZIA 1TU3A 1U2RA 4NCJA 4L16A 3ZVNA 3FVQA 3U44A 4PFSA 5JJKA 2XZPA 4FN5A 4IDNA 1X8JA 1U8ZA 1CIPA 2WBLC 4XSGA 4A15A 4GOJA 2OM2A 2YINC 4JLPA 2BC9A 2CCKA 4Q1FA 2O8BB 1L8QA 3BS4A 4FD2A 3P4YA 3IQXA 5KYKA 3AF0A 2PL3A 5J4VA 2V54A 3TRFA 1ZUNB 2A5FA 4B34A 1A7JA 2GF0A 4IDOA 1CR4A 1M7GA 1FNNA 1MT0A 4AIIA 3D8BA 4PPFA 3AB3A 4CEIA 3WMFA 1OW3B 2VBCA 1JR3A 4O2LA 3U61B 3BFKA 5EJEA 4TT3A 4LYHA 1F3OA 4NMMA 4X8MA 3KUCA 4F92B 1XB2A 2W6JD 4B2IA 4UXJA 3WNDA 4PSKA 2QBYA 1E9RA 3KQLA 2GCOB 1OFTA 1JEEA 4FW9A 2ZJZA 1IBRA 1YZQA 4NCNA 1YZUA 3MCAA 5DHFA 2D7DA 2DR3A 4CEJB 2QE7D 5FTJA 1KJYA 4R71A 4JSTA 2PCJA 1E79D 4B74A 4D4JA
chains in the Genus database with same CATH superfamily
3L07A 1Q19A 3UK1A 1G0OA 1WA5A 4RHUA 4D4LA 1STOA 3CFYA 2GXSA 4RVFA 1F0YA 1YSCA 4LN1A 1N2JA 3C3BA 1KI9A 1T29A 1LPBB 4JTCB 2VG8A 3H0CA 2BRUA 2PRZA 2Q3TA 4Q4AA 1LLQA 5IDVA 1YAHA 4P32A 2PUCA 3L0OA 1GPWB 5L40A 1Q7GA 4MUNA 3DB2A 4DCJA 1ZEJA 3TRDA 3DT9A 4YT4A 2AR0A 1XDWA 4AQ7A 3PLRA 3B2EA 3GBSA 4URWR 3ASOC 1X0XA 1V7PC 5JCJA 1DJQA 5CDYA 5KYYA 1Y63A 2Z08A 5KKAA 4DLWA 1YRHA 1JG2A 4RTPA 2FZLA 1Y34E 1AZWA 1D2AA 1YULA 2ID4A 4B5KA 3QJGA 1A9SA 2Q3HA 4WXEA 2WWXA 1YR9A 4ZGBA 2NO6A 4M9UA 2XUQA 3ID6C 3L0YA 1UR5A 1XCBA 1CQWA 1G18A 2QUPA 1KS9A 4F3CA 3G88A 1KK0A 2OZLB 2HHAA 3AB7A 2HU5A 3AETB 1JFSA 3R76A 3PDUA 4JMLA 4F96A 2IS4A 3US6A 3D7KA 2IWHA 3R5HA 4D0LB 1S02A 4MVJI 1CDZA 3C6XA 1UBJS 4US1R 2VF7A 4DEYA 1ZM9A 3TLEA 1R74A 3CTMA 3R6TA 3Q6NA 1O2DA 2CFIA 1CTQA 1R50A 4XD2A 4RTOA 2X5KO 3FRJA 4UNNA 2FZGA 3DPUA 3RIHA 3D31A 2XHZA 3R9WA 2A0YA 3KSUA 5IVHA 3B1KA 2HMYB 2Z6VA 1XX6A 3DE9A 1GPJA 4TKMA 1KZ6A 5K4AA 4V0QA 4C4OA 3NFRA 5J9FA 1NNSA 4GRDA 3O6XA 5B57C 5DN9A 3HVHA 4Q21A 4NZPA 5T6BA 3UPDA 3KKNA 4JKYA 1PVVA 2RJOA 5ADUS 1PZMA 2QI9F 3RUPA 4U7WA 1T8UA 3NRJA 1V26A 1ZC4A 3AF6A 4KK4A 3UH1A 1H69A 4BKRA 4RPKA 3A4LA 4URZR 1ESCA 2VOEA 2HCBA 5EUQB 4Q93A 2DG2A 3PYLA 5K8VA 1YJBA 3OWXA 5EUBA 4NYJQ 1IAVA 3K4QA 4OD4A 3FKJA 1W0JD 3U3KA 3U7JA 4M1QA 4ONEA 3B3FA 4YUXA 3RRMA 4ZD6A 3N59A 4CIPA 3SXYA 3IIIA 1P0PA 4QUHA 4FQ8A 4MV0A 1T2AA 2JLRA 2UUOA 3VI3B 3PNKA 4PPYA 4RL4A 4UE2A 3B3AA 4KHPB 4LDAA 2V58A 4P4NA 4QWWA 3L0IB 4C14A 6REQB 1MV5A 4G97A 2UUBB 1X1BA 2RJNA 1Z5ZA 3ND6A 5KYWA 3NYWA 3QVOA 1W9MA 2B21A 4GDMA 4HRVA 3A3NA 5WRFA 4EUHA 3MCUA 2W9XA 5JD5A 2V9PA 1VKJA 1XR3A 2NXWA 3HA3A 4MGEA 1ABFA 1G3QA 2HFJA 3IAEA 4ZOLA 4Q4ZF 3VR5H 1V4VA 4EI8A 2E4ZA 2W4MA 1G5ZA 2PK3A 1TIPA 3HADA 4WNYA 3RNOA 2EPKX 4XYLA 3L6BA 4BPBA 5BUCA 1X3SA 2ZI5A 3OZ7A 1V3VA 2R00C 4PAGA 5F2EA 5KDDA 2D5BA 1B43A 4LJ4A 2Q3LA 3EFOB 4Z9BA 4K9MA 4QFCA 4KH0A 4PICA 1WPXA 3RU7A 2QE7A 1AOXA 4ER9A 5DOVA 2V4ZA 4R2LA 1O5OA 1QV6A 5EUMA 4QNNA 3UAXA 1FVFA 1X2BA 4HR7A 1S2MA 4KBYA 4B8WA 1QIJA 1QZXA 5EPOA 1GNTA 2FJUA 3EZHA 2L6HA 2EKQA 1U9IA 4Q7JB 5CW1A 1ECGA 2DT8A 5AP9A 2LZ0A 1FAPB 2NLOA 4FFBA 1J8VA 4L5AA 3JQPA 2H06A 3BMQA 2B8JA 3BFPA 4IQ4A 2R8YA 1A7UA 1VPWA 3U16A 5KOHB 2NUPA 2ZTHA 3GEHA 4DNQA 4LLEA 2HI0A 3C3MA 2OMEA 2JLAA 5D6NA 2AVNA 4RA6A 3R6DA 1U81A 4E2FA 4U4AA 3DTVD 2N75A 1DZIA 3UB3A 4NLLA 4I8XA 1Z5VA 2PY6A 3STVA 1O0BA 1IH8A 1KAGA 2W11A 5EVCA 3S5JA 3C8GA 1K4YA 1VPLA 3PIRA 3T7TA 3NOXA 4EG7A 4UKDA 1KRXA 4EATA 4YWQA 1PWEA 2FI1A 1JB9A 1UOEA 1GNSA 1OZAA 1RRFA 2VDRB 3LF2A 5DNYB 5FPQA 2XA2A 2EC5A 2Q0XA 3O1IC 2QRVA 4ULWA 2PMBA 4PSUA 5DX8A 4RHCA 3I5MA 2A1TS 3OZXA 4Q9KA 1YUBA 5KJ1A 2WJPA 1X7GA 3L5KA 2Z2YA 3TVYA 4B6SA 4J76A 3QUSA 3BH6A 5B1EA 1GUZA 3V3KA 4JEMA 4X63A 4YFYA 4G8DA 3S1SA 2FZEA 2O2DA 3HI6A 3Q8MA 1C7ZA 3SSNA 1EM6A 3QEMB 3P71T 1CS0B 1R0SA 3D8NA 3UGTA 2CLLB 3HA7A 1GT6A 1SHUX 1W25A 3L1UA 4EMSA 3B1YA 1PK9A 3JAWA 2QTZA 2ZIUB 2YXDA 4ACAA 1HQDA 3ESYA 4TL6A 3RVRA 2G82A 2R6HA 5EQFA 3TTWA 1GA1A 1I6WA 3PHIA 1ZD2P 2WE8A 1UWKA 4CVNA 1DRWA 3QXGA 3KLOA 4V0OA 2H1OA 2KS6A 1VSVA 4DIBA 2FWBA 3NC0C 3IO3A 4QGFA 3L7KA 1LK7A 4YRKA 1E6UA 2K4MA 3MXTA 4AWXA 3E70C 4RF2A 4C4XA 1LV7A 3FWZA 3R5JA 5ICMA 5JP7A 1MJFA 2ATCA 3WDKA 4UQPA 1J0DA 1H65A 2B4AA 1FFEA 4KHZA 1A8PA 1FP4B 4JW1A 2NU6A 3LPNA 1O08A 2E4VA 3N2NA 3T41A 4ENTA 4CTKA 1G1AA 4CR7A 2DWUA 2I22A 4G63A 1SIBE 3BL5A 1PWXA 1E3QA 1CUAA 4D26A 1BQ3A 2YUTA 2I6UA 3JATB 4ZI5A 5FTLA 3DNMA 5KC9A 1CKEA 1OT5A 2WNSA 2NPFA 5KQPA 1R0WA 3TUZC 3TIGA 4UUNA 2PLAA 1ZGZA 4HYEA 1GPKA 2AJ8A 5D5HA 4O02B 3C45A 1BVRA 5EXTA 5JRDS 2X7XA 2GERA 3WYEA 5H3CA 3RADC 4B79A 3BULA 3BZWA 1CQPA 3F73A 4R40A 5HUQA 1YQTA 4YRDA 5AI6A 1M6YA 5ALUA 3TTXA 1SURA 4LXTA 3WYDA 4EKIA 5DTRA 2QT1A 4FYHA 2AW5A 3N24A 1OXKA 3EEBA 3SZMA 4ZU1X 5TF0A 2IU6A 3AUAA 2OXEA 1RADA 1KTIA 5TJ9A 1VTKA 2Q5CA 1Z68A 1PLKA 5EGSA 2JEOA 4K2HA 1TT5A 3GI1A 2F3QA 3BD9A 3TAHA 2PMEA 1C1HA 3CR3C 4IZOA 1VLLA 1I2DA 4J75A 2QL7A 5E6UA 2PSFA 3H84A 2Z95A 4K05A 4LZPA 4DZRA 3PITA 1JDSA 1T6IA 4O2AF 3DOJA 4UPDA 3KFXA 3NJ8A 3FYTA 2E1PA 3UBMA 3DKAA 3GL9A 1E2PA 3ZBUA 1I3KA 5DM2A 3QYAA 3L6RA 1E9AA 2NP6A 3RYCA 2R68A 5L0CA 1WTCA 5E4YA 2Y0BA 4YUWA 4OINF 5JUWA 2QTGA 1FJXA 3FFAA 1G5PA 1RLTA 2Z9BA 3U31A 1VI6A 3SJBA 5DEOA 5EMMA 1ADBA 3A6LA 1G8YA 4CNBA 3HB7A 3M81A 2MSWA 2NAFA 2H9YA 2X4DA 2WMYA 5FL3A 3OZDA 3F8SA 4XIIA 4QJ4A 4QQNA 2P8JA 1L5VA 3K4HA 4LVCA 3HNLA 4POAA 3U5SA 2B4TO 3EE6A 3DJNB 2OCGA 4Z5XA 5KNBD 3ZU5A 1AQLA 2OAQ1 3LY5A 1RQGA 3SEAA 5UKDA 4RTLA 1OR3A 4LVUA 2AIRA 1PJCA 4FKMA 2IE0A 2WD8A 3SOPA 4E1AA 5U1PA 1SUDA 4O4HA 4OLFA 1NQTA 4UHDA 2ZB7A 3ZVLA 1LZLA 1T43A 4IKEA 4M53A 3V8PA 2GA0A 3E5RA 2GK3A 1F12A 1A71A 3M6VA 4FGWA 4UAUA 2ZE8A 3NWJA 2W6PA 2ERXA 5J4LA 1JTFA 1VRVA 4J1TC 4FGZA 2DUJA 4EQZA 1JAYA 4XPYA 4LWOA 1QM5A 5B6IA 3DYBA 5HKKD 3N87A 1ID8A 4GS5A 1KEPA 1T1EA 4BMNA 2Q7DA 3I8XA 1DAOA 2ZAGA 3DVQX 2ZJ3A 1JHYA 3ER6A 1UP7A 1ESEA 4QNMA 1TZCA 1G20B 4OYYA 4XKJA 1IG3A 2YZ2A 2EPLX 3T7RA 1B8OA 1UDXA 1LUAA 3WSWA 1TAQA 1L4KA 1EXVA 4ZO6A 4ZCSA 2QYHA 1QORA 1FFDA 3WAGA 2QR5A 3CIFA 1BU8A 1QYRA 3SIWA 4EB8A 4E7SA 2J09A 3FFXA 3CVJA 3IB3A 1PG0A 2IOHA 1TJYA 3LXMA 1P9LA 5SYNA 4XCVA 5A03A 3RTCA 2QRKA 1EYZA 3NWPA 1NR5A 4UUOA 3ODGA 3O1LA 1B76A 4Z7NB 2QUKA 2PVPA 1NBHA 3TKYA 5GZ6A 1PVOA 2PF4E 5KJFA 2N1MA 2QLNA 3G13A 2I2FA 4MKXA 2BMDA 2CXOA 2QX4A 1CE8A 5KYTA 2AA3A 2FETA 3JARA 3GU3A 1A2QA 5AXAA 2B5OA 1SUPA 3CNBA 4YWHA 1UFRA 1WOLA 1RKQA 3NVDA 1ZOIA 5KTPA 1D0IA 1DX6A 4BO5A 4WFIA 4Y2VA 4EPRA 4HH3C 2QTCA 1OFUX 2O0LA 2C42A 2JFQA 2GAAA 5DN6A 3T12A 5KOIA 2WV7A 2WAOA 5K45A 2R4UA 4NP6A 1V45E 1XLUA 4BZPA 5DI3A 4YMTA 3EA5A 3OQIB 2ASRA 4A9AA 1Z06A 3OTGA 1SUEA 4CDYA 4GUDA 3ICWA 1P2SA 1U0GA 3ZWKA 2BCJQ 4IDGA 4HATA 1NSTA 2D7JA 3PC3A 1YXMA 1FP7A 2HJSA 2ZSEA 2YJ5A 3FNBA 1N8TA 4NPHA 3SJUA 2QLAA 3JZMA 1YWGO 5JDCA 5TEWA 3GM3A 1KH1A 2WYVA 3N7TA 4JT9A 3P5SA 4MQEB 1TE2A 1MMAA 1TFOB 1RQ2A 4QBTA 4QPNA 3BD7A 4GXTA 2CVHA 3RJMA 2V1XA 4GICA 4RIFA 1EJ0A 2OO7A 1WCIA 1VXRA 1YJCA 5C4MA 5KSPA 1GQ2A 3OOSA 1OCRC 2WJVA 3LYAA 2X8JA 4ID9A 3NKVA 4ON9A 2C59A 3WADA 4QOHA 4US2R 1W8IA 2Y0EA 3CEPB 1J0EA 3WIOA 1SAYA 2SICE 5ALTA 2WJYA 4G23A 2OC4A 1COZA 2J4CA 1A9RA 5FR2A 1JPJA 1SBQA 5IUKC 3O74A 1Y6ZA 2ZQYA 4XDZA 3HJTA 1U5CA 4ZAYA 4HUQA 3WFIA 4U0JA 3IT1A 1SCIA 1YGPA 2RGNC 3C39A 4ZTBA 3IL2A 3P32A 4L9WA 4JCHA 1Z22A 3A4YA 4IF4A 4M8IA 3U80A 4PV7A 4E22A 2YFQA 3GQVA 2ZEJA 3HWRA 5HK8A 3U39A 1T2FA 1L5WA 5DCUA 2WABA 4B44A 5B3AA 1OWNA 4RTQA 1V1JA 3FZEA 4R2XA 3RFYA 5BUZA 2CLCX 1O94C 1E2IA 3T1OA 3R77A 4P5DA 3ZNPA 2IUTA 1AKRA 4XLPF 1W47A 3SZOA 5KQLA 3FI0A 1XWIA 1MJHA 2HQRA 2XMCA 1KK2A 1XZBA 4JJ6A 4K6MA 4R6WA 5GONA 1SFRA 1ODJA 4EPVA 1QK5A 1AXRA 3FNEA 3TR6A 2ZUUA 3OESA 4HVTA 1GZ3A 2W2OA 4LCBA 4Y2UA 2UV8A 3EDMA 1QIEA 1RHRA 2IYXA 4D3YA 2BFCA 5EY5B 3U4AA 3X1JA 4M0KA 2BGJA 4YFVA 2P1AA 3O55A 3FLAA 3WGMA 4CS8C 4GRAA 1XZHA 3FYUA 3C6BA 3WYBA 4RABA 2ILTA 4JEHA 2XW6A 3IDQA 4V03A 4L50A 4JOSA 4GVPA 3RH3A 5CFLA 4JKVA 1VMDA 4B6FA 2Z1NA 4HG2A 3DO5A 2ODEA 2GO1A 2JH9A 1K3TA 5E7QA 1TC2A 4JT2A 2KK1A 5DW0A 1DWUA 5BR8B 5BW4A 1F2UA 3AL0C 3SM3A 1E59A 4P93A 1L4YA 5KZMB 4MVJM 4DV0B 1VLVA 5C3MA 4EZBA 3U17A 2D54A 2Y1KA 4MVJH 1EQ1A 2Y66A 3SEFA 3VU9B 4B3GA 1I0ZA 3C2QA 5DVZA 1OXMA 5CIWA 5JRJA 2Q5FA 4UUPA 3JU3A 1TU0A 2X5JO 2M2IA 5TEVA 5LPNA 2ZZMA 2OEXA 5IXSA 5IHXA 4K6GA 3MJRA 3W05A 4ZDIA 5DWVA 2H4FA 3L7JA 3MWJA 3RM3A 2D6FA 3LHDA 5CFNA 2VDQB 1CFZA 4ND1A 4NBRA 5H81A 3UJ8A 1QLHA 5DDIP 3HU3A 3CUKA 2B7BA 5K01A 3TLAA 3U62A 1EBFA 1UXIA 4CGZA 4UDOA 2YWGA 3FVQA 5BQFA 1L5LA 2XZPA 2EF1A 4RADA 2HO5A 2BC9A 4I3FA 2V54A 4ZPJA 4B6GA 4ZZ3A 2GLTA 5G4KA 3SHQA 1U80A 4J1NA 4PPFA 2V8BA 1YZCA 2J9ZB 5CP8A 2H4YA 1XDDA 4HH4A 4UXJA 3LUKA 4PSKA 4L1KA 1WPRA 3KQLA 1EFDN 3KTFA 3Q0EA 4KDFA 2XTZA 3GPLA 1R0LA 3TK1A 2AF3C 3QE0A 2VZLA 4K03A 2JAHA 3SHOA 4QJBA 5A9TA 2ECFA 4COOA 5BXQC 1APCA 1R9GA 4CCWA 2VZEA 3C3EA 3T6JA 2P6UA 4AC9A 4UM9D 1TWCA 4C76A 4CIDA 2DP4E 1S2IA 3L1KA 2QD2A 2DUWA 3UK6A 2FZWA 3KKEA 2PL9A 4OHKA 4GLBA 2Q8PA 2WTMA 3TG2A 5FOQA 1NJFA 3CLHA 4CE6A 1AN9A 3NM6B 2J33A 5C3UA 3ZGYA 5E8JA 1GSIA 2QMZA 1J23A 2I4OA 4GEGA 4KO4S 3QVJA 2RGEA 1L6RA 4BJHB 5HQ3A 2D1QA 5DTEA 5KU1A 1QGUB 5CDGA 4DWWA 2JBAA 3AI1A 3OQBA 1LKZA 1XVUA 1KEZA 2HAEA 3L8YA 2VT7A 1V8PA 1FTSA 3U37A 2RK6A 3RVZA 5FT9A 4W7HA 5FI3A 2XLEA 2FXVA 5B2FA 4KQKA 4DAOA 3I1YA 1UBFA 3U48A 3F7NA 1AUXA 2GN0A 1AGRA 2C3OA 1Z47A 3UFBA 3OLQA 3EVDA 2GRJA 4AP6A 4ZO8A 2YJTD 3C4JA 3L1JA 3GT4A 3HNIA 4KVZA 5HGJA 1Z33A 1IHXA 3VU3A 4RVNA 1FB5A 1SEPA 3DL2A 3TMKA 1HYGA 5I4CA 3NJRA 4YJ2F 2X8BA 2IE8A 1YZTA 4JSYA 3L8DA 3EQZA 4GZMA 5EIAA 2HS5A 1IEWA 2OLKA 2OOSA 3W2WA 1R6DA 2I3AA 4CWAA 2QOEA 4HC4A 2BGMA 3NC1C 4G8BA 4JJ7A 3SX4A 2J30A 3VKWA 2Y76A 1TMOA 2GBPA 3UMBA 1V3QE 4WINA 3B13B 1M66A 4Z49A 3NTUA 4QEKA 5AOCA 2NSJA 4HQNA 1DTWB 3IHKA 2XOKA 3IP7A 2EX4A 3N2IA 5I7HA 2JLYA 2UAGA 5CU7A 4E0BA 1HRKA 5IN4A 3PCVA 3NT4A 4YJ3B 2JEZA 1EEHA 1K97A 4KGXA 4GKVA 4S0XA 1MVOA 1SZDA 4XD7A 3SLGA 3QVMA 5KNDH 3ZYCA 4R84A 1UPBA 2P9QA 3JQ8A 5LQSA 3EGXB 4WXHA 2OBBA 2J9VA 4NJMB 4BLTA 2O5VA 5L4LA 2LE0A 1EWQA 2PSHA 3THRA 4GI2A 1DS6A 3T5MA 1MG0A 4DBVO 5KNLA 1QKIA 4OB8A 4LX8A 4MLZA 5B7QA 4EOGA 2F2TA 2KPOA 5JNUA 3O95A 1YJAA 3P27A 2VP9A 4KBLA 5A62A 4QOIA 4DJJA 4D46A 3D7NA 4NZMA 3DE4X 3K3PA 3HYRA 2JIOA 1DFIA 4MLPA 3GMSA 1LDYA 4D1YA 1W85B 2OQMA 4REMA 4KVAA 1SUFA 4QXPA 1PGQA 4BNMA 3ZV5A 2HY7A 4ZCQA 1MEOA 5LQKA 3DLHA 3QEKA 5CM2Z 1SD1A 4QI2A 1XHFA 2WZQA 3FGZA 2A5GA 1OHHA 4FILA 4PZ9A 5DYIA 5AIAA 4AF7A 3SKVA 2ZXEA 4DUPA 4EWLA 2I2AA 1L0BA 4LE2A 4M1SA 1DELA 1L7XA 2H51A 3ORFA 3IHUA 3VSAA 3A4VA 1UL1X 1X7HA 4TRRA 2XV1A 4L2IB 3W5JA 3L0PA 1EA5A 1XVAA 5ESDA 2Z09A 4I1OB 4LGVA 2DWQA 4O08A 3V46A 4HGYA 1XPRA 3NH9A 4OQZA 5EINA 1J8YF 2Q9AA 4E30A 2WQ6A 1PS9A 4RE5A 1HE1C 3LBFA 1P2GA 4HTAA 5AKGA 1K04A 2J9UA 5ALPA 4DMMA 1ND6A 2JX0A 2O8CA 5KDLA 2F00A 3PXAA 3OU2A 4J43A 3RJ5A 3LQQA 1XQYA 3LIPA 3VR4H 4O4IF 2AR7A 1I14A 3MELA 4EEZA 3RUCA 2KX7A 4PQEA 1U0BB 3F3SA 3QFHA 2EF0A 4HTFA 3I1JA 8OHMA 3UGPA 1E83A 4TKUA 2RH5A 2YY7A 3TW6A 3NUGA 2Y05A 4EDFA 4OLBA 3UN1A 3SSOA 1F14A 4CEHB 1SC9A 4P6IC 4MB2A 1Y4SA 4QTZA 3GEEA 3T99A 3FDJA 2GK4A 5HX7A 1PR3A 5A0FA 2BGLA 1XNRB 4RULA 4IUBS 1UBRS 3TSZA 3IA7A 4PIMA 2B2NA 4RD0A 2OV8A 2DJ5A 1T9GR 3SZRA 2DUUA 4WDRA 6LDHA 2W2PA 1QGDA 1T25A 4YV1A 3F4BA 3U60B 5JH7B 3UT6A 5JSFA 4ND3A 4RK7A 4RJJA 3D3KA 1M1NA 4RH1A 2VF4X 4II2A 2R48A 4UOEA 3AOEC 1P4SA 2DCUA 1GG5A 4IG9A 2VC9A 2BYTA 4AG5A 2IHYA 4J03A 4URUR 2H31A 3K9LA 4YCBA 1Q77A 2J0VA 3A1UA 4MARA 4BPRA 4ND4A 3ECAA 1RU3A 2YWFA 4PTLA 5EHGA 2Z2ZA 1VRCA 4TV9A 2GEDA 4G1BA 3JS5A 1SKYB 3N0TA 4UBLA 1UQUA 4CQMB 1T0JB 4J2HA 4DCOA 3U8VA 3D7RA 1H4TA 3QWHA 3TNLA 1IZ9A 1OQCA 4B3TB 1RAEA 3JYYA 1QONA 4EB6B 4IUDS 5T8KA 4PY2A 4DRIB 1XCMA 4N3BA 1G9XA 2X4GA 2FW6A 1W4LA 4UM8B 4E5SA 1JE0A 2BW0A 2PSSA 4PTYA 4P7FA 2JNWA 1E7SA 5CT9A 5JNLA 2OCCC 3WDMA 2XZDA 3NU1A 4NEHB 1F8YA 2D06A 1TO6A 2EHDA 1EVIA 4KW7A 3UJ7A 3UC5A 2REQB 2IPMA 1JSRA 1VFPA 2WWTA 1ISRA 3SYTA 4CIXA 2DQSA 4RLQA 3E3LA 2C2ZA 1KHHA 4D02A 3RVNA 1OILA 1C8BA 3N2LA 5LDHA 1VG1A 1QR2A 3Q8LA 3ECCA 3JRWA 3IXQA 2C5BA 4RJIA 1CUFA 5JS6A 3DP7A 2SKDA 1RKCA 1B15A 1B16A 1IVYA 2VTKA 2P2DA 3V4VB 4TL8A 1EUCB 3IDZA 1XTVA 5TQ0A 1XQ1A 4MP8A 5LP1A 4YHBA 5JS8A 3KM0A 4DQVA 3R7CA 2HA4A 1HE3A 3FMFA 1YQGA 3VISA 2IITA 4GPZA 2OCKA 5REQA 2E21A 2EKPA 5B7GA 2A7QA 2ZG6A 4K9RA 1WXDA 1T6YA 3FHJA 4HDCA 2X51A 2P3SA 3L43A 4XGNA 4RYDA 2FW7A 2D1SA 4BTVA 5AVVA 2GH1A 1LFAA 3K6SA 1E60A 5DVWA 3TSYA 1EFPB 1S6YA 1E2KA 1AXEA 1D0YA 3LX5A 4L5CA 5K8IA 3Q8KA 1C30A 4YHHB 1JQ5A 3T34A 4K3UA 3LG2A 4X24A 3RKRA 4EAQA 2RI1A 2R7UA 5C52B 4JJKA 2CNKA 1WKVA 4PIPA 1Z7GA 1SKBA 3SX2A 4LHVA 4DV1B 3ZVMA 2AC7A 5CD9A 4EHKA 1YFJA 3QPDA 1WSDA 4F3TA 3G8CA 1FYFA 2Q6VA 4ND7A 3DJFA 4X95A 4YJKA 2Z6AA 3HQ4O 1PJ2A 4BO4A 3THWB 2IF2A 4HZUB 3ZVRA 3RC9A 1OAKA 1M2HA 3VXKA 1BMFA 2Q4RA 5J5AA 1ICEA 3KEGA 3UM9A 4INAA 1ISGA 1PL6A 4QGBA 4UDXX 1UM9A 4DCNA 3BC1A 3V8QA 4G81A 1IPHA 3ZZ1A 4MR8A 3OCCA 3ZGVA 3JQ7B 3EIUA 4GGMX 4G37A 2CW5A 5CUQA 4BGEA 3CLSD 4I1PA 3SY8A 3BSFA 5T3YA 3KQUA 1ECFA 2X3YA 2XCTB 2HSDA 3X2SA 1HUQA 4WLVA 1A72A 2OHFA 1H1LB 1JQKA 1T91A 1Q21A 2SECE 3F6RA 1FQJA 3AKDA 1XKXA 4CMGA 4PTZA 4JIGA 1SUSA 2W4IA 2HLDD 3H04A 3O47A 3NHFA 1JR8A 4JK3A 1LI7A 2XX3A 3RVYA 2FX3A 3L4BA 1WQ4A 4DMCA 2Y9PB 4F1JA 3MWDB 3TNFA 2HDHA 4E70A 2PX2A 3OX4A 3SK0A 2QLBA 3LPLA 1ZIPA 2PGJA 1EVQA 1Q1QA 1XXHE 1R7RA 3G17A 2E0IA 3H2HA 4H1TA 3I2IA 5ICFA 4PLTA 4L8LA 1O95A 1ORVA 4DKXA 4E3WA 1Y4DE 3FMOB 5BSHA 3NPAA 1N2CE 2G8LA 1A76A 4I46A 3DE2X 1NI4B 4LC9A 3QW0A 2JJQA 1JQAA 4PNEA 4KWTA 2I2XB 1X0VA 1Z8NA 1LM3B 2O5RA 4CCSA 5CM9C 4KPYA 5A0TA 2QVZX 3CR8A 5EUCA 2O0MA 3HACA 3V2UA 1C2YA 4L6IA 3ESZA 2CNBA 5E6RB 1OH5A 4NJEA 4UNIA 1EGVB 1DDIA 3I2GA 4FWIB 2WMOB 3KD2A 1X38A 3PD1A 1CULC 1UMDA 5I8PA 1LLFA 1FTNA 4L3VA 1TWHA 2YV5A 2JJ8A 5HG0A 5A5GA 2IJGX 4XAQA 1EAMA 2GLUA 2VSNA 1I2CA 3KXPA 2F1JA 2V7PA 3FF4A 4KLCA 1CQJA 4GYKA 3QENA 3W4JA 2IODA 1LS6A 5F1PA 4FNGA 2ZRHA 3D4IA 4TL7A 4NXNB 1EU1A 4ZQEA 3X1XA 2QRZA 2HH9A 4L8FA 5CA0B 4AY2A 3H4IA 2ENWA 2F3TA 4BQOA 1M7BA 3HB1A 4O6YA 2EWVA 5I4IA 2PFGA 3N8GA 1C0KA 2VWGA 4MWGA 1DUIA 1O96B 1C1DA 4CCAA 1DG1G 3BTOA 2IEZA 1HBJA 4DDVA 1ZHYA 3I2YX 1UPFA 4EUKA 1CNEA 1OKKA 1M9NA 1CUZA 3T3HA 1EVKA 1JQEA 2QW8A 1WXEA 3HN6A 3ZHSA 1N6OA 1E7WA 3UJNA 4WESB 2CCJA 2DPGA 2R7QA 4EMTA 2X14A 3SBDA 1NJ5A 2L69A 1D2RA 4ZYTA 1OLXB 4LOJA 4ZA2A 4ICIA 3QUQA 1EVZA 3E23A 3Q12A 1JPNA 1NN1A 5HTKA 5TGZA 2C8VA 3NC4A 3MSXA 2PWAA 4HDAA 5CB8A 4G25A 4OMCA 1L7PA 2PEYA 5E9QA 3BD8A 2XLWA 4EY5A 3NWOA 1PZHA 3AHFA 5JNRA 4R51A 5I6DA 5CB4F 2RGBA 7GPBA 5G3ZA 3U49A 1QHIA 1THZA 4IIFA 1IZZA 4A8HA 4LZNA 4WMLA 1MHTA 4O1HA 2EFJA 4JASB 1OFHA 5JJCA 2JLUA 2NV0A 3WIBA 3F5DA 2Z5FA 3R20A 3C6KA 3KXKA 2PV7A 4NCBA 4GFDA 1CD5A 5KYXB 3DB1A 2HQBA 1JJFA 1JDJA 1NRIA 3M1LA 5E9AA 3CX8A 1PT6A 3ETDA 1WCXA 2PO5A 1T2CA 2BFFA 1TLFA 1TK2A 3L7MA 3RSHA 2H48A 2H4XA 5LQCA 1TJ5A 3DMRA 3WODF 3NIDB 4E11A 4E32A 5IJ9B 2EEPA 2VASA 4DL9A 4EX6A 1C3OA 4QU0A 2IEDA 3ILSA 2FMTA 5AC4A 3QOXA 4FYWA 5TV2A 2JA1A 1AB6A 4YRJA 1SU4A 4M4SA 4MNDA 1KSJA 2GD0A 3PD0A 1ABBA 3AM3A 3F6CA 3PPXA 5AI4A 2L18A 2FWAA 2P9HA 3SMVA 4AM8A 1R5ID 4XUDA 4BKQA 1E5TA 3KB1A 4QKQA 5L3QB 3LZCA 3QX8A 5HW0A 4JVLA 5IM5A 4ZIRB 3Q10A 1GKYA 1PR5A 3UMFA 2YQ5A 2DPLA 2FFJA 3P2MA 4A2CA 3WHNA 2WLTA 4YCAA 1TQ2A 2JJYA 2EKDA 3A6FA 5DASA 4JVMA 3ACDA 3HNRA 2DU8A 3OQOA 1OROA 4Y1FA 1D4ZA 1QV9A 4A4DA 1G4WR 3A9CA 2B4RO 4L8WB 3HA5A 3PE6A 4GLLA 2XRFA 3QG5A 2W2XA 3ASNC 1HNNA 1DVRA 2JFNA 3AW8A 1G0NA 2HDWA 4Y6SA 3SXUB 4YDHB 1SU6A 1H1DA 2RHDA 4F4CA 1CY4A 1HG1A 1QH1A 3E1GA 4OV6B 5CYFA 1GGNA 2Z58A 5INTA 1Z0ZA 4DOMA 3MRXA 5AJXA 3AIOA 4YJDA 4K88A 4EUNA 1SN7A 4X65B 1EH5A 4DRXB 4HQ0A 1SOWA 3DJYA 4UHFA 3KAKA 1CZLA 5HBRA 3LBIA 3VKGA 3BIFA 3IDOA 4GI7A 4AD8A 3SG0A 3KALA 3M70A 4C7VA 5EMKA 3ILXA 3GCDA 2GZ3A 4P7JA 4DTCA 1Z5PA 4C7JA 2BN4A 3WJ1A 2V6JA 1ULAA 3OJLA 4NC9A 3HR4A 1Q14A 2B36A 3OEHD 1IB0A 5LYJA 4BUCA 4PRKA 2DB4A 3WL3A 3R1IA 2V1UA 3JSAA 3T7EA 5H83A 3AG6A 3AY6A 5D3MB 2BMWA 3SS8A 4D74A 3ITNA 3VRHA 2PBEA 3PG5A 3FAJA 3RROA 1UAGA 2Q9UA 3NHKA 4YBRA 3LPAA 1T8PA 2F90A 2YC2C 3MUOA 3W9BA 3LT5A 2WTNA 4JUDX 4IHKA 4MIEA 2AOWA 5DYGA 3HXMA 4DC9A 3WKAA 5THKA 1C3JA 3DGEC 4BO6A 3UJ3X 2GS9A 1BROA 2VT2A 1PYOA 1HDRA 4TQGA 1VHLA 3IUPA 1JDBB 2EYUA 2I99A 3HCDA 4E31A 1PAUA 4MMYB 2NTYC 1BR1A 2J67A 5BN4B 1EEXB 1VCIA 5T6MA 4IIBA 3RLIA 4HUJA 4NCJA 3A2LA 2VAPA 3HFRA 4N8EA 4BVEA 2Y1FA 2WBLC 4Z7OB 4KQHA 3H5AA 2DECA 2PL3A 5LP6F 3WMFA 1UXHA 3V8RA 5CEJA 2VN8A 3BCHA 4Z86A 2B6NA 2R8EA 2D7DA 1YZQA 4WKCA 4CM7A 4LY6A 1DBQA 2DY0A 2AG0A 2RE8A 2HMTA 4B6OA 3Q2IA 1Z6PA 1HQCA 2W0MA 4FEEA 5HKBA 5KMGA 1WN0A 4X1IA 1WUTA 2IW3A 3W79A 3MHTA 1JLLB 3MA0A 5HUJA 4IS3A 4RFSB 1DU4A 2XF8A 2APJA 3NTOA 4JI6B 3Q6IA 1FFGA 3NPMA 2RGRA 1K6MA 2EPMX 4KE8A 1W2WB 4ZYUA 5DM60 2GCIA 4K0KB 5AW8A 1AT1A 4EJFA 1DAHA 1IXYA 4J7UA 2R4QA 2WR8A 3HLTA 3NM4A 3RU2A 4DIOA 5CK4A 2I80A 2W37A 2XECA 2QTFA 1SD5A 2HHJA 2Q3BA 1O89A 3JAKB 1QIMA 2YZNA 3PHGA 3RS9A 2GJKA 5BWMA 3OHPA 2YIMA 3JWIA 4NAHA 5LNK1 5KTYA 5ECWA 2MOKA 3JQAB 3QBVA 3BGIA 5TY0A 3DXXA 1FFAA 4H3VA 3GRCA 4FW8A 4MGHA 4CIYA 4IF6A 1EHYA 1RHMA 1DFHA 3EXHC 2C9YA 1AV7A 1I51A 4N01A 4HLUC 4YAEA 4ARZA 1GAWA 1LDBA 2OBNA 4RXUA 4AQDA 2KSQA 1TF2A 2QT0A 4I55F 3PRYA 3NT2A 4DG9A 3TM5A 4J29A 4CCYB 3QVWA 2DHQA 5KHLB 2QORA 1U2ZA 2ICWG 1JVSA 5EJ8A 3STHA 4XIFA 1AA9A 2A1IA 1NW5A 3ZIAA 4DLPA 3Q7RA 3IUNA 3OPXA 3AKYA 4CDRA 3CG0A 3C3JA 4TM8A 4TXLA 1OW7A 3FHTA 3HCBA 2VHTA 2BEJA 3VC2A 2Z4RA 4AS3A 4DIDA 1X7ZB 5ELXA 3G6KA 3DM5A 3BBPA 2O8BA 3N75A 2IV3A 1YZLA 1IJFA 2NYAA 2JI4A 4D4XA 3ENZA 1VC2A 2D7CA 2XM0A 4F5ZA 2I2DA 3LL4A 3PEEA 3C48A 1JPUA 2B7CA 2QJFA 1QJCA 2HA7A 3GIDA 1Z6ZA 3FWPA 4NTAA 3KKOA 4YJHA 5HCUA 3HTXA 1Y0BA 4OY3A 3L6UA 4DDUA 3Q15C 5AMXA 4CKEA 3S4YA 5DU2A 2OE2A 4XVHA 5DX1A 2VSFA 1XMJA 1FPMA 3N2KA 2ZYRA 4N6NA 2EZTA 4MUKA 3RVLA 3A27A 4MI6A 2UZ0A 1DIGA 1FLAA 3UTDA 5EWJA 1UK8A 3CX7A 3BL6A 3AMVA 3KB8A 1Z34A 1I3LA 5I7AA 2PFKA 4DSAA 3ZD7A 5KWJA 2VNJA 4W8PA 4W5NA 5K4HA 4NNOA 3ZWQA 5TPZA 5CLLA 4KUEA 1SVWA 1ZH8A 4RGVA 5ALEA 1B2LA 2VRCA 3PX2A 4RPHA 3O2SB 2ZANA 3IQIX 4J7CA 3MJTA 3A0UA 2A35A 5DNAA 2R65A 1X1QA 4N41A 4NDNE 1NQOA 4B32A 3LWBA 4JKOA 2BGGA 3N28A 2BFNA 4HNVA 1Q0TA 4FEYA 2WFMA 4CM9A 1RRVA 3HKKA 3CZ4A 2CBZA 4OQNA 1G8AA 3ZDDA 3QRWA 3UJDA 2FPIA 4ENRA 1N6IA 3LWNA 3KKMA 3PEWA 1NRJB 5D91A 3A58B 4A23A 1UC5B 2NVWA 5THQA 3G9QA 1UP6A 2XEDA 3IDSA 1R3DA 4JTAB 4B6PA 2JJ1D 1JNXX 2V7TA 4MWTA 3D7SA 3GUHA 4GBMA 4AE4B 3TD9A 4IWBA 1L7QA 1SXIA 2P78A 3EZYA 4IOMA 2GN8A 1Z8FA 2CW0F 3CVVA 5BYBA 1B0PA 4FN4A 3SF8B 4FS3A 4QM7A 1R6TA 3HUFA 1NVTA 4I4LA 5AM1A 3QKIA 1Y9DA 4FWVA 4NIMA 2XBUA 4WFKA 2IU3A 2VDWA 5BV0A 3PKJA 3RF7A 1PEDA 1F8UA 1RAFA 4FYVA 2PQMA 2R2GA 5H70A 4M87A 1A4UA 1JP7A 2R7RA 2FRDA 4OAOA 2ZIGA 1PUJA 3H75A 1QKRA 4JA2A 4D92A 3R7NA 1VJGA 2ARKA 1VSUA 3MMZA 3QQPA 3V00A 4U2EA 5ERGB