3DM9B

Structures and conformations in solution of the signal recognition particle receptor from the archaeon pyrococcus furiosus
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
319
structure length
305
Chain Sequence
SMFGKLREKLKSFVKRVEEEVEKETVEIKEKDVDKALDELEIDLLEADVALEVVDALREKIKQKLVGKKVRIGTDKGKIIEEAVKEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTAGRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPILFVGVGQGYDDLRPFEKEWFLERIFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Signal recognition particle receptor
publication title Structures of the Signal Recognition Particle Receptor from the Archaeon Pyrococcus furiosus: Implications for the Targeting Step at the Membrane.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 105
structure length 305
sequence length 319
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00448 SRP54 SRP54-type protein, GTPase domain
B PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3dm9B01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3dm9B02
1OXXK 2AK3A 3AEZA 3THWB 4Q4JB 4YMSA 5DNYB 4G5QA 5AK0A 1XJCA 4RD6A 1PUJA 1KMHB 2I1VB 4BZQA 3THWA 4Q4JA 1AK2A 3B1XA 3QVUA 1S3SA 1UPTA 4XJXA 5TV2A 1ZMXA 3H0KA 5BYJA 2J0UA 3AM1A 1NN1A 4B3CA 1SVLA 1W46A 2ZQ5A 3LXXA 1V5WA 2AHOA 5CJPA 3KFVA 3PUYA 1W0JA 1DEKA 1ELOA 5J4YA 4PHFA 4LJ7A 1U0JA 5EZ5A 4B33A 2BM0A 4LHVA 1G19A 1AQYA 1G3RA 2ZRDA 4PZZA 2WJVA 2AR7A 3KB2A 3U7GA 1OH5A 1GRNA 2Z4RA 4QKQA 4UXHA 3REGA 3THYB 1G4AE 4LYAA 1N25A 4B6EA 4HUQA 4E03A 3THYA 1SXJA 3KDSE 1X8LA 1JQLB 5F9HA 4G1UC 1XEXA 4JL5A 1NLYA 3I32A 3ZIAA 2WJJA 4B3GA 2GWHA 2BV3A 4CIDA 4C0SA 2ORWA 1SVKA 3BORA 4OK5A 1EFCA 2FFAA 4C2UA 5E95A 4A6PA 2ZSDA 3N70A 1XTKA 2X8AA 3KJIA 4NL4H 5G40A 3C15C 4B3FX 4DVGA 1R6BX 3KQKA 1J7KA 3C4JA 1ZM3A 3NBZC 4MYHA 1KTVA 4QGHA 5DI3A 1LVGA 4KO8A 121PA 4D0GA 2ZYUX 2CL7X 2ATXA 1G4UR 2G1KA 4HAXA 5DN6D 4G3XA 3EZ7A 1AKYA 4OQMA 4A92A 2QTFA 1QZXA 1WRBA 4PAQA 4TMXA 4DUGA 3LVQE 2FPLA 4KI0A 3TIFA 2G0NA 1Q22A 1TQDA 3E5HA 3TJZA 2CMKA 2ANBA 3Q8XB 4TQ9A 3RS2A 3UMRA 5JHGB 4CDGA 2JLQA 4U02A 1CRPA 3IIKA 3ONWA 1P5ZB 2GZDA 3CWQA 1VKJA 3SN6A 3M0EA 3N2EA 4LBVA 3W34A 2PZFA 2W2VA 4N3NA 5BN4A 5LD2C 1WDTA 1IONA 4IKEA 3HR7A 1IQPA 3L43A 2DFNA 2QN6A 4IOLA 4G5RA 4P4SB 2VHTA 2FJUA 4PSVA 4PQRA 1KI4A 5KSZA 4DIDA 3WMFA 1OXUA 1E1QD 2J9RA 3K0AB 3HU1A 4MKHA 4I81A 1U94A 3AP3A 1YR9A 1GL9B 3X1ZA 1F48A 1Q12A 2IT1A 3BH0A 3VHXA 1XPRA 4JLVA 1KK0A 2XGJA 2GESA 4IHQA 1G3QA 4CVNA 2G3YA 1XD2B 4NH0A 4F93B 4NPHA 3EX7C 2YHSA 1ZU5A 2FA9A 4JLDA 1BMFD 3UPUA 3T12A 2AX4A 4CRWB 4NKRA 1NN0A 1BYUA 4RZ2A 2AXNA 4QJ4A 1ESNA 5H1YA 4R71A 1ZRHA 3IHWA 1XU4A 2O52A 4JVSB 4CZ2A 4RFSA 1NIJA 1OFUX 2GK6A 3B5JA 3GJ7A 1T5IA 5HCIA 2D74A 4V0ME 1KI8A 3T1QA 4B48A 1JR3D 5FOWA 1S2MA 521PA 1RFLA 3EAQA 3C5CA 3FOZA 4Q7MB 2G83A 2NGRA 3SI7A 3LBHA 2C2HA 4CGZA 1GITA 2GKSA 3IHLA 4QM7A 3L2OB 1B0UA 1IJEA 1E1QA 1MOZA 3I72A 5KNCA 1WXQA 4IEEA 4ERNA 2WAYA 2WBLC 3UATA 5CIWA 3B2EA 5EP3A 3T06B 2HT6A 4A0RA 2QT1A 2D2FA 4JBXA 4RD4A 2OFOA 1MO5A 5HE8A 3QENA 4LC1A 1HTWA 1XDBA 1CJVC 2DWPA 3ETLA 4DDUA 4QOSA 1OXVA 2QL6A 3AP2A 1AIPA 3A4NA 1KHTA 1E0KA 1OIVA 2A5JA 1XNJA 4OK3A 3VTKA 2GF9A 5AR1A 5K8LA 1UEIA 2GETA 4RFVA 3CIOA 2ZRLA 1JR6A 1NSTA 2C04A 2OO7A 3C8UA 5FR2A 3SQXA 1ZC4A 3TQCA 3ZVLA 2RGBA 1SVIA 4V0MA 3CX6A 3QEOA 1CJTC 2WSSD 1P61B 2QUZA 2DY1A 2EWWA 1Q1QA 2FSGA 3R7WA 3WHLA 3RAPR 3TW4A 4IDQA 2IYUA 2JJ2D 3GJ5A 2ATVA 1LF0A 3QPUA 1U99A 1E32A 4G5GA 3AVQA 5BN3A 4B73A 1HH4A 5EXSA 1T3HA 3KJHA 5EZ6B 2WICA 3SC3A 1X86B 4JBYA 2ZJAA 3HU3A 2OAP1 4R2HA 2FGJA 5AJVB 2JLWA 2IYQA 2BBTA 5JEEA 4B43A 2ZS7A 3WMEA 4C2TA 5GVSA 3FKQA 1HV8A 4CEIA 5J4KA 1R0WA 621PA 4ZKDA 2HXSA 3IGFA 4LV8B 2DBYA 3BIFA 3QG1A 5JCPA 2GBLC 1SVSA 1RE0A 1E6CA 2ZYVX 4HAVA 3KKOA 1CU1A 1GTVA 3W5IA 2VL7A 2WJHA 3OESA 2GZHA 4GNKA 3U61B 1JPNA 1OB2A 1KK3A 2FMXA 1KJZA 1Z3IX 2WSSA 1Z6AA 4Z8YA 5JI2E 4GDFA 2PCLA 4FN5A 2A2ZA 2ZSAA 2V7QA 3BERA 1IY0A 1R4AA 2ZRCA 3P4YA 2OFXA 2Q3HA 3W6OA 1X3SA 3KKMA 4FWTA 1T3LA 1P6XA 3HYTA 3DZDA 1E9CA 2OILA 3ZZUA 2XOKA 4XVUA 2YINC 4CT4B 1U81A 2OCYC 3PEVA 3R9IA 3VR5A 1ZVQA 2O8FB 2RCNA 3K70B 4TYPA 3ND9A 3PCRB 5DYIA 1G64A 2JASA 2Y8EA 1XCMA 2QG6A 1SGWA 1R0YA 4JKIA 5DGXA 3GJ4A 2O8FA 3VX3A 1PZNA 4RKFA 5TVKA 3VKWA 4YQFA 1XXHE 3CF6R 3LAWA 2D7CA 1G3IA 4MRPA 1FQJA 4GOXA 2R6DA 3RSLA 1YE8A 2FG5A 2Z4SA 4P31A 1SZPA 2AFIE 3DKVA 2L0XA 3AF1A 2WPDA 4IEIA 5HTKA 4EFMA 4MDEA 5L3QB 3ZZTA 5E7JA 4NYJQ 2GCOA 4JLPA 2CHGA 4LJ5A 1S4QA 3ZVNA 2PJRA 2OXRA 4RD0A 4JL6A 4Q9IA 4KU4A 1E2DA 3KXKA 4FMBB 4PC6A 1PLLA 1L7VC 2WKQA 3QOFA 1NRJB 4R7ZA 5JEDA 1JB1A 2QE7D 3NEYA 4B74A 3ZDQA 2P2LA 3DEFA 2YKGA 4RD1A 5GJVC 4E5UA 2KI5A 2WTUA 2ZSBA 2XZPA 2QRZA 1R0XA 3FKSD 1ZD1A 1YJ5A 1YRAA 3FWYA 2ZRFA 1T4GA 3NBYC 1XXHB 2GA8A 2RHDA 2ZR0A 4WZ6A 1G17A 4ACAA 4C4PA 4CT5A 1I4LD 3OEED 2VLIA 2XNDD 1W4BA 3QE0A 2FU5C 4BFUA 4TLAA 4G5OA 1GL6A 1N3BA 1E2JA 4AD8A 1OF1A 2ZJ2A 2ZE7A 3P32A 1Z2CA 1KJWA 2OHFA 2YC4C 4M9QA 4M9XA 5FBQB 5HZHA 5EE3A 1P62B 3VR4A 4BUJA 1Q1EA 1QHHA 3QEJA 1YR7A 1EXMA 1KYIA 2WWIA 4RD3A 1ANKA 1SXJC 1VDZA 2Q21A 3NHBA 3QXJA 2OM2A 3MSXA 3AUYA 3P20A 5EE1A 4CEJA 3L0PA 4D4KA 2ZE8A 3BXZA 4H1VA 1XMVA 3G82C 2RB4A 1L4YA 1P2SA 5C18A 4OHYA 2WWYA 2NPFA 3LWNA 1KY2A 2IYYA 3B1ZA 3AVYA 4MUBA 3FMFA 3KZ1E 4KFUA 4YLGA 3UXMA 1MO3A 1MKYA 2YOGA 1E2NA 1HURA 3TR5A 4XTCS 1FUUA 1AS2A 2WAXA 3BB1A 3FKSA 4YXWD 4ZDIA 5BWMA 3UANA 5JHHB 4LZZA 1ZNYA 1DARA 1S3GA 1YR6A 3B6EA 1E0JA 2XNDA 2A9KA 3K0CA 1T3SA 4QXAA 2PL3A 2PBRA 3SJBA 2IS1A 3MWYW 1TMKA 1J2JA 3B9QA 4MYCA 5M04A 5B2ZA 1DE0A 4Q48A 3QKSA 2J59A 5EE0A 4CYMA 4TL8A 1M7BA 3FMPB 4D26A 2C99A 1ZD9A 4PPFA 1DAMA 3LX5A 4O3MA 1W1WA 2V1XA 4MA4A 1MH1A 1A2BA 1N6OA 2O8BB 3BWDD 1DADA 5TARA 4WAUA 3U44A 3KFXA 4HLDA 4JIMA 3DOEA 1F3OA 4URVR 2DHRA 2ODNA 4HAZA 4TZ0A 1S9HA 1IOZA 4FINA 3L0SA 4PZLA 2HEIA 2VHJA 4KJZA 2NOAA 4PX9A 4QRHA 4LCBA 2VHUA 4Q03A 4US0R 1NG9A 1QHNA 4TLCA 4Z1MD 1CJUC 3GEHA 4HLCA 1J8YF 4C0JA 1OFTA 1ZCBA 3I5YA 4HZIA 2V9PA 2VP2A 3A36A 1OFHA 1OH6A 2IYWA 3CM0A 1OV4A 4BLTA 3CF0A 1J70A 1UM8A 4YXWA 5FTKA 4QHYA 2C9YA 3QXHA 4DB2A 1KIMA 2F7SA 3CW2A 4BEJA 3CZQA 3A4MA 2Z0MA 3CNNA 3HDTA 1YZLA 2GJ9A 3HPQA 2RGCA 2PH1A 3FFBA 1LW7A 4V0LA 2D06A 3TVTA 5FI0B 1N6HA 4QHSA 3BFVA 1GRQA 4Q1BA 1LB1B 1IXZA 4L16A 4W9MC 2G0TA 4IVQA 4K81B 5DSZA 2NO9A 2MSEB 4W7SA 2X2FA 4QBFA 5CLQA 2ZROA 3AF0A 3P27A 5C4MA 4OHVA 1ZAKA 3GLGE 3BC1A 1A2KC 2KSQA 2ZI6A 3ECCA 1W36B 2A7QA 2BMFA 4TYNA 1G1MA 1G7RA 3F0TA 2P67A 4I1VA 3T35A 2XJ9A 1NLZA 4XWOA 1VHLA 4CEHB 1ZNWA 4PPQA 2NG1A 2QMUA 4DB4A 4RSGA 1XTQA 2BBWA 2BMDA 4BFWA 4KXFB 1KO1A 1K5DA 3ICQB 3AKCA 5FTLA 1WQ1R 1ZNXA 2GEDA 1YHNA 4Q1EA 4U7DA 1GKUB 1EX7A 4DC9A 1HEIA 6Q21A 3QI2A 3U7EB 5SZHB 4QFMA 4B3BA 5KHOC 1KNQA 2W6JD 2Q3FA 8OHMA 5TY0A 1J99A 1OKKD 5C2JB 2V4ZA 4GOJA 4P4UA 2JDIA 1GG2A 1EFRA 5G41A 5JSZB 4P4TA 4OQXA 3R8FA 1YR8A 2WOOA 2PX0A 1G6OA 5JSZA 3GLGB 5JJLA 2AKAB 4I1SA 5BN5A 2IS4A 5JWOA 2C9OA 3OIVA 1P4SA 1Q57A 2EFGA 2IW3A 1GKYA 2R6AA 2XTMA 2ZRGA 4X8LA 2ZRMA 4DT1B 2QENA 3CPHA 4Q1DA 2YV5A 3O8CA 2QNRA 1KK2A 5AWFC 2J41A 3MUFA 4LJ6A 3AVUA 3MRSA 4WXPA 4JBWA 1AZTA 1FP7A 3M4YA 3FMOB 1ZUNB 4Q47A 5GJWC 4URYR 3SYKA 4I4LA 1F2TA 3SJAA 5DO9A 4NCNA 3KB1A 4MKGA 4ABYA 1KO5A 3KQHA 1GP2A 3TK1A 1CKEA 2ZJBA 2C03A 2C95A 3I3SR 2W6JA 5J47A 1GAJA 1KSGA 2QY9A 1OKKA 1NY6A 5D3MA 1HT2E 2EWVA 4KSCA 1FPMA 2W6ID 2N1BA 3Q9LA 2W0MA 2HV8A 3B7GA 4M4SA 4A0HA 2R2AA 3ICEA 3BGWA 3LD9A 4W5HA 4PQFA 1HQCA 1R8SA 4JVLA 5A5GA 4BWYA 2CNWA 1VG8A 2FWRA 4MYTA 3SDZA 1N6RA 2P6NA 3KQNA 1WBDA 2W0SA 2ZSFA 1CULC 4KVAA 4QNRA 5GADl 4GRAA 4R9UC 2JIZD 1N6KA 3QNUA 4LYJA 4Q01A 1PLJA 2BM1A 3BH7A 3EZ2A 3VAAA 4C0QC 1NN5A 1F60A 2CCJA 2GJAA 1XZQA 2I4IA 3GPLA 4RVCA 2IYVA 5F9FA 5AJXA 3QJYA 5JMTA 3V4FA 1F5NA 2HLDD 2RGDA 4O2RA 3PUZA 4IW3B 3SBEA 1TQ6A 2ZI3A 2ZU0C 4BZPA 1SHZA 1XBTA 2WJYA 4PC1A 1N0WA 4QGAA 1Z07A 1KKMA 1CS4C 1TPZA 2H18A 4A36A 2LKCA 4TSFD 2WJGA 4XVQA 4C0LA 5EE5B 2JLXA 4JYBA 1N5LA 4F38A 5B30A 1FQKA 1G16A 4XOIA 4Z8XA 4KLZA 2P5SA 4NE2A 5JFGA 4QNMA 1Y63A 1MABB 2J87A 2V3CC 4X8HA 3TSZA 4AURA 2FOLA 4Q9HA 2JA1A 3M6AA 3QF7A 2ZJZA 1Y3AA 1Q1BA 5HE9A 1T8UA 1X8KA 4URWR 2ZS9A 1I4TD 1UBEA 4H1UA 2HLDA 3EWSA 1GM5A 1W0JD 2ZR7A 2O8DA 1ZIPA 1JNYA 1Z6TA 2Z83A 4RCYA 3SFZA 4C7OB 2B7CA 1XEWX 4HI0E 2Q9BA 3C5HA 1E0SA 5SZKB 1E9SA 1E3MA 4ON9A 1X6VA 1YVDA 3SR0A 4XD7A 1G8GA 4HSEA 3PFIA 4TSFA 4MKIA 5IT5A 4EQ6B 1JJVA 2GXAA 1L8QA 2N42A 2IF2A 5EXTA 4PC3A 1XTSA 2QAGB 4TYYA 3W90A 2CK3D 1KNXA 4IDPA 4BLPA 2WKRA 2OSBA 1VTKA 2QAGA 1XEWY 3WRXC 3I62A 1WB9A 3ZIAD 4RZUA 1COWA 1E79D 1FX0B 3QQ5A 5L3SA 1KI6B 2VRWA 5KDDA 5CITA 5L3VA 3LDAA 4Q4AB 1FX0A 4FD2A 1VG1A 1EFHA 3K0EA 3FE2A 2QMOA 3EXAA 4BZXA 1A7JA 4JL8A 1KOFA 1KMHA 1N6PA 5FUYA 4R2IA 1W5TA 2OV2A 2CXXA 3K0CC 3W3AA 1KDPA 3MCAA 1Z63A 4Q02A 4A0GA 4L8GA 1RRGA 4QBGB 2DPXA 1E1RD 2GJ8A 3EC2A 2OBNA 1T0JB 4DCVA 5JLJA 5FFMA 2NMVA 2O5VA 4ILEA 2ZAOA 2RGGA 2GTPA 4M1KA 1TEXA 1SULA 4Q1AA 2VTKA 4KBGA 5FBLB 3QXXA 4HB0A 2IUTA 2R6FA 5EP1A 4DUGD 3MAAC 1E69A 2FSFA 2X1VA 2RGNA 1C4OA 5FL3A 1IM2A 3T1VA 2QMHA 3D8BA 4D82A 4F4JA 1W7AA 4B3XA 2IF0A 1NG1A 4A8JB 1XEFA 3EA5A 3HPRA 3LY5A 1CP2A 2CK3A 1SQ5A 1CXZA 4LJYA 1KO4A 4EUNA 1VPLA 4AKEA 1GILA 1E79A 1Z0KA 1RRFA 5D3QA 2YWEA 1Z22A 4DCUA 3DDCA 2CHQA 2WJIA 4IVRA 4NHOA 3THOA 1DPFA 2KWIA 3AF3A 1TADA 4HLUC 1G18A 3IBYA 3NC0C 3C16C 4G0NA 4RCZA 3K0FB 4A4DA 1P9NA 1OXSC 1FZQA 1DBSA 1E1RA 1JALA 1NLFA 3FMIA 4DLYA 1II9A 2GF0A 5HKKA 4GL2A 1BH2A 5AUPB 3LW7A 3RRYA 3OZXA 3TRFA 4YDHB 2JLZA 4MH0R 3I61A 1G5TA 1NSFA 2WZQA 3EZ9A 2F3RA 4HYYA 2J3EA 2ZS8A 3NBFA 3THXB 3E70C 4GFDA 4OHWA 3QKUA 3EG5A 1FUKA 4TTRA 1ESMA 2PLFA 3PEUA 2VSFA 2IUSA 1G9XA 5AUNB 2FZ4A 1P2VA 3K9GA 3T15A 5EP2A 3PJRA 4MGKR 1DG1G 2VHCA 4JLJA 1E2MA 3KKPA 4LPKA 1QHXA 3CKLA 2CVHA 3U7HB 3TAHA 1NIPA 2GCPA 2V8OA 3BBPA 3F5FA 4KCGA 4P4SA 4WVFA 5F98A 1N6LA 2Q0HA 5IK2A 5H8WA 4IXMA 4ACBA 1EWQA 3K0AA 3EARA 3CRQA 1XTJA 3SQWA 2NO7A 3JVVA 1OB5A 4QL3A 2RH5A 4JT2A 2GJSA 4BEBA 1HY3A 2UVQA 4ZDWA 1K5GA 1II8B 1SHKA 3E1SA 3TAUA 1A1VA 4PO8A 1CR1A 1XD2A 4GPTA 4L9SA 2B7BA 3S1AB 4BFYA 1NI3A 1G7TA 1DS6A 2P5TB 1ZIOA 3U3OA 4AI6A 2VP0A 1C1YA 1CR2A 1NVVQ 3BE4A 4AWXA 3CWZA 1WGWA 2ZITA 4P33A 2A3RA 2VYFA 3ZZ0A 4P32A 3CB4A 4Q7JB 5G53C 4AY2A 3L8ZA 1KDOA 1BOFA 2N46A 2XTZA 2JLUA 2H5EA 4LRWA 1FNNA 3IDQA 2BJVA 1WF3A 3ZS8A 2GILA 1T8TA 3RDPA 3B8HA 4OL0A 1RYHA 5B64A 3ADKA 3AUXA 4E07A 4D0LB 2KBEA 1XJ0A 4PO9A 1OIXA 2CLSA 1A82A 4DJTA 1D6JA 1UKZA 3K9NA 1JR3E 3PR1A 4NU0A 2ZAMA 1IN7A 1E9RA 2CEAA 5A4JA 2AXPA 3KTAB 4O25A 3WYGA 4DHEA 3LBIA 3LFUA 1VCNA 3ZGXA 3TGPA 3LV8A 1G41A 1UJ2A 5JJIA 2ZRJA 4WW0A 1M7HA 4KAXA 5HZKA 1Z47A 2IEZA 3SHWA 2GZAA 2BEJA 4X8MA 4BRWA 2OBMA 2TMKA 1EGAA 4B6FA 1X8JA 2BEKA 1KSHA 4KLNA 3J81k 3MWKA 1NBME 2WV9A 3QY0A 5EUQB 2H16A 5KU1A 3NC1C 4E09A 3I5XA 4OQFA 3WY9A 2V54A 3VQTA 4Q18A 3B82A 2NZJA 1E9BA 2A30A 1AS3A 1KJYA 3PUXA 4HEJA 1RPZA 2XAUA 3TNFA 2V7QD 4N1AA 2DFLA 2VP6A 2FFHA 4AYXA 3KJEA 4EKDA 1CR4A 4Q9KA 4IOMA 1X1SA 2FGKA 2XOKD 2I1QA 2ZREA 4LV5B 3HU2A 4MITA 2ODBA 5AJWA 3RLFA 1D5CA 2P0EA 4PC2A 4B47A 2HJGA 2J7PD 1CRQA 1TU3A 3A1TA 3EWAA 3WBKA 4TMWA 1LFDB 2JLVA 3VR2A 3K70D 1K8RA 4UXIA 2C77A 2ZYTX 1ONBA 3AH8A 3P1JA 1DAKA 2F6RA 1R5OA 1XMSA 3LLMA 4I1OA 1NNEA 1DAIA 4KITB 2O8EB 3RC8A 4EPYA 5LBIA 2J45A 5BQ5A 5HPYB 2WIBA 2YVUA 2WPDD 3Q3JB 4R98A 4BPBA 1GNQA 2GVDC 2XNSA 3B85A 4BRUA 4F91B 4B71A 3RS3A 1NBMA 1JECA 3OEHD 1GSIA 5ANRB 4O2LA 2WHXA 5JJKA 1ODFA 2BKUA 4M8NE 2ZRKA 1P7CA 2OLKA 4A2QA 1FW6A 5CB6A 2ZRNA 4EFLA 1S0UA 5GVRA 2J46A 4BQSA 4KYUA 4PSAA 1DTSA 2RHMA 3H86A 4DLRA 2AFHE 3CH4B 4I1UA 3CRVA 1TU4A 1N5KA 2J7PA 1DELA 4UXJA 2ZEJA 3VMFA 3GLHE 1NMZA 3NHAA 4M1WA 4FMDF 3QUSA 2QRNA 5JRZA 2PMDA 4HAWA 3VNUA 3QF4B 2ZYWX 3MWLA 2VQSA 1SVMA 2QQ0A 4DSUA 1DOAA 4PAMA 1QHYA 1W4CA 3FHCB 4B44A 4L4UA 1I2MA 2CL0X 1HE8B 3QPVA 1CJKC 2ORIA 2QTHA 2BIFA 4ZIRB 3G0HA 2CBZA 3NWJA 2LKDA 3LBNA 4LYHA 3SBDA 4Z54A 3RRNA 3UG7A 2AL7A 2ERYA 3TUIC 5C1BA 1E2FA 2BOVA 4PSKA 3B13B 4HUTA 1WBBA 2ZTSA 5KSPA 5L3QA 3OEHA 5FBRB 1Q0UA 2RGXA 1OHHA 5TMPA 2C98A 5KUTA 5CK4A 1W2GA 3HJNA 3OHMA 1AGRA 1Q20A 5DI9A 3WP0A 3MG9A 1OSNA 4JVMA 2DB3A 2GHIA 1GOTA 3F3YA 2VF7A 4YC7A 1WE2A 3RHFA 4Q1FA 1E9EA 1P3JA 2A5DA 4JLKA 5TB5A 3WBJA 1SVOA 2OXCA 2ZE6A 2X19A 4OHXA 1E2IA 2PZEA 3UMFA 3IQXA 2CCKA 3U6BA 2OFWA 2WWGA 2IK8A 1IJFA 3GLHB 3ND8A 2VO1A 2J7KA 2ZM5A 1RKBA 4Y0VA 2GXSA 2Q9AA 1FMLA 2R44A 3AF2A 3AV0B 1RRPA 3ZD7A 1G21E 2JAQA 4GT1A 4QGFA 2VIIA 1XXHA 1HQYE 3PVSA 4HATA 3PG5A 3WHKA 2IA5A 1AA9A 3BS4A 4TT3A 3R9WA 4H9GA 1Z28A 3D31A 4DRZA 3G5UA 1RJ9B 1VG0B 1T5LA 4C0HA 3U3KA 4G5SA 3LX8A 2IYZA 1OH7A 1P9RA 2RKOA 3IQWA 1D2EA 5BW8A 1AN0A 3A1VA 1QVRA 3P4XA 4NYJR 1Z0DA 1W47A 3DMNA 4V03A 4G01B 3ADDA 4A15A 2W2TA 1H65A 4NYMQ 2E87A 5FTNA 5DE3A 2IL1A 5FPHA 2CE2X 3W9YA 5L3RA 1W4RA 3FDIA 1IXSB 3RYTC 2O8CB 3PEWA 4PTLA 1E2EA 4DLVA 2O8CA 1G5RA 3I8SA 3SFVA 2CJWB 4LHXA 1KGDA 2VEDA 2Q6TA 2O0KA 2J0VA 1XP8A 2YWFA 3NXSA 2ECKA 2F1IA 4GZMA 4LHYA 3PEYA 1HE1C 3T5DA 1Z29A 4ARZA 2WWXA 3B1YA 1U8ZA 5L8VA 2EW1A 2OG2A 2PJZA 4XVRA 2CHVA 2NZ8A 3W6NA 4B2PA 2ZRHA 4DDVA 2PLRA 4DBLC 4Y0AA 3PQCA 1BS1A 1TF2A 2IHYA 4POAA 3V9PA 1AJEA 2WIAA 4JT4A 4M1TA 4QBIA 3L82B 4LV6A 3T34A 1KI1A 3NIBA 2V1UA 1PJRA 4DLUA 2XZOA 2O8BA 1KI7A 5CYPA 4BE7B 2OBLA 2EFEB 2IYLD 1E4VA 3JVUA 1P2UA 2QM8A 3LH5A 3OE7D 4PR0A 4V0NA 2JGNA 1NY5A 1S9DA 1XWIA 4PHHA 3VFDA 2CL6X 1EK0A 2QQEA 4HAYA 2A78A 5EXPA 4ESHA 2ZRBA 2DFTA 2C78A 4N0EA 1JXMA 4WIAA 4BFVA 4FXPA 3RS7A 3T61A 1Q44A 3A6PC 1ETUA 2EU8A 3GD7A 4XWAA 1TUIA 1Q3HA 3DVLA 3CBQA 1MRSA 2FSIA 4XWKA 2LCFA 2BKEA 5BXQC 2PZGA 4AIIA 3BJIC 4B34A 2K5UA 4OQLA 4DCTA 4OBEA 1NMXA 4PHTA 1E9AA 1Q21A 4QBHA 4KFSA 1NP6A 2HCBA 3KUCA 4JMPA 1G291 3RS4A 4TMVA 2JDID 1EFRD 4KODA 4TLEA 2QI9C 4URUR 1YQTA 1L4UA 3W5JA 2HYIC 4TZ6A 2JJ8A 3OE7A 3GLIE 1NJGA 3I73A 1KI2A 2VHQA 3TSOA 2I3BA 4NZYA 1EFUA 5FH9A 1ZUIA 2CLDX 3RRMA 3SYNA 5KYKA 2QBYB 3D3QA 4FIDA 4L15A 5H68A 5KO2A 3IEUA 1ZP6A 3UKDA 3CR8A 4BFXA 1RRCA 3V00A 4CEHA 4P0TA 5LD2B 3N2IA 3DMDA 3BFXA 1ZC3A 2VSXA 3CH5A 4Q1CA 4Q7LA 1IXRC 4EAQA 3PUVA 4OJQA 1KO7A 1P72A 3FGNA 2XITA 1TF5A 2AD1A 3L0OA 2BCGY 3PUWA 3GLFE 3QPWA 1IN4A 2XEXA 2ZIAA 2ZRIA 2IYRA 4YONB 3HWSA 1P60A 1PVOA 2VF8A 4JLAA 1TL7C 4MKFA 1JXOA 4U00A 4ZDKA 2B8WA 1H8ED 5JS7A 3RS5A 2A5YB 4MRRA 3U5ZB 3DPUA 3IKJA 2XZLA 3CPJB 5E7IA 1JAHA 3CR7A 2BBSA 3GLIB 2ZUBA 1UFQA 1G3MA 4V0KA 2CDNA 3DZ8A 1TQ2A 2CNWD 1KO8A 4URZR 3GLGA 2ZI9A 3GLIA 1OJLA 4XTRA 1VECA 2FEOA 3B1VA 1LS6A 4DT1A 3U3JA 1ZINA 2X2EA 4PANA 3O8RA 1OPXA 4LSGA 1BIFA 2HJVA 2DYKA 1T6NA 3CO5A 1NVUQ 4IJMA 2VH5R 3GJ6A 3Q7PA 4F7WA 1Q3TA 2XJ4A 3TH5A 1N6NA 3FFAA 3T1OA 1DO0A 2IS6A 2PT7A 1G8HA 1US8B 1YZTA 3GLFB 1LF5A 1XD8A 1ZNZA 1JAIA 1CR0A 1XTRA 5CDFE 3QKRB 1S96A 1EESA 4AKIA 1U0HC 1H8EA 3U3RA 4N0DA 4Q21A 1MV5A 1Q1ZA 3X1XA 3FTQA 1EX6A 2BMEA 5K8TA 3NKVA 4B2LA 2A5FA 4MGIR 3UMSA 2MMGA 3TKLA 3Q5EA 4A6XA 4TTQA 4Q5IA 4BLQA 2F9LA 2ZI5A 3B60A 2VPPA 3CZPA 3H2YA 4IFEA 4MDFA 3KXIA 3OAAD 2IXFA 3BH6A 4AKGA 1S8FA 4NYIQ 2GK7A 1TQ4A 3K9LA 3K70C 3RRZA 3IO3A 3ZQJA 4EJSA 3IIJA 3IO5A 4M22A 3ZJYA 1M7GA 2NO0A 5BYKA 4Q9LA 4FCWA 3TVDA 2B6HA 3Q7QA 3B9PA 3W8RA 4D80A 4US1R 3VNVA 1IN5A 5K8UA 3BB4A 1T91A 3QXCA 4TLBA 3QXSA 3DL0A 2VA8A 1M2OB 1W0KA 1YU9A 1KSJA 2D3WA 2FH5B 1JJ7A 4XD7D 2HUPA 3QKTA 4TYQA 1E2PA 1NVXQ 2WWHA 3QIAA 2GCNA 2BWJA 2YYZA 4HB4A 3WNDA 4NDZA 5EE9A 4JLNA 2QA5A 4FMCF 1SVWA 2ZANA 2QZ4A 4D4MA 2OEPA 5IHPA 1K6MA 2IXGA 1C9KA 4Q4HB 2OUKA 2C5LA 4CF7A 1COWD 3AF4A 1IBRA 3WYAA 2GBLA 1UKYA 2R8RA 5KSOA 3OAAA 5IRCD 1N6IA 3CLVA 2FV8A 2RGAA 3CUEF 4TLDA 1FP6A 1CTQA 2F1JA 1MABA 3HP1A 3BK7A 2C8VA 4TMTA 4K8OA 3OIUA 2ONKA 4FCTA 4BASA 5K8IA 1VIYA 5FBVB 1MRNA 4A2PA 2NIPA 2OCAA 4HZUB 4JLBA 3EPJA 4DKXA 2XX3A 4C7OA 4NCJA 1UEJA 4RJLA 1HA3A 5F2EA 2GAOA 1UDXA 2GDJA 5CYOA 4PC7A 2WWFA 3NBXX 4KVGA 3MD0A 4YMWA 5FPTA 3W3ZB 2HDNB 3TUZC 2YWHA 4OQNA 3RS0A 4EQ6A 4KFRA 2GVZC 1MT0A 3GJ0A 3VU9B 4ZV4A 3B78A 1UF9A 3IPYA 2FDCA 1QF9A 2RAPA 2ANCA 2VP4A 1LS1A 3VU9A 4LOAA 3WNBA 1Z8FA 1FMJA 4US2R 1ZM4A 3C14C 5CLLA 2O0HA 2Z43A 1KI6A 3ZVRA 4ZKEA 1D2NA 4LJ8A 2D62A 2F9MA 4Q4AA 1P9WA 4FMCB 5C4GB 4LDJA 2JLSA 4Q00A 5B57C 1SXJE 2H7VA 2AD5A 5FUVA 5JS8A 1AKEA 1L2TA 5HKKD 4OI2A 3SZRA 1E9DA 4RZXA 2ZVQX 4FCVA 1S1CA 1YZKA 3TQFA 4P3YA 3F8TA 2E1RA 1TEVA 4AG5A 2GNOA 4PAOA 5J4LA 4LJAA 4K46A 2WOJA 5DHFA 3K9HA 1KSFX 4AC9A 2H8KA 2W00A 1JPJA 2GRJA 4F4IA 5DISB 1GNRA 2J0UB 2YC2C 1D8TA 4HB3A 1QG4A 2ERXA 3EZFA 3EASA 4JLOA 5KSYA 3RANA 1Z6GA 4A8JA 3RVBA 4MGYR 4ZDJA 4LY6A 3LRPA 1IN8A 2JCSA 1X1RA 5DLQC 4EDHA 1DAGA 1KI3A 2G9NA 4W5JA 4XIGS 3QG5A 5AUOB 5IK2D 2C9CA 3K53A 2HCJB 3A1SA 2P65A 1KMQA 4EPRA 1CEEA 2HF9A 2OZEA 4PQYA 4HUQB 2V6JA 4DCSA 1SXJB 4LWZA 2PX3A 4LBYA 5DHAA 2NQ2C 4O0MA 1XEXB 2A5GA 2J5XA 1Z06A 4LJ4A 3K0FA 3R20A 4PO1A 4OI4A 2P3SA 5ELXA 1ZU4A 4A82A 5E3HA 5JBQA 3C7KA 4X8OA 2FFQA 2IC5A 4UNQA 2GXUA 2C96A 3GQBA 5CJ2A 1AS0A 1TX4B 1E94E 3GEIA 4NMMA 2QGNA 3THXA 1Z0FA 5G3YA 1W2HA 3SHFA 5DI3B 3U3MA 4EPVA 1BYIA 4HAUA 2OAQ1 4B35A 1VIAA 1GZSA 3T5GA 3IILA 2FFBA 2JLRA 3HR8A 3NTUA 4GSYA 1QBKC 1P75A 3JZMA 2WSMA 2FE4A 2QTVB 3TE6A 1E0AA 4PPGA 3CONA 2KJQA 3U4QB 1W36C 3SE0A 1M1YE 1ZM7A 4PHGA 1FFHA 1WA5A 2FPMA 4ZCIA 3BOSA 4BGDA 4UNPA 3U4QA 4GBMA 4TL6A 4M1MA 3SOPA 4BFZA 2IXEA 2AK2A 2AWOA 3IEVA 4DLWA 3MFYA 2OT3B 1II8A 3TUJC 2W83A 1M34E 3S1AA 1QHGA 3H84A 2ZI4A 4BLSA 1VYTA 3LA6A 2ZSEA 2ZUDA 2FSHA 2IYXA 5FI1B 3Q72A 3RNLA 2H57A 4EPXA 1KDRA 1TAGA 4OK6A 2ZVPX 4GZLA 2GEVA 4C0AC 2CE7A 4IXNA 3NDPA 5DN6A 4QC2A 4NBSA 1E2KA 5KTYA 1AGPA 1N5JA 2YOHA 4W5WA 4RFSB 4M1YA 2QSYA 3NG1A 5IDVA 4ZI3A 1JEDA 1LY1A 1UAAA 4NTZA 4M21A 1OIWA 1GL7A 5CIQA 2JLYA 3IBGA 3VR1A 3GEEA 4B2IA 3KTAA 3U6KA 3UIEA 3AVPA 4MRSA 3ZD6A 1XFAA 4JZKA 5CB8A 1E9FA 1AZSC 2ZJOA 1OH8A 3KKNA 2D2EA 4M53A 1KAOA 3I8XA 5AUQA 1VG9B 3SU8A 4UNSA 3U7FB 1RIFA 2YNMA 1R0ZA 4LHZA 1G8YA 1BKDR 4HDOB 5A0FA 3NH9A 4JVNA 5JWRA 1N0UA 4TL9A 1NVVR 4MGZR 4DSNA 1NBMD 3X2SA 2W58A 4Q66C 4AKHA 1G8FA 1GDDA 1GUAA 1DAFA 2H1LA 1BMFA 1UBCA 3AVOA 4QJ3A 5FTMA 1TNDA 4F4CA 2IYSA 3VX4A 5SZJA 2WMOB 2QORA 1KI9A 4JS0A 1RYFA 2D7DA 3FPAA 3A8TA 5EJEA 4DEYA 4EJSB 1GVNB 1WMSA 3H4MA 1KZ7B 4DZZA 4EJSC 3W8NA 1IHUA 2EQBA 4L9WA 3GP8A 1JR3A 1OE0A 2EFHB 2IEYA 5EXXA 3EPHA 3R7WB 2EYQA 1II0A 3L0IB 4JLMA 1OYYA 1QRAA 5FL7D 4WXRA 1VCIA 3QBTA 3MWJA 1ZW6A 4PFSA 3AVXA 3KX2A 3KXLA 5SZIA 2QM7A 1U8YA 2LWIA 5TXGA 3TBKA 4UQOA 1Z0AA 1FTNA 1W48A 3MGCA 2ZUCA 2VSOA 2QAJA 2O8EA 2H92A 5FBWB 4OI1A 2FEMA 3ASZA 4V02A 4U5XA 5JRJA 3PITA 3MJRA 4IVPA 3SYLA 3DM9B 3ADBA 4FWIB 2ZJ8A 4B3DA 1TUEA 2VP9A 4CEIB 2JATA 2KB0A 4S35A 1QDEA 1SKQA 1OHHD 3X1YA 4AG6A 2NO1A 5G3ZA 1YZQA 4GMXA 1XCPA 1XX6A 2F43B 1M8PA 4C9BA 3UG6A 3OFND 4HLQB 1V43A 2B8TA 2F43A 5C46F 5AJZA 4DDTA 2P6UA 1E2GA 1Z08A 2YZ2A 5FR1A 3WMGA 3PV0A 4M2LA 3O8DA 1Z6YA 4QHTA 3EA0A 4NP6A 3AB3A 4PPNA 1XZPA 2HF8A 5FL7A 4A9AA 4D2IA 3CRW1 5JECA 2GXQA 3EIEA 4YMVA 2UZ3A 2UZIR 3N5CA 3KL4A 1PUIA 3VHLB 2JJ1D 1OW3B 2PCJA 2QP4A 2ZI7A 3QF4A 2JJ2A 3Q5DA 4DXAA 3KKQA 1U9IA 4D6PA 5GJCA 2ZRPA 2R6GA 2PEYA 5FPSA 3TMKA 3LW8A 3JZAA 2QROA 3D7MA 5TDHA 3MJHA 4TT3D 3SNHA 1W4AA 4YMUA 4ZIRA 2E9SA 3AVVA 3SJZA 2GJKA 5JI3E 4GP7A 1JBKA 3A1UA 2J1LA 4JJKA 1NF3A 1QG2A 4IDNA 4LPSA 4M9ZA 2BJWA 2QAGC 2DR3A 1UADA 2BVNA 2WWWA 4S2EA 2QU8A 2OCPA 1N2CE 3CF2A 2NPIA 2QPAA 3OFNA 4UNNA 4WZAE 5FOXA 3TLXA 3ZQ6A 1TF7A 4M9SA 2ZXUA 2OESA 2GCOB 4MQBA 4AYTA 1GIAA 1UKVY 1Z0JA 2B92A 2YJTD 1YRBA 2XTNA 1NL3A 3ASYA 3X1DA 2CVFA 3NDBB 3GLHA 3CPEA 1IAQA 2ODEA 2WMNB 4OI0A 3K1JA 4NONA 1KZGB 3E2IA 3VR3A 2JJ1A 2IWHA 2DCUA 3H1TA 3OF5A 4QJ5A 1BO6A 2QMEA 3ZVMA 3K8YA 2QGZA 1Z2AA 4FMDB 4M0LA 1DVRA 4DSTA 4KFTA 1I2DA 2RGNC 3BRWD 4KHZA 2ZETA 4QGGA 5LB4A 1OXTA 1QHSA 4Q9JA 1TTTA 2JEOA 2FX3A 1J90A 3NVAA 3FHOA 4ZI2A 1PLKA 1R5BA 3LVRE 721PA 2KBFA 3ZYCA 2AWNA 1RJ9A 3REFA 4A8JC 2BBOA 1NKTA 3K09A 1GRRA 3AKDA 5EQTA 1XB2A 1NMYA 1ZM2A 4LK2A 2DWQA 3LQQA 5EUMA 3TW8B 2ASEA 3RSOA 3GFPA 1DO2A 4DLTA 2BHRA 221PA 4TL7A 3KJGA 1S1MA 1QHHB 4UJ3A 1W5SA 2REXB 4BFSA 4PXAA 3QSYA 2P6RA 3AKYA 2G77B 2ZJ5A 3BB3A 3BD9A 1F6BA 4B76A 2F1RA 5FOUA 4A0FA 1E2HA 1HT1E 1UDWA 4BECA 4CEJB 1XPUA 2PMKA 1KKLA 1ZD8A 3QVVA 4LGMA 4Z51A 5HR5A 4LUCA 1DAHA 2CJWA 2RMKA 4JYCA 3ADCA 2OLJA 2Z6VA 3R8CA 4V0OA 3IIMA 2IWRA 3ZLJA 3U2QA 2QE7A 3EW9A 4TYWA 2DFKB 4UKDA 3CX7A 1CBUA 2ODWA 2BC9A 4EPTA 1OYWA 4B32A 1VHTA 3BFKA 1OFIA 3MLEA 4MYUA 4C3ZA 3U60B 3LLUA 5B58C 3LQRA 3RC3A 2HT1A 4M1SA 1N0VC 2HXYA 1A5TA 2EFDB 3AVWA 1OLOA 3OIWA 1T9HA 2ZPTX 3FHTA 3OEEA 2D4HA 1R2QA 4WBSA 2J0QA 3QKSB 1XRJA 1G6HA 1M74A 3X1WA 4AK9A 2FZLA 3DOFA 5UKDA 421PA 3WRYC 5KOYA 2BCJQ 5FOTA 1Z5ZA 2IHBA 2YOFA 1RZ3A 4NYMR 2X77A 1PV4A 4D25A 2F55A 1YZNA 2FPKA 5JZVA 4ZO4A 4WOPA 3O47A 3U44B 1W36D 1QHIA 3VKHA 1FNMA 3GMTA 4BLOA 1MO6A 4A1FA 4KYIB 3AQ4A 4MUAA 2R9VA 3LXRA 3MMPA 5J4HA 3B1WA 4IOKA 4WA7A 1VYVA 4NCHA 4WZBE 3W6PA 2NO6A 3I92A 1U90A 2REBA 4KV9A 1MO4A 4D4LA 4IRUB 5F3WB 2IS2A 5LDDC 1G3UA 1KDTA 3NEJA 3VKGA 4HDCA 1U98A 2O0JA 4HLUA 4M1OA 5AJYA 4II7A 2W2XA 3UK6A 2XSZD 1IY2A 1OT3A 5CK5A 4C30A 2ZR9A 2BMJA 1CIPA 2NTYC 3KQLA 1LNZA 4J0QA 1D9XA 1E2QA 2GEUA 2IX3A 1ZCAA 3EZ6A 1YZUA 2HYDA 5E7MA 3KUDA 1VCMA 2SHKA 3CRMA 4IFBA 3PIRA 2BDTA 4XH9B 1Z83A 3K0SA 4RY2A 2QBYA 1EG7A 4GMDA 1G5PA 1GWNA 4LI0A 1EFTA 3IPXA 1DAEA 3VR6A 1ZYUA 2XXAB 1FOEB 3LO5A 5DYGA 1XJQA 2EFCB 4RZ3A 2XXAA 2MMCA 1RVDA 4IDHA 3A37A 4Z1MA 4QG7A 2FN4A 1DG3A 2EVWX 2EYUA 3DHWC 5HCNA 2QEQA 4C0KA 5J4VA 1XPOA 821PA 1LTQA 1NJFA 2AN9A 2PEZA 4Q7KA 4DIEA 3EC1A 2MSCB 5FUWA 4IDOA 3EIQA 3GJXC 4ITRC 4OKSA 1JI0A 2QSZA 1T0HB 4ZCMA 3GFTA 4BFTA 3BAFA 3R9XA 3C41J 1CJMA 2G88A 2VP5A 1QVAA 2CCGA 3D6TB 3DO6A 4LC0A 1U2RA 3QBVA 1B23P 4FI3C 5IF9A 3EIHA 4JJZA 3M1IA 2XSZA 2Z5FA 3RWOA 3P26A 2FNAA 1M6NA 3CNLA 4ZPXA 5J5CA 4LJ9A 3SS8A 2CLCX 1FL9A 3TSWA 1A4RA 1JEEA 3AKEA 4GP6A 4LYFA 1SKYE 5J40A 1R8QA 2B21A 4LHWA 2IUUA 2WVJA 2VBCA 4KSBA 5GJBA 1NKSA 1G7SA 4TN1A 1VCOA 3AGPA 1IN6A 2G1JA 2F1HA 1Z0IA 2ORVA 4F92B 1R5NA 1GFIA 1E96A 4QM6A 1EWRA 3PXGA 1N5IA 2G6BA 4BLRA 3ZS9A 1KY3A 4Q19A 4UNRA 4NCKA 5FPYA 2ZU6A 1J8MF 1E98A 2OCBA 3AVTA 4DEXA 2V6IA 1US8A 4ESVA 1W0KD 3GLFA 4DSOA 4MRNA 2ZE5A 4C0BA 3SJCA 1UBFA 4B75A 3QKRA 2FF7A 1AQUA 3GJ3A 1F2TB 2MSDB 3KQUA 4I99A 4ARZB 1F2UB 1O3YA 1RC8A 1WP9A 3FYHA 1G20E 1XF9A 1KK1A 1F2UA 2QPTA 4EIWA 3A1WA 4HB2A 1ZUHA 4TQAA 1RW4A 1SKYB 3AP1A 3CRRA 3L8YA 1GNPA 5D3MB 1H8HD 1R7RA 2RGEA 4EPWA 1VYUA 2R6CA 5JCZA 3IUYA 5KDLA 3WNCA 4KBFA 4OJKA 1IY1A 4TQUS 1E4YA 1U9IC 1HUQA 5LB2A 5KNDA 2OE2A 1HYQA 4URXR 1CF4A 4RKEA 1XTIA 2UKDA 3FB4A 1ZBDA 3HYRA 1XCGB 4Q4LA 2GAAA 1P2TA 4ASUD 2XB4A 1P73A 3DKPA 1NVWQ 2PT5A 2WKPA 4EFNA 1JQJC 4TWZA 4JSTA 3O8BA 2Q3MA 4LBZA 4XSHA 1D2MA 4TTPA 5CDFA 4CW7A 1W44A 4YDSA 1E99A 5EP4A 4DLZA 3TR0A 2V55B 4AYWA 1FTSA 1G7CA 2YWGA 2XB2A 5JWHA 2WM9B 3NH6A 1R10A 2R65A 5CM9C 5FUXA 5H70A 4GOKA 3WXMA 4D81A 1YKSA 3UWOA 1MR3F 4Q4HA 2QT0A 4NCIA 1H8HA 4DWJA 4LX0A 1UBGA 1ZM9A 4TMZA 2W6IA 1ZJ6A 5FOVA 4L5BA 5FPKA 4NYIR 3GJ8A 5P21A 3WP1B 4D0NA 2IBMA 3I4LA 5KDOA 1G8PA 2R62A 5E4FA 3A58B 4TMKA 5CM8B 4DLSA 3GCGA 4UJ5A 1WCV1 4LBWA 4YMTA 2AKYA 2Q9CA 2QPOA 1U0LA 3FVQA 4ASUA 3PENA 5DIFA 2REOA 4HZUA 1AM4D 2JIZA 4PZYA 1Z6XA 3K09C 1YZGA 2J0SA 4ZCLA 3RWMB 4OYHA 1UKEA 2ZJYA 3EPLA 1GKIA 3UWKA 1CLUA 2QP9X 4FW9A 4DDWA 3DM5A 2O8DB 1O87A 4D4JA 2ONJA 2F3TA 4MRVA 1XD9A 2H17A 1I4DD 3SEAA 4IOJA 5LPNA 2IYTA 5FOSA 4OHZA 4HDQB 5KNBA 3RABA 2QP3A 1NN3A 4JKYA 4RD2A 3CX8A 4GI7A 3LNCA 1LV7A 5FTJA 1XMJA 4DLXA 3V4RA 3A4LA 1VMAA 1D9ZA 1KAGA 2ZRAA 5KPDA 3CNOA 3WYFA 1W49A 3GFOA 3OIYA 1E2LA 5KPJA 2KE5A 3Q85A 1SXJD 1XMIA 2DWOA 3AGQA 3ZH9B 4JSYA 3EPKA 5DH9A 5L3SB 4DCNA 1U8AA 3I1FA 4E22A 4A2WA 4XSGA 3T1TA
chains in the Genus database with same CATH superfamily
2VOEA 3L04A 4Y9TA 4QRDA 1L5MA 1HXHA 2I2AA 2OORA 1F8YA 4MIOA 2PUJA 1PWZA 4YQEA 3I39X 4YV2A 1NZJA 5K0LA 1NTOA 1NXTA 3KDSE 1XEXA 3I32A 2C3UA 3RM3A 2P11A 3JD3A 3CLUD 4CFZA 4FFNA 4CIDA 4AL0A 1L5KA 1M0SA 2FFAA 5JCOC 1IBMB 2LUOA 3JSAA 4B3FX 5FNVA 2WW8A 1WUHS 4F86A 1G4UR 2Q1WA 5B3AA 2QTFA 3H1FA 3HN2A 1QP8A 4TQ9A 4U02A 2HQRA 2WAOA 1OCOC 1U2DC 4BBZA 4BN0A 1C0LA 4I2VA 3HR7A 1DKPA 2VHTA 1B00A 4XVCA 4I2NA 4RAOA 1HX7A 3G88A 4BFLA 5KC8A 4HVLA 4E1AA 3C3KA 3BH0A 1EP9A 1HZZA 4RDAA 2FA9A 2JLAA 1G55A 4QJ4A 1ESNA 3QFCA 4DV6B 3B0VC 2L6GA 2HWYA 1PGQA 1KI8A 3AHIA 4JBHA 2WF7A 2FEPA 1B15A 4HH4A 1XZHA 2WAYA 5IUKC 2ETVA 2D2FA 4FOLA 1JG1A 4JXJA 5HKBA 4KN8A 3K73O 4LX8A 5AR1A 4M36A 4J0FA 1FS5A 3WMRA 3EJ6A 1SA0B 4Y9UA 1FP4B 1T2VA 3O21A 1L6RA 4ZO7A 5FWYB 2CXNA 4MKRA 3NO4A 3RRXA 1E1CB 2ATVA 1B14A 1E32A 5LUBA 4HN4B 3VYSB 3LEOA 1HH4A 4QUIA 5EZ6B 4I55A 1ENOA 5E3IA 4MTGA 2X22A 3HU3A 3ESBA 1X1BA 1XDWA 3HR4A 2GBLC 2IZOA 1TK9A 4WLNA 1E6CA 4HNGA 3TW0A 1B7GO 2DUNA 5GPGB 2VPTA 1WATA 3U39A 1XZNA 1KK3A 2FMXA 2A9FA 3AF6A 2JIQA 4O4JA 4RNDB 2EQ5A 2R6JA 5KTOA 2WFMA 2UUIA 5IDXA 1P6XA 4RA6A 2ZZKA 4BRSA 4CF5A 4MV5A 3JQ8A 2O8FB 3K70B 3PCRB 2Y3DA 1TOAA 2FAXA 3HGQA 3VKWA 3CF6R 4CV1A 3SICE 1UBHS 2BSAA 2AFIE 1T3TA 2V7TA 1VL0A 2ZJ7A 3FLEA 3UAYA 3OQVA 3FNGA 3DYBA 4Z53A 1SD2A 4P2GA 4NF2A 1TXGA 5JLIA 1L7VC 4GPIB 1OBVA 4J8PA 1Z2EA 4MUKA 3ZDQA 2P2LA 2EJVA 3NKFA 3BZWA 1RWQA 2IZZA 3NBYC 1G17A 2PU7A 3WJ1A 4YO8A 1UXHA 2ZJ2A 4JA0A 4IHAA 4C08A 3UAWA 1AKQA 2H9YA 3FW1A 5EE1A 4LE0A 2DUMA 1H5NA 1SELA 3G2QA 5KOJA 2NPFA 1KY2A 3TXYA 4HC4A 5DEIA 2M6LA 4K6OA 3JVEA 3I45A 1PW7A 1GNSA 2QTGA 2ZXWC 4BZZA 4ARZB 2A4KA 2IFTA 2OCKA 3HCPA 2IDMA 1KFEB 2BHLA 3KWFA 1A2BA 3K4HA 4HLDA 3DKRA 4GS5A 4HAZA 3QE2A 3OLZA 5AQ1A 2UZ0A 3GEHA 2BR3A 5REQB 2HRRA 1CE8B 4QLBA 2KQ9A 1P33A 2OGUA 4DB2A 3U1TA 3EGXA 5LMNB 1D1PA 3UN1A 4MJXA 4QHSA 3VKUA 1FMCA 3JYHA 1SD5A 1ESDA 4L16A 4R5HA 3IPCA 1TM2A 2ACEA 2FP4A 4J7UA 3AHGA 2I1LA 2KSQA 2I66A 4RO0A 2GUGA 3SQDA 2P67A 5LJLA 3V8VA 1NBBA 3CMCO 1SOUA 1BN6A 4DB4A 3CF4A 3BRJA 4Q39A 2XIJA 2C83A 1OZFA 3EXFA 1OC4A 1KR2A 4G5FA 4XUCA 3FPBA 1KNQA 8OHMA 4NPAA 3INTA 5K0JA 4H4EA 2VJYA 4B84A 4NZNA 2WDPA 1Q57A 1V8ZA 3NRCA 2QENA 4Q1DA 4EM6A 3ZQVA 4G4JA 1ZHTA 4X41A 1N7JA 3DBRB 3I3SR 5ILGA 2FJPA 1KSGA 1CEQA 3IAHA 3ZE8A 5FAKA 1VKRA 2W0MA 3T7JA 2JFNA 3TD2A 1VG8A 5HIJA 4H4CA 2HJRA 1TMGE 3HP7A 3KQNA 2IP2A 2QXYA 3KKKA 1DEAA 1X7XA 4UPVA 2D5CA 5CTJA 1F5NA 3QVXA 4V24A 5LLTA 4QOFA 4D44A 2O7NA 1PFWA 3U1BA 1Z07A 4QU0A 4A36A 4TSFD 4UAJA 4RGVA 4WINA 2C4NA 2HREA 1ZJWA 3KAKA 3C98A 1P1FA 1N8NA 2DPLA 3BM5A 2I55A 3BFPA 5BVHA 1EDZA 2JFBA 2ZJZA 4IM7A 5HE9A 3ICPA 2ZS9A 1KQOA 1A41A 3BXFA 1IVYA 1O9GA 1E0SA 3VH2A 5T57A 1WDLA 2J9GA 4QXOA 4BLPA 3WRXC 1XMQB 1G8XA 4LXXA 5L3VA 2JLCA 3VDQA 3U5SA 1EFHA 3K0EA 4UDVA 4OHKA 3FE2A 1KOFA 1M5RA 5ARDA 5A4DA 3KKZA 2G9QA 3I01M 3UOGA 4HDSA 2IUTA 3DE2X 3LC7O 5E6RB 3WYDA 3BEOA 1KEPA 4ED9A 1Z9BA 2YWEA 2YYYA 4DYHA 2HC9A 1A9XB 1LTHR 2OL4A 4V2IA 5HDBB 3UUWA 1A4IA 4RV9A 1IW7F 3U4MA 4DCPA 4MH0R 4G7OF 1SK9A 3IRUA 2V7PA 4BYMA 3EBPA 1VCHA 4WVFA 1DLIA 3RUAA 3K0AA 4B8ZA 3QZCA 3DB2A 1E84A 5ICGA 1SHKA 3E1SA 3ISJA 1A1VA 2Y69C 4LZAA 1N2JA 1QGED 5ENDA 3NRJA 1KA9H 3ZS8A 5A7FA 1L6IA 1YZCA 3F46A 1VLTA 2WVNA 4UUAA 1Y3CE 1FDSA 3OFSA 1QU2A 4LE2A 3T3MB 3ZXIA 4KTVE 5JJIA 3VSAA 3M79A 2VTVA 4MV3A 3T3EA 4DLBA 2QKYA 4OQFA 3TNFA 1PT6A 1UJCA 3UUEA 2AUTA 1UXJA 2HWXA 4LJSA 4F4HA 1IRXA 4YJ2A 1CJBA 1RR6A 1DJQA 2VRBA 4TTIA 3IIEA 3GAMA 2WAMA 5EYPA 3Q3JB 2F17A 4XQEA 2HBZA 3Q9NA 2CLEB 2F4NA 1KFJB 1DUVG 4ANJA 2AA3A 5AI9A 4E18A 1V54C 1OFVA 3VMFA 2HPAA 3QF4B 2XMZA 4R40A 1WZIA 2CB9A 2C59A 2JD2A 2AZ4A 1LTKA 2LKDA 3ZCUA 2ZBPA 3B13B 1OWMA 1TGYA 2ZTSA 3TB6A 2VBGA 5F78A 2W2NA 2QY6A 3HJNA 3TG8A 1H1TA 1ZQ9A 4AO7A 4QE3A 2P3QA 2V5AA 1HE2A 1ZVJA 3KE8A 1ZS9A 3ZE9A 4Y0VA 1TJYA 3SS7X 1XRPA 2Z95A 2Q5OA 4X7PA 3ID6C 1RXIA 4UARA 2RKOA 2HU5A 4I19A 4XX0A 1SBNE 2SCUB 3JWHA 1P3DA 2IOHA 2W2TA 2JHPA 1N2CB 2IL1A 5CVUA 2IKQA 2JHCA 2O14A 5HS6A 4DLVA 2O8CA 4ZT3A 1KGDA 3GWGA 5IKOA 5A05A 3WZ2A 5CCEA 4DBLC 2CHEA 3M4NA 1UBKS 4JP2A 3A7DA 5TQVA 3SG0A 3HC7A 3H6KA 5JSHA 2GO7A 3HXLA 4NAUA 4N0EA 4JITA 4EI7A 3IQ5A 2GCGA 5BWNA 3N8NA 4X95A 4U2CA 1S7CA 3CSUA 3OMLA 1HW2A 2Q3CA 2Y9PB 1CX9B 4ZYLA 1NP6A 1G291 1C3JA 2AE2A 2WFLB 4JFRA 1YQTA 3W5JA 1ULTA 3JS5A 2WD9A 1CFZA 1ULSA 3TSOA 3LWZA 2OMEA 2KSFA 5HK9A 1LI4A 3UKDA 4GVPA 4P0TA 1CG6A 5ERGB 1TA4A 1ADCA 5JAUA 4GLLA 4LY9A 2A7XA 4FWBA 3K1AA 3FN4A 4DMLA 4NI5A 4F97A 1L7BA 3W8FA 2IYRA 4YONB 3EODA 1TYEB 3ITKA 4U00A 1NQAO 4PS0A 5F35A 5B12A 4ZOLB 3EGOA 4UEWA 3E18A 3EQ7A 1G2QA 1UFQA 1G3MA 4ZVNA 1CSEE 1SZCA 4URZR 3GLIA 3BWVA 4DT1A 2H1RA 3ZCXA 2XZDA 2B1QA 3N0XA 2PLAA 4L0CA 1MX1A 2YIJA 1NF8A 3UMSA 5KINB 5T3TA 4O7GA 4XM0A 3IIJA 4M22A 5GGYA 3DEJA 1K7EB 3VNVA 5K8UA 3LBYA 1W0KA 4TYQA 2VJBA 9ATCA 2R7KA 5ALHA 4XOUA 4DJFC 3X2EA 1NVEA 1FRVA 5JSUA 3ED5A 5KSOA 2VJMB 5DNVA 2ZIXB 3N3AC 3FD8A 2W43A 2BEWB 1VPWA 2XS1A 4ZYXA 4FCTA 3NBKA 2QLFA 1ZN2A 1SMYF 4HZUB 4YGXB 1Y1KE 1AMUA 4NV0A 5FPTA 3G2IA 1L5FA 5A9RA 3UW1A 1LS1A 2Y66A 1L5ZA 3Q0IA 4IARA 4BMVA 3G13A 3BRCA 1PDVA 4Q00A 2O3RA 2J9FA 3LOUA 4JXZA 4DR2B 2YQ4A 1PK8A 3WICA 1XZFA 3FR7A 1WASA 2CFIA 1C0KA 2E1RA 4L72A 3EVDA 1Z15A 1DRVA 3HV0A 4WK6A 4LY6A 1RLOA 4AJ2A 5L7YA 1TAUA 1BX3A 2GBFA 1PWYE 3N8IA 2XNHA 3FBGA 2A5GA 5E3HA 1EVYA 2DULA 1ML4A 5CFMA 2FZWA 2IC5A 3R1IA 2HK9A 3VMMA 1MG5A 3MTDA 2I7XA 4HAUA 2VJQA 3CBGA 4B35A 4QVKA 3G1UA 3QNWA 1PGOA 5JD3A 4I8DA 3BOSA 2OBBA 5JLAA 3UNGC 2J9ZB 4P84A 2FAPB 3LZ6A 3TUJC 2EPMX 1OX4A 1I7SB 3S84A 3QPCA 2EIMC 2CDQA 3O84A 4I66A 3Q41A 4PCVA 3O2JA 1I7NA 2Q8NA 3RVZA 2PT9A 1YCFA 2P0YA 3CAXA 4JURI 1E58A 1UBSB 1GCUA 3KTAA 2I4RA 3UIEA 4YRDA 2ZJOA 4QWMA 3UCEA 4PX2A 1KAOA 4E2WA 1VG9B 3QFFA 4J2TA 4LHZA 4ZAZA 5D1HA 4YFVA 2G0AA 2WVOA 1Z12A 3AVOA 2WIGA 3QLUC 2GPWA 3L1VA 4PQGA 2JGKA 3JU3A 1LBSA 1N0IA 4HWRA 3W8IA 3RG8A 3GRFA 3MWJA 2QRUA 3MGGA 1HL3A 3HKEB 1Z4KA 4AXBA 3SYLA 2ODTX 3BMNA 1FFEA 2I91A 4B40A 3JPYA 4GR4A 1CVLA 2J9WA 3OFND 4Z4EA 2I71A 4MO2A 5ENZA 3PV0A 3O8DA 1EVQA 1Z6YA 4DY4A 1DCMA 2R8XA 4QARA 4D2IA 1WKBA 3N5CA 3IBTA 4COKA 1UOEA 2P9HA 4ESEA 3D7MA 3HZOA 1AXEA 1XZMA 5TDHA 3W5AA 1KJJA 3BYZA 2H1FA 4NE7A 1GYPA 1T3GA 5EJ2A 3IP6A 2SBTA 1DCTA 2QAGC 4PZCA 2E49A 3EFHA 2NPIA 5ECDA 4BMOB 3ZWIA 5JD6A 1P18A 2GCOB 4MQBA 5H4HA 1JVBA 1IAQA 4ZCRA 2Z30A 3HJHA 5E1OA 3RB8A 5MFZA 3K8YA 3S55A 4DQKA 3GA7A 4JOCA 1QHSA 2FQQA 1JJBA 3LVRE 4D56A 3S0JA 3HCFA 3KUKA 2L6HA 1NKTA 5EQTA 2G7MC 2FG6C 1W5SA 2R7TA 4F5DA 4CIVA 1Y3BE 1Z26A 4LGMA 4HEAJ 5HR5A 1U5BB 5CBPA 5AKXA 3DT9A 3EDRA 4OFZA 1G21A 4MPPA 4F2DA 3BRWA 4FT4A 4EB8A 3RF6A 2CGEA 5ALYA 2UUCB 3BGIA 3GXBA 1BX0A 4D99A 2ZPTX 3WGJA 5ELLA 1A9RA 3DOFA 3OWTA 3CVJA 5F23A 1PV4A 1HW1A 5A6BD 3U44B 1GA4A 4HQOA 4AJHA 4YRRA 4NCHA 3OEYA 1FDVA 1KDTA 2PR7A 4JC8A 3V5YA 2HSEA 5AJYA 1DKLA 1JDBB 2A0KA 1JWLA 1MB2A 3GQVA 5KWJA 4X1KA 3GN1A 1E2QA 2GEUA 5E7MA 1V95A 1PS8A 4Z4IA 3OOWA 2QBYA 4XDZA 2WYUA 4AJIA 2XGMA 4ZU1X 5DWQA 2P4QA 5JANA 4EHAA 1LBIA 4KUHA 2D1YA 4DTIA 4KGDA 1ZHZA 3R9XA 4YAWA 3GRCA 5J43A 4PYIA 2VK2A 3TSWA 3MQ4A 2ZBEA 2DAPA 2I80A 4RJ2A 2W70A 4CMIB 3MB5A 3C6BA 1IJKA 3ISTA 4IIFA 1G7SA 2Q4RA 1M6TA 1VJGA 5IH3A 4F92B 3KYBA 4Q0MA 4LTMA 1N5IA 1QO0D 3NT4A 3BPSA 2RFLA 1VE1A 3U3ZA 2Z9BA 4B75A 3R76A 1V8DA 1DKNA 4OOEA 5CAEB 1XF9A 4U4AA 4RS4A 1F2UA 2G8NA 1QTRA 4OSEA 2J85A 1N5MA 2B4YA 1NR1A 2OBXA 3HZZA 1UBNA 2UKDA 2POCA 5DXAA 3X43A 3EGEA 1CF9A 3Q2OA 2X9NA 1S2DA 4QAQA 2O50A 5CVDA 1MLDA 4I4TA 2IVFA 4U3JA 5B7PA 4Z0NA 1KH2A 2PUWA 2P9EA 2LCQA 4LX0A 3FPCA 3H8SA 1SUCA 2R6HA 4JP3A 1ONSA 5KDOA 3FCCA 2FW1A 3AI1A 2HGSA 3PENA 2YN2A 5DM60 2OKGA 2B4TO 2DUJA 3FMVA 4B6JA 5J2TA 3FWHA 2QP9X 2OPHA 1GAQA 5EMMA 2H17A 1VPDA 4OHZA 1IYZA 2ENUA 4ZK6A 1UWKA 2B78A 1QP0A 1EA5A 3A4LA 3AUSA 1VMKA 4MJ7A 3H65A 5KYYA 2XB9A 2QZPA 4R01A 3BDIA 5AK0A 4U5QA 3GYBA 5DS4A 1D1AA 2UYQA 3PJGA 2G76A 1V5WA 3UGJA 3RUFA 4PHFA 3IIIA 4LHVA 2OHXA 4Z7OB 1G19A 3KB2A 1T6QA 1KL7A 4U6QA 3B7WA 4GE3A 4IS3A 4W8KA 3MILA 1U9YA 1NLYA 1C5KA 3ZIAA 2Q8PA 4Y67A 4YPFA 3T41A 2Z57A 2YWDA 2Q4OA 3Q11A 4C4TA 4L02A 2M1ZA 1XTKA 1LI5A 1AVOB 3USES 1Y8QA 5DI3A 3PEFA 1TLLA 4KQ1A 2G1KA 4OQMA 1BFUA 4KI0A 3N2EA 4QYXA 4EITA 4LBVA 3FRIA 2PS9A 3LCMA 3EVCA 3JQBA 3HCBA 3Q1LA 1A7AA 3RVRA 3PQ8A 5TEVA 5HA5A 5B6IA 4E2YA 4QFDA 3DONA 1KPGA 4LYGA 1ZU5A 4HDMA 4TZTA 1SN7A 5F2KA 3MGAA 1IEVA 2GK6A 1J0BA 4V0ME 4EVSA 2XZTA 4ERXA 1I3NA 1M6HA 1TTPB 1OFGA 2NU8B 1MJHA 3ET4A 4RELA 3UATA 3B2EA 5F28E 3WTCA 1KJ9A 4YRAA 3U48A 1E7QA 4O0LA 4IY1A 2WYIA 4LZOA 3NFRA 1X92A 5IT4A 3BXEA 4EIYA 3VKFA 1OASA 5ESWA 3DB1A 1OQCA 1VE6A 1RKXA 3WHLA 4RJKA 1E8NA 4MWZA 1QK3A 5CG1A 1PEAA 3PCVA 1SUFA 4GI1A 4EHJA 1NOKA 5LWQA 1X86B 3O92A 1GU7A 4R2HA 4ENQA 5J1SB 5JEEA 2H4XA 4C2TA 1Q0SA 2QTWB 4LV8B 3M70A 5JCPA 4FOOA 5TS3A 2GEKA 2ZYVX 4MEBA 1GTVA 3KD2A 3UK7A 1FEZA 1C2YA 1NUHA 2QX9A 1K0UA 4DM3A 2WSSA 3AERB 3I2JA 5AJHA 3GFVA 1K68A 2PFDA 1X7YB 2O3UA 2H7BA 2RCNA 1GL3A 1VJ5A 1XCMA 1PFKA 4DNOA 3KEGA 3W2FA 5KVSA 1OZHA 4EFMA 2QJOA 1PW5A 3RH0A 4EYSA 4XXHA 1KDYA 1U7OA 3G50A 1QUEA 2HJWA 1S7GA 4ZVPA 5A9SA 4PC6A 2CN1A 3LNTA 3O4JA 2AFHB 2EBUA 2F3SA 2XZPA 3OCWA 2GBIA 2B1RA 3G1WA 3OEED 4B4OA 3H42B 3U4CA 3D2BA 3VR4A 1ILEA 3DXXA 5C8DA 1RZRD 3AUYA 2JIMA 1XCOA 4QOEA 4RTLA 5BWCA 2NU9A 2JB9A 2JEZA 3UANA 1T24A 3LHSA 4LDNA 3K0CA 4Q48A 1Q7RA 3E53A 1M7BA 2M6KA 1G59A 3KWMA 1XI2A 2XXJA 1F3OA 5IUNC 4G0ZA 4FINA 2NOAA 1CJUC 2VSQA 1QH8A 1OH6A 1OV4A 3CF0A 2DKNA 1ZGCA 4IRUA 2VPIA 3WGGA 3KOYA 1DJPA 1GQAA 2PH7A 4C87A 4DLPA 5KI6A 4HGPA 1L7QA 2JFYA 2ZBDA 3AGUA 4ZOLF 3PFWO 1YF3A 1K8QA 3WB0A 5LZ4A 4ZI7A 1JUDA 1KARA 5CPFA 1QV9A 1PWEA 3MS2A 3RRFA 3W9UA 2CW0F 1D2GA 1V39A 2XJ9A 4D9KA 1AMOA 5F7OA 3UB2A 1XTQA 3RYFB 1G5QA 3ICQB 4GP9A 4U7DA 3VH3A 3CGGA 4F6RB 3KTOA 3MJDA 3KKLA 4KNVA 1NV8A 3T7DA 1NJ1A 3S2YA 2FPWA 3JATB 4GZ6A 2R6AA 3SIRA 5JBNA 1QQ6A 4H0FA 4LJ6A 4PLWA 4C3EA 4CM4B 4MS2A 3N07A 4L0QA 4I4LA 1D6MA 1QGUA 1NT4A 1KMMA 1AZLA 4CLDA 3KB1A 4RW0A 4ZQEA 3JQGA 2JKZA 1KYWA 4DG9A 5HNKA 1MO2A 3CNBA 1GZ6A 2V7VA 1TFKB 3BMCA 2VWHA 1YMQA 1SCUA 4M4SA 3LWBA 4ZYTA 5LDHA 4DREA 1O5OA 2EPKX 2CNWA 3HKCB 4HJXA 2GI4A 4CDNA 4W1PA 4KQGA 3H5RA 4LMBA 1U6HA 1T15A 1NN5A 3E22B 3UC9A 2IYVA 2HZBA 3I9FA 2RGDA 3IP3A 4H15A 4IW3B 5FJIA 3SGLA 3SBEA 4HQLA 2X6QA 2ZI3A 2I62A 1GTRA 2H18A 1UKCA 4XLNF 4XOIA 4KLZA 3TJ6A 2POQX 1PJ4A 2IXNA 2Y1GA 2V3CC 3O1JC 3TLGA 1JA9A 3AHEA 5HK8A 3OCZA 1NFRA 4NBVA 1Y6FA 1Y7IA 3JQ9A 3O8OA 5GAJA 1ST6A 1E9SA 2IHUA 4KWIA 4YRNA 3C8GA 3JYLA 3R0JA 4RV4A 1DEHA 4CN8A 1L4KA 5CLHA 3TZLA 2QT9A 3ROPA 3OE1A 3M2PA 4FD2A 4M8SA 5HZMA 4LWOA 5I4CA 4YPVA 5ESRA 1Z63A 2WZCA 1ZVVA 1FUIA 3CE6A 5JSQA 2GTPA 1Y3HA 3MAAC 1E69A 3EDQA 1IM2A 3OZBA 4O3FA 1QSGA 4CTKA 1Y6QA 5AICA 1RRFA 2OYCA 4WKGA 3SEQA 1TADA 2H3HA 2ZYRA 4YIHA 1NQVA 4D74A 1PNQA 1E1RA 3H2HA 2Y67A 4RF3A 2OLEA 2PX6A 3TQIA 4KREA 2DUWA 1FB5A 2ZS8A 4KRGA 2ZSKA 1FUKA 1JHRA 3UEOA 4KQ6A 2YUIA 4N9QA 1R4NB 2ECFA 1DG1G 1XZBA 1QFMA 3OFJA 2FEKA 4RHYA 4HDNA 1XTJA 5JXJA 4ARSA 1QNFA 1MJGA 2OQMA 2X0EA 4CS8C 3R2PA 4YJWA 3IC5A 3UW3A 1ZIOA 4AI6A 1CR2A 4AWXA 1LZLA 3EK2A 2FB9A 4P32A 3ESZA 4HRVA 1FNNA 1H9AA 3AR4A 3IV9A 1R9MA 3DL2A 3OTIA 2VH2A 3L8EA 5B64A 1Z8NA 2CLSA 4RGBA 3TM4A 3TOZA 2Q4FA 4ZLCA 2D1FA 3C7TA 4MUIA 5B3IA 3JQCA 3O8QA 3QELB 1LKXA 4KX3A 3MWKA 3NC1C 2ERCA 2R1TA 3LUDA 1CY7A 4ER6A 1DOZA 4IOMA 2GH1A 1P5RA 1DFGA 2YL2A 2HIMA 1DQSA 5AVWA 4YJDA 4J7CA 1W25A 1J8DA 3PNKA 2XY4A 2YW2A 2ZUEA 4IAQA 5JAZA 2J45A 1UZMA 1VL5A 4O4LB 4ZQFA 2B9EA 3ZU3A 5DMXA 4X9XA 4BATA 3GNLA 2WHXA 2ZUTA 3ZWPA 5CB6A 1MD9A 2ZRNA 1WLSA 2GEFA 3FHLA 4NU6A 2VZ8A 1U8TA 4AWAA 4F56A 3OLCX 1WBJB 1Z7BA 3ZE2B 3DSRA 2CFCA 3RGGA 3AIOA 3KKBA 2EJCA 4MS4B 1JLSA 4IUBS 4BQOA 3UMGA 3E5RA 4GE0A 1GQ2A 2CZCA 1O08A 1QTNA 3F3YA 2JGMA 3JYNA 2QRMA 3UMFA 5AXDA 1ZHWA 3Q6IA 2FN9A 2BFWA 4A2CA 3PVSA 4NQRA 5ILOA 3BAZA 1XZDA 1PFYA 1WCIA 1RJ9B 1OREA 4JI2B 2XLBA 3NEAA 2VXYA 4A8TA 1RLUA 4NYMQ 1PU2A 3SXYA 5FPHA 1TJ3A 3PFCA 2BLLA 1MC4A 2W2QA 2XVXA 4GYYA 4Y6LA 3IR5A 4AJPA 1MQ9A 2F1IA 2CBGA 2X51A 1HE4A 3M33A 3BBLA 3W6NA 4MVJH 4PLHA 4QBIA 4UHHA 3U0VA 2L42A 2ZIEA 4ZK2A 2EFEB 3M6WA 4HZGA 2HA0A 1NY5A 1HTTA 2O5CA 2WJZB 2QQEA 1TEZA 2ZRBA 5HFAA 2EF0A 2HMAA 3ASVA 1V74B 3HLZA 3EA4A 1IZMA 2LCFA 5EZSA 2IV2X 4AIIA 1NVMB 1ML3A 3CVXA 2QL5A 4PHTA 5I01A 2YHAA 3ZE7A 4NAHA 3QMPA 4URUR 5SYAA 3HRKA 1E9VA 3B36A 3QWHA 1HSZA 3FOOA 5EEHA 1JF8A 2RHBA 5H68A 1K0FA 3JALB 1SJ9A 5LD2B 3DMDA 2LDBA 1J20A 2I5PO 3L0OA 1KOGA 2DPGA 3CF4G 3ICWA 2HBRA 4NMLA 5JW6A 4O6MA 4RDXA 1RJEA 3ZNQA 5KREA 2WFAA 3N9IA 2P9JA 2HBQA 1OBFO 4NC3A 2WHQA 2YLDA 1XG5A 1UDBA 1M2VA 5K0BA 5JAPA 5AMXA 2EEZA 3R9KA 4FZ5A 5FZTA 1D04A 1FJHA 2DYKA 2DI3A 1SB8A 1DMSA 3GU3A 1ORRA 2EW8A 4RTJA 1XD8A 4AJ1A 4HGYA 5F51A 1U3FA 2FSUA 4MGIR 3KOOA 3IVCA 3Q5EA 2RBKA 2HHHB 4EY4A 4P22A 1GU1A 8LDHA 3A25A 2GK7A 1YAHA 3ZJYA 4G65A 4FCWA 2AG0A 3UMCA 2VA8A 2NXJA 5A6AA 3CUWA 2GCNA 1Y34E 1MJNA 4DSAA 2HRCA 3SIWA 1J1UA 1E63A 4DV4B 3BMOB 1CTQA 2HWKA 3GIWA 2XE4A 2CNKA 4BASA 3J06A 3BF8A 1TWAA 4K9MA 3MYFA 1YUMA 1UEJA 3L6RA 1HA3A 2HIAA 2NZXA 1YGYA 1PZFA 1FSPA 4YRSA 3GJ0A 4LOAA 1ZM4A 1ZW1A 4KH0A 2OK7A 4XLTA 2F9MA 2QW8A 2SKDA 5H16A 3GCDA 3IBFA 5KYWB 5IJZA 3F8TA 3V8RA 4AG5A 3E9YA 3PXDA 5U9CA 2R02A 2VBFA 1A0BA 5EWLB 4BNWA 3QVLA 4RH0A 2VDRB 2XDAA 3DAPA 3HA5A 5CFNA 1Z4MA 3R40A 4W5JA 4KLAA 5EN4A 3N86A 2HSZA 2PX3A 4HNAA 2ISSD 3K0FA 4PO1A 2QR5A 3GVHA 2QX7A 5I7HA 2ZJ0A 4X8OA 4I3MA 2AJDA 3I0MA 4NNJA 3PFKA 1J1IA 3CW8X 2WSMA 1FC0A 4RABA 3HKDA 2YMLA 1CP3A 3AOUA 3ENNA 4MVRA 2QTBA 3A2MA 4F21A 4XJSA 2WVHA 3TPCA 3IQDB 3EMVA 1QIFA 3ESYA 3NPAA 4DVZA 2C7VA 2CVPA 5IBQA 3NIFB 5B3JA 3HDQA 1BCSA 2NVUA 4RFSB 4EX6A 3O4FA 2ZXEA 1XVTA 2BZ0A 2X40A 4RDIA 1WMAA 2D2EA 3AL0C 5HGXA 5AUQA 5TF4A 1EUCA 1NU6A 2YNMA 4INOA 1G8YA 4K6HA 1N0UA 2J08A 2ZUSA 1G8FA 1BMFA 5B1DA 4OM8A 1IEXA 3TBHA 1XRNA 1B43A 1WHSA 1KGSA 3QIVA 1II0A 2MJLA 1A96A 2OVBA 3I9V1 1U8YA 2I6GA 3L4KA 3N74A 2VSOA 2WI8A 3U5TA 3ASZA 4FWIB 4HQ6A 4IV5A 4MDHA 4MW7A 2XQKA 1ZIXA 3QEAZ 3VI3B 5C46F 3CUTA 5AJZA 2P6UA 4NQFA 1T3ZA 2ASVA 3CRW1 3VHLB 2XBLA 3I6IA 4PTZA 4ZEVA 4PZ9A 1KMNA 1D0YA 1PTJA 4F9FA 3M5CA 2BI7A 3MERA 4JJKA 1NF3A 4CIWA 1ZJ5A 3P2YA 4WPGA 3H1BA 1G5ZA 4L4ZA 3K4QA 1Z0JA 1YRBA 1NL3A 5A3RA 1QG6A 1JTEA 4OIFA 2WMNB 4OI0A 3VR3A 2VXCA 5I7RA 5ALEA 2QMEA 4FMDB 4DSTA 3CCBA 2OXIA 5L0FA 3KQWA 3STUA 3NVAA 5JNVA 2OVFA 1FMVA 4ENVA 2C7PA 5FKJA 1GRRA 2OBYA 3EAFA 2ASEA 4ZOAA 2K6GA 3V5XA 2ESRA 2AFIB 4PXAA 5HGJA 1E6KA 5FOUA 3GLVA 4WCFC 3QOYA 1DAHA 2RSEB 5JT4A 1YJAA 1TW2A 3ZLJA 3HGTA 3ZE6A 2Q27A 1OCRC 2HT1A 1NE7A 1TZBA 1LSOA 3TR6A 3GMDA 2JBAB 3LPCA 4A91A 2IPMA 2JJMA 1YFKA 3PB3A 2AOUB 3WIVA 1I32A 4XX1A 2QLTA 1CEXA 5CCBA 2R9VA 4H4KC 1TIKA 3IJRA 1E20A 1U98A 1F7VA 1FX1A 5CVJA 3W0LB 3H7IA 3OFKA 4OX9Y 4OXIA 1Z83A 3O10A 5LMUB 1Z18A 4X6YA 1YQXA 1L7AA 1TQHA 3WFZA 3VR6A 1FOEB 4KGVA 3H13A 2I4OA 4LDKA 1I8TA 3RWOA 1AU9A 2VUIB 3P26A 1VDMA 1JTVA 4IIHA 4MR9B 1UM9B 3OG9A 1JKMA 2YS7A 1ZN8A 1PQWA 1FA9A 4TXNA 1AF4A 2L82A 1YUNA 2QG9A 1E96A 3W3AH 5K45A 3PXGA 3HWX1 3T99A 1RLTA 2IHNA 1IUOA 1W0KD 4U9IS 4CS9C 1E8MA 4U2DA 2B5VA 3TQTA 4I99A 5EK0A 3ZGYA 3A1WA 2I3ZA 1X0XA 1ZUHA 2Q5JA 3AP1A 3PNSA 1MA0A 4WOKA 2HSJA 3PLAE 2XL4A 3SLRA 4EFNA 2CDCA 4JSTA 1XJ5A 1E99A 1ZGGA 1K97A 4DLZA 4OA5A 2HHJA 4CIAA 2XB2A 2KM1A 5KNBD 3DTVB 3TM5A 1DKRA 3DDZX 1IOWA 4ZEMA 4GU5A 3F6YA 1MIOB 4B31A 5CNMA 3QWFA 1AM4D 4UE2A 3DKIA 1YZGA 2ENWA 4BKPA 1HLFA 5T8KA 1R8YA 1JQAA 1MRZA 3SEAA 4BV9A 1XQVA 4HDQB 1NN3A 2C9ZA 4CV2A 3EMDA 3F71A 2VYVA 5GMOA 2JRCA 1BQ3A 5FUBA 4RXTA 2Q49A 4YAUA 1WKCA 5DH9A 5FB3A 4GGMX 2MSKA 2JI6A 3UJ3X 4Q4JB 3UT5A 1T2CA 1U6JA 1PUJA 5TC4A 2CMGA 2X9LA 3V8BA 5GTDA 2J0UA 2XUKA 4JC7A 4NBRA 1NN1A 4M0KA 4BHTA 1RJFA 3BEHA 1U80A 2XDQA 2IOFA 3UTCA 1M57C 3IODA 3U7QA 4ZALA 3W2IA 3H8JA 1GTSA 3R0QA 1CUEA 2ZBUA 3D0OA 1W1UA 2FMIA 4N7RA 3E3OA 5JDIC 5F1PA 4PGAA 4BP8A 5E95A 3CURA 3EQ8A 1IMJA 4QGHA 4KO8A 2CL7X 2ATXA 5DBEX 5LA6B 5DW0A 3CLSD 3BGVA 1AKYA 1B74A 1QIEA 2G0NA 3E5HA 1V26A 1WXIA 2XCQA 3DVAA 4H08A 2XE7A 1K88A 3M0EA 4I9UA 3ROKA 2W2VA 1WDTA 4JCCA 4DF3A 3UJ7A 2FJUA 3RFTA 2J9RA 3HU1A 3AOEC 3LX4A 2GPSA 2WY2D 1XVUA 1KK0A 4XGIA 2PWBA 3MTEA 1BYUA 1ZAYA 2AXNA 4BMXA 3ZHUA 3HH8A 4CZ2A 2VK8A 4JVSA 5HCIA 1IY9A 4B48A 1CVIA 4DNXA 3F9RA 3Q87B 3F78A 4DJJA 3GLTA 5F64A 1YA9A 1WXQA 4S3MA 3KJFA 3GUHA 3CB2A 4UOQA 4BPMA 2OYRA 1MO5A 3QA9A 1UK6A 2FHPA 4O4LF 4H6WA 3SP1A 1OXVA 5AGFA 1IWOA 2ISQA 2DLDA 2WVQA 1XNJA 1KEWA 1NOJA 3SBXA 4NTBA 3OPQA 2FN7A 4GO1A 1UEIA 3S44A 5D6OA 2BHNA 3NKDA 5MN6A 1TM1E 1UMDA 3LT2A 2IEAA 2ATCA 1T3HA 3KJHA 1RKUA 2R7RA 3I83A 2XD4A 3QEBZ 2A9RA 2DHQA 5J2UA 3KR1A 5JH7B 1ZEMA 2BR4A 4BWVA 1JPNA 5HJ5A 3NQ41 3P4YA 4CF6A 2MINB 3E1KA 2G3VA 3R9IA 3QPDA 2B61A 3NV7A 3QTBA 4QIHA 2GCEA 2VUTA 2WINI 3PDIA 3K6SB 1CWUA 1YE8A 3DCJA 3RJZA 1VP9A 2HA4A 4NYJQ 5B1IA 5JXHA 1L5WA 4PM4A 4KU4A 4ER5A 1AMNA 3DEFA 4D96A 2WZDA 2O3TA 1I4LD 3P0HA 4X61A 3N0WA 4XASA 3EDOA 5BSEA 1KJWA 2JH3A 4TV8B 1P62B 3HEBA 4RD3A 1S5PA 2GN2A 3EIXA 2NSGA 5ALJA 3E03A 5C7LO 5F4ZA 3GORA 5CX1B 3E6AA 2I3GA 4JB3A 2EX1A 2GZSA 5BWMA 3PQDA 5J59A 3JAWA 2Q0QA 3FJYA 3G9UA 5JNLA 5M04A 1EDOA 4R68A 5C7OO 4D26A 1DRJA 4PPFA 3QBJA 4JIMA 5D3KA 4URVR 3CVWA 3L0SA 3PZRA 4PZLA 4QRHA 1NLXA 1ZN9A 2EBFX 5B37A 4RAQA 3AIIA 3VTZA 3KRTA 2IX9A 3T9BA 5EJ9A 2QYSA 4UNIA 4F7DA 3HXPA 2PH1A 4JIGA 1M8GA 3N3BC 4ZT5A 4RVFA 2X23A 3BFVA 4EO9A 3TX6A 4DR7B 4E4YA 2ZROA 1AUPA 4F71A 3OUUA 3RJ5A 3ORQA 3QVJA 4BU1A 4IRMA 2IUEA 2CFOA 3OJOA 1G7RA 1EM8A 2QXTA 4CEHB 2NG1A 1COZA 1JHUA 1EJ0A 1OR3A 3PC6A 4BFWA 4ETWA 5HJ7A 3AKCA 1WQ1R 1ZNXA 4QEKA 3KCQA 1GKUB 2ABWA 5BSWA 4MUJA 5EQFA 4H6XA 4CKBB 3E0QA 2NSHA 2CMFA 1GG2A 1ONOA 4YASA 3OQHA 2L19A 3N5KA 2AKAB 2Y27A 1GKYA 4CV0A 2WU4A 4HEA1 5BR8B 5AWFC 3VVMA 1XMOB 1T2EA 2C4UA 3FMOB 5GJWC 4URYR 1ZUNA 3FTCA 4U63A 2HMZA 3WLNA 3R3UA 2ZZNA 2MYPA 2W6JA 1IJBA 4J7TA 5LQUA 1TM3E 4DA9A 1EGVB 5JC1A 4A0HA 3LD9A 3DMTA 1E0DA 3OQBA 3EZGA 4U5FE