1ZZPA

Solution structure of the f-actin binding domain of bcr-abl/c-abl
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
109
structure length
109
Chain Sequence
SGAITKGVVLDSTEALCLAISRNSEQMASHSAVLEAGKNLYSFCVSYVDSIQQMRNKFAFREAINKLENNLRELQICPATAGSGPAATQDFSKLLSSVKEISDIVQRLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
publication title Structural Basis for the Cytoskeletal Association of Bcr-Abl/c-Abl.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 29
structure length 109
sequence length 109
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2005-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08919 F_actin_bind F-actin binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1zzpA00
1V4AA 1ZZPA 3K7DA 3L8IA 1UFBA 5F28E 3U3FA 3AJMA 4XEVA 3BRJA 1K04A 2L6FA 1WTYA 1OW6A 3C8GD 3TULA 1K40A 1OW7A 2YWAA 3B71A 3C18A 3GM2A 2JX0A 3JZ0A 1JOGA 1WOLA 3RQGA 1KNYA 3RQEA 3U0CA 1O3UA 1KTMA 2KK1A 4EBJA 4R32A 1WWPA 2HSBA 2Q00A 3C8GA 3GM3A 1PV3A 3GM1A 4XEFA 3O10A 2L6HA 2L6GA 3JYYA 4XEKA 3S9OA 2JPUA 2PBEA 3L8JA 2LK4A 3C8GB 1QVXA 4NQFA 1OW8A 3RQFA 4EBKA 3MFNA 1K05A
chains in the Genus database with same CATH superfamily
4MW3A 4L6RA 4PJJA 5E3AA 5T3TA 1BDJB 3ZC4A 4E17A 2RD9A 2BE5F 1EI7A 2R7XA 4JIOA 1E85A 3OWTA 2EIMC 2HSQA 2WZFA 4GYTA 2MYSA 4PR9A 2R02A 5A6BD 4BJ5A 3G4XA 4OIPF 1YARO 2ZD9A 3EQLF 4JEAA 5COMA 3S29A 4LACB 3KL4A 1MMDA 1RKEB 3ZQYA 4KC9A 4R32A 1WWPA 2R05A 3LAYA 2WVOA 1RJ9B 3E9VA 3WODF 5BQHA 5IY5C 5L0CA 5L0HA 5KYNA 1CGME 3EGXA 3G4ZA 4U5GA 4BJ1A 2EINC 2ICWG 2UUHA 4YN0B 2H7OA 3S9OA 2CNWD 1DOWA 1J8YF 1OXBA 3K1IA 3NKDA 2IXOA 2VC9A 4XTKA 2YL1A 1PD0A 1UG7A 1ZHYA 4I44A 1MMAA 3IQTA 5EHHA 1Z63A 3KPHA 3AG3C 4JCHA 4WGZA 1RKCA 2XL4A 4BG0A 4AE4A 3NKEA 2A1DD 3I5PA 4C7OB 2ETSA 1WTYA 1NSGB 3WHNA 2PX0A 1Z23A 4RDAA 4ER9A 1MNDA 2LFDA 3GEEA 3ITFA 3LS0A 3SYNA 1FAPB 5DS5A 1LKXA 2O9XA 4U9EA 3SXMA 1D1AA 3HNLA 4MNDA 3ABKC 5L0FA 1ORSC 1TWAA 4AL1A 3O39A 4P6IC 3JSEO 3ZTZA 1C02A 1G8XA 3KH2A 2PBEA 3M4BA 3W8IA 1DOVA 4XQ1A 3FDQA 2YVKA 2CYDA 4P9TA 1Z7Qc 2C04A 1IW7F 1T9KA 2QUPA 1F1MA 3L34A 4U5BE 4U9DA 4XEVA 5JP7A 4EBBA 3S27A 2ZPAA 4WABA 5E3CA 4K1OA 3W2WA 2YRFA 1YAUO 1K40A 1XZPA 2NUTA 5KYXB 4O6YA 2KNHA 2QNLA 3MLGA 1NU9C 3PMRA 4PFPA 1G4US 1A0BA 1CGOA 1MMNA 1HW1A 3HJCA 2H7BA 4O79A 4Q7CA 4BJTA 5BUOA 1FFHA 3RVZA 4HE8D 2P6VA 1BR4A 1M2OA 3JSZA 1U0BB 5COFA 3B9QA 3O6XA 3N2ZB 1TFKB 4MVRA 3ZTMA 4NTFA 3EFOB 3FHDA 3RYLA 1VMAA 1B68A 3N24A 1TR2A 2HS5A 2KJGA 2YZSA 4I3MA 4AL0A 4NQFA 2Y3GA 3IQ6A 2IBFA 2HJMA 4JJFA 4K7BA 4DRHB 3M79A 5CI9A 3JTLO 1ZHWA 1OKKA 1OXKA 5B3SC 3EG9B 2J9BA 4YT2A 1T5OA 1LE4A 2KGOA 4HFFB 3EZIA 1O5HA 3V5ZA 3UGOA 2YWAA 3ZIBA 3DI5A 1Q0FA 4PJLA 2QY9A 3U0CA 4K0DA 5CI8A 3M15A 5JVEA 2M64A 4C3DA 1EA8A 2QTVA 3DD7A 2NUPB 3RH3A 1V55C 1Y6DA 4N06A 1RXQA 3WAQA 4IAQA 5AC5A 4CSAA 1HY5A 3J06A 1AUEA 1ZHZA 2A0UA 2AVKA 4O6MA 4YT8A 3FXHA 1WASA 3HNJA 3R2PA 4BJ5C 3Q6MA 1Z5ZA 2NSFA 3T4RA 2D5RB 5HV9A 3B0PA 4M63A 1OQCA 5GPGB 3M4CA 3VM6A 2J0WA 3EGXB 1I4YA 3RQFA 2Q9BA 4WGYA 1ZZPA 2PNOA 1CPRA 2B0JA 3FOOA 1ZHTA 2EIJC 4RBNA 3U9MA 3SXKA 2KYHA 3RW0A 3K1IC 4FESA 3EJNA 3X2QC 4AE4B 4DBQA 1MQVA 1ZW3A 3PHF2 2J8WA 3ATPA 2LCHA 4GEHA 4PK4A 2J9UA 3TOMA 1S7ZA 4N6HA 4Z9IA 4CDYA 4KNVA 2GDCA 3S0XA 1LVKA 4YL3A 3K33A 4JTDB 4YJWA 1G4WR 4MTFA 4XEFA 1GQAA 1M56C 3KYIA 3NMKA 3SP1A 3SZRA 4DOZA 5L0DA 2DYSC 5F5HA 4O7GA 4CIPA 2LQGA 2EPLX 1TWGA 4U5EE 3B29A 3LJBA 2R7WA 2HKVA 1IZMA 3VAYA 1A7EA 1YJGA 3F47A 1Q0KA 1V74B 2H7VC 2I15A 2PP4A 3FOPA 4CS9A 2WVQA 5L0JA 1QPUA 2R7UA 2YL0A 3UR3C 4ULWA 3BRJA 3ZQVA 1CGNA 3C62A 4J32B 3DM9B 3RF3A 5L0IA 2PF4E 3T6GB 5FCLA 4MTGA 5L0GA 1W2WA 1YYXA 2CCYA 1T6IA 2YLDA 3S28A 2DB4A 2EILC 2YL3A 3RFYA 5JRAA 3FVYA 1YLMA 2Q7RA 1H9TA 1BR1A 2NUTB 1LPEA 3LESA 4Z9JA 3ZVRA 2PX3A 5T3WA 2XXAA 1Y4CA 1JMWA 4YT4A 1YA9A 3GEHA 2OJQA 3JYYA 3QVYA 4HEAJ 2JPUA 1A7DA 4X0RA 4JKVA 3IEEA 4YWQA 2V3CC 1U6HA 1OCCC 1A41A 1YVIA 2ZXWC 4OD4A 2R7VA 5B1BC 3EGDA 2XLWA 4JE9A 4OIQF 4I1OB 3IQCA 5E33A 5B3IA 3NMIA 4MW8A 3AOUA 1JAFA 1D0ZA 1Q0MA 3QW0A 5KYYB 1MNEA 1VB5A 2KSFA 2KC3A 3AQCA 3C18A 3G50A 3NMJA 1M2VA 2OOCA 3JZ0A 3QMKA 2FAPB 1WGWA 2EPMX 2XLMA 1Z3IX 2LSEA 3NG1A 1BBHA 2EIKC 3ABMC 2IYLD 2CGEA 2ASRA 3ECSA 3I5QA 3C7JA 3CEXA 3A11A 3IHUA 3I4UA 4N6CA 5DQTA 3KKBA 2X0CA 3HTKC 1OCOC 2KW3C 2XLVA 2Q4FA 2OKUA 4AK9A 3C63A 2R7OA 1H6GA 4NTAA 2R7QA 4GQHA 3F46A 2LP4A 4JZAA 4MVSA 4BEJA 4OIOF 3FMSA 4CSAC 1C17M 1YZAA 2YL7A 1HMDA 2HMZA 2WL8A 2YKZA 2HV7A 3OEOA 1VTMP 4EKWA 3K1HA 3TULA 4EWCA 4O6NA 2R9RB 4E7SA 5F5FA 4ULVA 3U9JA 4JTCB 1OR3A 3WG7C 2IM8A 1SR2A 1ZU4A 2Q9AA 3T9OA 3Q6NA 1TFOB 1Q0GA 1VLTA 2P61A 4HFKB 2HZ8A 3H2VA 3TJ5A 1GM5A 3JRMO 3X1OA 4XLPF 1HW2A 2C03A 4Q5SF 1H7IA 1VLSA 3UMHA 4P9FA 1VYKA 3U5SA 2L6HA 3QVZA 4CS7A 3NYMA 3VF0A 4DRJB 5CIVA 4FWVA 3L8JA 3SEOA 2G3VA 3W8HA 5K0IA 4EBKA 2HFIA 2G62A 2OG2A 5KYWB 3T6BA 2L9JA 5A6JA 2RSEB 3GODA 3CQZA 1SYQA 4WJ0A 3U3FA 1VOMA 1RKEA 2HMQA 2XLDA 4PJNA 4BEMJ 1GS9A 1TWCA 1ZU5A 1ZVZA 2B0HA 3QW1A 1E2XA 1RJ9A 3GWLA 5A6KA 1JR8A 3ASNC 4KBLA 3US6A 1EKYA 4MVUA 4CDVA 4E7ZA 1WOLA 2BC5A 5AC4A 2XLHA 1O3UA 2AP3A 3LLIA 2MHRA 2LIGA 2Q3TA 4CS8A 1LE2A 4CS9C 4MVMA 5KYUB 2XLOA 3C8GA 4JVSA 2WZGA 2OEVA 3GM1A 1S05A 4ZLCA 1ZW2A 2CW0F 1APCA 2F22A 1QZXA 2H8AA 2ZXOA 3CSKA 1ST6A 2QLAA 1FTSA 1PD1A 2WB7A 2EPNA 2P7VA 3EZHA 3ZSUA 2VH3A 1CPQA 3OA1A 4XPWA 4YL0A 3LNMB 1I4ZA 1NFNA 1RCPA 3UNGC 256BA 2DGJA 3EH1A 4XPYA 4ZLDA 3DJNB 1D1CA 3NYLA 3B71A 3HNKA 3AG4C 4U5FE 3RIPA 3M1CB 2GAQA 3TD7A 4OIRF 1JRAA 1LM3B 3MX3A 4QDLA 3H2UA 4BJ6A 4EBJA 4FAPB 4EIYA 1QLEC 5JLIA 1AVOB 4E18A 1SF8A 1L3PA 1NU7D 4Q4ZF 1TKNA 1TWHA 2A6EF 2GA0A 2Z15A 4J30B 5EK0A 4LDRA 3DAFA 4AX2A 3ZG1A 2HJ3A 2L7AA 1ZYRF 3B0UX 1NG1A 1OKKD 3CAXA 5FZTA 2W9YA 1QVXA 4IARA 3W2VA 2XS1A 4LLEA 1QQ3A 4CBEA 5KYXA 4KNWA 2EPOA 3TQOA 1FMVA 1C03A 1XWJA 2OCCC 2CNWA 3MBGA 2M4EA 1K04A 1ORJA 3BEHA 2L6FA 3DKAA 2PFDA 3LEVA 5DQZA 2G3KA 1OW6A 3C8GD 2IOQA 4J7TA 3AQBA 3LUTB 3TK0A 3HKKA 1MMGA 1O87A 2NPUA 1HE9A 3EFOA 2J9WA 3O55A 2X51A 4JJGA 4N4WA 1I5NA 5D91A 2W45A 1OR2A 2IXPA 3EH2A 3Q7LA 1J8MF 2J46A 4DBRA 5JS5A 5E2QA 2WVNA 1YA7O 2Y3HA 2Y39A 3ABLC 4JCZA 2L6GA 3NDBB 4NC3A 3ZDLA 2YLIA 1SZIA 1K05A 2A68F 1QSPA 3U2LA 3K7DA 4JW1A 2W4BA 3FAJA 1UFBA 4UDVA 4PJMA 4D4XA 4JC7A 2VCBA 1EQ1A 4NY3A 4U5HA 1D1BA 2NUPA 5T1DB 3VYWA 1Q0DA 4DRIB 2XM0A 1SMYF 4E0IA 4XPXA 2D4UA 5L3VA 4IWBA 1KNYA 4IAOA 1KU2A 4JURI 3JCUQ 3V7OA 3U3BA 3GM3A 4MVOA 1BZ4A 4G7ZF 3JT1A 3R7CA 2AU5A 1LIHA 1OCRC 3DAGA 3HNIA 3JYHA 1ORYA 2OJED 1R4TA 3LS1A 1V54C 2I8BA 3DMDA 3C8GB 4EHPA 1A7VA 1OW8A 3GANA 3TOLA 2AWYA 3MFNA 1VK5A 2A69F 1JPNA 4CS8C 4DVYP 4FX5A 3DJUB 5L3QA 4QI2A 3T6JA 3KMIA 3AJMA 4CJGA 2L81A 3MYFA 1HMOA 4U5DE 2XS8A 1NLXA 3UMIA 4D4NA 3DE9A 3JRTA 3POVA 2OQMA 1AEPA 1Z6AA 3RQEA 3SXYA 4C3EA 2GFHA 2J45A 4LDQA 2KK1A 5BQIA 3LLKA 2YHSA 1JPJA 2VCAA 1H9GA 2VCCA 1T6UA 4LERA 1T01A 2XRHA 1N1CA 3C8ZA 1PCXA 4JTAB 3RKOF 3DZAA 2ZXRA 4LDKA 3K66A 3NRHA 2YEVA 3SNHA 5DLJA 1FFTC 1LS1A 4BJ6C 2ZXPA 1U89A 4CX9A 1V4AA 3KYJA 3GORA 2EPKX 5F28E 1HE1A 2UUIA 3ZWIA 4W8KA 3LEOA 2Y3DA 3V5YA 4CDAA 3AG2C 2YQYA 2Y3BA 2YLGA 3E70C 2V26A 1R5ID 5HSWA 4W8PA 3PDMP 4G7HF 1NBBA 1OW7A 4H4KC 1FR0A 3UGPA 2IXMA 2JX0A 1JOGA 2JD3A 4MVZA 4A4AA 1M6TA 1RMVA 3A9CA 2IXNA 3QZCA 1YZCA 4U5CE 2Y69C 3NYJA 4CJOA 1NFOA 2HSBA 2Q00A 4MTOA 5JT4A 4G0HA 4B6IA 1WN0A 2XSEA 3Q7GA 4J7YA 4XLNF 3CZ6A 4PACA 1TQGA 3O10A 4E0HA 2R7RA 3EHNA 3GEIA 1E86A 2AWCA 3AGTA 4ANJA 2J7PA 2MWQA 2TMVP 4KI2A 4YK5A 4C7OA 2HUJA 5KYYA 4OINF 3SXZA 4XEKA 2R25A 3K6BA 3VRCA 4DVZA 4CIHA 5DVWA 1WATA 5KYUA 5DS6A 2XXAB 4DXWA 4A2NB 2VASA 1XZQA 4RD9A 3UMKA 1M57C 3L1MA 1FMWA 5A6AA 4BPMA 2OEXA 1OCZC 2LFFA 1YDIA 2P0NA 1D0YA 2XL8A 1G5ZA 5JSLA 3DE8A 3TJ6A 3FAPB 3DXJF 2R7TA 3EGDB 1GGQA 3B0VC 4YT5A 3EPVA 5A69A 4Z9HA 3W4YA 3S90A 4JEBA 3RVYA 2QE9A 2BL2A 3V5XA 5A6BA 4PFOA 2J0XA 2A0BA 4MVQA 1M2VB 2XLEA 2R7SA 4IGGA 3IQ5A 3PCVA 2Q9CA 4H54A 2NSGA 4LLCA 2NG1A 2XL6A 3N0TA 2LK4A 2OU6A 4IRUA 4NTBA 3U8VA 2E87A 1QKRA 2DI3A 2KQ9A 4IJJA 1D0XA 1LI5A 2VB6A 3L8IA 4QI0A 4C3BA 2A6HF 3LNRA 3MYIA 4DJ9A 4F4BA 5DS4A 2P1AA 5EGYA 3ASOC 2R03A 3HLZA 4IB4A 2FGYA 1FNTc 2LD6A 2WZLA 3DWWA 3GM2A 3RQGA 1T6QA 2CDQA 3AG1C 3GWNA 4JRZA 4NCQA 4OD5A 5B1AC 3U8PA 2HV6A 4MS2A 5TJ5E 1VYIA 3QTHA 5JUAA 3EHMA 2FFHA 1KTMA 2J7PD 2XM4A 1L7CA 1BR2A 5D92A 5BQGA 5KYWA 1PV3A 4XWJA 4G7OF 1YYJA 3L0IA 1E84A 2DYRC 3IPMO 2J9VA 4I1MA 1LS4A 3S84A 3H65A 4MQ9F 2GWWA 4YL1A 5COGA 3AGUA 4ONSA 3EG9A 4G78A 5AGFA 1NZEA 1ZHXA 4EUKB 1E83A 3DM5A 2W4MA 3U2MA 1LI7A
chains in the Genus database with same CATH topology
1V4AA 1ZZPA 3K7DA 3L8IA 1UFBA 5F28E 3U3FA 3AJMA 4XEVA 3BRJA 1K04A 2L6FA 1WTYA 1OW6A 3C8GD 3TULA 1K40A 1OW7A 2YWAA 3B71A 3C18A 3GM2A 2JX0A 3JZ0A 1JOGA 1WOLA 3RQGA 1KNYA 3RQEA 3U0CA 1O3UA 1KTMA 2KK1A 4EBJA 4R32A 1WWPA 2HSBA 2Q00A 3C8GA 3GM3A 1PV3A 3GM1A 4XEFA 3O10A 2L6HA 2L6GA 3JYYA 4XEKA 3S9OA 2JPUA 2PBEA 3L8JA 2LK4A 3C8GB 1QVXA 4NQFA 1OW8A 3RQFA 4EBKA 3MFNA 1K05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V4A A;  1ZZP A;  3K7D A;  3L8I A;  1UFB A;  5F28 E;  3U3F A;  3AJM A;  4XEV A;  3BRJ A;  1K04 A;  2L6F A;  1WTY A;  1OW6 A;  3C8G D;  3TUL A;  1K40 A;  1OW7 A;  2YWA A;  3B71 A;  3C18 A;  3GM2 A;  2JX0 A;  3JZ0 A;  1JOG A;  1WOL A;  3RQG A;  1KNY A;  3RQE A;  3U0C A;  1O3U A;  1KTM A;  2KK1 A;  4EBJ A;  4R32 A;  1WWP A;  2HSB A;  2Q00 A;  3C8G A;  3GM3 A;  1PV3 A;  3GM1 A;  4XEF A;  3O10 A;  2L6H A;  2L6G A;  3JYY A;  4XEK A;  3S9O A;  2JPU A;  2PBE A;  3L8J A;  2LK4 A;  3C8G B;  1QVX A;  4NQF A;  1OW8 A;  3RQF A;  4EBK A;  3MFN A;  1K05 A; 
#chains in the Genus database with same CATH topology
 4MW3 A;  4L6R A;  4PJJ A;  5E3A A;  5T3T A;  1BDJ B;  3ZC4 A;  4E17 A;  2RD9 A;  2BE5 F;  1EI7 A;  2R7X A;  4JIO A;  1E85 A;  3OWT A;  2EIM C;  2HSQ A;  2WZF A;  4GYT A;  2MYS A;  4PR9 A;  2R02 A;  5A6B D;  4BJ5 A;  3G4X A;  4OIP F;  1YAR O;  2ZD9 A;  3EQL F;  4JEA A;  5COM A;  3S29 A;  4LAC B;  3KL4 A;  1MMD A;  1RKE B;  3ZQY A;  4KC9 A;  4R32 A;  1WWP A;  2R05 A;  3LAY A;  2WVO A;  1RJ9 B;  3E9V A;  3WOD F;  5BQH A;  5IY5 C;  5L0C A;  5L0H A;  5KYN A;  1CGM E;  3EGX A;  3G4Z A;  4U5G A;  4BJ1 A;  2EIN C;  2ICW G;  2UUH A;  4YN0 B;  2H7O A;  3S9O A;  2CNW D;  1DOW A;  1J8Y F;  1OXB A;  3K1I A;  3NKD A;  2IXO A;  2VC9 A;  4XTK A;  2YL1 A;  1PD0 A;  1UG7 A;  1ZHY A;  4I44 A;  1MMA A;  3IQT A;  5EHH A;  1Z63 A;  3KPH A;  3AG3 C;  4JCH A;  4WGZ A;  1RKC A;  2XL4 A;  4BG0 A;  4AE4 A;  3NKE A;  2A1D D;  3I5P A;  4C7O B;  2ETS A;  1WTY A;  1NSG B;  3WHN A;  2PX0 A;  1Z23 A;  4RDA A;  4ER9 A;  1MND A;  2LFD A;  3GEE A;  3ITF A;  3LS0 A;  3SYN A;  1FAP B;  5DS5 A;  1LKX A;  2O9X A;  4U9E A;  3SXM A;  1D1A A;  3HNL A;  4MND A;  3ABK C;  5L0F A;  1ORS C;  1TWA A;  4AL1 A;  3O39 A;  4P6I C;  3JSE O;  3ZTZ A;  1C02 A;  1G8X A;  3KH2 A;  2PBE A;  3M4B A;  3W8I A;  1DOV A;  4XQ1 A;  3FDQ A;  2YVK A;  2CYD A;  4P9T A;  1Z7Q c;  2C04 A;  1IW7 F;  1T9K A;  2QUP A;  1F1M A;  3L34 A;  4U5B E;  4U9D A;  4XEV A;  5JP7 A;  4EBB A;  3S27 A;  2ZPA A;  4WAB A;  5E3C A;  4K1O A;  3W2W A;  2YRF A;  1YAU O;  1K40 A;  1XZP A;  2NUT A;  5KYX B;  4O6Y A;  2KNH A;  2QNL A;  3MLG A;  1NU9 C;  3PMR A;  4PFP A;  1G4U S;  1A0B A;  1CGO A;  1MMN A;  1HW1 A;  3HJC A;  2H7B A;  4O79 A;  4Q7C A;  4BJT A;  5BUO A;  1FFH A;  3RVZ A;  4HE8 D;  2P6V A;  1BR4 A;  1M2O A;  3JSZ A;  1U0B B;  5COF A;  3B9Q A;  3O6X A;  3N2Z B;  1TFK B;  4MVR A;  3ZTM A;  4NTF A;  3EFO B;  3FHD A;  3RYL A;  1VMA A;  1B68 A;  3N24 A;  1TR2 A;  2HS5 A;  2KJG A;  2YZS A;  4I3M A;  4AL0 A;  4NQF A;  2Y3G A;  3IQ6 A;  2IBF A;  2HJM A;  4JJF A;  4K7B A;  4DRH B;  3M79 A;  5CI9 A;  3JTL O;  1ZHW A;  1OKK A;  1OXK A;  5B3S C;  3EG9 B;  2J9B A;  4YT2 A;  1T5O A;  1LE4 A;  2KGO A;  4HFF B;  3EZI A;  1O5H A;  3V5Z A;  3UGO A;  2YWA A;  3ZIB A;  3DI5 A;  1Q0F A;  4PJL A;  2QY9 A;  3U0C A;  4K0D A;  5CI8 A;  3M15 A;  5JVE A;  2M64 A;  4C3D A;  1EA8 A;  2QTV A;  3DD7 A;  2NUP B;  3RH3 A;  1V55 C;  1Y6D A;  4N06 A;  1RXQ A;  3WAQ A;  4IAQ A;  5AC5 A;  4CSA A;  1HY5 A;  3J06 A;  1AUE A;  1ZHZ A;  2A0U A;  2AVK A;  4O6M A;  4YT8 A;  3FXH A;  1WAS A;  3HNJ A;  3R2P A;  4BJ5 C;  3Q6M A;  1Z5Z A;  2NSF A;  3T4R A;  2D5R B;  5HV9 A;  3B0P A;  4M63 A;  1OQC A;  5GPG B;  3M4C A;  3VM6 A;  2J0W A;  3EGX B;  1I4Y A;  3RQF A;  2Q9B A;  4WGY A;  1ZZP A;  2PNO A;  1CPR A;  2B0J A;  3FOO A;  1ZHT A;  2EIJ C;  4RBN A;  3U9M A;  3SXK A;  2KYH A;  3RW0 A;  3K1I C;  4FES A;  3EJN A;  3X2Q C;  4AE4 B;  4DBQ A;  1MQV A;  1ZW3 A;  3PHF 2;  2J8W A;  3ATP A;  2LCH A;  4GEH A;  4PK4 A;  2J9U A;  3TOM A;  1S7Z A;  4N6H A;  4Z9I A;  4CDY A;  4KNV A;  2GDC A;  3S0X A;  1LVK A;  4YL3 A;  3K33 A;  4JTD B;  4YJW A;  1G4W R;  4MTF A;  4XEF A;  1GQA A;  1M56 C;  3KYI A;  3NMK A;  3SP1 A;  3SZR A;  4DOZ A;  5L0D A;  2DYS C;  5F5H A;  4O7G A;  4CIP A;  2LQG A;  2EPL X;  1TWG A;  4U5E E;  3B29 A;  3LJB A;  2R7W A;  2HKV A;  1IZM A;  3VAY A;  1A7E A;  1YJG A;  3F47 A;  1Q0K A;  1V74 B;  2H7V C;  2I15 A;  2PP4 A;  3FOP A;  4CS9 A;  2WVQ A;  5L0J A;  1QPU A;  2R7U A;  2YL0 A;  3UR3 C;  4ULW A;  3BRJ A;  3ZQV A;  1CGN A;  3C62 A;  4J32 B;  3DM9 B;  3RF3 A;  5L0I A;  2PF4 E;  3T6G B;  5FCL A;  4MTG A;  5L0G A;  1W2W A;  1YYX A;  2CCY A;  1T6I A;  2YLD A;  3S28 A;  2DB4 A;  2EIL C;  2YL3 A;  3RFY A;  5JRA A;  3FVY A;  1YLM A;  2Q7R A;  1H9T A;  1BR1 A;  2NUT B;  1LPE A;  3LES A;  4Z9J A;  3ZVR A;  2PX3 A;  5T3W A;  2XXA A;  1Y4C A;  1JMW A;  4YT4 A;  1YA9 A;  3GEH A;  2OJQ A;  3JYY A;  3QVY A;  4HEA J;  2JPU A;  1A7D A;  4X0R A;  4JKV A;  3IEE A;  4YWQ A;  2V3C C;  1U6H A;  1OCC C;  1A41 A;  1YVI A;  2ZXW C;  4OD4 A;  2R7V A;  5B1B C;  3EGD A;  2XLW A;  4JE9 A;  4OIQ F;  4I1O B;  3IQC A;  5E33 A;  5B3I A;  3NMI A;  4MW8 A;  3AOU A;  1JAF A;  1D0Z A;  1Q0M A;  3QW0 A;  5KYY B;  1MNE A;  1VB5 A;  2KSF A;  2KC3 A;  3AQC A;  3C18 A;  3G50 A;  3NMJ A;  1M2V A;  2OOC A;  3JZ0 A;  3QMK A;  2FAP B;  1WGW A;  2EPM X;  2XLM A;  1Z3I X;  2LSE A;  3NG1 A;  1BBH A;  2EIK C;  3ABM C;  2IYL D;  2CGE A;  2ASR A;  3ECS A;  3I5Q A;  3C7J A;  3CEX A;  3A11 A;  3IHU A;  3I4U A;  4N6C A;  5DQT A;  3KKB A;  2X0C A;  3HTK C;  1OCO C;  2KW3 C;  2XLV A;  2Q4F A;  2OKU A;  4AK9 A;  3C63 A;  2R7O A;  1H6G A;  4NTA A;  2R7Q A;  4GQH A;  3F46 A;  2LP4 A;  4JZA A;  4MVS A;  4BEJ A;  4OIO F;  3FMS A;  4CSA C;  1C17 M;  1YZA A;  2YL7 A;  1HMD A;  2HMZ A;  2WL8 A;  2YKZ A;  2HV7 A;  3OEO A;  1VTM P;  4EKW A;  3K1H A;  3TUL A;  4EWC A;  4O6N A;  2R9R B;  4E7S A;  5F5F A;  4ULV A;  3U9J A;  4JTC B;  1OR3 A;  3WG7 C;  2IM8 A;  1SR2 A;  1ZU4 A;  2Q9A A;  3T9O A;  3Q6N A;  1TFO B;  1Q0G A;  1VLT A;  2P61 A;  4HFK B;  2HZ8 A;  3H2V A;  3TJ5 A;  1GM5 A;  3JRM O;  3X1O A;  4XLP F;  1HW2 A;  2C03 A;  4Q5S F;  1H7I A;  1VLS A;  3UMH A;  4P9F A;  1VYK A;  3U5S A;  2L6H A;  3QVZ A;  4CS7 A;  3NYM A;  3VF0 A;  4DRJ B;  5CIV A;  4FWV A;  3L8J A;  3SEO A;  2G3V A;  3W8H A;  5K0I A;  4EBK A;  2HFI A;  2G62 A;  2OG2 A;  5KYW B;  3T6B A;  2L9J A;  5A6J A;  2RSE B;  3GOD A;  3CQZ A;  1SYQ A;  4WJ0 A;  3U3F A;  1VOM A;  1RKE A;  2HMQ A;  2XLD A;  4PJN A;  4BEM J;  1GS9 A;  1TWC A;  1ZU5 A;  1ZVZ A;  2B0H A;  3QW1 A;  1E2X A;  1RJ9 A;  3GWL A;  5A6K A;  1JR8 A;  3ASN C;  4KBL A;  3US6 A;  1EKY A;  4MVU A;  4CDV A;  4E7Z A;  1WOL A;  2BC5 A;  5AC4 A;  2XLH A;  1O3U A;  2AP3 A;  3LLI A;  2MHR A;  2LIG A;  2Q3T A;  4CS8 A;  1LE2 A;  4CS9 C;  4MVM A;  5KYU B;  2XLO A;  3C8G A;  4JVS A;  2WZG A;  2OEV A;  3GM1 A;  1S05 A;  4ZLC A;  1ZW2 A;  2CW0 F;  1APC A;  2F22 A;  1QZX A;  2H8A A;  2ZXO A;  3CSK A;  1ST6 A;  2QLA A;  1FTS A;  1PD1 A;  2WB7 A;  2EPN A;  2P7V A;  3EZH A;  3ZSU A;  2VH3 A;  1CPQ A;  3OA1 A;  4XPW A;  4YL0 A;  3LNM B;  1I4Z A;  1NFN A;  1RCP A;  3UNG C;  256B A;  2DGJ A;  3EH1 A;  4XPY A;  4ZLD A;  3DJN B;  1D1C A;  3NYL A;  3B71 A;  3HNK A;  3AG4 C;  4U5F E;  3RIP A;  3M1C B;  2GAQ A;  3TD7 A;  4OIR F;  1JRA A;  1LM3 B;  3MX3 A;  4QDL A;  3H2U A;  4BJ6 A;  4EBJ A;  4FAP B;  4EIY A;  1QLE C;  5JLI A;  1AVO B;  4E18 A;  1SF8 A;  1L3P A;  1NU7 D;  4Q4Z F;  1TKN A;  1TWH A;  2A6E F;  2GA0 A;  2Z15 A;  4J30 B;  5EK0 A;  4LDR A;  3DAF A;  4AX2 A;  3ZG1 A;  2HJ3 A;  2L7A A;  1ZYR F;  3B0U X;  1NG1 A;  1OKK D;  3CAX A;  5FZT A;  2W9Y A;  1QVX A;  4IAR A;  3W2V A;  2XS1 A;  4LLE A;  1QQ3 A;  4CBE A;  5KYX A;  4KNW A;  2EPO A;  3TQO A;  1FMV A;  1C03 A;  1XWJ A;  2OCC C;  2CNW A;  3MBG A;  2M4E A;  1K04 A;  1ORJ A;  3BEH A;  2L6F A;  3DKA A;  2PFD A;  3LEV A;  5DQZ A;  2G3K A;  1OW6 A;  3C8G D;  2IOQ A;  4J7T A;  3AQB A;  3LUT B;  3TK0 A;  3HKK A;  1MMG A;  1O87 A;  2NPU A;  1HE9 A;  3EFO A;  2J9W A;  3O55 A;  2X51 A;  4JJG A;  4N4W A;  1I5N A;  5D91 A;  2W45 A;  1OR2 A;  2IXP A;  3EH2 A;  3Q7L A;  1J8M F;  2J46 A;  4DBR A;  5JS5 A;  5E2Q A;  2WVN A;  1YA7 O;  2Y3H A;  2Y39 A;  3ABL C;  4JCZ A;  2L6G A;  3NDB B;  4NC3 A;  3ZDL A;  2YLI A;  1SZI A;  1K05 A;  2A68 F;  1QSP A;  3U2L A;  3K7D A;  4JW1 A;  2W4B A;  3FAJ A;  1UFB A;  4UDV A;  4PJM A;  4D4X A;  4JC7 A;  2VCB A;  1EQ1 A;  4NY3 A;  4U5H A;  1D1B A;  2NUP A;  5T1D B;  3VYW A;  1Q0D A;  4DRI B;  2XM0 A;  1SMY F;  4E0I A;  4XPX A;  2D4U A;  5L3V A;  4IWB A;  1KNY A;  4IAO A;  1KU2 A;  4JUR I;  3JCU Q;  3V7O A;  3U3B A;  3GM3 A;  4MVO A;  1BZ4 A;  4G7Z F;  3JT1 A;  3R7C A;  2AU5 A;  1LIH A;  1OCR C;  3DAG A;  3HNI A;  3JYH A;  1ORY A;  2OJE D;  1R4T A;  3LS1 A;  1V54 C;  2I8B A;  3DMD A;  3C8G B;  4EHP A;  1A7V A;  1OW8 A;  3GAN A;  3TOL A;  2AWY A;  3MFN A;  1VK5 A;  2A69 F;  1JPN A;  4CS8 C;  4DVY P;  4FX5 A;  3DJU B;  5L3Q A;  4QI2 A;  3T6J A;  3KMI A;  3AJM A;  4CJG A;  2L81 A;  3MYF A;  1HMO A;  4U5D E;  2XS8 A;  1NLX A;  3UMI A;  4D4N A;  3DE9 A;  3JRT A;  3POV A;  2OQM A;  1AEP A;  1Z6A A;  3RQE A;  3SXY A;  4C3E A;  2GFH A;  2J45 A;  4LDQ A;  2KK1 A;  5BQI A;  3LLK A;  2YHS A;  1JPJ A;  2VCA A;  1H9G A;  2VCC A;  1T6U A;  4LER A;  1T01 A;  2XRH A;  1N1C A;  3C8Z A;  1PCX A;  4JTA B;  3RKO F;  3DZA A;  2ZXR A;  4LDK A;  3K66 A;  3NRH A;  2YEV A;  3SNH A;  5DLJ A;  1FFT C;  1LS1 A;  4BJ6 C;  2ZXP A;  1U89 A;  4CX9 A;  1V4A A;  3KYJ A;  3GOR A;  2EPK X;  5F28 E;  1HE1 A;  2UUI A;  3ZWI A;  4W8K A;  3LEO A;  2Y3D A;  3V5Y A;  4CDA A;  3AG2 C;  2YQY A;  2Y3B A;  2YLG A;  3E70 C;  2V26 A;  1R5I D;  5HSW A;  4W8P A;  3PDM P;  4G7H F;  1NBB A;  1OW7 A;  4H4K C;  1FR0 A;  3UGP A;  2IXM A;  2JX0 A;  1JOG A;  2JD3 A;  4MVZ A;  4A4A A;  1M6T A;  1RMV A;  3A9C A;  2IXN A;  3QZC A;  1YZC A;  4U5C E;  2Y69 C;  3NYJ A;  4CJO A;  1NFO A;  2HSB A;  2Q00 A;  4MTO A;  5JT4 A;  4G0H A;  4B6I A;  1WN0 A;  2XSE A;  3Q7G A;  4J7Y A;  4XLN F;  3CZ6 A;  4PAC A;  1TQG A;  3O10 A;  4E0H A;  2R7R A;  3EHN A;  3GEI A;  1E86 A;  2AWC A;  3AGT A;  4ANJ A;  2J7P A;  2MWQ A;  2TMV P;  4KI2 A;  4YK5 A;  4C7O A;  2HUJ A;  5KYY A;  4OIN F;  3SXZ A;  4XEK A;  2R25 A;  3K6B A;  3VRC A;  4DVZ A;  4CIH A;  5DVW A;  1WAT A;  5KYU A;  5DS6 A;  2XXA B;  4DXW A;  4A2N B;  2VAS A;  1XZQ A;  4RD9 A;  3UMK A;  1M57 C;  3L1M A;  1FMW A;  5A6A A;  4BPM A;  2OEX A;  1OCZ C;  2LFF A;  1YDI A;  2P0N A;  1D0Y A;  2XL8 A;  1G5Z A;  5JSL A;  3DE8 A;  3TJ6 A;  3FAP B;  3DXJ F;  2R7T A;  3EGD B;  1GGQ A;  3B0V C;  4YT5 A;  3EPV A;  5A69 A;  4Z9H A;  3W4Y A;  3S90 A;  4JEB A;  3RVY A;  2QE9 A;  2BL2 A;  3V5X A;  5A6B A;  4PFO A;  2J0X A;  2A0B A;  4MVQ A;  1M2V B;  2XLE A;  2R7S A;  4IGG A;  3IQ5 A;  3PCV A;  2Q9C A;  4H54 A;  2NSG A;  4LLC A;  2NG1 A;  2XL6 A;  3N0T A;  2LK4 A;  2OU6 A;  4IRU A;  4NTB A;  3U8V A;  2E87 A;  1QKR A;  2DI3 A;  2KQ9 A;  4IJJ A;  1D0X A;  1LI5 A;  2VB6 A;  3L8I A;  4QI0 A;  4C3B A;  2A6H F;  3LNR A;  3MYI A;  4DJ9 A;  4F4B A;  5DS4 A;  2P1A A;  5EGY A;  3ASO C;  2R03 A;  3HLZ A;  4IB4 A;  2FGY A;  1FNT c;  2LD6 A;  2WZL A;  3DWW A;  3GM2 A;  3RQG A;  1T6Q A;  2CDQ A;  3AG1 C;  3GWN A;  4JRZ A;  4NCQ A;  4OD5 A;  5B1A C;  3U8P A;  2HV6 A;  4MS2 A;  5TJ5 E;  1VYI A;  3QTH A;  5JUA A;  3EHM A;  2FFH A;  1KTM A;  2J7P D;  2XM4 A;  1L7C A;  1BR2 A;  5D92 A;  5BQG A;  5KYW A;  1PV3 A;  4XWJ A;  4G7O F;  1YYJ A;  3L0I A;  1E84 A;  2DYR C;  3IPM O;  2J9V A;  4I1M A;  1LS4 A;  3S84 A;  3H65 A;  4MQ9 F;  2GWW A;  4YL1 A;  5COG A;  3AGU A;  4ONS A;  3EG9 A;  4G78 A;  5AGF A;  1NZE A;  1ZHX A;  4EUK B;  1E83 A;  3DM5 A;  2W4M A;  3U2M A;  1LI7 A; 
#chains in the Genus database with same CATH homology
 1V4A A;  1ZZP A;  3K7D A;  3L8I A;  1UFB A;  5F28 E;  3U3F A;  3AJM A;  4XEV A;  3BRJ A;  1K04 A;  2L6F A;  1WTY A;  1OW6 A;  3C8G D;  3TUL A;  1K40 A;  1OW7 A;  2YWA A;  3B71 A;  3C18 A;  3GM2 A;  2JX0 A;  3JZ0 A;  1JOG A;  1WOL A;  3RQG A;  1KNY A;  3RQE A;  3U0C A;  1O3U A;  1KTM A;  2KK1 A;  4EBJ A;  4R32 A;  1WWP A;  2HSB A;  2Q00 A;  3C8G A;  3GM3 A;  1PV3 A;  3GM1 A;  4XEF A;  3O10 A;  2L6H A;  2L6G A;  3JYY A;  4XEK A;  3S9O A;  2JPU A;  2PBE A;  3L8J A;  2LK4 A;  3C8G B;  1QVX A;  4NQF A;  1OW8 A;  3RQF A;  4EBK A;  3MFN A;  1K05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...