1ZZPA

Solution structure of the f-actin binding domain of bcr-abl/c-abl
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
109
structure length
109
Chain Sequence
SGAITKGVVLDSTEALCLAISRNSEQMASHSAVLEAGKNLYSFCVSYVDSIQQMRNKFAFREAINKLENNLRELQICPATAGSGPAATQDFSKLLSSVKEISDIVQRLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
publication title Structural Basis for the Cytoskeletal Association of Bcr-Abl/c-Abl.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 109
sequence length 109
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2005-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08919 F_actin_bind F-actin binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1zzpA00
4XEVA 1ZZPA 3C18A 3O10A 3C8GA 4EBKA 3JZ0A 4XEFA 3GM2A 1K04A 1UFBA 2JX0A 1K40A 3U3FA 1V4AA 4XEKA 1WWPA 1WTYA 3B71A 1PV3A 1QVXA 1K05A 3TULA 2L6FA 1KTMA 1OW8A 3GM3A 3K7DA 5F28E 4EBJA 1KNYA 2PBEA 1WOLA 1OW6A 3BRJA 3GM1A 4NQFA 3RQEA 2Q00A 3U0CA 3L8IA 2L6HA 1OW7A 3L8JA 3S9OA 2L6GA 3AJMA 3RQFA 2YWAA 3RQGA 3MFNA 3C8GB 1JOGA 2KK1A 2HSBA 2LK4A 4R32A 3C8GD 3JYYA 2JPUA 1O3UA
chains in the Genus database with same CATH superfamily
1FAPB 2VB6A 2JD3A 4MVRA 3ECSA 2EILC 2CNWD 3RH3A 1U89A 4N6CA 1YZCA 4JEBA 1NBBA 2X0CA 1TWHA 1MNDA 3RVYA 3ZG1A 2Y3BA 2GDCA 4WABA 2XLMA 1LVKA 1R5ID 3IHUA 1QLEC 1SR2A 2Q4FA 4MW8A 4EBJA 3U0CA 4JIOA 3GM1A 2VASA 4NQFA 1ZW3A 4PJLA 1ST6A 3UGOA 2HZ8A 3AQBA 4G78A 3M4CA 3ZQYA 2R7WA 1JR8A 2P1AA 1YAUO 3R2PA 2OEVA 3HNLA 4JEAA 2G3VA 2M64A 4YJWA 1AVOB 3EZHA 2J45A 2R05A 1RXQA 1LE2A 2KJGA 3EPVA 1S7ZA 3AQCA 4H54A 3U2LA 1YLMA 3SXMA 1QPUA 2XS8A 1A41A 4BJ6C 2LFFA 2W9YA 3NMKA 5JUAA 1HW1A 2ZXPA 3M4BA 5AGFA 2EPOA 3DKAA 1MMGA 4JZAA 4P6IC 4U5GA 1ZHWA 2XLHA 2EPLX 4JW1A 1GQAA 2A6HF 2OJED 2PF4E 3AOUA 1PV3A 3B9QA 1CPQA 1WATA 3Q7GA 3SXKA 1FNTc 5DS5A 2EPNA 1MQVA 5BQIA 5T1DB 1OW8A 1AEPA 1FFTC 1YA9A 3SNHA 3S90A 4DJ9A 2D5RB 2WZGA 1TFKB 1Y6DA 1T6QA 3EGDB 3WODF 1VLSA 3OA1A 2LIGA 3AG2C 2NUPB 2YL3A 3ATPA 2B0HA 1OR3A 4O79A 5JVEA 2J9BA 3JSEO 2TMVP 1T6UA 2IYLD 5E33A 5L0CA 3VYWA 1E84A 3IEEA 3I4UA 2PX0A 2YRFA 3FOPA 4OD5A 3U3BA 1Z5ZA 4IJJA 1TFOB 4DRIB 2I15A 4X0RA 4U5EE 2R25A 3EFOB 4Z9HA 5COMA 5DLJA 4Q4ZF 1I4ZA 3GEHA 3JZ0A 2YHSA 3SXZA 4K7BA 4W8PA 3KMIA 3NG1A 4PJNA 2Y3GA 1B68A 2R7OA 1VYIA 4ONSA 1ZYRF 4CDAA 4OIRF 1LI7A 3S84A 4DRHB 2VCAA 3LEVA 2RSEB 5CI8A 3LLKA 3HLZA 4GEHA 4O7GA 3FOOA 4AL0A 5BUOA 2KC3A 2X51A 4MTFA 5A6BA 1ZHXA 3PMRA 4U9EA 3WG7C 2J0XA 4YWQA 2DI3A 1ORJA 3DAGA 1IZMA 3QMKA 4JKVA 1HMOA 3S9OA 4J30B 2A0UA 3T6GB 3DJNB 4XQ1A 1D0ZA 3S28A 2AWYA 4E0HA 3US6A 3EGXA 4N6HA 4CS7A 3EH2A 5D92A 3VRCA 3UGPA 2M4EA 3S29A 3V7OA 4MNDA 3KYJA 4U5FE 3WAQA 2Q3TA 3HJCA 2NPUA 2QE9A 4DBRA 1R4TA 3MBGA 1QSPA 3FVYA 3GM2A 2G3KA 4RD9A 4U5HA 4ANJA 2ETSA 3O39A 1NLXA 1GS9A 1EQ1A 5HV9A 1WTYA 2PFDA 3F47A 4JCZA 3TULA 2AP3A 5KYNA 2WB7A 4CJOA 2BC5A 3DD7A 2H8AA 4EBBA 2W4BA 2PBEA 1TR2A 2YKZA 3M1CB 4C3EA 1XZQA 1V74B 2R7QA 1UG7A 4IGGA 3B29A 4QI0A 2LQGA 3FMSA 3Q7LA 3H65A 4YT5A 2O9XA 2YWAA 3JRMO 2XLDA 2L7AA 3EHNA 3IQ5A 3UMKA 2I8BA 1YDIA 2R02A 1HY5A 2DB4A 4XPXA 3EHMA 3VF0A 4AK9A 4CS8A 2JPUA 1LE4A 2R7UA 3NMJA 4YT4A 3A11A 3Q6MA 4CIHA 2R7SA 4QDLA 2GA0A 3RW0A 2KQ9A 4HE8D 1WWPA 3KYIA 4HFKB 3X1OA 4PJMA 4OIOF 1W2WA 2H7BA 2Q9BA 2XLVA 3CZ6A 3GM3A 1BR1A 4KC9A 4JCHA 4MVMA 4PFPA 3KPHA 3W8IA 3Q6NA 3RFYA 2P0NA 4E18A 2WL8A 2OU6A 4K0DA 4ER9A 1C02A 1OXKA 3EGXB 3EZIA 2UUIA 3QZCA 1D1AA 2Q9CA 2WVQA 2ASRA 3K33A 4LERA 1GM5A 2J9UA 5F5FA 1RKCA 1WN0A 2PP4A 1CPRA 2YLDA 4MS2A 5T3TA 3TOMA 5L0IA 4IAQA 1LS4A 4Q7CA 1EA8A 1JOGA 2LD6A 2VH3A 3E9VA 2HSBA 2LK4A 3AGUA 3F46A 1NSGB 3TJ5A 1IW7F 3W8HA 3OEOA 3HNKA 2R7XA 1LPEA 5FZTA 2OQMA 3H2VA 4XWJA 5KYWB 4LLEA 1YYXA 3MX3A 3B71A 3EH1A 3T4RA 3C7JA 1FTSA 1QVXA 3DM5A 4CSAA 5KYXA 4IRUA 5EHHA 2D4UA 1LI5A 5CI9A 1HE9A 2HV7A 2LFDA 1L7CA 2XM0A 3C8ZA 3BRJA 2FGYA 3SP1A 1D0YA 2XSEA 1ZHTA 1Q0DA 3UMIA 3ASNC 2A68F 4K1OA 4AL1A 2Y39A 1M2OA 2IXMA 3K1IA 1BBHA 4PJJA 1PCXA 2OKUA 3G4ZA 5BQGA 1LIHA 1JPJA 2HV6A 5F5HA 3EJNA 3HNIA 4XLPF 5B3SC 1V55C 4DVYP 4EHPA 5JT4A 4UDVA 4J7TA 1O3UA 4EUKB 2NSFA 1LS1A 4MTGA 4RBNA 2UUHA 3DE9A 2PX3A 1D1CA 1T6IA 3GORA 3TOLA 3ZDLA 3ZC4A 1MMNA 2XL4A 4Z9IA 1H9TA 3MYFA 1NFNA 3AG4C 2C03A 4LDKA 1KTMA 1VOMA 4LACB 5DQZA 2OOCA 3DAFA 3KH2A 1OW6A 4BJ5C 2XM4A 4XTKA 1G8XA 2DYSC 2Q7RA 2H7OA 1SZIA 3DJUB 1YVIA 1XZPA 3V5YA 2J46A 2J0WA 2KSFA 2LCHA 1J8YF 4KI2A 3K6BA 3N24A 2FFHA 3PCVA 3C62A 2F22A 4G7OF 1SF8A 4G0HA 3LESA 4ULWA 4BG0A 1HW2A 3C8GA 3SZRA 4C7OA 2CDQA 1OXBA 1S05A 5KYXB 2J7PA 5HSWA 4JC7A 3NDBB 1V4AA 3FHDA 3KL4A 4CS8C 2XLOA 3V5ZA 3ITFA 3H2UA 1E2XA 2VCCA 5COGA 5L0JA 1QZXA 1L3PA 2AWCA 2WVOA 5E2QA 3ZQVA 4CBEA 3IQ6A 2BE5F 4ULVA 4XPYA 5KYUA 1YA7O 4U5BE 4NTAA 1OCCC 1OKKA 4M63A 1SYQA 3SXYA 3BEHA 3S27A 4BPMA 4E7SA 4NC3A 1APCA 2GFHA 1VK5A 3UR3C 2EIMC 2KYHA 1HMDA 1O87A 4G7ZF 4BEJA 1TKNA 3CSKA 1NG1A 2XS1A 2HS5A 4I1OB 3RF3A 1ORYA 3M79A 4CS9C 2ICWG 4YN0B 3C8GD 4CS9A 3L34A 4C3DA 5TJ5E 3VM6A 1T01A 1TWGA 1ZZPA 2J7PD 3QVYA 4P9FA 4RDAA 1T9KA 4FESA 3JTLO 3LUTB 3T6JA 3U2MA 4Q5SF 3POVA 1FFHA 5B1BC 3NYMA 1G5ZA 1K40A 1M57C 1CGOA 2B0JA 2IOQA 4JTDB 3ZTMA 2DYRC 3TQOA 5A6AA 1M2VA 4BJ5A 1DOVA 4DRJB 4YL0A 2L6FA 4IB4A 1OKKD 3DWWA 5A6JA 5A6BD 4KBLA 5L0DA 4CSAC 4OD4A 5L3QA 3KKBA 4I1MA 4IARA 4U5CE 3U5SA 1PD0A 3K66A 3ZWIA 4EWCA 5JRAA 4QI2A 1OCOC 1U6HA 1G4WR 2R03A 3DE8A 1I5NA 3C8GB 3U9MA 4ZLCA 4C7OB 3K1IC 4O6MA 3MYIA 1ZHYA 3L8IA 1U0BB 3I5PA 5E3CA 2HJ3A 4NTFA 5AC4A 3TD7A 1FMVA 1Y4CA 3FAPB 1FMWA 4MW3A 5EGYA 2QTVA 4AX2A 1WGWA 2YL0A 2CW0F 4PK4A 2YL7A 2XL8A 4MVUA 1H7IA 5AC5A 2NG1A 4Z9JA 2QLAA 5A6KA 2EINC 2WZFA 2XL6A 3X2QC 1LM3B 5FCLA 5IY5C 4MVZA 5F28E 1Z6AA 3EQLF 4WGYA 4MQ9F 4CDVA 2HMQA 2OCCC 2YL1A 1QQ3A 3R7CA 3W2WA 3U8PA 2CYDA 2FAPB 3K1HA 3ABKC 4A4AA 1OW7A 5L0HA 3RIPA 1HE1A 1OR2A 1Z7Qc 2IXOA 2ZXWC 5L0FA 2KK1A 1MMAA 2AVKA 1RKEA 2NUTA 4O6YA 2VCBA 3AJMA 2IBFA 2J9WA 1RJ9A 4MVQA 2EIJC 4C3BA 4FAPB 3O6XA 3O10A 3B0VC 1LKXA 1N1CA 1M2VB 3LEOA 4YL3A 2JX0A 1JPNA 2CNWA 3TK0A 4YL1A 2A6EF 3U9JA 3ZSUA 5KYYA 1K05A 2J8WA 2L9JA 1A7EA 4LDRA 4N06A 3CQZA 1YJGA 3GEIA 5EK0A 2EPMX 1G4US 1KNYA 1C17M 4O6NA 4OINF 4AE4A 1PD1A 2L6HA 2HFIA 2YZSA 3JYHA 3T6BA 1BZ4A 4CX9A 1O5HA 3J06A 2QY9A 4XLNF 3GWNA 1MNEA 3AG3C 1I4YA 1Z3IX 3MFNA 4KNWA 4EKWA 4YT2A 4P9TA 1YARO 1WASA 3HTKC 1VTMP 1BR4A 2MWQA 2CCYA 4EIYA 4WJ0A 4H4KC 2QUPA 4BJ1A 3ZIBA 2ZPAA 5K0IA 3EFOA 1D0XA 3SEOA 2XXAA 2R7VA 4XEKA 3IPMO 3G50A 4LDQA 4CDYA 5BQHA 4MTOA 1M6TA 3RKOF 4B6IA 2PNOA 1RCPA 4JURI 3B0UX 4J7YA 2QNLA 3K7DA 5DVWA 2KW3C 1TWAA 2AU5A 2ZXRA 3LS1A 2LP4A 1A7VA 1CGNA 2Q00A 4HEAJ 3U8VA 3L8JA 1RKEB 2NUTB 3DMDA 2YLGA 3O55A 3N0TA 3ZVRA 1RJ9B 2BL2A 3NMIA 1Q0GA 1OQCA 5T3WA 2Y3HA 5L3VA 4E17A 4JE9A 1C03A 3NRHA 4JVSA 3C18A 3DI5A 1H9GA 1JRAA 4KNVA 3B0PA 3UMHA 5KYYB 4OIPF 1OCRC 5E3AA 1K04A 2A1DD 3G4XA 3W2VA 2YQYA 3LJBA 3TJ6A 4G7HF 1A0BA 3ABMC 4ZLDA 1BR2A 5JSLA 2L81A 2MYSA 1E83A 2XXAB 5JP7A 4OIQF 1F1MA 5COFA 4AE4B 3NYLA 4PR9A 2V3CC 4L6RA 2MHRA 1WOLA 3JRTA 3V5XA 5B1AC 1KU2A 1NU7D 4BJTA 4FX5A 4CJGA 3PDMP 3A9CA 3JSZA 2HKVA 3N2ZB 3SYNA 4DOZA 2EIKC 2Y69C 3HNJA 4HFFB 5D91A 1ORSC 2YVKA 3EG9A 2CGEA 3I5QA 3L1MA 3QW1A 1VYKA 3C63A 3GEEA 4N4WA 2HMZA 3CAXA 3AG1C 2R7TA 3GODA 4JTCB 1J8MF 3FXHA 4NCQA 4BEMJ 4FWVA 3FDQA 3JCUQ 3L0IA 3CEXA 3IQTA 4W8KA 2OEXA 3LNMB 3ABLC 4CIPA 1NFOA 1EI7A 1VLTA 4U9DA 3IQCA 2R7RA 1Q0MA 1VMAA 1MMDA 5L0GA 4BJ6A 2Y3DA 1TWCA 3M15A 3DZAA 3LAYA 2L6GA 1QKRA 3RQFA 3RVZA 1ZVZA 2KNHA 3E70C 2C04A 4MVSA 1V54C 2XLWA 3QTHA 4A2NB 1JAFA 5DS4A 3QVZA 5JS5A 1Z23A 4R32A 4JTAB 1ZU4A 3LS0A 4DBQA 4XEVA 4NTBA 2KGOA 4I3MA 256BA 5DS6A 3PHF2 1JMWA 4MVOA 4XEFA 3S0XA 2VC9A 2WZLA 1E85A 2YEVA 3T9OA 3RYLA 1YZAA 3DM9B 1RMVA 1TQGA 2NSGA 3NYJA 4NY3A 5JLIA 5KYWA 2ZXOA 5KYUB 1E86A 1CGME 1SMYF 3ZTZA 2ZD9A 2R9RB 1NU9C 2YLIA 4JRZA 4E0IA 2HUJA 3NKEA 4JJGA 3NKDA 2P7VA 4J32B 1A7DA 1OCZC 1Q0FA 1AUEA 4U5DE 2IM8A 3EG9B 3QW0A 5B3IA 3ASOC 5GPGB 3RQGA 4YK5A 3JT1A 1GGQA 4LLCA 1Z63A 3OWTA 4IWBA 3GWLA 4F4BA 2LSEA 3JYYA 2H7VC 3LNRA 2HJMA 3UNGC 4XPWA 5DQTA 2DGJA 4EBKA 2E87A 4JJFA 1UFBA 3FAJA 3U3FA 4PFOA 2P6VA 2IXNA 4DVZA 1XWJA 2XLEA 4E7ZA 2GAQA 3VAYA 4GQHA 1H6GA 2OJQA 3MLGA 4IAOA 2P61A 2W4MA 3W4YA 5CIVA 4D4XA 3HKKA 3WHNA 2V26A 3GANA 3RQEA 2J9VA 1T5OA 2W45A 2Z15A 4D4NA 1BDJB 1M56C 2A0BA 1ZU5A 4PACA 2IXPA 2WVNA 1VB5A 1FR0A 1YYJA 1EKYA 3EGDA 2OG2A 2A69F 2HSQA 2EPKX 1Q0KA 1ZHZA 2RD9A 1NZEA 1ZW2A 3AGTA 2XRHA 3LLIA 4WGZA 2NUPA 4GYTA 4I44A 2GWWA 4YT8A 2Q9AA 1DOWA 3DXJF 1D1BA 4DXWA 2G62A 5A69A
chains in the Genus database with same CATH topology
4XEVA 1ZZPA 3C18A 3O10A 3C8GA 4EBKA 3JZ0A 4XEFA 3GM2A 1K04A 1UFBA 2JX0A 1K40A 3U3FA 1V4AA 4XEKA 1WWPA 1WTYA 3B71A 1PV3A 1QVXA 1K05A 3TULA 2L6FA 1KTMA 1OW8A 3GM3A 3K7DA 5F28E 4EBJA 1KNYA 2PBEA 1WOLA 1OW6A 3BRJA 3GM1A 4NQFA 3RQEA 2Q00A 3U0CA 3L8IA 2L6HA 1OW7A 3L8JA 3S9OA 2L6GA 3AJMA 3RQFA 2YWAA 3RQGA 3MFNA 3C8GB 1JOGA 2KK1A 2HSBA 2LK4A 4R32A 3C8GD 3JYYA 2JPUA 1O3UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XEV A;  1ZZP A;  3C18 A;  3O10 A;  3C8G A;  4EBK A;  3JZ0 A;  4XEF A;  3GM2 A;  1K04 A;  1UFB A;  2JX0 A;  1K40 A;  3U3F A;  1V4A A;  4XEK A;  1WWP A;  1WTY A;  3B71 A;  1PV3 A;  1QVX A;  1K05 A;  3TUL A;  2L6F A;  1KTM A;  1OW8 A;  3GM3 A;  3K7D A;  5F28 E;  4EBJ A;  1KNY A;  2PBE A;  1WOL A;  1OW6 A;  3BRJ A;  3GM1 A;  4NQF A;  3RQE A;  2Q00 A;  3U0C A;  3L8I A;  2L6H A;  1OW7 A;  3L8J A;  3S9O A;  2L6G A;  3AJM A;  3RQF A;  2YWA A;  3RQG A;  3MFN A;  3C8G B;  1JOG A;  2KK1 A;  2HSB A;  2LK4 A;  4R32 A;  3C8G D;  3JYY A;  2JPU A;  1O3U A; 
#chains in the Genus database with same CATH topology
 1FAP B;  2VB6 A;  2JD3 A;  4MVR A;  3ECS A;  2EIL C;  2CNW D;  3RH3 A;  1U89 A;  4N6C A;  1YZC A;  4JEB A;  1NBB A;  2X0C A;  1TWH A;  1MND A;  3RVY A;  3ZG1 A;  2Y3B A;  2GDC A;  4WAB A;  2XLM A;  1LVK A;  1R5I D;  3IHU A;  1QLE C;  1SR2 A;  2Q4F A;  4MW8 A;  4EBJ A;  3U0C A;  4JIO A;  3GM1 A;  2VAS A;  4NQF A;  1ZW3 A;  4PJL A;  1ST6 A;  3UGO A;  2HZ8 A;  3AQB A;  4G78 A;  3M4C A;  3ZQY A;  2R7W A;  1JR8 A;  2P1A A;  1YAU O;  3R2P A;  2OEV A;  3HNL A;  4JEA A;  2G3V A;  2M64 A;  4YJW A;  1AVO B;  3EZH A;  2J45 A;  2R05 A;  1RXQ A;  1LE2 A;  2KJG A;  3EPV A;  1S7Z A;  3AQC A;  4H54 A;  3U2L A;  1YLM A;  3SXM A;  1QPU A;  2XS8 A;  1A41 A;  4BJ6 C;  2LFF A;  2W9Y A;  3NMK A;  5JUA A;  1HW1 A;  2ZXP A;  3M4B A;  5AGF A;  2EPO A;  3DKA A;  1MMG A;  4JZA A;  4P6I C;  4U5G A;  1ZHW A;  2XLH A;  2EPL X;  4JW1 A;  1GQA A;  2A6H F;  2OJE D;  2PF4 E;  3AOU A;  1PV3 A;  3B9Q A;  1CPQ A;  1WAT A;  3Q7G A;  3SXK A;  1FNT c;  5DS5 A;  2EPN A;  1MQV A;  5BQI A;  5T1D B;  1OW8 A;  1AEP A;  1FFT C;  1YA9 A;  3SNH A;  3S90 A;  4DJ9 A;  2D5R B;  2WZG A;  1TFK B;  1Y6D A;  1T6Q A;  3EGD B;  3WOD F;  1VLS A;  3OA1 A;  2LIG A;  3AG2 C;  2NUP B;  2YL3 A;  3ATP A;  2B0H A;  1OR3 A;  4O79 A;  5JVE A;  2J9B A;  3JSE O;  2TMV P;  1T6U A;  2IYL D;  5E33 A;  5L0C A;  3VYW A;  1E84 A;  3IEE A;  3I4U A;  2PX0 A;  2YRF A;  3FOP A;  4OD5 A;  3U3B A;  1Z5Z A;  4IJJ A;  1TFO B;  4DRI B;  2I15 A;  4X0R A;  4U5E E;  2R25 A;  3EFO B;  4Z9H A;  5COM A;  5DLJ A;  4Q4Z F;  1I4Z A;  3GEH A;  3JZ0 A;  2YHS A;  3SXZ A;  4K7B A;  4W8P A;  3KMI A;  3NG1 A;  4PJN A;  2Y3G A;  1B68 A;  2R7O A;  1VYI A;  4ONS A;  1ZYR F;  4CDA A;  4OIR F;  1LI7 A;  3S84 A;  4DRH B;  2VCA A;  3LEV A;  2RSE B;  5CI8 A;  3LLK A;  3HLZ A;  4GEH A;  4O7G A;  3FOO A;  4AL0 A;  5BUO A;  2KC3 A;  2X51 A;  4MTF A;  5A6B A;  1ZHX A;  3PMR A;  4U9E A;  3WG7 C;  2J0X A;  4YWQ A;  2DI3 A;  1ORJ A;  3DAG A;  1IZM A;  3QMK A;  4JKV A;  1HMO A;  3S9O A;  4J30 B;  2A0U A;  3T6G B;  3DJN B;  4XQ1 A;  1D0Z A;  3S28 A;  2AWY A;  4E0H A;  3US6 A;  3EGX A;  4N6H A;  4CS7 A;  3EH2 A;  5D92 A;  3VRC A;  3UGP A;  2M4E A;  3S29 A;  3V7O A;  4MND A;  3KYJ A;  4U5F E;  3WAQ A;  2Q3T A;  3HJC A;  2NPU A;  2QE9 A;  4DBR A;  1R4T A;  3MBG A;  1QSP A;  3FVY A;  3GM2 A;  2G3K A;  4RD9 A;  4U5H A;  4ANJ A;  2ETS A;  3O39 A;  1NLX A;  1GS9 A;  1EQ1 A;  5HV9 A;  1WTY A;  2PFD A;  3F47 A;  4JCZ A;  3TUL A;  2AP3 A;  5KYN A;  2WB7 A;  4CJO A;  2BC5 A;  3DD7 A;  2H8A A;  4EBB A;  2W4B A;  2PBE A;  1TR2 A;  2YKZ A;  3M1C B;  4C3E A;  1XZQ A;  1V74 B;  2R7Q A;  1UG7 A;  4IGG A;  3B29 A;  4QI0 A;  2LQG A;  3FMS A;  3Q7L A;  3H65 A;  4YT5 A;  2O9X A;  2YWA A;  3JRM O;  2XLD A;  2L7A A;  3EHN A;  3IQ5 A;  3UMK A;  2I8B A;  1YDI A;  2R02 A;  1HY5 A;  2DB4 A;  4XPX A;  3EHM A;  3VF0 A;  4AK9 A;  4CS8 A;  2JPU A;  1LE4 A;  2R7U A;  3NMJ A;  4YT4 A;  3A11 A;  3Q6M A;  4CIH A;  2R7S A;  4QDL A;  2GA0 A;  3RW0 A;  2KQ9 A;  4HE8 D;  1WWP A;  3KYI A;  4HFK B;  3X1O A;  4PJM A;  4OIO F;  1W2W A;  2H7B A;  2Q9B A;  2XLV A;  3CZ6 A;  3GM3 A;  1BR1 A;  4KC9 A;  4JCH A;  4MVM A;  4PFP A;  3KPH A;  3W8I A;  3Q6N A;  3RFY A;  2P0N A;  4E18 A;  2WL8 A;  2OU6 A;  4K0D A;  4ER9 A;  1C02 A;  1OXK A;  3EGX B;  3EZI A;  2UUI A;  3QZC A;  1D1A A;  2Q9C A;  2WVQ A;  2ASR A;  3K33 A;  4LER A;  1GM5 A;  2J9U A;  5F5F A;  1RKC A;  1WN0 A;  2PP4 A;  1CPR A;  2YLD A;  4MS2 A;  5T3T A;  3TOM A;  5L0I A;  4IAQ A;  1LS4 A;  4Q7C A;  1EA8 A;  1JOG A;  2LD6 A;  2VH3 A;  3E9V A;  2HSB A;  2LK4 A;  3AGU A;  3F46 A;  1NSG B;  3TJ5 A;  1IW7 F;  3W8H A;  3OEO A;  3HNK A;  2R7X A;  1LPE A;  5FZT A;  2OQM A;  3H2V A;  4XWJ A;  5KYW B;  4LLE A;  1YYX A;  3MX3 A;  3B71 A;  3EH1 A;  3T4R A;  3C7J A;  1FTS A;  1QVX A;  3DM5 A;  4CSA A;  5KYX A;  4IRU A;  5EHH A;  2D4U A;  1LI5 A;  5CI9 A;  1HE9 A;  2HV7 A;  2LFD A;  1L7C A;  2XM0 A;  3C8Z A;  3BRJ A;  2FGY A;  3SP1 A;  1D0Y A;  2XSE A;  1ZHT A;  1Q0D A;  3UMI A;  3ASN C;  2A68 F;  4K1O A;  4AL1 A;  2Y39 A;  1M2O A;  2IXM A;  3K1I A;  1BBH A;  4PJJ A;  1PCX A;  2OKU A;  3G4Z A;  5BQG A;  1LIH A;  1JPJ A;  2HV6 A;  5F5H A;  3EJN A;  3HNI A;  4XLP F;  5B3S C;  1V55 C;  4DVY P;  4EHP A;  5JT4 A;  4UDV A;  4J7T A;  1O3U A;  4EUK B;  2NSF A;  1LS1 A;  4MTG A;  4RBN A;  2UUH A;  3DE9 A;  2PX3 A;  1D1C A;  1T6I A;  3GOR A;  3TOL A;  3ZDL A;  3ZC4 A;  1MMN A;  2XL4 A;  4Z9I A;  1H9T A;  3MYF A;  1NFN A;  3AG4 C;  2C03 A;  4LDK A;  1KTM A;  1VOM A;  4LAC B;  5DQZ A;  2OOC A;  3DAF A;  3KH2 A;  1OW6 A;  4BJ5 C;  2XM4 A;  4XTK A;  1G8X A;  2DYS C;  2Q7R A;  2H7O A;  1SZI A;  3DJU B;  1YVI A;  1XZP A;  3V5Y A;  2J46 A;  2J0W A;  2KSF A;  2LCH A;  1J8Y F;  4KI2 A;  3K6B A;  3N24 A;  2FFH A;  3PCV A;  3C62 A;  2F22 A;  4G7O F;  1SF8 A;  4G0H A;  3LES A;  4ULW A;  4BG0 A;  1HW2 A;  3C8G A;  3SZR A;  4C7O A;  2CDQ A;  1OXB A;  1S05 A;  5KYX B;  2J7P A;  5HSW A;  4JC7 A;  3NDB B;  1V4A A;  3FHD A;  3KL4 A;  4CS8 C;  2XLO A;  3V5Z A;  3ITF A;  3H2U A;  1E2X A;  2VCC A;  5COG A;  5L0J A;  1QZX A;  1L3P A;  2AWC A;  2WVO A;  5E2Q A;  3ZQV A;  4CBE A;  3IQ6 A;  2BE5 F;  4ULV A;  4XPY A;  5KYU A;  1YA7 O;  4U5B E;  4NTA A;  1OCC C;  1OKK A;  4M63 A;  1SYQ A;  3SXY A;  3BEH A;  3S27 A;  4BPM A;  4E7S A;  4NC3 A;  1APC A;  2GFH A;  1VK5 A;  3UR3 C;  2EIM C;  2KYH A;  1HMD A;  1O87 A;  4G7Z F;  4BEJ A;  1TKN A;  3CSK A;  1NG1 A;  2XS1 A;  2HS5 A;  4I1O B;  3RF3 A;  1ORY A;  3M79 A;  4CS9 C;  2ICW G;  4YN0 B;  3C8G D;  4CS9 A;  3L34 A;  4C3D A;  5TJ5 E;  3VM6 A;  1T01 A;  1TWG A;  1ZZP A;  2J7P D;  3QVY A;  4P9F A;  4RDA A;  1T9K A;  4FES A;  3JTL O;  3LUT B;  3T6J A;  3U2M A;  4Q5S F;  3POV A;  1FFH A;  5B1B C;  3NYM A;  1G5Z A;  1K40 A;  1M57 C;  1CGO A;  2B0J A;  2IOQ A;  4JTD B;  3ZTM A;  2DYR C;  3TQO A;  5A6A A;  1M2V A;  4BJ5 A;  1DOV A;  4DRJ B;  4YL0 A;  2L6F A;  4IB4 A;  1OKK D;  3DWW A;  5A6J A;  5A6B D;  4KBL A;  5L0D A;  4CSA C;  4OD4 A;  5L3Q A;  3KKB A;  4I1M A;  4IAR A;  4U5C E;  3U5S A;  1PD0 A;  3K66 A;  3ZWI A;  4EWC A;  5JRA A;  4QI2 A;  1OCO C;  1U6H A;  1G4W R;  2R03 A;  3DE8 A;  1I5N A;  3C8G B;  3U9M A;  4ZLC A;  4C7O B;  3K1I C;  4O6M A;  3MYI A;  1ZHY A;  3L8I A;  1U0B B;  3I5P A;  5E3C A;  2HJ3 A;  4NTF A;  5AC4 A;  3TD7 A;  1FMV A;  1Y4C A;  3FAP B;  1FMW A;  4MW3 A;  5EGY A;  2QTV A;  4AX2 A;  1WGW A;  2YL0 A;  2CW0 F;  4PK4 A;  2YL7 A;  2XL8 A;  4MVU A;  1H7I A;  5AC5 A;  2NG1 A;  4Z9J A;  2QLA A;  5A6K A;  2EIN C;  2WZF A;  2XL6 A;  3X2Q C;  1LM3 B;  5FCL A;  5IY5 C;  4MVZ A;  5F28 E;  1Z6A A;  3EQL F;  4WGY A;  4MQ9 F;  4CDV A;  2HMQ A;  2OCC C;  2YL1 A;  1QQ3 A;  3R7C A;  3W2W A;  3U8P A;  2CYD A;  2FAP B;  3K1H A;  3ABK C;  4A4A A;  1OW7 A;  5L0H A;  3RIP A;  1HE1 A;  1OR2 A;  1Z7Q c;  2IXO A;  2ZXW C;  5L0F A;  2KK1 A;  1MMA A;  2AVK A;  1RKE A;  2NUT A;  4O6Y A;  2VCB A;  3AJM A;  2IBF A;  2J9W A;  1RJ9 A;  4MVQ A;  2EIJ C;  4C3B A;  4FAP B;  3O6X A;  3O10 A;  3B0V C;  1LKX A;  1N1C A;  1M2V B;  3LEO A;  4YL3 A;  2JX0 A;  1JPN A;  2CNW A;  3TK0 A;  4YL1 A;  2A6E F;  3U9J A;  3ZSU A;  5KYY A;  1K05 A;  2J8W A;  2L9J A;  1A7E A;  4LDR A;  4N06 A;  3CQZ A;  1YJG A;  3GEI A;  5EK0 A;  2EPM X;  1G4U S;  1KNY A;  1C17 M;  4O6N A;  4OIN F;  4AE4 A;  1PD1 A;  2L6H A;  2HFI A;  2YZS A;  3JYH A;  3T6B A;  1BZ4 A;  4CX9 A;  1O5H A;  3J06 A;  2QY9 A;  4XLN F;  3GWN A;  1MNE A;  3AG3 C;  1I4Y A;  1Z3I X;  3MFN A;  4KNW A;  4EKW A;  4YT2 A;  4P9T A;  1YAR O;  1WAS A;  3HTK C;  1VTM P;  1BR4 A;  2MWQ A;  2CCY A;  4EIY A;  4WJ0 A;  4H4K C;  2QUP A;  4BJ1 A;  3ZIB A;  2ZPA A;  5K0I A;  3EFO A;  1D0X A;  3SEO A;  2XXA A;  2R7V A;  4XEK A;  3IPM O;  3G50 A;  4LDQ A;  4CDY A;  5BQH A;  4MTO A;  1M6T A;  3RKO F;  4B6I A;  2PNO A;  1RCP A;  4JUR I;  3B0U X;  4J7Y A;  2QNL A;  3K7D A;  5DVW A;  2KW3 C;  1TWA A;  2AU5 A;  2ZXR A;  3LS1 A;  2LP4 A;  1A7V A;  1CGN A;  2Q00 A;  4HEA J;  3U8V A;  3L8J A;  1RKE B;  2NUT B;  3DMD A;  2YLG A;  3O55 A;  3N0T A;  3ZVR A;  1RJ9 B;  2BL2 A;  3NMI A;  1Q0G A;  1OQC A;  5T3W A;  2Y3H A;  5L3V A;  4E17 A;  4JE9 A;  1C03 A;  3NRH A;  4JVS A;  3C18 A;  3DI5 A;  1H9G A;  1JRA A;  4KNV A;  3B0P A;  3UMH A;  5KYY B;  4OIP F;  1OCR C;  5E3A A;  1K04 A;  2A1D D;  3G4X A;  3W2V A;  2YQY A;  3LJB A;  3TJ6 A;  4G7H F;  1A0B A;  3ABM C;  4ZLD A;  1BR2 A;  5JSL A;  2L81 A;  2MYS A;  1E83 A;  2XXA B;  5JP7 A;  4OIQ F;  1F1M A;  5COF A;  4AE4 B;  3NYL A;  4PR9 A;  2V3C C;  4L6R A;  2MHR A;  1WOL A;  3JRT A;  3V5X A;  5B1A C;  1KU2 A;  1NU7 D;  4BJT A;  4FX5 A;  4CJG A;  3PDM P;  3A9C A;  3JSZ A;  2HKV A;  3N2Z B;  3SYN A;  4DOZ A;  2EIK C;  2Y69 C;  3HNJ A;  4HFF B;  5D91 A;  1ORS C;  2YVK A;  3EG9 A;  2CGE A;  3I5Q A;  3L1M A;  3QW1 A;  1VYK A;  3C63 A;  3GEE A;  4N4W A;  2HMZ A;  3CAX A;  3AG1 C;  2R7T A;  3GOD A;  4JTC B;  1J8M F;  3FXH A;  4NCQ A;  4BEM J;  4FWV A;  3FDQ A;  3JCU Q;  3L0I A;  3CEX A;  3IQT A;  4W8K A;  2OEX A;  3LNM B;  3ABL C;  4CIP A;  1NFO A;  1EI7 A;  1VLT A;  4U9D A;  3IQC A;  2R7R A;  1Q0M A;  1VMA A;  1MMD A;  5L0G A;  4BJ6 A;  2Y3D A;  1TWC A;  3M15 A;  3DZA A;  3LAY A;  2L6G A;  1QKR A;  3RQF A;  3RVZ A;  1ZVZ A;  2KNH A;  3E70 C;  2C04 A;  4MVS A;  1V54 C;  2XLW A;  3QTH A;  4A2N B;  1JAF A;  5DS4 A;  3QVZ A;  5JS5 A;  1Z23 A;  4R32 A;  4JTA B;  1ZU4 A;  3LS0 A;  4DBQ A;  4XEV A;  4NTB A;  2KGO A;  4I3M A;  256B A;  5DS6 A;  3PHF 2;  1JMW A;  4MVO A;  4XEF A;  3S0X A;  2VC9 A;  2WZL A;  1E85 A;  2YEV A;  3T9O A;  3RYL A;  1YZA A;  3DM9 B;  1RMV A;  1TQG A;  2NSG A;  3NYJ A;  4NY3 A;  5JLI A;  5KYW A;  2ZXO A;  5KYU B;  1E86 A;  1CGM E;  1SMY F;  3ZTZ A;  2ZD9 A;  2R9R B;  1NU9 C;  2YLI A;  4JRZ A;  4E0I A;  2HUJ A;  3NKE A;  4JJG A;  3NKD A;  2P7V A;  4J32 B;  1A7D A;  1OCZ C;  1Q0F A;  1AUE A;  4U5D E;  2IM8 A;  3EG9 B;  3QW0 A;  5B3I A;  3ASO C;  5GPG B;  3RQG A;  4YK5 A;  3JT1 A;  1GGQ A;  4LLC A;  1Z63 A;  3OWT A;  4IWB A;  3GWL A;  4F4B A;  2LSE A;  3JYY A;  2H7V C;  3LNR A;  2HJM A;  3UNG C;  4XPW A;  5DQT A;  2DGJ A;  4EBK A;  2E87 A;  4JJF A;  1UFB A;  3FAJ A;  3U3F A;  4PFO A;  2P6V A;  2IXN A;  4DVZ A;  1XWJ A;  2XLE A;  4E7Z A;  2GAQ A;  3VAY A;  4GQH A;  1H6G A;  2OJQ A;  3MLG A;  4IAO A;  2P61 A;  2W4M A;  3W4Y A;  5CIV A;  4D4X A;  3HKK A;  3WHN A;  2V26 A;  3GAN A;  3RQE A;  2J9V A;  1T5O A;  2W45 A;  2Z15 A;  4D4N A;  1BDJ B;  1M56 C;  2A0B A;  1ZU5 A;  4PAC A;  2IXP A;  2WVN A;  1VB5 A;  1FR0 A;  1YYJ A;  1EKY A;  3EGD A;  2OG2 A;  2A69 F;  2HSQ A;  2EPK X;  1Q0K A;  1ZHZ A;  2RD9 A;  1NZE A;  1ZW2 A;  3AGT A;  2XRH A;  3LLI A;  4WGZ A;  2NUP A;  4GYT A;  4I44 A;  2GWW A;  4YT8 A;  2Q9A A;  1DOW A;  3DXJ F;  1D1B A;  4DXW A;  2G62 A;  5A69 A; 
#chains in the Genus database with same CATH homology
 4XEV A;  1ZZP A;  3C18 A;  3O10 A;  3C8G A;  4EBK A;  3JZ0 A;  4XEF A;  3GM2 A;  1K04 A;  1UFB A;  2JX0 A;  1K40 A;  3U3F A;  1V4A A;  4XEK A;  1WWP A;  1WTY A;  3B71 A;  1PV3 A;  1QVX A;  1K05 A;  3TUL A;  2L6F A;  1KTM A;  1OW8 A;  3GM3 A;  3K7D A;  5F28 E;  4EBJ A;  1KNY A;  2PBE A;  1WOL A;  1OW6 A;  3BRJ A;  3GM1 A;  4NQF A;  3RQE A;  2Q00 A;  3U0C A;  3L8I A;  2L6H A;  1OW7 A;  3L8J A;  3S9O A;  2L6G A;  3AJM A;  3RQF A;  2YWA A;  3RQG A;  3MFN A;  3C8G B;  1JOG A;  2KK1 A;  2HSB A;  2LK4 A;  4R32 A;  3C8G D;  3JYY A;  2JPU A;  1O3U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...