1ZZPA

Solution structure of the f-actin binding domain of bcr-abl/c-abl
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
109
structure length
109
Chain Sequence
SGAITKGVVLDSTEALCLAISRNSEQMASHSAVLEAGKNLYSFCVSYVDSIQQMRNKFAFREAINKLENNLRELQICPATAGSGPAATQDFSKLLSSVKEISDIVQRLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
publication title Structural Basis for the Cytoskeletal Association of Bcr-Abl/c-Abl.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 29
structure length 109
sequence length 109
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2005-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08919 F_actin_bind F-actin binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1zzpA00
1OW7A 4NQFA 3RQFA 1QVXA 2KK1A 3GM1A 3BRJA 3RQGA 3O10A 1JOGA 2LK4A 3C8GD 4EBJA 4EBKA 1V4AA 3L8IA 2PBEA 3S9OA 1K40A 2Q00A 3TULA 3B71A 3L8JA 2HSBA 2YWAA 2L6HA 1OW6A 1K05A 2L6FA 4XEKA 1K04A 3JYYA 4R32A 1O3UA 1ZZPA 3C8GB 4XEFA 3GM2A 1OW8A 3U0CA 1PV3A 1WTYA 3C8GA 3RQEA 3U3FA 3JZ0A 5F28E 2L6GA 3K7DA 3C18A 3GM3A 4XEVA 3MFNA 1WWPA 1KNYA 1WOLA 2JX0A 1KTMA 3AJMA 1UFBA 2JPUA
chains in the Genus database with same CATH superfamily
1APCA 2P0NA 2X0CA 3FOPA 3S84A 4AE4B 2R7XA 1LI5A 3RF3A 5DQZA 5CI9A 1Q0DA 4LDKA 2XXAA 2PBEA 2XLVA 3DAFA 4MTGA 2J7PD 1MMNA 3MYFA 2Y3HA 2OEVA 4XPYA 3JSZA 1CGNA 4LDQA 3S28A 3L8JA 3EG9B 5EHHA 2Y3BA 2IXPA 2XLEA 1CGME 1VOMA 2KW3C 2PX3A 4MTOA 2R7TA 3IQ6A 3PHF2 4DVYP 1O3UA 1ZZPA 1QSPA 3ABLC 1MMDA 1WATA 1XWJA 2C03A 3JRTA 2XLDA 1Y4CA 4JEAA 4U5GA 3V7OA 4PACA 3ZIBA 1GM5A 4C7OA 1FMWA 2A68F 3EHNA 2M64A 2A1DD 3RKOF 1OKKA 3EH1A 3U9JA 2JX0A 4GQHA 2HJMA 5L0GA 2YEVA 4KC9A 4JVSA 2ZD9A 1VLTA 2YL7A 2DI3A 3EQLF 3GODA 3IPMO 3JSEO 1D1CA 3K33A 2MHRA 1H9GA 5DLJA 1BR1A 1XZQA 3SP1A 4YL1A 2R7OA 3NMIA 4U5BE 2KSFA 3Q7LA 2HSBA 2A6HF 4AK9A 3W2VA 2VCCA 4RBNA 2FGYA 3L34A 4EIYA 2R02A 1YLMA 3O39A 2OU6A 2P6VA 2B0HA 4XWJA 2I8BA 2XLOA 1OW8A 3U0CA 3EJNA 1M2VB 2WVQA 2CYDA 2WZFA 4I1MA 1ZHTA 3T9OA 4DRHB 4E17A 4MS2A 2NSGA 3SYNA 3M79A 4DOZA 1NZEA 5DS4A 1YA9A 3SXKA 3DWWA 5L0JA 2VB6A 3OWTA 2VASA 3V5YA 3KKBA 3K1IA 4N6CA 1BR4A 4O6NA 2IXOA 3T4RA 2NPUA 1TWHA 5KYYB 1ST6A 2AVKA 2EIMC 3HNIA 3VRCA 1SZIA 4MVUA 4FESA 4MNDA 5JRAA 2KJGA 5KYXB 2CW0F 2YWAA 4H4KC 4JJFA 1K05A 3ABMC 1HE1A 3DZAA 3KH2A 5GPGB 1VTMP 1ZHYA 1MNEA 4I44A 3SNHA 1M2OA 3VF0A 3DXJF 2QY9A 2DYRC 5B1AC 1SYQA 3HNJA 3ZDLA 3VAYA 2HZ8A 2CDQA 3ZWIA 4OIQF 1BR2A 1R4TA 1LIHA 2YZSA 2EPKX 4RD9A 1ORYA 2O9XA 2UUHA 1OR3A 2NUPB 3BRJA 3QVZA 4EBKA 2XLHA 4LDRA 2GWWA 1F1MA 1PD0A 4MVRA 1Q0KA 3RYLA 5EGYA 1GGQA 1Z3IX 2YQYA 1Y6DA 3VYWA 4L6RA 4MVZA 4Z9HA 3ZC4A 3CZ6A 2J9UA 3T6GB 4ZLDA 3TK0A 4CJGA 4AL1A 2YLIA 1G5ZA 3C8GB 3GEIA 4BEMJ 5D91A 2XM4A 3U3FA 4HE8D 4MVSA 4J7YA 2AWYA 2OQMA 2XS8A 4C3EA 4WJ0A 4BPMA 1OCZC 2YKZA 1OQCA 3EGXB 2EPMX 4YT5A 4F4BA 4O6MA 2KQ9A 1YJGA 2XLMA 1TWAA 4HFKB 4D4NA 3K1IC 2H7OA 2BL2A 3NKDA 3S90A 5K0IA 3G4XA 2EPNA 1JAFA 1SF8A 3LUTB 4NC3A 5COFA 2J0WA 5A6BD 3UGPA 2B0JA 4BJTA 4MW8A 3DJUB 2XL4A 2EPOA 1FMVA 1IZMA 2A0UA 2MWQA 4LLCA 2GDCA 3LNMB 4ANJA 1FTSA 1ZYRF 2ZXOA 256BA 4ULWA 4U5FE 3ZG1A 3S0XA 1HW2A 3FDQA 3B0PA 4W8PA 1Q0GA 3R2PA 3U2LA 1LPEA 2D4UA 3NMKA 3TQOA 3ZQVA 1FFTC 4XLNF 3NYMA 1NU9C 4OD4A 1ZVZA 2D5RB 2QNLA 3HNKA 3WHNA 2YL0A 4U5EE 1QQ3A 4JJGA 3GM1A 5BQHA 1RKEA 2A0BA 2BE5F 2KYHA 5BQIA 3HNLA 1EQ1A 5T3TA 3PMRA 1I4YA 3C8GD 1U89A 4C3BA 2L7AA 4IAOA 5FZTA 3EFOA 2XSEA 1C03A 4I3MA 3F46A 2NUTA 2P61A 3MBGA 4O6YA 4QI0A 1T01A 4WGZA 2PNOA 1BDJB 3N0TA 1N1CA 1MQVA 2J9WA 3DD7A 3C7JA 1ZHXA 1RCPA 1T6QA 2XL8A 5AC4A 4EKWA 3G50A 4XEKA 5KYWB 1K04A 2J8WA 2WB7A 1LI7A 1V55C 2J9VA 3GM2A 4MQ9F 1Z5ZA 1OR2A 2HUJA 2CGEA 2Y69C 5L0CA 4MVQA 1J8YF 3AQCA 3B0UX 2J7PA 4MW3A 2HV7A 2R7WA 4K0DA 4U5DE 5L0HA 1B68A 2WVNA 3ASOC 3G4ZA 1V54C 1VYKA 3A11A 4W8KA 2DGJA 4CBEA 2UUIA 3M15A 5E2QA 5L3VA 2GA0A 3ECSA 2KGOA 5KYUB 3Q6MA 5AC5A 1ZU4A 1YVIA 3FAPB 4IRUA 3O10A 3SEOA 1VLSA 2LK4A 3LEVA 4AL0A 4OIPF 1A7EA 4YK5A 3TD7A 3UR3C 4CJOA 1E86A 5F5FA 2H8AA 2YRFA 4LERA 3LS1A 1LKXA 1QPUA 1BZ4A 3AOUA 4OINF 1VK5A 2WZLA 2ZXWC 5JS5A 4RDAA 4BEJA 2X51A 4GYTA 3QTHA 3KYIA 3DMDA 5T3WA 4FAPB 1U0BB 2OCCC 3EZHA 1AVOB 3HTKC 4PJJA 4U5CE 1EI7A 3IQ5A 4YN0B 1E85A 2R7QA 1MMAA 2L6GA 2QE9A 4PFPA 4C3DA 3ZVRA 3C8ZA 1U6HA 2IM8A 2KNHA 4HEAJ 3NDBB 4CIHA 1C02A 3AQBA 1QVXA 3FHDA 2R03A 3BEHA 1PD1A 3KYJA 3GANA 1HMOA 4JCHA 2PP4A 2LQGA 3UNGC 2Y3GA 3C62A 3RVYA 5DS5A 2VCAA 4IAQA 1RKCA 1A0BA 1ZHWA 2L6HA 2OJQA 3TJ5A 3TOLA 3T6BA 3W8HA 2R7VA 1GQAA 2TMVP 2H7VC 4ZLCA 3FVYA 2LFDA 2GFHA 5KYNA 3LNRA 2C04A 4CX9A 3ABKC 4KI2A 5JLIA 3C18A 3NYLA 3RFYA 3MFNA 2R7SA 4N6HA 4UDVA 4N06A 1QZXA 2VH3A 4NQFA 1AEPA 1TQGA 4OIRF 1G4US 3U3BA 2LP4A 5AGFA 4G78A 1GS9A 3EPVA 1BBHA 2Y39A 4ULVA 3IHUA 3L8IA 1T5OA 1OCOC 4JIOA 2A69F 4Z9JA 3UMHA 1J8MF 1NLXA 2PFDA 3JYHA 2DB4A 3TJ6A 4NTBA 1L7CA 1YZAA 3ASNC 3JRMO 3AGUA 4IJJA 2Q9CA 2CNWD 1L3PA 4KNWA 3E9VA 3IQCA 3NMJA 4P6IC 1LE2A 1MNDA 2J0XA 5E3AA 3N24A 4BG0A 3U9MA 1M57C 3MX3A 2R05A 3M4CA 3Q6NA 3CAXA 1M2VA 4EUKB 3LLIA 2WVOA 3NG1A 1WGWA 3I4UA 4E0HA 1EKYA 3K7DA 2Y3DA 3GWNA 2BC5A 1TR2A 2F22A 1WOLA 4DVZA 3ZTZA 2W9YA 3JTLO 3K66A 3DJNB 3PDMP 2IBFA 5E33A 2LD6A 2PF4E 3GORA 5IY5C 3UGOA 4G7HF 3EFOB 4PJMA 3RQGA 4E7ZA 5T1DB 2XXAB 3ITFA 3U5SA 1NU7D 4BJ1A 2HV6A 2NUTB 1CPRA 1V74B 2XS1A 1D1BA 1SMYF 5L3QA 1RXQA 4G0HA 3QZCA 3S29A 1E83A 2OKUA 1YZCA 3LJBA 3DM9B 2NSFA 1H7IA 3JYYA 2IXNA 4JRZA 2Q7RA 3UMKA 2IXMA 1VMAA 2P1AA 2EIKC 1ZU5A 2RSEB 2HS5A 4C7OB 3SZRA 4D4XA 3NYJA 5F5HA 3DM5A 3W8IA 3DI5A 4XTKA 3RW0A 1C17M 2OG2A 3V5ZA 4H54A 1LM3B 2JD3A 1I4ZA 3EGDA 4J32B 2HFIA 4BJ5C 3GEEA 2YLDA 3M1CB 5A69A 5JUAA 3RQFA 3POVA 1H9TA 1E84A 4U9DA 3L0IA 3JT1A 2W4BA 1JOGA 3KMIA 4P9FA 3K6BA 1LE4A 1TFKB 1V4AA 1YARO 2G3KA 2Q00A 2J46A 2RD9A 4XLPF 3H2VA 3TOMA 4GEHA 1M56C 4CDYA 2KC3A 3A9CA 1A41A 4EBBA 5A6KA 4CIPA 4G7ZF 4Q5SF 4A4AA 4U5HA 4PFOA 3KPHA 3QW0A 4IGGA 1DOVA 2R25A 3O6XA 1Z63A 4OIOF 5DQTA 1ZW3A 2AU5A 4I1OB 2R9RB 4XQ1A 1PV3A 3OEOA 3C8GA 1NSGB 1M6TA 2HMQA 3EH2A 4DBQA 1Q0FA 2Q4FA 4K1OA 2AWCA 1AUEA 1NFOA 2EILC 4PR9A 3X2QC 2YL1A 3OA1A 3W4YA 4CDAA 3UMIA 4IARA 2Q9AA 1WWPA 2AP3A 3EGXA 1UFBA 2JPUA 3R7CA 2EIJC 2LCHA 4DXWA 1OW7A 1OCRC 2H7BA 1ORJA 3QVYA 5DVWA 5HV9A 3B9QA 1S05A 3TULA 1W2WA 2OOCA 4YT2A 1WN0A 4AX2A 3QMKA 4CS9A 4O7GA 1OKKD 1FFHA 1FAPB 1H6GA 1ZW2A 2XLWA 1HW1A 1UG7A 4K7BA 1XZPA 3U8VA 5CIVA 1LS4A 1RJ9A 4J30B 3US6A 4A2NB 1G8XA 2CCYA 1VYIA 2YHSA 1OXKA 3ATPA 3HLZA 4PJNA 5L0FA 1S7ZA 1SR2A 1YYXA 3JZ0A 3GWLA 2YLGA 2J9BA 4CDVA 4YT4A 1Z23A 1ORSC 3N2ZB 1A7DA 2I15A 4XEVA 4CS8A 1TWCA 3AG3C 2W45A 3T6JA 4Q4ZF 2FAPB 2ZXRA 2ASRA 3RH3A 2ZXPA 1TKNA 4YJWA 3SXMA 1NG1A 5JVEA 3H65A 2VC9A 1D0ZA 1VB5A 3AGTA 2G3VA 1TWGA 4IB4A 3CSKA 3MLGA 2WL8A 3FMSA 3IEEA 4LLEA 4Z9IA 3W2WA 4AE4A 3M4BA 2VCBA 5L0IA 3U8PA 4YWQA 5JP7A 1IW7F 3LLKA 2DYSC 5TJ5E 3EHMA 3AG1C 4XPWA 4DBRA 5BUOA 4DRJB 1T6IA 1OW6A 2XL6A 4YT8A 2J45A 2L6FA 3EG9A 3NRHA 4JEBA 2MYSA 5KYWA 2V26A 2ETSA 3SXYA 2HJ3A 4JCZA 1YA7O 2FFHA 4WABA 1D0XA 3X1OA 4BJ6C 4QI2A 2LFFA 3I5QA 4JTAB 3WAQA 1DOWA 4JC7A 3MYIA 3QW1A 4E7SA 3GM3A 4CSAC 4P9TA 3RVZA 3SXZA 2OEXA 3S27A 3U2MA 4MVOA 4BJ5A 2HSQA 4PK4A 1JMWA 3DAGA 4JZAA 4ER9A 2R7UA 2G62A 5DS6A 4XPXA 2ICWG 4YL0A 4YL3A 5KYUA 5CI8A 1JPJA 2EPLX 2ZPAA 1FR0A 1MMGA 3I5PA 4IWBA 4PJLA 1YAUO 1Q0MA 1YYJA 3B71A 4B6IA 1KU2A 5A6AA 3DE9A 3HKKA 4CS9C 2NG1A 1OXBA 3DE8A 2YL3A 1LVKA 1R5ID 3RIPA 1HY5A 3WG7C 1D0YA 3WODF 2P7VA 1FNTc 1D1AA 1WTYA 3RQEA 2Q3TA 1EA8A 5B3IA 1JR8A 2L81A 3EGDB 3C63A 2A6EF 4EHPA 5B3SC 4CS8C 1KTMA 1KNYA 1G4WR 2CNWA 4JKVA 4R32A 1QKRA 2PX0A 1RKEB 2IOQA 2Z15A 2KK1A 2L9JA 1T9KA 3AG4C 4NY3A 4DJ9A 4M63A 3J06A 4ONSA 3S9OA 2GAQA 2QLAA 1K40A 4N4WA 1Z7Qc 5KYYA 3H2UA 4MVMA 3V5XA 2R7RA 3L1MA 3ZQYA 5FCLA 2LSEA 2LIGA 4G7OF 3NKEA 3FOOA 4U9EA 2QUPA 4CS7A 1JRAA 5KYXA 1WASA 5HSWA 4JTDB 3HJCA 3AG2C 2QTVA 5B1BC 2Q9BA 4OD5A 1NFNA 5JSLA 1TFOB 1YDIA 2XM0A 2IYLD 3B29A 3DKAA 3Q7GA 3F47A 1E2XA 1HE9A 5A6BA 2YVKA 3ZSUA 1A7VA 4LACB 5JT4A 5BQGA 4FWVA 5F28E 3CEXA 5COGA 3FXHA 2WZGA 3E70C 4X0RA 3K1HA 5COMA 3LESA 3VM6A 4O79A 1I5NA 5D92A 2V3CC 5EK0A 3B0VC 4KBLA 1OCCC 2HMZA 3ZTMA 1ZHZA 4E18A 1JPNA 1T6UA 2E87A 2EINC 3O55A 1QLEC 4EBJA 1PCXA 1LS1A 1Z6AA 2NUPA 2OJED 4JE9A 4MTFA 4DRIB 4J7TA 3IQTA 4NCQA 4NTFA 4QDLA 2XRHA 1RJ9B 4FX5A 4Q7CA 4WGYA 1CPQA 4JURI 3GEHA 4HFFB 4KNVA 3LAYA 2W4MA 3LS0A 4XEFA 2HKVA 1RMVA 2M4EA 1O87A 3EZIA 1HMDA 4BJ6A 4NTAA 3FAJA 5A6JA 1CGOA 3JCUQ 3KL4A 5L0DA 4EWCA 4CSAA 5E3CA 1NBBA 1O5HA 4JTCB 3LEOA 3CQZA 4JW1A 3PCVA 3AJMA 4E0IA
chains in the Genus database with same CATH topology
1OW7A 4NQFA 3RQFA 1QVXA 2KK1A 3GM1A 3BRJA 3RQGA 3O10A 1JOGA 2LK4A 3C8GD 4EBJA 4EBKA 1V4AA 3L8IA 2PBEA 3S9OA 1K40A 2Q00A 3TULA 3B71A 3L8JA 2HSBA 2YWAA 2L6HA 1OW6A 1K05A 2L6FA 4XEKA 1K04A 3JYYA 4R32A 1O3UA 1ZZPA 3C8GB 4XEFA 3GM2A 1OW8A 3U0CA 1PV3A 1WTYA 3C8GA 3RQEA 3U3FA 3JZ0A 5F28E 2L6GA 3K7DA 3C18A 3GM3A 4XEVA 3MFNA 1WWPA 1KNYA 1WOLA 2JX0A 1KTMA 3AJMA 1UFBA 2JPUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OW7 A;  4NQF A;  3RQF A;  1QVX A;  2KK1 A;  3GM1 A;  3BRJ A;  3RQG A;  3O10 A;  1JOG A;  2LK4 A;  3C8G D;  4EBJ A;  4EBK A;  1V4A A;  3L8I A;  2PBE A;  3S9O A;  1K40 A;  2Q00 A;  3TUL A;  3B71 A;  3L8J A;  2HSB A;  2YWA A;  2L6H A;  1OW6 A;  1K05 A;  2L6F A;  4XEK A;  1K04 A;  3JYY A;  4R32 A;  1O3U A;  1ZZP A;  3C8G B;  4XEF A;  3GM2 A;  1OW8 A;  3U0C A;  1PV3 A;  1WTY A;  3C8G A;  3RQE A;  3U3F A;  3JZ0 A;  5F28 E;  2L6G A;  3K7D A;  3C18 A;  3GM3 A;  4XEV A;  3MFN A;  1WWP A;  1KNY A;  1WOL A;  2JX0 A;  1KTM A;  3AJM A;  1UFB A;  2JPU A; 
#chains in the Genus database with same CATH topology
 1APC A;  2P0N A;  2X0C A;  3FOP A;  3S84 A;  4AE4 B;  2R7X A;  1LI5 A;  3RF3 A;  5DQZ A;  5CI9 A;  1Q0D A;  4LDK A;  2XXA A;  2PBE A;  2XLV A;  3DAF A;  4MTG A;  2J7P D;  1MMN A;  3MYF A;  2Y3H A;  2OEV A;  4XPY A;  3JSZ A;  1CGN A;  4LDQ A;  3S28 A;  3L8J A;  3EG9 B;  5EHH A;  2Y3B A;  2IXP A;  2XLE A;  1CGM E;  1VOM A;  2KW3 C;  2PX3 A;  4MTO A;  2R7T A;  3IQ6 A;  3PHF 2;  4DVY P;  1O3U A;  1ZZP A;  1QSP A;  3ABL C;  1MMD A;  1WAT A;  1XWJ A;  2C03 A;  3JRT A;  2XLD A;  1Y4C A;  4JEA A;  4U5G A;  3V7O A;  4PAC A;  3ZIB A;  1GM5 A;  4C7O A;  1FMW A;  2A68 F;  3EHN A;  2M64 A;  2A1D D;  3RKO F;  1OKK A;  3EH1 A;  3U9J A;  2JX0 A;  4GQH A;  2HJM A;  5L0G A;  2YEV A;  4KC9 A;  4JVS A;  2ZD9 A;  1VLT A;  2YL7 A;  2DI3 A;  3EQL F;  3GOD A;  3IPM O;  3JSE O;  1D1C A;  3K33 A;  2MHR A;  1H9G A;  5DLJ A;  1BR1 A;  1XZQ A;  3SP1 A;  4YL1 A;  2R7O A;  3NMI A;  4U5B E;  2KSF A;  3Q7L A;  2HSB A;  2A6H F;  4AK9 A;  3W2V A;  2VCC A;  4RBN A;  2FGY A;  3L34 A;  4EIY A;  2R02 A;  1YLM A;  3O39 A;  2OU6 A;  2P6V A;  2B0H A;  4XWJ A;  2I8B A;  2XLO A;  1OW8 A;  3U0C A;  3EJN A;  1M2V B;  2WVQ A;  2CYD A;  2WZF A;  4I1M A;  1ZHT A;  3T9O A;  4DRH B;  4E17 A;  4MS2 A;  2NSG A;  3SYN A;  3M79 A;  4DOZ A;  1NZE A;  5DS4 A;  1YA9 A;  3SXK A;  3DWW A;  5L0J A;  2VB6 A;  3OWT A;  2VAS A;  3V5Y A;  3KKB A;  3K1I A;  4N6C A;  1BR4 A;  4O6N A;  2IXO A;  3T4R A;  2NPU A;  1TWH A;  5KYY B;  1ST6 A;  2AVK A;  2EIM C;  3HNI A;  3VRC A;  1SZI A;  4MVU A;  4FES A;  4MND A;  5JRA A;  2KJG A;  5KYX B;  2CW0 F;  2YWA A;  4H4K C;  4JJF A;  1K05 A;  3ABM C;  1HE1 A;  3DZA A;  3KH2 A;  5GPG B;  1VTM P;  1ZHY A;  1MNE A;  4I44 A;  3SNH A;  1M2O A;  3VF0 A;  3DXJ F;  2QY9 A;  2DYR C;  5B1A C;  1SYQ A;  3HNJ A;  3ZDL A;  3VAY A;  2HZ8 A;  2CDQ A;  3ZWI A;  4OIQ F;  1BR2 A;  1R4T A;  1LIH A;  2YZS A;  2EPK X;  4RD9 A;  1ORY A;  2O9X A;  2UUH A;  1OR3 A;  2NUP B;  3BRJ A;  3QVZ A;  4EBK A;  2XLH A;  4LDR A;  2GWW A;  1F1M A;  1PD0 A;  4MVR A;  1Q0K A;  3RYL A;  5EGY A;  1GGQ A;  1Z3I X;  2YQY A;  1Y6D A;  3VYW A;  4L6R A;  4MVZ A;  4Z9H A;  3ZC4 A;  3CZ6 A;  2J9U A;  3T6G B;  4ZLD A;  3TK0 A;  4CJG A;  4AL1 A;  2YLI A;  1G5Z A;  3C8G B;  3GEI A;  4BEM J;  5D91 A;  2XM4 A;  3U3F A;  4HE8 D;  4MVS A;  4J7Y A;  2AWY A;  2OQM A;  2XS8 A;  4C3E A;  4WJ0 A;  4BPM A;  1OCZ C;  2YKZ A;  1OQC A;  3EGX B;  2EPM X;  4YT5 A;  4F4B A;  4O6M A;  2KQ9 A;  1YJG A;  2XLM A;  1TWA A;  4HFK B;  4D4N A;  3K1I C;  2H7O A;  2BL2 A;  3NKD A;  3S90 A;  5K0I A;  3G4X A;  2EPN A;  1JAF A;  1SF8 A;  3LUT B;  4NC3 A;  5COF A;  2J0W A;  5A6B D;  3UGP A;  2B0J A;  4BJT A;  4MW8 A;  3DJU B;  2XL4 A;  2EPO A;  1FMV A;  1IZM A;  2A0U A;  2MWQ A;  4LLC A;  2GDC A;  3LNM B;  4ANJ A;  1FTS A;  1ZYR F;  2ZXO A;  256B A;  4ULW A;  4U5F E;  3ZG1 A;  3S0X A;  1HW2 A;  3FDQ A;  3B0P A;  4W8P A;  1Q0G A;  3R2P A;  3U2L A;  1LPE A;  2D4U A;  3NMK A;  3TQO A;  3ZQV A;  1FFT C;  4XLN F;  3NYM A;  1NU9 C;  4OD4 A;  1ZVZ A;  2D5R B;  2QNL A;  3HNK A;  3WHN A;  2YL0 A;  4U5E E;  1QQ3 A;  4JJG A;  3GM1 A;  5BQH A;  1RKE A;  2A0B A;  2BE5 F;  2KYH A;  5BQI A;  3HNL A;  1EQ1 A;  5T3T A;  3PMR A;  1I4Y A;  3C8G D;  1U89 A;  4C3B A;  2L7A A;  4IAO A;  5FZT A;  3EFO A;  2XSE A;  1C03 A;  4I3M A;  3F46 A;  2NUT A;  2P61 A;  3MBG A;  4O6Y A;  4QI0 A;  1T01 A;  4WGZ A;  2PNO A;  1BDJ B;  3N0T A;  1N1C A;  1MQV A;  2J9W A;  3DD7 A;  3C7J A;  1ZHX A;  1RCP A;  1T6Q A;  2XL8 A;  5AC4 A;  4EKW A;  3G50 A;  4XEK A;  5KYW B;  1K04 A;  2J8W A;  2WB7 A;  1LI7 A;  1V55 C;  2J9V A;  3GM2 A;  4MQ9 F;  1Z5Z A;  1OR2 A;  2HUJ A;  2CGE A;  2Y69 C;  5L0C A;  4MVQ A;  1J8Y F;  3AQC A;  3B0U X;  2J7P A;  4MW3 A;  2HV7 A;  2R7W A;  4K0D A;  4U5D E;  5L0H A;  1B68 A;  2WVN A;  3ASO C;  3G4Z A;  1V54 C;  1VYK A;  3A11 A;  4W8K A;  2DGJ A;  4CBE A;  2UUI A;  3M15 A;  5E2Q A;  5L3V A;  2GA0 A;  3ECS A;  2KGO A;  5KYU B;  3Q6M A;  5AC5 A;  1ZU4 A;  1YVI A;  3FAP B;  4IRU A;  3O10 A;  3SEO A;  1VLS A;  2LK4 A;  3LEV A;  4AL0 A;  4OIP F;  1A7E A;  4YK5 A;  3TD7 A;  3UR3 C;  4CJO A;  1E86 A;  5F5F A;  2H8A A;  2YRF A;  4LER A;  3LS1 A;  1LKX A;  1QPU A;  1BZ4 A;  3AOU A;  4OIN F;  1VK5 A;  2WZL A;  2ZXW C;  5JS5 A;  4RDA A;  4BEJ A;  2X51 A;  4GYT A;  3QTH A;  3KYI A;  3DMD A;  5T3W A;  4FAP B;  1U0B B;  2OCC C;  3EZH A;  1AVO B;  3HTK C;  4PJJ A;  4U5C E;  1EI7 A;  3IQ5 A;  4YN0 B;  1E85 A;  2R7Q A;  1MMA A;  2L6G A;  2QE9 A;  4PFP A;  4C3D A;  3ZVR A;  3C8Z A;  1U6H A;  2IM8 A;  2KNH A;  4HEA J;  3NDB B;  4CIH A;  1C02 A;  3AQB A;  1QVX A;  3FHD A;  2R03 A;  3BEH A;  1PD1 A;  3KYJ A;  3GAN A;  1HMO A;  4JCH A;  2PP4 A;  2LQG A;  3UNG C;  2Y3G A;  3C62 A;  3RVY A;  5DS5 A;  2VCA A;  4IAQ A;  1RKC A;  1A0B A;  1ZHW A;  2L6H A;  2OJQ A;  3TJ5 A;  3TOL A;  3T6B A;  3W8H A;  2R7V A;  1GQA A;  2TMV P;  2H7V C;  4ZLC A;  3FVY A;  2LFD A;  2GFH A;  5KYN A;  3LNR A;  2C04 A;  4CX9 A;  3ABK C;  4KI2 A;  5JLI A;  3C18 A;  3NYL A;  3RFY A;  3MFN A;  2R7S A;  4N6H A;  4UDV A;  4N06 A;  1QZX A;  2VH3 A;  4NQF A;  1AEP A;  1TQG A;  4OIR F;  1G4U S;  3U3B A;  2LP4 A;  5AGF A;  4G78 A;  1GS9 A;  3EPV A;  1BBH A;  2Y39 A;  4ULV A;  3IHU A;  3L8I A;  1T5O A;  1OCO C;  4JIO A;  2A69 F;  4Z9J A;  3UMH A;  1J8M F;  1NLX A;  2PFD A;  3JYH A;  2DB4 A;  3TJ6 A;  4NTB A;  1L7C A;  1YZA A;  3ASN C;  3JRM O;  3AGU A;  4IJJ A;  2Q9C A;  2CNW D;  1L3P A;  4KNW A;  3E9V A;  3IQC A;  3NMJ A;  4P6I C;  1LE2 A;  1MND A;  2J0X A;  5E3A A;  3N24 A;  4BG0 A;  3U9M A;  1M57 C;  3MX3 A;  2R05 A;  3M4C A;  3Q6N A;  3CAX A;  1M2V A;  4EUK B;  3LLI A;  2WVO A;  3NG1 A;  1WGW A;  3I4U A;  4E0H A;  1EKY A;  3K7D A;  2Y3D A;  3GWN A;  2BC5 A;  1TR2 A;  2F22 A;  1WOL A;  4DVZ A;  3ZTZ A;  2W9Y A;  3JTL O;  3K66 A;  3DJN B;  3PDM P;  2IBF A;  5E33 A;  2LD6 A;  2PF4 E;  3GOR A;  5IY5 C;  3UGO A;  4G7H F;  3EFO B;  4PJM A;  3RQG A;  4E7Z A;  5T1D B;  2XXA B;  3ITF A;  3U5S A;  1NU7 D;  4BJ1 A;  2HV6 A;  2NUT B;  1CPR A;  1V74 B;  2XS1 A;  1D1B A;  1SMY F;  5L3Q A;  1RXQ A;  4G0H A;  3QZC A;  3S29 A;  1E83 A;  2OKU A;  1YZC A;  3LJB A;  3DM9 B;  2NSF A;  1H7I A;  3JYY A;  2IXN A;  4JRZ A;  2Q7R A;  3UMK A;  2IXM A;  1VMA A;  2P1A A;  2EIK C;  1ZU5 A;  2RSE B;  2HS5 A;  4C7O B;  3SZR A;  4D4X A;  3NYJ A;  5F5H A;  3DM5 A;  3W8I A;  3DI5 A;  4XTK A;  3RW0 A;  1C17 M;  2OG2 A;  3V5Z A;  4H54 A;  1LM3 B;  2JD3 A;  1I4Z A;  3EGD A;  4J32 B;  2HFI A;  4BJ5 C;  3GEE A;  2YLD A;  3M1C B;  5A69 A;  5JUA A;  3RQF A;  3POV A;  1H9T A;  1E84 A;  4U9D A;  3L0I A;  3JT1 A;  2W4B A;  1JOG A;  3KMI A;  4P9F A;  3K6B A;  1LE4 A;  1TFK B;  1V4A A;  1YAR O;  2G3K A;  2Q00 A;  2J46 A;  2RD9 A;  4XLP F;  3H2V A;  3TOM A;  4GEH A;  1M56 C;  4CDY A;  2KC3 A;  3A9C A;  1A41 A;  4EBB A;  5A6K A;  4CIP A;  4G7Z F;  4Q5S F;  4A4A A;  4U5H A;  4PFO A;  3KPH A;  3QW0 A;  4IGG A;  1DOV A;  2R25 A;  3O6X A;  1Z63 A;  4OIO F;  5DQT A;  1ZW3 A;  2AU5 A;  4I1O B;  2R9R B;  4XQ1 A;  1PV3 A;  3OEO A;  3C8G A;  1NSG B;  1M6T A;  2HMQ A;  3EH2 A;  4DBQ A;  1Q0F A;  2Q4F A;  4K1O A;  2AWC A;  1AUE A;  1NFO A;  2EIL C;  4PR9 A;  3X2Q C;  2YL1 A;  3OA1 A;  3W4Y A;  4CDA A;  3UMI A;  4IAR A;  2Q9A A;  1WWP A;  2AP3 A;  3EGX A;  1UFB A;  2JPU A;  3R7C A;  2EIJ C;  2LCH A;  4DXW A;  1OW7 A;  1OCR C;  2H7B A;  1ORJ A;  3QVY A;  5DVW A;  5HV9 A;  3B9Q A;  1S05 A;  3TUL A;  1W2W A;  2OOC A;  4YT2 A;  1WN0 A;  4AX2 A;  3QMK A;  4CS9 A;  4O7G A;  1OKK D;  1FFH A;  1FAP B;  1H6G A;  1ZW2 A;  2XLW A;  1HW1 A;  1UG7 A;  4K7B A;  1XZP A;  3U8V A;  5CIV A;  1LS4 A;  1RJ9 A;  4J30 B;  3US6 A;  4A2N B;  1G8X A;  2CCY A;  1VYI A;  2YHS A;  1OXK A;  3ATP A;  3HLZ A;  4PJN A;  5L0F A;  1S7Z A;  1SR2 A;  1YYX A;  3JZ0 A;  3GWL A;  2YLG A;  2J9B A;  4CDV A;  4YT4 A;  1Z23 A;  1ORS C;  3N2Z B;  1A7D A;  2I15 A;  4XEV A;  4CS8 A;  1TWC A;  3AG3 C;  2W45 A;  3T6J A;  4Q4Z F;  2FAP B;  2ZXR A;  2ASR A;  3RH3 A;  2ZXP A;  1TKN A;  4YJW A;  3SXM A;  1NG1 A;  5JVE A;  3H65 A;  2VC9 A;  1D0Z A;  1VB5 A;  3AGT A;  2G3V A;  1TWG A;  4IB4 A;  3CSK A;  3MLG A;  2WL8 A;  3FMS A;  3IEE A;  4LLE A;  4Z9I A;  3W2W A;  4AE4 A;  3M4B A;  2VCB A;  5L0I A;  3U8P A;  4YWQ A;  5JP7 A;  1IW7 F;  3LLK A;  2DYS C;  5TJ5 E;  3EHM A;  3AG1 C;  4XPW A;  4DBR A;  5BUO A;  4DRJ B;  1T6I A;  1OW6 A;  2XL6 A;  4YT8 A;  2J45 A;  2L6F A;  3EG9 A;  3NRH A;  4JEB A;  2MYS A;  5KYW A;  2V26 A;  2ETS A;  3SXY A;  2HJ3 A;  4JCZ A;  1YA7 O;  2FFH A;  4WAB A;  1D0X A;  3X1O A;  4BJ6 C;  4QI2 A;  2LFF A;  3I5Q A;  4JTA B;  3WAQ A;  1DOW A;  4JC7 A;  3MYI A;  3QW1 A;  4E7S A;  3GM3 A;  4CSA C;  4P9T A;  3RVZ A;  3SXZ A;  2OEX A;  3S27 A;  3U2M A;  4MVO A;  4BJ5 A;  2HSQ A;  4PK4 A;  1JMW A;  3DAG A;  4JZA A;  4ER9 A;  2R7U A;  2G62 A;  5DS6 A;  4XPX A;  2ICW G;  4YL0 A;  4YL3 A;  5KYU A;  5CI8 A;  1JPJ A;  2EPL X;  2ZPA A;  1FR0 A;  1MMG A;  3I5P A;  4IWB A;  4PJL A;  1YAU O;  1Q0M A;  1YYJ A;  3B71 A;  4B6I A;  1KU2 A;  5A6A A;  3DE9 A;  3HKK A;  4CS9 C;  2NG1 A;  1OXB A;  3DE8 A;  2YL3 A;  1LVK A;  1R5I D;  3RIP A;  1HY5 A;  3WG7 C;  1D0Y A;  3WOD F;  2P7V A;  1FNT c;  1D1A A;  1WTY A;  3RQE A;  2Q3T A;  1EA8 A;  5B3I A;  1JR8 A;  2L81 A;  3EGD B;  3C63 A;  2A6E F;  4EHP A;  5B3S C;  4CS8 C;  1KTM A;  1KNY A;  1G4W R;  2CNW A;  4JKV A;  4R32 A;  1QKR A;  2PX0 A;  1RKE B;  2IOQ A;  2Z15 A;  2KK1 A;  2L9J A;  1T9K A;  3AG4 C;  4NY3 A;  4DJ9 A;  4M63 A;  3J06 A;  4ONS A;  3S9O A;  2GAQ A;  2QLA A;  1K40 A;  4N4W A;  1Z7Q c;  5KYY A;  3H2U A;  4MVM A;  3V5X A;  2R7R A;  3L1M A;  3ZQY A;  5FCL A;  2LSE A;  2LIG A;  4G7O F;  3NKE A;  3FOO A;  4U9E A;  2QUP A;  4CS7 A;  1JRA A;  5KYX A;  1WAS A;  5HSW A;  4JTD B;  3HJC A;  3AG2 C;  2QTV A;  5B1B C;  2Q9B A;  4OD5 A;  1NFN A;  5JSL A;  1TFO B;  1YDI A;  2XM0 A;  2IYL D;  3B29 A;  3DKA A;  3Q7G A;  3F47 A;  1E2X A;  1HE9 A;  5A6B A;  2YVK A;  3ZSU A;  1A7V A;  4LAC B;  5JT4 A;  5BQG A;  4FWV A;  5F28 E;  3CEX A;  5COG A;  3FXH A;  2WZG A;  3E70 C;  4X0R A;  3K1H A;  5COM A;  3LES A;  3VM6 A;  4O79 A;  1I5N A;  5D92 A;  2V3C C;  5EK0 A;  3B0V C;  4KBL A;  1OCC C;  2HMZ A;  3ZTM A;  1ZHZ A;  4E18 A;  1JPN A;  1T6U A;  2E87 A;  2EIN C;  3O55 A;  1QLE C;  4EBJ A;  1PCX A;  1LS1 A;  1Z6A A;  2NUP A;  2OJE D;  4JE9 A;  4MTF A;  4DRI B;  4J7T A;  3IQT A;  4NCQ A;  4NTF A;  4QDL A;  2XRH A;  1RJ9 B;  4FX5 A;  4Q7C A;  4WGY A;  1CPQ A;  4JUR I;  3GEH A;  4HFF B;  4KNV A;  3LAY A;  2W4M A;  3LS0 A;  4XEF A;  2HKV A;  1RMV A;  2M4E A;  1O87 A;  3EZI A;  1HMD A;  4BJ6 A;  4NTA A;  3FAJ A;  5A6J A;  1CGO A;  3JCU Q;  3KL4 A;  5L0D A;  4EWC A;  4CSA A;  5E3C A;  1NBB A;  1O5H A;  4JTC B;  3LEO A;  3CQZ A;  4JW1 A;  3PCV A;  3AJM A;  4E0I A; 
#chains in the Genus database with same CATH homology
 1OW7 A;  4NQF A;  3RQF A;  1QVX A;  2KK1 A;  3GM1 A;  3BRJ A;  3RQG A;  3O10 A;  1JOG A;  2LK4 A;  3C8G D;  4EBJ A;  4EBK A;  1V4A A;  3L8I A;  2PBE A;  3S9O A;  1K40 A;  2Q00 A;  3TUL A;  3B71 A;  3L8J A;  2HSB A;  2YWA A;  2L6H A;  1OW6 A;  1K05 A;  2L6F A;  4XEK A;  1K04 A;  3JYY A;  4R32 A;  1O3U A;  1ZZP A;  3C8G B;  4XEF A;  3GM2 A;  1OW8 A;  3U0C A;  1PV3 A;  1WTY A;  3C8G A;  3RQE A;  3U3F A;  3JZ0 A;  5F28 E;  2L6G A;  3K7D A;  3C18 A;  3GM3 A;  4XEV A;  3MFN A;  1WWP A;  1KNY A;  1WOL A;  2JX0 A;  1KTM A;  3AJM A;  1UFB A;  2JPU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...