1ZZPA

Solution structure of the f-actin binding domain of bcr-abl/c-abl
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
109
structure length
109
Chain Sequence
b'SGAITKGVVLDSTEALCLAISRNSEQMASHSAVLEAGKNLYSFCVSYVDSIQQMRNKFAFREAINKLENNLRELQICPATAGSGPAATQDFSKLLSSVKEISDIVQRLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
publication title Structural Basis for the Cytoskeletal Association of Bcr-Abl/c-Abl.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 29
structure length 109
sequence length 109
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2005-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08919 F_actin_bind F-actin binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1zzpA00
1K05A 4XEVA 1JOGA 3RQEA 4NQFA 2L6GA 2L6FA 1V4AA 3B71A 4XEFA 1WOLA 1KNYA 1K40A 1WTYA 3S9OA 1OW8A 3C8GB 4EBJA 2L6HA 3RQFA 3L8JA 3BRJA 1UFBA 1OW6A 1WWPA 2KK1A 4EBKA 5F28E 1ZZPA 3U3FA 1QVXA 3GM1A 3C8GD 4R32A 3AJMA 3RQGA 2LK4A 3L8IA 1KTMA 1K04A 1PV3A 3C8GA 3TULA 3GM3A 2JPUA 3C18A 2HSBA 3O10A 1O3UA 1OW7A 2JX0A 3U0CA 3K7DA 3GM2A 4XEKA 2PBEA 3JYYA 2YWAA 2Q00A 3JZ0A 3MFNA
chains in the Genus database with same CATH superfamily
1TWAA 4MQ9F 4Q5SF 4F4BA 1MNEA 2NSGA 5CIVA 3ZQYA 2KJGA 2Q3TA 2P61A 1OQCA 3S84A 3FAJA 2XM4A 4WJ0A 4EBJA 2KQ9A 1VMAA 3UNGC 3EZIA 3Q6MA 2L6HA 3K33A 1V54C 2J46A 3V7OA 1CGME 4BJ6C 4EIYA 3LJBA 4MVUA 4HFFB 4B6IA 1TQGA 4D4XA 4NY3A 3L8IA 2FGYA 4KBLA 4MS2A 1FFTC 2P7VA 1YA9A 2Y39A 1W2WA 4ANJA 3CSKA 3T4RA 3US6A 5KYXB 4FX5A 4C3EA 2YL3A 4JURI 2HSBA 2A69F 2XLVA 4XLNF 4O79A 2Q4FA 3DE8A 4U5FE 3RVZA 3ZC4A 3FMSA 1M2OA 2X0CA 2MWQA 2NUPB 3B0PA 3T9OA 4PK4A 4Q4ZF 4LACB 2R7UA 1V55C 4GQHA 4BJTA 1HMDA 3CAXA 5BQGA 3SXZA 3WHNA 3VRCA 1OKKD 1A7EA 1WOLA 2UUIA 4CS9C 3C8GB 2PF4E 1NLXA 1HW1A 3FXHA 1CGNA 2HMQA 1NZEA 2AWCA 2LFFA 1T6QA 4Q7CA 3U3BA 4LDQA 3ZG1A 3UMKA 2GFHA 3S28A 4M63A 4ZLCA 3KL4A 3Q7LA 2PX3A 2R7OA 3LNMB 4OIOF 1C02A 3GANA 1EKYA 4YJWA 3B29A 3UR3C 2WZFA 1Z5ZA 5B3SC 3IHUA 2H7OA 1QQ3A 1OR3A 1D0ZA 3H2VA 3O10A 3J06A 1PD1A 3DXJF 4XTKA 2VC9A 5EHHA 4KC9A 2OEVA 5CI9A 1O5HA 2MYSA 3GM2A 1FNTc 1PCXA 1YYJA 1J8YF 2G3VA 1D0XA 1ORJA 4DXWA 1Z23A 3L34A 2L6FA 3K66A 4U5DE 5KYWB 3NDBB 4XEFA 1F1MA 4AL0A 1R4TA 3N24A 1AVOB 2ASRA 4N6HA 3MLGA 1FMVA 3ZIBA 1S7ZA 1M56C 3EZHA 1L7CA 4IAQA 3IEEA 4MVQA 1WASA 5AC5A 2KGOA 1AEPA 2WVOA 4LLEA 2KNHA 1GQAA 1JAFA 1M2VB 3EQLF 3I5QA 3K1IC 5T3TA 3SZRA 3SXKA 3ABKC 5JRAA 1ZVZA 5K0IA 1WATA 2R7TA 2E87A 3N2ZB 5JVEA 3FAPB 3LEOA 3PHF2 2R7SA 4KI2A 2R7QA 1E2XA 1IW7F 3AQCA 1Q0FA 3FOOA 5EK0A 5JT4A 1K05A 2EPOA 3RVYA 2B0HA 1VOMA 3W2VA 1YYXA 1GM5A 5T3WA 4CS7A 1OXBA 3O6XA 2XSEA 5BUOA 2HSQA 4IB4A 2YL7A 3G50A 2M64A 3AOUA 1VB5A 2ZXRA 3ASOC 2J0XA 4MVOA 2GDCA 2NUTA 1ZZPA 4JEBA 4LERA 4OIPF 2OEXA 3DWWA 3ITFA 1SF8A 1ZU4A 2J8WA 1FFHA 4LDKA 3LNRA 4WGYA 2Q7RA 3RIPA 3HNIA 3NYMA 1KTMA 1BDJB 5E3CA 5BQIA 2AVKA 5AC4A 2HKVA 4IRUA 3EGDA 3OWTA 1MMAA 3EHMA 3MX3A 4OD5A 3LUTB 3IQCA 1EA8A 4ER9A 1VK5A 2PBEA 2YVKA 3GWNA 3V5XA 2AWYA 5DS6A 3SXYA 4D4NA 1LI5A 2J0WA 3GWLA 3U2LA 3V5ZA 3U8PA 3S9OA 1KNYA 2YRFA 3HNJA 4JE9A 3C62A 4IGGA 3M4BA 2BC5A 1OCRC 3MYFA 1VLSA 5F28E 1E83A 2HMZA 4QI0A 4GYTA 1AUEA 1LE2A 3RFYA 2NG1A 4H54A 3CEXA 4MVZA 4BEJA 4AL1A 3ASNC 3EG9A 2EILC 4HFKB 3C7JA 2IBFA 2ZPAA 2Q9BA 4JTAB 2GAQA 1BR2A 2YKZA 5A6JA 3EPVA 4J7TA 2YQYA 4MNDA 4R32A 1HE9A 1CPRA 1Y4CA 5COFA 1CGOA 3EHNA 4XQ1A 2LSEA 2R7WA 2EPKX 3IPMO 3MBGA 4LDRA 2QNLA 3F47A 3NYJA 4QI2A 2NPUA 4GEHA 2AU5A 3PCVA 4AE4A 2DYSC 1NBBA 3RQFA 1SMYF 3AGUA 2WL8A 3GEEA 1Y6DA 3JT1A 3WODF 2PX0A 4EBKA 3UGPA 2Q9AA 2IXNA 4C7OA 2CW0F 1VYIA 4E0IA 1J8MF 1C03A 1RKEA 2OQMA 2XM0A 2A0BA 3QVZA 3GODA 3DMDA 1Z6AA 3HNLA 4Z9HA 2VCBA 2YL1A 2EPMX 1HW2A 4UDVA 5D92A 3KKBA 4CS8C 1BZ4A 1QSPA 2EINC 4BJ6A 1A0BA 4H4KC 1H9TA 4XPWA 2G62A 4CSAC 1Q0GA 4PFOA 2CNWA 3ECSA 3HKKA 2WZLA 3VYWA 2HS5A 3ZSUA 1K40A 4CS8A 2XLWA 3OA1A 1RCPA 1U6HA 2IYLD 3V5YA 4YT2A 4WGZA 4YK5A 3AGTA 2CDQA 1QVXA 2A0UA 2OG2A 4AK9A 3HJCA 3VAYA 2VCCA 3KYIA 2R25A 2R02A 3U5SA 4A4AA 1E85A 1K04A 4JZAA 3SP1A 4RBNA 1LVKA 1ZHZA 2BL2A 5COGA 4CS9A 2XXAA 1FAPB 3GEIA 2WVQA 4G78A 3NYLA 5L0HA 1O3UA 2CGEA 3DAGA 1Q0DA 2MHRA 2J7PA 1GGQA 1LI7A 1QKRA 2DI3A 3L1MA 4JJGA 4AX2A 5DLJA 2D4UA 3QMKA 5L0GA 1OXKA 2NUTB 1YZAA 3A11A 4MVSA 1GS9A 2QE9A 5KYUA 3B0UX 4E7ZA 3ATPA 3JTLO 3EFOA 1T9KA 4IWBA 4JRZA 2FAPB 3DD7A 3VM6A 2HV6A 4EBBA 2RD9A 3UGOA 1OCCC 1CPQA 3EGDB 3I4UA 4DJ9A 5L0IA 2TMVP 2AP3A 2H7VC 5A6AA 2CCYA 1A7DA 1H7IA 5A6BA 3PMRA 2KYHA 2JD3A 4U5HA 4BEMJ 4YL3A 4EWCA 1G4WR 2LK4A 1BBHA 1HY5A 4NTAA 3K6BA 3S90A 4U5GA 4DBRA 3GM3A 2EIJC 2A6EF 1APCA 1LS1A 1LE4A 2UUHA 1VTMP 2I8BA 2R7RA 2R05A 3G4XA 4YL0A 3AQBA 2VB6A 4E17A 1OR2A 1TKNA 5L3VA 3DZAA 1QPUA 4RD9A 2A1DD 1Q0MA 1FTSA 2QTVA 4NCQA 4DRHB 1TFKB 2W45A 2HJMA 4CDVA 2NSFA 1YAUO 1JRAA 1MMGA 2Y3HA 4YT4A 2L6GA 3DM9B 3K1IA 1LIHA 5B3IA 5HSWA 2I15A 4PJMA 4WABA 3GORA 1RJ9A 1WTYA 4FAPB 1MQVA 4K7BA 1HMOA 3ZTZA 3EG9B 2YZSA 5DS5A 1ZW3A 1YA7O 4YT5A 1UG7A 4MTGA 3F46A 1JMWA 1EQ1A 2XL4A 1ZHTA 3U3FA 2LQGA 3TOMA 4C3DA 2P0NA 3IQTA 1ZHWA 2B0JA 4HEAJ 3EH2A 4MTOA 4PJNA 5L0CA 2IOQA 1DOVA 2EPLX 2VH3A 4MVMA 3TJ5A 3EH1A 1MNDA 2CYDA 4BG0A 3RF3A 2JPUA 3LEVA 3ZTMA 2DGJA 5JLIA 4XWJA 3AG4C 5DQTA 3JRMO 4AE4B 4ULWA 3DJUB 2QUPA 3JSEO 2J9VA 3KPHA 3ZWIA 2LFDA 2XL8A 1I4ZA 1D1AA 4K1OA 3EJNA 2CNWD 4KNVA 1NU9C 5L0DA 4C7OB 3C8ZA 3LS0A 3T6BA 2LIGA 3U8VA 5DS4A 1RKEB 2LCHA 4I3MA 2VASA 2Y3BA 4JKVA 2IM8A 1VYKA 1OW8A 1EI7A 3T6JA 2HV7A 1ZU5A 1NFOA 1XWJA 3BRJA 2OCCC 4ONSA 4U5EE 3RYLA 2PNOA 3M79A 2KK1A 2P1AA 4K0DA 1LM3B 4L6RA 1E86A 3DAFA 3S29A 2F22A 4MW3A 3FVYA 1ORYA 2J9WA 3M1CB 1WN0A 4J30B 3M15A 1E84A 1SR2A 2ETSA 2WZGA 3QTHA 4ULVA 3POVA 4JC7A 3C18A 3ZVRA 3EGXA 3TQOA 2J7PD 2J9BA 1ZW2A 2Z15A 3Q6NA 1RKCA 4KNWA 1YJGA 4NTFA 1LS4A 4YN0B 5TJ5E 4EHPA 3LS1A 5JSLA 3U0CA 4PR9A 1OCZC 4MW8A 1RXQA 3JYYA 4NTBA 1A41A 3NKEA 4JIOA 5JP7A 1NU7D 4G0HA 4XEVA 4P9TA 3NMIA 3U9JA 1TWGA 2LD6A 4PJLA 4YL1A 3SYNA 4DBQA 2OOCA 1T6IA 2XLDA 3JCUQ 2YHSA 2XXAB 2C04A 3H65A 4XPXA 4E0HA 2BE5F 1Z3IX 3R7CA 5A6BD 4I1MA 1ZHYA 3IQ5A 2XLOA 2ZD9A 4QDLA 5DQZA 1NG1A 4N6CA 3FDQA 2YL0A 5KYYA 3KMIA 1H6GA 2FFHA 3I5PA 3BEHA 3QW1A 3U2MA 5DVWA 3VF0A 3PDMP 5B1AC 2R7XA 5KYUB 4HE8D 4JEAA 2W4BA 3ZDLA 1H9GA 3WG7C 4JJFA 4OIQF 4G7OF 4CDAA 1M6TA 4XEKA 1ZHXA 5F5HA 4X0RA 5B1BC 4CJGA 3JZ0A 2R7VA 4MVRA 2A68F 3DI5A 5D91A 3UMIA 1ST6A 4NQFA 3HNKA 3T6GB 2PFDA 4OIRF 3U9MA 1BR4A 4DOZA 2KC3A 3L8JA 2ICWG 1JR8A 5COMA 3GEHA 4N06A 5E2QA 3ZQVA 4XLPF 3MYIA 2A6HF 2L7AA 2V26A 4OD4A 4U5CE 5JUAA 3C8GD 4CSAA 4E18A 3TK0A 1PD0A 3KH2A 1O87A 1YVIA 4EKWA 3L0IA 2ZXOA 2H7BA 1PV3A 1D0YA 3AG1C 5CI8A 3CZ6A 2L9JA 2VCAA 4O6YA 1RJ9B 4U9EA 3W4YA 2WVNA 3FOPA 2Y3DA 4P9FA 4LLCA 3CQZA 1I5NA 2XL6A 1YLMA 5GPGB 1VLTA 2XLEA 3MFNA 3X1OA 2YLDA 2PP4A 1G5ZA 1JOGA 2IXOA 2IXMA 2RSEB 3IQ6A 4FESA 3RQEA 2EIKC 3RH3A 3JSZA 3O55A 1YDIA 3AG3C 1N1CA 3M4CA 2GWWA 4YT8A 4JTCB 2O9XA 3Q7GA 1QLEC 4YWQA 5BQHA 1U0BB 3LESA 3NG1A 1OW6A 2HFIA 3JYHA 3QZCA 4MTFA 2YLIA 1A7VA 1T6UA 2C03A 4E7SA 4I44A 4DVYP 1IZMA 1C17M 3SEOA 3HLZA 3H2UA 5KYNA 3E70C 3SNHA 1QZXA 2HZ8A 2OJED 4CX9A 4N4WA 5L0JA 3W8IA 4CJOA 2WB7A 3A9CA 2DB4A 3LAYA 2J45A 4Z9IA 4U5BE 3UMHA 1OW7A 3KYJA 2JX0A 3B9QA 4OINF 2W4MA 3W8HA 5A6KA 2ZXPA 4NC3A 4BPMA 1D1BA 4J7YA 3RW0A 2HUJA 5KYXA 3B0VC 3E9VA 1FMWA 1Q0KA 4O6NA 3LLIA 1TR2A 1D1CA 2YEVA 3K1HA 4CBEA 1DOWA 4BJ1A 1HE1A 3EGXB 4Z9JA 1T5OA 2NUPA 1TFOB 2Y3GA 3DKAA 4PFPA 1RMVA 2Y69C 2EPNA 1NSGB 4O7GA 4G7ZF 3RQGA 1ZYRF 1Z7Qc 2P6VA 5HV9A 3C8GA 3TULA 1L3PA 3RKOF 3TJ6A 4JW1A 2LP4A 4JVSA 4CDYA 4PACA 4DRIB 4ZLDA 2W9YA 3K7DA 2QY9A 5AGFA 4JCZA 4A2NB 3W2WA 1ORSC 3LLKA 1G4US 2YLGA 2DYRC 5FZTA 1XZQA 2R9RB 1BR1A 4BJ5C 1G8XA 4I1OB 4JCHA 3QVYA 4C3BA 5L0FA 3JRTA 3DM5A 3G4ZA 5KYYB 1SYQA 1MMNA 5L3QA 1JPNA 2X51A 2XLHA 3B71A 4XPYA 5E33A 1LPEA 4O6MA 3R2PA 1YZCA 3ABLC 1M57C 1OKKA 1XZPA 256BA 4IAOA 4BJ5A 4W8KA 3GM1A 1OCOC 4IJJA 3S0XA 1R5ID 2KW3C 2M4EA 2D5RB 5KYWA 1YARO 1V74B 3TOLA 2OU6A 2IXPA 3DE9A 5T1DB 3NMJA 4CIPA 2EIMC 3HTKC 4DVZA 2OKUA 4J32B 1SZIA 2XS1A 4W8PA 1T01A 2KSFA 3FHDA 4JTDB 2H8AA 2YWAA 2Q00A 2XLMA 1B68A 1I4YA 3NKDA 3SXMA 1Z63A 4CIHA 1M2VA 2XS8A 4FWVA 4IARA 2L81A 2QLAA 4RDAA 2ZXWC 4DRJB 2G3KA 1V4AA 5F5FA 1U89A 3OEOA 1S05A 3ABMC 4PJJA 3QW0A 3TD7A 1MMDA 2XRHA 1UFBA 2J9UA 3C63A 3NRHA 5IY5C 4U9DA 1WWPA 5EGYA 3AG2C 3WAQA 1KU2A 4P6IC 5A69A 3DJNB 3AJMA 3N0TA 1TWHA 3X2QC 3S27A 2GA0A 4G7HF 2HJ3A 2R03A 5JS5A 5FCLA 1LKXA 4EUKB 1FR0A 2V3CC 1WGWA 2OJQA 1NFNA 1TWCA 3EFOB 3O39A 3NMKA 5E3AA 1JPJA 2Q9CA
chains in the Genus database with same CATH topology
1K05A 4XEVA 1JOGA 3RQEA 4NQFA 2L6GA 2L6FA 1V4AA 3B71A 4XEFA 1WOLA 1KNYA 1K40A 1WTYA 3S9OA 1OW8A 3C8GB 4EBJA 2L6HA 3RQFA 3L8JA 3BRJA 1UFBA 1OW6A 1WWPA 2KK1A 4EBKA 5F28E 1ZZPA 3U3FA 1QVXA 3GM1A 3C8GD 4R32A 3AJMA 3RQGA 2LK4A 3L8IA 1KTMA 1K04A 1PV3A 3C8GA 3TULA 3GM3A 2JPUA 3C18A 2HSBA 3O10A 1O3UA 1OW7A 2JX0A 3U0CA 3K7DA 3GM2A 4XEKA 2PBEA 3JYYA 2YWAA 2Q00A 3JZ0A 3MFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K05 A;  4XEV A;  1JOG A;  3RQE A;  4NQF A;  2L6G A;  2L6F A;  1V4A A;  3B71 A;  4XEF A;  1WOL A;  1KNY A;  1K40 A;  1WTY A;  3S9O A;  1OW8 A;  3C8G B;  4EBJ A;  2L6H A;  3RQF A;  3L8J A;  3BRJ A;  1UFB A;  1OW6 A;  1WWP A;  2KK1 A;  4EBK A;  5F28 E;  1ZZP A;  3U3F A;  1QVX A;  3GM1 A;  3C8G D;  4R32 A;  3AJM A;  3RQG A;  2LK4 A;  3L8I A;  1KTM A;  1K04 A;  1PV3 A;  3C8G A;  3TUL A;  3GM3 A;  2JPU A;  3C18 A;  2HSB A;  3O10 A;  1O3U A;  1OW7 A;  2JX0 A;  3U0C A;  3K7D A;  3GM2 A;  4XEK A;  2PBE A;  3JYY A;  2YWA A;  2Q00 A;  3JZ0 A;  3MFN A; 
#chains in the Genus database with same CATH topology
 1TWA A;  4MQ9 F;  4Q5S F;  4F4B A;  1MNE A;  2NSG A;  5CIV A;  3ZQY A;  2KJG A;  2Q3T A;  2P61 A;  1OQC A;  3S84 A;  3FAJ A;  2XM4 A;  4WJ0 A;  4EBJ A;  2KQ9 A;  1VMA A;  3UNG C;  3EZI A;  3Q6M A;  2L6H A;  3K33 A;  1V54 C;  2J46 A;  3V7O A;  1CGM E;  4BJ6 C;  4EIY A;  3LJB A;  4MVU A;  4HFF B;  4B6I A;  1TQG A;  4D4X A;  4NY3 A;  3L8I A;  2FGY A;  4KBL A;  4MS2 A;  1FFT C;  2P7V A;  1YA9 A;  2Y39 A;  1W2W A;  4ANJ A;  3CSK A;  3T4R A;  3US6 A;  5KYX B;  4FX5 A;  4C3E A;  2YL3 A;  4JUR I;  2HSB A;  2A69 F;  2XLV A;  4XLN F;  4O79 A;  2Q4F A;  3DE8 A;  4U5F E;  3RVZ A;  3ZC4 A;  3FMS A;  1M2O A;  2X0C A;  2MWQ A;  2NUP B;  3B0P A;  3T9O A;  4PK4 A;  4Q4Z F;  4LAC B;  2R7U A;  1V55 C;  4GQH A;  4BJT A;  1HMD A;  3CAX A;  5BQG A;  3SXZ A;  3WHN A;  3VRC A;  1OKK D;  1A7E A;  1WOL A;  2UUI A;  4CS9 C;  3C8G B;  2PF4 E;  1NLX A;  1HW1 A;  3FXH A;  1CGN A;  2HMQ A;  1NZE A;  2AWC A;  2LFF A;  1T6Q A;  4Q7C A;  3U3B A;  4LDQ A;  3ZG1 A;  3UMK A;  2GFH A;  3S28 A;  4M63 A;  4ZLC A;  3KL4 A;  3Q7L A;  2PX3 A;  2R7O A;  3LNM B;  4OIO F;  1C02 A;  3GAN A;  1EKY A;  4YJW A;  3B29 A;  3UR3 C;  2WZF A;  1Z5Z A;  5B3S C;  3IHU A;  2H7O A;  1QQ3 A;  1OR3 A;  1D0Z A;  3H2V A;  3O10 A;  3J06 A;  1PD1 A;  3DXJ F;  4XTK A;  2VC9 A;  5EHH A;  4KC9 A;  2OEV A;  5CI9 A;  1O5H A;  2MYS A;  3GM2 A;  1FNT c;  1PCX A;  1YYJ A;  1J8Y F;  2G3V A;  1D0X A;  1ORJ A;  4DXW A;  1Z23 A;  3L34 A;  2L6F A;  3K66 A;  4U5D E;  5KYW B;  3NDB B;  4XEF A;  1F1M A;  4AL0 A;  1R4T A;  3N24 A;  1AVO B;  2ASR A;  4N6H A;  3MLG A;  1FMV A;  3ZIB A;  1S7Z A;  1M56 C;  3EZH A;  1L7C A;  4IAQ A;  3IEE A;  4MVQ A;  1WAS A;  5AC5 A;  2KGO A;  1AEP A;  2WVO A;  4LLE A;  2KNH A;  1GQA A;  1JAF A;  1M2V B;  3EQL F;  3I5Q A;  3K1I C;  5T3T A;  3SZR A;  3SXK A;  3ABK C;  5JRA A;  1ZVZ A;  5K0I A;  1WAT A;  2R7T A;  2E87 A;  3N2Z B;  5JVE A;  3FAP B;  3LEO A;  3PHF 2;  2R7S A;  4KI2 A;  2R7Q A;  1E2X A;  1IW7 F;  3AQC A;  1Q0F A;  3FOO A;  5EK0 A;  5JT4 A;  1K05 A;  2EPO A;  3RVY A;  2B0H A;  1VOM A;  3W2V A;  1YYX A;  1GM5 A;  5T3W A;  4CS7 A;  1OXB A;  3O6X A;  2XSE A;  5BUO A;  2HSQ A;  4IB4 A;  2YL7 A;  3G50 A;  2M64 A;  3AOU A;  1VB5 A;  2ZXR A;  3ASO C;  2J0X A;  4MVO A;  2GDC A;  2NUT A;  1ZZP A;  4JEB A;  4LER A;  4OIP F;  2OEX A;  3DWW A;  3ITF A;  1SF8 A;  1ZU4 A;  2J8W A;  1FFH A;  4LDK A;  3LNR A;  4WGY A;  2Q7R A;  3RIP A;  3HNI A;  3NYM A;  1KTM A;  1BDJ B;  5E3C A;  5BQI A;  2AVK A;  5AC4 A;  2HKV A;  4IRU A;  3EGD A;  3OWT A;  1MMA A;  3EHM A;  3MX3 A;  4OD5 A;  3LUT B;  3IQC A;  1EA8 A;  4ER9 A;  1VK5 A;  2PBE A;  2YVK A;  3GWN A;  3V5X A;  2AWY A;  5DS6 A;  3SXY A;  4D4N A;  1LI5 A;  2J0W A;  3GWL A;  3U2L A;  3V5Z A;  3U8P A;  3S9O A;  1KNY A;  2YRF A;  3HNJ A;  4JE9 A;  3C62 A;  4IGG A;  3M4B A;  2BC5 A;  1OCR C;  3MYF A;  1VLS A;  5F28 E;  1E83 A;  2HMZ A;  4QI0 A;  4GYT A;  1AUE A;  1LE2 A;  3RFY A;  2NG1 A;  4H54 A;  3CEX A;  4MVZ A;  4BEJ A;  4AL1 A;  3ASN C;  3EG9 A;  2EIL C;  4HFK B;  3C7J A;  2IBF A;  2ZPA A;  2Q9B A;  4JTA B;  2GAQ A;  1BR2 A;  2YKZ A;  5A6J A;  3EPV A;  4J7T A;  2YQY A;  4MND A;  4R32 A;  1HE9 A;  1CPR A;  1Y4C A;  5COF A;  1CGO A;  3EHN A;  4XQ1 A;  2LSE A;  2R7W A;  2EPK X;  3IPM O;  3MBG A;  4LDR A;  2QNL A;  3F47 A;  3NYJ A;  4QI2 A;  2NPU A;  4GEH A;  2AU5 A;  3PCV A;  4AE4 A;  2DYS C;  1NBB A;  3RQF A;  1SMY F;  3AGU A;  2WL8 A;  3GEE A;  1Y6D A;  3JT1 A;  3WOD F;  2PX0 A;  4EBK A;  3UGP A;  2Q9A A;  2IXN A;  4C7O A;  2CW0 F;  1VYI A;  4E0I A;  1J8M F;  1C03 A;  1RKE A;  2OQM A;  2XM0 A;  2A0B A;  3QVZ A;  3GOD A;  3DMD A;  1Z6A A;  3HNL A;  4Z9H A;  2VCB A;  2YL1 A;  2EPM X;  1HW2 A;  4UDV A;  5D92 A;  3KKB A;  4CS8 C;  1BZ4 A;  1QSP A;  2EIN C;  4BJ6 A;  1A0B A;  4H4K C;  1H9T A;  4XPW A;  2G62 A;  4CSA C;  1Q0G A;  4PFO A;  2CNW A;  3ECS A;  3HKK A;  2WZL A;  3VYW A;  2HS5 A;  3ZSU A;  1K40 A;  4CS8 A;  2XLW A;  3OA1 A;  1RCP A;  1U6H A;  2IYL D;  3V5Y A;  4YT2 A;  4WGZ A;  4YK5 A;  3AGT A;  2CDQ A;  1QVX A;  2A0U A;  2OG2 A;  4AK9 A;  3HJC A;  3VAY A;  2VCC A;  3KYI A;  2R25 A;  2R02 A;  3U5S A;  4A4A A;  1E85 A;  1K04 A;  4JZA A;  3SP1 A;  4RBN A;  1LVK A;  1ZHZ A;  2BL2 A;  5COG A;  4CS9 A;  2XXA A;  1FAP B;  3GEI A;  2WVQ A;  4G78 A;  3NYL A;  5L0H A;  1O3U A;  2CGE A;  3DAG A;  1Q0D A;  2MHR A;  2J7P A;  1GGQ A;  1LI7 A;  1QKR A;  2DI3 A;  3L1M A;  4JJG A;  4AX2 A;  5DLJ A;  2D4U A;  3QMK A;  5L0G A;  1OXK A;  2NUT B;  1YZA A;  3A11 A;  4MVS A;  1GS9 A;  2QE9 A;  5KYU A;  3B0U X;  4E7Z A;  3ATP A;  3JTL O;  3EFO A;  1T9K A;  4IWB A;  4JRZ A;  2FAP B;  3DD7 A;  3VM6 A;  2HV6 A;  4EBB A;  2RD9 A;  3UGO A;  1OCC C;  1CPQ A;  3EGD B;  3I4U A;  4DJ9 A;  5L0I A;  2TMV P;  2AP3 A;  2H7V C;  5A6A A;  2CCY A;  1A7D A;  1H7I A;  5A6B A;  3PMR A;  2KYH A;  2JD3 A;  4U5H A;  4BEM J;  4YL3 A;  4EWC A;  1G4W R;  2LK4 A;  1BBH A;  1HY5 A;  4NTA A;  3K6B A;  3S90 A;  4U5G A;  4DBR A;  3GM3 A;  2EIJ C;  2A6E F;  1APC A;  1LS1 A;  1LE4 A;  2UUH A;  1VTM P;  2I8B A;  2R7R A;  2R05 A;  3G4X A;  4YL0 A;  3AQB A;  2VB6 A;  4E17 A;  1OR2 A;  1TKN A;  5L3V A;  3DZA A;  1QPU A;  4RD9 A;  2A1D D;  1Q0M A;  1FTS A;  2QTV A;  4NCQ A;  4DRH B;  1TFK B;  2W45 A;  2HJM A;  4CDV A;  2NSF A;  1YAU O;  1JRA A;  1MMG A;  2Y3H A;  4YT4 A;  2L6G A;  3DM9 B;  3K1I A;  1LIH A;  5B3I A;  5HSW A;  2I15 A;  4PJM A;  4WAB A;  3GOR A;  1RJ9 A;  1WTY A;  4FAP B;  1MQV A;  4K7B A;  1HMO A;  3ZTZ A;  3EG9 B;  2YZS A;  5DS5 A;  1ZW3 A;  1YA7 O;  4YT5 A;  1UG7 A;  4MTG A;  3F46 A;  1JMW A;  1EQ1 A;  2XL4 A;  1ZHT A;  3U3F A;  2LQG A;  3TOM A;  4C3D A;  2P0N A;  3IQT A;  1ZHW A;  2B0J A;  4HEA J;  3EH2 A;  4MTO A;  4PJN A;  5L0C A;  2IOQ A;  1DOV A;  2EPL X;  2VH3 A;  4MVM A;  3TJ5 A;  3EH1 A;  1MND A;  2CYD A;  4BG0 A;  3RF3 A;  2JPU A;  3LEV A;  3ZTM A;  2DGJ A;  5JLI A;  4XWJ A;  3AG4 C;  5DQT A;  3JRM O;  4AE4 B;  4ULW A;  3DJU B;  2QUP A;  3JSE O;  2J9V A;  3KPH A;  3ZWI A;  2LFD A;  2XL8 A;  1I4Z A;  1D1A A;  4K1O A;  3EJN A;  2CNW D;  4KNV A;  1NU9 C;  5L0D A;  4C7O B;  3C8Z A;  3LS0 A;  3T6B A;  2LIG A;  3U8V A;  5DS4 A;  1RKE B;  2LCH A;  4I3M A;  2VAS A;  2Y3B A;  4JKV A;  2IM8 A;  1VYK A;  1OW8 A;  1EI7 A;  3T6J A;  2HV7 A;  1ZU5 A;  1NFO A;  1XWJ A;  3BRJ A;  2OCC C;  4ONS A;  4U5E E;  3RYL A;  2PNO A;  3M79 A;  2KK1 A;  2P1A A;  4K0D A;  1LM3 B;  4L6R A;  1E86 A;  3DAF A;  3S29 A;  2F22 A;  4MW3 A;  3FVY A;  1ORY A;  2J9W A;  3M1C B;  1WN0 A;  4J30 B;  3M15 A;  1E84 A;  1SR2 A;  2ETS A;  2WZG A;  3QTH A;  4ULV A;  3POV A;  4JC7 A;  3C18 A;  3ZVR A;  3EGX A;  3TQO A;  2J7P D;  2J9B A;  1ZW2 A;  2Z15 A;  3Q6N A;  1RKC A;  4KNW A;  1YJG A;  4NTF A;  1LS4 A;  4YN0 B;  5TJ5 E;  4EHP A;  3LS1 A;  5JSL A;  3U0C A;  4PR9 A;  1OCZ C;  4MW8 A;  1RXQ A;  3JYY A;  4NTB A;  1A41 A;  3NKE A;  4JIO A;  5JP7 A;  1NU7 D;  4G0H A;  4XEV A;  4P9T A;  3NMI A;  3U9J A;  1TWG A;  2LD6 A;  4PJL A;  4YL1 A;  3SYN A;  4DBQ A;  2OOC A;  1T6I A;  2XLD A;  3JCU Q;  2YHS A;  2XXA B;  2C04 A;  3H65 A;  4XPX A;  4E0H A;  2BE5 F;  1Z3I X;  3R7C A;  5A6B D;  4I1M A;  1ZHY A;  3IQ5 A;  2XLO A;  2ZD9 A;  4QDL A;  5DQZ A;  1NG1 A;  4N6C A;  3FDQ A;  2YL0 A;  5KYY A;  3KMI A;  1H6G A;  2FFH A;  3I5P A;  3BEH A;  3QW1 A;  3U2M A;  5DVW A;  3VF0 A;  3PDM P;  5B1A C;  2R7X A;  5KYU B;  4HE8 D;  4JEA A;  2W4B A;  3ZDL A;  1H9G A;  3WG7 C;  4JJF A;  4OIQ F;  4G7O F;  4CDA A;  1M6T A;  4XEK A;  1ZHX A;  5F5H A;  4X0R A;  5B1B C;  4CJG A;  3JZ0 A;  2R7V A;  4MVR A;  2A68 F;  3DI5 A;  5D91 A;  3UMI A;  1ST6 A;  4NQF A;  3HNK A;  3T6G B;  2PFD A;  4OIR F;  3U9M A;  1BR4 A;  4DOZ A;  2KC3 A;  3L8J A;  2ICW G;  1JR8 A;  5COM A;  3GEH A;  4N06 A;  5E2Q A;  3ZQV A;  4XLP F;  3MYI A;  2A6H F;  2L7A A;  2V26 A;  4OD4 A;  4U5C E;  5JUA A;  3C8G D;  4CSA A;  4E18 A;  3TK0 A;  1PD0 A;  3KH2 A;  1O87 A;  1YVI A;  4EKW A;  3L0I A;  2ZXO A;  2H7B A;  1PV3 A;  1D0Y A;  3AG1 C;  5CI8 A;  3CZ6 A;  2L9J A;  2VCA A;  4O6Y A;  1RJ9 B;  4U9E A;  3W4Y A;  2WVN A;  3FOP A;  2Y3D A;  4P9F A;  4LLC A;  3CQZ A;  1I5N A;  2XL6 A;  1YLM A;  5GPG B;  1VLT A;  2XLE A;  3MFN A;  3X1O A;  2YLD A;  2PP4 A;  1G5Z A;  1JOG A;  2IXO A;  2IXM A;  2RSE B;  3IQ6 A;  4FES A;  3RQE A;  2EIK C;  3RH3 A;  3JSZ A;  3O55 A;  1YDI A;  3AG3 C;  1N1C A;  3M4C A;  2GWW A;  4YT8 A;  4JTC B;  2O9X A;  3Q7G A;  1QLE C;  4YWQ A;  5BQH A;  1U0B B;  3LES A;  3NG1 A;  1OW6 A;  2HFI A;  3JYH A;  3QZC A;  4MTF A;  2YLI A;  1A7V A;  1T6U A;  2C03 A;  4E7S A;  4I44 A;  4DVY P;  1IZM A;  1C17 M;  3SEO A;  3HLZ A;  3H2U A;  5KYN A;  3E70 C;  3SNH A;  1QZX A;  2HZ8 A;  2OJE D;  4CX9 A;  4N4W A;  5L0J A;  3W8I A;  4CJO A;  2WB7 A;  3A9C A;  2DB4 A;  3LAY A;  2J45 A;  4Z9I A;  4U5B E;  3UMH A;  1OW7 A;  3KYJ A;  2JX0 A;  3B9Q A;  4OIN F;  2W4M A;  3W8H A;  5A6K A;  2ZXP A;  4NC3 A;  4BPM A;  1D1B A;  4J7Y A;  3RW0 A;  2HUJ A;  5KYX A;  3B0V C;  3E9V A;  1FMW A;  1Q0K A;  4O6N A;  3LLI A;  1TR2 A;  1D1C A;  2YEV A;  3K1H A;  4CBE A;  1DOW A;  4BJ1 A;  1HE1 A;  3EGX B;  4Z9J A;  1T5O A;  2NUP A;  1TFO B;  2Y3G A;  3DKA A;  4PFP A;  1RMV A;  2Y69 C;  2EPN A;  1NSG B;  4O7G A;  4G7Z F;  3RQG A;  1ZYR F;  1Z7Q c;  2P6V A;  5HV9 A;  3C8G A;  3TUL A;  1L3P A;  3RKO F;  3TJ6 A;  4JW1 A;  2LP4 A;  4JVS A;  4CDY A;  4PAC A;  4DRI B;  4ZLD A;  2W9Y A;  3K7D A;  2QY9 A;  5AGF A;  4JCZ A;  4A2N B;  3W2W A;  1ORS C;  3LLK A;  1G4U S;  2YLG A;  2DYR C;  5FZT A;  1XZQ A;  2R9R B;  1BR1 A;  4BJ5 C;  1G8X A;  4I1O B;  4JCH A;  3QVY A;  4C3B A;  5L0F A;  3JRT A;  3DM5 A;  3G4Z A;  5KYY B;  1SYQ A;  1MMN A;  5L3Q A;  1JPN A;  2X51 A;  2XLH A;  3B71 A;  4XPY A;  5E33 A;  1LPE A;  4O6M A;  3R2P A;  1YZC A;  3ABL C;  1M57 C;  1OKK A;  1XZP A;  256B A;  4IAO A;  4BJ5 A;  4W8K A;  3GM1 A;  1OCO C;  4IJJ A;  3S0X A;  1R5I D;  2KW3 C;  2M4E A;  2D5R B;  5KYW A;  1YAR O;  1V74 B;  3TOL A;  2OU6 A;  2IXP A;  3DE9 A;  5T1D B;  3NMJ A;  4CIP A;  2EIM C;  3HTK C;  4DVZ A;  2OKU A;  4J32 B;  1SZI A;  2XS1 A;  4W8P A;  1T01 A;  2KSF A;  3FHD A;  4JTD B;  2H8A A;  2YWA A;  2Q00 A;  2XLM A;  1B68 A;  1I4Y A;  3NKD A;  3SXM A;  1Z63 A;  4CIH A;  1M2V A;  2XS8 A;  4FWV A;  4IAR A;  2L81 A;  2QLA A;  4RDA A;  2ZXW C;  4DRJ B;  2G3K A;  1V4A A;  5F5F A;  1U89 A;  3OEO A;  1S05 A;  3ABM C;  4PJJ A;  3QW0 A;  3TD7 A;  1MMD A;  2XRH A;  1UFB A;  2J9U A;  3C63 A;  3NRH A;  5IY5 C;  4U9D A;  1WWP A;  5EGY A;  3AG2 C;  3WAQ A;  1KU2 A;  4P6I C;  5A69 A;  3DJN B;  3AJM A;  3N0T A;  1TWH A;  3X2Q C;  3S27 A;  2GA0 A;  4G7H F;  2HJ3 A;  2R03 A;  5JS5 A;  5FCL A;  1LKX A;  4EUK B;  1FR0 A;  2V3C C;  1WGW A;  2OJQ A;  1NFN A;  1TWC A;  3EFO B;  3O39 A;  3NMK A;  5E3A A;  1JPJ A;  2Q9C A; 
#chains in the Genus database with same CATH homology
 1K05 A;  4XEV A;  1JOG A;  3RQE A;  4NQF A;  2L6G A;  2L6F A;  1V4A A;  3B71 A;  4XEF A;  1WOL A;  1KNY A;  1K40 A;  1WTY A;  3S9O A;  1OW8 A;  3C8G B;  4EBJ A;  2L6H A;  3RQF A;  3L8J A;  3BRJ A;  1UFB A;  1OW6 A;  1WWP A;  2KK1 A;  4EBK A;  5F28 E;  1ZZP A;  3U3F A;  1QVX A;  3GM1 A;  3C8G D;  4R32 A;  3AJM A;  3RQG A;  2LK4 A;  3L8I A;  1KTM A;  1K04 A;  1PV3 A;  3C8G A;  3TUL A;  3GM3 A;  2JPU A;  3C18 A;  2HSB A;  3O10 A;  1O3U A;  1OW7 A;  2JX0 A;  3U0C A;  3K7D A;  3GM2 A;  4XEK A;  2PBE A;  3JYY A;  2YWA A;  2Q00 A;  3JZ0 A;  3MFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...