1CGOA

Cytochrome c'
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
125
structure length
125
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLTALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C
publication title Three-dimensional structure of cytochrome c' from two Alcaligenes species and the implications for four-helix bundle structures.
pubmed doi rcsb
source organism Alcaligenes sp.
molecule tags Electron transport (cytochrome)
total genus 48
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 1995-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1cgoA00
3HNJA 4CX9A 2YLIA 2YL3A 2XM4A 1BBHA 1S05A 1E83A 3IQ5A 1QQ3A 2J8WA 1YYXA 3M4CA 4WGZA 5JT4A 4EIYA 1NBBA 2XLOA 4D4NA 1CGNA 1LM3B 4IAQA 4U9DA 4CDAA 3M79A 5JP7A 4IARA 3VRCA 1RCPA 3NMJA 2BC5A 4ULVA 3QVYA 3M4BA 4N6HA 5JRAA 3QW1A 1E86A 2CCYA 1M6TA 4CIPA 4NC3A 4CDYA 5JVEA 3HNKA 3FOOA 2YL7A 3TOLA 5JLIA 2XLMA 1GQAA 3QW0A 5JS5A 2XLHA 4JE9A 2YLGA 1YYJA 2XM0A 4JEAA 3IQ6A 1CGOA 4ER9A 3TOMA 2YL1A 2XL8A 4D4XA 3QVZA 2J9BA 1YZCA 2YKZA 4JEBA 3NMKA 2YL0A 3ZQVA 3ZQYA 4CJGA 1CPRA 1APCA 2YLDA 256BA 3U8PA 5AGFA 3C62A 1E85A 4CJOA 3DE8A 5B3IA 1MQVA 1YZAA 3FOPA 2QLAA 2XLVA 1JAFA 3L1MA 3ZWIA 5JUAA 3NMIA 1EKYA 3ZTMA 4U9EA 3C63A 1E84A 4WGYA 3M15A 4N4WA 1CPQA 2XLDA 1A7VA 4JKVA 3DE9A 1QPUA 5JSLA 4IB4A 3ZTZA 2XLWA 3HNLA 4CDVA 2XL6A 2XLEA 3HNIA 4L6RA
chains in the Genus database with same CATH superfamily
1TQGA 1ZVZA 2J9VA 2R9RB 1G4WR 3C8GA 3T6BA 4CX9A 3KMIA 2L6GA 2YL3A 1FFHA 3F46A 2WVOA 2Y3GA 3G4ZA 4ZLCA 3WG7C 2L7AA 2W45A 1G4US 3L8IA 3IQ5A 5F5FA 2H8AA 1F1MA 2R03A 2IBFA 2VC9A 3JZ0A 4NQFA 3U2LA 4OIPF 2A6HF 3E70C 1NFNA 3GEIA 1IZMA 3FVYA 1UG7A 2Q7RA 4WGZA 5B1BC 2B0HA 2D4UA 2J0XA 4LACB 4EIYA 1LE2A 4Z9IA 3GM1A 3ZSUA 5A6JA 4PJJA 1RJ9A 4JC7A 2M4EA 3C18A 2PNOA 2YRFA 1K04A 3EHNA 5L0IA 2A0BA 4CS7A 4EHPA 2GWWA 5DS5A 1Y4CA 3UMHA 4GYTA 2P61A 4N6HA 3S9OA 5JRAA 4JTDB 1T9KA 2WB7A 1H9TA 1O5HA 1NU9C 1E86A 1WATA 4JJGA 5KYXB 2YVKA 4JIOA 4CIPA 4DXWA 1YA9A 2D5RB 2P0NA 3FOOA 1TFOB 2YL7A 2ETSA 4O6MA 4QI2A 2QTVA 2XLMA 1GQAA 2OU6A 2VB6A 4DVYP 2E87A 5EHHA 2XLHA 4IWBA 2CNWA 1LI5A 4OIOF 3B0VC 1M2VB 4K7BA 4G7HF 2XM0A 3PMRA 5L0JA 1UFBA 4KNVA 1QLEC 3EZIA 2VCCA 3IQ6A 2Y3DA 1EA8A 4MW3A 4X0RA 3W8IA 2HJ3A 3UMIA 1OR3A 3VM6A 1BDJB 1SF8A 1TWAA 3GEHA 2LFDA 4N6CA 3RF3A 1YZCA 2A6EF 4JCZA 2BL2A 2J46A 1HE9A 3MYIA 3K1IA 1A7DA 2EPLX 3EGDB 3JT1A 3ZQVA 4PJMA 2ZXOA 3NKEA 1ZW2A 3GANA 2YHSA 4AK9A 3K6BA 4YT4A 5L0FA 2V3CC 3AG1C 1K40A 2G3KA 4KI2A 3Q6NA 2ZPAA 1OKKD 4OIRF 5HV9A 1TWGA 1YZAA 3I5QA 3T4RA 4XLPF 3DMDA 1R5ID 2QLAA 2ASRA 4RBNA 3JYHA 2R7OA 4MVZA 2NUTA 5KYUB 3UGOA 3MX3A 2GA0A 4H54A 3S27A 1AUEA 1HY5A 3EFOB 3NMIA 3ABKC 1XZPA 3SXMA 2LD6A 4JTCB 2Q9BA 3G50A 4JRZA 1O3UA 1ZHTA 4BJ1A 4CSAC 1LI7A 1YAUO 3A11A 1S7ZA 1OR2A 1LIHA 4Q4ZF 1CPQA 2QY9A 1I5NA 3B71A 3LESA 4U5BE 1FAPB 4JKVA 4EWCA 3DKAA 2EIJC 4MTOA 3WHNA 5A6BD 4ULWA 3GEEA 1LS1A 5CIVA 1QPUA 3EPVA 4BEMJ 5JSLA 3LNRA 3NYJA 5BQIA 3RVYA 2R7RA 4U5CE 4Z9HA 2Y69C 3NRHA 5HSWA 2VASA 2OJED 1Z23A 2AVKA 2J45A 1GGQA 2QNLA 2RSEB 4CDVA 2PFDA 5BQHA 4HFKB 3S84A 5KYYB 4L6RA 4RD9A 2ZXWC 3M1CB 3O6XA 2DGJA 4BJ6C 3CQZA 3LAYA 3A9CA 1YARO 3L0IA 1TWHA 3AG2C 1YA7O 3L8JA 4QI0A 3RW0A 5EK0A 1BBHA 1S05A 1VLTA 1J8MF 3IPMO 1AVOB 1PV3A 4YJWA 1HW1A 1JMWA 2W4BA 1ZYRF 3CEXA 3KKBA 4O6NA 5F28E 3EG9B 3ZDLA 4Q7CA 1L7CA 3LLIA 3BRJA 1YYXA 2R25A 3KL4A 1EI7A 1RKCA 4NTFA 1CGME 2EPMX 1ZHZA 3W8HA 4G7ZF 1QVXA 1OCCC 5T3WA 4KBLA 2PX0A 3PCVA 2PP4A 1SYQA 1LM3B 4JZAA 4BJ5A 3JCUQ 4U9DA 1NG1A 3N2ZB 1D0XA 1T6QA 3ATPA 3O10A 3VRCA 4A4AA 1D1AA 3T6GB 4DBQA 1Z7Qc 2BC5A 1FFTC 3H2UA 2IM8A 2HV7A 2LQGA 3M4BA 3QVYA 4MS2A 2DYSC 3QW1A 1PCXA 4N06A 5D91A 5B1AC 1GM5A 2P7VA 3AOUA 1OCRC 3ECSA 3MLGA 2M64A 4JCHA 3NG1A 1VK5A 1XZQA 1Q0DA 1VMAA 2LSEA 2WZFA 3HNKA 1JPJA 1LVKA 3LLKA 2OEVA 4NY3A 5EGYA 2XRHA 3H2VA 3SZRA 5AC4A 5JLIA 3QW0A 2XL4A 2W4MA 2LP4A 4IRUA 4J7TA 4IGGA 5A6KA 5JS5A 4CS9C 2G62A 2YLGA 4AX2A 1FMWA 1RXQA 1TR2A 2EILC 4KNWA 4XQ1A 4JEAA 4YL0A 4WABA 4G78A 4U5GA 5KYUA 4FWVA 2R7WA 1MMDA 5BQGA 4YT8A 2XL8A 4K1OA 2AU5A 4NTAA 3TK0A 4D4XA 1KU2A 1NU7D 3QVZA 4E0HA 4C7OB 1YVIA 3K66A 4PR9A 1C02A 4JEBA 3RQEA 4XEKA 2CYDA 3GM2A 4E7SA 2XSEA 3DXJF 3TQOA 1MMNA 5FCLA 3SEOA 3N24A 1D1CA 3VF0A 4CJGA 2FAPB 2R7QA 2XXAA 1WOLA 2YLDA 2YZSA 2R7XA 1Q0GA 256BA 2F22A 2HS5A 3DM5A 3K1IC 3QTHA 2X51A 3RKOF 1E85A 3DE8A 1NFOA 5B3IA 2MWQA 1MQVA 3W2WA 1ORYA 1V55C 3EGXB 3LS0A 4DVZA 3EH1A 1WGWA 3SXKA 4U5FE 2TMVP 4W8PA 1WASA 4Z9JA 3MBGA 1NZEA 1JAFA 3GORA 2HKVA 2NUPB 5F5HA 1WTYA 3UMKA 4EBBA 1HW2A 3QMKA 4EBKA 4NTBA 1ZW3A 5DVWA 3C63A 1ST6A 4DRJB 3WAQA 2OG2A 4R32A 2RD9A 3IEEA 4LLCA 3M15A 5KYNA 5D92A 3VYWA 4XPWA 1DOWA 1Z5ZA 2LFFA 2WZLA 2HSQA 1A7VA 3CZ6A 2WL8A 1HMDA 2OCCC 4BEJA 5KYWA 1K05A 3DM9B 3DE9A 4MVQA 3X1OA 1Y6DA 3BEHA 4HEAJ 4IJJA 1LPEA 1SR2A 5K0IA 4DRHB 4EKWA 2R05A 1YLMA 2QE9A 2HFIA 3VAYA 1D1BA 4LDQA 2XLWA 4AE4B 4JJFA 2GFHA 1V4AA 3IQTA 1Q0KA 3U5SA 1C17M 2DI3A 3SP1A 4G7OF 2WVNA 4MVMA 3W2VA 3EH2A 2UUIA 3HNJA 3C8GD 2YLIA 3ZG1A 1I4YA 2J9WA 3FXHA 2XM4A 4J30B 2KGOA 4OINF 2X0CA 1FR0A 5L0GA 1DOVA 2HSBA 3V7OA 3RH3A 3RYLA 4OD5A 3B0UX 2J0WA 3DZAA 2VCBA 4W8KA 4H4KC 3T9OA 3EQLF 3KYIA 2GAQA 2J8WA 4ANJA 1OW8A 3UGPA 2QUPA 1RJ9B 3UR3C 3LEVA 3M4CA 4I1MA 4LDRA 4OIQF 1OQCA 3SXYA 3R7CA 4OD4A 1NBBA 1T01A 3NDBB 3T6JA 3AG3C 2H7BA 1E2XA 4NCQA 5TJ5E 1VB5A 4XWJA 3AGTA 3AQCA 4J32B 1D0YA 1YDIA 2EPKX 2I8BA 3TD7A 4FESA 5FZTA 3M79A 4DJ9A 5JP7A 3J06A 4IARA 2G3VA 4MVUA 2IXPA 1RCPA 2JPUA 5A69A 2V26A 3ASOC 3NMJA 5T1DB 2BE5F 1OW6A 2J7PA 2KK1A 4XTKA 3U3FA 2R7UA 2CW0F 3B0PA 1A41A 5L0HA 2CCYA 3AJMA 4XPYA 1N1CA 4O6YA 4U5HA 4NC3A 2FFHA 1C03A 4CDYA 1V74B 1Q0MA 5L0DA 3U8VA 2A69F 4E0IA 5KYXA 1V54C 1MMGA 2Y3HA 3K1HA 3TOLA 1JRAA 2FGYA 3FAPB 2AWCA 2AP3A 2XS1A 1LKXA 2VH3A 2HZ8A 4O79A 1ZHWA 2CNWD 4MNDA 3Q7LA 4JE9A 3DWWA 3X2QC 4DRIB 5BUOA 3S0XA 1OXKA 3PDMP 1O87A 1RKEB 3S90A 4FX5A 3U2MA 4AL1A 4C3BA 4CSAA 3JRMO 3IQCA 4Q5SF 3JTLO 1CGOA 1M2VA 1YJGA 2EPOA 2J9UA 2NUPA 2YL1A 1U89A 3N0TA 4RDAA 2OQMA 1QSPA 2I15A 2J9BA 2KC3A 1T6IA 3S28A 3GM3A 2KNHA 2R7TA 5L3VA 3ABMC 2OEXA 1JPNA 3DAFA 2EIMC 4HE8D 1H9GA 1NSGB 1NLXA 2IXNA 4WJ0A 2R7VA 1CPRA 4HFFB 4MW8A 3JRTA 4ZLDA 1LE4A 2LIGA 1IW7F 1OW7A 5AGFA 1OCOC 3EJNA 3AQBA 3EGDA 3U8PA 2MHRA 3ZIBA 4CJOA 4PFPA 5COMA 1JOGA 4JTAB 3LUTB 2PX3A 1ZU5A 3I4UA 2HMQA 2PBEA 3AG4C 2CDQA 3R2PA 3ZWIA 3RFYA 3IHUA 2YEVA 2KYHA 1EKYA 5E33A 4YL1A 1B68A 4AE4A 3PHF2 4MVRA 1AEPA 3LNMB 2C03A 2Q9CA 4KC9A 1KNYA 1ZZPA 3EFOA 4CBEA 1E84A 1G8XA 2L9JA 5DS4A 3CSKA 3NYMA 2R7SA 2Q00A 3HLZA 1QKRA 4N4WA 3F47A 2LCHA 3WODF 2OJQA 5DQZA 4CS8A 3DI5A 2IXMA 1MMAA 2NSFA 3RIPA 3C7JA 4P6IC 1U0BB 4DOZA 5COFA 5A6BA 1R4TA 4PFOA 2O9XA 4E18A 2KW3C 3OEOA 1VYKA 3DAGA 3HTKC 4LDKA 4CIHA 5GPGB 2OKUA 2MYSA 1ORSC 2Q3TA 4MQ9F 3ZTZA 4XLNF 2LK4A 2P6VA 3HNLA 1RMVA 4P9TA 3UNGC 1U6HA 3K7DA 2XLEA 3HNIA 3MFNA 3DJUB 5DQTA 1FTSA 2J7PD 2ZD9A 2IYLD 4YL3A 2Q4FA 1JR8A 1OCZC 3HKKA 5KYYA 2CGEA 3W4YA 3L34A 1VLSA 4MTGA 1E83A 3MYFA 2WVQA 4C3DA 5E3AA 3SNHA 3I5PA 1VTMP 5CI9A 3HJCA 1TKNA 3E9VA 1GS9A 1WN0A 4XEFA 5E2QA 3TJ6A 3U9MA 1FNTc 2HV6A 1QQ3A 2KSFA 3K33A 4LLEA 4CS9A 1Z6AA 1XWJA 3SXZA 1Q0FA 1VOMA 3B9QA 5JT4A 3S29A 3TULA 3EG9A 1EQ1A 1HE1A 1SMYF 2XLOA 4XPXA 5A6AA 4D4NA 1H7IA 3OA1A 2WZGA 1CGNA 1VYIA 2B0JA 2NG1A 4EUKB 3LEOA 4IAQA 3V5XA 4AL0A 2KJGA 2XXAB 4I3MA 4JURI 3JYYA 4IAOA 3C8GB 4CDAA 2UUHA 3FMSA 4LERA 5CI8A 5E3CA 1RKEA 3ASNC 4K0DA 1SZIA 4BJTA 4ULVA 1QZXA 2GDCA 4PACA 4U5DE 2Y39A 2IXOA 2ZXPA 4QDLA 5L3QA 1ZHXA 4PK4A 1PD0A 1M6TA 3RVZA 5L0CA 1KTMA 2ZXRA 1ORJA 1ZU4A 2VCAA 5JVEA 4F4BA 1M2OA 1MNDA 4G0HA 1BR2A 2A0UA 2A68F 4FAPB 2OOCA 4GEHA 3KPHA 2R02A 3ZC4A 3EHMA 3U9JA 2Q9AA 2PF4E 3CAXA 3ABLC 3O39A 1FMVA 1T6UA 3U3BA 1J8YF 1YYJA 3LS1A 3GWLA 1Z3IX 2H7OA 2JD3A 3H65A 4ONSA 3KYJA 4YN0B 3V5YA 2HMZA 3JSEO 4E7ZA 1A0BA 3US6A 3ITFA 3EZHA 4ER9A 3TOMA 5COGA 5T3TA 1TWCA 4MVOA 3GODA 5DS6A 4I1OB 2DYRC 4BJ5C 4J7YA 4YWQA 2YKZA 3C8ZA 3TJ5A 4U5EE 3RQGA 2NSGA 3NMKA 4GQHA 3Q6MA 4UDVA 4C7OA 1L3PA 3LJBA 2Y3BA 2YL0A 3ZQYA 1APCA 4P9FA 3POVA 2H7VC 2L6FA 3OWTA 3DD7A 3C62A 4I44A 4PJLA 4PJNA 4A2NB 3FOPA 1D0ZA 3FDQA 2IOQA 2XLVA 3SYNA 1W2WA 1BR1A 3L1MA 3EGXA 5JUAA 1I4ZA 4DBRA 2JX0A 1MNEA 4YK5A 1M56C 3JSZA 1H6GA 1ZHYA 5B3SC 3ZTMA 4JVSA 4JW1A 5DLJA 4U9EA 4C3EA 5AC5A 3G4XA 4YT5A 4B6IA 4WGYA 4MVSA 2W9YA 3V5ZA 2YQYA 1HMOA 5KYWB 3GWNA 3O55A 4BPMA 1WWPA 3AGUA 2ICWG 2XS8A 3Q7GA 2A1DD 2C04A 2AWYA 1LS4A 2L6HA 2XLDA 4BG0A 2HUJA 2P1AA 2DB4A 3KH2A 1M57C 1T5OA 1PD1A 2YWAA 5IY5C 3QZCA 3NYLA 4O7GA 4CS8C 4EBJA 1BR4A 3FAJA 2KQ9A 3FHDA 2L81A 1TFKB 2NUTB 1OKKA 3U0CA 2HJMA 2Z15A 4IB4A 4BJ6A 4E17A 1Z63A 4MTFA 4XEVA 1BZ4A 3B29A 4YT2A 1OXBA 2EIKC 3ZVRA 2EPNA 2EINC 3NKDA 3RQFA 2XL6A 1A7EA 1G5ZA 3DJNB 4M63A 2NPUA
chains in the Genus database with same CATH topology
3HNJA 4CX9A 2YLIA 2YL3A 2XM4A 1BBHA 1S05A 1E83A 3IQ5A 1QQ3A 2J8WA 1YYXA 3M4CA 4WGZA 5JT4A 4EIYA 1NBBA 2XLOA 4D4NA 1CGNA 1LM3B 4IAQA 4U9DA 4CDAA 3M79A 5JP7A 4IARA 3VRCA 1RCPA 3NMJA 2BC5A 4ULVA 3QVYA 3M4BA 4N6HA 5JRAA 3QW1A 1E86A 2CCYA 1M6TA 4CIPA 4NC3A 4CDYA 5JVEA 3HNKA 3FOOA 2YL7A 3TOLA 5JLIA 2XLMA 1GQAA 3QW0A 5JS5A 2XLHA 4JE9A 2YLGA 1YYJA 2XM0A 4JEAA 3IQ6A 1CGOA 4ER9A 3TOMA 2YL1A 2XL8A 4D4XA 3QVZA 2J9BA 1YZCA 2YKZA 4JEBA 3NMKA 2YL0A 3ZQVA 3ZQYA 4CJGA 1CPRA 1APCA 2YLDA 256BA 3U8PA 5AGFA 3C62A 1E85A 4CJOA 3DE8A 5B3IA 1MQVA 1YZAA 3FOPA 2QLAA 2XLVA 1JAFA 3L1MA 3ZWIA 5JUAA 3NMIA 1EKYA 3ZTMA 4U9EA 3C63A 1E84A 4WGYA 3M15A 4N4WA 1CPQA 2XLDA 1A7VA 4JKVA 3DE9A 1QPUA 5JSLA 4IB4A 3ZTZA 2XLWA 3HNLA 4CDVA 2XL6A 2XLEA 3HNIA 4L6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HNJ A;  4CX9 A;  2YLI A;  2YL3 A;  2XM4 A;  1BBH A;  1S05 A;  1E83 A;  3IQ5 A;  1QQ3 A;  2J8W A;  1YYX A;  3M4C A;  4WGZ A;  5JT4 A;  4EIY A;  1NBB A;  2XLO A;  4D4N A;  1CGN A;  1LM3 B;  4IAQ A;  4U9D A;  4CDA A;  3M79 A;  5JP7 A;  4IAR A;  3VRC A;  1RCP A;  3NMJ A;  2BC5 A;  4ULV A;  3QVY A;  3M4B A;  4N6H A;  5JRA A;  3QW1 A;  1E86 A;  2CCY A;  1M6T A;  4CIP A;  4NC3 A;  4CDY A;  5JVE A;  3HNK A;  3FOO A;  2YL7 A;  3TOL A;  5JLI A;  2XLM A;  1GQA A;  3QW0 A;  5JS5 A;  2XLH A;  4JE9 A;  2YLG A;  1YYJ A;  2XM0 A;  4JEA A;  3IQ6 A;  1CGO A;  4ER9 A;  3TOM A;  2YL1 A;  2XL8 A;  4D4X A;  3QVZ A;  2J9B A;  1YZC A;  2YKZ A;  4JEB A;  3NMK A;  2YL0 A;  3ZQV A;  3ZQY A;  4CJG A;  1CPR A;  1APC A;  2YLD A;  256B A;  3U8P A;  5AGF A;  3C62 A;  1E85 A;  4CJO A;  3DE8 A;  5B3I A;  1MQV A;  1YZA A;  3FOP A;  2QLA A;  2XLV A;  1JAF A;  3L1M A;  3ZWI A;  5JUA A;  3NMI A;  1EKY A;  3ZTM A;  4U9E A;  3C63 A;  1E84 A;  4WGY A;  3M15 A;  4N4W A;  1CPQ A;  2XLD A;  1A7V A;  4JKV A;  3DE9 A;  1QPU A;  5JSL A;  4IB4 A;  3ZTZ A;  2XLW A;  3HNL A;  4CDV A;  2XL6 A;  2XLE A;  3HNI A;  4L6R A; 
#chains in the Genus database with same CATH topology
 1TQG A;  1ZVZ A;  2J9V A;  2R9R B;  1G4W R;  3C8G A;  3T6B A;  4CX9 A;  3KMI A;  2L6G A;  2YL3 A;  1FFH A;  3F46 A;  2WVO A;  2Y3G A;  3G4Z A;  4ZLC A;  3WG7 C;  2L7A A;  2W45 A;  1G4U S;  3L8I A;  3IQ5 A;  5F5F A;  2H8A A;  1F1M A;  2R03 A;  2IBF A;  2VC9 A;  3JZ0 A;  4NQF A;  3U2L A;  4OIP F;  2A6H F;  3E70 C;  1NFN A;  3GEI A;  1IZM A;  3FVY A;  1UG7 A;  2Q7R A;  4WGZ A;  5B1B C;  2B0H A;  2D4U A;  2J0X A;  4LAC B;  4EIY A;  1LE2 A;  4Z9I A;  3GM1 A;  3ZSU A;  5A6J A;  4PJJ A;  1RJ9 A;  4JC7 A;  2M4E A;  3C18 A;  2PNO A;  2YRF A;  1K04 A;  3EHN A;  5L0I A;  2A0B A;  4CS7 A;  4EHP A;  2GWW A;  5DS5 A;  1Y4C A;  3UMH A;  4GYT A;  2P61 A;  4N6H A;  3S9O A;  5JRA A;  4JTD B;  1T9K A;  2WB7 A;  1H9T A;  1O5H A;  1NU9 C;  1E86 A;  1WAT A;  4JJG A;  5KYX B;  2YVK A;  4JIO A;  4CIP A;  4DXW A;  1YA9 A;  2D5R B;  2P0N A;  3FOO A;  1TFO B;  2YL7 A;  2ETS A;  4O6M A;  4QI2 A;  2QTV A;  2XLM A;  1GQA A;  2OU6 A;  2VB6 A;  4DVY P;  2E87 A;  5EHH A;  2XLH A;  4IWB A;  2CNW A;  1LI5 A;  4OIO F;  3B0V C;  1M2V B;  4K7B A;  4G7H F;  2XM0 A;  3PMR A;  5L0J A;  1UFB A;  4KNV A;  1QLE C;  3EZI A;  2VCC A;  3IQ6 A;  2Y3D A;  1EA8 A;  4MW3 A;  4X0R A;  3W8I A;  2HJ3 A;  3UMI A;  1OR3 A;  3VM6 A;  1BDJ B;  1SF8 A;  1TWA A;  3GEH A;  2LFD A;  4N6C A;  3RF3 A;  1YZC A;  2A6E F;  4JCZ A;  2BL2 A;  2J46 A;  1HE9 A;  3MYI A;  3K1I A;  1A7D A;  2EPL X;  3EGD B;  3JT1 A;  3ZQV A;  4PJM A;  2ZXO A;  3NKE A;  1ZW2 A;  3GAN A;  2YHS A;  4AK9 A;  3K6B A;  4YT4 A;  5L0F A;  2V3C C;  3AG1 C;  1K40 A;  2G3K A;  4KI2 A;  3Q6N A;  2ZPA A;  1OKK D;  4OIR F;  5HV9 A;  1TWG A;  1YZA A;  3I5Q A;  3T4R A;  4XLP F;  3DMD A;  1R5I D;  2QLA A;  2ASR A;  4RBN A;  3JYH A;  2R7O A;  4MVZ A;  2NUT A;  5KYU B;  3UGO A;  3MX3 A;  2GA0 A;  4H54 A;  3S27 A;  1AUE A;  1HY5 A;  3EFO B;  3NMI A;  3ABK C;  1XZP A;  3SXM A;  2LD6 A;  4JTC B;  2Q9B A;  3G50 A;  4JRZ A;  1O3U A;  1ZHT A;  4BJ1 A;  4CSA C;  1LI7 A;  1YAU O;  3A11 A;  1S7Z A;  1OR2 A;  1LIH A;  4Q4Z F;  1CPQ A;  2QY9 A;  1I5N A;  3B71 A;  3LES A;  4U5B E;  1FAP B;  4JKV A;  4EWC A;  3DKA A;  2EIJ C;  4MTO A;  3WHN A;  5A6B D;  4ULW A;  3GEE A;  1LS1 A;  5CIV A;  1QPU A;  3EPV A;  4BEM J;  5JSL A;  3LNR A;  3NYJ A;  5BQI A;  3RVY A;  2R7R A;  4U5C E;  4Z9H A;  2Y69 C;  3NRH A;  5HSW A;  2VAS A;  2OJE D;  1Z23 A;  2AVK A;  2J45 A;  1GGQ A;  2QNL A;  2RSE B;  4CDV A;  2PFD A;  5BQH A;  4HFK B;  3S84 A;  5KYY B;  4L6R A;  4RD9 A;  2ZXW C;  3M1C B;  3O6X A;  2DGJ A;  4BJ6 C;  3CQZ A;  3LAY A;  3A9C A;  1YAR O;  3L0I A;  1TWH A;  3AG2 C;  1YA7 O;  3L8J A;  4QI0 A;  3RW0 A;  5EK0 A;  1BBH A;  1S05 A;  1VLT A;  1J8M F;  3IPM O;  1AVO B;  1PV3 A;  4YJW A;  1HW1 A;  1JMW A;  2W4B A;  1ZYR F;  3CEX A;  3KKB A;  4O6N A;  5F28 E;  3EG9 B;  3ZDL A;  4Q7C A;  1L7C A;  3LLI A;  3BRJ A;  1YYX A;  2R25 A;  3KL4 A;  1EI7 A;  1RKC A;  4NTF A;  1CGM E;  2EPM X;  1ZHZ A;  3W8H A;  4G7Z F;  1QVX A;  1OCC C;  5T3W A;  4KBL A;  2PX0 A;  3PCV A;  2PP4 A;  1SYQ A;  1LM3 B;  4JZA A;  4BJ5 A;  3JCU Q;  4U9D A;  1NG1 A;  3N2Z B;  1D0X A;  1T6Q A;  3ATP A;  3O10 A;  3VRC A;  4A4A A;  1D1A A;  3T6G B;  4DBQ A;  1Z7Q c;  2BC5 A;  1FFT C;  3H2U A;  2IM8 A;  2HV7 A;  2LQG A;  3M4B A;  3QVY A;  4MS2 A;  2DYS C;  3QW1 A;  1PCX A;  4N06 A;  5D91 A;  5B1A C;  1GM5 A;  2P7V A;  3AOU A;  1OCR C;  3ECS A;  3MLG A;  2M64 A;  4JCH A;  3NG1 A;  1VK5 A;  1XZQ A;  1Q0D A;  1VMA A;  2LSE A;  2WZF A;  3HNK A;  1JPJ A;  1LVK A;  3LLK A;  2OEV A;  4NY3 A;  5EGY A;  2XRH A;  3H2V A;  3SZR A;  5AC4 A;  5JLI A;  3QW0 A;  2XL4 A;  2W4M A;  2LP4 A;  4IRU A;  4J7T A;  4IGG A;  5A6K A;  5JS5 A;  4CS9 C;  2G62 A;  2YLG A;  4AX2 A;  1FMW A;  1RXQ A;  1TR2 A;  2EIL C;  4KNW A;  4XQ1 A;  4JEA A;  4YL0 A;  4WAB A;  4G78 A;  4U5G A;  5KYU A;  4FWV A;  2R7W A;  1MMD A;  5BQG A;  4YT8 A;  2XL8 A;  4K1O A;  2AU5 A;  4NTA A;  3TK0 A;  4D4X A;  1KU2 A;  1NU7 D;  3QVZ A;  4E0H A;  4C7O B;  1YVI A;  3K66 A;  4PR9 A;  1C02 A;  4JEB A;  3RQE A;  4XEK A;  2CYD A;  3GM2 A;  4E7S A;  2XSE A;  3DXJ F;  3TQO A;  1MMN A;  5FCL A;  3SEO A;  3N24 A;  1D1C A;  3VF0 A;  4CJG A;  2FAP B;  2R7Q A;  2XXA A;  1WOL A;  2YLD A;  2YZS A;  2R7X A;  1Q0G A;  256B A;  2F22 A;  2HS5 A;  3DM5 A;  3K1I C;  3QTH A;  2X51 A;  3RKO F;  1E85 A;  3DE8 A;  1NFO A;  5B3I A;  2MWQ A;  1MQV A;  3W2W A;  1ORY A;  1V55 C;  3EGX B;  3LS0 A;  4DVZ A;  3EH1 A;  1WGW A;  3SXK A;  4U5F E;  2TMV P;  4W8P A;  1WAS A;  4Z9J A;  3MBG A;  1NZE A;  1JAF A;  3GOR A;  2HKV A;  2NUP B;  5F5H A;  1WTY A;  3UMK A;  4EBB A;  1HW2 A;  3QMK A;  4EBK A;  4NTB A;  1ZW3 A;  5DVW A;  3C63 A;  1ST6 A;  4DRJ B;  3WAQ A;  2OG2 A;  4R32 A;  2RD9 A;  3IEE A;  4LLC A;  3M15 A;  5KYN A;  5D92 A;  3VYW A;  4XPW A;  1DOW A;  1Z5Z A;  2LFF A;  2WZL A;  2HSQ A;  1A7V A;  3CZ6 A;  2WL8 A;  1HMD A;  2OCC C;  4BEJ A;  5KYW A;  1K05 A;  3DM9 B;  3DE9 A;  4MVQ A;  3X1O A;  1Y6D A;  3BEH A;  4HEA J;  4IJJ A;  1LPE A;  1SR2 A;  5K0I A;  4DRH B;  4EKW A;  2R05 A;  1YLM A;  2QE9 A;  2HFI A;  3VAY A;  1D1B A;  4LDQ A;  2XLW A;  4AE4 B;  4JJF A;  2GFH A;  1V4A A;  3IQT A;  1Q0K A;  3U5S A;  1C17 M;  2DI3 A;  3SP1 A;  4G7O F;  2WVN A;  4MVM A;  3W2V A;  3EH2 A;  2UUI A;  3HNJ A;  3C8G D;  2YLI A;  3ZG1 A;  1I4Y A;  2J9W A;  3FXH A;  2XM4 A;  4J30 B;  2KGO A;  4OIN F;  2X0C A;  1FR0 A;  5L0G A;  1DOV A;  2HSB A;  3V7O A;  3RH3 A;  3RYL A;  4OD5 A;  3B0U X;  2J0W A;  3DZA A;  2VCB A;  4W8K A;  4H4K C;  3T9O A;  3EQL F;  3KYI A;  2GAQ A;  2J8W A;  4ANJ A;  1OW8 A;  3UGP A;  2QUP A;  1RJ9 B;  3UR3 C;  3LEV A;  3M4C A;  4I1M A;  4LDR A;  4OIQ F;  1OQC A;  3SXY A;  3R7C A;  4OD4 A;  1NBB A;  1T01 A;  3NDB B;  3T6J A;  3AG3 C;  2H7B A;  1E2X A;  4NCQ A;  5TJ5 E;  1VB5 A;  4XWJ A;  3AGT A;  3AQC A;  4J32 B;  1D0Y A;  1YDI A;  2EPK X;  2I8B A;  3TD7 A;  4FES A;  5FZT A;  3M79 A;  4DJ9 A;  5JP7 A;  3J06 A;  4IAR A;  2G3V A;  4MVU A;  2IXP A;  1RCP A;  2JPU A;  5A69 A;  2V26 A;  3ASO C;  3NMJ A;  5T1D B;  2BE5 F;  1OW6 A;  2J7P A;  2KK1 A;  4XTK A;  3U3F A;  2R7U A;  2CW0 F;  3B0P A;  1A41 A;  5L0H A;  2CCY A;  3AJM A;  4XPY A;  1N1C A;  4O6Y A;  4U5H A;  4NC3 A;  2FFH A;  1C03 A;  4CDY A;  1V74 B;  1Q0M A;  5L0D A;  3U8V A;  2A69 F;  4E0I A;  5KYX A;  1V54 C;  1MMG A;  2Y3H A;  3K1H A;  3TOL A;  1JRA A;  2FGY A;  3FAP B;  2AWC A;  2AP3 A;  2XS1 A;  1LKX A;  2VH3 A;  2HZ8 A;  4O79 A;  1ZHW A;  2CNW D;  4MND A;  3Q7L A;  4JE9 A;  3DWW A;  3X2Q C;  4DRI B;  5BUO A;  3S0X A;  1OXK A;  3PDM P;  1O87 A;  1RKE B;  3S90 A;  4FX5 A;  3U2M A;  4AL1 A;  4C3B A;  4CSA A;  3JRM O;  3IQC A;  4Q5S F;  3JTL O;  1CGO A;  1M2V A;  1YJG A;  2EPO A;  2J9U A;  2NUP A;  2YL1 A;  1U89 A;  3N0T A;  4RDA A;  2OQM A;  1QSP A;  2I15 A;  2J9B A;  2KC3 A;  1T6I A;  3S28 A;  3GM3 A;  2KNH A;  2R7T A;  5L3V A;  3ABM C;  2OEX A;  1JPN A;  3DAF A;  2EIM C;  4HE8 D;  1H9G A;  1NSG B;  1NLX A;  2IXN A;  4WJ0 A;  2R7V A;  1CPR A;  4HFF B;  4MW8 A;  3JRT A;  4ZLD A;  1LE4 A;  2LIG A;  1IW7 F;  1OW7 A;  5AGF A;  1OCO C;  3EJN A;  3AQB A;  3EGD A;  3U8P A;  2MHR A;  3ZIB A;  4CJO A;  4PFP A;  5COM A;  1JOG A;  4JTA B;  3LUT B;  2PX3 A;  1ZU5 A;  3I4U A;  2HMQ A;  2PBE A;  3AG4 C;  2CDQ A;  3R2P A;  3ZWI A;  3RFY A;  3IHU A;  2YEV A;  2KYH A;  1EKY A;  5E33 A;  4YL1 A;  1B68 A;  4AE4 A;  3PHF 2;  4MVR A;  1AEP A;  3LNM B;  2C03 A;  2Q9C A;  4KC9 A;  1KNY A;  1ZZP A;  3EFO A;  4CBE A;  1E84 A;  1G8X A;  2L9J A;  5DS4 A;  3CSK A;  3NYM A;  2R7S A;  2Q00 A;  3HLZ A;  1QKR A;  4N4W A;  3F47 A;  2LCH A;  3WOD F;  2OJQ A;  5DQZ A;  4CS8 A;  3DI5 A;  2IXM A;  1MMA A;  2NSF A;  3RIP A;  3C7J A;  4P6I C;  1U0B B;  4DOZ A;  5COF A;  5A6B A;  1R4T A;  4PFO A;  2O9X A;  4E18 A;  2KW3 C;  3OEO A;  1VYK A;  3DAG A;  3HTK C;  4LDK A;  4CIH A;  5GPG B;  2OKU A;  2MYS A;  1ORS C;  2Q3T A;  4MQ9 F;  3ZTZ A;  4XLN F;  2LK4 A;  2P6V A;  3HNL A;  1RMV A;  4P9T A;  3UNG C;  1U6H A;  3K7D A;  2XLE A;  3HNI A;  3MFN A;  3DJU B;  5DQT A;  1FTS A;  2J7P D;  2ZD9 A;  2IYL D;  4YL3 A;  2Q4F A;  1JR8 A;  1OCZ C;  3HKK A;  5KYY A;  2CGE A;  3W4Y A;  3L34 A;  1VLS A;  4MTG A;  1E83 A;  3MYF A;  2WVQ A;  4C3D A;  5E3A A;  3SNH A;  3I5P A;  1VTM P;  5CI9 A;  3HJC A;  1TKN A;  3E9V A;  1GS9 A;  1WN0 A;  4XEF A;  5E2Q A;  3TJ6 A;  3U9M A;  1FNT c;  2HV6 A;  1QQ3 A;  2KSF A;  3K33 A;  4LLE A;  4CS9 A;  1Z6A A;  1XWJ A;  3SXZ A;  1Q0F A;  1VOM A;  3B9Q A;  5JT4 A;  3S29 A;  3TUL A;  3EG9 A;  1EQ1 A;  1HE1 A;  1SMY F;  2XLO A;  4XPX A;  5A6A A;  4D4N A;  1H7I A;  3OA1 A;  2WZG A;  1CGN A;  1VYI A;  2B0J A;  2NG1 A;  4EUK B;  3LEO A;  4IAQ A;  3V5X A;  4AL0 A;  2KJG A;  2XXA B;  4I3M A;  4JUR I;  3JYY A;  4IAO A;  3C8G B;  4CDA A;  2UUH A;  3FMS A;  4LER A;  5CI8 A;  5E3C A;  1RKE A;  3ASN C;  4K0D A;  1SZI A;  4BJT A;  4ULV A;  1QZX A;  2GDC A;  4PAC A;  4U5D E;  2Y39 A;  2IXO A;  2ZXP A;  4QDL A;  5L3Q A;  1ZHX A;  4PK4 A;  1PD0 A;  1M6T A;  3RVZ A;  5L0C A;  1KTM A;  2ZXR A;  1ORJ A;  1ZU4 A;  2VCA A;  5JVE A;  4F4B A;  1M2O A;  1MND A;  4G0H A;  1BR2 A;  2A0U A;  2A68 F;  4FAP B;  2OOC A;  4GEH A;  3KPH A;  2R02 A;  3ZC4 A;  3EHM A;  3U9J A;  2Q9A A;  2PF4 E;  3CAX A;  3ABL C;  3O39 A;  1FMV A;  1T6U A;  3U3B A;  1J8Y F;  1YYJ A;  3LS1 A;  3GWL A;  1Z3I X;  2H7O A;  2JD3 A;  3H65 A;  4ONS A;  3KYJ A;  4YN0 B;  3V5Y A;  2HMZ A;  3JSE O;  4E7Z A;  1A0B A;  3US6 A;  3ITF A;  3EZH A;  4ER9 A;  3TOM A;  5COG A;  5T3T A;  1TWC A;  4MVO A;  3GOD A;  5DS6 A;  4I1O B;  2DYR C;  4BJ5 C;  4J7Y A;  4YWQ A;  2YKZ A;  3C8Z A;  3TJ5 A;  4U5E E;  3RQG A;  2NSG A;  3NMK A;  4GQH A;  3Q6M A;  4UDV A;  4C7O A;  1L3P A;  3LJB A;  2Y3B A;  2YL0 A;  3ZQY A;  1APC A;  4P9F A;  3POV A;  2H7V C;  2L6F A;  3OWT A;  3DD7 A;  3C62 A;  4I44 A;  4PJL A;  4PJN A;  4A2N B;  3FOP A;  1D0Z A;  3FDQ A;  2IOQ A;  2XLV A;  3SYN A;  1W2W A;  1BR1 A;  3L1M A;  3EGX A;  5JUA A;  1I4Z A;  4DBR A;  2JX0 A;  1MNE A;  4YK5 A;  1M56 C;  3JSZ A;  1H6G A;  1ZHY A;  5B3S C;  3ZTM A;  4JVS A;  4JW1 A;  5DLJ A;  4U9E A;  4C3E A;  5AC5 A;  3G4X A;  4YT5 A;  4B6I A;  4WGY A;  4MVS A;  2W9Y A;  3V5Z A;  2YQY A;  1HMO A;  5KYW B;  3GWN A;  3O55 A;  4BPM A;  1WWP A;  3AGU A;  2ICW G;  2XS8 A;  3Q7G A;  2A1D D;  2C04 A;  2AWY A;  1LS4 A;  2L6H A;  2XLD A;  4BG0 A;  2HUJ A;  2P1A A;  2DB4 A;  3KH2 A;  1M57 C;  1T5O A;  1PD1 A;  2YWA A;  5IY5 C;  3QZC A;  3NYL A;  4O7G A;  4CS8 C;  4EBJ A;  1BR4 A;  3FAJ A;  2KQ9 A;  3FHD A;  2L81 A;  1TFK B;  2NUT B;  1OKK A;  3U0C A;  2HJM A;  2Z15 A;  4IB4 A;  4BJ6 A;  4E17 A;  1Z63 A;  4MTF A;  4XEV A;  1BZ4 A;  3B29 A;  4YT2 A;  1OXB A;  2EIK C;  3ZVR A;  2EPN A;  2EIN C;  3NKD A;  3RQF A;  2XL6 A;  1A7E A;  1G5Z A;  3DJN B;  4M63 A;  2NPU A; 
#chains in the Genus database with same CATH homology
 3HNJ A;  4CX9 A;  2YLI A;  2YL3 A;  2XM4 A;  1BBH A;  1S05 A;  1E83 A;  3IQ5 A;  1QQ3 A;  2J8W A;  1YYX A;  3M4C A;  4WGZ A;  5JT4 A;  4EIY A;  1NBB A;  2XLO A;  4D4N A;  1CGN A;  1LM3 B;  4IAQ A;  4U9D A;  4CDA A;  3M79 A;  5JP7 A;  4IAR A;  3VRC A;  1RCP A;  3NMJ A;  2BC5 A;  4ULV A;  3QVY A;  3M4B A;  4N6H A;  5JRA A;  3QW1 A;  1E86 A;  2CCY A;  1M6T A;  4CIP A;  4NC3 A;  4CDY A;  5JVE A;  3HNK A;  3FOO A;  2YL7 A;  3TOL A;  5JLI A;  2XLM A;  1GQA A;  3QW0 A;  5JS5 A;  2XLH A;  4JE9 A;  2YLG A;  1YYJ A;  2XM0 A;  4JEA A;  3IQ6 A;  1CGO A;  4ER9 A;  3TOM A;  2YL1 A;  2XL8 A;  4D4X A;  3QVZ A;  2J9B A;  1YZC A;  2YKZ A;  4JEB A;  3NMK A;  2YL0 A;  3ZQV A;  3ZQY A;  4CJG A;  1CPR A;  1APC A;  2YLD A;  256B A;  3U8P A;  5AGF A;  3C62 A;  1E85 A;  4CJO A;  3DE8 A;  5B3I A;  1MQV A;  1YZA A;  3FOP A;  2QLA A;  2XLV A;  1JAF A;  3L1M A;  3ZWI A;  5JUA A;  3NMI A;  1EKY A;  3ZTM A;  4U9E A;  3C63 A;  1E84 A;  4WGY A;  3M15 A;  4N4W A;  1CPQ A;  2XLD A;  1A7V A;  4JKV A;  3DE9 A;  1QPU A;  5JSL A;  4IB4 A;  3ZTZ A;  2XLW A;  3HNL A;  4CDV A;  2XL6 A;  2XLE A;  3HNI A;  4L6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...