1CGOA

Cytochrome c'
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
125
structure length
125
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLTALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of cytochrome c' from two Alcaligenes species and the implications for four-helix bundle structures.
pubmed doi rcsb
source organism Alcaligenes sp.
molecule tags Electron transport (cytochrome)
molecule keywords CYTOCHROME C
total genus 48
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 1995-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1cgoA00
5JP7A 3FOPA 3FOOA 4CX9A 4CIPA 4CDVA 4L6RA 1E86A 2J8WA 4ULVA 1S05A 3ZTZA 4IB4A 4WGZA 3QW0A 4JE9A 4ER9A 1JAFA 3HNJA 4IARA 3HNLA 1YYXA 3NMIA 1E83A 2YL3A 3QVZA 3U8PA 2QLAA 3L1MA 3DE8A 2XLHA 2YLGA 1NBBA 3C62A 5AGFA 1CGOA 4N6HA 2XM4A 1QQ3A 2XLWA 3M79A 3QW1A 5JRAA 4CJOA 4JKVA 3M15A 2YLDA 2BC5A 3IQ6A 1MQVA 3DE9A 5JVEA 4EIYA 2YL0A 1YZAA 5JSLA 3IQ5A 2XL6A 1YZCA 1LM3B 3TOLA 2YL1A 3QVYA 1CPRA 5JLIA 3ZWIA 4U9DA 2XM0A 4JEAA 4NC3A 5JS5A 1E84A 4U9EA 3HNIA 1GQAA 3ZTMA 3NMKA 2XLMA 3ZQYA 256BA 4D4NA 2YLIA 4IAQA 5JUAA 3ZQVA 3C63A 4WGYA 2XL8A 3TOMA 1E85A 1QPUA 2XLEA 3M4CA 4CDAA 5B3IA 2J9BA 4JEBA 1A7VA 4N4WA 1EKYA 2CCYA 1APCA 4CJGA 2YL7A 3VRCA 2YKZA 3M4BA 1CGNA 1BBHA 1M6TA 4D4XA 2XLVA 2XLOA 2XLDA 3NMJA 3HNKA 5JT4A 1CPQA 1RCPA 1YYJA 4CDYA
chains in the Genus database with same CATH superfamily
2EPMX 5CIVA 2GFHA 3GM2A 3UGPA 5JP7A 3RW0A 3LS0A 4LDKA 1FNTc 2EIKC 3FOOA 4CX9A 4LDQA 2XS8A 4DRHB 1JR8A 1OW8A 4CS9A 4CIPA 2C04A 2NUTB 3TJ5A 1TWCA 3K1IA 4NY3A 1FFHA 1OXKA 2A0UA 4PJLA 4PR9A 3WODF 4Q4ZF 2D5RB 4BEJA 2P6VA 2Y3DA 3C7JA 4OINF 2X51A 5COFA 2ETSA 1OR3A 2I8BA 2P1AA 2HUJA 5KYWA 3OA1A 1DOVA 3KH2A 1OCCC 2OJQA 5B3SC 1JMWA 2XXAB 4KBLA 5A6KA 3GORA 1VYIA 3JRTA 4H54A 3E70C 3HNJA 1HE9A 3RYLA 1VMAA 3K1IC 1RXQA 3KMIA 4R32A 1E83A 2YL3A 1ZHZA 3GWNA 1OQCA 1OW7A 4YL1A 2HS5A 5DQTA 1KU2A 1VK5A 2Y3GA 4AE4B 1OR2A 4XEKA 3RQGA 3U2LA 1UG7A 4MVUA 1OKKD 3L1MA 1I4YA 1RJ9A 3ABLC 3N2ZB 4X0RA 3I4UA 3IEEA 3G50A 1QLEC 3NYMA 3AQCA 1RMVA 1G5ZA 3DWWA 1CGOA 3EGDA 2FAPB 2R02A 3U2MA 2R7SA 4IJJA 5KYXB 3LNRA 1T6UA 3U3BA 1D1AA 3NG1A 2XLWA 3RF3A 1D0YA 3GODA 4N6CA 1TR2A 4CJOA 3FAJA 4QDLA 3M15A 3CAXA 5EK0A 1E2XA 3EFOA 1EI7A 1QKRA 1VOMA 1Z5ZA 3CZ6A 3IQ6A 4JW1A 4U5EE 5JVEA 4E0IA 2L9JA 1MMAA 1H7IA 1QZXA 1RJ9B 2MYSA 2WZFA 3DMDA 3GM1A 1YZAA 2IXMA 5F28E 3JTLO 5JSLA 2IYLD 3R7CA 3ZC4A 3ZSUA 4EWCA 3B0UX 1F1MA 1T5OA 1V4AA 2L7AA 1NFNA 2L6FA 2AWCA 2YL1A 3QVYA 2H8AA 3AG2C 3MX3A 3FHDA 3UMIA 1BZ4A 5D91A 1VYKA 3C8GD 1LI5A 4JEAA 1E84A 2WVQA 2J7PD 4CSAC 1XZPA 1SR2A 3HNIA 4U5DE 2Z15A 3O10A 4FWVA 3RIPA 1GQAA 4P6IC 1TWAA 2Q9CA 4NQFA 4DVZA 4MTGA 4RBNA 5K0IA 5HSWA 2RD9A 256BA 4QI2A 5FCLA 4I44A 2OKUA 1EA8A 5TJ5E 4E7ZA 1GS9A 3K66A 1O87A 3UMHA 1ST6A 3TOMA 1BR2A 4XEVA 2GDCA 5L0CA 1OKKA 4WJ0A 5D92A 4CSAA 4BJ5C 2DB4A 2J9BA 1D1BA 2E87A 2J9VA 2Y39A 3FXHA 2WZGA 3L0IA 3LEVA 4J32B 4U5HA 1RKCA 4U5GA 2WL8A 4BEMJ 1ORYA 3VM6A 1JOGA 4PJNA 2R7VA 1ZU4A 2HKVA 2CCYA 4Q7CA 1EKYA 2G3KA 2MHRA 1T9KA 1KTMA 3T9OA 3RKOF 2YL7A 1D0XA 4MTFA 4XWJA 4DXWA 4MW3A 4BJ6A 2EINC 1IZMA 1IW7F 1D0ZA 3GWLA 5BQIA 1ZHTA 1LE2A 2QNLA 1YLMA 2CNWA 4EBBA 3W8HA 5L3VA 1T01A 1OCRC 1U6HA 1WWPA 1Q0GA 1ZZPA 4XPYA 2IM8A 2OEXA 5T1DB 3W2VA 5A6BD 1PCXA 2J46A 5JT4A 4XPXA 3A11A 3B0PA 4IWBA 3EGXA 1Z3IX 2W9YA 1VB5A 3PMRA 4G0HA 4C3BA 5IY5C 1XZQA 2W45A 1L3PA 2WVNA 3NKDA 5KYXA 3IQCA 1HW2A 4LDRA 1ZHYA 1I4ZA 5FZTA 4CDVA 1Y4CA 3EQLF 5DS4A 1HY5A 1ORJA 3LS1A 5L0DA 3ZDLA 4CS8C 1H6GA 2KJGA 3SNHA 4G78A 1A0BA 2QE9A 1TWGA 4CS7A 4DOZA 2AU5A 2Q9BA 3T6JA 4O7GA 3U9MA 3SEOA 1OW6A 1JPNA 4K1OA 2OOCA 3KL4A 4MVZA 3LLKA 3EZIA 3KYJA 3H65A 3N24A 2HV6A 4NCQA 3S84A 1WTYA 4XPWA 2AP3A 4BG0A 2NG1A 1WGWA 3UNGC 3X1OA 1K40A 1YYXA 2P7VA 4G7OF 1AUEA 4CIHA 4U5BE 1ZHWA 2KYHA 3C8GB 2EPKX 1M2VB 3QVZA 4FX5A 2QLAA 2A0BA 3S29A 3U8PA 2VCBA 3EG9B 3Q7GA 2CW0F 3B71A 3H2VA 4MVOA 2WB7A 1MMNA 1VLSA 5GPGB 4JIOA 4MS2A 4J30B 5KYYB 3U8VA 2R7RA 1Y6DA 2KK1A 1ZYRF 1C02A 3DE8A 4PFPA 1V74B 1CGME 3C62A 2EIMC 4IAOA 4U5CE 1DOWA 2OG2A 3EHNA 1NU7D 4N06A 3Q6MA 1LPEA 3H2UA 4JJGA 2IXNA 4K7BA 5E33A 3AG1C 1M2OA 1U89A 3ABMC 4AL0A 2FGYA 1QQ3A 2KGOA 1H9TA 2R7TA 1K05A 3AGTA 1SF8A 1J8MF 2CDQA 2CYDA 5B1AC 4PJJA 2YLDA 3OEOA 4C3EA 1O5HA 3CSKA 2DYSC 4H4KC 2D4UA 1YARO 2V26A 3IHUA 3QMKA 3UMKA 3FDQA 1YZCA 1OCOC 3FMSA 1KNYA 1LM3B 3TOLA 1JPJA 3L8JA 4I1OB 4U9DA 1NSGB 4YT8A 4MVSA 3EPVA 5COGA 4MQ9F 5BUOA 5CI8A 4AL1A 4NC3A 5JS5A 2J0XA 1TFOB 4Z9JA 1A7DA 3EZHA 3U5SA 4DVYP 3AOUA 4C7OA 5L0JA 2G62A 2HFIA 2J9WA 1PD0A 4HEAJ 2CNWD 2UUIA 1FFTC 3JZ0A 4K0DA 4EBKA 3W4YA 1GM5A 2EPNA 2KC3A 1YA9A 4AE4A 5JUAA 3GM3A 3C8GA 4OIOF 3C63A 4WGYA 1WATA 3HKKA 1E85A 2NUPA 5A6BA 4I1MA 2XLEA 3I5PA 3W2WA 4CDAA 4UDVA 3IPMO 3O55A 5T3WA 1LS4A 2QTVA 4E17A 2A6HF 1YA7O 2JX0A 3ASOC 1A7VA 2JPUA 1MMDA 4MTOA 3F47A 5E3CA 3SP1A 3AQBA 1YDIA 3Q6NA 5B1BC 1TWHA 1APCA 3HTKC 4CJGA 2LFFA 1NZEA 3MFNA 4GEHA 3N0TA 3OWTA 3JCUQ 3G4ZA 2HSBA 2KNHA 1PV3A 2YQYA 1OCZC 4HFKB 1NLXA 1WN0A 2Q00A 3TD7A 2Q9AA 1G4US 2I15A 2XLVA 2XLOA 3DM9B 2XLDA 3ECSA 3NYLA 4O6NA 1SMYF 5DS5A 3GANA 3SXKA 3EH1A 3SXMA 1GGQA 2AVKA 3Q7LA 3J06A 4YWQA 1HW1A 4IGGA 4YL3A 3LESA 3WHNA 1H9GA 1FMVA 3FOPA 2ZXOA 2UUHA 1UFBA 4XEFA 4YT5A 1BR1A 2Q4FA 5CI9A 3MYFA 2B0HA 3EG9A 4KC9A 4L6RA 3T6BA 3US6A 3DI5A 5AC4A 3MBGA 1ZHXA 4O79A 2HJMA 2R7UA 4ONSA 3V5ZA 2J8WA 3G4XA 3GEEA 3HJCA 4ULVA 1WOLA 3ZTZA 5L0GA 1R4TA 2LCHA 2Q3TA 2PNOA 3S27A 4WGZA 2Y69C 3QW0A 2KQ9A 2VCCA 3HLZA 1FAPB 5T3TA 2W4MA 4O6YA 3B29A 3ZVRA 4FAPB 1SYQA 4IARA 3K7DA 5A6JA 2Q7RA 3JSZA 3L34A 2L81A 3NYJA 3UR3C 1A7EA 4BPMA 2P61A 4ZLCA 2KSFA 2EPOA 2HJ3A 4XLPF 3PDMP 1Q0FA 1ZU5A 2XSEA 2IXOA 3W8IA 4BJ6C 1NG1A 1PD1A 1M56C 1V54C 3BRJA 4J7YA 3U3FA 1TFKB 1YJGA 2VCAA 3ZIBA 3LLIA 2R05A 1K04A 4XQ1A 3KYIA 4YT4A 1MNEA 2XLHA 4E0HA 5EHHA 5L3QA 1NBBA 1B68A 3JRMO 4E18A 3RFYA 2LQGA 1M57C 1G8XA 2CGEA 2ZXRA 4NTBA 2HSQA 4CS9C 2DGJA 2O9XA 2XM4A 4JTDB 2GAQA 2NSFA 3V5YA 2YZSA 1RKEA 1LKXA 2A69F 3B9QA 1NU9C 1V55C 3QW1A 5JRAA 1RKEB 4JTAB 5DVWA 4DRJB 4RD9A 1I5NA 3JYYA 3EFOB 2ASRA 1HMDA 3IQTA 2YEVA 2NUPB 1T6IA 4M63A 4PACA 4AX2A 2ZD9A 5KYYA 3AGUA 2XL6A 3MYIA 2Y3HA 2XL4A 4YT2A 3EGDB 3SXZA 4OIPF 4DBQA 2HMZA 5JLIA 3NRHA 3SZRA 3ZWIA 3O6XA 4W8PA 4DJ9A 3KKBA 3ASNC 2YHSA 3KPHA 5DLJA 3DXJF 4U9EA 3TJ6A 1AEPA 1M2VA 2LIGA 2HZ8A 3FAPB 5DS6A 1FMWA 3EHMA 4KI2A 4JC7A 2YVKA 2LSEA 3V5XA 2EIJC 3NMKA 4G7HF 2XLMA 2VH3A 4E7SA 4PJMA 4D4NA 2VB6A 2YLIA 4CS8A 4IAQA 2YRFA 1O3UA 1LVKA 4BJTA 4OD5A 3RQFA 1ORSC 2XL8A 2R25A 4MVMA 1S7ZA 2HMQA 3RQEA 2M4EA 5KYWB 3JSEO 1QPUA 2IBFA 1QVXA 2LFDA 3DM5A 3M4CA 4ULWA 1D1CA 4JCZA 1C03A 2LK4A 5B3IA 2XXAA 2J9UA 4JEBA 5L0FA 5DQZA 3O39A 4BJ1A 1QSPA 4JJFA 3S0XA 1U0BB 5COMA 1BDJB 1R5ID 1TQGA 2A1DD 4HE8D 1LIHA 4NTFA 2R7OA 3LEOA 1AVOB 3U9JA 3QZCA 4KNVA 1CGNA 1BBHA 2IXPA 4D4XA 2OEVA 3DJUB 3LAYA 3SYNA 5EGYA 3T6GB 2M64A 1Q0DA 2WZLA 4DBRA 5HV9A 1J8YF 1TKNA 1XWJA 2MWQA 2VC9A 3NMJA 2R9RB 2H7OA 2R7XA 4MNDA 2ZXWC 3AG4C 1RCPA 3DZAA 1MNDA 1YYJA 2J45A 2JD3A 4LLEA 4AK9A 1HE1A 4Z9IA 3AG3C 2ZXPA 5L0IA 3C8ZA 3UGOA 1Z6AA 4NTAA 1C17M 2VASA 3ITFA 3QTHA 5KYUB 4P9TA 2QY9A 2IOQA 2BL2A 2H7BA 1E86A 3NDBB 1FR0A 5F5HA 5BQHA 4JZAA 5E2QA 1S05A 4LERA 2RSEB 4QI0A 5A6AA 2B0JA 4BJ5A 4PFOA 4P9FA 4C3DA 4IB4A 4RDAA 1JRAA 4O6MA 3X2QC 4U5FE 3F46A 1ZVZA 3POVA 3GEIA 5F5FA 5L0HA 2EPLX 4JE9A 4DRIB 4ER9A 1JAFA 2J0WA 2PX0A 3DKAA 3JT1A 1WASA 2ICWG 3HNLA 4Z9HA 2H7VC 3A9CA 4MW8A 1VLTA 3DAGA 2V3CC 3NMIA 2NSGA 3GEHA 3C18A 2C03A 3MLGA 3S90A 4OIQF 3FVYA 2OU6A 3TULA 1VTMP 4LACB 3K6BA 3K1HA 3LUTB 4PK4A 1ZW3A 3I5QA 2PX3A 3K33A 1L7CA 4Q5SF 4HFFB 4MVRA 4A4AA 4JVSA 3CQZA 2YWAA 3ABKC 4EKWA 1OXBA 2YLGA 4YK5A 5AC5A 4I3MA 5AGFA 4ANJA 3ATPA 4JURI 4N6HA 1G4WR 2PP4A 4F4BA 2LP4A 1BR4A 2A6EF 2NUTA 3VF0A 3M79A 1Z63A 2BE5F 4OIRF 2OJED 2W4BA 4JKVA 4JTCB 3PHF2 2BC5A 2A68F 2WVOA 3EJNA 3B0VC 1T6QA 1MQVA 3DE9A 4W8KA 1W2WA 4EIYA 4MVQA 5KYNA 4OD4A 2YL0A 2PBEA 1N1CA 3E9VA 2P0NA 1FTSA 3IQ5A 3JYHA 2NPUA 1HMOA 2L6GA 4GYTA 3DAFA 3VAYA 3WG7C 3NKEA 3PCVA 1CPRA 4CBEA 4YJWA 2PFDA 1Q0MA 2J7PA 2XRHA 1LE4A 3TQOA 4KNWA 2XM0A 1Z7Qc 2R7QA 4FESA 2AWYA 2FFHA 4XLNF 2QUPA 3RH3A 2XS1A 2G3VA 3S28A 3SXYA 3DD7A 4EBJA 3ZTMA 2Y3BA 3R2PA 4A2NB 4IRUA 4ZLDA 4GQHA 2KW3C 3ZQYA 2DYRC 4LLCA 2X0CA 2F22A 3RVZA 3WAQA 3ZG1A 4YL0A 3DJNB 4YN0B 5E3AA 2ZPAA 3ZQVA 3AJMA 1NFOA 4WABA 1LI7A 2OCCC 2LD6A 1LS1A 2DI3A 3VYWA 5BQGA 3EGXB 4C7OB 3L8IA 3M1CB 4B6IA 2EILC 2OQMA 1Z23A 4N4WA 1MMGA 4EUKB 2GWWA 2TMVP 4CDYA 5KYUA 3S9OA 4JRZA 1A41A 2GA0A 3VRCA 3LJBA 2YKZA 3M4BA 3TK0A 1Q0KA 2L6HA 3V7OA 1M6TA 4XTKA 4J7TA 3RVYA 3T4RA 2R03A 3CEXA 3LNMB 3U0CA 1YVIA 4JCHA 1ZW2A 1SZIA 2R7WA 1YAUO 2HV7A 3BEHA 3HNKA 2PF4E 4EHPA 4G7ZF 1CPQA 1EQ1A 3EH2A 5A69A
chains in the Genus database with same CATH topology
5JP7A 3FOPA 3FOOA 4CX9A 4CIPA 4CDVA 4L6RA 1E86A 2J8WA 4ULVA 1S05A 3ZTZA 4IB4A 4WGZA 3QW0A 4JE9A 4ER9A 1JAFA 3HNJA 4IARA 3HNLA 1YYXA 3NMIA 1E83A 2YL3A 3QVZA 3U8PA 2QLAA 3L1MA 3DE8A 2XLHA 2YLGA 1NBBA 3C62A 5AGFA 1CGOA 4N6HA 2XM4A 1QQ3A 2XLWA 3M79A 3QW1A 5JRAA 4CJOA 4JKVA 3M15A 2YLDA 2BC5A 3IQ6A 1MQVA 3DE9A 5JVEA 4EIYA 2YL0A 1YZAA 5JSLA 3IQ5A 2XL6A 1YZCA 1LM3B 3TOLA 2YL1A 3QVYA 1CPRA 5JLIA 3ZWIA 4U9DA 2XM0A 4JEAA 4NC3A 5JS5A 1E84A 4U9EA 3HNIA 1GQAA 3ZTMA 3NMKA 2XLMA 3ZQYA 256BA 4D4NA 2YLIA 4IAQA 5JUAA 3ZQVA 3C63A 4WGYA 2XL8A 3TOMA 1E85A 1QPUA 2XLEA 3M4CA 4CDAA 5B3IA 2J9BA 4JEBA 1A7VA 4N4WA 1EKYA 2CCYA 1APCA 4CJGA 2YL7A 3VRCA 2YKZA 3M4BA 1CGNA 1BBHA 1M6TA 4D4XA 2XLVA 2XLOA 2XLDA 3NMJA 3HNKA 5JT4A 1CPQA 1RCPA 1YYJA 4CDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JP7 A;  3FOP A;  3FOO A;  4CX9 A;  4CIP A;  4CDV A;  4L6R A;  1E86 A;  2J8W A;  4ULV A;  1S05 A;  3ZTZ A;  4IB4 A;  4WGZ A;  3QW0 A;  4JE9 A;  4ER9 A;  1JAF A;  3HNJ A;  4IAR A;  3HNL A;  1YYX A;  3NMI A;  1E83 A;  2YL3 A;  3QVZ A;  3U8P A;  2QLA A;  3L1M A;  3DE8 A;  2XLH A;  2YLG A;  1NBB A;  3C62 A;  5AGF A;  1CGO A;  4N6H A;  2XM4 A;  1QQ3 A;  2XLW A;  3M79 A;  3QW1 A;  5JRA A;  4CJO A;  4JKV A;  3M15 A;  2YLD A;  2BC5 A;  3IQ6 A;  1MQV A;  3DE9 A;  5JVE A;  4EIY A;  2YL0 A;  1YZA A;  5JSL A;  3IQ5 A;  2XL6 A;  1YZC A;  1LM3 B;  3TOL A;  2YL1 A;  3QVY A;  1CPR A;  5JLI A;  3ZWI A;  4U9D A;  2XM0 A;  4JEA A;  4NC3 A;  5JS5 A;  1E84 A;  4U9E A;  3HNI A;  1GQA A;  3ZTM A;  3NMK A;  2XLM A;  3ZQY A;  256B A;  4D4N A;  2YLI A;  4IAQ A;  5JUA A;  3ZQV A;  3C63 A;  4WGY A;  2XL8 A;  3TOM A;  1E85 A;  1QPU A;  2XLE A;  3M4C A;  4CDA A;  5B3I A;  2J9B A;  4JEB A;  1A7V A;  4N4W A;  1EKY A;  2CCY A;  1APC A;  4CJG A;  2YL7 A;  3VRC A;  2YKZ A;  3M4B A;  1CGN A;  1BBH A;  1M6T A;  4D4X A;  2XLV A;  2XLO A;  2XLD A;  3NMJ A;  3HNK A;  5JT4 A;  1CPQ A;  1RCP A;  1YYJ A;  4CDY A; 
#chains in the Genus database with same CATH topology
 2EPM X;  5CIV A;  2GFH A;  3GM2 A;  3UGP A;  5JP7 A;  3RW0 A;  3LS0 A;  4LDK A;  1FNT c;  2EIK C;  3FOO A;  4CX9 A;  4LDQ A;  2XS8 A;  4DRH B;  1JR8 A;  1OW8 A;  4CS9 A;  4CIP A;  2C04 A;  2NUT B;  3TJ5 A;  1TWC A;  3K1I A;  4NY3 A;  1FFH A;  1OXK A;  2A0U A;  4PJL A;  4PR9 A;  3WOD F;  4Q4Z F;  2D5R B;  4BEJ A;  2P6V A;  2Y3D A;  3C7J A;  4OIN F;  2X51 A;  5COF A;  2ETS A;  1OR3 A;  2I8B A;  2P1A A;  2HUJ A;  5KYW A;  3OA1 A;  1DOV A;  3KH2 A;  1OCC C;  2OJQ A;  5B3S C;  1JMW A;  2XXA B;  4KBL A;  5A6K A;  3GOR A;  1VYI A;  3JRT A;  4H54 A;  3E70 C;  3HNJ A;  1HE9 A;  3RYL A;  1VMA A;  3K1I C;  1RXQ A;  3KMI A;  4R32 A;  1E83 A;  2YL3 A;  1ZHZ A;  3GWN A;  1OQC A;  1OW7 A;  4YL1 A;  2HS5 A;  5DQT A;  1KU2 A;  1VK5 A;  2Y3G A;  4AE4 B;  1OR2 A;  4XEK A;  3RQG A;  3U2L A;  1UG7 A;  4MVU A;  1OKK D;  3L1M A;  1I4Y A;  1RJ9 A;  3ABL C;  3N2Z B;  4X0R A;  3I4U A;  3IEE A;  3G50 A;  1QLE C;  3NYM A;  3AQC A;  1RMV A;  1G5Z A;  3DWW A;  1CGO A;  3EGD A;  2FAP B;  2R02 A;  3U2M A;  2R7S A;  4IJJ A;  5KYX B;  3LNR A;  1T6U A;  3U3B A;  1D1A A;  3NG1 A;  2XLW A;  3RF3 A;  1D0Y A;  3GOD A;  4N6C A;  1TR2 A;  4CJO A;  3FAJ A;  4QDL A;  3M15 A;  3CAX A;  5EK0 A;  1E2X A;  3EFO A;  1EI7 A;  1QKR A;  1VOM A;  1Z5Z A;  3CZ6 A;  3IQ6 A;  4JW1 A;  4U5E E;  5JVE A;  4E0I A;  2L9J A;  1MMA A;  1H7I A;  1QZX A;  1RJ9 B;  2MYS A;  2WZF A;  3DMD A;  3GM1 A;  1YZA A;  2IXM A;  5F28 E;  3JTL O;  5JSL A;  2IYL D;  3R7C A;  3ZC4 A;  3ZSU A;  4EWC A;  3B0U X;  1F1M A;  1T5O A;  1V4A A;  2L7A A;  1NFN A;  2L6F A;  2AWC A;  2YL1 A;  3QVY A;  2H8A A;  3AG2 C;  3MX3 A;  3FHD A;  3UMI A;  1BZ4 A;  5D91 A;  1VYK A;  3C8G D;  1LI5 A;  4JEA A;  1E84 A;  2WVQ A;  2J7P D;  4CSA C;  1XZP A;  1SR2 A;  3HNI A;  4U5D E;  2Z15 A;  3O10 A;  4FWV A;  3RIP A;  1GQA A;  4P6I C;  1TWA A;  2Q9C A;  4NQF A;  4DVZ A;  4MTG A;  4RBN A;  5K0I A;  5HSW A;  2RD9 A;  256B A;  4QI2 A;  5FCL A;  4I44 A;  2OKU A;  1EA8 A;  5TJ5 E;  4E7Z A;  1GS9 A;  3K66 A;  1O87 A;  3UMH A;  1ST6 A;  3TOM A;  1BR2 A;  4XEV A;  2GDC A;  5L0C A;  1OKK A;  4WJ0 A;  5D92 A;  4CSA A;  4BJ5 C;  2DB4 A;  2J9B A;  1D1B A;  2E87 A;  2J9V A;  2Y39 A;  3FXH A;  2WZG A;  3L0I A;  3LEV A;  4J32 B;  4U5H A;  1RKC A;  4U5G A;  2WL8 A;  4BEM J;  1ORY A;  3VM6 A;  1JOG A;  4PJN A;  2R7V A;  1ZU4 A;  2HKV A;  2CCY A;  4Q7C A;  1EKY A;  2G3K A;  2MHR A;  1T9K A;  1KTM A;  3T9O A;  3RKO F;  2YL7 A;  1D0X A;  4MTF A;  4XWJ A;  4DXW A;  4MW3 A;  4BJ6 A;  2EIN C;  1IZM A;  1IW7 F;  1D0Z A;  3GWL A;  5BQI A;  1ZHT A;  1LE2 A;  2QNL A;  1YLM A;  2CNW A;  4EBB A;  3W8H A;  5L3V A;  1T01 A;  1OCR C;  1U6H A;  1WWP A;  1Q0G A;  1ZZP A;  4XPY A;  2IM8 A;  2OEX A;  5T1D B;  3W2V A;  5A6B D;  1PCX A;  2J46 A;  5JT4 A;  4XPX A;  3A11 A;  3B0P A;  4IWB A;  3EGX A;  1Z3I X;  2W9Y A;  1VB5 A;  3PMR A;  4G0H A;  4C3B A;  5IY5 C;  1XZQ A;  2W45 A;  1L3P A;  2WVN A;  3NKD A;  5KYX A;  3IQC A;  1HW2 A;  4LDR A;  1ZHY A;  1I4Z A;  5FZT A;  4CDV A;  1Y4C A;  3EQL F;  5DS4 A;  1HY5 A;  1ORJ A;  3LS1 A;  5L0D A;  3ZDL A;  4CS8 C;  1H6G A;  2KJG A;  3SNH A;  4G78 A;  1A0B A;  2QE9 A;  1TWG A;  4CS7 A;  4DOZ A;  2AU5 A;  2Q9B A;  3T6J A;  4O7G A;  3U9M A;  3SEO A;  1OW6 A;  1JPN A;  4K1O A;  2OOC A;  3KL4 A;  4MVZ A;  3LLK A;  3EZI A;  3KYJ A;  3H65 A;  3N24 A;  2HV6 A;  4NCQ A;  3S84 A;  1WTY A;  4XPW A;  2AP3 A;  4BG0 A;  2NG1 A;  1WGW A;  3UNG C;  3X1O A;  1K40 A;  1YYX A;  2P7V A;  4G7O F;  1AUE A;  4CIH A;  4U5B E;  1ZHW A;  2KYH A;  3C8G B;  2EPK X;  1M2V B;  3QVZ A;  4FX5 A;  2QLA A;  2A0B A;  3S29 A;  3U8P A;  2VCB A;  3EG9 B;  3Q7G A;  2CW0 F;  3B71 A;  3H2V A;  4MVO A;  2WB7 A;  1MMN A;  1VLS A;  5GPG B;  4JIO A;  4MS2 A;  4J30 B;  5KYY B;  3U8V A;  2R7R A;  1Y6D A;  2KK1 A;  1ZYR F;  1C02 A;  3DE8 A;  4PFP A;  1V74 B;  1CGM E;  3C62 A;  2EIM C;  4IAO A;  4U5C E;  1DOW A;  2OG2 A;  3EHN A;  1NU7 D;  4N06 A;  3Q6M A;  1LPE A;  3H2U A;  4JJG A;  2IXN A;  4K7B A;  5E33 A;  3AG1 C;  1M2O A;  1U89 A;  3ABM C;  4AL0 A;  2FGY A;  1QQ3 A;  2KGO A;  1H9T A;  2R7T A;  1K05 A;  3AGT A;  1SF8 A;  1J8M F;  2CDQ A;  2CYD A;  5B1A C;  4PJJ A;  2YLD A;  3OEO A;  4C3E A;  1O5H A;  3CSK A;  2DYS C;  4H4K C;  2D4U A;  1YAR O;  2V26 A;  3IHU A;  3QMK A;  3UMK A;  3FDQ A;  1YZC A;  1OCO C;  3FMS A;  1KNY A;  1LM3 B;  3TOL A;  1JPJ A;  3L8J A;  4I1O B;  4U9D A;  1NSG B;  4YT8 A;  4MVS A;  3EPV A;  5COG A;  4MQ9 F;  5BUO A;  5CI8 A;  4AL1 A;  4NC3 A;  5JS5 A;  2J0X A;  1TFO B;  4Z9J A;  1A7D A;  3EZH A;  3U5S A;  4DVY P;  3AOU A;  4C7O A;  5L0J A;  2G62 A;  2HFI A;  2J9W A;  1PD0 A;  4HEA J;  2CNW D;  2UUI A;  1FFT C;  3JZ0 A;  4K0D A;  4EBK A;  3W4Y A;  1GM5 A;  2EPN A;  2KC3 A;  1YA9 A;  4AE4 A;  5JUA A;  3GM3 A;  3C8G A;  4OIO F;  3C63 A;  4WGY A;  1WAT A;  3HKK A;  1E85 A;  2NUP A;  5A6B A;  4I1M A;  2XLE A;  3I5P A;  3W2W A;  4CDA A;  4UDV A;  3IPM O;  3O55 A;  5T3W A;  1LS4 A;  2QTV A;  4E17 A;  2A6H F;  1YA7 O;  2JX0 A;  3ASO C;  1A7V A;  2JPU A;  1MMD A;  4MTO A;  3F47 A;  5E3C A;  3SP1 A;  3AQB A;  1YDI A;  3Q6N A;  5B1B C;  1TWH A;  1APC A;  3HTK C;  4CJG A;  2LFF A;  1NZE A;  3MFN A;  4GEH A;  3N0T A;  3OWT A;  3JCU Q;  3G4Z A;  2HSB A;  2KNH A;  1PV3 A;  2YQY A;  1OCZ C;  4HFK B;  1NLX A;  1WN0 A;  2Q00 A;  3TD7 A;  2Q9A A;  1G4U S;  2I15 A;  2XLV A;  2XLO A;  3DM9 B;  2XLD A;  3ECS A;  3NYL A;  4O6N A;  1SMY F;  5DS5 A;  3GAN A;  3SXK A;  3EH1 A;  3SXM A;  1GGQ A;  2AVK A;  3Q7L A;  3J06 A;  4YWQ A;  1HW1 A;  4IGG A;  4YL3 A;  3LES A;  3WHN A;  1H9G A;  1FMV A;  3FOP A;  2ZXO A;  2UUH A;  1UFB A;  4XEF A;  4YT5 A;  1BR1 A;  2Q4F A;  5CI9 A;  3MYF A;  2B0H A;  3EG9 A;  4KC9 A;  4L6R A;  3T6B A;  3US6 A;  3DI5 A;  5AC4 A;  3MBG A;  1ZHX A;  4O79 A;  2HJM A;  2R7U A;  4ONS A;  3V5Z A;  2J8W A;  3G4X A;  3GEE A;  3HJC A;  4ULV A;  1WOL A;  3ZTZ A;  5L0G A;  1R4T A;  2LCH A;  2Q3T A;  2PNO A;  3S27 A;  4WGZ A;  2Y69 C;  3QW0 A;  2KQ9 A;  2VCC A;  3HLZ A;  1FAP B;  5T3T A;  2W4M A;  4O6Y A;  3B29 A;  3ZVR A;  4FAP B;  1SYQ A;  4IAR A;  3K7D A;  5A6J A;  2Q7R A;  3JSZ A;  3L34 A;  2L81 A;  3NYJ A;  3UR3 C;  1A7E A;  4BPM A;  2P61 A;  4ZLC A;  2KSF A;  2EPO A;  2HJ3 A;  4XLP F;  3PDM P;  1Q0F A;  1ZU5 A;  2XSE A;  2IXO A;  3W8I A;  4BJ6 C;  1NG1 A;  1PD1 A;  1M56 C;  1V54 C;  3BRJ A;  4J7Y A;  3U3F A;  1TFK B;  1YJG A;  2VCA A;  3ZIB A;  3LLI A;  2R05 A;  1K04 A;  4XQ1 A;  3KYI A;  4YT4 A;  1MNE A;  2XLH A;  4E0H A;  5EHH A;  5L3Q A;  1NBB A;  1B68 A;  3JRM O;  4E18 A;  3RFY A;  2LQG A;  1M57 C;  1G8X A;  2CGE A;  2ZXR A;  4NTB A;  2HSQ A;  4CS9 C;  2DGJ A;  2O9X A;  2XM4 A;  4JTD B;  2GAQ A;  2NSF A;  3V5Y A;  2YZS A;  1RKE A;  1LKX A;  2A69 F;  3B9Q A;  1NU9 C;  1V55 C;  3QW1 A;  5JRA A;  1RKE B;  4JTA B;  5DVW A;  4DRJ B;  4RD9 A;  1I5N A;  3JYY A;  3EFO B;  2ASR A;  1HMD A;  3IQT A;  2YEV A;  2NUP B;  1T6I A;  4M63 A;  4PAC A;  4AX2 A;  2ZD9 A;  5KYY A;  3AGU A;  2XL6 A;  3MYI A;  2Y3H A;  2XL4 A;  4YT2 A;  3EGD B;  3SXZ A;  4OIP F;  4DBQ A;  2HMZ A;  5JLI A;  3NRH A;  3SZR A;  3ZWI A;  3O6X A;  4W8P A;  4DJ9 A;  3KKB A;  3ASN C;  2YHS A;  3KPH A;  5DLJ A;  3DXJ F;  4U9E A;  3TJ6 A;  1AEP A;  1M2V A;  2LIG A;  2HZ8 A;  3FAP B;  5DS6 A;  1FMW A;  3EHM A;  4KI2 A;  4JC7 A;  2YVK A;  2LSE A;  3V5X A;  2EIJ C;  3NMK A;  4G7H F;  2XLM A;  2VH3 A;  4E7S A;  4PJM A;  4D4N A;  2VB6 A;  2YLI A;  4CS8 A;  4IAQ A;  2YRF A;  1O3U A;  1LVK A;  4BJT A;  4OD5 A;  3RQF A;  1ORS C;  2XL8 A;  2R25 A;  4MVM A;  1S7Z A;  2HMQ A;  3RQE A;  2M4E A;  5KYW B;  3JSE O;  1QPU A;  2IBF A;  1QVX A;  2LFD A;  3DM5 A;  3M4C A;  4ULW A;  1D1C A;  4JCZ A;  1C03 A;  2LK4 A;  5B3I A;  2XXA A;  2J9U A;  4JEB A;  5L0F A;  5DQZ A;  3O39 A;  4BJ1 A;  1QSP A;  4JJF A;  3S0X A;  1U0B B;  5COM A;  1BDJ B;  1R5I D;  1TQG A;  2A1D D;  4HE8 D;  1LIH A;  4NTF A;  2R7O A;  3LEO A;  1AVO B;  3U9J A;  3QZC A;  4KNV A;  1CGN A;  1BBH A;  2IXP A;  4D4X A;  2OEV A;  3DJU B;  3LAY A;  3SYN A;  5EGY A;  3T6G B;  2M64 A;  1Q0D A;  2WZL A;  4DBR A;  5HV9 A;  1J8Y F;  1TKN A;  1XWJ A;  2MWQ A;  2VC9 A;  3NMJ A;  2R9R B;  2H7O A;  2R7X A;  4MND A;  2ZXW C;  3AG4 C;  1RCP A;  3DZA A;  1MND A;  1YYJ A;  2J45 A;  2JD3 A;  4LLE A;  4AK9 A;  1HE1 A;  4Z9I A;  3AG3 C;  2ZXP A;  5L0I A;  3C8Z A;  3UGO A;  1Z6A A;  4NTA A;  1C17 M;  2VAS A;  3ITF A;  3QTH A;  5KYU B;  4P9T A;  2QY9 A;  2IOQ A;  2BL2 A;  2H7B A;  1E86 A;  3NDB B;  1FR0 A;  5F5H A;  5BQH A;  4JZA A;  5E2Q A;  1S05 A;  4LER A;  2RSE B;  4QI0 A;  5A6A A;  2B0J A;  4BJ5 A;  4PFO A;  4P9F A;  4C3D A;  4IB4 A;  4RDA A;  1JRA A;  4O6M A;  3X2Q C;  4U5F E;  3F46 A;  1ZVZ A;  3POV A;  3GEI A;  5F5F A;  5L0H A;  2EPL X;  4JE9 A;  4DRI B;  4ER9 A;  1JAF A;  2J0W A;  2PX0 A;  3DKA A;  3JT1 A;  1WAS A;  2ICW G;  3HNL A;  4Z9H A;  2H7V C;  3A9C A;  4MW8 A;  1VLT A;  3DAG A;  2V3C C;  3NMI A;  2NSG A;  3GEH A;  3C18 A;  2C03 A;  3MLG A;  3S90 A;  4OIQ F;  3FVY A;  2OU6 A;  3TUL A;  1VTM P;  4LAC B;  3K6B A;  3K1H A;  3LUT B;  4PK4 A;  1ZW3 A;  3I5Q A;  2PX3 A;  3K33 A;  1L7C A;  4Q5S F;  4HFF B;  4MVR A;  4A4A A;  4JVS A;  3CQZ A;  2YWA A;  3ABK C;  4EKW A;  1OXB A;  2YLG A;  4YK5 A;  5AC5 A;  4I3M A;  5AGF A;  4ANJ A;  3ATP A;  4JUR I;  4N6H A;  1G4W R;  2PP4 A;  4F4B A;  2LP4 A;  1BR4 A;  2A6E F;  2NUT A;  3VF0 A;  3M79 A;  1Z63 A;  2BE5 F;  4OIR F;  2OJE D;  2W4B A;  4JKV A;  4JTC B;  3PHF 2;  2BC5 A;  2A68 F;  2WVO A;  3EJN A;  3B0V C;  1T6Q A;  1MQV A;  3DE9 A;  4W8K A;  1W2W A;  4EIY A;  4MVQ A;  5KYN A;  4OD4 A;  2YL0 A;  2PBE A;  1N1C A;  3E9V A;  2P0N A;  1FTS A;  3IQ5 A;  3JYH A;  2NPU A;  1HMO A;  2L6G A;  4GYT A;  3DAF A;  3VAY A;  3WG7 C;  3NKE A;  3PCV A;  1CPR A;  4CBE A;  4YJW A;  2PFD A;  1Q0M A;  2J7P A;  2XRH A;  1LE4 A;  3TQO A;  4KNW A;  2XM0 A;  1Z7Q c;  2R7Q A;  4FES A;  2AWY A;  2FFH A;  4XLN F;  2QUP A;  3RH3 A;  2XS1 A;  2G3V A;  3S28 A;  3SXY A;  3DD7 A;  4EBJ A;  3ZTM A;  2Y3B A;  3R2P A;  4A2N B;  4IRU A;  4ZLD A;  4GQH A;  2KW3 C;  3ZQY A;  2DYR C;  4LLC A;  2X0C A;  2F22 A;  3RVZ A;  3WAQ A;  3ZG1 A;  4YL0 A;  3DJN B;  4YN0 B;  5E3A A;  2ZPA A;  3ZQV A;  3AJM A;  1NFO A;  4WAB A;  1LI7 A;  2OCC C;  2LD6 A;  1LS1 A;  2DI3 A;  3VYW A;  5BQG A;  3EGX B;  4C7O B;  3L8I A;  3M1C B;  4B6I A;  2EIL C;  2OQM A;  1Z23 A;  4N4W A;  1MMG A;  4EUK B;  2GWW A;  2TMV P;  4CDY A;  5KYU A;  3S9O A;  4JRZ A;  1A41 A;  2GA0 A;  3VRC A;  3LJB A;  2YKZ A;  3M4B A;  3TK0 A;  1Q0K A;  2L6H A;  3V7O A;  1M6T A;  4XTK A;  4J7T A;  3RVY A;  3T4R A;  2R03 A;  3CEX A;  3LNM B;  3U0C A;  1YVI A;  4JCH A;  1ZW2 A;  1SZI A;  2R7W A;  1YAU O;  2HV7 A;  3BEH A;  3HNK A;  2PF4 E;  4EHP A;  4G7Z F;  1CPQ A;  1EQ1 A;  3EH2 A;  5A69 A; 
#chains in the Genus database with same CATH homology
 5JP7 A;  3FOP A;  3FOO A;  4CX9 A;  4CIP A;  4CDV A;  4L6R A;  1E86 A;  2J8W A;  4ULV A;  1S05 A;  3ZTZ A;  4IB4 A;  4WGZ A;  3QW0 A;  4JE9 A;  4ER9 A;  1JAF A;  3HNJ A;  4IAR A;  3HNL A;  1YYX A;  3NMI A;  1E83 A;  2YL3 A;  3QVZ A;  3U8P A;  2QLA A;  3L1M A;  3DE8 A;  2XLH A;  2YLG A;  1NBB A;  3C62 A;  5AGF A;  1CGO A;  4N6H A;  2XM4 A;  1QQ3 A;  2XLW A;  3M79 A;  3QW1 A;  5JRA A;  4CJO A;  4JKV A;  3M15 A;  2YLD A;  2BC5 A;  3IQ6 A;  1MQV A;  3DE9 A;  5JVE A;  4EIY A;  2YL0 A;  1YZA A;  5JSL A;  3IQ5 A;  2XL6 A;  1YZC A;  1LM3 B;  3TOL A;  2YL1 A;  3QVY A;  1CPR A;  5JLI A;  3ZWI A;  4U9D A;  2XM0 A;  4JEA A;  4NC3 A;  5JS5 A;  1E84 A;  4U9E A;  3HNI A;  1GQA A;  3ZTM A;  3NMK A;  2XLM A;  3ZQY A;  256B A;  4D4N A;  2YLI A;  4IAQ A;  5JUA A;  3ZQV A;  3C63 A;  4WGY A;  2XL8 A;  3TOM A;  1E85 A;  1QPU A;  2XLE A;  3M4C A;  4CDA A;  5B3I A;  2J9B A;  4JEB A;  1A7V A;  4N4W A;  1EKY A;  2CCY A;  1APC A;  4CJG A;  2YL7 A;  3VRC A;  2YKZ A;  3M4B A;  1CGN A;  1BBH A;  1M6T A;  4D4X A;  2XLV A;  2XLO A;  2XLD A;  3NMJ A;  3HNK A;  5JT4 A;  1CPQ A;  1RCP A;  1YYJ A;  4CDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...