1CGOA

Cytochrome c'
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
125
structure length
125
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLTALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport (cytochrome)
molecule keywords CYTOCHROME C
publication title Three-dimensional structure of cytochrome c' from two Alcaligenes species and the implications for four-helix bundle structures.
pubmed doi rcsb
source organism Alcaligenes sp.
total genus 48
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 1995-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1cgoA00
4ULVA 1CPRA 2YL3A 4N4WA 1QPUA 1APCA 4D4XA 1LM3B 4CJGA 4CJOA 1EKYA 1JAFA 5JS5A 1M6TA 3HNKA 1QQ3A 1YYJA 2YLGA 2YL7A 5JSLA 4NC3A 4JEAA 2XL8A 2XM0A 1S05A 1E85A 256BA 1YYXA 3C62A 2QLAA 5B3IA 3M4BA 4IARA 4N6HA 2XLWA 4CIPA 3U8PA 5JVEA 4U9EA 3QW1A 3L1MA 4JEBA 3M4CA 4CDAA 4CDYA 3ZTZA 3QVYA 2XLVA 1CGOA 3VRCA 1E83A 2XLHA 3DE8A 4IB4A 2XLOA 5JUAA 3TOLA 1RCPA 2YKZA 3QW0A 3IQ5A 4JKVA 5JLIA 1A7VA 5JRAA 2YL1A 2YL0A 2J9BA 3ZQVA 2YLIA 3NMJA 4ER9A 2XLDA 3NMIA 1CPQA 4CX9A 3FOOA 4JE9A 1CGNA 3FOPA 3HNIA 5AGFA 1E86A 4U9DA 4CDVA 1NBBA 2CCYA 3QVZA 5JP7A 2XM4A 3HNJA 4WGYA 3DE9A 3IQ6A 4L6RA 2BC5A 5JT4A 4EIYA 1GQAA 1YZCA 2XLMA 3NMKA 2J8WA 1E84A 2XL6A 3M79A 3ZQYA 1YZAA 2YLDA 1BBHA 3M15A 4IAQA 4WGZA 3ZTMA 3C63A 4D4NA 3TOMA 3ZWIA 1MQVA 2XLEA 3HNLA
chains in the Genus database with same CATH superfamily
1WATA 3W8HA 2IXMA 1DOVA 1QPUA 1A41A 3B0UX 3ABLC 2R25A 4A4AA 4I1MA 1LM3B 1N1CA 1G4US 2ZD9A 1FTSA 1VOMA 4XEVA 4CJOA 1JAFA 2J9UA 2FGYA 1OCRC 2RSEB 3H65A 1AVOB 1R4TA 1ZU4A 3ITFA 4JCHA 4JVSA 1OCZC 5L0FA 1Y4CA 2L6FA 3WHNA 1FFTC 3ZSUA 4JURI 2F22A 4U5BE 4MVSA 3RQEA 3UGOA 5JSLA 2IM8A 4IAOA 3S27A 1ZHWA 1LI7A 4I3MA 2R7OA 4JTDB 1Q0DA 3EGDB 5D91A 2O9XA 3S28A 3EZHA 2AU5A 3BEHA 4OD5A 5L3QA 1LIHA 1S05A 3EG9B 1AEPA 1NZEA 3B9QA 1TKNA 4YT5A 1YAUO 3TK0A 1MMAA 2DB4A 2WVQA 1Q0KA 2Q00A 3JRMO 4CS7A 4C3BA 3ABMC 4XEKA 2A68F 4MVUA 5B3IA 3S90A 4YJWA 4NTBA 3EZIA 3KMIA 3LNRA 3S9OA 1L7CA 2YVKA 1Z7Qc 3U8PA 4EBBA 4KNWA 4U9EA 5JVEA 3QW1A 2Q9CA 1Y6DA 4JC7A 1ORSC 2XRHA 2FAPB 3M4CA 4Z9IA 5HV9A 3ZTZA 1EQ1A 3QVYA 1R5ID 2AVKA 1V54C 1RMVA 1BR4A 4G7ZF 1CGOA 3TJ6A 1GS9A 5TJ5E 1U6HA 3RFYA 5CI9A 3LESA 4PK4A 3K1IA 2R02A 2HSQA 2WL8A 2QY9A 1H9GA 2WB7A 4G78A 2Y3BA 2E87A 3LEOA 3BRJA 2VCCA 2J46A 1A0BA 1NFOA 4Z9JA 2A0UA 3ASNC 5KYWB 4DBRA 1LVKA 1TWGA 4JKVA 5JLIA 1A7VA 1EI7A 2Q3TA 3LAYA 1LE2A 3ECSA 1J8MF 3O55A 1EA8A 2W4BA 3RQGA 5F5HA 1OR3A 1JR8A 2PX3A 5FZTA 4F4BA 1SF8A 3T6BA 4YWQA 1C03A 3QMKA 4JE9A 4XPYA 4OINF 1OCCC 2I15A 1QZXA 3KPHA 3L8JA 4NTFA 3EHMA 3LUTB 4CDVA 2L6GA 3IHUA 5B1BC 2KGOA 3F47A 1C02A 3H2VA 2HSBA 1PD0A 2A0BA 4PACA 1H6GA 2CDQA 3I5QA 4KNVA 3W2WA 3POVA 2Y3DA 3CAXA 1RXQA 4FAPB 1MNDA 1ORYA 1M2VA 1SZIA 5CIVA 3ZG1A 2IXNA 3V5ZA 2ZXOA 3AG2C 4LACB 3SXKA 5DLJA 5DQTA 1WWPA 1YZCA 1D1BA 1GM5A 2Y3HA 3NDBB 4H54A 2XLMA 3W4YA 4BJTA 3LNMB 2J8WA 4IJJA 4ANJA 2IYLD 2HUJA 4OIRF 3JYYA 3RVZA 2KC3A 2CW0F 4NCQA 5KYXB 1C17M 2HV6A 3K66A 4XLNF 1WN0A 3W2VA 4ZLCA 1V74B 1JRAA 1Z5ZA 2MYSA 2Q9BA 3ASOC 3QZCA 2X51A 1VYIA 3JT1A 2YLDA 2NUPB 3S84A 3CEXA 4K1OA 4WGZA 3C63A 3DZAA 4D4NA 4RBNA 2CYDA 5E3AA 1BDJB 1ZHYA 2CGEA 4E0HA 5IY5C 2XS1A 2NG1A 5EK0A 4ULVA 2QE9A 1HE1A 4N4WA 4CS9A 1APCA 4ZLDA 2P0NA 2L9JA 2Q9AA 3U0CA 1ZHXA 3FVYA 1FNTc 3NRHA 3MBGA 1TFOB 5KYNA 2NUTB 3SXZA 4MTFA 1HW2A 5JS5A 1M6TA 5KYUA 3RKOF 1OW8A 1QQ3A 1YYJA 3HNKA 1TFKB 3VF0A 4DOZA 3MYFA 2GA0A 2G3KA 3DM9B 4IRUA 4HE8D 4XPXA 5COFA 2C03A 2YL7A 3Q6NA 2OEXA 2IOQA 4DVYP 4JEAA 3DAGA 3DM5A 4PJJA 2I8BA 2J9WA 3G50A 1T6UA 2IBFA 1VLTA 5T1DB 5BUOA 3K1HA 3FMSA 1XWJA 2XM0A 3UMKA 1E85A 4JRZA 3UMHA 3K7DA 3AQCA 1MMDA 3FAPB 4YT2A 1VYKA 1YA9A 1YYXA 1AUEA 1SMYF 2V26A 3C62A 4I1OB 4JTCB 1NSGB 4E7ZA 4YL3A 3M4BA 1NLXA 4J7TA 4O6MA 1U89A 4E18A 2HS5A 3E70C 2KYHA 1B68A 4QDLA 2JD3A 3DKAA 3ZVRA 5EGYA 5L0DA 3OWTA 2HJ3A 3L1MA 2KJGA 3GM3A 4GYTA 2VASA 2XS8A 3PCVA 4YK5A 3EGXB 3S0XA 2L81A 2R7QA 2YEVA 4U5FE 1OW7A 1RKCA 1T6QA 4U5EE 5T3TA 2D4UA 2IXPA 3PMRA 3VRCA 4RDAA 4MTOA 4P9TA 4DBQA 1A7DA 2DI3A 1E2XA 2OOCA 3DE8A 3JSZA 3N2ZB 3SXMA 2ZXPA 4JW1A 4IGGA 3VAYA 1QVXA 1JPJA 5F5FA 5JUAA 4MVQA 2XL4A 1BR1A 1ST6A 3U5SA 2L6HA 1K05A 3Q6MA 3R2PA 2H8AA 2C04A 3DD7A 2UUIA 3CZ6A 4FWVA 4AX2A 1ZW3A 5L0JA 2LFDA 5DS6A 2ZXWC 2YKZA 4G7OF 1PD1A 3HKKA 3JCUQ 3EG9A 1NG1A 1J8YF 1YVIA 4PR9A 3DJNB 4XTKA 4B6IA 3J06A 2ICWG 1PCXA 4MVZA 3B0VC 3O39A 4AE4B 4PJLA 2YL0A 4Q4ZF 4CSAC 1M57C 4JIOA 3ZQVA 4DRHB 1G4WR 3RF3A 3NMIA 5L0HA 1CPQA 2MWQA 1LI5A 4CX9A 3GEIA 1NU7D 1D0ZA 1D1AA 1PV3A 3HLZA 1E86A 2AP3A 4AL0A 2M64A 3L34A 3QVZA 3U3FA 3IQCA 1ZU5A 3GANA 2R9RB 2LP4A 3EFOB 2XM4A 3HNJA 2OEVA 4Q7CA 1TWHA 2OCCC 4XQ1A 4WGYA 4U5HA 5AC5A 1RKEA 1YDIA 1T6IA 1RJ9B 1F1MA 3B29A 2BC5A 3AQBA 3GWNA 4EIYA 3NKDA 2OJQA 4YT8A 1L3PA 1E83A 3PHF2 3US6A 2EIKC 2L7AA 4GEHA 2JPUA 3L0IA 4ONSA 4OIQF 1XZPA 4O6NA 5KYWA 5DS4A 2QTVA 4PJMA 3ZC4A 2R05A 1I4YA 2EPOA 3UMIA 4CS8C 4HFKB 4IWBA 3T4RA 1Z3IX 3GORA 1LKXA 4OIOF 2EPKX 3LEVA 3A9CA 1IW7F 2VC9A 3V7OA 1YJGA 4CS8A 2TMVP 1WTYA 3CSKA 4FX5A 4K7BA 2HJMA 4IAQA 3K33A 4U5DE 4BG0A 4LLEA 4HFFB 3ZWIA 1MQVA 5GPGB 2NSFA 4G7HF 1IZMA 3QTHA 3C8GD 1O87A 4YL1A 3SZRA 4D4XA 2A6EF 3C8GA 3U9JA 2A6HF 4NY3A 2DYSC 4C3DA 4I44A 2B0JA 4QI0A 5COGA 1CGME 3SYNA 4M63A 3NYMA 4CJGA 1ZZPA 5L0CA 1ZYRF 1EKYA 3TQOA 4U5CE 4Z9HA 2UUHA 2QNLA 1OCOC 5E33A 1SYQA 4MS2A 4YT4A 5L3VA 1KTMA 3O10A 4DRJB 1NU9C 1ZVZA 4W8KA 4MNDA 4CBEA 1TWAA 3I4UA 1Z63A 4KC9A 3UNGC 2J0XA 1JOGA 2J0WA 2BE5F 2J7PD 2XL8A 2YRFA 1VB5A 3M1CB 4U5GA 5B1AC 4MW8A 3X1OA 4UDVA 2J7PA 3IEEA 3A11A 2H7OA 3RH3A 4W8PA 2HV7A 2NUPA 256BA 1FR0A 2LCHA 2NSGA 5BQHA 3W8IA 3F46A 1LE4A 1Q0MA 2QLAA 4O6YA 1T01A 3OEOA 5FCLA 3T6GB 2VH3A 3AG3C 4MQ9F 4N6HA 1NFNA 5BQGA 2XLWA 4E0IA 2HFIA 4CIPA 2PBEA 2LSEA 2OKUA 4RD9A 4MVOA 4DVZA 1D0YA 1QKRA 2YZSA 3T6JA 1BZ4A 4JEBA 3EPVA 5E3CA 2G62A 1MMGA 2J45A 3DWWA 2WVOA 2XLVA 3Q7GA 4J30B 4O7GA 4A2NB 5DS5A 3MFNA 2P6VA 2V3CC 4JZAA 2XLHA 3UR3C 3I5PA 3ZIBA 1JPNA 2HMQA 2XSEA 3SEOA 3DXJF 2R7TA 4P9FA 3EJNA 2M4EA 2XLOA 3HJCA 1SR2A 4C7OB 3TOLA 1WASA 2KQ9A 4LDKA 5A6JA 3VYWA 1LS1A 4BJ5C 1ZHTA 1RCPA 2EPMX 4LDRA 2KSFA 5KYUB 1V4AA 5DQZA 3UGPA 3IQ5A 4EBJA 2ETSA 3RQFA 3CQZA 4BJ5A 5JRAA 5COMA 2EPNA 2QUPA 2WZFA 1UFBA 3E9VA 2J9BA 4DJ9A 1G8XA 2GAQA 2WZLA 2W45A 1GGQA 1O3UA 2OG2A 3GM1A 2B0HA 3K6BA 3NMJA 4ER9A 1E84A 2Q7RA 3FOOA 1M2OA 2PNOA 1CGNA 3GODA 2OJED 2DGJA 5KYYA 2ASRA 1W2WA 5KYYB 4DXWA 1FMWA 2XXAA 3GWLA 3EGXA 1NBBA 1TWCA 4MTGA 4U9DA 4EHPA 5A6KA 2GFHA 2A1DD 1HMOA 2W4MA 1Z23A 3AGTA 5AC4A 5JP7A 1OXKA 2YHSA 2A69F 2VCAA 3X2QC 3PDMP 5F28E 3B0PA 1UG7A 3EGDA 5D92A 3MX3A 4MVRA 4NQFA 3G4ZA 2VB6A 1FMVA 3C8ZA 3KL4A 4CDYA 1MMNA 1WGWA 3ATPA 1GQAA 2EIJC 1FAPB 1I4ZA 4FESA 1ORJA 1YARO 3MLGA 3NMKA 4R32A 4QI2A 2OU6A 4K0DA 1OQCA 4AE4A 4HEAJ 2P7VA 3L8IA 3C18A 3U3BA 3RYLA 2XL6A 3M79A 4CSAA 4EUKB 3ZQYA 2R7XA 2XXAB 1HW1A 2ZXRA 3DI5A 2BL2A 2G3VA 2LK4A 3N0TA 2P61A 4EBKA 1ZW2A 4XWJA 3FDQA 3FAJA 3G4XA 3U8VA 2LFFA 3R7CA 3EH1A 3ZTMA 3NKEA 4PFPA 3SP1A 2X0CA 4KBLA 5E2QA 3LS1A 2Y39A 1S7ZA 3GEHA 3LLIA 1CPRA 2YL3A 1HE9A 4ULWA 2P1AA 3EFOA 2Z15A 3DAFA 1FFHA 1O5HA 4BEJA 2JX0A 2PFDA 1K40A 1RJ9A 2VCBA 4Q5SF 1V55C 3FHDA 3V5XA 1OW6A 1QSPA 2W9YA 5L0GA 3JTLO 4JJGA 2R7WA 2YLGA 2R7SA 3K1IC 2NUTA 2R03A 1H7IA 2DYRC 2EINC 3NYJA 3TULA 3KYIA 4NC3A 5L0IA 1TQGA 1LS4A 3H2UA 4LERA 1KU2A 2WVNA 3GEEA 3O6XA 1H9TA 1RKEB 1OXBA 1D0XA 5EHHA 3EHNA 1T5OA 3KH2A 1QLEC 2D5RB 4WABA 4AK9A 4BEMJ 3DMDA 3VM6A 4N6CA 3TJ5A 5BQIA 3ZDLA 4XPWA 2LD6A 4JCZA 4IARA 1KNYA 2YQYA 4LDQA 2Y3GA 1ZHZA 4PFOA 4XEFA 4BJ1A 4KI2A 2GDCA 3IQTA 1M56C 3S29A 4N06A 1WOLA 1JMWA 4CDAA 5A69A 4YN0B 2H7BA 1LPEA 3KYJA 4OD4A 2WZGA 2KW3C 3JRTA 3LJBA 5T3WA 1DOWA 5A6BD 4J32B 5B3SC 5A6BA 2PX0A 3U2LA 4P6IC 5KYXA 3B71A 4IB4A 3AJMA 3U9MA 2R7UA 1YLMA 1Z6AA 1M2VB 4JTAB 3C8GB 1Q0GA 2Y69C 1MNEA 3AOUA 5A6AA 5HSWA 3AG4C 3KKBA 1VTMP 4YL0A 2LIGA 3QW0A 3TD7A 3OA1A 1HY5A 2J9VA 2YL1A 3WAQA 4EWCA 2YLIA 1YA7O 3JYHA 2FFHA 3RW0A 2R7VA 1OR2A 2XLDA 1D1CA 3WODF 3EQLF 4NTAA 1A7EA 3FOPA 3HNIA 3HTKC 2NPUA 2PP4A 4DRIB 5AGFA 2KNHA 4BPMA 4C3EA 3N24A 2CCYA 3LLKA 3EH2A 2LQGA 3LS0A 1BR2A 4LLCA 1K04A 3AGUA 3C7JA 4J7YA 2PF4E 3RIPA 3V5YA 4CS9C 1Q0FA 2EIMC 1HMDA 4O79A 3SXYA 4AL1A 1VK5A 2CNWD 5K0IA 2R7RA 3IPMO 3DE9A 5DVWA 4MW3A 4C7OA 3JZ0A 2CNWA 2EPLX 3IQ6A 3NYLA 4L6RA 3DJUB 3U2MA 3WG7C 4E17A 1U0BB 1I5NA 5JT4A 2HKVA 3FXHA 3AG1C 3RVYA 2Q4FA 4G0HA 4E7SA 2ZPAA 4H4KC 4PJNA 2YWAA 3JSEO 4MVMA 3Q7LA 3ABKC 4GQHA 1T9KA 2GWWA 4BJ6C 1OKKD 4XLPF 3MYIA 2AWYA 3NG1A 1VLSA 2HMZA 1TR2A 3SNHA 1OKKA 2HZ8A 4WJ0A 4EKWA 1VMAA 4JJFA 4BJ6A 1YZAA 2KK1A 1BBHA 2AWCA 2EILC 2MHRA 1XZQA 3GM2A 3M15A 3T9OA 2IXOA 2OQMA 4CIHA 2H7VC 4X0RA 3TOMA 2XLEA 1G5ZA 3HNLA 4OIPF 2RD9A 5CI8A
chains in the Genus database with same CATH topology
4ULVA 1CPRA 2YL3A 4N4WA 1QPUA 1APCA 4D4XA 1LM3B 4CJGA 4CJOA 1EKYA 1JAFA 5JS5A 1M6TA 3HNKA 1QQ3A 1YYJA 2YLGA 2YL7A 5JSLA 4NC3A 4JEAA 2XL8A 2XM0A 1S05A 1E85A 256BA 1YYXA 3C62A 2QLAA 5B3IA 3M4BA 4IARA 4N6HA 2XLWA 4CIPA 3U8PA 5JVEA 4U9EA 3QW1A 3L1MA 4JEBA 3M4CA 4CDAA 4CDYA 3ZTZA 3QVYA 2XLVA 1CGOA 3VRCA 1E83A 2XLHA 3DE8A 4IB4A 2XLOA 5JUAA 3TOLA 1RCPA 2YKZA 3QW0A 3IQ5A 4JKVA 5JLIA 1A7VA 5JRAA 2YL1A 2YL0A 2J9BA 3ZQVA 2YLIA 3NMJA 4ER9A 2XLDA 3NMIA 1CPQA 4CX9A 3FOOA 4JE9A 1CGNA 3FOPA 3HNIA 5AGFA 1E86A 4U9DA 4CDVA 1NBBA 2CCYA 3QVZA 5JP7A 2XM4A 3HNJA 4WGYA 3DE9A 3IQ6A 4L6RA 2BC5A 5JT4A 4EIYA 1GQAA 1YZCA 2XLMA 3NMKA 2J8WA 1E84A 2XL6A 3M79A 3ZQYA 1YZAA 2YLDA 1BBHA 3M15A 4IAQA 4WGZA 3ZTMA 3C63A 4D4NA 3TOMA 3ZWIA 1MQVA 2XLEA 3HNLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ULV A;  1CPR A;  2YL3 A;  4N4W A;  1QPU A;  1APC A;  4D4X A;  1LM3 B;  4CJG A;  4CJO A;  1EKY A;  1JAF A;  5JS5 A;  1M6T A;  3HNK A;  1QQ3 A;  1YYJ A;  2YLG A;  2YL7 A;  5JSL A;  4NC3 A;  4JEA A;  2XL8 A;  2XM0 A;  1S05 A;  1E85 A;  256B A;  1YYX A;  3C62 A;  2QLA A;  5B3I A;  3M4B A;  4IAR A;  4N6H A;  2XLW A;  4CIP A;  3U8P A;  5JVE A;  4U9E A;  3QW1 A;  3L1M A;  4JEB A;  3M4C A;  4CDA A;  4CDY A;  3ZTZ A;  3QVY A;  2XLV A;  1CGO A;  3VRC A;  1E83 A;  2XLH A;  3DE8 A;  4IB4 A;  2XLO A;  5JUA A;  3TOL A;  1RCP A;  2YKZ A;  3QW0 A;  3IQ5 A;  4JKV A;  5JLI A;  1A7V A;  5JRA A;  2YL1 A;  2YL0 A;  2J9B A;  3ZQV A;  2YLI A;  3NMJ A;  4ER9 A;  2XLD A;  3NMI A;  1CPQ A;  4CX9 A;  3FOO A;  4JE9 A;  1CGN A;  3FOP A;  3HNI A;  5AGF A;  1E86 A;  4U9D A;  4CDV A;  1NBB A;  2CCY A;  3QVZ A;  5JP7 A;  2XM4 A;  3HNJ A;  4WGY A;  3DE9 A;  3IQ6 A;  4L6R A;  2BC5 A;  5JT4 A;  4EIY A;  1GQA A;  1YZC A;  2XLM A;  3NMK A;  2J8W A;  1E84 A;  2XL6 A;  3M79 A;  3ZQY A;  1YZA A;  2YLD A;  1BBH A;  3M15 A;  4IAQ A;  4WGZ A;  3ZTM A;  3C63 A;  4D4N A;  3TOM A;  3ZWI A;  1MQV A;  2XLE A;  3HNL A; 
#chains in the Genus database with same CATH topology
 1WAT A;  3W8H A;  2IXM A;  1DOV A;  1QPU A;  1A41 A;  3B0U X;  3ABL C;  2R25 A;  4A4A A;  4I1M A;  1LM3 B;  1N1C A;  1G4U S;  2ZD9 A;  1FTS A;  1VOM A;  4XEV A;  4CJO A;  1JAF A;  2J9U A;  2FGY A;  1OCR C;  2RSE B;  3H65 A;  1AVO B;  1R4T A;  1ZU4 A;  3ITF A;  4JCH A;  4JVS A;  1OCZ C;  5L0F A;  1Y4C A;  2L6F A;  3WHN A;  1FFT C;  3ZSU A;  4JUR I;  2F22 A;  4U5B E;  4MVS A;  3RQE A;  3UGO A;  5JSL A;  2IM8 A;  4IAO A;  3S27 A;  1ZHW A;  1LI7 A;  4I3M A;  2R7O A;  4JTD B;  1Q0D A;  3EGD B;  5D91 A;  2O9X A;  3S28 A;  3EZH A;  2AU5 A;  3BEH A;  4OD5 A;  5L3Q A;  1LIH A;  1S05 A;  3EG9 B;  1AEP A;  1NZE A;  3B9Q A;  1TKN A;  4YT5 A;  1YAU O;  3TK0 A;  1MMA A;  2DB4 A;  2WVQ A;  1Q0K A;  2Q00 A;  3JRM O;  4CS7 A;  4C3B A;  3ABM C;  4XEK A;  2A68 F;  4MVU A;  5B3I A;  3S90 A;  4YJW A;  4NTB A;  3EZI A;  3KMI A;  3LNR A;  3S9O A;  1L7C A;  2YVK A;  1Z7Q c;  3U8P A;  4EBB A;  4KNW A;  4U9E A;  5JVE A;  3QW1 A;  2Q9C A;  1Y6D A;  4JC7 A;  1ORS C;  2XRH A;  2FAP B;  3M4C A;  4Z9I A;  5HV9 A;  3ZTZ A;  1EQ1 A;  3QVY A;  1R5I D;  2AVK A;  1V54 C;  1RMV A;  1BR4 A;  4G7Z F;  1CGO A;  3TJ6 A;  1GS9 A;  5TJ5 E;  1U6H A;  3RFY A;  5CI9 A;  3LES A;  4PK4 A;  3K1I A;  2R02 A;  2HSQ A;  2WL8 A;  2QY9 A;  1H9G A;  2WB7 A;  4G78 A;  2Y3B A;  2E87 A;  3LEO A;  3BRJ A;  2VCC A;  2J46 A;  1A0B A;  1NFO A;  4Z9J A;  2A0U A;  3ASN C;  5KYW B;  4DBR A;  1LVK A;  1TWG A;  4JKV A;  5JLI A;  1A7V A;  1EI7 A;  2Q3T A;  3LAY A;  1LE2 A;  3ECS A;  1J8M F;  3O55 A;  1EA8 A;  2W4B A;  3RQG A;  5F5H A;  1OR3 A;  1JR8 A;  2PX3 A;  5FZT A;  4F4B A;  1SF8 A;  3T6B A;  4YWQ A;  1C03 A;  3QMK A;  4JE9 A;  4XPY A;  4OIN F;  1OCC C;  2I15 A;  1QZX A;  3KPH A;  3L8J A;  4NTF A;  3EHM A;  3LUT B;  4CDV A;  2L6G A;  3IHU A;  5B1B C;  2KGO A;  3F47 A;  1C02 A;  3H2V A;  2HSB A;  1PD0 A;  2A0B A;  4PAC A;  1H6G A;  2CDQ A;  3I5Q A;  4KNV A;  3W2W A;  3POV A;  2Y3D A;  3CAX A;  1RXQ A;  4FAP B;  1MND A;  1ORY A;  1M2V A;  1SZI A;  5CIV A;  3ZG1 A;  2IXN A;  3V5Z A;  2ZXO A;  3AG2 C;  4LAC B;  3SXK A;  5DLJ A;  5DQT A;  1WWP A;  1YZC A;  1D1B A;  1GM5 A;  2Y3H A;  3NDB B;  4H54 A;  2XLM A;  3W4Y A;  4BJT A;  3LNM B;  2J8W A;  4IJJ A;  4ANJ A;  2IYL D;  2HUJ A;  4OIR F;  3JYY A;  3RVZ A;  2KC3 A;  2CW0 F;  4NCQ A;  5KYX B;  1C17 M;  2HV6 A;  3K66 A;  4XLN F;  1WN0 A;  3W2V A;  4ZLC A;  1V74 B;  1JRA A;  1Z5Z A;  2MYS A;  2Q9B A;  3ASO C;  3QZC A;  2X51 A;  1VYI A;  3JT1 A;  2YLD A;  2NUP B;  3S84 A;  3CEX A;  4K1O A;  4WGZ A;  3C63 A;  3DZA A;  4D4N A;  4RBN A;  2CYD A;  5E3A A;  1BDJ B;  1ZHY A;  2CGE A;  4E0H A;  5IY5 C;  2XS1 A;  2NG1 A;  5EK0 A;  4ULV A;  2QE9 A;  1HE1 A;  4N4W A;  4CS9 A;  1APC A;  4ZLD A;  2P0N A;  2L9J A;  2Q9A A;  3U0C A;  1ZHX A;  3FVY A;  1FNT c;  3NRH A;  3MBG A;  1TFO B;  5KYN A;  2NUT B;  3SXZ A;  4MTF A;  1HW2 A;  5JS5 A;  1M6T A;  5KYU A;  3RKO F;  1OW8 A;  1QQ3 A;  1YYJ A;  3HNK A;  1TFK B;  3VF0 A;  4DOZ A;  3MYF A;  2GA0 A;  2G3K A;  3DM9 B;  4IRU A;  4HE8 D;  4XPX A;  5COF A;  2C03 A;  2YL7 A;  3Q6N A;  2OEX A;  2IOQ A;  4DVY P;  4JEA A;  3DAG A;  3DM5 A;  4PJJ A;  2I8B A;  2J9W A;  3G50 A;  1T6U A;  2IBF A;  1VLT A;  5T1D B;  5BUO A;  3K1H A;  3FMS A;  1XWJ A;  2XM0 A;  3UMK A;  1E85 A;  4JRZ A;  3UMH A;  3K7D A;  3AQC A;  1MMD A;  3FAP B;  4YT2 A;  1VYK A;  1YA9 A;  1YYX A;  1AUE A;  1SMY F;  2V26 A;  3C62 A;  4I1O B;  4JTC B;  1NSG B;  4E7Z A;  4YL3 A;  3M4B A;  1NLX A;  4J7T A;  4O6M A;  1U89 A;  4E18 A;  2HS5 A;  3E70 C;  2KYH A;  1B68 A;  4QDL A;  2JD3 A;  3DKA A;  3ZVR A;  5EGY A;  5L0D A;  3OWT A;  2HJ3 A;  3L1M A;  2KJG A;  3GM3 A;  4GYT A;  2VAS A;  2XS8 A;  3PCV A;  4YK5 A;  3EGX B;  3S0X A;  2L81 A;  2R7Q A;  2YEV A;  4U5F E;  1OW7 A;  1RKC A;  1T6Q A;  4U5E E;  5T3T A;  2D4U A;  2IXP A;  3PMR A;  3VRC A;  4RDA A;  4MTO A;  4P9T A;  4DBQ A;  1A7D A;  2DI3 A;  1E2X A;  2OOC A;  3DE8 A;  3JSZ A;  3N2Z B;  3SXM A;  2ZXP A;  4JW1 A;  4IGG A;  3VAY A;  1QVX A;  1JPJ A;  5F5F A;  5JUA A;  4MVQ A;  2XL4 A;  1BR1 A;  1ST6 A;  3U5S A;  2L6H A;  1K05 A;  3Q6M A;  3R2P A;  2H8A A;  2C04 A;  3DD7 A;  2UUI A;  3CZ6 A;  4FWV A;  4AX2 A;  1ZW3 A;  5L0J A;  2LFD A;  5DS6 A;  2ZXW C;  2YKZ A;  4G7O F;  1PD1 A;  3HKK A;  3JCU Q;  3EG9 A;  1NG1 A;  1J8Y F;  1YVI A;  4PR9 A;  3DJN B;  4XTK A;  4B6I A;  3J06 A;  2ICW G;  1PCX A;  4MVZ A;  3B0V C;  3O39 A;  4AE4 B;  4PJL A;  2YL0 A;  4Q4Z F;  4CSA C;  1M57 C;  4JIO A;  3ZQV A;  4DRH B;  1G4W R;  3RF3 A;  3NMI A;  5L0H A;  1CPQ A;  2MWQ A;  1LI5 A;  4CX9 A;  3GEI A;  1NU7 D;  1D0Z A;  1D1A A;  1PV3 A;  3HLZ A;  1E86 A;  2AP3 A;  4AL0 A;  2M64 A;  3L34 A;  3QVZ A;  3U3F A;  3IQC A;  1ZU5 A;  3GAN A;  2R9R B;  2LP4 A;  3EFO B;  2XM4 A;  3HNJ A;  2OEV A;  4Q7C A;  1TWH A;  2OCC C;  4XQ1 A;  4WGY A;  4U5H A;  5AC5 A;  1RKE A;  1YDI A;  1T6I A;  1RJ9 B;  1F1M A;  3B29 A;  2BC5 A;  3AQB A;  3GWN A;  4EIY A;  3NKD A;  2OJQ A;  4YT8 A;  1L3P A;  1E83 A;  3PHF 2;  3US6 A;  2EIK C;  2L7A A;  4GEH A;  2JPU A;  3L0I A;  4ONS A;  4OIQ F;  1XZP A;  4O6N A;  5KYW A;  5DS4 A;  2QTV A;  4PJM A;  3ZC4 A;  2R05 A;  1I4Y A;  2EPO A;  3UMI A;  4CS8 C;  4HFK B;  4IWB A;  3T4R A;  1Z3I X;  3GOR A;  1LKX A;  4OIO F;  2EPK X;  3LEV A;  3A9C A;  1IW7 F;  2VC9 A;  3V7O A;  1YJG A;  4CS8 A;  2TMV P;  1WTY A;  3CSK A;  4FX5 A;  4K7B A;  2HJM A;  4IAQ A;  3K33 A;  4U5D E;  4BG0 A;  4LLE A;  4HFF B;  3ZWI A;  1MQV A;  5GPG B;  2NSF A;  4G7H F;  1IZM A;  3QTH A;  3C8G D;  1O87 A;  4YL1 A;  3SZR A;  4D4X A;  2A6E F;  3C8G A;  3U9J A;  2A6H F;  4NY3 A;  2DYS C;  4C3D A;  4I44 A;  2B0J A;  4QI0 A;  5COG A;  1CGM E;  3SYN A;  4M63 A;  3NYM A;  4CJG A;  1ZZP A;  5L0C A;  1ZYR F;  1EKY A;  3TQO A;  4U5C E;  4Z9H A;  2UUH A;  2QNL A;  1OCO C;  5E33 A;  1SYQ A;  4MS2 A;  4YT4 A;  5L3V A;  1KTM A;  3O10 A;  4DRJ B;  1NU9 C;  1ZVZ A;  4W8K A;  4MND A;  4CBE A;  1TWA A;  3I4U A;  1Z63 A;  4KC9 A;  3UNG C;  2J0X A;  1JOG A;  2J0W A;  2BE5 F;  2J7P D;  2XL8 A;  2YRF A;  1VB5 A;  3M1C B;  4U5G A;  5B1A C;  4MW8 A;  3X1O A;  4UDV A;  2J7P A;  3IEE A;  3A11 A;  2H7O A;  3RH3 A;  4W8P A;  2HV7 A;  2NUP A;  256B A;  1FR0 A;  2LCH A;  2NSG A;  5BQH A;  3W8I A;  3F46 A;  1LE4 A;  1Q0M A;  2QLA A;  4O6Y A;  1T01 A;  3OEO A;  5FCL A;  3T6G B;  2VH3 A;  3AG3 C;  4MQ9 F;  4N6H A;  1NFN A;  5BQG A;  2XLW A;  4E0I A;  2HFI A;  4CIP A;  2PBE A;  2LSE A;  2OKU A;  4RD9 A;  4MVO A;  4DVZ A;  1D0Y A;  1QKR A;  2YZS A;  3T6J A;  1BZ4 A;  4JEB A;  3EPV A;  5E3C A;  2G62 A;  1MMG A;  2J45 A;  3DWW A;  2WVO A;  2XLV A;  3Q7G A;  4J30 B;  4O7G A;  4A2N B;  5DS5 A;  3MFN A;  2P6V A;  2V3C C;  4JZA A;  2XLH A;  3UR3 C;  3I5P A;  3ZIB A;  1JPN A;  2HMQ A;  2XSE A;  3SEO A;  3DXJ F;  2R7T A;  4P9F A;  3EJN A;  2M4E A;  2XLO A;  3HJC A;  1SR2 A;  4C7O B;  3TOL A;  1WAS A;  2KQ9 A;  4LDK A;  5A6J A;  3VYW A;  1LS1 A;  4BJ5 C;  1ZHT A;  1RCP A;  2EPM X;  4LDR A;  2KSF A;  5KYU B;  1V4A A;  5DQZ A;  3UGP A;  3IQ5 A;  4EBJ A;  2ETS A;  3RQF A;  3CQZ A;  4BJ5 A;  5JRA A;  5COM A;  2EPN A;  2QUP A;  2WZF A;  1UFB A;  3E9V A;  2J9B A;  4DJ9 A;  1G8X A;  2GAQ A;  2WZL A;  2W45 A;  1GGQ A;  1O3U A;  2OG2 A;  3GM1 A;  2B0H A;  3K6B A;  3NMJ A;  4ER9 A;  1E84 A;  2Q7R A;  3FOO A;  1M2O A;  2PNO A;  1CGN A;  3GOD A;  2OJE D;  2DGJ A;  5KYY A;  2ASR A;  1W2W A;  5KYY B;  4DXW A;  1FMW A;  2XXA A;  3GWL A;  3EGX A;  1NBB A;  1TWC A;  4MTG A;  4U9D A;  4EHP A;  5A6K A;  2GFH A;  2A1D D;  1HMO A;  2W4M A;  1Z23 A;  3AGT A;  5AC4 A;  5JP7 A;  1OXK A;  2YHS A;  2A69 F;  2VCA A;  3X2Q C;  3PDM P;  5F28 E;  3B0P A;  1UG7 A;  3EGD A;  5D92 A;  3MX3 A;  4MVR A;  4NQF A;  3G4Z A;  2VB6 A;  1FMV A;  3C8Z A;  3KL4 A;  4CDY A;  1MMN A;  1WGW A;  3ATP A;  1GQA A;  2EIJ C;  1FAP B;  1I4Z A;  4FES A;  1ORJ A;  1YAR O;  3MLG A;  3NMK A;  4R32 A;  4QI2 A;  2OU6 A;  4K0D A;  1OQC A;  4AE4 A;  4HEA J;  2P7V A;  3L8I A;  3C18 A;  3U3B A;  3RYL A;  2XL6 A;  3M79 A;  4CSA A;  4EUK B;  3ZQY A;  2R7X A;  2XXA B;  1HW1 A;  2ZXR A;  3DI5 A;  2BL2 A;  2G3V A;  2LK4 A;  3N0T A;  2P61 A;  4EBK A;  1ZW2 A;  4XWJ A;  3FDQ A;  3FAJ A;  3G4X A;  3U8V A;  2LFF A;  3R7C A;  3EH1 A;  3ZTM A;  3NKE A;  4PFP A;  3SP1 A;  2X0C A;  4KBL A;  5E2Q A;  3LS1 A;  2Y39 A;  1S7Z A;  3GEH A;  3LLI A;  1CPR A;  2YL3 A;  1HE9 A;  4ULW A;  2P1A A;  3EFO A;  2Z15 A;  3DAF A;  1FFH A;  1O5H A;  4BEJ A;  2JX0 A;  2PFD A;  1K40 A;  1RJ9 A;  2VCB A;  4Q5S F;  1V55 C;  3FHD A;  3V5X A;  1OW6 A;  1QSP A;  2W9Y A;  5L0G A;  3JTL O;  4JJG A;  2R7W A;  2YLG A;  2R7S A;  3K1I C;  2NUT A;  2R03 A;  1H7I A;  2DYR C;  2EIN C;  3NYJ A;  3TUL A;  3KYI A;  4NC3 A;  5L0I A;  1TQG A;  1LS4 A;  3H2U A;  4LER A;  1KU2 A;  2WVN A;  3GEE A;  3O6X A;  1H9T A;  1RKE B;  1OXB A;  1D0X A;  5EHH A;  3EHN A;  1T5O A;  3KH2 A;  1QLE C;  2D5R B;  4WAB A;  4AK9 A;  4BEM J;  3DMD A;  3VM6 A;  4N6C A;  3TJ5 A;  5BQI A;  3ZDL A;  4XPW A;  2LD6 A;  4JCZ A;  4IAR A;  1KNY A;  2YQY A;  4LDQ A;  2Y3G A;  1ZHZ A;  4PFO A;  4XEF A;  4BJ1 A;  4KI2 A;  2GDC A;  3IQT A;  1M56 C;  3S29 A;  4N06 A;  1WOL A;  1JMW A;  4CDA A;  5A69 A;  4YN0 B;  2H7B A;  1LPE A;  3KYJ A;  4OD4 A;  2WZG A;  2KW3 C;  3JRT A;  3LJB A;  5T3W A;  1DOW A;  5A6B D;  4J32 B;  5B3S C;  5A6B A;  2PX0 A;  3U2L A;  4P6I C;  5KYX A;  3B71 A;  4IB4 A;  3AJM A;  3U9M A;  2R7U A;  1YLM A;  1Z6A A;  1M2V B;  4JTA B;  3C8G B;  1Q0G A;  2Y69 C;  1MNE A;  3AOU A;  5A6A A;  5HSW A;  3AG4 C;  3KKB A;  1VTM P;  4YL0 A;  2LIG A;  3QW0 A;  3TD7 A;  3OA1 A;  1HY5 A;  2J9V A;  2YL1 A;  3WAQ A;  4EWC A;  2YLI A;  1YA7 O;  3JYH A;  2FFH A;  3RW0 A;  2R7V A;  1OR2 A;  2XLD A;  1D1C A;  3WOD F;  3EQL F;  4NTA A;  1A7E A;  3FOP A;  3HNI A;  3HTK C;  2NPU A;  2PP4 A;  4DRI B;  5AGF A;  2KNH A;  4BPM A;  4C3E A;  3N24 A;  2CCY A;  3LLK A;  3EH2 A;  2LQG A;  3LS0 A;  1BR2 A;  4LLC A;  1K04 A;  3AGU A;  3C7J A;  4J7Y A;  2PF4 E;  3RIP A;  3V5Y A;  4CS9 C;  1Q0F A;  2EIM C;  1HMD A;  4O79 A;  3SXY A;  4AL1 A;  1VK5 A;  2CNW D;  5K0I A;  2R7R A;  3IPM O;  3DE9 A;  5DVW A;  4MW3 A;  4C7O A;  3JZ0 A;  2CNW A;  2EPL X;  3IQ6 A;  3NYL A;  4L6R A;  3DJU B;  3U2M A;  3WG7 C;  4E17 A;  1U0B B;  1I5N A;  5JT4 A;  2HKV A;  3FXH A;  3AG1 C;  3RVY A;  2Q4F A;  4G0H A;  4E7S A;  2ZPA A;  4H4K C;  4PJN A;  2YWA A;  3JSE O;  4MVM A;  3Q7L A;  3ABK C;  4GQH A;  1T9K A;  2GWW A;  4BJ6 C;  1OKK D;  4XLP F;  3MYI A;  2AWY A;  3NG1 A;  1VLS A;  2HMZ A;  1TR2 A;  3SNH A;  1OKK A;  2HZ8 A;  4WJ0 A;  4EKW A;  1VMA A;  4JJF A;  4BJ6 A;  1YZA A;  2KK1 A;  1BBH A;  2AWC A;  2EIL C;  2MHR A;  1XZQ A;  3GM2 A;  3M15 A;  3T9O A;  2IXO A;  2OQM A;  4CIH A;  2H7V C;  4X0R A;  3TOM A;  2XLE A;  1G5Z A;  3HNL A;  4OIP F;  2RD9 A;  5CI8 A; 
#chains in the Genus database with same CATH homology
 4ULV A;  1CPR A;  2YL3 A;  4N4W A;  1QPU A;  1APC A;  4D4X A;  1LM3 B;  4CJG A;  4CJO A;  1EKY A;  1JAF A;  5JS5 A;  1M6T A;  3HNK A;  1QQ3 A;  1YYJ A;  2YLG A;  2YL7 A;  5JSL A;  4NC3 A;  4JEA A;  2XL8 A;  2XM0 A;  1S05 A;  1E85 A;  256B A;  1YYX A;  3C62 A;  2QLA A;  5B3I A;  3M4B A;  4IAR A;  4N6H A;  2XLW A;  4CIP A;  3U8P A;  5JVE A;  4U9E A;  3QW1 A;  3L1M A;  4JEB A;  3M4C A;  4CDA A;  4CDY A;  3ZTZ A;  3QVY A;  2XLV A;  1CGO A;  3VRC A;  1E83 A;  2XLH A;  3DE8 A;  4IB4 A;  2XLO A;  5JUA A;  3TOL A;  1RCP A;  2YKZ A;  3QW0 A;  3IQ5 A;  4JKV A;  5JLI A;  1A7V A;  5JRA A;  2YL1 A;  2YL0 A;  2J9B A;  3ZQV A;  2YLI A;  3NMJ A;  4ER9 A;  2XLD A;  3NMI A;  1CPQ A;  4CX9 A;  3FOO A;  4JE9 A;  1CGN A;  3FOP A;  3HNI A;  5AGF A;  1E86 A;  4U9D A;  4CDV A;  1NBB A;  2CCY A;  3QVZ A;  5JP7 A;  2XM4 A;  3HNJ A;  4WGY A;  3DE9 A;  3IQ6 A;  4L6R A;  2BC5 A;  5JT4 A;  4EIY A;  1GQA A;  1YZC A;  2XLM A;  3NMK A;  2J8W A;  1E84 A;  2XL6 A;  3M79 A;  3ZQY A;  1YZA A;  2YLD A;  1BBH A;  3M15 A;  4IAQ A;  4WGZ A;  3ZTM A;  3C63 A;  4D4N A;  3TOM A;  3ZWI A;  1MQV A;  2XLE A;  3HNL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...