1CGOA

Cytochrome c'
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
125
structure length
125
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLTALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C
publication title Three-dimensional structure of cytochrome c' from two Alcaligenes species and the implications for four-helix bundle structures.
pubmed doi rcsb
source organism Alcaligenes sp.
molecule tags Electron transport (cytochrome)
total genus 48
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 1995-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1cgoA00
2XLVA 3FOOA 3C63A 5JLIA 2BC5A 2XLDA 5JT4A 5JUAA 256BA 5B3IA 4ER9A 2XM4A 1JAFA 1GQAA 4IB4A 1QQ3A 1LM3B 2YL7A 3HNLA 4CDYA 3DE8A 3NMKA 3M79A 4WGYA 4U9EA 3QVYA 3M4BA 3C62A 4EIYA 3ZQYA 4CDVA 1E84A 4WGZA 1RCPA 1YYXA 1E83A 4JEBA 4IARA 4CJOA 4U9DA 2J9BA 3FOPA 3IQ6A 2YL1A 3M4CA 2YKZA 3TOLA 3U8PA 1CPQA 2XL6A 2QLAA 3NMJA 1YZCA 2XLEA 2XLMA 3QW0A 1A7VA 4D4XA 3QW1A 1CGOA 2YLDA 3QVZA 1CPRA 4CIPA 4NC3A 5JS5A 4CX9A 3M15A 1E85A 3HNIA 2YL3A 5JSLA 4JKVA 4N6HA 4IAQA 2YLIA 2XLOA 2YLGA 3ZWIA 2XLWA 2YL0A 1CGNA 1QPUA 2XLHA 3L1MA 3NMIA 4CDAA 1M6TA 5JP7A 4D4NA 4N4WA 3TOMA 1EKYA 3IQ5A 3ZTZA 5JVEA 1E86A 1NBBA 4JEAA 1S05A 1MQVA 5AGFA 2XM0A 4CJGA 3DE9A 3HNJA 1BBHA 3VRCA 1YYJA 3ZTMA 2J8WA 1YZAA 4JE9A 4ULVA 5JRAA 3ZQVA 2XL8A 2CCYA 3HNKA 4L6RA 1APCA
chains in the Genus database with same CATH superfamily
4EHPA 2HJMA 2HV6A 4IGGA 3FOOA 2VCCA 2LSEA 2CNWD 1VYKA 2KSFA 3DZAA 1DOVA 3RYLA 3DM5A 5L0CA 3UGPA 3T4RA 3C8GB 1TWGA 5DQZA 4H4KC 5JLIA 5JT4A 3DXJF 1Y6DA 4BEJA 1MNEA 1EA8A 1JPJA 2DYSC 2R9RB 5JUAA 256BA 3W4YA 4NTBA 2XS1A 5DLJA 4JC7A 4O79A 2QY9A 2R7XA 2R03A 4F4BA 4PACA 1FAPB 2J9WA 1N1CA 2Q3TA 3IHUA 4OINF 4CS9A 4E7ZA 1TKNA 2WVNA 1FR0A 3UR3C 2Y39A 5F5FA 1TQGA 4EBKA 2R25A 4XEFA 2L6GA 3S29A 1HMOA 4CS7A 4OIPF 2OCCC 3IQTA 4C7OB 1SR2A 4GYTA 1RMVA 1NSGB 1VMAA 3M79A 1WWPA 2HMZA 3LS1A 2W4MA 2VCAA 5BQGA 3M4BA 2MYSA 2VCBA 2L6HA 5E33A 2R02A 2QE9A 2YQYA 2YWAA 2LFFA 2JD3A 2PP4A 3C7JA 4MVMA 4CDVA 4O7GA 3GWNA 4Q5SF 1JR8A 5BQHA 3EFOA 4YT8A 1I4ZA 2OJED 2Y3BA 4J7TA 1NLXA 4CSAA 2GAQA 2DGJA 1MMNA 2WB7A 2Q9BA 5COMA 5A6KA 3FXHA 1NU9C 3RH3A 2R7WA 2J9VA 3U0CA 2NUTB 1KU2A 3FOPA 3MFNA 3NYMA 2NG1A 3AQBA 1CPQA 3DJUB 5D91A 2HSQA 2YZSA 3C8GA 4HEAJ 1WATA 3GANA 3O39A 4K0DA 3U9MA 1Z6AA 2W9YA 3DWWA 4MVQA 4RDAA 5KYWB 1OCCC 4G7ZF 3ZG1A 1Q0GA 4JW1A 5CIVA 1TR2A 4P9FA 2JX0A 5L3QA 2CDQA 3B71A 1ZHZA 3CSKA 2YLDA 4XEKA 3U9JA 3QVZA 4QI2A 2L6FA 1MMDA 3S27A 4KC9A 4NTAA 4BPMA 5JS5A 4NTFA 4PJJA 3TD7A 3JSZA 3TULA 3HNIA 4C7OA 2IXNA 1RKEB 2YEVA 1YAUO 2KGOA 2IXPA 1O87A 2GDCA 5EK0A 2AU5A 3DAGA 1OR3A 2XLWA 4MQ9F 4G7HF 4FWVA 2LFDA 2OG2A 3RVZA 3SXMA 4ZLCA 2Y69C 3NMIA 5DS4A 4XLPF 3LAYA 1M6TA 2HS5A 4EKWA 3ASOC 5L0FA 3M1CB 1QVXA 4D4NA 3NKEA 1TWAA 3VM6A 3RW0A 1V74B 2H7OA 3TOMA 3BEHA 3IQ5A 1Z63A 5T3WA 3KPHA 1U89A 1C17M 2V3CC 4E18A 5EGYA 1NBBA 1YJGA 3RF3A 1C03A 5CI9A 5A6BD 1T9KA 4LERA 2MHRA 2XM0A 1ZVZA 2J0WA 4MVSA 1QKRA 2G3KA 2W45A 3MBGA 2NUTA 3T6BA 3UMKA 1HY5A 4Z9JA 3HNJA 3W2WA 1NU7D 2BE5F 3ZC4A 3ZTMA 4JE9A 2TMVP 4J32B 4MNDA 5KYWA 4DBQA 1LVKA 2XL8A 3CAXA 2CYDA 2D5RB 1M57C 5KYXB 4E17A 3K6BA 2IBFA 1D1CA 2MWQA 3PMRA 1RKCA 2KC3A 2UUIA 3O10A 1GGQA 1T6UA 3FMSA 4CSAC 3K1HA 4N6CA 1RKEA 2BC5A 1O3UA 4YJWA 2A0UA 4HE8D 3X1OA 2OOCA 2R7RA 4DBRA 2J0XA 2L9JA 4WJ0A 5A6JA 4MVRA 3AG2C 4XQ1A 2HFIA 3JZ0A 4DOZA 1SF8A 1LI5A 1J8MF 2QUPA 2RSEB 3LJBA 2ZXWC 2P7VA 3US6A 3EFOB 5DQTA 5L0DA 1UFBA 2YL7A 4K1OA 5HSWA 4QDLA 2A6HF 2DYRC 2Q9AA 4JVSA 4LLEA 1MNDA 3DE8A 3HJCA 1M2VB 4WGYA 3JSEO 2KYHA 1ZHWA 4G7OF 5BUOA 1OQCA 1TWHA 3C62A 5F28E 5E3AA 1VYIA 2EPOA 1JPNA 1E84A 3PCVA 1Z3IX 5E3CA 1LE4A 3AGUA 4NY3A 5L3VA 1WGWA 3MX3A 4PJNA 2LQGA 1V54C 4IARA 3AG4C 4U5EE 2IM8A 3EZIA 5B1AC 1EQ1A 2DI3A 1FMWA 3LNMB 3JCUQ 2VC9A 3ABKC 3X2QC 1ZHTA 2VASA 3BRJA 3OA1A 2P61A 1WOLA 4CJOA 5KYXA 2B0HA 1D0ZA 4JJFA 4Z9HA 4B6IA 1H7IA 3AJMA 3S84A 4MTFA 2XRHA 1OCZC 4RBNA 1I4YA 5KYUA 1VLTA 4EBBA 3PHF2 3JTLO 2XL6A 4YN0B 3LUTB 1Z23A 3AG3C 1BDJB 1JOGA 3NMJA 2HSBA 1CGME 1Z5ZA 2ZXRA 2XLMA 4XLNF 4PR9A 1A7VA 2C04A 4ULWA 5K0IA 3QW1A 5KYNA 3E9VA 3KH2A 3MLGA 4I1MA 5TJ5E 2VH3A 1R5ID 4NC3A 1YDIA 4IAOA 2Y3DA 2Y3GA 4CX9A 4IRUA 3T6GB 1E85A 2OJQA 2AP3A 3SXZA 4N6HA 2OU6A 4IAQA 1V4AA 4LDRA 2PFDA 1M2VA 2XLOA 2GFHA 2ZD9A 3EGDB 4BJ6A 2KW3C 4E7SA 2M4EA 2G3VA 1KTMA 1ZZPA 2AWCA 2XL4A 4C3BA 5AC5A 1OW8A 3UMIA 2LCHA 1TWCA 5JP7A 1NZEA 3C8GD 3H65A 4N4WA 4YK5A 3RQGA 3SXYA 1OXKA 4W8KA 2DB4A 2Q4FA 1FMVA 2FGYA 2LK4A 2EILC 4YT2A 3WG7C 1Y4CA 2LP4A 3ZIBA 1E86A 3IPMO 4JEAA 4CDAA 1S05A 4DRJB 2OKUA 3GORA 3A11A 4FX5A 5GPGB 4U5DE 1GS9A 3DD7A 3UGOA 4E0IA 5DS6A 3FVYA 4IWBA 4G78A 3GWLA 3N0TA 2OEXA 1RXQA 3CEXA 1UG7A 1AEPA 3AQCA 1VOMA 3ECSA 1AVOB 2Q7RA 5AC4A 1ORYA 3ZQVA 4FAPB 2HMQA 3QZCA 2JPUA 2KJGA 4MW3A 2F22A 3LLKA 3NDBB 3EHNA 4AK9A 5DVWA 4L6RA 1APCA 4NQFA 4PFPA 2EIMC 2YRFA 5FZTA 2XLVA 2XXAA 3DMDA 3IQCA 5COFA 3U2MA 2EINC 4J30B 4Q4ZF 3C63A 4OIRF 1OR2A 4PFOA 2XLDA 3V7OA 1TFOB 2AWYA 4M63A 3HLZA 1YLMA 3EGDA 2CW0F 2Q00A 3A9CA 4PJMA 2PX0A 4OIQF 1Q0KA 3EH1A 4BEMJ 2WL8A 3K7DA 3U8VA 1HMDA 2XM4A 2J9UA 1H9TA 1GQAA 1QQ3A 3LS0A 1TFKB 4CDYA 3I5PA 3VF0A 2NPUA 2R7SA 1HW1A 2ICWG 1T6QA 3NMKA 3OWTA 3U5SA 4KBLA 1E2XA 2NSFA 3QVYA 3Q7GA 4MTGA 4YL0A 2A69F 1LPEA 3U3BA 3KYIA 3JYYA 4LLCA 2PX3A 2WZGA 3EGXB 1A0BA 4HFFB 3K66A 4WGZA 3TQOA 4BJTA 5KYUB 2R05A 1ZHXA 1RCPA 4XWJA 1D0XA 1YYXA 3F47A 1O5HA 4BG0A 4JEBA 1RJ9A 2O9XA 4MVOA 4BJ6C 4CIHA 3EQLF 1MMAA 3N24A 3SYNA 1VTMP 2G62A 1K04A 2NSGA 1WTYA 2OQMA 3B29A 4HFKB 4BJ1A 1ZU4A 4P6IC 4DRHB 5DS5A 4KI2A 5B1BC 4U5GA 1BR4A 2J9BA 3RFYA 3LEOA 3ZDLA 3MYIA 3L0IA 3TJ5A 4A4AA 3T6JA 3FAJA 3W2VA 3M4CA 1BR1A 2QTVA 2YKZA 3CQZA 2IOQA 3TK0A 2C03A 3TOLA 3U8PA 1ZW3A 4WABA 3H2VA 2L7AA 1I5NA 1XZPA 3EJNA 2J45A 4MVUA 1FFTC 1AUEA 4JJGA 2D4UA 2EPMX 2FFHA 3QW0A 1HW2A 4D4XA 1FFHA 1M2OA 4NCQA 3R7CA 3MYFA 3GODA 1K40A 1CGOA 2CGEA 2PBEA 4JTDB 3B0UX 4P9TA 1CPRA 1J8YF 2EPNA 4GEHA 1R4TA 1K05A 1G4WR 4YWQA 1JMWA 2X51A 1OKKA 5JSLA 1T01A 2KNHA 3NG1A 3ZVRA 3C8ZA 4AX2A 3EG9B 3AOUA 5L0JA 3Q7LA 1LI7A 2YLGA 1BR2A 4R32A 1WN0A 2AVKA 1FNTc 1D1BA 2J7PA 2PF4E 2H7BA 3EHMA 3OEOA 1XZQA 2PNOA 2A6EF 2XLHA 1PD1A 3L1MA 1ORJA 2LD6A 3EGXA 3I4UA 4GQHA 1Q0DA 4PK4A 1HE1A 1T6IA 3GM3A 2A0BA 3KYJA 3SNHA 4PJLA 3V5YA 1EKYA 1NG1A 5A69A 2CNWA 2YVKA 5L0HA 1Q0FA 3ZTZA 4DRIB 1ORSC 3I5QA 3RVYA 4ZLDA 2R7UA 3H2UA 1U6HA 3IEEA 4DVZA 1YVIA 2WVOA 2NUPB 2KK1A 2XXAB 4XPWA 3HKKA 3W8IA 1ZW2A 3DE9A 2E87A 3K1IA 1GM5A 3VRCA 1LKXA 1YYJA 2HJ3A 2J8WA 1YZAA 3NYLA 1OW6A 4ULVA 5A6BA 2J46A 3S90A 2R7VA 5T1DB 4I44A 3DM9B 1QLEC 1M56C 3ZSUA 5JRAA 1U0BB 3Q6NA 3WAQA 3V5ZA 4OIOF 1IW7F 2FAPB 3GEHA 1IZMA 1ZYRF 4A2NB 3SP1A 5BQIA 1DOWA 5D92A 1LIHA 2CCYA 4MS2A 1A41A 3LLIA 4XPYA 2HZ8A 4DXWA 3KL4A 4OD4A 3GEIA 2H7VC 4LACB 2R7QA 4OD5A 4C3DA 3DI5A 3G4ZA 4MVZA 2ZXPA 2IXMA 2EPKX 3JYHA 4U5CE 4AE4B 3EG9A 4U5HA 2Y3HA 3DJNB 3G50A 3J06A 3PDMP 4JRZA 3RIPA 4JURI 4QI0A 3UMHA 1VB5A 1C02A 4MTOA 2WZLA 3SEOA 4BJ5A 5B3IA 3LEVA 1Q0MA 3F46A 3L8JA 1OXBA 3G4XA 3DKAA 4ER9A 1JAFA 1ST6A 1G8XA 1QSPA 4IB4A 4ONSA 3HNLA 1LM3B 5CI8A 1RJ9B 4I3MA 5FCLA 2I15A 1OCOC 3RKOF 3V5XA 1ZU5A 2W4BA 3L8IA 3B0VC 3T9OA 5B3SC 3GM2A 1KNYA 1XWJA 5HV9A 4DVYP 1NFNA 4U9EA 4XPXA 3KMIA 3VYWA 3R2PA 2LIGA 4J7YA 3ABLC 4EIYA 3ZQYA 4CS8A 2L81A 4DJ9A 3O55A 5EHHA 4YT5A 4K7BA 1JRAA 2NUPA 2GWWA 3FAPB 1SZIA 1L7CA 3CZ6A 3FHDA 1VLSA 3LNRA 3QMKA 4G0HA 2H8AA 1H9GA 1D1AA 1E83A 2M64A 3K33A 1F1MA 1FTSA 1G4US 1LS1A 3DAFA 4Z9IA 2R7TA 2HUJA 4JIOA 3ASNC 4AL0A 4U9DA 1V55C 2HV7A 2WZFA 4ANJA 2ZPAA 3IQ6A 2P0NA 2YL1A 5E2QA 1BZ4A 2I8BA 3S28A 1L3PA 2EIKC 3B9QA 5F5HA 1SMYF 5KYYB 2OEVA 2QLAA 3AGTA 4AE4A 1YZCA 3UNGC 2XLEA 3C18A 4C3EA 2ZXOA 2WVQA 4UDVA 4X0RA 3POVA 1YA7O 4CS9C 3JT1A 3K1IC 4CBEA 2Q9CA 2XS8A 1H6GA 1A7DA 2EIJC 4EBJA 1OW7A 3GM1A 3KKBA 3O6XA 1LE2A 2KQ9A 4IJJA 1Z7Qc 4CIPA 1A7EA 3E70C 4RD9A 3M15A 3Q6MA 3U3FA 4YL3A 2QNLA 2YL3A 1NFOA 4JKVA 1SYQA 2P1AA 3LESA 4U5FE 3GEEA 2YLIA 4JCZA 1VK5A 4W8PA 3HTKC 3ZWIA 4YT4A 2YHSA 2YL0A 1CGNA 3ITFA 1QZXA 2B0JA 2IXOA 3JRMO 2R7OA 1PCXA 2EPLX 1QPUA 1PD0A 1OCRC 2XSEA 1LS4A 4KNVA 3WODF 5L0IA 3FDQA 4O6MA 5L0GA 1PV3A 4O6YA 2ASRA 2IYLD 4I1OB 1T5OA 3JRTA 3B0PA 3AG1C 4O6NA 1B68A 2V26A 4U5BE 4BJ5C 1W2WA 3EH2A 5JVEA 3RQFA 4E0HA 4KNWA 4YL1A 1YARO 3NKDA 1MQVA 3ABMC 2VB6A 4XEVA 5AGFA 5IY5C 2GA0A 4JZAA 4EWCA 2UUHA 2BL2A 4LDQA 4JCHA 4CJGA 3U2LA 1OKKD 1G5ZA 3WHNA 3W8HA 3ATPA 1S7ZA 1BBHA 2RD9A 5T3TA 2HKVA 2P6VA 3NRHA 3QTHA 4JTCB 4H54A 2A68F 2X0CA 3S0XA 3L34A 4Q7CA 3EPVA 3EZHA 2A1DD 5KYYA 5A6AA 4LDKA 2J7PD 1HE9A 4MW8A 4CS8C 4JTAB 1MMGA 1D0YA 1YA9A 4N06A 1EI7A 3SXKA 4FESA 3SZRA 4XTKA 5COGA 2ETSA 3RQEA 3S9OA 3NYJA 3N2ZB 3TJ6A 4AL1A 2Z15A 3HNKA 1WASA 3VAYA 1ZHYA 4EUKB
chains in the Genus database with same CATH topology
2XLVA 3FOOA 3C63A 5JLIA 2BC5A 2XLDA 5JT4A 5JUAA 256BA 5B3IA 4ER9A 2XM4A 1JAFA 1GQAA 4IB4A 1QQ3A 1LM3B 2YL7A 3HNLA 4CDYA 3DE8A 3NMKA 3M79A 4WGYA 4U9EA 3QVYA 3M4BA 3C62A 4EIYA 3ZQYA 4CDVA 1E84A 4WGZA 1RCPA 1YYXA 1E83A 4JEBA 4IARA 4CJOA 4U9DA 2J9BA 3FOPA 3IQ6A 2YL1A 3M4CA 2YKZA 3TOLA 3U8PA 1CPQA 2XL6A 2QLAA 3NMJA 1YZCA 2XLEA 2XLMA 3QW0A 1A7VA 4D4XA 3QW1A 1CGOA 2YLDA 3QVZA 1CPRA 4CIPA 4NC3A 5JS5A 4CX9A 3M15A 1E85A 3HNIA 2YL3A 5JSLA 4JKVA 4N6HA 4IAQA 2YLIA 2XLOA 2YLGA 3ZWIA 2XLWA 2YL0A 1CGNA 1QPUA 2XLHA 3L1MA 3NMIA 4CDAA 1M6TA 5JP7A 4D4NA 4N4WA 3TOMA 1EKYA 3IQ5A 3ZTZA 5JVEA 1E86A 1NBBA 4JEAA 1S05A 1MQVA 5AGFA 2XM0A 4CJGA 3DE9A 3HNJA 1BBHA 3VRCA 1YYJA 3ZTMA 2J8WA 1YZAA 4JE9A 4ULVA 5JRAA 3ZQVA 2XL8A 2CCYA 3HNKA 4L6RA 1APCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XLV A;  3FOO A;  3C63 A;  5JLI A;  2BC5 A;  2XLD A;  5JT4 A;  5JUA A;  256B A;  5B3I A;  4ER9 A;  2XM4 A;  1JAF A;  1GQA A;  4IB4 A;  1QQ3 A;  1LM3 B;  2YL7 A;  3HNL A;  4CDY A;  3DE8 A;  3NMK A;  3M79 A;  4WGY A;  4U9E A;  3QVY A;  3M4B A;  3C62 A;  4EIY A;  3ZQY A;  4CDV A;  1E84 A;  4WGZ A;  1RCP A;  1YYX A;  1E83 A;  4JEB A;  4IAR A;  4CJO A;  4U9D A;  2J9B A;  3FOP A;  3IQ6 A;  2YL1 A;  3M4C A;  2YKZ A;  3TOL A;  3U8P A;  1CPQ A;  2XL6 A;  2QLA A;  3NMJ A;  1YZC A;  2XLE A;  2XLM A;  3QW0 A;  1A7V A;  4D4X A;  3QW1 A;  1CGO A;  2YLD A;  3QVZ A;  1CPR A;  4CIP A;  4NC3 A;  5JS5 A;  4CX9 A;  3M15 A;  1E85 A;  3HNI A;  2YL3 A;  5JSL A;  4JKV A;  4N6H A;  4IAQ A;  2YLI A;  2XLO A;  2YLG A;  3ZWI A;  2XLW A;  2YL0 A;  1CGN A;  1QPU A;  2XLH A;  3L1M A;  3NMI A;  4CDA A;  1M6T A;  5JP7 A;  4D4N A;  4N4W A;  3TOM A;  1EKY A;  3IQ5 A;  3ZTZ A;  5JVE A;  1E86 A;  1NBB A;  4JEA A;  1S05 A;  1MQV A;  5AGF A;  2XM0 A;  4CJG A;  3DE9 A;  3HNJ A;  1BBH A;  3VRC A;  1YYJ A;  3ZTM A;  2J8W A;  1YZA A;  4JE9 A;  4ULV A;  5JRA A;  3ZQV A;  2XL8 A;  2CCY A;  3HNK A;  4L6R A;  1APC A; 
#chains in the Genus database with same CATH topology
 4EHP A;  2HJM A;  2HV6 A;  4IGG A;  3FOO A;  2VCC A;  2LSE A;  2CNW D;  1VYK A;  2KSF A;  3DZA A;  1DOV A;  3RYL A;  3DM5 A;  5L0C A;  3UGP A;  3T4R A;  3C8G B;  1TWG A;  5DQZ A;  4H4K C;  5JLI A;  5JT4 A;  3DXJ F;  1Y6D A;  4BEJ A;  1MNE A;  1EA8 A;  1JPJ A;  2DYS C;  2R9R B;  5JUA A;  256B A;  3W4Y A;  4NTB A;  2XS1 A;  5DLJ A;  4JC7 A;  4O79 A;  2QY9 A;  2R7X A;  2R03 A;  4F4B A;  4PAC A;  1FAP B;  2J9W A;  1N1C A;  2Q3T A;  3IHU A;  4OIN F;  4CS9 A;  4E7Z A;  1TKN A;  2WVN A;  1FR0 A;  3UR3 C;  2Y39 A;  5F5F A;  1TQG A;  4EBK A;  2R25 A;  4XEF A;  2L6G A;  3S29 A;  1HMO A;  4CS7 A;  4OIP F;  2OCC C;  3IQT A;  4C7O B;  1SR2 A;  4GYT A;  1RMV A;  1NSG B;  1VMA A;  3M79 A;  1WWP A;  2HMZ A;  3LS1 A;  2W4M A;  2VCA A;  5BQG A;  3M4B A;  2MYS A;  2VCB A;  2L6H A;  5E33 A;  2R02 A;  2QE9 A;  2YQY A;  2YWA A;  2LFF A;  2JD3 A;  2PP4 A;  3C7J A;  4MVM A;  4CDV A;  4O7G A;  3GWN A;  4Q5S F;  1JR8 A;  5BQH A;  3EFO A;  4YT8 A;  1I4Z A;  2OJE D;  2Y3B A;  4J7T A;  1NLX A;  4CSA A;  2GAQ A;  2DGJ A;  1MMN A;  2WB7 A;  2Q9B A;  5COM A;  5A6K A;  3FXH A;  1NU9 C;  3RH3 A;  2R7W A;  2J9V A;  3U0C A;  2NUT B;  1KU2 A;  3FOP A;  3MFN A;  3NYM A;  2NG1 A;  3AQB A;  1CPQ A;  3DJU B;  5D91 A;  2HSQ A;  2YZS A;  3C8G A;  4HEA J;  1WAT A;  3GAN A;  3O39 A;  4K0D A;  3U9M A;  1Z6A A;  2W9Y A;  3DWW A;  4MVQ A;  4RDA A;  5KYW B;  1OCC C;  4G7Z F;  3ZG1 A;  1Q0G A;  4JW1 A;  5CIV A;  1TR2 A;  4P9F A;  2JX0 A;  5L3Q A;  2CDQ A;  3B71 A;  1ZHZ A;  3CSK A;  2YLD A;  4XEK A;  3U9J A;  3QVZ A;  4QI2 A;  2L6F A;  1MMD A;  3S27 A;  4KC9 A;  4NTA A;  4BPM A;  5JS5 A;  4NTF A;  4PJJ A;  3TD7 A;  3JSZ A;  3TUL A;  3HNI A;  4C7O A;  2IXN A;  1RKE B;  2YEV A;  1YAU O;  2KGO A;  2IXP A;  1O87 A;  2GDC A;  5EK0 A;  2AU5 A;  3DAG A;  1OR3 A;  2XLW A;  4MQ9 F;  4G7H F;  4FWV A;  2LFD A;  2OG2 A;  3RVZ A;  3SXM A;  4ZLC A;  2Y69 C;  3NMI A;  5DS4 A;  4XLP F;  3LAY A;  1M6T A;  2HS5 A;  4EKW A;  3ASO C;  5L0F A;  3M1C B;  1QVX A;  4D4N A;  3NKE A;  1TWA A;  3VM6 A;  3RW0 A;  1V74 B;  2H7O A;  3TOM A;  3BEH A;  3IQ5 A;  1Z63 A;  5T3W A;  3KPH A;  1U89 A;  1C17 M;  2V3C C;  4E18 A;  5EGY A;  1NBB A;  1YJG A;  3RF3 A;  1C03 A;  5CI9 A;  5A6B D;  1T9K A;  4LER A;  2MHR A;  2XM0 A;  1ZVZ A;  2J0W A;  4MVS A;  1QKR A;  2G3K A;  2W45 A;  3MBG A;  2NUT A;  3T6B A;  3UMK A;  1HY5 A;  4Z9J A;  3HNJ A;  3W2W A;  1NU7 D;  2BE5 F;  3ZC4 A;  3ZTM A;  4JE9 A;  2TMV P;  4J32 B;  4MND A;  5KYW A;  4DBQ A;  1LVK A;  2XL8 A;  3CAX A;  2CYD A;  2D5R B;  1M57 C;  5KYX B;  4E17 A;  3K6B A;  2IBF A;  1D1C A;  2MWQ A;  3PMR A;  1RKC A;  2KC3 A;  2UUI A;  3O10 A;  1GGQ A;  1T6U A;  3FMS A;  4CSA C;  3K1H A;  4N6C A;  1RKE A;  2BC5 A;  1O3U A;  4YJW A;  2A0U A;  4HE8 D;  3X1O A;  2OOC A;  2R7R A;  4DBR A;  2J0X A;  2L9J A;  4WJ0 A;  5A6J A;  4MVR A;  3AG2 C;  4XQ1 A;  2HFI A;  3JZ0 A;  4DOZ A;  1SF8 A;  1LI5 A;  1J8M F;  2QUP A;  2RSE B;  3LJB A;  2ZXW C;  2P7V A;  3US6 A;  3EFO B;  5DQT A;  5L0D A;  1UFB A;  2YL7 A;  4K1O A;  5HSW A;  4QDL A;  2A6H F;  2DYR C;  2Q9A A;  4JVS A;  4LLE A;  1MND A;  3DE8 A;  3HJC A;  1M2V B;  4WGY A;  3JSE O;  2KYH A;  1ZHW A;  4G7O F;  5BUO A;  1OQC A;  1TWH A;  3C62 A;  5F28 E;  5E3A A;  1VYI A;  2EPO A;  1JPN A;  1E84 A;  3PCV A;  1Z3I X;  5E3C A;  1LE4 A;  3AGU A;  4NY3 A;  5L3V A;  1WGW A;  3MX3 A;  4PJN A;  2LQG A;  1V54 C;  4IAR A;  3AG4 C;  4U5E E;  2IM8 A;  3EZI A;  5B1A C;  1EQ1 A;  2DI3 A;  1FMW A;  3LNM B;  3JCU Q;  2VC9 A;  3ABK C;  3X2Q C;  1ZHT A;  2VAS A;  3BRJ A;  3OA1 A;  2P61 A;  1WOL A;  4CJO A;  5KYX A;  2B0H A;  1D0Z A;  4JJF A;  4Z9H A;  4B6I A;  1H7I A;  3AJM A;  3S84 A;  4MTF A;  2XRH A;  1OCZ C;  4RBN A;  1I4Y A;  5KYU A;  1VLT A;  4EBB A;  3PHF 2;  3JTL O;  2XL6 A;  4YN0 B;  3LUT B;  1Z23 A;  3AG3 C;  1BDJ B;  1JOG A;  3NMJ A;  2HSB A;  1CGM E;  1Z5Z A;  2ZXR A;  2XLM A;  4XLN F;  4PR9 A;  1A7V A;  2C04 A;  4ULW A;  5K0I A;  3QW1 A;  5KYN A;  3E9V A;  3KH2 A;  3MLG A;  4I1M A;  5TJ5 E;  2VH3 A;  1R5I D;  4NC3 A;  1YDI A;  4IAO A;  2Y3D A;  2Y3G A;  4CX9 A;  4IRU A;  3T6G B;  1E85 A;  2OJQ A;  2AP3 A;  3SXZ A;  4N6H A;  2OU6 A;  4IAQ A;  1V4A A;  4LDR A;  2PFD A;  1M2V A;  2XLO A;  2GFH A;  2ZD9 A;  3EGD B;  4BJ6 A;  2KW3 C;  4E7S A;  2M4E A;  2G3V A;  1KTM A;  1ZZP A;  2AWC A;  2XL4 A;  4C3B A;  5AC5 A;  1OW8 A;  3UMI A;  2LCH A;  1TWC A;  5JP7 A;  1NZE A;  3C8G D;  3H65 A;  4N4W A;  4YK5 A;  3RQG A;  3SXY A;  1OXK A;  4W8K A;  2DB4 A;  2Q4F A;  1FMV A;  2FGY A;  2LK4 A;  2EIL C;  4YT2 A;  3WG7 C;  1Y4C A;  2LP4 A;  3ZIB A;  1E86 A;  3IPM O;  4JEA A;  4CDA A;  1S05 A;  4DRJ B;  2OKU A;  3GOR A;  3A11 A;  4FX5 A;  5GPG B;  4U5D E;  1GS9 A;  3DD7 A;  3UGO A;  4E0I A;  5DS6 A;  3FVY A;  4IWB A;  4G78 A;  3GWL A;  3N0T A;  2OEX A;  1RXQ A;  3CEX A;  1UG7 A;  1AEP A;  3AQC A;  1VOM A;  3ECS A;  1AVO B;  2Q7R A;  5AC4 A;  1ORY A;  3ZQV A;  4FAP B;  2HMQ A;  3QZC A;  2JPU A;  2KJG A;  4MW3 A;  2F22 A;  3LLK A;  3NDB B;  3EHN A;  4AK9 A;  5DVW A;  4L6R A;  1APC A;  4NQF A;  4PFP A;  2EIM C;  2YRF A;  5FZT A;  2XLV A;  2XXA A;  3DMD A;  3IQC A;  5COF A;  3U2M A;  2EIN C;  4J30 B;  4Q4Z F;  3C63 A;  4OIR F;  1OR2 A;  4PFO A;  2XLD A;  3V7O A;  1TFO B;  2AWY A;  4M63 A;  3HLZ A;  1YLM A;  3EGD A;  2CW0 F;  2Q00 A;  3A9C A;  4PJM A;  2PX0 A;  4OIQ F;  1Q0K A;  3EH1 A;  4BEM J;  2WL8 A;  3K7D A;  3U8V A;  1HMD A;  2XM4 A;  2J9U A;  1H9T A;  1GQA A;  1QQ3 A;  3LS0 A;  1TFK B;  4CDY A;  3I5P A;  3VF0 A;  2NPU A;  2R7S A;  1HW1 A;  2ICW G;  1T6Q A;  3NMK A;  3OWT A;  3U5S A;  4KBL A;  1E2X A;  2NSF A;  3QVY A;  3Q7G A;  4MTG A;  4YL0 A;  2A69 F;  1LPE A;  3U3B A;  3KYI A;  3JYY A;  4LLC A;  2PX3 A;  2WZG A;  3EGX B;  1A0B A;  4HFF B;  3K66 A;  4WGZ A;  3TQO A;  4BJT A;  5KYU B;  2R05 A;  1ZHX A;  1RCP A;  4XWJ A;  1D0X A;  1YYX A;  3F47 A;  1O5H A;  4BG0 A;  4JEB A;  1RJ9 A;  2O9X A;  4MVO A;  4BJ6 C;  4CIH A;  3EQL F;  1MMA A;  3N24 A;  3SYN A;  1VTM P;  2G62 A;  1K04 A;  2NSG A;  1WTY A;  2OQM A;  3B29 A;  4HFK B;  4BJ1 A;  1ZU4 A;  4P6I C;  4DRH B;  5DS5 A;  4KI2 A;  5B1B C;  4U5G A;  1BR4 A;  2J9B A;  3RFY A;  3LEO A;  3ZDL A;  3MYI A;  3L0I A;  3TJ5 A;  4A4A A;  3T6J A;  3FAJ A;  3W2V A;  3M4C A;  1BR1 A;  2QTV A;  2YKZ A;  3CQZ A;  2IOQ A;  3TK0 A;  2C03 A;  3TOL A;  3U8P A;  1ZW3 A;  4WAB A;  3H2V A;  2L7A A;  1I5N A;  1XZP A;  3EJN A;  2J45 A;  4MVU A;  1FFT C;  1AUE A;  4JJG A;  2D4U A;  2EPM X;  2FFH A;  3QW0 A;  1HW2 A;  4D4X A;  1FFH A;  1M2O A;  4NCQ A;  3R7C A;  3MYF A;  3GOD A;  1K40 A;  1CGO A;  2CGE A;  2PBE A;  4JTD B;  3B0U X;  4P9T A;  1CPR A;  1J8Y F;  2EPN A;  4GEH A;  1R4T A;  1K05 A;  1G4W R;  4YWQ A;  1JMW A;  2X51 A;  1OKK A;  5JSL A;  1T01 A;  2KNH A;  3NG1 A;  3ZVR A;  3C8Z A;  4AX2 A;  3EG9 B;  3AOU A;  5L0J A;  3Q7L A;  1LI7 A;  2YLG A;  1BR2 A;  4R32 A;  1WN0 A;  2AVK A;  1FNT c;  1D1B A;  2J7P A;  2PF4 E;  2H7B A;  3EHM A;  3OEO A;  1XZQ A;  2PNO A;  2A6E F;  2XLH A;  1PD1 A;  3L1M A;  1ORJ A;  2LD6 A;  3EGX A;  3I4U A;  4GQH A;  1Q0D A;  4PK4 A;  1HE1 A;  1T6I A;  3GM3 A;  2A0B A;  3KYJ A;  3SNH A;  4PJL A;  3V5Y A;  1EKY A;  1NG1 A;  5A69 A;  2CNW A;  2YVK A;  5L0H A;  1Q0F A;  3ZTZ A;  4DRI B;  1ORS C;  3I5Q A;  3RVY A;  4ZLD A;  2R7U A;  3H2U A;  1U6H A;  3IEE A;  4DVZ A;  1YVI A;  2WVO A;  2NUP B;  2KK1 A;  2XXA B;  4XPW A;  3HKK A;  3W8I A;  1ZW2 A;  3DE9 A;  2E87 A;  3K1I A;  1GM5 A;  3VRC A;  1LKX A;  1YYJ A;  2HJ3 A;  2J8W A;  1YZA A;  3NYL A;  1OW6 A;  4ULV A;  5A6B A;  2J46 A;  3S90 A;  2R7V A;  5T1D B;  4I44 A;  3DM9 B;  1QLE C;  1M56 C;  3ZSU A;  5JRA A;  1U0B B;  3Q6N A;  3WAQ A;  3V5Z A;  4OIO F;  1IW7 F;  2FAP B;  3GEH A;  1IZM A;  1ZYR F;  4A2N B;  3SP1 A;  5BQI A;  1DOW A;  5D92 A;  1LIH A;  2CCY A;  4MS2 A;  1A41 A;  3LLI A;  4XPY A;  2HZ8 A;  4DXW A;  3KL4 A;  4OD4 A;  3GEI A;  2H7V C;  4LAC B;  2R7Q A;  4OD5 A;  4C3D A;  3DI5 A;  3G4Z A;  4MVZ A;  2ZXP A;  2IXM A;  2EPK X;  3JYH A;  4U5C E;  4AE4 B;  3EG9 A;  4U5H A;  2Y3H A;  3DJN B;  3G50 A;  3J06 A;  3PDM P;  4JRZ A;  3RIP A;  4JUR I;  4QI0 A;  3UMH A;  1VB5 A;  1C02 A;  4MTO A;  2WZL A;  3SEO A;  4BJ5 A;  5B3I A;  3LEV A;  1Q0M A;  3F46 A;  3L8J A;  1OXB A;  3G4X A;  3DKA A;  4ER9 A;  1JAF A;  1ST6 A;  1G8X A;  1QSP A;  4IB4 A;  4ONS A;  3HNL A;  1LM3 B;  5CI8 A;  1RJ9 B;  4I3M A;  5FCL A;  2I15 A;  1OCO C;  3RKO F;  3V5X A;  1ZU5 A;  2W4B A;  3L8I A;  3B0V C;  3T9O A;  5B3S C;  3GM2 A;  1KNY A;  1XWJ A;  5HV9 A;  4DVY P;  1NFN A;  4U9E A;  4XPX A;  3KMI A;  3VYW A;  3R2P A;  2LIG A;  4J7Y A;  3ABL C;  4EIY A;  3ZQY A;  4CS8 A;  2L81 A;  4DJ9 A;  3O55 A;  5EHH A;  4YT5 A;  4K7B A;  1JRA A;  2NUP A;  2GWW A;  3FAP B;  1SZI A;  1L7C A;  3CZ6 A;  3FHD A;  1VLS A;  3LNR A;  3QMK A;  4G0H A;  2H8A A;  1H9G A;  1D1A A;  1E83 A;  2M64 A;  3K33 A;  1F1M A;  1FTS A;  1G4U S;  1LS1 A;  3DAF A;  4Z9I A;  2R7T A;  2HUJ A;  4JIO A;  3ASN C;  4AL0 A;  4U9D A;  1V55 C;  2HV7 A;  2WZF A;  4ANJ A;  2ZPA A;  3IQ6 A;  2P0N A;  2YL1 A;  5E2Q A;  1BZ4 A;  2I8B A;  3S28 A;  1L3P A;  2EIK C;  3B9Q A;  5F5H A;  1SMY F;  5KYY B;  2OEV A;  2QLA A;  3AGT A;  4AE4 A;  1YZC A;  3UNG C;  2XLE A;  3C18 A;  4C3E A;  2ZXO A;  2WVQ A;  4UDV A;  4X0R A;  3POV A;  1YA7 O;  4CS9 C;  3JT1 A;  3K1I C;  4CBE A;  2Q9C A;  2XS8 A;  1H6G A;  1A7D A;  2EIJ C;  4EBJ A;  1OW7 A;  3GM1 A;  3KKB A;  3O6X A;  1LE2 A;  2KQ9 A;  4IJJ A;  1Z7Q c;  4CIP A;  1A7E A;  3E70 C;  4RD9 A;  3M15 A;  3Q6M A;  3U3F A;  4YL3 A;  2QNL A;  2YL3 A;  1NFO A;  4JKV A;  1SYQ A;  2P1A A;  3LES A;  4U5F E;  3GEE A;  2YLI A;  4JCZ A;  1VK5 A;  4W8P A;  3HTK C;  3ZWI A;  4YT4 A;  2YHS A;  2YL0 A;  1CGN A;  3ITF A;  1QZX A;  2B0J A;  2IXO A;  3JRM O;  2R7O A;  1PCX A;  2EPL X;  1QPU A;  1PD0 A;  1OCR C;  2XSE A;  1LS4 A;  4KNV A;  3WOD F;  5L0I A;  3FDQ A;  4O6M A;  5L0G A;  1PV3 A;  4O6Y A;  2ASR A;  2IYL D;  4I1O B;  1T5O A;  3JRT A;  3B0P A;  3AG1 C;  4O6N A;  1B68 A;  2V26 A;  4U5B E;  4BJ5 C;  1W2W A;  3EH2 A;  5JVE A;  3RQF A;  4E0H A;  4KNW A;  4YL1 A;  1YAR O;  3NKD A;  1MQV A;  3ABM C;  2VB6 A;  4XEV A;  5AGF A;  5IY5 C;  2GA0 A;  4JZA A;  4EWC A;  2UUH A;  2BL2 A;  4LDQ A;  4JCH A;  4CJG A;  3U2L A;  1OKK D;  1G5Z A;  3WHN A;  3W8H A;  3ATP A;  1S7Z A;  1BBH A;  2RD9 A;  5T3T A;  2HKV A;  2P6V A;  3NRH A;  3QTH A;  4JTC B;  4H54 A;  2A68 F;  2X0C A;  3S0X A;  3L34 A;  4Q7C A;  3EPV A;  3EZH A;  2A1D D;  5KYY A;  5A6A A;  4LDK A;  2J7P D;  1HE9 A;  4MW8 A;  4CS8 C;  4JTA B;  1MMG A;  1D0Y A;  1YA9 A;  4N06 A;  1EI7 A;  3SXK A;  4FES A;  3SZR A;  4XTK A;  5COG A;  2ETS A;  3RQE A;  3S9O A;  3NYJ A;  3N2Z B;  3TJ6 A;  4AL1 A;  2Z15 A;  3HNK A;  1WAS A;  3VAY A;  1ZHY A;  4EUK B; 
#chains in the Genus database with same CATH homology
 2XLV A;  3FOO A;  3C63 A;  5JLI A;  2BC5 A;  2XLD A;  5JT4 A;  5JUA A;  256B A;  5B3I A;  4ER9 A;  2XM4 A;  1JAF A;  1GQA A;  4IB4 A;  1QQ3 A;  1LM3 B;  2YL7 A;  3HNL A;  4CDY A;  3DE8 A;  3NMK A;  3M79 A;  4WGY A;  4U9E A;  3QVY A;  3M4B A;  3C62 A;  4EIY A;  3ZQY A;  4CDV A;  1E84 A;  4WGZ A;  1RCP A;  1YYX A;  1E83 A;  4JEB A;  4IAR A;  4CJO A;  4U9D A;  2J9B A;  3FOP A;  3IQ6 A;  2YL1 A;  3M4C A;  2YKZ A;  3TOL A;  3U8P A;  1CPQ A;  2XL6 A;  2QLA A;  3NMJ A;  1YZC A;  2XLE A;  2XLM A;  3QW0 A;  1A7V A;  4D4X A;  3QW1 A;  1CGO A;  2YLD A;  3QVZ A;  1CPR A;  4CIP A;  4NC3 A;  5JS5 A;  4CX9 A;  3M15 A;  1E85 A;  3HNI A;  2YL3 A;  5JSL A;  4JKV A;  4N6H A;  4IAQ A;  2YLI A;  2XLO A;  2YLG A;  3ZWI A;  2XLW A;  2YL0 A;  1CGN A;  1QPU A;  2XLH A;  3L1M A;  3NMI A;  4CDA A;  1M6T A;  5JP7 A;  4D4N A;  4N4W A;  3TOM A;  1EKY A;  3IQ5 A;  3ZTZ A;  5JVE A;  1E86 A;  1NBB A;  4JEA A;  1S05 A;  1MQV A;  5AGF A;  2XM0 A;  4CJG A;  3DE9 A;  3HNJ A;  1BBH A;  3VRC A;  1YYJ A;  3ZTM A;  2J8W A;  1YZA A;  4JE9 A;  4ULV A;  5JRA A;  3ZQV A;  2XL8 A;  2CCY A;  3HNK A;  4L6R A;  1APC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...