4X0RA

Crystal structure of human mxb stalk domain
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
236
structure length
201
Chain Sequence
b'EADKMFFLIEKIKMFNQDIEKLVEGEEVVRENETRLYNKIREDFKNWVGILATNTQKVKNIIHEETFEIIVHQYIQQLVEPALSMLQKAMEIIQQAFINVAKKHFGEFFNLNQTVQSTIEDIKVKHTAKAENMIQLQFRMEQMVFKTEIGIHLNAYFLETSKRLANQIPFIIQYFMLRENGDSLQKAMMQILQEKNRYSWL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interferon-induced GTP-binding protein Mx2
publication title Structural insight into the assembly of human anti-HIV dynamin-like protein MxB/Mx2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antiviral protein
total genus 87
structure length 201
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1240 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4x0rA00
3ZVRA 4X0RA 3SNHA 3LJBA 3SZRA 4BEJA
chains in the Genus database with same CATH superfamily
1Q0FA 2PF4E 3ECSA 2BC5A 3SNHA 3M4CA 2XLHA 2W4MA 2YL3A 2QTVA 1ZHWA 3DE8A 4JTDB 4RDAA 3FVYA 3U8VA 3N2ZB 1O5HA 1VB5A 2G62A 2WVNA 5T3WA 3EFOB 4C3BA 1AVOB 1DOWA 1VK5A 4WABA 2NG1A 2AP3A 4BJ5C 1EKYA 2VCBA 2Y3DA 4MVMA 5TJ5E 3SP1A 3ZQVA 5L3VA 2DYSC 4EUKB 2WZLA 2TMVP 4CIPA 3NMJA 3MX3A 4PFOA 3FAJA 2X0CA 3Q6MA 1OKKA 3C8GD 2CW0F 1TKNA 1TWHA 2UUHA 1L7CA 4NTFA 4MNDA 2XS1A 4D4NA 3CEXA 5L0GA 3Q6NA 2XLVA 1FMWA 2UUIA 1QQ3A 2AWCA 4BJTA 1MQVA 2HJ3A 3H2VA 2OKUA 1A7DA 4WGZA 5EHHA 4CX9A 2R7RA 3C7JA 5DQZA 2E87A 1RXQA 2LIGA 1J8MF 4UDVA 3EGDA 1LS1A 4MQ9F 1F1MA 3O39A 3M79A 2IBFA 4JEAA 1M2VB 3CAXA 2R7QA 4YT4A 1OCCC 2F22A 3TULA 2CDQA 2IOQA 4CBEA 1LI7A 1NBBA 2PBEA 3L8JA 4I1MA 4CDYA 2XSEA 3EG9B 4BJ6A 4MW3A 3MLGA 2HJMA 4QDLA 4DJ9A 3GEIA 1JPNA 2FAPB 1I4ZA 1OCRC 3EGXA 3JRMO 1K40A 1WATA 4IAOA 4LLCA 3S28A 5DVWA 5A6JA 5JRAA 3MBGA 1TQGA 2O9XA 5A6AA 2ZXWC 2QLAA 2NSGA 4AX2A 1RKCA 1QLEC 2OJQA 5E3CA 5CIVA 4O7GA 5EK0A 3U3FA 3JT1A 1T01A 3PDMP 2MYSA 4MTFA 4OINF 3G4ZA 5AC4A 1G4WR 2A1DD 2EPLX 2RD9A 4MTGA 4YK5A 1OCOC 1Q0KA 2PX3A 1VLTA 2VCCA 3V5YA 1FMVA 4K1OA 1LE2A 3UR3C 3A11A 3RKOF 4ANJA 4MVQA 2YEVA 4CJGA 3UNGC 4D4XA 1JMWA 4G78A 1WWPA 2Y3BA 4X0RA 1HE1A 2J9VA 4E7SA 2Q3TA 3BEHA 3TK0A 2YKZA 4LDKA 3RW0A 5L0IA 3Q7LA 4EBKA 3H65A 2J8WA 4JJFA 3VAYA 5KYXB 1E2XA 1M2OA 4BPMA 1HMOA 4E18A 5B1BC 3QMKA 4EBBA 3JSEO 4IB4A 3K1IA 1UFBA 2WB7A 4WGYA 4AE4A 4MTOA 4GYTA 3JZ0A 4YL1A 5DLJA 2EINC 1KU2A 2H8AA 2Y39A 3VRCA 1E85A 4MS2A 2YHSA 3LESA 2P0NA 3FOPA 2EILC 4JEBA 3S0XA 2XRHA 1ZVZA 3KPHA 5L0JA 1OCZC 1T6QA 1XZPA 3JRTA 1M57C 5BQIA 2DGJA 1YJGA 2HSBA 2OU6A 2MWQA 1A41A 1A7VA 4KC9A 1VLSA 4PJJA 1E86A 2LFDA 5IY5C 3ABLC 2R9RB 2J9UA 3DXJF 1R5ID 4W8PA 2W45A 3JCUQ 4GEHA 4N6CA 1QPUA 5KYWA 1BZ4A 2ZD9A 2J46A 4OIRF 1V74B 3R7CA 4HFKB 1YYXA 4IGGA 5DS5A 2ICWG 1T5OA 1N1CA 3RIPA 4MVUA 5KYUA 1SF8A 2Q4FA 3OWTA 4JC7A 3PCVA 2IYLD 5JS5A 3R2PA 3SXKA 1D1AA 1YA7O 1ZZPA 2GDCA 2KGOA 4JURI 4L6RA 5B3SC 1EQ1A 2XM0A 3MYIA 3O6XA 3AQBA 2W4BA 2WZFA 3PMRA 4NY3A 2NPUA 2R05A 4C7OB 3A9CA 4G7OF 4C3EA 3DD7A 2JX0A 3AG2C 4Q4ZF 3F46A 2L81A 3M4BA 2L7AA 2VASA 2KSFA 2LSEA 4M63A 3RQEA 5D91A 1U6HA 2OEVA 2LD6A 4NTAA 4CS7A 4NQFA 4K0DA 1D0YA 3QW0A 4PJLA 2HV6A 2L9JA 4Z9HA 2XLMA 3GM2A 3ZWIA 3JSZA 1H7IA 1V55C 2NUPB 3C63A 1VYKA 2D4UA 4U5EE 1R4TA 4P9TA 4O6YA 4IRUA 1PV3A 1RJ9A 1D0ZA 2VC9A 3FMSA 4G0HA 4C3DA 3E9VA 4CS8A 3KL4A 1M6TA 2H7VC 2A69F 2HSQA 3LEOA 2G3KA 1YYJA 3GANA 3CQZA 5F5HA 1LIHA 1LKXA 1WN0A 3IPMO 4PR9A 3ZTZA 2AWYA 4BG0A 1BR1A 1JOGA 3EQLF 1TFKB 2J9BA 1ZU4A 2YVKA 3N24A 5AGFA 1EI7A 3DKAA 3H2UA 2EPMX 2V26A 1MMAA 2J45A 3IQ5A 3WAQA 3ZIBA 1HY5A 1PD1A 3DM5A 3L0IA 4Q7CA 2DI3A 1MMDA 1FFHA 1TWGA 4XEVA 1BR2A 3LNRA 5DQTA 1QSPA 2KQ9A 3W2VA 3B0PA 2HMZA 3NMIA 4BJ5A 4MW8A 1CGOA 2KC3A 3KKBA 1MMNA 1WOLA 1IZMA 3ASOC 1TWCA 2QE9A 3HJCA 3QVYA 5EGYA 3C8ZA 4LACB 2R7XA 1I5NA 3O55A 4NCQA 2VH3A 3EZIA 3X1OA 1YARO 2I8BA 3ATPA 1H9GA 3LAYA 4MVSA 1S05A 4RBNA 2KNHA 2Q9AA 5T3TA 2XM4A 4J7TA 3HNLA 3I5PA 2M64A 4BJ6C 1LPEA 3N0TA 3TJ6A 2IM8A 4Q5SF 4OIOF 2YL7A 2Q9CA 4O79A 3IQCA 2PFDA 2P6VA 3DM9B 5JUAA 2ETSA 2PX0A 2XXAB 4IJJA 5DS6A 1NFOA 4FWVA 4OD4A 2LK4A 1M2VA 2CNWD 2I15A 3SZRA 2ASRA 4GQHA 4ER9A 1NU9C 2Y3HA 3AQCA 2YLIA 2EIMC 2HS5A 2B0HA 3DAFA 1IW7F 3L34A 1RKEB 3EG9A 4W8KA 3TQOA 1LM3B 4YT8A 2L6GA 1D1CA 2J9WA 3K7DA 4ULWA 3QTHA 3S9OA 2Q7RA 3KH2A 1LE4A 1KNYA 4HFFB 2OCCC 4KBLA 1Q0GA 2AVKA 4K7BA 5E33A 4F4BA 1A0BA 3ZG1A 1HW2A 1W2WA 3B0VC 3C8GB 2LCHA 3RF3A 2LQGA 2ZXRA 2ZXOA 4IAQA 4YJWA 5L0CA 3U5SA 1JR8A 4FESA 4BEJA 1GM5A 4JRZA 1E83A 1PD0A 4KNVA 3U0CA 2Q00A 3AJMA 4CSAC 4DBQA 4U5CE 3K1IC 3LEVA 3B71A 2DYRC 3GORA 4DBRA 1M56C 2HV7A 2LFFA 2LP4A 3HLZA 5FZTA 4AL0A 5L0DA 3ZVRA 1NU7D 2QUPA 4XLNF 3PHF2 2OG2A 5A6BA 2R7VA 3CSKA 4LDRA 2J7PA 1B68A 1YZAA 3US6A 3ZTMA 5KYXA 4I1OB 3GWNA 2VCAA 2WVOA 3CZ6A 3TJ5A 5HSWA 1NZEA 3LS1A 2A0UA 4E0HA 3DJUB 3QZCA 1WASA 4O6NA 4U5FE 1VOMA 1Z7Qc 3NYLA 4DRHB 4MVOA 4CDAA 2P7VA 4B6IA 1C02A 4E17A 1OKKD 3JYHA 2JPUA 4IARA 3AOUA 4NTBA 3U8PA 1E84A 3SXMA 1NSGB 5F5FA 1YDIA 1WGWA 2B0JA 2XL6A 3JTLO 3NRHA 3NYMA 2NUTA 3RQGA 3RVZA 2A68F 3W2WA 3WODF 1GQAA 1OR2A 3T4RA 2R02A 2W9YA 4N4WA 2XLDA 3DAGA 2HMQA 2IXMA 3RVYA 5KYYA 4JTCB 3ZSUA 4JKVA 2L6FA 4J30B 1V4AA 2WL8A 1I4YA 2BE5F 3MFNA 4JVSA 1YA9A 3VM6A 3E70C 3IQ6A 2CGEA 5F28E 3UGPA 1C17M 2R25A 4N6HA 4U9EA 2X51A 4OIPF 1YLMA 1ZHZA 4KI2A 1OQCA 4JTAB 1TWAA 5D92A 1JAFA 3L1MA 1LS4A 3TOLA 1L3PA 3C62A 3T6JA 4CS9A 1G4US 2A6EF 3FXHA 1O87A 3HTKC 3B29A 1BR4A 4XWJA 4A4AA 4C7OA 4P6IC 1ORSC 3LLKA 1K04A 4JW1A 4H54A 2G3VA 2L6HA 4H4KC 1T6IA 1FFTC 4DVZA 1V54C 3ASNC 3EHNA 4MVZA 1BDJB 1YVIA 3LNMB 4O6MA 3W8IA 5B1AC 3I4UA 3T6BA 3O10A 3ZC4A 1U89A 2XLEA 3U2MA 3EH1A 3IQTA 1T6UA 5BQGA 3EPVA 3S29A 1QZXA 1XZQA 256BA 5K0IA 3I5QA 1XWJA 1ZU5A 2KW3C 3AGUA 5JSLA 1OXBA 4JIOA 4U5GA 5JLIA 4EKWA 2HUJA 3OA1A 3VF0A 5JT4A 4HE8D 4PJNA 3U3BA 3AG3C 2XL4A 2AU5A 3LJBA 5HV9A 2IXOA 1YAUO 2GWWA 3SXZA 3IHUA 3B0UX 1APCA 1FAPB 1SR2A 1ZHXA 2J0WA 3EFOA 2IXNA 3M15A 4EBJA 3FHDA 1A7EA 4OD5A 3QW1A 4Z9IA 4EHPA 5BUOA 3C18A 2OEXA 3FAPB 3NG1A 2VB6A 3NKDA 4XPWA 3U9MA 2R7WA 4RD9A 3AG1C 4I44A 2R7OA 3GWLA 3OEOA 4ULVA 4DRIB 1S7ZA 2CCYA 3FOOA 2KYHA 3L8IA 5L0HA 1TFOB 2KJGA 2YLDA 2J0XA 3EGDB 4YT5A 5A6BD 1AUEA 2J7PD 1FR0A 2YLGA 3B9QA 3DE9A 3KMIA 3F47A 4HEAJ 4NC3A 4CJOA 4N06A 5L0FA 4YWQA 1C03A 1Z3IX 2P1AA 2PNOA 2XL8A 2XLOA 4J32B 4JCHA 3LS0A 4PACA 4IWBA 5CI8A 3S27A 3T6GB 5FCLA 5KYNA 4CDVA 3U2LA 3UMIA 2GA0A 3ZDLA 3V5XA 2A6HF 3EGXB 4P9FA 4BJ1A 2YRFA 3RYLA 1HW1A 4DOZA 4XQ1A 1MMGA 2GFHA 3K66A 4YL3A 5AC5A 2PP4A 3HNJA 1J8YF 2WZGA 2Z15A 5GPGB 4XLPF 2QNLA 2JD3A 3LUTB 3FDQA 2GAQA 2QY9A 4JJGA 3NDBB 1PCXA 1VYIA 1Z5ZA 1AEPA 1ZW2A 2HZ8A 4XEFA 4E7ZA 4OIQF 3AG4C 3M1CB 1CPQA 1SYQA 1U0BB 1D1BA 3ITFA 4LLEA 3V5ZA 2XXAA 5E2QA 4ZLCA 4R32A 5JVEA 4DRJB 4JCZA 1JRAA 1EA8A 1NFNA 3QVZA 5L3QA 1GGQA 1NG1A 2Y69C 1T9KA 3SYNA 2Q9BA 1FNTc 4JE9A 1FTSA 4A2NB 3V7OA 3VYWA 3IEEA 1RKEA 1Z23A 2EPNA 1OW6A 2P61A 4FAPB 1BBHA 2Y3GA 5B3IA 3GEEA 4YN0B 1LI5A 1Y6DA 2BL2A 1H9TA 2C04A 1SZIA 4G7HF 4ZLDA 3HNKA 3TOMA 2DB4A 1CPRA 4EWCA 1RMVA 4CIHA 1TR2A 4DXWA 3DMDA 4AE4B 2D5RB 2XLWA 4XPYA 3MYFA 1WTYA 3RQFA 2EIJC 3EZHA 3W4YA 3C8GA 3TD7A 1Z63A 2R7SA 1G8XA 3NKEA 3SXYA 1QVXA 1Y4CA 3W8HA 5COMA 4LDQA 2R7UA 3UMKA 3AGTA 1OR3A 5JP7A 2A0BA 5DS4A 1VMAA 2YZSA 5A69A 3EHMA 2OQMA 4CSAA 3BRJA 3UGOA 2NSFA 4PK4A 3EJNA 1K05A 2FFHA 1ZHTA 4AL1A 2OOCA 4WJ0A 1ZW3A 2FGYA 2M4EA 5KYWB 2EPOA 1ORYA 1NLXA 2RSEB 3S90A 1D0XA 1Q0MA 2H7BA 2ZPAA 4PFPA 3GM3A 1YZCA 4AK9A 4LERA 1LVKA 5KYUB 4KNWA 1CGME 2NUTB 4QI0A 2XS8A 3LLIA 3K1HA 3DJNB 3G4XA 3HKKA 2YQYA 4FX5A 1GS9A 1ZHYA 1UG7A 4I3MA 4PJMA 5CI9A 4E0IA 3JYYA 1JPJA 4Z9JA 1KTMA 2HFIA 1CGNA 1OW7A 4JZAA 3S84A 3POVA 5KYYB 3EH2A 3K6BA 5COFA 3X2QC 5BQHA 3U9JA 1MNEA 4XEKA 5T1DB 1RCPA 2YL0A 3DI5A 1O3UA 3RFYA 3SEOA 2CNWA 3K33A 1VTMP 4ONSA 1H6GA 1G5ZA 4MVRA 4U9DA 1HMDA 4U5DE 4XTKA 3GM1A 3ZQYA 1QKRA 3ABMC 4EIYA 3KYJA 1ORJA 1SMYF 1OW8A 3NMKA 3GODA 5COGA 2V3CC 3T9OA 3ABKC 4CS9C 2OJED 2WVQA 3RH3A 4DVYP 3GEHA 2R7TA 2YL1A 2YWAA 3Q7GA 4J7YA 2EPKX 2IXPA 4U5HA 3WHNA 1HE9A 2R03A 1OXKA 4XPXA 1DOVA 5E3AA 3HNIA 2KK1A 4CS8C 3NYJA 4YT2A 1RJ9B 2HKVA 1MNDA 4U5BE 3UMHA 4G7ZF 3DWWA 3J06A 2ZXPA 2H7OA 1ST6A 3WG7C 4BEMJ 4YL0A 3KYIA 2EIKC 2NUPA 1ZYRF 2C03A 2CYDA 3G50A 5A6KA 1Z6AA 4QI2A 3DZAA 1Q0DA 2MHRA
chains in the Genus database with same CATH topology
3ECSA 2PF4E 3SNHA 2W4MA 2QTVA 1ZHWA 4RDAA 3FVYA 3N2ZB 1O5HA 2G62A 2WVNA 5T3WA 4C3BA 3EFOB 1VK5A 4BJ5C 2NG1A 2Y3DA 3SP1A 5L3VA 2DYSC 2WZLA 3MX3A 4PFOA 3FAJA 3Q6MA 1OKKA 2CW0F 1TKNA 1TWHA 4MNDA 3Q6NA 1FMWA 4BJTA 5EHHA 2R7RA 5DQZA 2E87A 1J8MF 3EGDA 1LS1A 4MQ9F 3O39A 1M2VB 4YT4A 2R7QA 1OCCC 2CDQA 2IOQA 4CBEA 4I1MA 2XSEA 3EG9B 4BJ6A 3MLGA 4QDLA 1JPNA 3S28A 1OCRC 3EGXA 4IAOA 4LLCA 5DVWA 2O9XA 2ZXWC 4AX2A 5E3CA 1QLEC 4O7GA 3JT1A 2MYSA 4OINF 2A1DD 1OCOC 2PX3A 1FMVA 3UR3C 3RKOF 4ANJA 2YEVA 3UNGC 2Y3BA 4X0RA 2J9VA 4E7SA 2Q3TA 3Q7LA 3H65A 4JJFA 3VAYA 5KYXB 1M2OA 5B1BC 3QMKA 4EBBA 2WB7A 4AE4A 4GYTA 5DLJA 2EINC 1KU2A 2Y39A 2YHSA 3LESA 2EILC 3S0XA 2XRHA 1OCZC 3JRTA 1M57C 2DGJA 2MWQA 4KC9A 4PJJA 5IY5C 3ABLC 2J9UA 3DXJF 2W45A 3JCUQ 4GEHA 5KYWA 2J46A 4OIRF 4HFKB 5DS5A 1N1CA 3RIPA 5KYUA 1SF8A 3OWTA 2IYLD 1D1AA 2KGOA 4JURI 5B3SC 3O6XA 3AQBA 2W4BA 2WZFA 3PMRA 4NY3A 4C7OB 4G7OF 4C3EA 3DD7A 3AG2C 4Q4ZF 3F46A 2L81A 2VASA 2LSEA 4M63A 5D91A 4CS7A 4K0DA 1D0YA 4PJLA 2HV6A 2L9JA 3JSZA 1V55C 2NUPB 1VYKA 4U5EE 4O6YA 4IRUA 1RJ9A 1D0ZA 4G0HA 4C3DA 3E9VA 4CS8A 3KL4A 2H7VC 2A69F 2G3KA 3GANA 3CQZA 5F5HA 1LKXA 4BG0A 1BR1A 3EQLF 3N24A 1ZU4A 2V26A 1MMAA 2J45A 3ZIBA 1PD1A 3DM5A 3L0IA 4Q7CA 1MMDA 1TWGA 1FFHA 5DQTA 1BR2A 3LNRA 2KQ9A 3W2VA 3B0PA 4BJ5A 3KKBA 1MMNA 1IZMA 3ASOC 1TWCA 3HJCA 5EGYA 2R7XA 4LACB 2VH3A 3EZIA 3X1OA 2I8BA 3LAYA 4RBNA 2KNHA 2Q9AA 5T3TA 3I5PA 4BJ6C 3N0TA 4Q5SF 4OIOF 2Q9CA 4O79A 2XXAB 2PFDA 2P6VA 3DM9B 2PX0A 4IJJA 5DS6A 4FWVA 4OD4A 1M2VA 2CNWD 3SZRA 1NU9C 2Y3HA 3AQCA 4W8KA 2EIMC 3DAFA 3L34A 1IW7F 3EG9A 4YT8A 1D1CA 2J9WA 3K7DA 4ULWA 3KH2A 4HFFB 2OCCC 4KBLA 4K7BA 5E33A 4F4BA 3ZG1A 1W2WA 3B0VC 2ZXRA 2ZXOA 4YJWA 4BEJA 4FESA 1PD0A 4KNVA 4CSAC 4DBQA 4U5CE 3K1IC 3LEVA 4DBRA 2DYRC 1M56C 2HV7A 3HLZA 3ZVRA 1NU7D 4XLNF 3PHF2 2OG2A 2R7VA 3CSKA 2J7PA 5KYXA 4I1OB 2WVOA 3CZ6A 5HSWA 1NZEA 3LS1A 3DJUB 3QZCA 4O6NA 4U5FE 1VOMA 3NYLA 2P7VA 4B6IA 1OKKD 5F5FA 3NRHA 1WGWA 2B0JA 2NUTA 3WODF 3NYMA 3W2WA 2A68F 3T4RA 2W9YA 3DAGA 2IXMA 5KYYA 3ZSUA 4J30B 4JVSA 2WL8A 2BE5F 3E70C 2CGEA 3UGPA 2X51A 4OIPF 1ZHZA 4KI2A 5D92A 1TWAA 3T6JA 4CS9A 2A6EF 1O87A 3HTKC 1BR4A 4XWJA 4C7OA 4P6IC 3LLKA 4JW1A 2G3VA 4H4KC 1FFTC 4DVZA 1V54C 3ASNC 3EHNA 4O6MA 3W8IA 5B1AC 3I4UA 3T6BA 3ZC4A 3EH1A 3S29A 3EPVA 1QZXA 3I5QA 1ZU5A 2KW3C 4U5GA 3OA1A 4HE8D 4PJNA 3AG3C 2XL4A 3LJBA 2IXOA 3B0UX 2J0WA 1ZHXA 3EFOA 2IXNA 5BUOA 3FHDA 4OD5A 2R7WA 3NG1A 2VB6A 3NKDA 4RD9A 3AG1C 4I44A 2R7OA 3OEOA 1S7ZA 2KJGA 2J0XA 3EGDB 4YT5A 2J7PD 3B9QA 3KMIA 3F47A 4HEAJ 4N06A 4YWQA 4J32B 1Z3IX 4JCHA 5KYNA 5CI8A 3LS0A 3S27A 4IWBA 5FCLA 3UMIA 2A6HF 3EGXB 4BJ1A 3RYLA 4DOZA 1MMGA 2GFHA 3K66A 2PP4A 1J8YF 2WZGA 2Z15A 4XLPF 3FDQA 2JD3A 2QY9A 4JJGA 3NDBB 1PCXA 1VYIA 1Z5ZA 4OIQF 4E7ZA 3AG4C 3M1CB 1D1BA 3ITFA 4LLEA 2XXAA 5E2QA 4ZLCA 5L3QA 1NG1A 2Y69C 3SYNA 2Q9BA 4A2NB 1FTSA 3V7OA 3VYWA 3IEEA 1Z23A 2Y3GA 4YN0B 2C04A 1SZIA 4G7HF 4ZLDA 4EWCA 4CIHA 1TR2A 3DMDA 4AE4B 2D5RB 2EIJC 3EZHA 3TD7A 1Z63A 2R7SA 1G8XA 3NKEA 3W8HA 2R7UA 3UMKA 5DS4A 1VMAA 2YZSA 3EHMA 4CSAA 3UGOA 4PK4A 3EJNA 2FFHA 1ZHTA 4WJ0A 2FGYA 2M4EA 5KYWB 1D0XA 2H7BA 2ZPAA 4PFPA 4AK9A 4LERA 1LVKA 5KYUB 4KNWA 2NUTB 4QI0A 3LLIA 3K1HA 3DJNB 4FX5A 4I3MA 1ZHYA 4PJMA 5CI9A 1JPJA 4JZAA 3POVA 5KYYB 3EH2A 3K6BA 3X2QC 1MNEA 5T1DB 3RFYA 3SEOA 2CNWA 3K33A 4U5DE 4XTKA 3ABMC 1SMYF 2V3CC 3GODA 4CS9C 3ABKC 2WVQA 3RH3A 4DVYP 2R7TA 3Q7GA 2IXPA 4U5HA 5E3AA 4CS8C 3NYJA 4YT2A 1RJ9B 1MNDA 4U5BE 3UMHA 4G7ZF 2ZXPA 2H7OA 1ST6A 3WG7C 2EIKC 2NUPA 1ZYRF 2C03A 1Z6AA 4QI2A 3DZAA 3JYHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZVR A;  4X0R A;  3SNH A;  3LJB A;  3SZR A;  4BEJ A; 
#chains in the Genus database with same CATH topology
 1Q0F A;  2PF4 E;  3ECS A;  2BC5 A;  3SNH A;  3M4C A;  2XLH A;  2W4M A;  2YL3 A;  2QTV A;  1ZHW A;  3DE8 A;  4JTD B;  4RDA A;  3FVY A;  3U8V A;  3N2Z B;  1O5H A;  1VB5 A;  2G62 A;  2WVN A;  5T3W A;  3EFO B;  4C3B A;  1AVO B;  1DOW A;  1VK5 A;  4WAB A;  2NG1 A;  2AP3 A;  4BJ5 C;  1EKY A;  2VCB A;  2Y3D A;  4MVM A;  5TJ5 E;  3SP1 A;  3ZQV A;  5L3V A;  2DYS C;  4EUK B;  2WZL A;  2TMV P;  4CIP A;  3NMJ A;  3MX3 A;  4PFO A;  3FAJ A;  2X0C A;  3Q6M A;  1OKK A;  3C8G D;  2CW0 F;  1TKN A;  1TWH A;  2UUH A;  1L7C A;  4NTF A;  4MND A;  2XS1 A;  4D4N A;  3CEX A;  5L0G A;  3Q6N A;  2XLV A;  1FMW A;  2UUI A;  1QQ3 A;  2AWC A;  4BJT A;  1MQV A;  2HJ3 A;  3H2V A;  2OKU A;  1A7D A;  4WGZ A;  5EHH A;  4CX9 A;  2R7R A;  3C7J A;  5DQZ A;  2E87 A;  1RXQ A;  2LIG A;  1J8M F;  4UDV A;  3EGD A;  1LS1 A;  4MQ9 F;  1F1M A;  3O39 A;  3M79 A;  2IBF A;  4JEA A;  1M2V B;  3CAX A;  2R7Q A;  4YT4 A;  1OCC C;  2F22 A;  3TUL A;  2CDQ A;  2IOQ A;  4CBE A;  1LI7 A;  1NBB A;  2PBE A;  3L8J A;  4I1M A;  4CDY A;  2XSE A;  3EG9 B;  4BJ6 A;  4MW3 A;  3MLG A;  2HJM A;  4QDL A;  4DJ9 A;  3GEI A;  1JPN A;  2FAP B;  1I4Z A;  1OCR C;  3EGX A;  3JRM O;  1K40 A;  1WAT A;  4IAO A;  4LLC A;  3S28 A;  5DVW A;  5A6J A;  5JRA A;  3MBG A;  1TQG A;  2O9X A;  5A6A A;  2ZXW C;  2QLA A;  2NSG A;  4AX2 A;  1RKC A;  1QLE C;  2OJQ A;  5E3C A;  5CIV A;  4O7G A;  5EK0 A;  3U3F A;  3JT1 A;  1T01 A;  3PDM P;  2MYS A;  4MTF A;  4OIN F;  3G4Z A;  5AC4 A;  1G4W R;  2A1D D;  2EPL X;  2RD9 A;  4MTG A;  4YK5 A;  1OCO C;  1Q0K A;  2PX3 A;  1VLT A;  2VCC A;  3V5Y A;  1FMV A;  4K1O A;  1LE2 A;  3UR3 C;  3A11 A;  3RKO F;  4ANJ A;  4MVQ A;  2YEV A;  4CJG A;  3UNG C;  4D4X A;  1JMW A;  4G78 A;  1WWP A;  2Y3B A;  4X0R A;  1HE1 A;  2J9V A;  4E7S A;  2Q3T A;  3BEH A;  3TK0 A;  2YKZ A;  4LDK A;  3RW0 A;  5L0I A;  3Q7L A;  4EBK A;  3H65 A;  2J8W A;  4JJF A;  3VAY A;  5KYX B;  1E2X A;  1M2O A;  4BPM A;  1HMO A;  4E18 A;  5B1B C;  3QMK A;  4EBB A;  3JSE O;  4IB4 A;  3K1I A;  1UFB A;  2WB7 A;  4WGY A;  4AE4 A;  4MTO A;  4GYT A;  3JZ0 A;  4YL1 A;  5DLJ A;  2EIN C;  1KU2 A;  2H8A A;  2Y39 A;  3VRC A;  1E85 A;  4MS2 A;  2YHS A;  3LES A;  2P0N A;  3FOP A;  2EIL C;  4JEB A;  3S0X A;  2XRH A;  1ZVZ A;  3KPH A;  5L0J A;  1OCZ C;  1T6Q A;  1XZP A;  3JRT A;  1M57 C;  5BQI A;  2DGJ A;  1YJG A;  2HSB A;  2OU6 A;  2MWQ A;  1A41 A;  1A7V A;  4KC9 A;  1VLS A;  4PJJ A;  1E86 A;  2LFD A;  5IY5 C;  3ABL C;  2R9R B;  2J9U A;  3DXJ F;  1R5I D;  4W8P A;  2W45 A;  3JCU Q;  4GEH A;  4N6C A;  1QPU A;  5KYW A;  1BZ4 A;  2ZD9 A;  2J46 A;  4OIR F;  1V74 B;  3R7C A;  4HFK B;  1YYX A;  4IGG A;  5DS5 A;  2ICW G;  1T5O A;  1N1C A;  3RIP A;  4MVU A;  5KYU A;  1SF8 A;  2Q4F A;  3OWT A;  4JC7 A;  3PCV A;  2IYL D;  5JS5 A;  3R2P A;  3SXK A;  1D1A A;  1YA7 O;  1ZZP A;  2GDC A;  2KGO A;  4JUR I;  4L6R A;  5B3S C;  1EQ1 A;  2XM0 A;  3MYI A;  3O6X A;  3AQB A;  2W4B A;  2WZF A;  3PMR A;  4NY3 A;  2NPU A;  2R05 A;  4C7O B;  3A9C A;  4G7O F;  4C3E A;  3DD7 A;  2JX0 A;  3AG2 C;  4Q4Z F;  3F46 A;  2L81 A;  3M4B A;  2L7A A;  2VAS A;  2KSF A;  2LSE A;  4M63 A;  3RQE A;  5D91 A;  1U6H A;  2OEV A;  2LD6 A;  4NTA A;  4CS7 A;  4NQF A;  4K0D A;  1D0Y A;  3QW0 A;  4PJL A;  2HV6 A;  2L9J A;  4Z9H A;  2XLM A;  3GM2 A;  3ZWI A;  3JSZ A;  1H7I A;  1V55 C;  2NUP B;  3C63 A;  1VYK A;  2D4U A;  4U5E E;  1R4T A;  4P9T A;  4O6Y A;  4IRU A;  1PV3 A;  1RJ9 A;  1D0Z A;  2VC9 A;  3FMS A;  4G0H A;  4C3D A;  3E9V A;  4CS8 A;  3KL4 A;  1M6T A;  2H7V C;  2A69 F;  2HSQ A;  3LEO A;  2G3K A;  1YYJ A;  3GAN A;  3CQZ A;  5F5H A;  1LIH A;  1LKX A;  1WN0 A;  3IPM O;  4PR9 A;  3ZTZ A;  2AWY A;  4BG0 A;  1BR1 A;  1JOG A;  3EQL F;  1TFK B;  2J9B A;  1ZU4 A;  2YVK A;  3N24 A;  5AGF A;  1EI7 A;  3DKA A;  3H2U A;  2EPM X;  2V26 A;  1MMA A;  2J45 A;  3IQ5 A;  3WAQ A;  3ZIB A;  1HY5 A;  1PD1 A;  3DM5 A;  3L0I A;  4Q7C A;  2DI3 A;  1MMD A;  1FFH A;  1TWG A;  4XEV A;  1BR2 A;  3LNR A;  5DQT A;  1QSP A;  2KQ9 A;  3W2V A;  3B0P A;  2HMZ A;  3NMI A;  4BJ5 A;  4MW8 A;  1CGO A;  2KC3 A;  3KKB A;  1MMN A;  1WOL A;  1IZM A;  3ASO C;  1TWC A;  2QE9 A;  3HJC A;  3QVY A;  5EGY A;  3C8Z A;  4LAC B;  2R7X A;  1I5N A;  3O55 A;  4NCQ A;  2VH3 A;  3EZI A;  3X1O A;  1YAR O;  2I8B A;  3ATP A;  1H9G A;  3LAY A;  4MVS A;  1S05 A;  4RBN A;  2KNH A;  2Q9A A;  5T3T A;  2XM4 A;  4J7T A;  3HNL A;  3I5P A;  2M64 A;  4BJ6 C;  1LPE A;  3N0T A;  3TJ6 A;  2IM8 A;  4Q5S F;  4OIO F;  2YL7 A;  2Q9C A;  4O79 A;  3IQC A;  2PFD A;  2P6V A;  3DM9 B;  5JUA A;  2ETS A;  2PX0 A;  2XXA B;  4IJJ A;  5DS6 A;  1NFO A;  4FWV A;  4OD4 A;  2LK4 A;  1M2V A;  2CNW D;  2I15 A;  3SZR A;  2ASR A;  4GQH A;  4ER9 A;  1NU9 C;  2Y3H A;  3AQC A;  2YLI A;  2EIM C;  2HS5 A;  2B0H A;  3DAF A;  1IW7 F;  3L34 A;  1RKE B;  3EG9 A;  4W8K A;  3TQO A;  1LM3 B;  4YT8 A;  2L6G A;  1D1C A;  2J9W A;  3K7D A;  4ULW A;  3QTH A;  3S9O A;  2Q7R A;  3KH2 A;  1LE4 A;  1KNY A;  4HFF B;  2OCC C;  4KBL A;  1Q0G A;  2AVK A;  4K7B A;  5E33 A;  4F4B A;  1A0B A;  3ZG1 A;  1HW2 A;  1W2W A;  3B0V C;  3C8G B;  2LCH A;  3RF3 A;  2LQG A;  2ZXR A;  2ZXO A;  4IAQ A;  4YJW A;  5L0C A;  3U5S A;  1JR8 A;  4FES A;  4BEJ A;  1GM5 A;  4JRZ A;  1E83 A;  1PD0 A;  4KNV A;  3U0C A;  2Q00 A;  3AJM A;  4CSA C;  4DBQ A;  4U5C E;  3K1I C;  3LEV A;  3B71 A;  2DYR C;  3GOR A;  4DBR A;  1M56 C;  2HV7 A;  2LFF A;  2LP4 A;  3HLZ A;  5FZT A;  4AL0 A;  5L0D A;  3ZVR A;  1NU7 D;  2QUP A;  4XLN F;  3PHF 2;  2OG2 A;  5A6B A;  2R7V A;  3CSK A;  4LDR A;  2J7P A;  1B68 A;  1YZA A;  3US6 A;  3ZTM A;  5KYX A;  4I1O B;  3GWN A;  2VCA A;  2WVO A;  3CZ6 A;  3TJ5 A;  5HSW A;  1NZE A;  3LS1 A;  2A0U A;  4E0H A;  3DJU B;  3QZC A;  1WAS A;  4O6N A;  4U5F E;  1VOM A;  1Z7Q c;  3NYL A;  4DRH B;  4MVO A;  4CDA A;  2P7V A;  4B6I A;  1C02 A;  4E17 A;  1OKK D;  3JYH A;  2JPU A;  4IAR A;  3AOU A;  4NTB A;  3U8P A;  1E84 A;  3SXM A;  1NSG B;  5F5F A;  1YDI A;  1WGW A;  2B0J A;  2XL6 A;  3JTL O;  3NRH A;  3NYM A;  2NUT A;  3RQG A;  3RVZ A;  2A68 F;  3W2W A;  3WOD F;  1GQA A;  1OR2 A;  3T4R A;  2R02 A;  2W9Y A;  4N4W A;  2XLD A;  3DAG A;  2HMQ A;  2IXM A;  3RVY A;  5KYY A;  4JTC B;  3ZSU A;  4JKV A;  2L6F A;  4J30 B;  1V4A A;  2WL8 A;  1I4Y A;  2BE5 F;  3MFN A;  4JVS A;  1YA9 A;  3VM6 A;  3E70 C;  3IQ6 A;  2CGE A;  5F28 E;  3UGP A;  1C17 M;  2R25 A;  4N6H A;  4U9E A;  2X51 A;  4OIP F;  1YLM A;  1ZHZ A;  4KI2 A;  1OQC A;  4JTA B;  1TWA A;  5D92 A;  1JAF A;  3L1M A;  1LS4 A;  3TOL A;  1L3P A;  3C62 A;  3T6J A;  4CS9 A;  1G4U S;  2A6E F;  3FXH A;  1O87 A;  3HTK C;  3B29 A;  1BR4 A;  4XWJ A;  4A4A A;  4C7O A;  4P6I C;  1ORS C;  3LLK A;  1K04 A;  4JW1 A;  4H54 A;  2G3V A;  2L6H A;  4H4K C;  1T6I A;  1FFT C;  4DVZ A;  1V54 C;  3ASN C;  3EHN A;  4MVZ A;  1BDJ B;  1YVI A;  3LNM B;  4O6M A;  3W8I A;  5B1A C;  3I4U A;  3T6B A;  3O10 A;  3ZC4 A;  1U89 A;  2XLE A;  3U2M A;  3EH1 A;  3IQT A;  1T6U A;  5BQG A;  3EPV A;  3S29 A;  1QZX A;  1XZQ A;  256B A;  5K0I A;  3I5Q A;  1XWJ A;  1ZU5 A;  2KW3 C;  3AGU A;  5JSL A;  1OXB A;  4JIO A;  4U5G A;  5JLI A;  4EKW A;  2HUJ A;  3OA1 A;  3VF0 A;  5JT4 A;  4HE8 D;  4PJN A;  3U3B A;  3AG3 C;  2XL4 A;  2AU5 A;  3LJB A;  5HV9 A;  2IXO A;  1YAU O;  2GWW A;  3SXZ A;  3IHU A;  3B0U X;  1APC A;  1FAP B;  1SR2 A;  1ZHX A;  2J0W A;  3EFO A;  2IXN A;  3M15 A;  4EBJ A;  3FHD A;  1A7E A;  4OD5 A;  3QW1 A;  4Z9I A;  4EHP A;  5BUO A;  3C18 A;  2OEX A;  3FAP B;  3NG1 A;  2VB6 A;  3NKD A;  4XPW A;  3U9M A;  2R7W A;  4RD9 A;  3AG1 C;  4I44 A;  2R7O A;  3GWL A;  3OEO A;  4ULV A;  4DRI B;  1S7Z A;  2CCY A;  3FOO A;  2KYH A;  3L8I A;  5L0H A;  1TFO B;  2KJG A;  2YLD A;  2J0X A;  3EGD B;  4YT5 A;  5A6B D;  1AUE A;  2J7P D;  1FR0 A;  2YLG A;  3B9Q A;  3DE9 A;  3KMI A;  3F47 A;  4HEA J;  4NC3 A;  4CJO A;  4N06 A;  5L0F A;  4YWQ A;  1C03 A;  1Z3I X;  2P1A A;  2PNO A;  2XL8 A;  2XLO A;  4J32 B;  4JCH A;  3LS0 A;  4PAC A;  4IWB A;  5CI8 A;  3S27 A;  3T6G B;  5FCL A;  5KYN A;  4CDV A;  3U2L A;  3UMI A;  2GA0 A;  3ZDL A;  3V5X A;  2A6H F;  3EGX B;  4P9F A;  4BJ1 A;  2YRF A;  3RYL A;  1HW1 A;  4DOZ A;  4XQ1 A;  1MMG A;  2GFH A;  3K66 A;  4YL3 A;  5AC5 A;  2PP4 A;  3HNJ A;  1J8Y F;  2WZG A;  2Z15 A;  5GPG B;  4XLP F;  2QNL A;  2JD3 A;  3LUT B;  3FDQ A;  2GAQ A;  2QY9 A;  4JJG A;  3NDB B;  1PCX A;  1VYI A;  1Z5Z A;  1AEP A;  1ZW2 A;  2HZ8 A;  4XEF A;  4E7Z A;  4OIQ F;  3AG4 C;  3M1C B;  1CPQ A;  1SYQ A;  1U0B B;  1D1B A;  3ITF A;  4LLE A;  3V5Z A;  2XXA A;  5E2Q A;  4ZLC A;  4R32 A;  5JVE A;  4DRJ B;  4JCZ A;  1JRA A;  1EA8 A;  1NFN A;  3QVZ A;  5L3Q A;  1GGQ A;  1NG1 A;  2Y69 C;  1T9K A;  3SYN A;  2Q9B A;  1FNT c;  4JE9 A;  1FTS A;  4A2N B;  3V7O A;  3VYW A;  3IEE A;  1RKE A;  1Z23 A;  2EPN A;  1OW6 A;  2P61 A;  4FAP B;  1BBH A;  2Y3G A;  5B3I A;  3GEE A;  4YN0 B;  1LI5 A;  1Y6D A;  2BL2 A;  1H9T A;  2C04 A;  1SZI A;  4G7H F;  4ZLD A;  3HNK A;  3TOM A;  2DB4 A;  1CPR A;  4EWC A;  1RMV A;  4CIH A;  1TR2 A;  4DXW A;  3DMD A;  4AE4 B;  2D5R B;  2XLW A;  4XPY A;  3MYF A;  1WTY A;  3RQF A;  2EIJ C;  3EZH A;  3W4Y A;  3C8G A;  3TD7 A;  1Z63 A;  2R7S A;  1G8X A;  3NKE A;  3SXY A;  1QVX A;  1Y4C A;  3W8H A;  5COM A;  4LDQ A;  2R7U A;  3UMK A;  3AGT A;  1OR3 A;  5JP7 A;  2A0B A;  5DS4 A;  1VMA A;  2YZS A;  5A69 A;  3EHM A;  2OQM A;  4CSA A;  3BRJ A;  3UGO A;  2NSF A;  4PK4 A;  3EJN A;  1K05 A;  2FFH A;  1ZHT A;  4AL1 A;  2OOC A;  4WJ0 A;  1ZW3 A;  2FGY A;  2M4E A;  5KYW B;  2EPO A;  1ORY A;  1NLX A;  2RSE B;  3S90 A;  1D0X A;  1Q0M A;  2H7B A;  2ZPA A;  4PFP A;  3GM3 A;  1YZC A;  4AK9 A;  4LER A;  1LVK A;  5KYU B;  4KNW A;  1CGM E;  2NUT B;  4QI0 A;  2XS8 A;  3LLI A;  3K1H A;  3DJN B;  3G4X A;  3HKK A;  2YQY A;  4FX5 A;  1GS9 A;  1ZHY A;  1UG7 A;  4I3M A;  4PJM A;  5CI9 A;  4E0I A;  3JYY A;  1JPJ A;  4Z9J A;  1KTM A;  2HFI A;  1CGN A;  1OW7 A;  4JZA A;  3S84 A;  3POV A;  5KYY B;  3EH2 A;  3K6B A;  5COF A;  3X2Q C;  5BQH A;  3U9J A;  1MNE A;  4XEK A;  5T1D B;  1RCP A;  2YL0 A;  3DI5 A;  1O3U A;  3RFY A;  3SEO A;  2CNW A;  3K33 A;  1VTM P;  4ONS A;  1H6G A;  1G5Z A;  4MVR A;  4U9D A;  1HMD A;  4U5D E;  4XTK A;  3GM1 A;  3ZQY A;  1QKR A;  3ABM C;  4EIY A;  3KYJ A;  1ORJ A;  1SMY F;  1OW8 A;  3NMK A;  3GOD A;  5COG A;  2V3C C;  3T9O A;  3ABK C;  4CS9 C;  2OJE D;  2WVQ A;  3RH3 A;  4DVY P;  3GEH A;  2R7T A;  2YL1 A;  2YWA A;  3Q7G A;  4J7Y A;  2EPK X;  2IXP A;  4U5H A;  3WHN A;  1HE9 A;  2R03 A;  1OXK A;  4XPX A;  1DOV A;  5E3A A;  3HNI A;  2KK1 A;  4CS8 C;  3NYJ A;  4YT2 A;  1RJ9 B;  2HKV A;  1MND A;  4U5B E;  3UMH A;  4G7Z F;  3DWW A;  3J06 A;  2ZXP A;  2H7O A;  1ST6 A;  3WG7 C;  4BEM J;  4YL0 A;  3KYI A;  2EIK C;  2NUP A;  1ZYR F;  2C03 A;  2CYD A;  3G50 A;  5A6K A;  1Z6A A;  4QI2 A;  3DZA A;  1Q0D A;  2MHR A; 
#chains in the Genus database with same CATH homology
 3ECS A;  2PF4 E;  3SNH A;  2W4M A;  2QTV A;  1ZHW A;  4RDA A;  3FVY A;  3N2Z B;  1O5H A;  2G62 A;  2WVN A;  5T3W A;  4C3B A;  3EFO B;  1VK5 A;  4BJ5 C;  2NG1 A;  2Y3D A;  3SP1 A;  5L3V A;  2DYS C;  2WZL A;  3MX3 A;  4PFO A;  3FAJ A;  3Q6M A;  1OKK A;  2CW0 F;  1TKN A;  1TWH A;  4MND A;  3Q6N A;  1FMW A;  4BJT A;  5EHH A;  2R7R A;  5DQZ A;  2E87 A;  1J8M F;  3EGD A;  1LS1 A;  4MQ9 F;  3O39 A;  1M2V B;  4YT4 A;  2R7Q A;  1OCC C;  2CDQ A;  2IOQ A;  4CBE A;  4I1M A;  2XSE A;  3EG9 B;  4BJ6 A;  3MLG A;  4QDL A;  1JPN A;  3S28 A;  1OCR C;  3EGX A;  4IAO A;  4LLC A;  5DVW A;  2O9X A;  2ZXW C;  4AX2 A;  5E3C A;  1QLE C;  4O7G A;  3JT1 A;  2MYS A;  4OIN F;  2A1D D;  1OCO C;  2PX3 A;  1FMV A;  3UR3 C;  3RKO F;  4ANJ A;  2YEV A;  3UNG C;  2Y3B A;  4X0R A;  2J9V A;  4E7S A;  2Q3T A;  3Q7L A;  3H65 A;  4JJF A;  3VAY A;  5KYX B;  1M2O A;  5B1B C;  3QMK A;  4EBB A;  2WB7 A;  4AE4 A;  4GYT A;  5DLJ A;  2EIN C;  1KU2 A;  2Y39 A;  2YHS A;  3LES A;  2EIL C;  3S0X A;  2XRH A;  1OCZ C;  3JRT A;  1M57 C;  2DGJ A;  2MWQ A;  4KC9 A;  4PJJ A;  5IY5 C;  3ABL C;  2J9U A;  3DXJ F;  2W45 A;  3JCU Q;  4GEH A;  5KYW A;  2J46 A;  4OIR F;  4HFK B;  5DS5 A;  1N1C A;  3RIP A;  5KYU A;  1SF8 A;  3OWT A;  2IYL D;  1D1A A;  2KGO A;  4JUR I;  5B3S C;  3O6X A;  3AQB A;  2W4B A;  2WZF A;  3PMR A;  4NY3 A;  4C7O B;  4G7O F;  4C3E A;  3DD7 A;  3AG2 C;  4Q4Z F;  3F46 A;  2L81 A;  2VAS A;  2LSE A;  4M63 A;  5D91 A;  4CS7 A;  4K0D A;  1D0Y A;  4PJL A;  2HV6 A;  2L9J A;  3JSZ A;  1V55 C;  2NUP B;  1VYK A;  4U5E E;  4O6Y A;  4IRU A;  1RJ9 A;  1D0Z A;  4G0H A;  4C3D A;  3E9V A;  4CS8 A;  3KL4 A;  2H7V C;  2A69 F;  2G3K A;  3GAN A;  3CQZ A;  5F5H A;  1LKX A;  4BG0 A;  1BR1 A;  3EQL F;  3N24 A;  1ZU4 A;  2V26 A;  1MMA A;  2J45 A;  3ZIB A;  1PD1 A;  3DM5 A;  3L0I A;  4Q7C A;  1MMD A;  1TWG A;  1FFH A;  5DQT A;  1BR2 A;  3LNR A;  2KQ9 A;  3W2V A;  3B0P A;  4BJ5 A;  3KKB A;  1MMN A;  1IZM A;  3ASO C;  1TWC A;  3HJC A;  5EGY A;  2R7X A;  4LAC B;  2VH3 A;  3EZI A;  3X1O A;  2I8B A;  3LAY A;  4RBN A;  2KNH A;  2Q9A A;  5T3T A;  3I5P A;  4BJ6 C;  3N0T A;  4Q5S F;  4OIO F;  2Q9C A;  4O79 A;  2XXA B;  2PFD A;  2P6V A;  3DM9 B;  2PX0 A;  4IJJ A;  5DS6 A;  4FWV A;  4OD4 A;  1M2V A;  2CNW D;  3SZR A;  1NU9 C;  2Y3H A;  3AQC A;  4W8K A;  2EIM C;  3DAF A;  3L34 A;  1IW7 F;  3EG9 A;  4YT8 A;  1D1C A;  2J9W A;  3K7D A;  4ULW A;  3KH2 A;  4HFF B;  2OCC C;  4KBL A;  4K7B A;  5E33 A;  4F4B A;  3ZG1 A;  1W2W A;  3B0V C;  2ZXR A;  2ZXO A;  4YJW A;  4BEJ A;  4FES A;  1PD0 A;  4KNV A;  4CSA C;  4DBQ A;  4U5C E;  3K1I C;  3LEV A;  4DBR A;  2DYR C;  1M56 C;  2HV7 A;  3HLZ A;  3ZVR A;  1NU7 D;  4XLN F;  3PHF 2;  2OG2 A;  2R7V A;  3CSK A;  2J7P A;  5KYX A;  4I1O B;  2WVO A;  3CZ6 A;  5HSW A;  1NZE A;  3LS1 A;  3DJU B;  3QZC A;  4O6N A;  4U5F E;  1VOM A;  3NYL A;  2P7V A;  4B6I A;  1OKK D;  5F5F A;  3NRH A;  1WGW A;  2B0J A;  2NUT A;  3WOD F;  3NYM A;  3W2W A;  2A68 F;  3T4R A;  2W9Y A;  3DAG A;  2IXM A;  5KYY A;  3ZSU A;  4J30 B;  4JVS A;  2WL8 A;  2BE5 F;  3E70 C;  2CGE A;  3UGP A;  2X51 A;  4OIP F;  1ZHZ A;  4KI2 A;  5D92 A;  1TWA A;  3T6J A;  4CS9 A;  2A6E F;  1O87 A;  3HTK C;  1BR4 A;  4XWJ A;  4C7O A;  4P6I C;  3LLK A;  4JW1 A;  2G3V A;  4H4K C;  1FFT C;  4DVZ A;  1V54 C;  3ASN C;  3EHN A;  4O6M A;  3W8I A;  5B1A C;  3I4U A;  3T6B A;  3ZC4 A;  3EH1 A;  3S29 A;  3EPV A;  1QZX A;  3I5Q A;  1ZU5 A;  2KW3 C;  4U5G A;  3OA1 A;  4HE8 D;  4PJN A;  3AG3 C;  2XL4 A;  3LJB A;  2IXO A;  3B0U X;  2J0W A;  1ZHX A;  3EFO A;  2IXN A;  5BUO A;  3FHD A;  4OD5 A;  2R7W A;  3NG1 A;  2VB6 A;  3NKD A;  4RD9 A;  3AG1 C;  4I44 A;  2R7O A;  3OEO A;  1S7Z A;  2KJG A;  2J0X A;  3EGD B;  4YT5 A;  2J7P D;  3B9Q A;  3KMI A;  3F47 A;  4HEA J;  4N06 A;  4YWQ A;  4J32 B;  1Z3I X;  4JCH A;  5KYN A;  5CI8 A;  3LS0 A;  3S27 A;  4IWB A;  5FCL A;  3UMI A;  2A6H F;  3EGX B;  4BJ1 A;  3RYL A;  4DOZ A;  1MMG A;  2GFH A;  3K66 A;  2PP4 A;  1J8Y F;  2WZG A;  2Z15 A;  4XLP F;  3FDQ A;  2JD3 A;  2QY9 A;  4JJG A;  3NDB B;  1PCX A;  1VYI A;  1Z5Z A;  4OIQ F;  4E7Z A;  3AG4 C;  3M1C B;  1D1B A;  3ITF A;  4LLE A;  2XXA A;  5E2Q A;  4ZLC A;  5L3Q A;  1NG1 A;  2Y69 C;  3SYN A;  2Q9B A;  4A2N B;  1FTS A;  3V7O A;  3VYW A;  3IEE A;  1Z23 A;  2Y3G A;  4YN0 B;  2C04 A;  1SZI A;  4G7H F;  4ZLD A;  4EWC A;  4CIH A;  1TR2 A;  3DMD A;  4AE4 B;  2D5R B;  2EIJ C;  3EZH A;  3TD7 A;  1Z63 A;  2R7S A;  1G8X A;  3NKE A;  3W8H A;  2R7U A;  3UMK A;  5DS4 A;  1VMA A;  2YZS A;  3EHM A;  4CSA A;  3UGO A;  4PK4 A;  3EJN A;  2FFH A;  1ZHT A;  4WJ0 A;  2FGY A;  2M4E A;  5KYW B;  1D0X A;  2H7B A;  2ZPA A;  4PFP A;  4AK9 A;  4LER A;  1LVK A;  5KYU B;  4KNW A;  2NUT B;  4QI0 A;  3LLI A;  3K1H A;  3DJN B;  4FX5 A;  4I3M A;  1ZHY A;  4PJM A;  5CI9 A;  1JPJ A;  4JZA A;  3POV A;  5KYY B;  3EH2 A;  3K6B A;  3X2Q C;  1MNE A;  5T1D B;  3RFY A;  3SEO A;  2CNW A;  3K33 A;  4U5D E;  4XTK A;  3ABM C;  1SMY F;  2V3C C;  3GOD A;  4CS9 C;  3ABK C;  2WVQ A;  3RH3 A;  4DVY P;  2R7T A;  3Q7G A;  2IXP A;  4U5H A;  5E3A A;  4CS8 C;  3NYJ A;  4YT2 A;  1RJ9 B;  1MND A;  4U5B E;  3UMH A;  4G7Z F;  2ZXP A;  2H7O A;  1ST6 A;  3WG7 C;  2EIK C;  2NUP A;  1ZYR F;  2C03 A;  1Z6A A;  4QI2 A;  3DZA A;  3JYH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...