4X0RA

Crystal structure of human mxb stalk domain
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
236
structure length
201
Chain Sequence
EADKMFFLIEKIKMFNQDIEKLVEGEEVVRENETRLYNKIREDFKNWVGILATNTQKVKNIIHEETFEIIVHQYIQQLVEPALSMLQKAMEIIQQAFINVAKKHFGEFFNLNQTVQSTIEDIKVKHTAKAENMIQLQFRMEQMVFKTEIGIHLNAYFLETSKRLANQIPFIIQYFMLRENGDSLQKAMMQILQEKNRYSWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into the assembly of human anti-HIV dynamin-like protein MxB/Mx2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antiviral protein
molecule keywords Interferon-induced GTP-binding protein Mx2
total genus 87
structure length 201
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1240 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4x0rA00
3SNHA 3LJBA 4X0RA 4BEJA 3SZRA 3ZVRA
chains in the Genus database with same CATH superfamily
4EKWA 2HS5A 2OG2A 1H9TA 2J46A 4JW1A 4MVUA 3U3FA 2DI3A 1NFOA 1NLXA 2D5RB 4IAOA 4NQFA 3ZVRA 2OJED 5GPGB 1J8MF 1NU7D 2R25A 3JSEO 3EFOB 1OKKA 1OW8A 4I1MA 4LDQA 5CI9A 3KL4A 4XEKA 3RVZA 2QE9A 2XLEA 3WAQA 1LI7A 1TFOB 3GM1A 4JKVA 1QKRA 2W4BA 3FMSA 1ZU5A 4O79A 4RD9A 4EBBA 5BUOA 4DOZA 1AEPA 1D0XA 2J7PD 1SZIA 2PFDA 2W4MA 4QI0A 2OQMA 4PJJA 1JMWA 5A69A 1B68A 4B6IA 1T6QA 2YZSA 1YDIA 2GAQA 1H7IA 5BQIA 3TULA 3HTKC 3O55A 4U5HA 4EIYA 3FDQA 2LFFA 1TWGA 4BG0A 2VH3A 2XXAA 4U9DA 3Q6MA 2R7SA 2VCBA 2J0XA 3MYIA 4GYTA 2Y39A 5DLJA 4E17A 4JCZA 4BJ6C 4PFOA 3BEHA 2F22A 3NYLA 2EIMC 3DAGA 4QDLA 5A6JA 1WATA 3C7JA 3IPMO 1FFTC 4YWQA 3NDBB 5E3AA 4NTAA 2CGEA 2XS1A 1LS1A 3EQLF 3UMHA 1M2VB 4U5DE 1TQGA 3TQOA 2KQ9A 1K05A 1O5HA 3IQ6A 3JYHA 4J7TA 3EZHA 1KTMA 1D0ZA 3RW0A 3DM5A 4YT8A 2YLGA 2MYSA 5AGFA 2HZ8A 1V55C 4KC9A 2L81A 2VC9A 1WGWA 2AWCA 4AE4A 2AP3A 3GANA 3MX3A 1EQ1A 4XPWA 1RKEA 2KGOA 4U5EE 2NPUA 2ZXPA 3QTHA 4NTBA 5JP7A 1EKYA 3GM2A 3V5YA 2LD6A 4X0RA 4AL0A 1ZW3A 3N24A 4IWBA 5KYUA 2WZFA 3S29A 5KYWA 3M4CA 1Q0FA 3K7DA 5B1AC 1DOVA 5B3SC 4IJJA 1BDJB 2CNWA 3AOUA 3IQCA 1FNTc 4CDYA 1ZVZA 3IQ5A 5L0CA 3S90A 2OCCC 4OINF 2KJGA 1NBBA 2H7VC 4XPXA 1RMVA 3FAPB 2XL6A 3F47A 3NKDA 1Y4CA 3GODA 4I44A 1NZEA 4XEVA 2HMQA 1FTSA 3TOMA 3RQFA 4BJ5A 2A6HF 1OXBA 4JTAB 1H9GA 3KMIA 5L0FA 3E9VA 3KKBA 2IXNA 2XM4A 3LUTB 3X2QC 4DBRA 5KYYA 1T6UA 5FZTA 2JX0A 1RJ9B 2A6EF 4P9TA 4E0HA 3JZ0A 1VYKA 3KPHA 2J9BA 4LERA 4ONSA 4MVMA 1XWJA 4H54A 4YL3A 3SNHA 3ATPA 1W2WA 4AE4B 3CSKA 2HKVA 3NYJA 4NCQA 1Q0KA 5BQGA 4UDVA 1LIHA 2XL4A 4N6HA 1PD1A 1RJ9A 2YRFA 3AQCA 3GORA 2DYRC 4MVQA 4R32A 5JVEA 2Y3GA 1D1AA 1VOMA 3M79A 3L34A 4CS7A 2YVKA 5E3CA 2IM8A 4O6NA 4U5FE 2R7QA 1VLSA 3HKKA 3QMKA 1FR0A 3Q7LA 3UMIA 1F1MA 1JAFA 3KH2A 3B71A 2Q00A 2R7RA 4JCHA 1G5ZA 2L6FA 3QW1A 1NU9C 2P1AA 1R5ID 3DM9B 4BEMJ 1JRAA 1YARO 3V7OA 5L0GA 4AK9A 4CIHA 1S05A 1YVIA 2Q9BA 5JRAA 1ZHYA 2NSFA 2YL1A 2AVKA 3RQGA 4MTOA 5KYXB 1KU2A 1KNYA 3ITFA 3T6JA 2RD9A 3ZWIA 5A6KA 2FGYA 3M4BA 2OEVA 4C3EA 3EJNA 5JUAA 3S84A 3EHNA 1VK5A 3AGTA 1VYIA 3ABMC 3W2VA 4U5CE 3VF0A 1CGNA 2EPNA 4XEFA 1Z63A 2LK4A 5L0IA 1ORJA 4I3MA 4N6CA 3W4YA 5KYXA 4PJLA 3OEOA 3DWWA 4NC3A 1ZHXA 1NG1A 2XLDA 5A6AA 1MNDA 2DGJA 2J9VA 4MNDA 1YA9A 4LDRA 256BA 2AWYA 2RSEB 1OW7A 3PMRA 2EINC 1S7ZA 2LP4A 4D4NA 2XLWA 3CQZA 2QUPA 1Y6DA 3LS0A 3GEEA 3RF3A 2V26A 3JTLO 1K04A 4G7OF 4CS8C 5KYNA 3LLIA 4A4AA 2HMZA 2KSFA 3GM3A 3FOOA 2XL8A 4HEAJ 3ZQYA 4CDAA 4YT4A 2CDQA 3ASOC 2L6HA 3VM6A 4G7ZF 2LIGA 4Q4ZF 5HSWA 3IQTA 1G4WR 1BZ4A 4IRUA 4BJTA 1PD0A 2VCAA 3Q7GA 1C03A 5FCLA 1CGME 3U2LA 2H8AA 2EPMX 5F5FA 2YQYA 3ZC4A 5L0JA 5L0HA 3W2WA 1T6IA 1A7DA 2DB4A 3SXYA 2ZPAA 3MBGA 3HNKA 2PX3A 3QVYA 1G4US 3SP1A 4KNVA 2YHSA 4EUKB 1VB5A 4ZLCA 3B9QA 4OD5A 4U5GA 4N06A 1Z3IX 2H7BA 3US6A 1E83A 3JRMO 3FVYA 5KYUB 3KYJA 2X0CA 2GFHA 4JJFA 3ZIBA 4MVZA 5KYWB 4G7HF 2IXOA 1ZU4A 2IYLD 2NSGA 3AG2C 5L0DA 4E7SA 1WTYA 1V4AA 3WG7C 2YKZA 4MVOA 4U9EA 2NUTB 4N4WA 3T6GB 2R9RB 3C8GD 3JYYA 3QZCA 3MLGA 3C18A 3K66A 2ZXOA 1V74B 1V54C 3LNMB 3W8IA 2QY9A 4F4BA 2HV7A 3WHNA 2H7OA 4Q7CA 3W8HA 5K0IA 5COFA 2WZGA 2Y3DA 3QVZA 2KYHA 2BC5A 4JEBA 5CIVA 4GQHA 1NFNA 3RFYA 1D1CA 1TWAA 3H2UA 4JTDB 4BJ6A 2Q9CA 1CGOA 3DAFA 4XTKA 5L3VA 1YZAA 2CW0F 2PNOA 2LSEA 2XLOA 1GS9A 3DI5A 3HNLA 2Z15A 5F5HA 3DE8A 3G4XA 2D4UA 3M15A 4XQ1A 5CI8A 1OXKA 3U9JA 5DQZA 5JS5A 4P6IC 2L9JA 3FHDA 1VMAA 4CS8A 5DS4A 2EPKX 4KBLA 4DRJB 4XLNF 5D92A 1YYXA 3EH2A 1MQVA 1LM3B 1GQAA 2ZXWC 4JEAA 3U9MA 3S0XA 4E18A 1VTMP 4MTFA 3TOLA 2YL7A 5IY5C 3S28A 3ECSA 1WOLA 2VCCA 4OD4A 5T3TA 3AG4C 3LAYA 2CCYA 4HFKB 1Z7Qc 2A1DD 2YWAA 4EHPA 4DJ9A 1E85A 3WODF 1ST6A 3U0CA 3K33A 4DXWA 2J8WA 3ZQVA 2WVQA 3JCUQ 1H6GA 4YN0B 3UGPA 3I4UA 3LEOA 3L8IA 3NG1A 3V5ZA 4KI2A 4OIOF 2J0WA 2GA0A 1OCRC 1AUEA 1Q0MA 1Z23A 4MVRA 1ORYA 3PDMP 3AG3C 4DRHB 1UG7A 3JSZA 3TK0A 3EPVA 2C03A 2HSBA 1TKNA 4MTGA 4FAPB 2P6VA 5E33A 2R7VA 3K6BA 3O10A 3K1HA 4HFFB 1YA7O 4ULVA 5DQTA 2Y3BA 4CBEA 1TWHA 1NSGB 2PP4A 2QTVA 2JPUA 2R03A 1JPJA 2R7XA 3O39A 4ULWA 2P7VA 4C3BA 4C7OA 2HJ3A 3V5XA 4FESA 2R05A 2YEVA 4A2NB 3TJ5A 4OIRF 2W9YA 2OKUA 2HJMA 3AJMA 3GEIA 3HNJA 1MMDA 3DJUB 3SXMA 4ZLDA 2YL3A 4WGYA 4MVSA 1FFHA 1HMOA 3S27A 1OW6A 2QLAA 3IEEA 3OA1A 2L6GA 1OR3A 3S9OA 2EPOA 2GDCA 2G3VA 4JC7A 4M63A 1YYJA 5HV9A 2LQGA 3POVA 1LI5A 2YLIA 2ZXRA 1ZW2A 2VB6A 4IB4A 3A11A 3ABKC 2ICWG 2WZLA 2XLVA 2XM0A 3G4ZA 2ETSA 1YJGA 1A41A 4JRZA 2A0UA 1FMVA 2O9XA 3DXJF 3Q6NA 3VRCA 3A9CA 4JURI 4JTCB 1MMNA 5COGA 1QVXA 4Z9HA 3HLZA 2W45A 3HJCA 3T9OA 5B3IA 1YAUO 3VAYA 3C8GB 2I8BA 5JT4A 1M2OA 4L6RA 2P61A 3HNIA 3U8PA 1QPUA 2A69F 2R7OA 3PCVA 5BQHA 2WVOA 3AGUA 3CEXA 3JT1A 4H4KC 5COMA 3DZAA 5T3WA 4JE9A 1RKEB 4MQ9F 5E2QA 3EFOA 4C7OB 5JSLA 2NUTA 1QSPA 1MNEA 2IXPA 3C8GA 3L8JA 4CS9C 1ORSC 3ZDLA 4LLCA 1MMAA 2Q3TA 1A0BA 3RH3A 3U8VA 2XLHA 1OQCA 1UFBA 3MYFA 2A0BA 2J7PA 2Y3HA 3PHF2 3NRHA 3B0VC 2G62A 1U0BB 1E84A 4BPMA 1SMYF 4G0HA 2A68F 4BEJA 2M4EA 4PJNA 5A6BA 2MHRA 2IBFA 2EPLX 1JR8A 2IOQA 3I5PA 1A7VA 4CJOA 3ZSUA 2PBEA 2R7TA 4RBNA 1E86A 3I5QA 1L3PA 4Z9IA 1OCCC 4G78A 4AL1A 3G50A 5F28E 3RQEA 3UGOA 1LPEA 3EGDA 2C04A 4WABA 5EGYA 4CIPA 3FOPA 2ASRA 5D91A 4MW3A 3ZG1A 3FAJA 3EGXA 3GEHA 4QI2A 1M57C 3RVYA 2PF4E 4LACB 4Q5SF 2NUPB 3NMIA 3FXHA 2WB7A 2HFIA 1I4YA 2B0HA 2KNHA 1LE4A 2ZD9A 4K1OA 1C02A 2DYSC 3U5SA 1J8YF 2M64A 3CAXA 3O6XA 4O6MA 3GWNA 2HUJA 4NY3A 3KYIA 5T1DB 4CSAC 1TWCA 1D0YA 1WWPA 2BL2A 2X51A 3C63A 3EG9B 3L1MA 3AQBA 3EGXB 3H2VA 1SR2A 3L0IA 2Y69C 3UR3C 4DRIB 3DE9A 3K1IC 2PX0A 4C3DA 3ZTZA 1ZHTA 1O87A 3SYNA 2AU5A 1ZHZA 2FAPB 4OIPF 4DVYP 4XLPF 4WJ0A 1OKKD 3NMJA 3C62A 3NKEA 3RYLA 2XRHA 3SEOA 4CS9A 1BR1A 5JLIA 5EHHA 3ZTMA 4CJGA 5DVWA 1TFKB 1VLTA 1N1CA 2R7UA 3EH1A 4PJMA 1RCPA 3QW0A 2Q7RA 3SXZA 1U89A 3U3BA 5KYYB 1L7CA 4PACA 3ABLC 3GWLA 3RKOF 3J06A 2B0JA 3MFNA 3NYMA 4EBKA 1GM5A 3CZ6A 1MMGA 1IW7F 4XPYA 4K0DA 3SXKA 4LLEA 4CDVA 1JPNA 3AG1C 2XXAB 2R02A 3DD7A 4E7ZA 1GGQA 1R4TA 1O3UA 4YK5A 4EWCA 4IGGA 2OOCA 1OCOC 1BR4A 1CPRA 1Q0GA 1YZCA 4JJGA 4DVZA 1WASA 1HW2A 2QNLA 1DOWA 2I15A 2JD3A 2YL0A 1EI7A 3NMKA 5DS5A 1G8XA 2KK1A 3B29A 4W8KA 4AX2A 4CSAA 4D4XA 3LJBA 1I5NA 1K40A 3H65A 4O7GA 2P0NA 4EBJA 3EG9A 1Z6AA 4NTFA 3X1OA 2CYDA 2OU6A 5DS6A 1HE9A 4IAQA 4U5BE 1QQ3A 4YJWA 3EHMA 5TJ5E 4JZAA 1HY5A 3B0PA 1SF8A 2WVNA 3EZIA 2OJQA 1C17M 1PV3A 3N0TA 4YT5A 5A6BD 1OCZC 2KC3A 2TMVP 4ER9A 2V3CC 4RDAA 3UNGC 3LEVA 1HW1A 3U2MA 3OWTA 3VYWA 3IHUA 4WGZA 2LFDA 4FX5A 3N2ZB 4FWVA 2XS8A 4BJ1A 1RXQA 2FFHA 2EILC 3T4RA 3M1CB 1IZMA 4E0IA 3DJNB 3R2PA 4MS2A 4J7YA 4XWJA 1QLEC 1TR2A 3JRTA 4MW8A 1M56C 1LVKA 1RKCA 3DMDA 1BBHA 4PFPA 5EK0A 3SZRA 4J30B 1ZHWA 4W8PA 3R7CA 1PCXA 2L7AA 3TJ6A 2IXMA 4CX9A 3F46A 1LE2A 1JOGA 2BE5F 3C8ZA 1APCA 2VASA 1Z5ZA 2Q9AA 2E87A 2UUHA 4LDKA 4Z9JA 4O6YA 2NG1A 2UUIA 4BJ5C 3ASNC 1U6HA 3E70C 2G3KA 2R7WA 3RIPA 1EA8A 2XSEA 3B0UX 3LLKA 1ZZPA 1FAPB 1XZQA 1D1BA 1T9KA 2CNWD 1T5OA 2HSQA 3DKAA 4PK4A 1HMDA 4I1OB 4JVSA 1E2XA 1LS4A 5B1BC 1XZPA 2HV6A 4HE8D 4ANJA 2GWWA 5L3QA 2EIJC 3LNRA 4YT2A 2WL8A 1T01A 4IARA 5AC4A 2YLDA 2EIKC 1OR2A 1M6TA 3LS1A 2LCHA 4GEHA 3EGDB 2XLMA 2OEXA 4P9FA 1QZXA 3BRJA 1M2VA 1FMWA 2J9WA 3UMKA 1AVOB 4OIQF 4PR9A 4KNWA 2KW3C 1BR2A 4JIOA 3TD7A 1ZYRF 1Q0DA 1SYQA 1YLMA 4J32B 1A7EA 2NUPA 4YL0A 1LKXA 2J9UA 1I4ZA 2MWQA 1HE1A 2J45A 1WN0A 4YL1A 3LESA 3T6BA 5AC5A 4DBQA 4K7BA 1CPQA 2Q4FA 3K1IA
chains in the Genus database with same CATH topology
2OG2A 2J46A 4JW1A 2D5RB 4IAOA 3ZVRA 1J8MF 1NU7D 4I1MA 4CIHA 3EFOB 1OKKA 5CI9A 4C7OA 3KL4A 2W4BA 4O79A 1ZU5A 4RD9A 4EBBA 5BUOA 4DOZA 1D0XA 2PFDA 2J7PD 1SZIA 2W4MA 4QI0A 4PJJA 4B6IA 2YZSA 3HTKC 3FDQA 4U5HA 1TWGA 4BG0A 2VH3A 2XXAA 3Q6MA 2R7SA 2J0XA 4GYTA 2Y39A 5DLJA 4BJ6C 4PFOA 3NYLA 2EIMC 3DAGA 4QDLA 1FFTC 4YWQA 3NDBB 5E3AA 2CGEA 1LS1A 3EQLF 1M2VB 4U5DE 2KQ9A 1O5HA 3JYHA 3EZHA 1D0ZA 3DM5A 4YT8A 2MYSA 1V55C 4KC9A 2L81A 1WGWA 4AE4A 3GANA 3MX3A 2KGOA 4U5EE 2ZXPA 4X0RA 3N24A 4IWBA 5KYUA 2WZFA 3S29A 5KYWA 3K7DA 5B1AC 5B3SC 4IJJA 2CNWA 2OCCC 4OINF 2KJGA 2H7VC 3NKDA 4I44A 3F47A 3GODA 1NZEA 1FTSA 4BJ5A 2A6HF 3KMIA 3E9VA 3KKBA 2IXNA 3X2QC 4DBRA 5KYYA 1RJ9B 2A6EF 1VYKA 4LERA 3SNHA 1W2WA 4AE4B 3CSKA 3NYJA 2XL4A 1PD1A 1RJ9A 3AQCA 3UGOA 2DYRC 2Y3GA 1D1AA 1VOMA 3L34A 4CS7A 5E3CA 4O6NA 4U5FE 2R7QA 3QMKA 3Q7LA 3UMIA 3KH2A 2R7RA 4JCHA 1NU9C 3DM9B 3V7OA 4AK9A 2Q9BA 1ZHYA 5KYXB 1KU2A 3ITFA 3T6JA 2FGYA 4C3EA 3EJNA 3EHNA 1VK5A 1VYIA 3ABMC 3W2VA 4U5CE 1Z63A 4I3MA 5KYXA 4PJLA 3OEOA 1ZHXA 1NG1A 1MNDA 2DGJA 2J9VA 4MNDA 3PMRA 2EINC 1S7ZA 3CQZA 3LS0A 2V26A 4G7OF 4CS8C 5KYNA 3LLIA 4HEAJ 4YT4A 2CDQA 3ASOC 4G7ZF 4Q4ZF 5HSWA 4IRUA 4BJTA 1PD0A 3Q7GA 5FCLA 5F5FA 3ZC4A 3W2WA 2ZPAA 2PX3A 4ZLCA 3SP1A 4KNVA 2YHSA 3B9QA 4OD5A 4U5GA 4N06A 1Z3IX 2H7BA 3FVYA 5KYUB 3ZIBA 2GFHA 4JJFA 4G7HF 5KYWB 2IXOA 1ZU4A 2IYLD 3AG2C 4E7SA 3WG7C 2NUTB 3QZCA 3MLGA 3K66A 2ZXOA 1V54C 3W8IA 2QY9A 4F4BA 2HV7A 2H7OA 4Q7CA 3W8HA 2WZGA 2Y3DA 3RFYA 1D1CA 1TWAA 4BJ6A 2Q9CA 3DAFA 4XTKA 5L3VA 2CW0F 2LSEA 5F5HA 2Z15A 4CSAC 5CI8A 5DQZA 4P6IC 2L9JA 3FHDA 1VMAA 4CS8A 5DS4A 4KBLA 4XLNF 5D92A 3EH2A 2ZXWC 3S0XA 5IY5C 3S28A 3ECSA 4OD4A 5T3TA 3AG4C 3LAYA 4HFKB 2A1DD 3WODF 1ST6A 3K33A 2WVQA 3JCUQ 4YN0B 3UGPA 3I4UA 4KI2A 3NG1A 4OIOF 2J0WA 1OCRC 1Z23A 3AG3C 3JSZA 3EPVA 2C03A 1TKNA 2P6VA 5E33A 2R7VA 3K6BA 3K1HA 4HFFB 5DQTA 4CBEA 2Y3BA 1TWHA 2PP4A 2QTVA 2R7XA 1JPJA 3O39A 4ULWA 2P7VA 4C3BA 4FESA 4A2NB 4OIRF 2W9YA 1MMDA 3DJUB 4ZLDA 1FFHA 3S27A 3OA1A 3IEEA 2G3VA 4M63A 3POVA 2ZXRA 2VB6A 3ABKC 2WZLA 1FMVA 2O9XA 3DXJF 3Q6NA 4JURI 1MMNA 3HLZA 2W45A 3HJCA 3VAYA 2I8BA 1M2OA 2A69F 2R7OA 2WVOA 3JT1A 5T3WA 4H4KC 3DZAA 4MQ9F 5E2QA 3EFOA 4C7OB 2NUTA 1MNEA 2IXPA 4CS9C 4LLCA 1MMAA 2Q3TA 3RH3A 2J7PA 3PHF2 2Y3HA 3NRHA 3B0VC 2G62A 1SMYF 4G0HA 2A68F 4BEJA 2M4EA 4PJNA 2IOQA 3I5PA 3ZSUA 2R7TA 4RBNA 3I5QA 1OCCC 3EGDA 2C04A 5D91A 3ZG1A 3FAJA 3EGXA 4QI2A 1M57C 2PF4E 4LACB 2NUPB 2WB7A 5EGYA 2KNHA 2DYSC 1J8YF 3O6XA 4O6MA 4NY3A 5T1DB 1TWCA 1D0YA 3EG9B 2X51A 3UMHA 3UR3C 4Q5SF 3AQBA 3EGXB 3L0IA 2Y69C 3K1IC 2PX0A 4C3DA 1ZHTA 1O87A 3SYNA 1ZHZA 4OIPF 4DVYP 4XLPF 4WJ0A 1OKKD 3RYLA 3NKEA 4CS9A 2XRHA 3SEOA 1BR1A 5EHHA 5DVWA 2R7UA 1N1CA 3EH1A 4PJMA 5KYYB 3ABLC 3RKOF 2B0JA 3NYMA 3CZ6A 1MMGA 1IW7F 4K0DA 4LLEA 2XXAB 1JPNA 3AG1C 3DD7A 4E7ZA 4EWCA 4DVZA 1OCOC 1BR4A 4JJGA 5DS5A 2JD3A 1G8XA 4W8KA 4AX2A 4CSAA 3LJBA 3H65A 4O7GA 3EG9A 1Z6AA 5DS6A 3X1OA 4U5BE 4YJWA 3EHMA 4JZAA 3B0PA 1SF8A 2WVNA 3EZIA 3N0TA 4YT5A 1OCZC 2V3CC 4RDAA 3UNGC 3LEVA 3OWTA 3VYWA 4FX5A 3N2ZB 4FWVA 4BJ1A 2FFHA 2EILC 3T4RA 3M1CB 1IZMA 3DJNB 4XWJA 1QLEC 1TR2A 3JRTA 1M56C 1LVKA 3DMDA 4PFPA 3SZRA 4J30B 1ZHWA 1PCXA 2IXMA 3F46A 2BE5F 2VASA 1Z5ZA 2Q9AA 2E87A 4O6YA 2NG1A 4BJ5C 3ASNC 3E70C 2R7WA 2G3KA 3RIPA 2XSEA 3B0UX 3LLKA 2CNWD 1D1BA 4PK4A 4JVSA 4I1OB 5B1BC 2HV6A 4HE8D 4ANJA 5L3QA 2EIJC 3LNRA 4YT2A 2WL8A 2EIKC 3LS1A 4GEHA 3EGDB 1QZXA 1M2VA 1FMWA 2J9WA 3UMKA 4OIQF 4KNWA 2KW3C 1BR2A 3TD7A 1ZYRF 4J32B 2NUPA 1LKXA 2J9UA 2MWQA 2J45A 3LESA 3T6BA 4DBQA 4K7BA 2YEVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SNH A;  3LJB A;  4X0R A;  4BEJ A;  3SZR A;  3ZVR A; 
#chains in the Genus database with same CATH topology
 4EKW A;  2HS5 A;  2OG2 A;  1H9T A;  2J46 A;  4JW1 A;  4MVU A;  3U3F A;  2DI3 A;  1NFO A;  1NLX A;  2D5R B;  4IAO A;  4NQF A;  3ZVR A;  2OJE D;  5GPG B;  1J8M F;  1NU7 D;  2R25 A;  3JSE O;  3EFO B;  1OKK A;  1OW8 A;  4I1M A;  4LDQ A;  5CI9 A;  3KL4 A;  4XEK A;  3RVZ A;  2QE9 A;  2XLE A;  3WAQ A;  1LI7 A;  1TFO B;  3GM1 A;  4JKV A;  1QKR A;  2W4B A;  3FMS A;  1ZU5 A;  4O79 A;  4RD9 A;  4EBB A;  5BUO A;  4DOZ A;  1AEP A;  1D0X A;  2J7P D;  1SZI A;  2PFD A;  2W4M A;  4QI0 A;  2OQM A;  4PJJ A;  1JMW A;  5A69 A;  1B68 A;  4B6I A;  1T6Q A;  2YZS A;  1YDI A;  2GAQ A;  1H7I A;  5BQI A;  3TUL A;  3HTK C;  3O55 A;  4U5H A;  4EIY A;  3FDQ A;  2LFF A;  1TWG A;  4BG0 A;  2VH3 A;  2XXA A;  4U9D A;  3Q6M A;  2R7S A;  2VCB A;  2J0X A;  3MYI A;  4GYT A;  2Y39 A;  5DLJ A;  4E17 A;  4JCZ A;  4BJ6 C;  4PFO A;  3BEH A;  2F22 A;  3NYL A;  2EIM C;  3DAG A;  4QDL A;  5A6J A;  1WAT A;  3C7J A;  3IPM O;  1FFT C;  4YWQ A;  3NDB B;  5E3A A;  4NTA A;  2CGE A;  2XS1 A;  1LS1 A;  3EQL F;  3UMH A;  1M2V B;  4U5D E;  1TQG A;  3TQO A;  2KQ9 A;  1K05 A;  1O5H A;  3IQ6 A;  3JYH A;  4J7T A;  3EZH A;  1KTM A;  1D0Z A;  3RW0 A;  3DM5 A;  4YT8 A;  2YLG A;  2MYS A;  5AGF A;  2HZ8 A;  1V55 C;  4KC9 A;  2L81 A;  2VC9 A;  1WGW A;  2AWC A;  4AE4 A;  2AP3 A;  3GAN A;  3MX3 A;  1EQ1 A;  4XPW A;  1RKE A;  2KGO A;  4U5E E;  2NPU A;  2ZXP A;  3QTH A;  4NTB A;  5JP7 A;  1EKY A;  3GM2 A;  3V5Y A;  2LD6 A;  4X0R A;  4AL0 A;  1ZW3 A;  3N24 A;  4IWB A;  5KYU A;  2WZF A;  3S29 A;  5KYW A;  3M4C A;  1Q0F A;  3K7D A;  5B1A C;  1DOV A;  5B3S C;  4IJJ A;  1BDJ B;  2CNW A;  3AOU A;  3IQC A;  1FNT c;  4CDY A;  1ZVZ A;  3IQ5 A;  5L0C A;  3S90 A;  2OCC C;  4OIN F;  2KJG A;  1NBB A;  2H7V C;  4XPX A;  1RMV A;  3FAP B;  2XL6 A;  3F47 A;  3NKD A;  1Y4C A;  3GOD A;  4I44 A;  1NZE A;  4XEV A;  2HMQ A;  1FTS A;  3TOM A;  3RQF A;  4BJ5 A;  2A6H F;  1OXB A;  4JTA B;  1H9G A;  3KMI A;  5L0F A;  3E9V A;  3KKB A;  2IXN A;  2XM4 A;  3LUT B;  3X2Q C;  4DBR A;  5KYY A;  1T6U A;  5FZT A;  2JX0 A;  1RJ9 B;  2A6E F;  4P9T A;  4E0H A;  3JZ0 A;  1VYK A;  3KPH A;  2J9B A;  4LER A;  4ONS A;  4MVM A;  1XWJ A;  4H54 A;  4YL3 A;  3SNH A;  3ATP A;  1W2W A;  4AE4 B;  3CSK A;  2HKV A;  3NYJ A;  4NCQ A;  1Q0K A;  5BQG A;  4UDV A;  1LIH A;  2XL4 A;  4N6H A;  1PD1 A;  1RJ9 A;  2YRF A;  3AQC A;  3GOR A;  2DYR C;  4MVQ A;  4R32 A;  5JVE A;  2Y3G A;  1D1A A;  1VOM A;  3M79 A;  3L34 A;  4CS7 A;  2YVK A;  5E3C A;  2IM8 A;  4O6N A;  4U5F E;  2R7Q A;  1VLS A;  3HKK A;  3QMK A;  1FR0 A;  3Q7L A;  3UMI A;  1F1M A;  1JAF A;  3KH2 A;  3B71 A;  2Q00 A;  2R7R A;  4JCH A;  1G5Z A;  2L6F A;  3QW1 A;  1NU9 C;  2P1A A;  1R5I D;  3DM9 B;  4BEM J;  1JRA A;  1YAR O;  3V7O A;  5L0G A;  4AK9 A;  4CIH A;  1S05 A;  1YVI A;  2Q9B A;  5JRA A;  1ZHY A;  2NSF A;  2YL1 A;  2AVK A;  3RQG A;  4MTO A;  5KYX B;  1KU2 A;  1KNY A;  3ITF A;  3T6J A;  2RD9 A;  3ZWI A;  5A6K A;  2FGY A;  3M4B A;  2OEV A;  4C3E A;  3EJN A;  5JUA A;  3S84 A;  3EHN A;  1VK5 A;  3AGT A;  1VYI A;  3ABM C;  3W2V A;  4U5C E;  3VF0 A;  1CGN A;  2EPN A;  4XEF A;  1Z63 A;  2LK4 A;  5L0I A;  1ORJ A;  4I3M A;  4N6C A;  3W4Y A;  5KYX A;  4PJL A;  3OEO A;  3DWW A;  4NC3 A;  1ZHX A;  1NG1 A;  2XLD A;  5A6A A;  1MND A;  2DGJ A;  2J9V A;  4MND A;  1YA9 A;  4LDR A;  256B A;  2AWY A;  2RSE B;  1OW7 A;  3PMR A;  2EIN C;  1S7Z A;  2LP4 A;  4D4N A;  2XLW A;  3CQZ A;  2QUP A;  1Y6D A;  3LS0 A;  3GEE A;  3RF3 A;  2V26 A;  3JTL O;  1K04 A;  4G7O F;  4CS8 C;  5KYN A;  3LLI A;  4A4A A;  2HMZ A;  2KSF A;  3GM3 A;  3FOO A;  2XL8 A;  4HEA J;  3ZQY A;  4CDA A;  4YT4 A;  2CDQ A;  3ASO C;  2L6H A;  3VM6 A;  4G7Z F;  2LIG A;  4Q4Z F;  5HSW A;  3IQT A;  1G4W R;  1BZ4 A;  4IRU A;  4BJT A;  1PD0 A;  2VCA A;  3Q7G A;  1C03 A;  5FCL A;  1CGM E;  3U2L A;  2H8A A;  2EPM X;  5F5F A;  2YQY A;  3ZC4 A;  5L0J A;  5L0H A;  3W2W A;  1T6I A;  1A7D A;  2DB4 A;  3SXY A;  2ZPA A;  3MBG A;  3HNK A;  2PX3 A;  3QVY A;  1G4U S;  3SP1 A;  4KNV A;  2YHS A;  4EUK B;  1VB5 A;  4ZLC A;  3B9Q A;  4OD5 A;  4U5G A;  4N06 A;  1Z3I X;  2H7B A;  3US6 A;  1E83 A;  3JRM O;  3FVY A;  5KYU B;  3KYJ A;  2X0C A;  2GFH A;  4JJF A;  3ZIB A;  4MVZ A;  5KYW B;  4G7H F;  2IXO A;  1ZU4 A;  2IYL D;  2NSG A;  3AG2 C;  5L0D A;  4E7S A;  1WTY A;  1V4A A;  3WG7 C;  2YKZ A;  4MVO A;  4U9E A;  2NUT B;  4N4W A;  3T6G B;  2R9R B;  3C8G D;  3JYY A;  3QZC A;  3MLG A;  3C18 A;  3K66 A;  2ZXO A;  1V74 B;  1V54 C;  3LNM B;  3W8I A;  2QY9 A;  4F4B A;  2HV7 A;  3WHN A;  2H7O A;  4Q7C A;  3W8H A;  5K0I A;  5COF A;  2WZG A;  2Y3D A;  3QVZ A;  2KYH A;  2BC5 A;  4JEB A;  5CIV A;  4GQH A;  1NFN A;  3RFY A;  1D1C A;  1TWA A;  3H2U A;  4JTD B;  4BJ6 A;  2Q9C A;  1CGO A;  3DAF A;  4XTK A;  5L3V A;  1YZA A;  2CW0 F;  2PNO A;  2LSE A;  2XLO A;  1GS9 A;  3DI5 A;  3HNL A;  2Z15 A;  5F5H A;  3DE8 A;  3G4X A;  2D4U A;  3M15 A;  4XQ1 A;  5CI8 A;  1OXK A;  3U9J A;  5DQZ A;  5JS5 A;  4P6I C;  2L9J A;  3FHD A;  1VMA A;  4CS8 A;  5DS4 A;  2EPK X;  4KBL A;  4DRJ B;  4XLN F;  5D92 A;  1YYX A;  3EH2 A;  1MQV A;  1LM3 B;  1GQA A;  2ZXW C;  4JEA A;  3U9M A;  3S0X A;  4E18 A;  1VTM P;  4MTF A;  3TOL A;  2YL7 A;  5IY5 C;  3S28 A;  3ECS A;  1WOL A;  2VCC A;  4OD4 A;  5T3T A;  3AG4 C;  3LAY A;  2CCY A;  4HFK B;  1Z7Q c;  2A1D D;  2YWA A;  4EHP A;  4DJ9 A;  1E85 A;  3WOD F;  1ST6 A;  3U0C A;  3K33 A;  4DXW A;  2J8W A;  3ZQV A;  2WVQ A;  3JCU Q;  1H6G A;  4YN0 B;  3UGP A;  3I4U A;  3LEO A;  3L8I A;  3NG1 A;  3V5Z A;  4KI2 A;  4OIO F;  2J0W A;  2GA0 A;  1OCR C;  1AUE A;  1Q0M A;  1Z23 A;  4MVR A;  1ORY A;  3PDM P;  3AG3 C;  4DRH B;  1UG7 A;  3JSZ A;  3TK0 A;  3EPV A;  2C03 A;  2HSB A;  1TKN A;  4MTG A;  4FAP B;  2P6V A;  5E33 A;  2R7V A;  3K6B A;  3O10 A;  3K1H A;  4HFF B;  1YA7 O;  4ULV A;  5DQT A;  2Y3B A;  4CBE A;  1TWH A;  1NSG B;  2PP4 A;  2QTV A;  2JPU A;  2R03 A;  1JPJ A;  2R7X A;  3O39 A;  4ULW A;  2P7V A;  4C3B A;  4C7O A;  2HJ3 A;  3V5X A;  4FES A;  2R05 A;  2YEV A;  4A2N B;  3TJ5 A;  4OIR F;  2W9Y A;  2OKU A;  2HJM A;  3AJM A;  3GEI A;  3HNJ A;  1MMD A;  3DJU B;  3SXM A;  4ZLD A;  2YL3 A;  4WGY A;  4MVS A;  1FFH A;  1HMO A;  3S27 A;  1OW6 A;  2QLA A;  3IEE A;  3OA1 A;  2L6G A;  1OR3 A;  3S9O A;  2EPO A;  2GDC A;  2G3V A;  4JC7 A;  4M63 A;  1YYJ A;  5HV9 A;  2LQG A;  3POV A;  1LI5 A;  2YLI A;  2ZXR A;  1ZW2 A;  2VB6 A;  4IB4 A;  3A11 A;  3ABK C;  2ICW G;  2WZL A;  2XLV A;  2XM0 A;  3G4Z A;  2ETS A;  1YJG A;  1A41 A;  4JRZ A;  2A0U A;  1FMV A;  2O9X A;  3DXJ F;  3Q6N A;  3VRC A;  3A9C A;  4JUR I;  4JTC B;  1MMN A;  5COG A;  1QVX A;  4Z9H A;  3HLZ A;  2W45 A;  3HJC A;  3T9O A;  5B3I A;  1YAU O;  3VAY A;  3C8G B;  2I8B A;  5JT4 A;  1M2O A;  4L6R A;  2P61 A;  3HNI A;  3U8P A;  1QPU A;  2A69 F;  2R7O A;  3PCV A;  5BQH A;  2WVO A;  3AGU A;  3CEX A;  3JT1 A;  4H4K C;  5COM A;  3DZA A;  5T3W A;  4JE9 A;  1RKE B;  4MQ9 F;  5E2Q A;  3EFO A;  4C7O B;  5JSL A;  2NUT A;  1QSP A;  1MNE A;  2IXP A;  3C8G A;  3L8J A;  4CS9 C;  1ORS C;  3ZDL A;  4LLC A;  1MMA A;  2Q3T A;  1A0B A;  3RH3 A;  3U8V A;  2XLH A;  1OQC A;  1UFB A;  3MYF A;  2A0B A;  2J7P A;  2Y3H A;  3PHF 2;  3NRH A;  3B0V C;  2G62 A;  1U0B B;  1E84 A;  4BPM A;  1SMY F;  4G0H A;  2A68 F;  4BEJ A;  2M4E A;  4PJN A;  5A6B A;  2MHR A;  2IBF A;  2EPL X;  1JR8 A;  2IOQ A;  3I5P A;  1A7V A;  4CJO A;  3ZSU A;  2PBE A;  2R7T A;  4RBN A;  1E86 A;  3I5Q A;  1L3P A;  4Z9I A;  1OCC C;  4G78 A;  4AL1 A;  3G50 A;  5F28 E;  3RQE A;  3UGO A;  1LPE A;  3EGD A;  2C04 A;  4WAB A;  5EGY A;  4CIP A;  3FOP A;  2ASR A;  5D91 A;  4MW3 A;  3ZG1 A;  3FAJ A;  3EGX A;  3GEH A;  4QI2 A;  1M57 C;  3RVY A;  2PF4 E;  4LAC B;  4Q5S F;  2NUP B;  3NMI A;  3FXH A;  2WB7 A;  2HFI A;  1I4Y A;  2B0H A;  2KNH A;  1LE4 A;  2ZD9 A;  4K1O A;  1C02 A;  2DYS C;  3U5S A;  1J8Y F;  2M64 A;  3CAX A;  3O6X A;  4O6M A;  3GWN A;  2HUJ A;  4NY3 A;  3KYI A;  5T1D B;  4CSA C;  1TWC A;  1D0Y A;  1WWP A;  2BL2 A;  2X51 A;  3C63 A;  3EG9 B;  3L1M A;  3AQB A;  3EGX B;  3H2V A;  1SR2 A;  3L0I A;  2Y69 C;  3UR3 C;  4DRI B;  3DE9 A;  3K1I C;  2PX0 A;  4C3D A;  3ZTZ A;  1ZHT A;  1O87 A;  3SYN A;  2AU5 A;  1ZHZ A;  2FAP B;  4OIP F;  4DVY P;  4XLP F;  4WJ0 A;  1OKK D;  3NMJ A;  3C62 A;  3NKE A;  3RYL A;  2XRH A;  3SEO A;  4CS9 A;  1BR1 A;  5JLI A;  5EHH A;  3ZTM A;  4CJG A;  5DVW A;  1TFK B;  1VLT A;  1N1C A;  2R7U A;  3EH1 A;  4PJM A;  1RCP A;  3QW0 A;  2Q7R A;  3SXZ A;  1U89 A;  3U3B A;  5KYY B;  1L7C A;  4PAC A;  3ABL C;  3GWL A;  3RKO F;  3J06 A;  2B0J A;  3MFN A;  3NYM A;  4EBK A;  1GM5 A;  3CZ6 A;  1MMG A;  1IW7 F;  4XPY A;  4K0D A;  3SXK A;  4LLE A;  4CDV A;  1JPN A;  3AG1 C;  2XXA B;  2R02 A;  3DD7 A;  4E7Z A;  1GGQ A;  1R4T A;  1O3U A;  4YK5 A;  4EWC A;  4IGG A;  2OOC A;  1OCO C;  1BR4 A;  1CPR A;  1Q0G A;  1YZC A;  4JJG A;  4DVZ A;  1WAS A;  1HW2 A;  2QNL A;  1DOW A;  2I15 A;  2JD3 A;  2YL0 A;  1EI7 A;  3NMK A;  5DS5 A;  1G8X A;  2KK1 A;  3B29 A;  4W8K A;  4AX2 A;  4CSA A;  4D4X A;  3LJB A;  1I5N A;  1K40 A;  3H65 A;  4O7G A;  2P0N A;  4EBJ A;  3EG9 A;  1Z6A A;  4NTF A;  3X1O A;  2CYD A;  2OU6 A;  5DS6 A;  1HE9 A;  4IAQ A;  4U5B E;  1QQ3 A;  4YJW A;  3EHM A;  5TJ5 E;  4JZA A;  1HY5 A;  3B0P A;  1SF8 A;  2WVN A;  3EZI A;  2OJQ A;  1C17 M;  1PV3 A;  3N0T A;  4YT5 A;  5A6B D;  1OCZ C;  2KC3 A;  2TMV P;  4ER9 A;  2V3C C;  4RDA A;  3UNG C;  3LEV A;  1HW1 A;  3U2M A;  3OWT A;  3VYW A;  3IHU A;  4WGZ A;  2LFD A;  4FX5 A;  3N2Z B;  4FWV A;  2XS8 A;  4BJ1 A;  1RXQ A;  2FFH A;  2EIL C;  3T4R A;  3M1C B;  1IZM A;  4E0I A;  3DJN B;  3R2P A;  4MS2 A;  4J7Y A;  4XWJ A;  1QLE C;  1TR2 A;  3JRT A;  4MW8 A;  1M56 C;  1LVK A;  1RKC A;  3DMD A;  1BBH A;  4PFP A;  5EK0 A;  3SZR A;  4J30 B;  1ZHW A;  4W8P A;  3R7C A;  1PCX A;  2L7A A;  3TJ6 A;  2IXM A;  4CX9 A;  3F46 A;  1LE2 A;  1JOG A;  2BE5 F;  3C8Z A;  1APC A;  2VAS A;  1Z5Z A;  2Q9A A;  2E87 A;  2UUH A;  4LDK A;  4Z9J A;  4O6Y A;  2NG1 A;  2UUI A;  4BJ5 C;  3ASN C;  1U6H A;  3E70 C;  2G3K A;  2R7W A;  3RIP A;  1EA8 A;  2XSE A;  3B0U X;  3LLK A;  1ZZP A;  1FAP B;  1XZQ A;  1D1B A;  1T9K A;  2CNW D;  1T5O A;  2HSQ A;  3DKA A;  4PK4 A;  1HMD A;  4I1O B;  4JVS A;  1E2X A;  1LS4 A;  5B1B C;  1XZP A;  2HV6 A;  4HE8 D;  4ANJ A;  2GWW A;  5L3Q A;  2EIJ C;  3LNR A;  4YT2 A;  2WL8 A;  1T01 A;  4IAR A;  5AC4 A;  2YLD A;  2EIK C;  1OR2 A;  1M6T A;  3LS1 A;  2LCH A;  4GEH A;  3EGD B;  2XLM A;  2OEX A;  4P9F A;  1QZX A;  3BRJ A;  1M2V A;  1FMW A;  2J9W A;  3UMK A;  1AVO B;  4OIQ F;  4PR9 A;  4KNW A;  2KW3 C;  1BR2 A;  4JIO A;  3TD7 A;  1ZYR F;  1Q0D A;  1SYQ A;  1YLM A;  4J32 B;  1A7E A;  2NUP A;  4YL0 A;  1LKX A;  2J9U A;  1I4Z A;  2MWQ A;  1HE1 A;  2J45 A;  1WN0 A;  4YL1 A;  3LES A;  3T6B A;  5AC5 A;  4DBQ A;  4K7B A;  1CPQ A;  2Q4F A;  3K1I A; 
#chains in the Genus database with same CATH homology
 2OG2 A;  2J46 A;  4JW1 A;  2D5R B;  4IAO A;  3ZVR A;  1J8M F;  1NU7 D;  4I1M A;  4CIH A;  3EFO B;  1OKK A;  5CI9 A;  4C7O A;  3KL4 A;  2W4B A;  4O79 A;  1ZU5 A;  4RD9 A;  4EBB A;  5BUO A;  4DOZ A;  1D0X A;  2PFD A;  2J7P D;  1SZI A;  2W4M A;  4QI0 A;  4PJJ A;  4B6I A;  2YZS A;  3HTK C;  3FDQ A;  4U5H A;  1TWG A;  4BG0 A;  2VH3 A;  2XXA A;  3Q6M A;  2R7S A;  2J0X A;  4GYT A;  2Y39 A;  5DLJ A;  4BJ6 C;  4PFO A;  3NYL A;  2EIM C;  3DAG A;  4QDL A;  1FFT C;  4YWQ A;  3NDB B;  5E3A A;  2CGE A;  1LS1 A;  3EQL F;  1M2V B;  4U5D E;  2KQ9 A;  1O5H A;  3JYH A;  3EZH A;  1D0Z A;  3DM5 A;  4YT8 A;  2MYS A;  1V55 C;  4KC9 A;  2L81 A;  1WGW A;  4AE4 A;  3GAN A;  3MX3 A;  2KGO A;  4U5E E;  2ZXP A;  4X0R A;  3N24 A;  4IWB A;  5KYU A;  2WZF A;  3S29 A;  5KYW A;  3K7D A;  5B1A C;  5B3S C;  4IJJ A;  2CNW A;  2OCC C;  4OIN F;  2KJG A;  2H7V C;  3NKD A;  4I44 A;  3F47 A;  3GOD A;  1NZE A;  1FTS A;  4BJ5 A;  2A6H F;  3KMI A;  3E9V A;  3KKB A;  2IXN A;  3X2Q C;  4DBR A;  5KYY A;  1RJ9 B;  2A6E F;  1VYK A;  4LER A;  3SNH A;  1W2W A;  4AE4 B;  3CSK A;  3NYJ A;  2XL4 A;  1PD1 A;  1RJ9 A;  3AQC A;  3UGO A;  2DYR C;  2Y3G A;  1D1A A;  1VOM A;  3L34 A;  4CS7 A;  5E3C A;  4O6N A;  4U5F E;  2R7Q A;  3QMK A;  3Q7L A;  3UMI A;  3KH2 A;  2R7R A;  4JCH A;  1NU9 C;  3DM9 B;  3V7O A;  4AK9 A;  2Q9B A;  1ZHY A;  5KYX B;  1KU2 A;  3ITF A;  3T6J A;  2FGY A;  4C3E A;  3EJN A;  3EHN A;  1VK5 A;  1VYI A;  3ABM C;  3W2V A;  4U5C E;  1Z63 A;  4I3M A;  5KYX A;  4PJL A;  3OEO A;  1ZHX A;  1NG1 A;  1MND A;  2DGJ A;  2J9V A;  4MND A;  3PMR A;  2EIN C;  1S7Z A;  3CQZ A;  3LS0 A;  2V26 A;  4G7O F;  4CS8 C;  5KYN A;  3LLI A;  4HEA J;  4YT4 A;  2CDQ A;  3ASO C;  4G7Z F;  4Q4Z F;  5HSW A;  4IRU A;  4BJT A;  1PD0 A;  3Q7G A;  5FCL A;  5F5F A;  3ZC4 A;  3W2W A;  2ZPA A;  2PX3 A;  4ZLC A;  3SP1 A;  4KNV A;  2YHS A;  3B9Q A;  4OD5 A;  4U5G A;  4N06 A;  1Z3I X;  2H7B A;  3FVY A;  5KYU B;  3ZIB A;  2GFH A;  4JJF A;  4G7H F;  5KYW B;  2IXO A;  1ZU4 A;  2IYL D;  3AG2 C;  4E7S A;  3WG7 C;  2NUT B;  3QZC A;  3MLG A;  3K66 A;  2ZXO A;  1V54 C;  3W8I A;  2QY9 A;  4F4B A;  2HV7 A;  2H7O A;  4Q7C A;  3W8H A;  2WZG A;  2Y3D A;  3RFY A;  1D1C A;  1TWA A;  4BJ6 A;  2Q9C A;  3DAF A;  4XTK A;  5L3V A;  2CW0 F;  2LSE A;  5F5H A;  2Z15 A;  4CSA C;  5CI8 A;  5DQZ A;  4P6I C;  2L9J A;  3FHD A;  1VMA A;  4CS8 A;  5DS4 A;  4KBL A;  4XLN F;  5D92 A;  3EH2 A;  2ZXW C;  3S0X A;  5IY5 C;  3S28 A;  3ECS A;  4OD4 A;  5T3T A;  3AG4 C;  3LAY A;  4HFK B;  2A1D D;  3WOD F;  1ST6 A;  3K33 A;  2WVQ A;  3JCU Q;  4YN0 B;  3UGP A;  3I4U A;  4KI2 A;  3NG1 A;  4OIO F;  2J0W A;  1OCR C;  1Z23 A;  3AG3 C;  3JSZ A;  3EPV A;  2C03 A;  1TKN A;  2P6V A;  5E33 A;  2R7V A;  3K6B A;  3K1H A;  4HFF B;  5DQT A;  4CBE A;  2Y3B A;  1TWH A;  2PP4 A;  2QTV A;  2R7X A;  1JPJ A;  3O39 A;  4ULW A;  2P7V A;  4C3B A;  4FES A;  4A2N B;  4OIR F;  2W9Y A;  1MMD A;  3DJU B;  4ZLD A;  1FFH A;  3S27 A;  3OA1 A;  3IEE A;  2G3V A;  4M63 A;  3POV A;  2ZXR A;  2VB6 A;  3ABK C;  2WZL A;  1FMV A;  2O9X A;  3DXJ F;  3Q6N A;  4JUR I;  1MMN A;  3HLZ A;  2W45 A;  3HJC A;  3VAY A;  2I8B A;  1M2O A;  2A69 F;  2R7O A;  2WVO A;  3JT1 A;  5T3W A;  4H4K C;  3DZA A;  4MQ9 F;  5E2Q A;  3EFO A;  4C7O B;  2NUT A;  1MNE A;  2IXP A;  4CS9 C;  4LLC A;  1MMA A;  2Q3T A;  3RH3 A;  2J7P A;  3PHF 2;  2Y3H A;  3NRH A;  3B0V C;  2G62 A;  1SMY F;  4G0H A;  2A68 F;  4BEJ A;  2M4E A;  4PJN A;  2IOQ A;  3I5P A;  3ZSU A;  2R7T A;  4RBN A;  3I5Q A;  1OCC C;  3EGD A;  2C04 A;  5D91 A;  3ZG1 A;  3FAJ A;  3EGX A;  4QI2 A;  1M57 C;  2PF4 E;  4LAC B;  2NUP B;  2WB7 A;  5EGY A;  2KNH A;  2DYS C;  1J8Y F;  3O6X A;  4O6M A;  4NY3 A;  5T1D B;  1TWC A;  1D0Y A;  3EG9 B;  2X51 A;  3UMH A;  3UR3 C;  4Q5S F;  3AQB A;  3EGX B;  3L0I A;  2Y69 C;  3K1I C;  2PX0 A;  4C3D A;  1ZHT A;  1O87 A;  3SYN A;  1ZHZ A;  4OIP F;  4DVY P;  4XLP F;  4WJ0 A;  1OKK D;  3RYL A;  3NKE A;  4CS9 A;  2XRH A;  3SEO A;  1BR1 A;  5EHH A;  5DVW A;  2R7U A;  1N1C A;  3EH1 A;  4PJM A;  5KYY B;  3ABL C;  3RKO F;  2B0J A;  3NYM A;  3CZ6 A;  1MMG A;  1IW7 F;  4K0D A;  4LLE A;  2XXA B;  1JPN A;  3AG1 C;  3DD7 A;  4E7Z A;  4EWC A;  4DVZ A;  1OCO C;  1BR4 A;  4JJG A;  5DS5 A;  2JD3 A;  1G8X A;  4W8K A;  4AX2 A;  4CSA A;  3LJB A;  3H65 A;  4O7G A;  3EG9 A;  1Z6A A;  5DS6 A;  3X1O A;  4U5B E;  4YJW A;  3EHM A;  4JZA A;  3B0P A;  1SF8 A;  2WVN A;  3EZI A;  3N0T A;  4YT5 A;  1OCZ C;  2V3C C;  4RDA A;  3UNG C;  3LEV A;  3OWT A;  3VYW A;  4FX5 A;  3N2Z B;  4FWV A;  4BJ1 A;  2FFH A;  2EIL C;  3T4R A;  3M1C B;  1IZM A;  3DJN B;  4XWJ A;  1QLE C;  1TR2 A;  3JRT A;  1M56 C;  1LVK A;  3DMD A;  4PFP A;  3SZR A;  4J30 B;  1ZHW A;  1PCX A;  2IXM A;  3F46 A;  2BE5 F;  2VAS A;  1Z5Z A;  2Q9A A;  2E87 A;  4O6Y A;  2NG1 A;  4BJ5 C;  3ASN C;  3E70 C;  2R7W A;  2G3K A;  3RIP A;  2XSE A;  3B0U X;  3LLK A;  2CNW D;  1D1B A;  4PK4 A;  4JVS A;  4I1O B;  5B1B C;  2HV6 A;  4HE8 D;  4ANJ A;  5L3Q A;  2EIJ C;  3LNR A;  4YT2 A;  2WL8 A;  2EIK C;  3LS1 A;  4GEH A;  3EGD B;  1QZX A;  1M2V A;  1FMW A;  2J9W A;  3UMK A;  4OIQ F;  4KNW A;  2KW3 C;  1BR2 A;  3TD7 A;  1ZYR F;  4J32 B;  2NUP A;  1LKX A;  2J9U A;  2MWQ A;  2J45 A;  3LES A;  3T6B A;  4DBQ A;  4K7B A;  2YEV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...