4X0RA

Crystal structure of human mxb stalk domain
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
236
structure length
201
Chain Sequence
EADKMFFLIEKIKMFNQDIEKLVEGEEVVRENETRLYNKIREDFKNWVGILATNTQKVKNIIHEETFEIIVHQYIQQLVEPALSMLQKAMEIIQQAFINVAKKHFGEFFNLNQTVQSTIEDIKVKHTAKAENMIQLQFRMEQMVFKTEIGIHLNAYFLETSKRLANQIPFIIQYFMLRENGDSLQKAMMQILQEKNRYSWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into the assembly of human anti-HIV dynamin-like protein MxB/Mx2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antiviral protein
molecule keywords Interferon-induced GTP-binding protein Mx2
total genus 87
structure length 201
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1240 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4x0rA00
3ZVRA 3LJBA 4X0RA 3SNHA 3SZRA 4BEJA
chains in the Genus database with same CATH superfamily
3BEHA 3EGXA 4YN0B 4E0HA 3S90A 1BR2A 4UDVA 5L3VA 2A1DD 4EWCA 5KYYB 1G5ZA 4DBRA 1XZPA 5L0FA 1H7IA 1YAUO 1M56C 2EPNA 2NPUA 3EJNA 3FMSA 5T1DB 2Q9CA 1WATA 2A6EF 4BJ6C 1O3UA 4U9DA 5B1BC 3RF3A 2KK1A 2LIGA 3JYHA 1ST6A 1V55C 2ASRA 2M64A 2Q3TA 3FAJA 2YVKA 3DXJF 4PJJA 1ZW2A 2QE9A 2PP4A 3U9MA 3TJ5A 2HSBA 5A69A 4BG0A 2L6GA 2X51A 2XM0A 4XEFA 3V5XA 2CW0F 3LNMB 4I44A 1V4AA 2G3KA 2QUPA 3W2WA 1G4US 1D1BA 4Q4ZF 4BJ1A 5F5HA 3B29A 4DVYP 1LI5A 4U5FE 3AQBA 4JJFA 3ZTMA 3TULA 3EGDB 2J0WA 4YJWA 2EPMX 1Q0MA 2WZGA 2WL8A 4AL1A 2ETSA 1RCPA 3H2UA 3JYYA 3T6GB 2DGJA 5EK0A 3X1OA 4MVZA 1CGME 4JZAA 4PJLA 2GAQA 3LS1A 3TK0A 4IJJA 4G7HF 4CDVA 3V5YA 3L8IA 1RKCA 2XLWA 3EGDA 5A6KA 1U0BB 4RDAA 3U0CA 2DYSC 3ITFA 3EFOB 4CIHA 2VH3A 2ZXPA 4BJ6A 5EGYA 4NQFA 1APCA 3EZHA 4BEJA 1NZEA 1OR2A 1OQCA 2JD3A 2IYLD 2R05A 3FVYA 3KYIA 3NYMA 4C3BA 4JTDB 4CJGA 5L0CA 3EQLF 1LS4A 1OCOC 1TQGA 2YQYA 4U5HA 1SR2A 2MYSA 1ZYRF 2GDCA 4WABA 3LEOA 3K33A 3B0PA 3Q6NA 2L7AA 4M63A 3ECSA 2QLAA 3C8ZA 5KYNA 4CSAA 2XL8A 3LUTB 2F22A 3AGTA 3UMKA 5A6AA 2EILC 1JPJA 3G4XA 1HE1A 1Q0KA 1WN0A 3NKEA 1J8MF 5T3TA 2IBFA 4QI2A 4CS9A 2ZXWC 2IXOA 3FAPB 3M4BA 2GFHA 2P1AA 2YKZA 2OCCC 3ZWIA 4EBKA 3FHDA 3DZAA 3RW0A 1ZHTA 3Q7LA 1TFOB 5KYXB 4OIQF 2I15A 1LKXA 1PD0A 1VYKA 3HLZA 2R7SA 2L81A 3EZIA 3C7JA 3R7CA 2J9UA 4YT8A 3TQOA 1OW6A 3ZDLA 4DVZA 1QVXA 1L7CA 1V54C 3GM3A 4IRUA 1D1AA 1I4ZA 1O87A 2KYHA 2WVQA 3IQCA 3M4CA 4MQ9F 1KTMA 4AE4A 2JX0A 2OU6A 3L1MA 1RJ9B 1D0ZA 3FOPA 2Q7RA 2R7WA 3L0IA 3DAFA 2HV6A 3DAGA 4AX2A 4CJOA 1AVOB 2HSQA 3DMDA 4ZLDA 2XRHA 2XLEA 4JCZA 1YYXA 2VB6A 1NG1A 4E0IA 5JRAA 5JVEA 4GYTA 4NTAA 1BDJB 3UMIA 3AG3C 4K0DA 5JLIA 1MMNA 4LLCA 2EPKX 2X0CA 4EUKB 1E85A 1FTSA 3C18A 3DKAA 2VASA 2VCAA 1ZZPA 3N0TA 4NTBA 1CGOA 2A0BA 3LNRA 4FWVA 4JEBA 5JS5A 4B6IA 3GWNA 4XLNF 4K1OA 2XM4A 3S0XA 3MX3A 1LVKA 1HY5A 4C3DA 2J0XA 2KW3C 4IWBA 1IZMA 3KL4A 4W8PA 3W2VA 2RSEB 3UNGC 3LESA 4MVUA 1D0YA 3AG4C 1I4YA 1M6TA 1JR8A 1SMYF 2YL3A 4RD9A 3KH2A 5T3WA 2E87A 3A11A 3C8GA 2FGYA 2A6HF 2OQMA 2KJGA 3EGXB 3LJBA 3U2MA 5A6BA 2PBEA 3EG9B 3GODA 2V26A 1FMWA 1T6UA 1DOVA 2HUJA 4N4WA 5COFA 2XXAB 4MTFA 2ICWG 2KSFA 2A0UA 3DE9A 3SXZA 2HS5A 2Q9AA 1PCXA 4LDRA 1N1CA 2C04A 2P0NA 3ZIBA 2B0JA 1AUEA 3GORA 5EHHA 4IAOA 2HMQA 1TKNA 2YWAA 4CX9A 5KYWB 2DB4A 2NUPB 2Y69C 3K7DA 4JTAB 4BJTA 1OCZC 3JT1A 2R03A 1U6HA 3HNJA 1M57C 2CNWA 3KMIA 1Z63A 3W4YA 4JW1A 3ZG1A 4FAPB 1JPNA 1NFOA 2W9YA 3Q6MA 3VF0A 3U3BA 4CDAA 2IXPA 4CIPA 4KI2A 3H65A 5L0DA 4DOZA 2CNWD 5DS5A 3FXHA 4I1MA 4MW3A 4DRHB 1R5ID 5K0IA 4AL0A 4O6MA 2HZ8A 1T9KA 1WASA 2NSGA 1OXKA 4O6YA 4DXWA 5F5FA 2XS1A 3B0VC 3CSKA 2YHSA 3DJNB 1S7ZA 3B0UX 3ABMC 3PHF2 3NMIA 4Q5SF 4JRZA 2XSEA 1LPEA 2NUPA 2HJ3A 2XLOA 2KGOA 1FMVA 4KNWA 1D0XA 3KKBA 3N24A 1QZXA 4FESA 4Z9JA 3KYJA 3R2PA 4EBBA 2J9BA 3O6XA 1ZHYA 3NKDA 3RQGA 3MFNA 2AP3A 2MHRA 3DM9B 5JP7A 4JJGA 5HV9A 5KYWA 5KYUA 3RVYA 3LAYA 5TJ5E 3GM1A 4K7BA 3G4ZA 3HNKA 3RKOF 2C03A 1CGNA 2R7XA 3NG1A 3JRMO 2DI3A 2W4BA 3WAQA 3GWLA 1A7VA 4OD4A 4YL3A 3QVZA 2IM8A 3ZC4A 5KYUB 1E2XA 4J32B 2H7VC 1MNDA 3UGPA 3ASOC 4CSAC 2R02A 2BL2A 3H2VA 1VYIA 4U5EE 4EBJA 1K40A 1LS1A 2J7PA 3NYLA 2HV7A 3TD7A 4LLEA 3SEOA 4L6RA 5FZTA 1B68A 1QKRA 2LK4A 1DOWA 3GM2A 4JVSA 5L0HA 4CS8C 5L3QA 2ZXRA 3M15A 4J7TA 4YWQA 3K1HA 4CDYA 1F1MA 2OG2A 5E2QA 3M79A 2HKVA 4EIYA 4PK4A 2XL6A 4N6HA 4JCHA 4P9FA 5GPGB 2FAPB 4OINF 3ZVRA 3VM6A 4CBEA 1J8YF 1D1CA 1RKEB 3HNLA 1OCCC 4D4NA 1A7DA 4Z9IA 4U5DE 2DYRC 5JSLA 2L6HA 3S29A 2PF4E 3K1IA 3SXMA 3TOMA 1V74B 4YT5A 1T6IA 2Q4FA 2R7TA 5E33A 2XL4A 2ZPAA 2OEVA 1WGWA 1MMGA 4U5CE 3L34A 1E83A 1CPRA 1YA9A 3JSZA 4EHPA 2R7RA 4MVOA 3RYLA 1EA8A 3HKKA 3K6BA 2D5RB 3A9CA 2CGEA 3MYFA 4WGYA 1H6GA 2HMZA 3IQ6A 3QMKA 3VAYA 1T6QA 4MVSA 1ZVZA 3HJCA 1JMWA 3EPVA 2YZSA 1VTMP 1MQVA 1NFNA 1IW7F 4DBQA 3POVA 2VCBA 2YL1A 3RH3A 1TWCA 2KQ9A 2LP4A 4E18A 5HSWA 4YT4A 2OJED 4CS8A 1ZW3A 2MWQA 4FX5A 3KPHA 4PR9A 1CPQA 3JZ0A 2QTVA 4YL0A 2VC9A 5BQIA 4I3MA 4OIOF 5KYXA 2WVOA 2IOQA 1U89A 3SNHA 4E7ZA 1BBHA 2J7PD 1JOGA 3JRTA 2G62A 1NU9C 4DRJB 2CDQA 4QI0A 3IHUA 4LDKA 1KNYA 1Z6AA 5B3SC 3F47A 3C63A 1HMDA 3OA1A 5E3AA 2CYDA 4W8KA 3WG7C 4LDQA 2G3VA 1C03A 4O7GA 1Z3IX 3W8HA 2EIKC 5DS6A 1FFTC 3PDMP 1WOLA 3ASNC 5A6JA 2OOCA 2XLVA 2ZD9A 3T9OA 4R32A 3EHNA 1Z7Qc 2AU5A 2M4EA 3EFOA 3QVYA 1VLTA 3WODF 4KC9A 1ORSC 1UG7A 2XLDA 5CI9A 1GS9A 2FFHA 4RBNA 3ZQVA 4OIPF 3HNIA 4YT2A 2EPLX 4G7ZF 1JAFA 1W2WA 1TWGA 1GQAA 3GEHA 4G78A 4DRIB 1K04A 1YLMA 2L9JA 4HFKB 2R7QA 2WZLA 4HFFB 2EIJC 5FCLA 1RJ9A 3AOUA 1A0BA 3ZSUA 5BUOA 2GA0A 1G8XA 4WJ0A 2UUIA 5CI8A 1Q0FA 3IEEA 3V7OA 1UFBA 1YYJA 2Q9BA 3TOLA 4D4XA 4AK9A 4XQ1A 3SYNA 2LCHA 2LFDA 1LM3B 2Y3DA 3EHMA 4Z9HA 1PD1A 3MBGA 5D92A 3N2ZB 4NC3A 2IXMA 4PACA 4C7OB 1QLEC 3W8IA 5DQZA 1YZAA 2KNHA 4ANJA 1XWJA 1EQ1A 1NBBA 1LIHA 4P6IC 5CIVA 1HW1A 4MTOA 1VLSA 4NY3A 4ULWA 2UUHA 2LD6A 2HJMA 2QNLA 3BRJA 3QZCA 4ULVA 3V5ZA 3UGOA 3J06A 1KU2A 2ZXOA 4H4KC 3Q7GA 3SXKA 5BQHA 2NG1A 3LLIA 3VYWA 3QTHA 4PFOA 2R9RB 3F46A 1ZHWA 1VOMA 1HE9A 2O9XA 3FOOA 3X2QC 5A6BD 5KYYA 3RVZA 3T4RA 3TJ6A 4CS9C 3FDQA 3NMJA 1ORJA 2TMVP 4PJNA 3NYJA 1L3PA 3OEOA 4J7YA 5COGA 2QY9A 5DLJA 3C8GD 2I8BA 5AC4A 1R4TA 1MMAA 2GWWA 3U3FA 2H7BA 4JE9A 4MW8A 4MVMA 3U2LA 5AGFA 1SYQA 2YL7A 3NMKA 4IB4A 4DJ9A 1ZHXA 4JEAA 4NTFA 2B0HA 3IPMO 1XZQA 2EIMC 1QPUA 3C62A 4JTCB 1OCRC 4H54A 4HEAJ 1NSGB 2AWCA 2PFDA 4OIRF 4XPXA 1TR2A 3AG2C 1TWAA 3O10A 2D4UA 2XLHA 2Y3GA 3NRHA 4GEHA 1SZIA 1VB5A 2XS8A 1A41A 1MMDA 4NCQA 1NU7D 3RQEA 5L0GA 1H9TA 2WB7A 2P7VA 1ZU4A 2YL0A 4G7OF 2P6VA 1RKEA 3DM5A 1JRAA 3PMRA 4U9EA 2AVKA 4XLPF 2H8AA 1M2VB 1OXBA 1BR1A 4MNDA 4JKVA 2NUTA 4BJ5A 3LEVA 1QSPA 2KC3A 4O79A 5L0IA 4MVRA 4JC7A 2VCCA 1H9GA 2BE5F 4A4AA 2PX0A 5L0JA 2J9WA 2J9VA 4YL1A 2PNOA 3AQCA 4MVQA 4C3EA 3E9VA 5B3IA 3ABLC 1ZHZA 2V3CC 1BZ4A 2YLDA 3S28A 3L8JA 2J8WA 2A68F 1WWPA 3CEXA 4U5BE 1NLXA 2P61A 1ORYA 4IGGA 3S27A 2OJQA 1OKKA 2R7OA 2R25A 3T6BA 1YVIA 4Q7CA 1ZU5A 3QW0A 2J46A 2XLMA 3LLKA 4GQHA 3SXYA 3U5SA 1E86A 3E70C 3DJUB 3WHNA 3B9QA 4O6NA 2NUTB 2JPUA 3GANA 3GEIA 4LACB 1BR4A 1Y6DA 2NSFA 3S9OA 1O5HA 4XEVA 3RQFA 2YLGA 1S05A 1YJGA 1C02A 1TFKB 4HE8D 4XPWA 1FNTc 5JUAA 3O39A 2H7OA 1MNEA 1SF8A 3DI5A 4BJ5C 4OD5A 5AC5A 1OKKD 3JCUQ 3ABKC 2Y3BA 4F4BA 3CQZA 4XWJA 2YRFA 1WTYA 4N06A 3RFYA 4QDLA 4PFPA 4U5GA 3QW1A 2YEVA 1GM5A 1VMAA 3AGUA 3ZTZA 3HTKC 3OWTA 4E17A 2RD9A 2Q00A 3U9JA 5JT4A 3PCVA 5DS4A 1LE2A 1YZCA 2OKUA 1Q0GA 1I5NA 4IARA 3RIPA 1GGQA 4X0RA 2AWYA 3ZQYA 4BPMA 4ER9A 2XXAA 3NDBB 5E3CA 5IY5C 2W4MA 3DWWA 3EH2A 4C7OA 3EG9A 3I5PA 2Z15A 1QQ3A 2LQGA 1AEPA 3AJMA 3ATPA 3C8GB 2IXNA 3IQTA 4G0HA 1HMOA 1Q0DA 3DE8A 1E84A 3CAXA 3UMHA 2WVNA 4N6CA 1TWHA 3I5QA 4XPYA 2PX3A 4BEMJ 1A7EA 3T6JA 1PV3A 2CCYA 3MLGA 4I1OB 4XTKA 3UR3C 2EPOA 3G50A 1M2VA 2L6FA 1T5OA 3M1CB 1YARO 4JURI 4P9TA 5DQTA 3JSEO 1FFHA 5DVWA 2A69F 1RMVA 2LSEA 3LS0A 1Z23A 1LE4A 3AG1C 4E7SA 2R7VA 1T01A 5B1AC 3U8PA 4MTGA 3U8VA 4ONSA 1C17M 3JTLO 3US6A 1EI7A 1OW7A 5COMA 1YA7O 4IAQA 3SP1A 2Y39A 5D91A 1HW2A 1FAPB 4CS7A 1FR0A 3B71A 4KBLA 3IQ5A 3CZ6A 2YLIA 3K1IC 4WGZA 4MS2A 2EINC 4XEKA 3VRCA 3I4UA 4LERA 3S84A 1EKYA 2LFFA 2W45A 4KNVA 2WZFA 3MYIA 1Z5ZA 3K66A 3DD7A 2OEXA 2BC5A 1OR3A 1G4WR 1K05A 4AE4B 1Y4CA 3O55A 3EH1A 4YK5A 2HFIA 5BQGA 4A2NB 1YDIA 3GEEA 4JIOA 5F28E 2R7UA 1OW8A 1VK5A 2J45A 1LI7A 256BA 4EKWA 4ZLCA 4PJMA 3SZRA 1M2OA 4J30B 1RXQA 2Y3HA
chains in the Genus database with same CATH topology
3EGXA 4YN0B 1BR2A 5L3VA 2A1DD 4EWCA 5KYYB 4DBRA 3EJNA 1M56C 5T1DB 2Q9CA 2A6EF 4BJ6C 5B1BC 3JYHA 1ST6A 1V55C 2Q3TA 3FAJA 4PJJA 3DXJF 2PP4A 4BG0A 2X51A 2CW0F 4I44A 2G3KA 3W2WA 1D1BA 4Q4ZF 4BJ1A 5F5HA 4U5FE 3AQBA 4JJFA 3EGDB 2J0WA 4YJWA 2WZGA 2WL8A 2DGJA 3X1OA 4JZAA 4PJLA 3LS1A 4G7HF 4IJJA 3EGDA 4RDAA 2DYSC 3ITFA 3EFOB 4CIHA 2VH3A 2ZXPA 4BJ6A 5EGYA 3EZHA 4BEJA 1NZEA 2JD3A 2IYLD 3FVYA 3NYMA 4C3BA 3EQLF 1OCOC 4U5HA 2MYSA 1ZYRF 3K33A 3B0PA 3Q6NA 4M63A 3ECSA 5KYNA 4CSAA 3UMKA 2EILC 1JPJA 5T3TA 3NKEA 4QI2A 1J8MF 4CS9A 2ZXWC 2IXOA 2GFHA 2OCCC 5KYXB 4C7OA 3FHDA 3DZAA 4OIQF 1ZHTA 3Q7LA 1LKXA 1PD0A 1VYKA 3HLZA 2R7SA 2L81A 3EZIA 4YT8A 2J9UA 4DVZA 1V54C 4IRUA 1D1AA 1O87A 4MQ9F 2WVQA 4AE4A 1RJ9B 1D0ZA 2R7WA 3L0IA 3DAFA 2HV6A 3DAGA 4AX2A 4ZLDA 3DMDA 2XRHA 2VB6A 1NG1A 4GYTA 3UMIA 3AG3C 4K0DA 1MMNA 4LLCA 1FTSA 2VASA 3N0TA 3LNRA 4FWVA 4B6IA 4XLNF 3S0XA 3MX3A 1LVKA 4C3DA 2J0XA 2KW3C 4IWBA 1IZMA 3KL4A 3W2VA 3UNGC 3LESA 1D0YA 3AG4C 4RD9A 1SMYF 3KH2A 5T3WA 2E87A 2FGYA 2A6HF 3LJBA 2KJGA 3EGXB 3EG9B 3GODA 2V26A 1FMWA 2XXAB 2Q9AA 1PCXA 1N1CA 2C04A 3ZIBA 2B0JA 5EHHA 4IAOA 1TKNA 5KYWB 3K7DA 2NUPB 2Y69C 4BJTA 1OCZC 3JT1A 1M57C 2CNWA 3KMIA 1Z63A 4JW1A 3ZG1A 1JPNA 2W9YA 3Q6MA 2IXPA 4KI2A 3H65A 4DOZA 2CNWD 5DS5A 4I1MA 4O6MA 4O6YA 5F5FA 3B0VC 3CSKA 2YHSA 3DJNB 1S7ZA 3B0UX 3ABMC 3PHF2 4Q5SF 2XSEA 2NUPA 2KGOA 1FMVA 4KNWA 1D0XA 3KKBA 3N24A 1QZXA 4FESA 4EBBA 3O6XA 1ZHYA 3NKDA 3DM9B 4JJGA 5KYWA 5KYUA 3LAYA 4K7BA 3RKOF 2C03A 2R7XA 3NG1A 2W4BA 4OD4A 3ZC4A 5KYUB 4J32B 2H7VC 1MNDA 3UGPA 3ASOC 4CSAC 1VYIA 4U5EE 1LS1A 3NYLA 2J7PA 2HV7A 3TD7A 4LLEA 3SEOA 4JVSA 5L3QA 4CS8C 2ZXRA 4YWQA 3K1HA 2OG2A 5E2QA 4PK4A 3ZVRA 4JCHA 4CBEA 4DVYP 4OINF 2R7VA 1J8YF 1D1CA 1OCCC 4U5DE 2DYRC 3S29A 2PF4E 4YT5A 2R7TA 5E33A 2XL4A 2ZPAA 1WGWA 1MMGA 4U5CE 3L34A 3JSZA 2R7RA 3RYLA 3K6BA 2D5RB 2CGEA 3QMKA 3VAYA 3HJCA 3EPVA 2YZSA 1IW7F 4DBQA 3POVA 3RH3A 1TWCA 2KQ9A 5HSWA 4YT4A 4CS8A 2MWQA 4FX5A 2QTVA 4I3MA 4OIOF 5KYXA 2WVOA 2IOQA 3SNHA 4E7ZA 2J7PD 3JRTA 2G62A 1NU9C 2CDQA 4QI0A 1Z6AA 5B3SC 3F47A 3OA1A 5E3AA 4W8KA 3WG7C 2G3VA 4O7GA 1Z3IX 5DS6A 2EIKC 1FFTC 3ASNC 3EHNA 2M4EA 3EFOA 3WODF 4KC9A 5CI9A 2FFHA 4RBNA 4OIPF 4YT2A 4G7ZF 1W2WA 1TWGA 2L9JA 4HFKB 2R7QA 2WZLA 4HFFB 2EIJC 5FCLA 1RJ9A 3ZSUA 5BUOA 4WJ0A 1G8XA 5CI8A 3IEEA 3V7OA 2Q9BA 4AK9A 3SYNA 2Y3DA 3EHMA 1PD1A 5D92A 3N2ZB 2IXMA 4C7OB 1QLEC 3W8IA 5DQZA 2KNHA 4ANJA 4P6IC 4NY3A 4ULWA 3UGOA 3QZCA 1KU2A 4H4KC 2ZXOA 3Q7GA 2NG1A 3LLIA 3VYWA 4PFOA 3F46A 1ZHWA 1VOMA 2O9XA 3X2QC 5KYYA 4CS9C 3T4RA 3FDQA 4PJNA 3NYJA 3OEOA 2QY9A 5DLJA 2I8BA 1MMAA 2H7BA 1ZHXA 2EIMC 1OCRC 4HEAJ 2PFDA 4OIRF 1TR2A 3AG2C 1TWAA 2Y3GA 3NRHA 4GEHA 1SZIA 1MMDA 1NU7D 4G7OF 2WB7A 2P7VA 1ZU4A 2P6VA 3DM5A 3PMRA 4XLPF 1M2VB 1BR1A 4MNDA 2NUTA 4BJ5A 3LEVA 4O79A 2BE5F 2PX0A 2J9WA 2J9VA 3AQCA 4C3EA 3E9VA 3ABLC 1ZHZA 2V3CC 3S28A 4U5BE 2A68F 3S27A 1OKKA 2R7OA 3T6BA 4Q7CA 1ZU5A 2J46A 3LLKA 3E70C 3DJUB 3B9QA 4O6NA 2NUTB 3GANA 4LACB 1BR4A 1O5HA 4HE8D 3O39A 2H7OA 1SF8A 1MNEA 4OD5A 1OKKD 3JCUQ 3ABKC 2Y3BA 4F4BA 3CQZA 4XWJA 4N06A 3RFYA 4QDLA 4PFPA 4U5GA 2YEVA 1VMAA 3HTKC 3OWTA 5DS4A 3RIPA 4BJ5C 3NDBB 4X0RA 2XXAA 5E3CA 5IY5C 2W4MA 3EH2A 3EG9A 3I5PA 2Z15A 2IXNA 4G0HA 3UMHA 2WVNA 1TWHA 3I5QA 2PX3A 3T6JA 3MLGA 4I1OB 4XTKA 3W8HA 3UR3C 3M1CB 1M2VA 4JURI 5DQTA 1FFHA 5DVWA 2A69F 2LSEA 3LS0A 1Z23A 3AG1C 4E7SA 5B1AC 3SP1A 2Y39A 5D91A 4CS7A 4KBLA 3CZ6A 3K1IC 2EINC 3I4UA 4LERA 2W45A 4KNVA 2WZFA 1Z5ZA 3K66A 3DD7A 4AE4B 3EH1A 4A2NB 2R7UA 1VK5A 2J45A 4ZLCA 4PJMA 3SZRA 1M2OA 4J30B 2Y3HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZVR A;  3LJB A;  4X0R A;  3SNH A;  3SZR A;  4BEJ A; 
#chains in the Genus database with same CATH topology
 3BEH A;  3EGX A;  4YN0 B;  4E0H A;  3S90 A;  1BR2 A;  4UDV A;  5L3V A;  2A1D D;  4EWC A;  5KYY B;  1G5Z A;  4DBR A;  1XZP A;  5L0F A;  1H7I A;  1YAU O;  1M56 C;  2EPN A;  2NPU A;  3EJN A;  3FMS A;  5T1D B;  2Q9C A;  1WAT A;  2A6E F;  4BJ6 C;  1O3U A;  4U9D A;  5B1B C;  3RF3 A;  2KK1 A;  2LIG A;  3JYH A;  1ST6 A;  1V55 C;  2ASR A;  2M64 A;  2Q3T A;  3FAJ A;  2YVK A;  3DXJ F;  4PJJ A;  1ZW2 A;  2QE9 A;  2PP4 A;  3U9M A;  3TJ5 A;  2HSB A;  5A69 A;  4BG0 A;  2L6G A;  2X51 A;  2XM0 A;  4XEF A;  3V5X A;  2CW0 F;  3LNM B;  4I44 A;  1V4A A;  2G3K A;  2QUP A;  3W2W A;  1G4U S;  1D1B A;  4Q4Z F;  4BJ1 A;  5F5H A;  3B29 A;  4DVY P;  1LI5 A;  4U5F E;  3AQB A;  4JJF A;  3ZTM A;  3TUL A;  3EGD B;  2J0W A;  4YJW A;  2EPM X;  1Q0M A;  2WZG A;  2WL8 A;  4AL1 A;  2ETS A;  1RCP A;  3H2U A;  3JYY A;  3T6G B;  2DGJ A;  5EK0 A;  3X1O A;  4MVZ A;  1CGM E;  4JZA A;  4PJL A;  2GAQ A;  3LS1 A;  3TK0 A;  4IJJ A;  4G7H F;  4CDV A;  3V5Y A;  3L8I A;  1RKC A;  2XLW A;  3EGD A;  5A6K A;  1U0B B;  4RDA A;  3U0C A;  2DYS C;  3ITF A;  3EFO B;  4CIH A;  2VH3 A;  2ZXP A;  4BJ6 A;  5EGY A;  4NQF A;  1APC A;  3EZH A;  4BEJ A;  1NZE A;  1OR2 A;  1OQC A;  2JD3 A;  2IYL D;  2R05 A;  3FVY A;  3KYI A;  3NYM A;  4C3B A;  4JTD B;  4CJG A;  5L0C A;  3EQL F;  1LS4 A;  1OCO C;  1TQG A;  2YQY A;  4U5H A;  1SR2 A;  2MYS A;  1ZYR F;  2GDC A;  4WAB A;  3LEO A;  3K33 A;  3B0P A;  3Q6N A;  2L7A A;  4M63 A;  3ECS A;  2QLA A;  3C8Z A;  5KYN A;  4CSA A;  2XL8 A;  3LUT B;  2F22 A;  3AGT A;  3UMK A;  5A6A A;  2EIL C;  1JPJ A;  3G4X A;  1HE1 A;  1Q0K A;  1WN0 A;  3NKE A;  1J8M F;  5T3T A;  2IBF A;  4QI2 A;  4CS9 A;  2ZXW C;  2IXO A;  3FAP B;  3M4B A;  2GFH A;  2P1A A;  2YKZ A;  2OCC C;  3ZWI A;  4EBK A;  3FHD A;  3DZA A;  3RW0 A;  1ZHT A;  3Q7L A;  1TFO B;  5KYX B;  4OIQ F;  2I15 A;  1LKX A;  1PD0 A;  1VYK A;  3HLZ A;  2R7S A;  2L81 A;  3EZI A;  3C7J A;  3R7C A;  2J9U A;  4YT8 A;  3TQO A;  1OW6 A;  3ZDL A;  4DVZ A;  1QVX A;  1L7C A;  1V54 C;  3GM3 A;  4IRU A;  1D1A A;  1I4Z A;  1O87 A;  2KYH A;  2WVQ A;  3IQC A;  3M4C A;  4MQ9 F;  1KTM A;  4AE4 A;  2JX0 A;  2OU6 A;  3L1M A;  1RJ9 B;  1D0Z A;  3FOP A;  2Q7R A;  2R7W A;  3L0I A;  3DAF A;  2HV6 A;  3DAG A;  4AX2 A;  4CJO A;  1AVO B;  2HSQ A;  3DMD A;  4ZLD A;  2XRH A;  2XLE A;  4JCZ A;  1YYX A;  2VB6 A;  1NG1 A;  4E0I A;  5JRA A;  5JVE A;  4GYT A;  4NTA A;  1BDJ B;  3UMI A;  3AG3 C;  4K0D A;  5JLI A;  1MMN A;  4LLC A;  2EPK X;  2X0C A;  4EUK B;  1E85 A;  1FTS A;  3C18 A;  3DKA A;  2VAS A;  2VCA A;  1ZZP A;  3N0T A;  4NTB A;  1CGO A;  2A0B A;  3LNR A;  4FWV A;  4JEB A;  5JS5 A;  4B6I A;  3GWN A;  4XLN F;  4K1O A;  2XM4 A;  3S0X A;  3MX3 A;  1LVK A;  1HY5 A;  4C3D A;  2J0X A;  2KW3 C;  4IWB A;  1IZM A;  3KL4 A;  4W8P A;  3W2V A;  2RSE B;  3UNG C;  3LES A;  4MVU A;  1D0Y A;  3AG4 C;  1I4Y A;  1M6T A;  1JR8 A;  1SMY F;  2YL3 A;  4RD9 A;  3KH2 A;  5T3W A;  2E87 A;  3A11 A;  3C8G A;  2FGY A;  2A6H F;  2OQM A;  2KJG A;  3EGX B;  3LJB A;  3U2M A;  5A6B A;  2PBE A;  3EG9 B;  3GOD A;  2V26 A;  1FMW A;  1T6U A;  1DOV A;  2HUJ A;  4N4W A;  5COF A;  2XXA B;  4MTF A;  2ICW G;  2KSF A;  2A0U A;  3DE9 A;  3SXZ A;  2HS5 A;  2Q9A A;  1PCX A;  4LDR A;  1N1C A;  2C04 A;  2P0N A;  3ZIB A;  2B0J A;  1AUE A;  3GOR A;  5EHH A;  4IAO A;  2HMQ A;  1TKN A;  2YWA A;  4CX9 A;  5KYW B;  2DB4 A;  2NUP B;  2Y69 C;  3K7D A;  4JTA B;  4BJT A;  1OCZ C;  3JT1 A;  2R03 A;  1U6H A;  3HNJ A;  1M57 C;  2CNW A;  3KMI A;  1Z63 A;  3W4Y A;  4JW1 A;  3ZG1 A;  4FAP B;  1JPN A;  1NFO A;  2W9Y A;  3Q6M A;  3VF0 A;  3U3B A;  4CDA A;  2IXP A;  4CIP A;  4KI2 A;  3H65 A;  5L0D A;  4DOZ A;  2CNW D;  5DS5 A;  3FXH A;  4I1M A;  4MW3 A;  4DRH B;  1R5I D;  5K0I A;  4AL0 A;  4O6M A;  2HZ8 A;  1T9K A;  1WAS A;  2NSG A;  1OXK A;  4O6Y A;  4DXW A;  5F5F A;  2XS1 A;  3B0V C;  3CSK A;  2YHS A;  3DJN B;  1S7Z A;  3B0U X;  3ABM C;  3PHF 2;  3NMI A;  4Q5S F;  4JRZ A;  2XSE A;  1LPE A;  2NUP A;  2HJ3 A;  2XLO A;  2KGO A;  1FMV A;  4KNW A;  1D0X A;  3KKB A;  3N24 A;  1QZX A;  4FES A;  4Z9J A;  3KYJ A;  3R2P A;  4EBB A;  2J9B A;  3O6X A;  1ZHY A;  3NKD A;  3RQG A;  3MFN A;  2AP3 A;  2MHR A;  3DM9 B;  5JP7 A;  4JJG A;  5HV9 A;  5KYW A;  5KYU A;  3RVY A;  3LAY A;  5TJ5 E;  3GM1 A;  4K7B A;  3G4Z A;  3HNK A;  3RKO F;  2C03 A;  1CGN A;  2R7X A;  3NG1 A;  3JRM O;  2DI3 A;  2W4B A;  3WAQ A;  3GWL A;  1A7V A;  4OD4 A;  4YL3 A;  3QVZ A;  2IM8 A;  3ZC4 A;  5KYU B;  1E2X A;  4J32 B;  2H7V C;  1MND A;  3UGP A;  3ASO C;  4CSA C;  2R02 A;  2BL2 A;  3H2V A;  1VYI A;  4U5E E;  4EBJ A;  1K40 A;  1LS1 A;  2J7P A;  3NYL A;  2HV7 A;  3TD7 A;  4LLE A;  3SEO A;  4L6R A;  5FZT A;  1B68 A;  1QKR A;  2LK4 A;  1DOW A;  3GM2 A;  4JVS A;  5L0H A;  4CS8 C;  5L3Q A;  2ZXR A;  3M15 A;  4J7T A;  4YWQ A;  3K1H A;  4CDY A;  1F1M A;  2OG2 A;  5E2Q A;  3M79 A;  2HKV A;  4EIY A;  4PK4 A;  2XL6 A;  4N6H A;  4JCH A;  4P9F A;  5GPG B;  2FAP B;  4OIN F;  3ZVR A;  3VM6 A;  4CBE A;  1J8Y F;  1D1C A;  1RKE B;  3HNL A;  1OCC C;  4D4N A;  1A7D A;  4Z9I A;  4U5D E;  2DYR C;  5JSL A;  2L6H A;  3S29 A;  2PF4 E;  3K1I A;  3SXM A;  3TOM A;  1V74 B;  4YT5 A;  1T6I A;  2Q4F A;  2R7T A;  5E33 A;  2XL4 A;  2ZPA A;  2OEV A;  1WGW A;  1MMG A;  4U5C E;  3L34 A;  1E83 A;  1CPR A;  1YA9 A;  3JSZ A;  4EHP A;  2R7R A;  4MVO A;  3RYL A;  1EA8 A;  3HKK A;  3K6B A;  2D5R B;  3A9C A;  2CGE A;  3MYF A;  4WGY A;  1H6G A;  2HMZ A;  3IQ6 A;  3QMK A;  3VAY A;  1T6Q A;  4MVS A;  1ZVZ A;  3HJC A;  1JMW A;  3EPV A;  2YZS A;  1VTM P;  1MQV A;  1NFN A;  1IW7 F;  4DBQ A;  3POV A;  2VCB A;  2YL1 A;  3RH3 A;  1TWC A;  2KQ9 A;  2LP4 A;  4E18 A;  5HSW A;  4YT4 A;  2OJE D;  4CS8 A;  1ZW3 A;  2MWQ A;  4FX5 A;  3KPH A;  4PR9 A;  1CPQ A;  3JZ0 A;  2QTV A;  4YL0 A;  2VC9 A;  5BQI A;  4I3M A;  4OIO F;  5KYX A;  2WVO A;  2IOQ A;  1U89 A;  3SNH A;  4E7Z A;  1BBH A;  2J7P D;  1JOG A;  3JRT A;  2G62 A;  1NU9 C;  4DRJ B;  2CDQ A;  4QI0 A;  3IHU A;  4LDK A;  1KNY A;  1Z6A A;  5B3S C;  3F47 A;  3C63 A;  1HMD A;  3OA1 A;  5E3A A;  2CYD A;  4W8K A;  3WG7 C;  4LDQ A;  2G3V A;  1C03 A;  4O7G A;  1Z3I X;  3W8H A;  2EIK C;  5DS6 A;  1FFT C;  3PDM P;  1WOL A;  3ASN C;  5A6J A;  2OOC A;  2XLV A;  2ZD9 A;  3T9O A;  4R32 A;  3EHN A;  1Z7Q c;  2AU5 A;  2M4E A;  3EFO A;  3QVY A;  1VLT A;  3WOD F;  4KC9 A;  1ORS C;  1UG7 A;  2XLD A;  5CI9 A;  1GS9 A;  2FFH A;  4RBN A;  3ZQV A;  4OIP F;  3HNI A;  4YT2 A;  2EPL X;  4G7Z F;  1JAF A;  1W2W A;  1TWG A;  1GQA A;  3GEH A;  4G78 A;  4DRI B;  1K04 A;  1YLM A;  2L9J A;  4HFK B;  2R7Q A;  2WZL A;  4HFF B;  2EIJ C;  5FCL A;  1RJ9 A;  3AOU A;  1A0B A;  3ZSU A;  5BUO A;  2GA0 A;  1G8X A;  4WJ0 A;  2UUI A;  5CI8 A;  1Q0F A;  3IEE A;  3V7O A;  1UFB A;  1YYJ A;  2Q9B A;  3TOL A;  4D4X A;  4AK9 A;  4XQ1 A;  3SYN A;  2LCH A;  2LFD A;  1LM3 B;  2Y3D A;  3EHM A;  4Z9H A;  1PD1 A;  3MBG A;  5D92 A;  3N2Z B;  4NC3 A;  2IXM A;  4PAC A;  4C7O B;  1QLE C;  3W8I A;  5DQZ A;  1YZA A;  2KNH A;  4ANJ A;  1XWJ A;  1EQ1 A;  1NBB A;  1LIH A;  4P6I C;  5CIV A;  1HW1 A;  4MTO A;  1VLS A;  4NY3 A;  4ULW A;  2UUH A;  2LD6 A;  2HJM A;  2QNL A;  3BRJ A;  3QZC A;  4ULV A;  3V5Z A;  3UGO A;  3J06 A;  1KU2 A;  2ZXO A;  4H4K C;  3Q7G A;  3SXK A;  5BQH A;  2NG1 A;  3LLI A;  3VYW A;  3QTH A;  4PFO A;  2R9R B;  3F46 A;  1ZHW A;  1VOM A;  1HE9 A;  2O9X A;  3FOO A;  3X2Q C;  5A6B D;  5KYY A;  3RVZ A;  3T4R A;  3TJ6 A;  4CS9 C;  3FDQ A;  3NMJ A;  1ORJ A;  2TMV P;  4PJN A;  3NYJ A;  1L3P A;  3OEO A;  4J7Y A;  5COG A;  2QY9 A;  5DLJ A;  3C8G D;  2I8B A;  5AC4 A;  1R4T A;  1MMA A;  2GWW A;  3U3F A;  2H7B A;  4JE9 A;  4MW8 A;  4MVM A;  3U2L A;  5AGF A;  1SYQ A;  2YL7 A;  3NMK A;  4IB4 A;  4DJ9 A;  1ZHX A;  4JEA A;  4NTF A;  2B0H A;  3IPM O;  1XZQ A;  2EIM C;  1QPU A;  3C62 A;  4JTC B;  1OCR C;  4H54 A;  4HEA J;  1NSG B;  2AWC A;  2PFD A;  4OIR F;  4XPX A;  1TR2 A;  3AG2 C;  1TWA A;  3O10 A;  2D4U A;  2XLH A;  2Y3G A;  3NRH A;  4GEH A;  1SZI A;  1VB5 A;  2XS8 A;  1A41 A;  1MMD A;  4NCQ A;  1NU7 D;  3RQE A;  5L0G A;  1H9T A;  2WB7 A;  2P7V A;  1ZU4 A;  2YL0 A;  4G7O F;  2P6V A;  1RKE A;  3DM5 A;  1JRA A;  3PMR A;  4U9E A;  2AVK A;  4XLP F;  2H8A A;  1M2V B;  1OXB A;  1BR1 A;  4MND A;  4JKV A;  2NUT A;  4BJ5 A;  3LEV A;  1QSP A;  2KC3 A;  4O79 A;  5L0I A;  4MVR A;  4JC7 A;  2VCC A;  1H9G A;  2BE5 F;  4A4A A;  2PX0 A;  5L0J A;  2J9W A;  2J9V A;  4YL1 A;  2PNO A;  3AQC A;  4MVQ A;  4C3E A;  3E9V A;  5B3I A;  3ABL C;  1ZHZ A;  2V3C C;  1BZ4 A;  2YLD A;  3S28 A;  3L8J A;  2J8W A;  2A68 F;  1WWP A;  3CEX A;  4U5B E;  1NLX A;  2P61 A;  1ORY A;  4IGG A;  3S27 A;  2OJQ A;  1OKK A;  2R7O A;  2R25 A;  3T6B A;  1YVI A;  4Q7C A;  1ZU5 A;  3QW0 A;  2J46 A;  2XLM A;  3LLK A;  4GQH A;  3SXY A;  3U5S A;  1E86 A;  3E70 C;  3DJU B;  3WHN A;  3B9Q A;  4O6N A;  2NUT B;  2JPU A;  3GAN A;  3GEI A;  4LAC B;  1BR4 A;  1Y6D A;  2NSF A;  3S9O A;  1O5H A;  4XEV A;  3RQF A;  2YLG A;  1S05 A;  1YJG A;  1C02 A;  1TFK B;  4HE8 D;  4XPW A;  1FNT c;  5JUA A;  3O39 A;  2H7O A;  1MNE A;  1SF8 A;  3DI5 A;  4BJ5 C;  4OD5 A;  5AC5 A;  1OKK D;  3JCU Q;  3ABK C;  2Y3B A;  4F4B A;  3CQZ A;  4XWJ A;  2YRF A;  1WTY A;  4N06 A;  3RFY A;  4QDL A;  4PFP A;  4U5G A;  3QW1 A;  2YEV A;  1GM5 A;  1VMA A;  3AGU A;  3ZTZ A;  3HTK C;  3OWT A;  4E17 A;  2RD9 A;  2Q00 A;  3U9J A;  5JT4 A;  3PCV A;  5DS4 A;  1LE2 A;  1YZC A;  2OKU A;  1Q0G A;  1I5N A;  4IAR A;  3RIP A;  1GGQ A;  4X0R A;  2AWY A;  3ZQY A;  4BPM A;  4ER9 A;  2XXA A;  3NDB B;  5E3C A;  5IY5 C;  2W4M A;  3DWW A;  3EH2 A;  4C7O A;  3EG9 A;  3I5P A;  2Z15 A;  1QQ3 A;  2LQG A;  1AEP A;  3AJM A;  3ATP A;  3C8G B;  2IXN A;  3IQT A;  4G0H A;  1HMO A;  1Q0D A;  3DE8 A;  1E84 A;  3CAX A;  3UMH A;  2WVN A;  4N6C A;  1TWH A;  3I5Q A;  4XPY A;  2PX3 A;  4BEM J;  1A7E A;  3T6J A;  1PV3 A;  2CCY A;  3MLG A;  4I1O B;  4XTK A;  3UR3 C;  2EPO A;  3G50 A;  1M2V A;  2L6F A;  1T5O A;  3M1C B;  1YAR O;  4JUR I;  4P9T A;  5DQT A;  3JSE O;  1FFH A;  5DVW A;  2A69 F;  1RMV A;  2LSE A;  3LS0 A;  1Z23 A;  1LE4 A;  3AG1 C;  4E7S A;  2R7V A;  1T01 A;  5B1A C;  3U8P A;  4MTG A;  3U8V A;  4ONS A;  1C17 M;  3JTL O;  3US6 A;  1EI7 A;  1OW7 A;  5COM A;  1YA7 O;  4IAQ A;  3SP1 A;  2Y39 A;  5D91 A;  1HW2 A;  1FAP B;  4CS7 A;  1FR0 A;  3B71 A;  4KBL A;  3IQ5 A;  3CZ6 A;  2YLI A;  3K1I C;  4WGZ A;  4MS2 A;  2EIN C;  4XEK A;  3VRC A;  3I4U A;  4LER A;  3S84 A;  1EKY A;  2LFF A;  2W45 A;  4KNV A;  2WZF A;  3MYI A;  1Z5Z A;  3K66 A;  3DD7 A;  2OEX A;  2BC5 A;  1OR3 A;  1G4W R;  1K05 A;  4AE4 B;  1Y4C A;  3O55 A;  3EH1 A;  4YK5 A;  2HFI A;  5BQG A;  4A2N B;  1YDI A;  3GEE A;  4JIO A;  5F28 E;  2R7U A;  1OW8 A;  1VK5 A;  2J45 A;  1LI7 A;  256B A;  4EKW A;  4ZLC A;  4PJM A;  3SZR A;  1M2O A;  4J30 B;  1RXQ A;  2Y3H A; 
#chains in the Genus database with same CATH homology
 3EGX A;  4YN0 B;  1BR2 A;  5L3V A;  2A1D D;  4EWC A;  5KYY B;  4DBR A;  3EJN A;  1M56 C;  5T1D B;  2Q9C A;  2A6E F;  4BJ6 C;  5B1B C;  3JYH A;  1ST6 A;  1V55 C;  2Q3T A;  3FAJ A;  4PJJ A;  3DXJ F;  2PP4 A;  4BG0 A;  2X51 A;  2CW0 F;  4I44 A;  2G3K A;  3W2W A;  1D1B A;  4Q4Z F;  4BJ1 A;  5F5H A;  4U5F E;  3AQB A;  4JJF A;  3EGD B;  2J0W A;  4YJW A;  2WZG A;  2WL8 A;  2DGJ A;  3X1O A;  4JZA A;  4PJL A;  3LS1 A;  4G7H F;  4IJJ A;  3EGD A;  4RDA A;  2DYS C;  3ITF A;  3EFO B;  4CIH A;  2VH3 A;  2ZXP A;  4BJ6 A;  5EGY A;  3EZH A;  4BEJ A;  1NZE A;  2JD3 A;  2IYL D;  3FVY A;  3NYM A;  4C3B A;  3EQL F;  1OCO C;  4U5H A;  2MYS A;  1ZYR F;  3K33 A;  3B0P A;  3Q6N A;  4M63 A;  3ECS A;  5KYN A;  4CSA A;  3UMK A;  2EIL C;  1JPJ A;  5T3T A;  3NKE A;  4QI2 A;  1J8M F;  4CS9 A;  2ZXW C;  2IXO A;  2GFH A;  2OCC C;  5KYX B;  4C7O A;  3FHD A;  3DZA A;  4OIQ F;  1ZHT A;  3Q7L A;  1LKX A;  1PD0 A;  1VYK A;  3HLZ A;  2R7S A;  2L81 A;  3EZI A;  4YT8 A;  2J9U A;  4DVZ A;  1V54 C;  4IRU A;  1D1A A;  1O87 A;  4MQ9 F;  2WVQ A;  4AE4 A;  1RJ9 B;  1D0Z A;  2R7W A;  3L0I A;  3DAF A;  2HV6 A;  3DAG A;  4AX2 A;  4ZLD A;  3DMD A;  2XRH A;  2VB6 A;  1NG1 A;  4GYT A;  3UMI A;  3AG3 C;  4K0D A;  1MMN A;  4LLC A;  1FTS A;  2VAS A;  3N0T A;  3LNR A;  4FWV A;  4B6I A;  4XLN F;  3S0X A;  3MX3 A;  1LVK A;  4C3D A;  2J0X A;  2KW3 C;  4IWB A;  1IZM A;  3KL4 A;  3W2V A;  3UNG C;  3LES A;  1D0Y A;  3AG4 C;  4RD9 A;  1SMY F;  3KH2 A;  5T3W A;  2E87 A;  2FGY A;  2A6H F;  3LJB A;  2KJG A;  3EGX B;  3EG9 B;  3GOD A;  2V26 A;  1FMW A;  2XXA B;  2Q9A A;  1PCX A;  1N1C A;  2C04 A;  3ZIB A;  2B0J A;  5EHH A;  4IAO A;  1TKN A;  5KYW B;  3K7D A;  2NUP B;  2Y69 C;  4BJT A;  1OCZ C;  3JT1 A;  1M57 C;  2CNW A;  3KMI A;  1Z63 A;  4JW1 A;  3ZG1 A;  1JPN A;  2W9Y A;  3Q6M A;  2IXP A;  4KI2 A;  3H65 A;  4DOZ A;  2CNW D;  5DS5 A;  4I1M A;  4O6M A;  4O6Y A;  5F5F A;  3B0V C;  3CSK A;  2YHS A;  3DJN B;  1S7Z A;  3B0U X;  3ABM C;  3PHF 2;  4Q5S F;  2XSE A;  2NUP A;  2KGO A;  1FMV A;  4KNW A;  1D0X A;  3KKB A;  3N24 A;  1QZX A;  4FES A;  4EBB A;  3O6X A;  1ZHY A;  3NKD A;  3DM9 B;  4JJG A;  5KYW A;  5KYU A;  3LAY A;  4K7B A;  3RKO F;  2C03 A;  2R7X A;  3NG1 A;  2W4B A;  4OD4 A;  3ZC4 A;  5KYU B;  4J32 B;  2H7V C;  1MND A;  3UGP A;  3ASO C;  4CSA C;  1VYI A;  4U5E E;  1LS1 A;  3NYL A;  2J7P A;  2HV7 A;  3TD7 A;  4LLE A;  3SEO A;  4JVS A;  5L3Q A;  4CS8 C;  2ZXR A;  4YWQ A;  3K1H A;  2OG2 A;  5E2Q A;  4PK4 A;  3ZVR A;  4JCH A;  4CBE A;  4DVY P;  4OIN F;  2R7V A;  1J8Y F;  1D1C A;  1OCC C;  4U5D E;  2DYR C;  3S29 A;  2PF4 E;  4YT5 A;  2R7T A;  5E33 A;  2XL4 A;  2ZPA A;  1WGW A;  1MMG A;  4U5C E;  3L34 A;  3JSZ A;  2R7R A;  3RYL A;  3K6B A;  2D5R B;  2CGE A;  3QMK A;  3VAY A;  3HJC A;  3EPV A;  2YZS A;  1IW7 F;  4DBQ A;  3POV A;  3RH3 A;  1TWC A;  2KQ9 A;  5HSW A;  4YT4 A;  4CS8 A;  2MWQ A;  4FX5 A;  2QTV A;  4I3M A;  4OIO F;  5KYX A;  2WVO A;  2IOQ A;  3SNH A;  4E7Z A;  2J7P D;  3JRT A;  2G62 A;  1NU9 C;  2CDQ A;  4QI0 A;  1Z6A A;  5B3S C;  3F47 A;  3OA1 A;  5E3A A;  4W8K A;  3WG7 C;  2G3V A;  4O7G A;  1Z3I X;  5DS6 A;  2EIK C;  1FFT C;  3ASN C;  3EHN A;  2M4E A;  3EFO A;  3WOD F;  4KC9 A;  5CI9 A;  2FFH A;  4RBN A;  4OIP F;  4YT2 A;  4G7Z F;  1W2W A;  1TWG A;  2L9J A;  4HFK B;  2R7Q A;  2WZL A;  4HFF B;  2EIJ C;  5FCL A;  1RJ9 A;  3ZSU A;  5BUO A;  4WJ0 A;  1G8X A;  5CI8 A;  3IEE A;  3V7O A;  2Q9B A;  4AK9 A;  3SYN A;  2Y3D A;  3EHM A;  1PD1 A;  5D92 A;  3N2Z B;  2IXM A;  4C7O B;  1QLE C;  3W8I A;  5DQZ A;  2KNH A;  4ANJ A;  4P6I C;  4NY3 A;  4ULW A;  3UGO A;  3QZC A;  1KU2 A;  4H4K C;  2ZXO A;  3Q7G A;  2NG1 A;  3LLI A;  3VYW A;  4PFO A;  3F46 A;  1ZHW A;  1VOM A;  2O9X A;  3X2Q C;  5KYY A;  4CS9 C;  3T4R A;  3FDQ A;  4PJN A;  3NYJ A;  3OEO A;  2QY9 A;  5DLJ A;  2I8B A;  1MMA A;  2H7B A;  1ZHX A;  2EIM C;  1OCR C;  4HEA J;  2PFD A;  4OIR F;  1TR2 A;  3AG2 C;  1TWA A;  2Y3G A;  3NRH A;  4GEH A;  1SZI A;  1MMD A;  1NU7 D;  4G7O F;  2WB7 A;  2P7V A;  1ZU4 A;  2P6V A;  3DM5 A;  3PMR A;  4XLP F;  1M2V B;  1BR1 A;  4MND A;  2NUT A;  4BJ5 A;  3LEV A;  4O79 A;  2BE5 F;  2PX0 A;  2J9W A;  2J9V A;  3AQC A;  4C3E A;  3E9V A;  3ABL C;  1ZHZ A;  2V3C C;  3S28 A;  4U5B E;  2A68 F;  3S27 A;  1OKK A;  2R7O A;  3T6B A;  4Q7C A;  1ZU5 A;  2J46 A;  3LLK A;  3E70 C;  3DJU B;  3B9Q A;  4O6N A;  2NUT B;  3GAN A;  4LAC B;  1BR4 A;  1O5H A;  4HE8 D;  3O39 A;  2H7O A;  1SF8 A;  1MNE A;  4OD5 A;  1OKK D;  3JCU Q;  3ABK C;  2Y3B A;  4F4B A;  3CQZ A;  4XWJ A;  4N06 A;  3RFY A;  4QDL A;  4PFP A;  4U5G A;  2YEV A;  1VMA A;  3HTK C;  3OWT A;  5DS4 A;  3RIP A;  4BJ5 C;  3NDB B;  4X0R A;  2XXA A;  5E3C A;  5IY5 C;  2W4M A;  3EH2 A;  3EG9 A;  3I5P A;  2Z15 A;  2IXN A;  4G0H A;  3UMH A;  2WVN A;  1TWH A;  3I5Q A;  2PX3 A;  3T6J A;  3MLG A;  4I1O B;  4XTK A;  3W8H A;  3UR3 C;  3M1C B;  1M2V A;  4JUR I;  5DQT A;  1FFH A;  5DVW A;  2A69 F;  2LSE A;  3LS0 A;  1Z23 A;  3AG1 C;  4E7S A;  5B1A C;  3SP1 A;  2Y39 A;  5D91 A;  4CS7 A;  4KBL A;  3CZ6 A;  3K1I C;  2EIN C;  3I4U A;  4LER A;  2W45 A;  4KNV A;  2WZF A;  1Z5Z A;  3K66 A;  3DD7 A;  4AE4 B;  3EH1 A;  4A2N B;  2R7U A;  1VK5 A;  2J45 A;  4ZLC A;  4PJM A;  3SZR A;  1M2O A;  4J30 B;  2Y3H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...