4X0RA

Crystal structure of human mxb stalk domain
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
236
structure length
201
Chain Sequence
EADKMFFLIEKIKMFNQDIEKLVEGEEVVRENETRLYNKIREDFKNWVGILATNTQKVKNIIHEETFEIIVHQYIQQLVEPALSMLQKAMEIIQQAFINVAKKHFGEFFNLNQTVQSTIEDIKVKHTAKAENMIQLQFRMEQMVFKTEIGIHLNAYFLETSKRLANQIPFIIQYFMLRENGDSLQKAMMQILQEKNRYSWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antiviral protein
molecule keywords Interferon-induced GTP-binding protein Mx2
publication title Structural insight into the assembly of human anti-HIV dynamin-like protein MxB/Mx2.
pubmed doi rcsb
source organism Homo sapiens
total genus 87
structure length 201
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1240 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4x0rA00
3LJBA 3ZVRA 3SNHA 4X0RA 3SZRA 4BEJA
chains in the Genus database with same CATH superfamily
3IEEA 3TD7A 1ZHWA 2J7PA 3R2PA 5DQTA 2HMZA 2R05A 4D4NA 1K05A 2Q9BA 3ZWIA 4DRJB 2X51A 4G7ZF 3UGPA 1WN0A 4JJFA 2KK1A 3LLKA 2AWCA 2YQYA 3AG3C 5B3SC 2PX0A 5AC4A 3GWNA 2Y3DA 5E33A 3DI5A 3H65A 2AP3A 3UR3C 4PJMA 3IQCA 3KYIA 2J0XA 3EGDA 3S28A 5KYYA 3PMRA 4OINF 4P9TA 3IQ6A 5KYNA 1Z6AA 3QVYA 1YYXA 3EG9A 4NQFA 2OU6A 4XWJA 5BUOA 1CGNA 1H9GA 5FZTA 4AK9A 1LE4A 2A69F 3JRMO 3Q6MA 1LKXA 3FDQA 2HSBA 2PP4A 1T6QA 2MYSA 4HE8D 4PFPA 2PF4E 4YJWA 3WG7C 4NTFA 4JURI 2J7PD 2XL4A 4MNDA 4CS7A 3S90A 2KSFA 2Q7RA 2EPNA 1WGWA 5F5HA 3W8HA 5L0HA 3EH2A 3RVYA 3SXKA 4F4BA 1AEPA 1BZ4A 3NKDA 4YL3A 4YT5A 3EZHA 3L1MA 2YZSA 3SYNA 4KNVA 3LESA 1QPUA 3C62A 4LACB 1AVOB 2LSEA 1DOWA 2BE5F 4HEAJ 4JTAB 3FVYA 4K1OA 3ZTMA 3WAQA 4G0HA 2KW3C 3LEVA 5EHHA 4BEMJ 3GM3A 4E0HA 1QLEC 1F1MA 3GM1A 2R9RB 2V26A 3O6XA 5DS6A 3ECSA 1RCPA 2GFHA 3KMIA 2A6HF 1JR8A 4JC7A 3RQEA 3AGUA 4I3MA 3RW0A 2HUJA 4HFFB 3N2ZB 4DBQA 2HV6A 2NUPB 1TFOB 2GAQA 3X1OA 3NKEA 5L0FA 2R7XA 4CDAA 1TWCA 3O55A 3E70C 3ITFA 5KYUA 3U2LA 1A0BA 2AVKA 4LLEA 1M57C 1PV3A 2KQ9A 1PCXA 5BQGA 2OQMA 2XLDA 1T01A 2J9BA 3EFOA 4AL1A 2XXAB 4D4XA 1H6GA 2G3KA 1QVXA 4IARA 1D1AA 5B1BC 2XLEA 1HY5A 4EHPA 1GS9A 3NDBB 3K1IA 4PR9A 1A7VA 1ZHXA 3VAYA 4E7SA 5T3WA 2EIMC 3M15A 5F28E 3V5XA 2W4BA 1I4YA 4EBKA 4XPXA 5L3QA 2XL8A 4DVYP 2Y69C 3H2UA 4OD5A 2M64A 1OCZC 2UUHA 1UG7A 4ZLCA 4U5HA 1ZZPA 1D0YA 1HE9A 3G4ZA 2R7UA 2H7BA 3L0IA 5L0JA 1OCRC 1OW6A 2XRHA 4FAPB 3H2VA 2XLOA 3DE9A 1LI5A 2M4EA 3TQOA 2L6GA 3DZAA 4U9EA 1JPNA 2KYHA 4U9DA 1CGME 4CSAA 1MMGA 3DMDA 1KTMA 2HFIA 3LNRA 3O10A 2VCBA 4X0RA 2W4MA 3SXYA 1NFNA 2ZPAA 3DXJF 2L7AA 4I44A 3FXHA 4QI0A 3SXMA 5JSLA 1L3PA 3L8IA 3RH3A 2J9WA 3K1IC 3POVA 1VLTA 3HTKC 4WGZA 3EHMA 2TMVP 1Y4CA 3WHNA 1NSGB 2LIGA 3GEIA 3RFYA 3M79A 2R7SA 4BJ6A 2D5RB 1WTYA 3FOPA 3AG2C 1BBHA 5JP7A 1ZW2A 2Z15A 3C8GA 1WATA 1V74B 1D0XA 2PX3A 2EIKC 3U5SA 3ABMC 3ATPA 5JT4A 2KC3A 2CGEA 3IQTA 4NCQA 4O7GA 3E9VA 3GM2A 1R5ID 3ZQYA 1LM3B 3B0VC 3I5PA 1ZVZA 1O3UA 1YZCA 1U0BB 1MMDA 3EGXA 2QLAA 1ZW3A 1RKEB 4JRZA 3ZC4A 4CSAC 5A6KA 4MTFA 4A2NB 4K7BA 2DYSC 1KNYA 4Q5SF 1OCCC 4JIOA 1M2OA 1FFHA 1QQ3A 5KYWA 3V7OA 5HSWA 3KH2A 2LCHA 2OOCA 1YVIA 1MNDA 4LLCA 5EK0A 3SEOA 5L0IA 4CIPA 3AGTA 3SNHA 3QW0A 3S29A 4YL1A 4JEBA 2IXOA 4L6RA 4CJOA 2LP4A 2P7VA 3C8GD 3DAFA 4EIYA 3ASNC 4U5GA 1Y6DA 2PNOA 1TWGA 3S84A 1VK5A 1BDJB 2QNLA 4KBLA 2IYLD 2C04A 3S27A 1RXQA 1LI7A 3NMIA 1LIHA 3CEXA 4PJJA 3FAPB 3JT1A 2IXMA 4MVSA 4QDLA 1Z23A 2CCYA 4RDAA 1FFTC 4PJNA 4U5CE 1HW1A 4PJLA 2HJMA 2ZD9A 5TJ5E 2L9JA 3PCVA 4MVRA 4DRIB 4AE4B 5T1DB 3GEEA 3MYFA 3WODF 2GA0A 5CI8A 1VOMA 1BR1A 2OEVA 4J32B 4PFOA 3AG4C 5GPGB 2AWYA 3ZIBA 3JSEO 4I1OB 4ZLDA 1G8XA 2EIJC 2LQGA 4P6IC 3ZDLA 1TWHA 2NG1A 5AC5A 1FR0A 1YA7O 2XS8A 3DD7A 1ORYA 2YLGA 3MFNA 4BJ5A 2EPLX 2B0HA 3G50A 4GEHA 2VC9A 4IGGA 4A4AA 3K7DA 3U2MA 3AQBA 2R7VA 2NUTB 3TK0A 1EQ1A 1VTMP 4G78A 4N6HA 4XEKA 1C02A 4JVSA 3GODA 3ABKC 3RIPA 3QMKA 1UFBA 4H54A 2L6FA 2WL8A 3M4BA 4GYTA 3OEOA 5DQZA 1ZU5A 4G7OF 2YLIA 3LS0A 2R7WA 3JRTA 1H9TA 1A7DA 5KYXA 2EPMX 4DVZA 3ZQVA 1E2XA 2UUIA 4Z9JA 4C7OA 1QKRA 3A9CA 3RKOF 2HJ3A 3T4RA 4YK5A 1LS4A 3F46A 4FX5A 2KJGA 1I5NA 2R03A 2PFDA 3OA1A 2LK4A 2RD9A 1J8MF 3VRCA 4AX2A 1JOGA 3DKAA 3EHNA 2ASRA 1T5OA 2QY9A 1J8YF 3A11A 2MWQA 3FOOA 4BJ5C 1H7IA 4YWQA 1NBBA 5IY5C 1Q0KA 3B0PA 1E84A 1E85A 4BPMA 3I5QA 3LAYA 3C63A 3EGDB 3R7CA 5KYYB 3HNLA 4R32A 2YKZA 3K66A 3W2WA 3EG9B 1TQGA 1G4WR 3SP1A 4YT2A 1HW2A 5DLJA 1T6IA 3DAGA 5CIVA 2DI3A 2EILC 4XEVA 1YARO 5DS5A 3MBGA 5JLIA 1N1CA 5DS4A 4PACA 4WJ0A 2CW0F 2Y39A 1TR2A 2WB7A 3U0CA 2NSFA 1ST6A 2J45A 1K40A 2A6EF 4KNWA 1XZPA 4XQ1A 3K33A 3IHUA 1MQVA 1SMYF 3U8PA 4BJ1A 3U9JA 3L8JA 3M1CB 1KU2A 1U6HA 1YLMA 3AQCA 3HNKA 4E17A 1XZQA 1ZHTA 3ZVRA 2B0JA 2O9XA 4IJJA 4EBJA 1AUEA 2CYDA 1YAUO 2LD6A 4JJGA 3N24A 1OXBA 2VCAA 3TULA 3B71A 3QW1A 1U89A 2BC5A 4DOZA 3OWTA 1GM5A 3TJ6A 1YA9A 1M2VA 3W4YA 4JEAA 1JPJA 4C3EA 2Q3TA 3KPHA 5JUAA 2A1DD 2X0CA 1VB5A 1RJ9A 3UNGC 2GDCA 3DJUB 3G4XA 3ZTZA 1PD1A 3TOLA 1D1CA 1VYIA 3CSKA 1CGOA 5B1AC 5COFA 2HV7A 3EZIA 3LNMB 2YLDA 1RMVA 3LJBA 4HFKB 4J30B 2J9UA 3AG1C 4LDQA 3AJMA 4YN0B 4WABA 2IBFA 5KYUB 1OW7A 4U5FE 2VB6A 2EPOA 2XM0A 5F5FA 3NG1A 1V4AA 4FESA 2ZXRA 3SXZA 2KNHA 5A6JA 2AU5A 1NZEA 1EKYA 2F22A 3EFOB 4YL0A 4CS8C 1S05A 2VCCA 2MHRA 5L0DA 3FMSA 3MYIA 4MVMA 2XM4A 1Q0MA 3GORA 5L0CA 2Y3GA 3UMHA 2P61A 3KKBA 2EINC 1S7ZA 3EPVA 4MTGA 3TJ5A 3US6A 3JTLO 1HMOA 2LFFA 3DM9B 4O6MA 4U5BE 2HMQA 2J9VA 2P6VA 1IW7F 3Q6NA 3Q7GA 3LEOA 1K04A 2Y3HA 4DJ9A 5D91A 3UMIA 3NRHA 4J7TA 4CDVA 2XLWA 2JD3A 4IAOA 2OJED 1QSPA 3C8ZA 3GANA 3K6BA 5CI9A 2OG2A 4OD4A 4Q7CA 3ZSUA 5EGYA 2VH3A 3LUTB 4CBEA 2CNWA 4DBRA 1VLSA 3M4CA 2R7TA 2YWAA 1VYKA 2YRFA 4CDYA 2L6HA 2XLHA 3JZ0A 1OXKA 1C17M 1YJGA 3U9MA 3HLZA 1BR2A 4PK4A 3DJNB 3N0TA 1Q0DA 1A7EA 1SZIA 4JTDB 4JCZA 4LDKA 4ULVA 5BQHA 2Y3BA 4JW1A 1I4ZA 1O87A 4U5EE 4OIOF 3K1HA 1ZHYA 4MQ9F 4RD9A 1O5HA 2W45A 2ZXWC 3CZ6A 3HNIA 4MS2A 4CS9A 2PBEA 4C3DA 4N06A 1T9KA 4MVZA 2YVKA 4DXWA 1MMAA 2XLMA 4NTBA 2QTVA 3C8GB 2V3CC 3Q7LA 4JTCB 1OW8A 4N6CA 4O6YA 4BEJA 1EI7A 2H7VC 1A41A 2I15A 5COGA 1EA8A 3QVZA 1JRAA 5A6BD 2Q9AA 1YYJA 1MMNA 1Z5ZA 3EGXB 3FHDA 1M56C 3VF0A 4YT4A 1WASA 5KYWB 3NYJA 4P9FA 1JAFA 1NLXA 2RSEB 4CX9A 4E18A 4EBBA 2BL2A 3CAXA 3VM6A 3C7JA 1TKNA 1HMDA 1NU7D 2JX0A 5JS5A 3ZG1A 4OIPF 2NUPA 3W8IA 3RVZA 4CS9C 4ULWA 4ONSA 4BG0A 3RQGA 3ASOC 5E3AA 3V5ZA 4MTOA 4LDRA 3T6JA 2J0WA 3EJNA 1JMWA 3EH1A 3F47A 3VYWA 2IXNA 3S9OA 3J06A 3U8VA 3U3BA 2YL7A 3QZCA 3TOMA 5BQIA 4XLPF 2XXAA 1CPQA 1ZU4A 1LS1A 4Q4ZF 3HNJA 3DM5A 1GGQA 2W9YA 2HKVA 1WOLA 2R7QA 3QTHA 5E2QA 2Q00A 4UDVA 2CDQA 2L81A 2R7OA 1NG1A 1LE2A 3JYYA 1OR2A 4MW8A 1LPEA 3L34A 4XTKA 4Z9HA 4MW3A 3HJCA 4RBNA 1T6UA 2DYRC 3JSZA 3RQFA 2H8AA 3AOUA 4U5DE 4IAQA 1SR2A 4W8PA 5A69A 2XS1A 2DGJA 1V54C 5FCLA 1E83A 3RYLA 3PHF2 5A6BA 3B9QA 5D92A 3SZRA 5L0GA 5T3TA 1W2WA 4J7YA 4CJGA 3DWWA 4XEFA 2J8WA 5JVEA 4IRUA 4E7ZA 2DB4A 3NYMA 1R4TA 3JYHA 2J46A 3HKKA 4KC9A 3GEHA 3NMJA 5E3CA 1Z7Qc 4XLNF 4C3BA 1VMAA 2KGOA 2GWWA 4MVQA 4W8KA 1ZYRF 1E86A 1OCOC 1BR4A 2I8BA 3B0UX 2YEVA 4NC3A 3JCUQ 4OIQF 2WVOA 2QUPA 4IWBA 3LLIA 4CS8A 1IZMA 1LVKA 1ORSC 4O6NA 5KYXB 3O39A 4G7HF 2P1AA 4O79A 1WWPA 5HV9A 4C7OB 2WZFA 2HS5A 2IOQA 4ER9A 5DVWA 1DOVA 3KL4A 1XWJA 5JRAA 4JZAA 3CQZA 1L7CA 1SF8A 2FAPB 1YDIA 3BRJA 2YL1A 5COMA 4B6IA 1QZXA 1FMVA 3NYLA 3GWLA 2WZLA 2VASA 2ZXOA 4MVOA 1RKEA 1Q0FA 3B29A 3MLGA 5B3IA 3X2QC 2A68F 3LS1A 2G62A 2OJQA 3C18A 5K0IA 4EUKB 4QI2A 3ABLC 5A6AA 3UGOA 2A0BA 2P0NA 2R25A 1MNEA 1TFKB 4KI2A 4LERA 1B68A 2NPUA 4M63A 3EQLF 1Z63A 3NMKA 2FGYA 2H7OA 3IPMO 4DRHB 3V5YA 1FAPB 5L3VA 1D0ZA 4AL0A 5AGFA 1C03A 4WGYA 4XPYA 1D1BA 1HE1A 1NFOA 3I4UA 2JPUA 3FAJA 1ORJA 1OKKA 1RKCA 3S0XA 3MX3A 1PD0A 2YL3A 4GQHA 4AE4A 2WVQA 2IM8A 4EWCA 2D4UA 1M2VB 2XSEA 4IB4A 1FTSA 1RJ9B 4I1MA 2A0UA 2Q4FA 1TWAA 4XPWA 3T6GB 2HSQA 3W2VA 2LFDA 2ICWG 3U3FA 1SYQA 2XLVA 1CPRA 3BEHA 4N4WA 2YL0A 4JCHA 4EKWA 1ZHZA 2HZ8A 4OIRF 1OR3A 2EPKX 2OEXA 1GQAA 2ETSA 2OKUA 3DE8A 4NY3A 1Z3IX 2NUTA 4E0IA 1OKKD 2R7RA 4H4KC 1M6TA 1NU9C 1FMWA 4FWVA 2G3VA 1FNTc 2FFHA 1YZAA 2ZXPA 4JKVA 3IQ5A 2C03A 2CNWD 3KYJA 2WZGA 2XL6A 4YT8A 2NSGA 3T9OA 4Z9IA 4NTAA 4CIHA 2WVNA 1APCA 2R02A 2YHSA 1G5ZA 1V55C 1G4US 2E87A 3RF3A 4BJTA 4BJ6C 2Q9CA 2OCCC 4MVUA 2QE9A 4ANJA 256BA 1Q0GA 1OQCA 4K0DA 3T6BA 3UMKA 2IXPA 4JE9A 3PDMP
chains in the Genus database with same CATH topology
3IEEA 3TD7A 1ZHWA 2J7PA 5DQTA 2Q9BA 3UGPA 2X51A 4G7ZF 4JJFA 3LLKA 3AG3C 5B3SC 2PX0A 2Y3DA 5E33A 3H65A 3UR3C 4PJMA 2J0XA 3EGDA 3S28A 5KYYA 3PMRA 4OINF 5KYNA 1Z6AA 3EG9A 4XWJA 5BUOA 4AK9A 2A69F 3Q6MA 3FDQA 1LKXA 2PP4A 2MYSA 4HE8D 4PFPA 2PF4E 4YJWA 3WG7C 4JURI 2J7PD 2XL4A 4MNDA 4CS7A 1WGWA 5F5HA 3W8HA 3EH2A 4F4BA 3NKDA 4YT5A 3EZHA 2YZSA 3SYNA 4KNVA 3LESA 4LACB 2LSEA 2BE5F 4HEAJ 3FVYA 4G0HA 2KW3C 3LEVA 5EHHA 1QLEC 3O6XA 2V26A 5DS6A 3ECSA 2GFHA 3KMIA 2A6HF 4I3MA 4HFFB 4DBQA 3N2ZB 2HV6A 2NUPB 3X1OA 3NKEA 2R7XA 1TWCA 3E70C 3ITFA 5KYUA 4LLEA 1M57C 2KQ9A 1PCXA 2XXAB 3EFOA 2G3KA 5B1BC 1D1AA 3NDBB 1ZHXA 3VAYA 4E7SA 5T3WA 2EIMC 2W4BA 5L3QA 4DVYP 2Y69C 4OD5A 1OCZC 4ZLCA 4U5HA 1D0YA 2R7UA 2H7BA 3L0IA 1OCRC 2XRHA 2M4EA 3DZAA 1JPNA 4CSAA 1MMGA 3DMDA 3LNRA 4X0RA 2W4MA 2ZPAA 3DXJF 4I44A 4QI0A 3RH3A 2J9WA 3K1IC 3POVA 3HTKC 3EHMA 3RFYA 4BJ6A 2D5RB 3AG2C 2Z15A 1D0XA 2PX3A 2EIKC 3ABMC 2CGEA 4O7GA 3E9VA 3B0VC 3I5PA 1MMDA 3EGXA 3ZC4A 4CSAC 4A2NB 4K7BA 2DYSC 4Q5SF 1OCCC 1M2OA 1FFHA 5KYWA 3V7OA 5HSWA 3KH2A 4LLCA 1MNDA 3SEOA 3SNHA 3S29A 2IXOA 2P7VA 3DAFA 3ASNC 4U5GA 2R7SA 1TWGA 1VK5A 4KBLA 3S27A 2IYLD 2C04A 4PJJA 3JT1A 2IXMA 4QDLA 1Z23A 4RDAA 1FFTC 4PJNA 4U5CE 4PJLA 2L9JA 4AE4B 5T1DB 3WODF 5CI8A 1VOMA 1BR1A 4J32B 4PFOA 3AG4C 3ZIBA 4I1OB 4ZLDA 1G8XA 2EIJC 4P6IC 1TWHA 2NG1A 3DD7A 4BJ5A 4GEHA 3K7DA 3AQBA 2R7VA 2NUTB 4JVSA 3GODA 3ABKC 3RIPA 3QMKA 2WL8A 4GYTA 3OEOA 5DQZA 1ZU5A 4G7OF 3LS0A 2R7WA 3JRTA 5KYXA 4DVZA 4C7OA 3RKOF 3T4RA 3F46A 4FX5A 2KJGA 2PFDA 3OA1A 1J8MF 4AX2A 3EHNA 2QY9A 4BJ5C 1J8YF 2MWQA 4YWQA 5IY5C 3B0PA 3I5QA 3LAYA 3EGDB 5KYYB 3W2WA 3K66A 3EG9B 3SP1A 4YT2A 5DLJA 3DAGA 2EILC 5DS5A 1N1CA 5DS4A 4WJ0A 2CW0F 2Y39A 1TR2A 2WB7A 1ST6A 2J45A 2A6EF 4KNWA 3K33A 1SMYF 4BJ1A 3M1CB 1KU2A 3AQCA 1ZHTA 3ZVRA 2B0JA 2O9XA 4IJJA 4JJGA 3N24A 4DOZA 3OWTA 1M2VA 1JPJA 4C3EA 2Q3TA 2A1DD 1RJ9A 3UNGC 3DJUB 1PD1A 1D1CA 1VYIA 3CSKA 5B1AC 2HV7A 3EZIA 3LJBA 4HFKB 4J30B 2J9UA 3AG1C 4YN0B 5KYUB 4U5FE 2VB6A 5F5FA 3NG1A 4FESA 2ZXRA 2KNHA 1NZEA 3EFOB 4CS8C 2Y3GA 3UMHA 3KKBA 2EINC 1S7ZA 3EPVA 3DM9B 4O6MA 4U5BE 2J9VA 2P6VA 1IW7F 3Q6NA 3Q7GA 2Y3HA 5D91A 3UMIA 3NRHA 2JD3A 4IAOA 3GANA 3K6BA 5CI9A 3ZSUA 2OG2A 4OD4A 4Q7CA 5EGYA 2VH3A 4CBEA 2CNWA 4DBRA 2R7TA 1VYKA 3HLZA 1BR2A 4PK4A 3DJNB 3N0TA 1SZIA 2Y3BA 4JW1A 1O87A 4U5EE 4OIOF 3K1HA 1ZHYA 4MQ9F 4RD9A 1O5HA 2W45A 2ZXWC 3CZ6A 4CS9A 4C3DA 4N06A 1MMAA 2QTVA 2V3CC 3Q7LA 4O6YA 4BEJA 2H7VC 2Q9AA 1MMNA 1Z5ZA 3EGXB 3FHDA 1M56C 4YT4A 5KYWB 3NYJA 4EBBA 1TKNA 1NU7D 4OIPF 3ZG1A 2NUPA 3W8IA 4CS9C 4ULWA 4BG0A 3ASOC 5E3AA 3T6JA 2J0WA 3EJNA 3EH1A 3F47A 3VYWA 2IXNA 3QZCA 4XLPF 2XXAA 1ZU4A 1LS1A 4Q4ZF 3DM5A 2W9YA 2R7QA 5E2QA 2CDQA 2L81A 2R7OA 1NG1A 3L34A 4XTKA 3HJCA 4RBNA 2DYRC 3JSZA 4U5DE 2DGJA 1V54C 5FCLA 3RYLA 3PHF2 3B9QA 5D92A 3SZRA 5T3TA 1W2WA 4IRUA 4E7ZA 3NYMA 3JYHA 2J46A 4KC9A 4XLNF 5E3CA 4C3BA 1VMAA 2KGOA 4W8KA 1ZYRF 1OCOC 1BR4A 2I8BA 3B0UX 2YEVA 4OIQF 3JCUQ 2WVOA 4IWBA 3LLIA 4CS8A 1IZMA 1LVKA 4O6NA 5KYXB 3O39A 4G7HF 4O79A 4C7OB 2WZFA 2IOQA 5DVWA 3KL4A 4JZAA 3CQZA 1SF8A 4B6IA 1QZXA 1FMVA 3NYLA 2WZLA 2VASA 2ZXOA 3MLGA 3X2QC 2A68F 3LS1A 2G62A 4QI2A 3ABLC 3UGOA 1MNEA 4KI2A 4LERA 4M63A 3EQLF 1Z63A 2FGYA 2H7OA 5L3VA 1D0ZA 1D1BA 3I4UA 3FAJA 1OKKA 3S0XA 3MX3A 1PD0A 4AE4A 2WVQA 4EWCA 1M2VB 2XSEA 1FTSA 1RJ9B 4I1MA 1TWAA 3W2VA 4JCHA 1ZHZA 4OIRF 4NY3A 2NUTA 1Z3IX 1OKKD 2R7RA 4H4KC 1NU9C 1FMWA 4FWVA 2G3VA 2FFHA 2ZXPA 4YT8A 2C03A 2CNWD 2WZGA 4CIHA 2WVNA 2YHSA 2E87A 1V55C 4BJTA 4BJ6C 2Q9CA 2OCCC 4ANJA 4K0DA 3T6BA 3UMKA 2IXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LJB A;  3ZVR A;  3SNH A;  4X0R A;  3SZR A;  4BEJ A; 
#chains in the Genus database with same CATH topology
 3IEE A;  3TD7 A;  1ZHW A;  2J7P A;  3R2P A;  5DQT A;  2HMZ A;  2R05 A;  4D4N A;  1K05 A;  2Q9B A;  3ZWI A;  4DRJ B;  2X51 A;  4G7Z F;  3UGP A;  1WN0 A;  4JJF A;  2KK1 A;  3LLK A;  2AWC A;  2YQY A;  3AG3 C;  5B3S C;  2PX0 A;  5AC4 A;  3GWN A;  2Y3D A;  5E33 A;  3DI5 A;  3H65 A;  2AP3 A;  3UR3 C;  4PJM A;  3IQC A;  3KYI A;  2J0X A;  3EGD A;  3S28 A;  5KYY A;  3PMR A;  4OIN F;  4P9T A;  3IQ6 A;  5KYN A;  1Z6A A;  3QVY A;  1YYX A;  3EG9 A;  4NQF A;  2OU6 A;  4XWJ A;  5BUO A;  1CGN A;  1H9G A;  5FZT A;  4AK9 A;  1LE4 A;  2A69 F;  3JRM O;  3Q6M A;  1LKX A;  3FDQ A;  2HSB A;  2PP4 A;  1T6Q A;  2MYS A;  4HE8 D;  4PFP A;  2PF4 E;  4YJW A;  3WG7 C;  4NTF A;  4JUR I;  2J7P D;  2XL4 A;  4MND A;  4CS7 A;  3S90 A;  2KSF A;  2Q7R A;  2EPN A;  1WGW A;  5F5H A;  3W8H A;  5L0H A;  3EH2 A;  3RVY A;  3SXK A;  4F4B A;  1AEP A;  1BZ4 A;  3NKD A;  4YL3 A;  4YT5 A;  3EZH A;  3L1M A;  2YZS A;  3SYN A;  4KNV A;  3LES A;  1QPU A;  3C62 A;  4LAC B;  1AVO B;  2LSE A;  1DOW A;  2BE5 F;  4HEA J;  4JTA B;  3FVY A;  4K1O A;  3ZTM A;  3WAQ A;  4G0H A;  2KW3 C;  3LEV A;  5EHH A;  4BEM J;  3GM3 A;  4E0H A;  1QLE C;  1F1M A;  3GM1 A;  2R9R B;  2V26 A;  3O6X A;  5DS6 A;  3ECS A;  1RCP A;  2GFH A;  3KMI A;  2A6H F;  1JR8 A;  4JC7 A;  3RQE A;  3AGU A;  4I3M A;  3RW0 A;  2HUJ A;  4HFF B;  3N2Z B;  4DBQ A;  2HV6 A;  2NUP B;  1TFO B;  2GAQ A;  3X1O A;  3NKE A;  5L0F A;  2R7X A;  4CDA A;  1TWC A;  3O55 A;  3E70 C;  3ITF A;  5KYU A;  3U2L A;  1A0B A;  2AVK A;  4LLE A;  1M57 C;  1PV3 A;  2KQ9 A;  1PCX A;  5BQG A;  2OQM A;  2XLD A;  1T01 A;  2J9B A;  3EFO A;  4AL1 A;  2XXA B;  4D4X A;  1H6G A;  2G3K A;  1QVX A;  4IAR A;  1D1A A;  5B1B C;  2XLE A;  1HY5 A;  4EHP A;  1GS9 A;  3NDB B;  3K1I A;  4PR9 A;  1A7V A;  1ZHX A;  3VAY A;  4E7S A;  5T3W A;  2EIM C;  3M15 A;  5F28 E;  3V5X A;  2W4B A;  1I4Y A;  4EBK A;  4XPX A;  5L3Q A;  2XL8 A;  4DVY P;  2Y69 C;  3H2U A;  4OD5 A;  2M64 A;  1OCZ C;  2UUH A;  1UG7 A;  4ZLC A;  4U5H A;  1ZZP A;  1D0Y A;  1HE9 A;  3G4Z A;  2R7U A;  2H7B A;  3L0I A;  5L0J A;  1OCR C;  1OW6 A;  2XRH A;  4FAP B;  3H2V A;  2XLO A;  3DE9 A;  1LI5 A;  2M4E A;  3TQO A;  2L6G A;  3DZA A;  4U9E A;  1JPN A;  2KYH A;  4U9D A;  1CGM E;  4CSA A;  1MMG A;  3DMD A;  1KTM A;  2HFI A;  3LNR A;  3O10 A;  2VCB A;  4X0R A;  2W4M A;  3SXY A;  1NFN A;  2ZPA A;  3DXJ F;  2L7A A;  4I44 A;  3FXH A;  4QI0 A;  3SXM A;  5JSL A;  1L3P A;  3L8I A;  3RH3 A;  2J9W A;  3K1I C;  3POV A;  1VLT A;  3HTK C;  4WGZ A;  3EHM A;  2TMV P;  1Y4C A;  3WHN A;  1NSG B;  2LIG A;  3GEI A;  3RFY A;  3M79 A;  2R7S A;  4BJ6 A;  2D5R B;  1WTY A;  3FOP A;  3AG2 C;  1BBH A;  5JP7 A;  1ZW2 A;  2Z15 A;  3C8G A;  1WAT A;  1V74 B;  1D0X A;  2PX3 A;  2EIK C;  3U5S A;  3ABM C;  3ATP A;  5JT4 A;  2KC3 A;  2CGE A;  3IQT A;  4NCQ A;  4O7G A;  3E9V A;  3GM2 A;  1R5I D;  3ZQY A;  1LM3 B;  3B0V C;  3I5P A;  1ZVZ A;  1O3U A;  1YZC A;  1U0B B;  1MMD A;  3EGX A;  2QLA A;  1ZW3 A;  1RKE B;  4JRZ A;  3ZC4 A;  4CSA C;  5A6K A;  4MTF A;  4A2N B;  4K7B A;  2DYS C;  1KNY A;  4Q5S F;  1OCC C;  4JIO A;  1M2O A;  1FFH A;  1QQ3 A;  5KYW A;  3V7O A;  5HSW A;  3KH2 A;  2LCH A;  2OOC A;  1YVI A;  1MND A;  4LLC A;  5EK0 A;  3SEO A;  5L0I A;  4CIP A;  3AGT A;  3SNH A;  3QW0 A;  3S29 A;  4YL1 A;  4JEB A;  2IXO A;  4L6R A;  4CJO A;  2LP4 A;  2P7V A;  3C8G D;  3DAF A;  4EIY A;  3ASN C;  4U5G A;  1Y6D A;  2PNO A;  1TWG A;  3S84 A;  1VK5 A;  1BDJ B;  2QNL A;  4KBL A;  2IYL D;  2C04 A;  3S27 A;  1RXQ A;  1LI7 A;  3NMI A;  1LIH A;  3CEX A;  4PJJ A;  3FAP B;  3JT1 A;  2IXM A;  4MVS A;  4QDL A;  1Z23 A;  2CCY A;  4RDA A;  1FFT C;  4PJN A;  4U5C E;  1HW1 A;  4PJL A;  2HJM A;  2ZD9 A;  5TJ5 E;  2L9J A;  3PCV A;  4MVR A;  4DRI B;  4AE4 B;  5T1D B;  3GEE A;  3MYF A;  3WOD F;  2GA0 A;  5CI8 A;  1VOM A;  1BR1 A;  2OEV A;  4J32 B;  4PFO A;  3AG4 C;  5GPG B;  2AWY A;  3ZIB A;  3JSE O;  4I1O B;  4ZLD A;  1G8X A;  2EIJ C;  2LQG A;  4P6I C;  3ZDL A;  1TWH A;  2NG1 A;  5AC5 A;  1FR0 A;  1YA7 O;  2XS8 A;  3DD7 A;  1ORY A;  2YLG A;  3MFN A;  4BJ5 A;  2EPL X;  2B0H A;  3G50 A;  4GEH A;  2VC9 A;  4IGG A;  4A4A A;  3K7D A;  3U2M A;  3AQB A;  2R7V A;  2NUT B;  3TK0 A;  1EQ1 A;  1VTM P;  4G78 A;  4N6H A;  4XEK A;  1C02 A;  4JVS A;  3GOD A;  3ABK C;  3RIP A;  3QMK A;  1UFB A;  4H54 A;  2L6F A;  2WL8 A;  3M4B A;  4GYT A;  3OEO A;  5DQZ A;  1ZU5 A;  4G7O F;  2YLI A;  3LS0 A;  2R7W A;  3JRT A;  1H9T A;  1A7D A;  5KYX A;  2EPM X;  4DVZ A;  3ZQV A;  1E2X A;  2UUI A;  4Z9J A;  4C7O A;  1QKR A;  3A9C A;  3RKO F;  2HJ3 A;  3T4R A;  4YK5 A;  1LS4 A;  3F46 A;  4FX5 A;  2KJG A;  1I5N A;  2R03 A;  2PFD A;  3OA1 A;  2LK4 A;  2RD9 A;  1J8M F;  3VRC A;  4AX2 A;  1JOG A;  3DKA A;  3EHN A;  2ASR A;  1T5O A;  2QY9 A;  1J8Y F;  3A11 A;  2MWQ A;  3FOO A;  4BJ5 C;  1H7I A;  4YWQ A;  1NBB A;  5IY5 C;  1Q0K A;  3B0P A;  1E84 A;  1E85 A;  4BPM A;  3I5Q A;  3LAY A;  3C63 A;  3EGD B;  3R7C A;  5KYY B;  3HNL A;  4R32 A;  2YKZ A;  3K66 A;  3W2W A;  3EG9 B;  1TQG A;  1G4W R;  3SP1 A;  4YT2 A;  1HW2 A;  5DLJ A;  1T6I A;  3DAG A;  5CIV A;  2DI3 A;  2EIL C;  4XEV A;  1YAR O;  5DS5 A;  3MBG A;  5JLI A;  1N1C A;  5DS4 A;  4PAC A;  4WJ0 A;  2CW0 F;  2Y39 A;  1TR2 A;  2WB7 A;  3U0C A;  2NSF A;  1ST6 A;  2J45 A;  1K40 A;  2A6E F;  4KNW A;  1XZP A;  4XQ1 A;  3K33 A;  3IHU A;  1MQV A;  1SMY F;  3U8P A;  4BJ1 A;  3U9J A;  3L8J A;  3M1C B;  1KU2 A;  1U6H A;  1YLM A;  3AQC A;  3HNK A;  4E17 A;  1XZQ A;  1ZHT A;  3ZVR A;  2B0J A;  2O9X A;  4IJJ A;  4EBJ A;  1AUE A;  2CYD A;  1YAU O;  2LD6 A;  4JJG A;  3N24 A;  1OXB A;  2VCA A;  3TUL A;  3B71 A;  3QW1 A;  1U89 A;  2BC5 A;  4DOZ A;  3OWT A;  1GM5 A;  3TJ6 A;  1YA9 A;  1M2V A;  3W4Y A;  4JEA A;  1JPJ A;  4C3E A;  2Q3T A;  3KPH A;  5JUA A;  2A1D D;  2X0C A;  1VB5 A;  1RJ9 A;  3UNG C;  2GDC A;  3DJU B;  3G4X A;  3ZTZ A;  1PD1 A;  3TOL A;  1D1C A;  1VYI A;  3CSK A;  1CGO A;  5B1A C;  5COF A;  2HV7 A;  3EZI A;  3LNM B;  2YLD A;  1RMV A;  3LJB A;  4HFK B;  4J30 B;  2J9U A;  3AG1 C;  4LDQ A;  3AJM A;  4YN0 B;  4WAB A;  2IBF A;  5KYU B;  1OW7 A;  4U5F E;  2VB6 A;  2EPO A;  2XM0 A;  5F5F A;  3NG1 A;  1V4A A;  4FES A;  2ZXR A;  3SXZ A;  2KNH A;  5A6J A;  2AU5 A;  1NZE A;  1EKY A;  2F22 A;  3EFO B;  4YL0 A;  4CS8 C;  1S05 A;  2VCC A;  2MHR A;  5L0D A;  3FMS A;  3MYI A;  4MVM A;  2XM4 A;  1Q0M A;  3GOR A;  5L0C A;  2Y3G A;  3UMH A;  2P61 A;  3KKB A;  2EIN C;  1S7Z A;  3EPV A;  4MTG A;  3TJ5 A;  3US6 A;  3JTL O;  1HMO A;  2LFF A;  3DM9 B;  4O6M A;  4U5B E;  2HMQ A;  2J9V A;  2P6V A;  1IW7 F;  3Q6N A;  3Q7G A;  3LEO A;  1K04 A;  2Y3H A;  4DJ9 A;  5D91 A;  3UMI A;  3NRH A;  4J7T A;  4CDV A;  2XLW A;  2JD3 A;  4IAO A;  2OJE D;  1QSP A;  3C8Z A;  3GAN A;  3K6B A;  5CI9 A;  2OG2 A;  4OD4 A;  4Q7C A;  3ZSU A;  5EGY A;  2VH3 A;  3LUT B;  4CBE A;  2CNW A;  4DBR A;  1VLS A;  3M4C A;  2R7T A;  2YWA A;  1VYK A;  2YRF A;  4CDY A;  2L6H A;  2XLH A;  3JZ0 A;  1OXK A;  1C17 M;  1YJG A;  3U9M A;  3HLZ A;  1BR2 A;  4PK4 A;  3DJN B;  3N0T A;  1Q0D A;  1A7E A;  1SZI A;  4JTD B;  4JCZ A;  4LDK A;  4ULV A;  5BQH A;  2Y3B A;  4JW1 A;  1I4Z A;  1O87 A;  4U5E E;  4OIO F;  3K1H A;  1ZHY A;  4MQ9 F;  4RD9 A;  1O5H A;  2W45 A;  2ZXW C;  3CZ6 A;  3HNI A;  4MS2 A;  4CS9 A;  2PBE A;  4C3D A;  4N06 A;  1T9K A;  4MVZ A;  2YVK A;  4DXW A;  1MMA A;  2XLM A;  4NTB A;  2QTV A;  3C8G B;  2V3C C;  3Q7L A;  4JTC B;  1OW8 A;  4N6C A;  4O6Y A;  4BEJ A;  1EI7 A;  2H7V C;  1A41 A;  2I15 A;  5COG A;  1EA8 A;  3QVZ A;  1JRA A;  5A6B D;  2Q9A A;  1YYJ A;  1MMN A;  1Z5Z A;  3EGX B;  3FHD A;  1M56 C;  3VF0 A;  4YT4 A;  1WAS A;  5KYW B;  3NYJ A;  4P9F A;  1JAF A;  1NLX A;  2RSE B;  4CX9 A;  4E18 A;  4EBB A;  2BL2 A;  3CAX A;  3VM6 A;  3C7J A;  1TKN A;  1HMD A;  1NU7 D;  2JX0 A;  5JS5 A;  3ZG1 A;  4OIP F;  2NUP A;  3W8I A;  3RVZ A;  4CS9 C;  4ULW A;  4ONS A;  4BG0 A;  3RQG A;  3ASO C;  5E3A A;  3V5Z A;  4MTO A;  4LDR A;  3T6J A;  2J0W A;  3EJN A;  1JMW A;  3EH1 A;  3F47 A;  3VYW A;  2IXN A;  3S9O A;  3J06 A;  3U8V A;  3U3B A;  2YL7 A;  3QZC A;  3TOM A;  5BQI A;  4XLP F;  2XXA A;  1CPQ A;  1ZU4 A;  1LS1 A;  4Q4Z F;  3HNJ A;  3DM5 A;  1GGQ A;  2W9Y A;  2HKV A;  1WOL A;  2R7Q A;  3QTH A;  5E2Q A;  2Q00 A;  4UDV A;  2CDQ A;  2L81 A;  2R7O A;  1NG1 A;  1LE2 A;  3JYY A;  1OR2 A;  4MW8 A;  1LPE A;  3L34 A;  4XTK A;  4Z9H A;  4MW3 A;  3HJC A;  4RBN A;  1T6U A;  2DYR C;  3JSZ A;  3RQF A;  2H8A A;  3AOU A;  4U5D E;  4IAQ A;  1SR2 A;  4W8P A;  5A69 A;  2XS1 A;  2DGJ A;  1V54 C;  5FCL A;  1E83 A;  3RYL A;  3PHF 2;  5A6B A;  3B9Q A;  5D92 A;  3SZR A;  5L0G A;  5T3T A;  1W2W A;  4J7Y A;  4CJG A;  3DWW A;  4XEF A;  2J8W A;  5JVE A;  4IRU A;  4E7Z A;  2DB4 A;  3NYM A;  1R4T A;  3JYH A;  2J46 A;  3HKK A;  4KC9 A;  3GEH A;  3NMJ A;  5E3C A;  1Z7Q c;  4XLN F;  4C3B A;  1VMA A;  2KGO A;  2GWW A;  4MVQ A;  4W8K A;  1ZYR F;  1E86 A;  1OCO C;  1BR4 A;  2I8B A;  3B0U X;  2YEV A;  4NC3 A;  3JCU Q;  4OIQ F;  2WVO A;  2QUP A;  4IWB A;  3LLI A;  4CS8 A;  1IZM A;  1LVK A;  1ORS C;  4O6N A;  5KYX B;  3O39 A;  4G7H F;  2P1A A;  4O79 A;  1WWP A;  5HV9 A;  4C7O B;  2WZF A;  2HS5 A;  2IOQ A;  4ER9 A;  5DVW A;  1DOV A;  3KL4 A;  1XWJ A;  5JRA A;  4JZA A;  3CQZ A;  1L7C A;  1SF8 A;  2FAP B;  1YDI A;  3BRJ A;  2YL1 A;  5COM A;  4B6I A;  1QZX A;  1FMV A;  3NYL A;  3GWL A;  2WZL A;  2VAS A;  2ZXO A;  4MVO A;  1RKE A;  1Q0F A;  3B29 A;  3MLG A;  5B3I A;  3X2Q C;  2A68 F;  3LS1 A;  2G62 A;  2OJQ A;  3C18 A;  5K0I A;  4EUK B;  4QI2 A;  3ABL C;  5A6A A;  3UGO A;  2A0B A;  2P0N A;  2R25 A;  1MNE A;  1TFK B;  4KI2 A;  4LER A;  1B68 A;  2NPU A;  4M63 A;  3EQL F;  1Z63 A;  3NMK A;  2FGY A;  2H7O A;  3IPM O;  4DRH B;  3V5Y A;  1FAP B;  5L3V A;  1D0Z A;  4AL0 A;  5AGF A;  1C03 A;  4WGY A;  4XPY A;  1D1B A;  1HE1 A;  1NFO A;  3I4U A;  2JPU A;  3FAJ A;  1ORJ A;  1OKK A;  1RKC A;  3S0X A;  3MX3 A;  1PD0 A;  2YL3 A;  4GQH A;  4AE4 A;  2WVQ A;  2IM8 A;  4EWC A;  2D4U A;  1M2V B;  2XSE A;  4IB4 A;  1FTS A;  1RJ9 B;  4I1M A;  2A0U A;  2Q4F A;  1TWA A;  4XPW A;  3T6G B;  2HSQ A;  3W2V A;  2LFD A;  2ICW G;  3U3F A;  1SYQ A;  2XLV A;  1CPR A;  3BEH A;  4N4W A;  2YL0 A;  4JCH A;  4EKW A;  1ZHZ A;  2HZ8 A;  4OIR F;  1OR3 A;  2EPK X;  2OEX A;  1GQA A;  2ETS A;  2OKU A;  3DE8 A;  4NY3 A;  1Z3I X;  2NUT A;  4E0I A;  1OKK D;  2R7R A;  4H4K C;  1M6T A;  1NU9 C;  1FMW A;  4FWV A;  2G3V A;  1FNT c;  2FFH A;  1YZA A;  2ZXP A;  4JKV A;  3IQ5 A;  2C03 A;  2CNW D;  3KYJ A;  2WZG A;  2XL6 A;  4YT8 A;  2NSG A;  3T9O A;  4Z9I A;  4NTA A;  4CIH A;  2WVN A;  1APC A;  2R02 A;  2YHS A;  1G5Z A;  1V55 C;  1G4U S;  2E87 A;  3RF3 A;  4BJT A;  4BJ6 C;  2Q9C A;  2OCC C;  4MVU A;  2QE9 A;  4ANJ A;  256B A;  1Q0G A;  1OQC A;  4K0D A;  3T6B A;  3UMK A;  2IXP A;  4JE9 A;  3PDM P; 
#chains in the Genus database with same CATH homology
 3IEE A;  3TD7 A;  1ZHW A;  2J7P A;  5DQT A;  2Q9B A;  3UGP A;  2X51 A;  4G7Z F;  4JJF A;  3LLK A;  3AG3 C;  5B3S C;  2PX0 A;  2Y3D A;  5E33 A;  3H65 A;  3UR3 C;  4PJM A;  2J0X A;  3EGD A;  3S28 A;  5KYY A;  3PMR A;  4OIN F;  5KYN A;  1Z6A A;  3EG9 A;  4XWJ A;  5BUO A;  4AK9 A;  2A69 F;  3Q6M A;  3FDQ A;  1LKX A;  2PP4 A;  2MYS A;  4HE8 D;  4PFP A;  2PF4 E;  4YJW A;  3WG7 C;  4JUR I;  2J7P D;  2XL4 A;  4MND A;  4CS7 A;  1WGW A;  5F5H A;  3W8H A;  3EH2 A;  4F4B A;  3NKD A;  4YT5 A;  3EZH A;  2YZS A;  3SYN A;  4KNV A;  3LES A;  4LAC B;  2LSE A;  2BE5 F;  4HEA J;  3FVY A;  4G0H A;  2KW3 C;  3LEV A;  5EHH A;  1QLE C;  3O6X A;  2V26 A;  5DS6 A;  3ECS A;  2GFH A;  3KMI A;  2A6H F;  4I3M A;  4HFF B;  4DBQ A;  3N2Z B;  2HV6 A;  2NUP B;  3X1O A;  3NKE A;  2R7X A;  1TWC A;  3E70 C;  3ITF A;  5KYU A;  4LLE A;  1M57 C;  2KQ9 A;  1PCX A;  2XXA B;  3EFO A;  2G3K A;  5B1B C;  1D1A A;  3NDB B;  1ZHX A;  3VAY A;  4E7S A;  5T3W A;  2EIM C;  2W4B A;  5L3Q A;  4DVY P;  2Y69 C;  4OD5 A;  1OCZ C;  4ZLC A;  4U5H A;  1D0Y A;  2R7U A;  2H7B A;  3L0I A;  1OCR C;  2XRH A;  2M4E A;  3DZA A;  1JPN A;  4CSA A;  1MMG A;  3DMD A;  3LNR A;  4X0R A;  2W4M A;  2ZPA A;  3DXJ F;  4I44 A;  4QI0 A;  3RH3 A;  2J9W A;  3K1I C;  3POV A;  3HTK C;  3EHM A;  3RFY A;  4BJ6 A;  2D5R B;  3AG2 C;  2Z15 A;  1D0X A;  2PX3 A;  2EIK C;  3ABM C;  2CGE A;  4O7G A;  3E9V A;  3B0V C;  3I5P A;  1MMD A;  3EGX A;  3ZC4 A;  4CSA C;  4A2N B;  4K7B A;  2DYS C;  4Q5S F;  1OCC C;  1M2O A;  1FFH A;  5KYW A;  3V7O A;  5HSW A;  3KH2 A;  4LLC A;  1MND A;  3SEO A;  3SNH A;  3S29 A;  2IXO A;  2P7V A;  3DAF A;  3ASN C;  4U5G A;  2R7S A;  1TWG A;  1VK5 A;  4KBL A;  3S27 A;  2IYL D;  2C04 A;  4PJJ A;  3JT1 A;  2IXM A;  4QDL A;  1Z23 A;  4RDA A;  1FFT C;  4PJN A;  4U5C E;  4PJL A;  2L9J A;  4AE4 B;  5T1D B;  3WOD F;  5CI8 A;  1VOM A;  1BR1 A;  4J32 B;  4PFO A;  3AG4 C;  3ZIB A;  4I1O B;  4ZLD A;  1G8X A;  2EIJ C;  4P6I C;  1TWH A;  2NG1 A;  3DD7 A;  4BJ5 A;  4GEH A;  3K7D A;  3AQB A;  2R7V A;  2NUT B;  4JVS A;  3GOD A;  3ABK C;  3RIP A;  3QMK A;  2WL8 A;  4GYT A;  3OEO A;  5DQZ A;  1ZU5 A;  4G7O F;  3LS0 A;  2R7W A;  3JRT A;  5KYX A;  4DVZ A;  4C7O A;  3RKO F;  3T4R A;  3F46 A;  4FX5 A;  2KJG A;  2PFD A;  3OA1 A;  1J8M F;  4AX2 A;  3EHN A;  2QY9 A;  4BJ5 C;  1J8Y F;  2MWQ A;  4YWQ A;  5IY5 C;  3B0P A;  3I5Q A;  3LAY A;  3EGD B;  5KYY B;  3W2W A;  3K66 A;  3EG9 B;  3SP1 A;  4YT2 A;  5DLJ A;  3DAG A;  2EIL C;  5DS5 A;  1N1C A;  5DS4 A;  4WJ0 A;  2CW0 F;  2Y39 A;  1TR2 A;  2WB7 A;  1ST6 A;  2J45 A;  2A6E F;  4KNW A;  3K33 A;  1SMY F;  4BJ1 A;  3M1C B;  1KU2 A;  3AQC A;  1ZHT A;  3ZVR A;  2B0J A;  2O9X A;  4IJJ A;  4JJG A;  3N24 A;  4DOZ A;  3OWT A;  1M2V A;  1JPJ A;  4C3E A;  2Q3T A;  2A1D D;  1RJ9 A;  3UNG C;  3DJU B;  1PD1 A;  1D1C A;  1VYI A;  3CSK A;  5B1A C;  2HV7 A;  3EZI A;  3LJB A;  4HFK B;  4J30 B;  2J9U A;  3AG1 C;  4YN0 B;  5KYU B;  4U5F E;  2VB6 A;  5F5F A;  3NG1 A;  4FES A;  2ZXR A;  2KNH A;  1NZE A;  3EFO B;  4CS8 C;  2Y3G A;  3UMH A;  3KKB A;  2EIN C;  1S7Z A;  3EPV A;  3DM9 B;  4O6M A;  4U5B E;  2J9V A;  2P6V A;  1IW7 F;  3Q6N A;  3Q7G A;  2Y3H A;  5D91 A;  3UMI A;  3NRH A;  2JD3 A;  4IAO A;  3GAN A;  3K6B A;  5CI9 A;  3ZSU A;  2OG2 A;  4OD4 A;  4Q7C A;  5EGY A;  2VH3 A;  4CBE A;  2CNW A;  4DBR A;  2R7T A;  1VYK A;  3HLZ A;  1BR2 A;  4PK4 A;  3DJN B;  3N0T A;  1SZI A;  2Y3B A;  4JW1 A;  1O87 A;  4U5E E;  4OIO F;  3K1H A;  1ZHY A;  4MQ9 F;  4RD9 A;  1O5H A;  2W45 A;  2ZXW C;  3CZ6 A;  4CS9 A;  4C3D A;  4N06 A;  1MMA A;  2QTV A;  2V3C C;  3Q7L A;  4O6Y A;  4BEJ A;  2H7V C;  2Q9A A;  1MMN A;  1Z5Z A;  3EGX B;  3FHD A;  1M56 C;  4YT4 A;  5KYW B;  3NYJ A;  4EBB A;  1TKN A;  1NU7 D;  4OIP F;  3ZG1 A;  2NUP A;  3W8I A;  4CS9 C;  4ULW A;  4BG0 A;  3ASO C;  5E3A A;  3T6J A;  2J0W A;  3EJN A;  3EH1 A;  3F47 A;  3VYW A;  2IXN A;  3QZC A;  4XLP F;  2XXA A;  1ZU4 A;  1LS1 A;  4Q4Z F;  3DM5 A;  2W9Y A;  2R7Q A;  5E2Q A;  2CDQ A;  2L81 A;  2R7O A;  1NG1 A;  3L34 A;  4XTK A;  3HJC A;  4RBN A;  2DYR C;  3JSZ A;  4U5D E;  2DGJ A;  1V54 C;  5FCL A;  3RYL A;  3PHF 2;  3B9Q A;  5D92 A;  3SZR A;  5T3T A;  1W2W A;  4IRU A;  4E7Z A;  3NYM A;  3JYH A;  2J46 A;  4KC9 A;  4XLN F;  5E3C A;  4C3B A;  1VMA A;  2KGO A;  4W8K A;  1ZYR F;  1OCO C;  1BR4 A;  2I8B A;  3B0U X;  2YEV A;  4OIQ F;  3JCU Q;  2WVO A;  4IWB A;  3LLI A;  4CS8 A;  1IZM A;  1LVK A;  4O6N A;  5KYX B;  3O39 A;  4G7H F;  4O79 A;  4C7O B;  2WZF A;  2IOQ A;  5DVW A;  3KL4 A;  4JZA A;  3CQZ A;  1SF8 A;  4B6I A;  1QZX A;  1FMV A;  3NYL A;  2WZL A;  2VAS A;  2ZXO A;  3MLG A;  3X2Q C;  2A68 F;  3LS1 A;  2G62 A;  4QI2 A;  3ABL C;  3UGO A;  1MNE A;  4KI2 A;  4LER A;  4M63 A;  3EQL F;  1Z63 A;  2FGY A;  2H7O A;  5L3V A;  1D0Z A;  1D1B A;  3I4U A;  3FAJ A;  1OKK A;  3S0X A;  3MX3 A;  1PD0 A;  4AE4 A;  2WVQ A;  4EWC A;  1M2V B;  2XSE A;  1FTS A;  1RJ9 B;  4I1M A;  1TWA A;  3W2V A;  4JCH A;  1ZHZ A;  4OIR F;  4NY3 A;  2NUT A;  1Z3I X;  1OKK D;  2R7R A;  4H4K C;  1NU9 C;  1FMW A;  4FWV A;  2G3V A;  2FFH A;  2ZXP A;  4YT8 A;  2C03 A;  2CNW D;  2WZG A;  4CIH A;  2WVN A;  2YHS A;  2E87 A;  1V55 C;  4BJT A;  4BJ6 C;  2Q9C A;  2OCC C;  4ANJ A;  4K0D A;  3T6B A;  3UMK A;  2IXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...