4X0RA

Crystal structure of human mxb stalk domain
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
236
structure length
201
Chain Sequence
EADKMFFLIEKIKMFNQDIEKLVEGEEVVRENETRLYNKIREDFKNWVGILATNTQKVKNIIHEETFEIIVHQYIQQLVEPALSMLQKAMEIIQQAFINVAKKHFGEFFNLNQTVQSTIEDIKVKHTAKAENMIQLQFRMEQMVFKTEIGIHLNAYFLETSKRLANQIPFIIQYFMLRENGDSLQKAMMQILQEKNRYSWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interferon-induced GTP-binding protein Mx2
publication title Structural insight into the assembly of human anti-HIV dynamin-like protein MxB/Mx2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antiviral protein
total genus 87
structure length 201
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1240 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4x0rA00
3SNHA 4BEJA 4X0RA 3SZRA 3ZVRA 3LJBA
chains in the Genus database with same CATH superfamily
4E7SA 4CS8C 2ZXOA 2L81A 3EGDB 1D1BA 1Y4CA 2GWWA 4XPWA 2UUIA 3DD7A 4J7YA 1SF8A 2G62A 2WL8A 3AGUA 4DOZA 3POVA 1NU7D 3AG3C 1BZ4A 2LSEA 4MVRA 3ZC4A 2LFFA 4YT5A 3Q7LA 4J32B 2ETSA 2H7OA 2JX0A 2HV6A 2PX3A 3JT1A 3M15A 4BG0A 3KH2A 1CPRA 2EINC 1JRAA 3RVZA 2H8AA 1ZU5A 3NKEA 4JURI 4YL3A 3W2VA 2EIKC 2A69F 1MQVA 5E2QA 5B1AC 4IAQA 5BUOA 3ZDLA 4D4XA 3TJ5A 2PNOA 2GA0A 2Y69C 4FESA 4NTBA 4JTDB 2FGYA 4JTCB 3JYHA 2J45A 2XL8A 1YYJA 1A41A 5T3TA 3W8HA 2R7TA 2ASRA 5BQHA 3NDBB 4NTFA 2R7VA 4UDVA 2EILC 3B0VC 3T4RA 3PHF2 1GS9A 1V55C 1Q0FA 3O55A 1FNTc 2A1DD 3FAPB 3A11A 4IB4A 2X0CA 1VLSA 2HSBA 4BPMA 1J8MF 4HFKB 4MVZA 2ICWG 4C3EA 3U2LA 1OXKA 5KYWB 2NUTB 2HFIA 5JVEA 4Z9JA 3EFOB 2XSEA 3ASNC 1WWPA 1OR3A 3J06A 2XLEA 2CYDA 4MNDA 4I1OB 2LCHA 3JSZA 3TK0A 3I5PA 1RJ9A 3B9QA 1GM5A 3DAGA 3QW1A 3U8VA 1AEPA 1CGNA 3FAJA 4XPXA 1CPQA 1MMNA 2J7PD 5T3WA 3L8IA 5KYNA 5L3QA 3DKAA 4U9EA 2OOCA 4OIOF 3H65A 2J9BA 1QLEC 1D1CA 4MVOA 5BQGA 1Y6DA 1A0BA 4J7TA 2H7VC 3A9CA 3GWLA 2OCCC 2KGOA 3C8GD 3W8IA 5DS6A 3SXKA 3R2PA 5JT4A 2Q3TA 3FHDA 5E3CA 5KYYB 1LKXA 4JJGA 4L6RA 4H54A 5F28E 2P61A 2V3CC 4ONSA 4U5DE 3IEEA 2LK4A 4CS7A 2IOQA 5EGYA 2GDCA 2YL1A 1PV3A 2W45A 2QE9A 5K0IA 2ZPAA 1M56C 1SYQA 1V74B 3S9OA 1G8XA 4EBJA 4JVSA 3HNLA 4KBLA 1YDIA 4NY3A 5DLJA 4EHPA 3E70C 2OJED 2Q9AA 3G4ZA 3MBGA 5A6BD 3NYJA 2XLWA 3CEXA 3LUTB 3RQFA 2HJ3A 2B0HA 2KYHA 2IXPA 2WZFA 2YL3A 4D4NA 1KNYA 3VYWA 2YKZA 3EGDA 4XEVA 1OW8A 3H2VA 5JRAA 1T9KA 3S90A 1OW7A 1TKNA 2J9UA 2Q9CA 2XL6A 3FXHA 4DVZA 3C63A 3GEEA 3MYFA 5FZTA 4GEHA 1ZHYA 3SXZA 3DXJF 2A68F 2Y3BA 2TMVP 3QW0A 1APCA 1BR4A 1QPUA 3L1MA 4QI0A 1G4WR 3HNJA 3RVYA 4C7OB 1S05A 4U5BE 2CGEA 4EWCA 1EQ1A 3C8GB 3TOMA 2CCYA 2J9WA 2Q00A 1ORSC 3V7OA 4CBEA 1S7ZA 2CNWD 2J8WA 3L8JA 1PCXA 2IXNA 4ANJA 3U3FA 4NQFA 1ZW2A 1EA8A 4EIYA 2YZSA 3GM1A 3S29A 1KTMA 4CIPA 3ASOC 3KYIA 2ZD9A 1FFTC 5F5HA 2XXAB 1MNDA 2L7AA 2VH3A 1ZVZA 2NSFA 3Q7GA 1L3PA 4KI2A 2R7QA 2QY9A 3CQZA 4U5EE 2V26A 5KYWA 4NC3A 2NUTA 3S0XA 1SZIA 4I1MA 4JIOA 2Y3HA 3KKBA 3EFOA 1JAFA 2MWQA 1UFBA 3EJNA 3FOPA 4CJOA 4YT2A 3N0TA 4HFFB 2HSQA 2HS5A 2MYSA 3M79A 4XWJA 1NZEA 3MLGA 3UGPA 1ORYA 3DJUB 3R7CA 1T6UA 4DRJB 3TULA 4JE9A 5EK0A 1TR2A 4MS2A 4LERA 3AOUA 4M63A 4U5HA 2AU5A 5GPGB 3W4YA 2J0XA 4BJTA 4GQHA 3WAQA 3JCUQ 5T1DB 3K1HA 3NRHA 3UNGC 1WATA 3T6GB 1G5ZA 3UR3C 4EBBA 3U5SA 1HE9A 1YJGA 3LNMB 3RKOF 5KYYA 3BEHA 3C7JA 4NCQA 4LLCA 4MTGA 5TJ5E 1GGQA 2IM8A 1PD0A 4ZLCA 4JKVA 1DOWA 4DXWA 3LNRA 3ZTZA 3W2WA 4B6IA 4PFPA 3OA1A 1MMAA 1O5HA 1OCRC 1M2VB 1JOGA 1ZW3A 256BA 3U9JA 4RBNA 1Z3IX 4EUKB 4O6YA 1ZHTA 1HMDA 1LM3B 1ZYRF 1K40A 3NG1A 4JEAA 4YL0A 4DRHB 1VYIA 3HTKC 4JTAB 1VOMA 3HNKA 3NKDA 3DM5A 3SEOA 3U9MA 3RYLA 3DZAA 4RD9A 3DAFA 2NUPB 2UUHA 1ZU4A 1C17M 1IW7F 4Q5SF 2PFDA 1YARO 3I5QA 4E7ZA 3HJCA 1Q0DA 4ULVA 4IARA 3ABLC 2VCCA 3AG2C 3UMKA 2YLGA 3ZSUA 1JR8A 2G3VA 3FMSA 2WVOA 2G3KA 3UMIA 4G7HF 3DM9B 3IQ5A 1H7IA 4MQ9F 1XWJA 1QKRA 2X51A 3MFNA 1OKKD 3B0PA 1LE4A 2HJMA 1ZHZA 4C7OA 2W4MA 4ZLDA 1YA7O 3C8GA 5E33A 1VTMP 2RD9A 3O10A 1OW6A 3DE9A 4YT8A 1D0ZA 2R7SA 3AQCA 1JPJA 3ABKC 3MYIA 5CI8A 4P9FA 2ZXWC 3S27A 1T6IA 3SXMA 2OKUA 1PD1A 2O9XA 4AX2A 4P9TA 1VMAA 1E83A 4ER9A 4C3BA 3EHMA 2XXAA 3ZQVA 4EBKA 4YWQA 2IBFA 2OEVA 4IJJA 2XLMA 4YL1A 3SXYA 2XL4A 4WGZA 1A7DA 1C03A 1OCZC 1WGWA 3JRMO 2VC9A 2P6VA 3GM3A 3QVYA 3F47A 1FAPB 1YVIA 2GAQA 2EPOA 3RH3A 4G7OF 4U5FE 1LI5A 3LLKA 1YYXA 2IYLD 3OWTA 1F1MA 3TD7A 4BEJA 4KNWA 1BR1A 2XM4A 3C62A 2BC5A 2EPLX 4IRUA 4XQ1A 2OJQA 2B0JA 4OIRF 3DJNB 4CS9A 1U0BB 5DQZA 3RW0A 4AE4B 1LS1A 2YVKA 5L0IA 3F46A 2KW3C 1I4ZA 1WOLA 1NG1A 1ST6A 1U89A 3DWWA 3G4XA 1Z63A 4KC9A 2XLHA 4BJ6C 3K7DA 5L0CA 5L0DA 2YEVA 2HMZA 1RCPA 2EPMX 2NG1A 2NSGA 2KNHA 3LS1A 2DI3A 4N6CA 3N24A 3AG4C 1I5NA 4G78A 1H9GA 3GWNA 4ULWA 5DVWA 2YLDA 1M2VA 3ITFA 2EPKX 3LEOA 4F4BA 4DRIB 1D0XA 1FMWA 4O6MA 1Q0GA 4AL0A 4PJMA 3QTHA 5CIVA 2Q9BA 2GFHA 3US6A 2A0UA 3ZQYA 5L0HA 5AC4A 1RKCA 4G0HA 3EHNA 2AWCA 3QMKA 1XZPA 1R4TA 4O7GA 1JMWA 2C04A 2WVQA 2NUPA 1CGOA 1OQCA 1E86A 1O87A 1TFOB 4XEKA 3U8PA 4CSAA 2BL2A 2D4UA 2J9VA 4P6IC 3SYNA 3TOLA 4BJ1A 3U0CA 2YHSA 1N1CA 2EIJC 5COMA 1VB5A 3C8ZA 3GM2A 1WTYA 5D91A 3V5XA 3UMHA 5COFA 3EPVA 4A2NB 1E85A 1L7CA 3QZCA 2ZXPA 4CX9A 3U2MA 2WB7A 1XZQA 3JSEO 4DBRA 1BR2A 4Q4ZF 4OIQF 3S84A 2WZLA 4JEBA 3KYJA 5A6AA 4PFOA 2R02A 2VB6A 1WN0A 3O39A 3KPHA 4MTFA 2C03A 2Q7RA 2YLIA 3ATPA 4PK4A 2JD3A 2XS8A 5BQIA 4FX5A 3ZVRA 1A7VA 2PX0A 3RQGA 3FDQA 3LEVA 4N6HA 2VASA 3RF3A 1RKEB 3WHNA 2MHRA 1V4AA 3KL4A 2OG2A 3I4UA 3T6BA 2A6EF 1LVKA 4NTAA 1R5ID 1UG7A 4O79A 3Q6MA 4XPYA 1Z7Qc 4JRZA 5DQTA 5JLIA 3B0UX 1GQAA 1T5OA 2YWAA 3ZTMA 2YRFA 2Z15A 1M6TA 4XEFA 1Z6AA 2W9YA 3JYYA 4CS9C 3L0IA 3RQEA 4XLPF 1EI7A 4DJ9A 1T6QA 4FAPB 1QSPA 1QZXA 5A6KA 4PJJA 2LIGA 3HKKA 1LS4A 2R25A 2XLVA 3LESA 5COGA 2YQYA 2HMQA 1MMDA 2J0WA 3S28A 1OR2A 2P1AA 3AJMA 4XTKA 5CI9A 1B68A 1YZAA 2F22A 2OQMA 3C18A 4WGYA 5KYUB 1OCOC 2LFDA 4QDLA 3VRCA 5D92A 3M4BA 1D1AA 1VK5A 2L6FA 4JCHA 4AE4A 4BJ6A 1OKKA 4HEAJ 4K0DA 1O3UA 4H4KC 4MVMA 1ZHXA 3LAYA 2HZ8A 3NYLA 1E84A 3K6BA 4N06A 3SNHA 4BJ5A 2WVNA 5HV9A 3K1IA 4IGGA 3IPMO 4OD4A 1WASA 2CW0F 2R7UA 2QNLA 4CIHA 3CZ6A 1BDJB 4CSAC 2IXMA 5KYXB 2VCAA 4LLEA 5F5FA 4E17A 1HY5A 2I15A 2J7PA 2OEXA 1YA9A 1IZMA 2Q4FA 2Y3DA 5AC5A 3HNIA 3N2ZB 4U5CE 3OEOA 5IY5C 2FAPB 2R7RA 3IQ6A 1VLTA 3GORA 3NMKA 3NMJA 3ABMC 3ECSA 3QVZA 3UGOA 3O6XA 4R32A 4N4WA 4A4AA 4AL1A 2ZXRA 1T01A 5B3SC 3GEHA 3HLZA 3U3BA 4CDVA 4KNVA 1M57C 2DGJA 2WZGA 3FOOA 2XLOA 4E18A 4XLNF 4DVYP 3PDMP 2YL0A 2XRHA 3EQLF 2AVKA 3JTLO 4GYTA 4FWVA 2NPUA 2R03A 1HMOA 5EHHA 4EKWA 3JZ0A 3GEIA 1U6HA 2EIMC 2KQ9A 3RFYA 1VYKA 2DB4A 3EZHA 5A6BA 3EG9B 3WODF 2A6HF 4LDQA 4MVQA 1OCCC 4MW8A 1V54C 5JSLA 4CDAA 3CAXA 2CDQA 3JRTA 3ZWIA 2EPNA 1FTSA 1H6GA 1E2XA 4WJ0A 4Z9HA 3SP1A 2BE5F 5L0FA 3K66A 1J8YF 1K05A 5L0GA 1RKEA 4LACB 2AWYA 4PACA 4JC7A 5JS5A 1CGME 3VAYA 3M4CA 4U9DA 1SR2A 2Y3GA 3VM6A 4CDYA 4JJFA 3DI5A 2PF4E 4JZAA 3X1OA 3NYMA 3EGXB 3B29A 5FCLA 3PMRA 3RIPA 2H7BA 2HV7A 1LE2A 2QTVA 4C3DA 4E0IA 2R7WA 3PCVA 1TWCA 1TQGA 2LQGA 3NMIA 4OINF 4O6NA 2P0NA 1C02A 4U5GA 2CNWA 5B3IA 4Q7CA 2M64A 4OIPF 1YAUO 4BJ5C 1FFHA 3AGTA 4MTOA 5JUAA 3L34A 1H9TA 3K1IC 4PJLA 3IQCA 1NU9C 1LPEA 5A69A 5KYUA 3LLIA 1TWAA 2M4EA 4CS8A 1A7EA 1DOVA 1Q0MA 2KC3A 2R9RB 2E87A 2R7OA 4MVUA 1I4YA 1Z5ZA 2PBEA 3DE8A 3V5YA 4YT4A 4K1OA 4YK5A 4W8KA 5DS4A 2FFHA 1KU2A 4RDAA 1G4US 1NFNA 3TQOA 2DYRC 3FVYA 2QUPA 3LS0A 4I3MA 2KK1A 1HE1A 4PJNA 1BBHA 2R7XA 1D0YA 2L6GA 3IQTA 4G7ZF 2AP3A 4JCZA 3ZIBA 4QI2A 1Z23A 5KYXA 3WG7C 1M2OA 3EH2A 3T9OA 1NLXA 3EH1A 1EKYA 3E9VA 4CJGA 1ORJA 2XM0A 1AUEA 4PR9A 1JPNA 2I8BA 3TJ6A 3AQBA 3DMDA 4LDKA 3GODA 1TFKB 2YL7A 4W8PA 4OD5A 1NBBA 2JPUA 2Y39A 3B71A 3M1CB 4HE8D 4E0HA 4YJWA 1LIHA 4K7BA 5L0JA 2DYSC 4I44A 3CSKA 5AGFA 3G50A 4YN0B 5A6JA 1FR0A 1YLMA 1FMVA 4LDRA 3VF0A 1NFOA 4DBQA 2RSEB 2VCBA 2KSFA 1MNEA 1ZHWA 1TWHA 2R05A 4IAOA 1RJ9B 4WABA 2QLAA 4JW1A 5JP7A 4Z9IA 3GANA 1LI7A 2W4BA 2J46A 4MVSA 1Q0KA 2L9JA 4X0RA 3X2QC 2D5RB 2OU6A 3IHUA 2HKVA 3Q6NA 5B1BC 2P7VA 5L3VA 3LJBA 1NSGB 2KJGA 4IWBA 3EG9A 2LD6A 1HW2A 5HSWA 3MX3A 3K33A 1RMVA 2PP4A 1QQ3A 1ZZPA 4AK9A 3V5ZA 2LP4A 1K04A 4BEMJ 1W2WA 1AVOB 3T6JA 1MMGA 4J30B 2HUJA 3EZIA 1HW1A 1QVXA 3SZRA 2IXOA 3BRJA 1OXBA 3KMIA 2XLDA 4MW3A 2A0BA 1TWGA 1SMYF 2XS1A 3H2UA 1YZCA 5E3AA 3AG1C 3EGXA 5DS5A 1RXQA 3ZG1A 2L6HA
chains in the Genus database with same CATH topology
4E7SA 4CS8C 2ZXOA 2L81A 3EGDB 1D1BA 3DD7A 1SF8A 2G62A 2WL8A 4DOZA 3POVA 1NU7D 3AG3C 2LSEA 3ZC4A 4YT5A 3Q7LA 4J32B 2H7OA 2HV6A 2PX3A 3JT1A 4BG0A 3KH2A 2EINC 1ZU5A 3NKEA 4JURI 3W2VA 2EIKC 2A69F 5E2QA 5B1AC 5BUOA 4FESA 2Y69C 2FGYA 3JYHA 2J45A 5T3TA 2R7TA 3W8HA 3NDBB 2EILC 3B0VC 3T4RA 3PHF2 1V55C 2A1DD 1J8MF 4HFKB 4C3EA 5KYWB 2NUTB 3EFOB 2XSEA 3ASNC 4MNDA 4I1OB 3JSZA 3I5PA 1RJ9A 3B9QA 3DAGA 3FAJA 5T3WA 1MMNA 2J7PD 5L3QA 5KYNA 4OIOF 3H65A 1QLEC 1D1CA 2H7VC 2OCCC 2KGOA 3W8IA 5DS6A 5KYYB 2Q3TA 3FHDA 5E3CA 1LKXA 4JJGA 2V3CC 4U5DE 3IEEA 4CS7A 2IOQA 5EGYA 2W45A 2ZPAA 1M56C 1G8XA 4JVSA 4KBLA 4NY3A 5DLJA 3E70C 2Q9AA 3NYJA 2WZFA 2IXPA 3VYWA 3EGDA 1TKNA 2J9UA 2Q9CA 4DVZA 4GEHA 1ZHYA 3DXJF 2A68F 2Y3BA 1BR4A 4QI0A 4C7OB 4U5BE 2CGEA 4EWCA 2J9WA 3V7OA 4CBEA 1S7ZA 2CNWD 1PCXA 2IXNA 4ANJA 2YZSA 3ASOC 1FFTC 5F5HA 2XXAB 1MNDA 2VH3A 4KI2A 3Q7GA 2R7QA 2QY9A 3CQZA 4U5EE 2V26A 5KYWA 2NUTA 3S0XA 1SZIA 4I1MA 2R7VA 2Y3HA 3KKBA 3EFOA 2MWQA 4YT2A 3N0TA 4HFFB 2MYSA 4XWJA 1NZEA 3MLGA 3UGPA 3DJUB 1TR2A 4LERA 4M63A 4U5HA 2J0XA 4BJTA 3JCUQ 5T1DB 3K1HA 3NRHA 3UNGC 3UR3C 4EBBA 5KYYA 3RKOF 4LLCA 4ZLCA 1PD0A 3LNRA 3W2WA 4B6IA 4PFPA 3OA1A 1MMAA 1O5HA 1OCRC 1M2VB 4RBNA 1Z3IX 4O6YA 1ZHTA 1ZYRF 3NG1A 1VYIA 3HTKC 1VOMA 3SEOA 3NKDA 3DM5A 3RYLA 3DZAA 4RD9A 3DAFA 2NUPB 4Q5SF 1ZU4A 1IW7F 2PFDA 3I5QA 4E7ZA 3HJCA 3ABLC 3AG2C 3UMKA 3ZSUA 2G3VA 2WVOA 2G3KA 3UMIA 4G7HF 3DM9B 4MQ9F 2X51A 1OKKD 3B0PA 1ZHZA 4C7OA 2W4MA 4ZLDA 5E33A 4YT8A 1D0ZA 2R7SA 3AQCA 1JPJA 3ABKC 5CI8A 2ZXWC 3S27A 1PD1A 2O9XA 4AX2A 1VMAA 4C3BA 3EHMA 2XXAA 4YWQA 4IJJA 2XL4A 1OCZC 1WGWA 3RH3A 2P6VA 4G7OF 3F47A 4U5FE 3LLKA 2IYLD 3OWTA 3TD7A 4BEJA 4KNWA 1BR1A 4IRUA 2B0JA 4OIRF 3DJNB 4CS9A 5DQZA 4AE4B 1LS1A 3F46A 2KW3C 1NG1A 1ST6A 1Z63A 4KC9A 4BJ6C 3K7DA 2YEVA 2NG1A 2KNHA 3LS1A 3N24A 3AG4C 5DVWA 4ULWA 1M2VA 3ITFA 4F4BA 1D0XA 1FMWA 4O6MA 4PJMA 2Q9BA 2GFHA 4G0HA 3EHNA 3QMKA 4O7GA 2C04A 2WVQA 2NUPA 1O87A 4CSAA 2J9VA 4P6IC 2R7XA 4BJ1A 3SYNA 2YHSA 1N1CA 2EIJC 5D91A 3UMHA 3EPVA 4A2NB 3QZCA 2ZXPA 2WB7A 4DBRA 1BR2A 4Q4ZF 4OIQF 2WZLA 4PFOA 2VB6A 3O39A 3S29A 2C03A 4PK4A 2JD3A 4FX5A 3ZVRA 2PX0A 3FDQA 3LEVA 2VASA 3KL4A 2OG2A 3I4UA 3T6BA 2A6EF 1LVKA 5DQTA 4O79A 3Q6MA 3B0UX 2Z15A 1Z6AA 2W9YA 4CS9C 3L0IA 4XLPF 1QZXA 4PJJA 3LESA 1MMDA 2J0WA 3S28A 4XTKA 5CI9A 5KYUB 1OCOC 4QDLA 5D92A 1D1AA 1VK5A 4JCHA 4AE4A 4BJ6A 1OKKA 4HEAJ 4K0DA 4H4KC 1ZHXA 3LAYA 3NYLA 3K6BA 4N06A 3SNHA 4BJ5A 2WVNA 4OD4A 2CW0F 2R7UA 4CIHA 3CZ6A 4CSAC 2IXMA 5KYXB 4LLEA 5F5FA 2J7PA 1IZMA 2Y3DA 3N2ZB 4U5CE 5IY5C 3OEOA 2R7RA 3ABMC 3ECSA 3UGOA 3O6XA 2ZXRA 5B3SC 3HLZA 4KNVA 1M57C 2DGJA 2WZGA 4XLNF 4DVYP 2XRHA 3EQLF 4GYTA 4FWVA 5EHHA 2EIMC 2KQ9A 3RFYA 1VYKA 3EZHA 3EG9B 3WODF 2A6HF 1OCCC 1V54C 2CDQA 3JRTA 1FTSA 4WJ0A 3SP1A 2BE5F 3K66A 1J8YF 4LACB 3VAYA 2Y3GA 4JJFA 2PF4E 4JZAA 3X1OA 3NYMA 3EGXB 5FCLA 3PMRA 3RIPA 2H7BA 2HV7A 4C3DA 2QTVA 2R7WA 1TWCA 4OINF 4O6NA 4U5GA 2CNWA 4Q7CA 4OIPF 4BJ5C 1FFHA 3L34A 3K1IC 4PJLA 1NU9C 5KYUA 3LLIA 1TWAA 2M4EA 4CS8A 2R7OA 2E87A 1Z5ZA 4YT4A 4W8KA 5DS4A 2FFHA 1KU2A 4RDAA 2DYRC 3FVYA 3LS0A 4I3MA 4PJNA 1D0YA 4G7ZF 3ZIBA 4QI2A 1Z23A 5KYXA 3WG7C 1M2OA 3EH2A 3EH1A 3E9VA 1JPNA 2I8BA 3AQBA 3DMDA 3GODA 4OD5A 2Y39A 3M1CB 4HE8D 4YJWA 4K7BA 2DYSC 4I44A 3CSKA 4YN0B 1FMVA 4DBQA 1MNEA 1ZHWA 1TWHA 4IAOA 1RJ9B 4JW1A 3GANA 2W4BA 2J46A 2L9JA 4X0RA 3X2QC 2D5RB 3Q6NA 5B1BC 2P7VA 5L3VA 3LJBA 2KJGA 4IWBA 3EG9A 5HSWA 3MX3A 3K33A 2PP4A 4AK9A 1W2WA 3T6JA 1MMGA 4J30B 3EZIA 3SZRA 2IXOA 3KMIA 1TWGA 1SMYF 5E3AA 3AG1C 3EGXA 5DS5A 3ZG1A 3EJNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SNH A;  4BEJ A;  4X0R A;  3SZR A;  3ZVR A;  3LJB A; 
#chains in the Genus database with same CATH topology
 4E7S A;  4CS8 C;  2ZXO A;  2L81 A;  3EGD B;  1D1B A;  1Y4C A;  2GWW A;  4XPW A;  2UUI A;  3DD7 A;  4J7Y A;  1SF8 A;  2G62 A;  2WL8 A;  3AGU A;  4DOZ A;  3POV A;  1NU7 D;  3AG3 C;  1BZ4 A;  2LSE A;  4MVR A;  3ZC4 A;  2LFF A;  4YT5 A;  3Q7L A;  4J32 B;  2ETS A;  2H7O A;  2JX0 A;  2HV6 A;  2PX3 A;  3JT1 A;  3M15 A;  4BG0 A;  3KH2 A;  1CPR A;  2EIN C;  1JRA A;  3RVZ A;  2H8A A;  1ZU5 A;  3NKE A;  4JUR I;  4YL3 A;  3W2V A;  2EIK C;  2A69 F;  1MQV A;  5E2Q A;  5B1A C;  4IAQ A;  5BUO A;  3ZDL A;  4D4X A;  3TJ5 A;  2PNO A;  2GA0 A;  2Y69 C;  4FES A;  4NTB A;  4JTD B;  2FGY A;  4JTC B;  3JYH A;  2J45 A;  2XL8 A;  1YYJ A;  1A41 A;  5T3T A;  3W8H A;  2R7T A;  2ASR A;  5BQH A;  3NDB B;  4NTF A;  2R7V A;  4UDV A;  2EIL C;  3B0V C;  3T4R A;  3PHF 2;  1GS9 A;  1V55 C;  1Q0F A;  3O55 A;  1FNT c;  2A1D D;  3FAP B;  3A11 A;  4IB4 A;  2X0C A;  1VLS A;  2HSB A;  4BPM A;  1J8M F;  4HFK B;  4MVZ A;  2ICW G;  4C3E A;  3U2L A;  1OXK A;  5KYW B;  2NUT B;  2HFI A;  5JVE A;  4Z9J A;  3EFO B;  2XSE A;  3ASN C;  1WWP A;  1OR3 A;  3J06 A;  2XLE A;  2CYD A;  4MND A;  4I1O B;  2LCH A;  3JSZ A;  3TK0 A;  3I5P A;  1RJ9 A;  3B9Q A;  1GM5 A;  3DAG A;  3QW1 A;  3U8V A;  1AEP A;  1CGN A;  3FAJ A;  4XPX A;  1CPQ A;  1MMN A;  2J7P D;  5T3W A;  3L8I A;  5KYN A;  5L3Q A;  3DKA A;  4U9E A;  2OOC A;  4OIO F;  3H65 A;  2J9B A;  1QLE C;  1D1C A;  4MVO A;  5BQG A;  1Y6D A;  1A0B A;  4J7T A;  2H7V C;  3A9C A;  3GWL A;  2OCC C;  2KGO A;  3C8G D;  3W8I A;  5DS6 A;  3SXK A;  3R2P A;  5JT4 A;  2Q3T A;  3FHD A;  5E3C A;  5KYY B;  1LKX A;  4JJG A;  4L6R A;  4H54 A;  5F28 E;  2P61 A;  2V3C C;  4ONS A;  4U5D E;  3IEE A;  2LK4 A;  4CS7 A;  2IOQ A;  5EGY A;  2GDC A;  2YL1 A;  1PV3 A;  2W45 A;  2QE9 A;  5K0I A;  2ZPA A;  1M56 C;  1SYQ A;  1V74 B;  3S9O A;  1G8X A;  4EBJ A;  4JVS A;  3HNL A;  4KBL A;  1YDI A;  4NY3 A;  5DLJ A;  4EHP A;  3E70 C;  2OJE D;  2Q9A A;  3G4Z A;  3MBG A;  5A6B D;  3NYJ A;  2XLW A;  3CEX A;  3LUT B;  3RQF A;  2HJ3 A;  2B0H A;  2KYH A;  2IXP A;  2WZF A;  2YL3 A;  4D4N A;  1KNY A;  3VYW A;  2YKZ A;  3EGD A;  4XEV A;  1OW8 A;  3H2V A;  5JRA A;  1T9K A;  3S90 A;  1OW7 A;  1TKN A;  2J9U A;  2Q9C A;  2XL6 A;  3FXH A;  4DVZ A;  3C63 A;  3GEE A;  3MYF A;  5FZT A;  4GEH A;  1ZHY A;  3SXZ A;  3DXJ F;  2A68 F;  2Y3B A;  2TMV P;  3QW0 A;  1APC A;  1BR4 A;  1QPU A;  3L1M A;  4QI0 A;  1G4W R;  3HNJ A;  3RVY A;  4C7O B;  1S05 A;  4U5B E;  2CGE A;  4EWC A;  1EQ1 A;  3C8G B;  3TOM A;  2CCY A;  2J9W A;  2Q00 A;  1ORS C;  3V7O A;  4CBE A;  1S7Z A;  2CNW D;  2J8W A;  3L8J A;  1PCX A;  2IXN A;  4ANJ A;  3U3F A;  4NQF A;  1ZW2 A;  1EA8 A;  4EIY A;  2YZS A;  3GM1 A;  3S29 A;  1KTM A;  4CIP A;  3ASO C;  3KYI A;  2ZD9 A;  1FFT C;  5F5H A;  2XXA B;  1MND A;  2L7A A;  2VH3 A;  1ZVZ A;  2NSF A;  3Q7G A;  1L3P A;  4KI2 A;  2R7Q A;  2QY9 A;  3CQZ A;  4U5E E;  2V26 A;  5KYW A;  4NC3 A;  2NUT A;  3S0X A;  1SZI A;  4I1M A;  4JIO A;  2Y3H A;  3KKB A;  3EFO A;  1JAF A;  2MWQ A;  1UFB A;  3EJN A;  3FOP A;  4CJO A;  4YT2 A;  3N0T A;  4HFF B;  2HSQ A;  2HS5 A;  2MYS A;  3M79 A;  4XWJ A;  1NZE A;  3MLG A;  3UGP A;  1ORY A;  3DJU B;  3R7C A;  1T6U A;  4DRJ B;  3TUL A;  4JE9 A;  5EK0 A;  1TR2 A;  4MS2 A;  4LER A;  3AOU A;  4M63 A;  4U5H A;  2AU5 A;  5GPG B;  3W4Y A;  2J0X A;  4BJT A;  4GQH A;  3WAQ A;  3JCU Q;  5T1D B;  3K1H A;  3NRH A;  3UNG C;  1WAT A;  3T6G B;  1G5Z A;  3UR3 C;  4EBB A;  3U5S A;  1HE9 A;  1YJG A;  3LNM B;  3RKO F;  5KYY A;  3BEH A;  3C7J A;  4NCQ A;  4LLC A;  4MTG A;  5TJ5 E;  1GGQ A;  2IM8 A;  1PD0 A;  4ZLC A;  4JKV A;  1DOW A;  4DXW A;  3LNR A;  3ZTZ A;  3W2W A;  4B6I A;  4PFP A;  3OA1 A;  1MMA A;  1O5H A;  1OCR C;  1M2V B;  1JOG A;  1ZW3 A;  256B A;  3U9J A;  4RBN A;  1Z3I X;  4EUK B;  4O6Y A;  1ZHT A;  1HMD A;  1LM3 B;  1ZYR F;  1K40 A;  3NG1 A;  4JEA A;  4YL0 A;  4DRH B;  1VYI A;  3HTK C;  4JTA B;  1VOM A;  3HNK A;  3NKD A;  3DM5 A;  3SEO A;  3U9M A;  3RYL A;  3DZA A;  4RD9 A;  3DAF A;  2NUP B;  2UUH A;  1ZU4 A;  1C17 M;  1IW7 F;  4Q5S F;  2PFD A;  1YAR O;  3I5Q A;  4E7Z A;  3HJC A;  1Q0D A;  4ULV A;  4IAR A;  3ABL C;  2VCC A;  3AG2 C;  3UMK A;  2YLG A;  3ZSU A;  1JR8 A;  2G3V A;  3FMS A;  2WVO A;  2G3K A;  3UMI A;  4G7H F;  3DM9 B;  3IQ5 A;  1H7I A;  4MQ9 F;  1XWJ A;  1QKR A;  2X51 A;  3MFN A;  1OKK D;  3B0P A;  1LE4 A;  2HJM A;  1ZHZ A;  4C7O A;  2W4M A;  4ZLD A;  1YA7 O;  3C8G A;  5E33 A;  1VTM P;  2RD9 A;  3O10 A;  1OW6 A;  3DE9 A;  4YT8 A;  1D0Z A;  2R7S A;  3AQC A;  1JPJ A;  3ABK C;  3MYI A;  5CI8 A;  4P9F A;  2ZXW C;  3S27 A;  1T6I A;  3SXM A;  2OKU A;  1PD1 A;  2O9X A;  4AX2 A;  4P9T A;  1VMA A;  1E83 A;  4ER9 A;  4C3B A;  3EHM A;  2XXA A;  3ZQV A;  4EBK A;  4YWQ A;  2IBF A;  2OEV A;  4IJJ A;  2XLM A;  4YL1 A;  3SXY A;  2XL4 A;  4WGZ A;  1A7D A;  1C03 A;  1OCZ C;  1WGW A;  3JRM O;  2VC9 A;  2P6V A;  3GM3 A;  3QVY A;  3F47 A;  1FAP B;  1YVI A;  2GAQ A;  2EPO A;  3RH3 A;  4G7O F;  4U5F E;  1LI5 A;  3LLK A;  1YYX A;  2IYL D;  3OWT A;  1F1M A;  3TD7 A;  4BEJ A;  4KNW A;  1BR1 A;  2XM4 A;  3C62 A;  2BC5 A;  2EPL X;  4IRU A;  4XQ1 A;  2OJQ A;  2B0J A;  4OIR F;  3DJN B;  4CS9 A;  1U0B B;  5DQZ A;  3RW0 A;  4AE4 B;  1LS1 A;  2YVK A;  5L0I A;  3F46 A;  2KW3 C;  1I4Z A;  1WOL A;  1NG1 A;  1ST6 A;  1U89 A;  3DWW A;  3G4X A;  1Z63 A;  4KC9 A;  2XLH A;  4BJ6 C;  3K7D A;  5L0C A;  5L0D A;  2YEV A;  2HMZ A;  1RCP A;  2EPM X;  2NG1 A;  2NSG A;  2KNH A;  3LS1 A;  2DI3 A;  4N6C A;  3N24 A;  3AG4 C;  1I5N A;  4G78 A;  1H9G A;  3GWN A;  4ULW A;  5DVW A;  2YLD A;  1M2V A;  3ITF A;  2EPK X;  3LEO A;  4F4B A;  4DRI B;  1D0X A;  1FMW A;  4O6M A;  1Q0G A;  4AL0 A;  4PJM A;  3QTH A;  5CIV A;  2Q9B A;  2GFH A;  3US6 A;  2A0U A;  3ZQY A;  5L0H A;  5AC4 A;  1RKC A;  4G0H A;  3EHN A;  2AWC A;  3QMK A;  1XZP A;  1R4T A;  4O7G A;  1JMW A;  2C04 A;  2WVQ A;  2NUP A;  1CGO A;  1OQC A;  1E86 A;  1O87 A;  1TFO B;  4XEK A;  3U8P A;  4CSA A;  2BL2 A;  2D4U A;  2J9V A;  4P6I C;  3SYN A;  3TOL A;  4BJ1 A;  3U0C A;  2YHS A;  1N1C A;  2EIJ C;  5COM A;  1VB5 A;  3C8Z A;  3GM2 A;  1WTY A;  5D91 A;  3V5X A;  3UMH A;  5COF A;  3EPV A;  4A2N B;  1E85 A;  1L7C A;  3QZC A;  2ZXP A;  4CX9 A;  3U2M A;  2WB7 A;  1XZQ A;  3JSE O;  4DBR A;  1BR2 A;  4Q4Z F;  4OIQ F;  3S84 A;  2WZL A;  4JEB A;  3KYJ A;  5A6A A;  4PFO A;  2R02 A;  2VB6 A;  1WN0 A;  3O39 A;  3KPH A;  4MTF A;  2C03 A;  2Q7R A;  2YLI A;  3ATP A;  4PK4 A;  2JD3 A;  2XS8 A;  5BQI A;  4FX5 A;  3ZVR A;  1A7V A;  2PX0 A;  3RQG A;  3FDQ A;  3LEV A;  4N6H A;  2VAS A;  3RF3 A;  1RKE B;  3WHN A;  2MHR A;  1V4A A;  3KL4 A;  2OG2 A;  3I4U A;  3T6B A;  2A6E F;  1LVK A;  4NTA A;  1R5I D;  1UG7 A;  4O79 A;  3Q6M A;  4XPY A;  1Z7Q c;  4JRZ A;  5DQT A;  5JLI A;  3B0U X;  1GQA A;  1T5O A;  2YWA A;  3ZTM A;  2YRF A;  2Z15 A;  1M6T A;  4XEF A;  1Z6A A;  2W9Y A;  3JYY A;  4CS9 C;  3L0I A;  3RQE A;  4XLP F;  1EI7 A;  4DJ9 A;  1T6Q A;  4FAP B;  1QSP A;  1QZX A;  5A6K A;  4PJJ A;  2LIG A;  3HKK A;  1LS4 A;  2R25 A;  2XLV A;  3LES A;  5COG A;  2YQY A;  2HMQ A;  1MMD A;  2J0W A;  3S28 A;  1OR2 A;  2P1A A;  3AJM A;  4XTK A;  5CI9 A;  1B68 A;  1YZA A;  2F22 A;  2OQM A;  3C18 A;  4WGY A;  5KYU B;  1OCO C;  2LFD A;  4QDL A;  3VRC A;  5D92 A;  3M4B A;  1D1A A;  1VK5 A;  2L6F A;  4JCH A;  4AE4 A;  4BJ6 A;  1OKK A;  4HEA J;  4K0D A;  1O3U A;  4H4K C;  4MVM A;  1ZHX A;  3LAY A;  2HZ8 A;  3NYL A;  1E84 A;  3K6B A;  4N06 A;  3SNH A;  4BJ5 A;  2WVN A;  5HV9 A;  3K1I A;  4IGG A;  3IPM O;  4OD4 A;  1WAS A;  2CW0 F;  2R7U A;  2QNL A;  4CIH A;  3CZ6 A;  1BDJ B;  4CSA C;  2IXM A;  5KYX B;  2VCA A;  4LLE A;  5F5F A;  4E17 A;  1HY5 A;  2I15 A;  2J7P A;  2OEX A;  1YA9 A;  1IZM A;  2Q4F A;  2Y3D A;  5AC5 A;  3HNI A;  3N2Z B;  4U5C E;  3OEO A;  5IY5 C;  2FAP B;  2R7R A;  3IQ6 A;  1VLT A;  3GOR A;  3NMK A;  3NMJ A;  3ABM C;  3ECS A;  3QVZ A;  3UGO A;  3O6X A;  4R32 A;  4N4W A;  4A4A A;  4AL1 A;  2ZXR A;  1T01 A;  5B3S C;  3GEH A;  3HLZ A;  3U3B A;  4CDV A;  4KNV A;  1M57 C;  2DGJ A;  2WZG A;  3FOO A;  2XLO A;  4E18 A;  4XLN F;  4DVY P;  3PDM P;  2YL0 A;  2XRH A;  3EQL F;  2AVK A;  3JTL O;  4GYT A;  4FWV A;  2NPU A;  2R03 A;  1HMO A;  5EHH A;  4EKW A;  3JZ0 A;  3GEI A;  1U6H A;  2EIM C;  2KQ9 A;  3RFY A;  1VYK A;  2DB4 A;  3EZH A;  5A6B A;  3EG9 B;  3WOD F;  2A6H F;  4LDQ A;  4MVQ A;  1OCC C;  4MW8 A;  1V54 C;  5JSL A;  4CDA A;  3CAX A;  2CDQ A;  3JRT A;  3ZWI A;  2EPN A;  1FTS A;  1H6G A;  1E2X A;  4WJ0 A;  4Z9H A;  3SP1 A;  2BE5 F;  5L0F A;  3K66 A;  1J8Y F;  1K05 A;  5L0G A;  1RKE A;  4LAC B;  2AWY A;  4PAC A;  4JC7 A;  5JS5 A;  1CGM E;  3VAY A;  3M4C A;  4U9D A;  1SR2 A;  2Y3G A;  3VM6 A;  4CDY A;  4JJF A;  3DI5 A;  2PF4 E;  4JZA A;  3X1O A;  3NYM A;  3EGX B;  3B29 A;  5FCL A;  3PMR A;  3RIP A;  2H7B A;  2HV7 A;  1LE2 A;  2QTV A;  4C3D A;  4E0I A;  2R7W A;  3PCV A;  1TWC A;  1TQG A;  2LQG A;  3NMI A;  4OIN F;  4O6N A;  2P0N A;  1C02 A;  4U5G A;  2CNW A;  5B3I A;  4Q7C A;  2M64 A;  4OIP F;  1YAU O;  4BJ5 C;  1FFH A;  3AGT A;  4MTO A;  5JUA A;  3L34 A;  1H9T A;  3K1I C;  4PJL A;  3IQC A;  1NU9 C;  1LPE A;  5A69 A;  5KYU A;  3LLI A;  1TWA A;  2M4E A;  4CS8 A;  1A7E A;  1DOV A;  1Q0M A;  2KC3 A;  2R9R B;  2E87 A;  2R7O A;  4MVU A;  1I4Y A;  1Z5Z A;  2PBE A;  3DE8 A;  3V5Y A;  4YT4 A;  4K1O A;  4YK5 A;  4W8K A;  5DS4 A;  2FFH A;  1KU2 A;  4RDA A;  1G4U S;  1NFN A;  3TQO A;  2DYR C;  3FVY A;  2QUP A;  3LS0 A;  4I3M A;  2KK1 A;  1HE1 A;  4PJN A;  1BBH A;  2R7X A;  1D0Y A;  2L6G A;  3IQT A;  4G7Z F;  2AP3 A;  4JCZ A;  3ZIB A;  4QI2 A;  1Z23 A;  5KYX A;  3WG7 C;  1M2O A;  3EH2 A;  3T9O A;  1NLX A;  3EH1 A;  1EKY A;  3E9V A;  4CJG A;  1ORJ A;  2XM0 A;  1AUE A;  4PR9 A;  1JPN A;  2I8B A;  3TJ6 A;  3AQB A;  3DMD A;  4LDK A;  3GOD A;  1TFK B;  2YL7 A;  4W8P A;  4OD5 A;  1NBB A;  2JPU A;  2Y39 A;  3B71 A;  3M1C B;  4HE8 D;  4E0H A;  4YJW A;  1LIH A;  4K7B A;  5L0J A;  2DYS C;  4I44 A;  3CSK A;  5AGF A;  3G50 A;  4YN0 B;  5A6J A;  1FR0 A;  1YLM A;  1FMV A;  4LDR A;  3VF0 A;  1NFO A;  4DBQ A;  2RSE B;  2VCB A;  2KSF A;  1MNE A;  1ZHW A;  1TWH A;  2R05 A;  4IAO A;  1RJ9 B;  4WAB A;  2QLA A;  4JW1 A;  5JP7 A;  4Z9I A;  3GAN A;  1LI7 A;  2W4B A;  2J46 A;  4MVS A;  1Q0K A;  2L9J A;  4X0R A;  3X2Q C;  2D5R B;  2OU6 A;  3IHU A;  2HKV A;  3Q6N A;  5B1B C;  2P7V A;  5L3V A;  3LJB A;  1NSG B;  2KJG A;  4IWB A;  3EG9 A;  2LD6 A;  1HW2 A;  5HSW A;  3MX3 A;  3K33 A;  1RMV A;  2PP4 A;  1QQ3 A;  1ZZP A;  4AK9 A;  3V5Z A;  2LP4 A;  1K04 A;  4BEM J;  1W2W A;  1AVO B;  3T6J A;  1MMG A;  4J30 B;  2HUJ A;  3EZI A;  1HW1 A;  1QVX A;  3SZR A;  2IXO A;  3BRJ A;  1OXB A;  3KMI A;  2XLD A;  4MW3 A;  2A0B A;  1TWG A;  1SMY F;  2XS1 A;  3H2U A;  1YZC A;  5E3A A;  3AG1 C;  3EGX A;  5DS5 A;  1RXQ A;  3ZG1 A;  2L6H A; 
#chains in the Genus database with same CATH homology
 4E7S A;  4CS8 C;  2ZXO A;  2L81 A;  3EGD B;  1D1B A;  3DD7 A;  1SF8 A;  2G62 A;  2WL8 A;  4DOZ A;  3POV A;  1NU7 D;  3AG3 C;  2LSE A;  3ZC4 A;  4YT5 A;  3Q7L A;  4J32 B;  2H7O A;  2HV6 A;  2PX3 A;  3JT1 A;  4BG0 A;  3KH2 A;  2EIN C;  1ZU5 A;  3NKE A;  4JUR I;  3W2V A;  2EIK C;  2A69 F;  5E2Q A;  5B1A C;  5BUO A;  4FES A;  2Y69 C;  2FGY A;  3JYH A;  2J45 A;  5T3T A;  2R7T A;  3W8H A;  3NDB B;  2EIL C;  3B0V C;  3T4R A;  3PHF 2;  1V55 C;  2A1D D;  1J8M F;  4HFK B;  4C3E A;  5KYW B;  2NUT B;  3EFO B;  2XSE A;  3ASN C;  4MND A;  4I1O B;  3JSZ A;  3I5P A;  1RJ9 A;  3B9Q A;  3DAG A;  3FAJ A;  5T3W A;  1MMN A;  2J7P D;  5L3Q A;  5KYN A;  4OIO F;  3H65 A;  1QLE C;  1D1C A;  2H7V C;  2OCC C;  2KGO A;  3W8I A;  5DS6 A;  5KYY B;  2Q3T A;  3FHD A;  5E3C A;  1LKX A;  4JJG A;  2V3C C;  4U5D E;  3IEE A;  4CS7 A;  2IOQ A;  5EGY A;  2W45 A;  2ZPA A;  1M56 C;  1G8X A;  4JVS A;  4KBL A;  4NY3 A;  5DLJ A;  3E70 C;  2Q9A A;  3NYJ A;  2WZF A;  2IXP A;  3VYW A;  3EGD A;  1TKN A;  2J9U A;  2Q9C A;  4DVZ A;  4GEH A;  1ZHY A;  3DXJ F;  2A68 F;  2Y3B A;  1BR4 A;  4QI0 A;  4C7O B;  4U5B E;  2CGE A;  4EWC A;  2J9W A;  3V7O A;  4CBE A;  1S7Z A;  2CNW D;  1PCX A;  2IXN A;  4ANJ A;  2YZS A;  3ASO C;  1FFT C;  5F5H A;  2XXA B;  1MND A;  2VH3 A;  4KI2 A;  3Q7G A;  2R7Q A;  2QY9 A;  3CQZ A;  4U5E E;  2V26 A;  5KYW A;  2NUT A;  3S0X A;  1SZI A;  4I1M A;  2R7V A;  2Y3H A;  3KKB A;  3EFO A;  2MWQ A;  4YT2 A;  3N0T A;  4HFF B;  2MYS A;  4XWJ A;  1NZE A;  3MLG A;  3UGP A;  3DJU B;  1TR2 A;  4LER A;  4M63 A;  4U5H A;  2J0X A;  4BJT A;  3JCU Q;  5T1D B;  3K1H A;  3NRH A;  3UNG C;  3UR3 C;  4EBB A;  5KYY A;  3RKO F;  4LLC A;  4ZLC A;  1PD0 A;  3LNR A;  3W2W A;  4B6I A;  4PFP A;  3OA1 A;  1MMA A;  1O5H A;  1OCR C;  1M2V B;  4RBN A;  1Z3I X;  4O6Y A;  1ZHT A;  1ZYR F;  3NG1 A;  1VYI A;  3HTK C;  1VOM A;  3SEO A;  3NKD A;  3DM5 A;  3RYL A;  3DZA A;  4RD9 A;  3DAF A;  2NUP B;  4Q5S F;  1ZU4 A;  1IW7 F;  2PFD A;  3I5Q A;  4E7Z A;  3HJC A;  3ABL C;  3AG2 C;  3UMK A;  3ZSU A;  2G3V A;  2WVO A;  2G3K A;  3UMI A;  4G7H F;  3DM9 B;  4MQ9 F;  2X51 A;  1OKK D;  3B0P A;  1ZHZ A;  4C7O A;  2W4M A;  4ZLD A;  5E33 A;  4YT8 A;  1D0Z A;  2R7S A;  3AQC A;  1JPJ A;  3ABK C;  5CI8 A;  2ZXW C;  3S27 A;  1PD1 A;  2O9X A;  4AX2 A;  1VMA A;  4C3B A;  3EHM A;  2XXA A;  4YWQ A;  4IJJ A;  2XL4 A;  1OCZ C;  1WGW A;  3RH3 A;  2P6V A;  4G7O F;  3F47 A;  4U5F E;  3LLK A;  2IYL D;  3OWT A;  3TD7 A;  4BEJ A;  4KNW A;  1BR1 A;  4IRU A;  2B0J A;  4OIR F;  3DJN B;  4CS9 A;  5DQZ A;  4AE4 B;  1LS1 A;  3F46 A;  2KW3 C;  1NG1 A;  1ST6 A;  1Z63 A;  4KC9 A;  4BJ6 C;  3K7D A;  2YEV A;  2NG1 A;  2KNH A;  3LS1 A;  3N24 A;  3AG4 C;  5DVW A;  4ULW A;  1M2V A;  3ITF A;  4F4B A;  1D0X A;  1FMW A;  4O6M A;  4PJM A;  2Q9B A;  2GFH A;  4G0H A;  3EHN A;  3QMK A;  4O7G A;  2C04 A;  2WVQ A;  2NUP A;  1O87 A;  4CSA A;  2J9V A;  4P6I C;  2R7X A;  4BJ1 A;  3SYN A;  2YHS A;  1N1C A;  2EIJ C;  5D91 A;  3UMH A;  3EPV A;  4A2N B;  3QZC A;  2ZXP A;  2WB7 A;  4DBR A;  1BR2 A;  4Q4Z F;  4OIQ F;  2WZL A;  4PFO A;  2VB6 A;  3O39 A;  3S29 A;  2C03 A;  4PK4 A;  2JD3 A;  4FX5 A;  3ZVR A;  2PX0 A;  3FDQ A;  3LEV A;  2VAS A;  3KL4 A;  2OG2 A;  3I4U A;  3T6B A;  2A6E F;  1LVK A;  5DQT A;  4O79 A;  3Q6M A;  3B0U X;  2Z15 A;  1Z6A A;  2W9Y A;  4CS9 C;  3L0I A;  4XLP F;  1QZX A;  4PJJ A;  3LES A;  1MMD A;  2J0W A;  3S28 A;  4XTK A;  5CI9 A;  5KYU B;  1OCO C;  4QDL A;  5D92 A;  1D1A A;  1VK5 A;  4JCH A;  4AE4 A;  4BJ6 A;  1OKK A;  4HEA J;  4K0D A;  4H4K C;  1ZHX A;  3LAY A;  3NYL A;  3K6B A;  4N06 A;  3SNH A;  4BJ5 A;  2WVN A;  4OD4 A;  2CW0 F;  2R7U A;  4CIH A;  3CZ6 A;  4CSA C;  2IXM A;  5KYX B;  4LLE A;  5F5F A;  2J7P A;  1IZM A;  2Y3D A;  3N2Z B;  4U5C E;  5IY5 C;  3OEO A;  2R7R A;  3ABM C;  3ECS A;  3UGO A;  3O6X A;  2ZXR A;  5B3S C;  3HLZ A;  4KNV A;  1M57 C;  2DGJ A;  2WZG A;  4XLN F;  4DVY P;  2XRH A;  3EQL F;  4GYT A;  4FWV A;  5EHH A;  2EIM C;  2KQ9 A;  3RFY A;  1VYK A;  3EZH A;  3EG9 B;  3WOD F;  2A6H F;  1OCC C;  1V54 C;  2CDQ A;  3JRT A;  1FTS A;  4WJ0 A;  3SP1 A;  2BE5 F;  3K66 A;  1J8Y F;  4LAC B;  3VAY A;  2Y3G A;  4JJF A;  2PF4 E;  4JZA A;  3X1O A;  3NYM A;  3EGX B;  5FCL A;  3PMR A;  3RIP A;  2H7B A;  2HV7 A;  4C3D A;  2QTV A;  2R7W A;  1TWC A;  4OIN F;  4O6N A;  4U5G A;  2CNW A;  4Q7C A;  4OIP F;  4BJ5 C;  1FFH A;  3L34 A;  3K1I C;  4PJL A;  1NU9 C;  5KYU A;  3LLI A;  1TWA A;  2M4E A;  4CS8 A;  2R7O A;  2E87 A;  1Z5Z A;  4YT4 A;  4W8K A;  5DS4 A;  2FFH A;  1KU2 A;  4RDA A;  2DYR C;  3FVY A;  3LS0 A;  4I3M A;  4PJN A;  1D0Y A;  4G7Z F;  3ZIB A;  4QI2 A;  1Z23 A;  5KYX A;  3WG7 C;  1M2O A;  3EH2 A;  3EH1 A;  3E9V A;  1JPN A;  2I8B A;  3AQB A;  3DMD A;  3GOD A;  4OD5 A;  2Y39 A;  3M1C B;  4HE8 D;  4YJW A;  4K7B A;  2DYS C;  4I44 A;  3CSK A;  4YN0 B;  1FMV A;  4DBQ A;  1MNE A;  1ZHW A;  1TWH A;  4IAO A;  1RJ9 B;  4JW1 A;  3GAN A;  2W4B A;  2J46 A;  2L9J A;  4X0R A;  3X2Q C;  2D5R B;  3Q6N A;  5B1B C;  2P7V A;  5L3V A;  3LJB A;  2KJG A;  4IWB A;  3EG9 A;  5HSW A;  3MX3 A;  3K33 A;  2PP4 A;  4AK9 A;  1W2W A;  3T6J A;  1MMG A;  4J30 B;  3EZI A;  3SZR A;  2IXO A;  3KMI A;  1TWG A;  1SMY F;  5E3A A;  3AG1 C;  3EGX A;  5DS5 A;  3ZG1 A;  3EJN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...