1EQ1A

Nmr structure of an exchangeable apolipoprotein-manduca sexta apolipophorin-iii
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
166
structure length
166
Chain Sequence
DAPAGGNAFEEMEKHAKEFQKTFSEQFNSLVNSKNTQDFNKALKDGSDSVLQQLSAFSSSLQGAISDANGKAKEALEQARQNVEKTAEELRKAHPDVEKEANAFKDKLQAAVQTTVQESQKLAKEVASNMEETNKKLAPKIKQAYDDFVKHAEEVQKKLHEAATKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the conformational adaptability of apolipophorin III, a helix-bundle exchangeable apolipoprotein
pubmed doi rcsb
source organism Manduca sexta
molecule tags Lipid binding protein
molecule keywords APOLIPOPHORIN-III
total genus 46
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2000-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07464 ApoLp-III Apolipophorin-III precursor (apoLp-III)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1eq1A00
1GS9A 1NFOA 1OR3A 1B68A 1EA8A 1EQ1A 1NFNA 3S84A 1H7IA 1AEPA 1YA9A 1LS4A 1LPEA 1OR2A 1BZ4A 2KC3A 1LE2A 3R2PA 1LE4A
chains in the Genus database with same CATH superfamily
3L1MA 2IXMA 1S05A 1ZW2A 2LSEA 4EKWA 3DWWA 1C02A 3DE9A 5KYWA 3EHNA 1I5NA 1RJ9A 4U5CE 1YDIA 2WL8A 2XS8A 2NG1A 5F28E 3JYYA 5EHHA 1KTMA 2P61A 3A9CA 2WVNA 5CI8A 3M15A 1ZVZA 1A0BA 3CZ6A 1S7ZA 2R05A 1HW2A 2L81A 3IQ6A 1OKKD 2FFHA 4LDKA 4U5FE 2DGJA 3C8GD 3HNKA 3DD7A 3KH2A 3B0VC 3U2LA 1QPUA 1V55C 3NMKA 4MQ9F 4E7SA 5DS5A 4J30B 2YLGA 4EBKA 5JLIA 2EIMC 2IBFA 4U9EA 2KGOA 1TWAA 1M56C 5L0JA 3I5QA 1FMWA 1LI7A 4BJ6A 1D0YA 3S28A 3OA1A 1ZHTA 3B9QA 3ASOC 3OWTA 2CDQA 4IARA 4N06A 1VOMA 4IB4A 2R7WA 2QNLA 1LS1A 2HFIA 3LS1A 2OU6A 5DQTA 4Z9IA 5AC5A 3GWLA 2G62A 3DJUB 4K0DA 4IJJA 3GEIA 4Q7CA 3SP1A 4YK5A 5B3IA 5FCLA 3RQGA 1LS4A 3KYIA 5JUAA 5L0GA 2EPOA 4DVZA 4JTDB 3ECSA 2PBEA 3O55A 4PJMA 5E3CA 1QSPA 2G3KA 4CS9C 1Y4CA 1JPJA 1PD0A 3A11A 3ZG1A 3ABLC 2ZD9A 2XXAA 3LJBA 3O39A 3GEEA 3U5SA 2AU5A 4IWBA 1ZHXA 5L3QA 1KU2A 4CDAA 2M4EA 4QI0A 1V4AA 1G5ZA 1R4TA 1F1MA 1VB5A 3LNMB 4OD4A 1Z63A 3SXKA 2GDCA 2C04A 3MYFA 2H7VC 2Y3GA 2HKVA 4CSAA 2A1DD 2FGYA 3W2VA 4MVSA 2VCBA 3LLKA 2HV6A 2Q9AA 2XM4A 1XZPA 2OQMA 3GM1A 2XLWA 4YT2A 3MYIA 3Q7LA 5T3TA 4BPMA 3UMHA 1Q0KA 5A6BA 1FFHA 1QZXA 3JRTA 3DXJF 4W8PA 2R7SA 2OG2A 2CGEA 2R7QA 1UG7A 1K05A 2HV7A 4HE8D 4LERA 4R32A 1ZHZA 1MMGA 3IQTA 4H54A 5T3WA 3X1OA 1OKKA 1FAPB 1NFNA 3JSEO 2XL8A 5L0FA 3HTKC 4RD9A 2KW3C 5B1BC 4O7GA 4O79A 3DM9B 1D1AA 5KYUA 3WAQA 3RQEA 3EGDB 4JEBA 5HV9A 2Y3HA 4G7ZF 1JAFA 1CPQA 3UMKA 5JRAA 2H7BA 2VASA 4GQHA 3ZSUA 1A7DA 3CSKA 3HKKA 4G7HF 2R02A 2H8AA 3K7DA 2OCCC 1OW7A 1GS9A 1D0XA 5KYUB 2LIGA 5BUOA 5L0CA 2NPUA 1V54C 1HMOA 2HJMA 4JURI 4JTAB 2M64A 3UNGC 2ZXWC 1XZQA 4O6YA 3HJCA 3LEVA 5L0IA 1GM5A 2UUHA 2KC3A 2KK1A 2KNHA 2QUPA 3ABKC 4LDRA 1QKRA 2W45A 1SF8A 1SYQA 4NTFA 3WODF 1D1BA 3NDBB 3RW0A 3L34A 2ETSA 4ZLDA 4DRIB 3EQLF 3RH3A 4CJGA 5COMA 2WVQA 2KSFA 3B29A 5B3SC 4EBBA 3PDMP 1EA8A 2J8WA 2MWQA 2A69F 4PACA 1VLSA 2DB4A 2OEXA 4RBNA 4JIOA 4ULVA 4ONSA 5E33A 3TOMA 4K7BA 2PF4E 1A7VA 3QVZA 2XLHA 4GEHA 1ST6A 2GFHA 1QVXA 1BR4A 1RKCA 4J32B 2Y3BA 4MVUA 1LIHA 4XQ1A 3VRCA 2J0WA 4DRJB 5L0HA 2VCCA 1SR2A 4CIHA 3AG3C 4J7TA 4NTAA 4E18A 1TQGA 2GA0A 2R25A 3ZQVA 2A6HF 3DI5A 2ZPAA 1OW8A 4MVZA 3DAGA 1U6HA 2OOCA 2XL6A 2XLVA 3M4CA 2VCAA 2KQ9A 1BR1A 2H7OA 2ASRA 3EGXB 3OEOA 3QZCA 5KYXB 3G4ZA 3DMDA 2UUIA 3T4RA 2OJQA 3KL4A 3S84A 1VK5A 2W4BA 3S29A 3VM6A 1WOLA 1PD1A 4BJ6C 4DBRA 4FWVA 3JSZA 1PV3A 4KBLA 2YL3A 2HS5A 3EG9A 4JZAA 4RDAA 4ANJA 1YA7O 3EGXA 3Q6NA 2Q00A 2B0HA 4CJOA 2NUTA 3K33A 1LE4A 2KJGA 2YHSA 3CEXA 5EGYA 4KNWA 4KC9A 1C03A 1OCRC 4PJLA 2CW0F 2ZXOA 3IEEA 2XLMA 4OIRF 1Z5ZA 2WZGA 5T1DB 3T6JA 2A0UA 1J8MF 1ZHYA 3ZVRA 5A69A 3UGOA 3LEOA 5DS6A 1IZMA 1MMDA 1YYXA 1VMAA 3M4BA 3GODA 4CS8C 1RKEB 4IGGA 3B0PA 2EPNA 2X51A 3C8GB 2YL0A 1NFOA 3ZTZA 3S90A 2XLOA 1D1CA 3C18A 2R9RB 4CS9A 2R7TA 3BEHA 1AVOB 3EZIA 4MS2A 4XEKA 2PNOA 1L3PA 4XTKA 2OKUA 2EIKC 3VF0A 4XWJA 3S27A 4OIQF 2A0BA 2J46A 3HLZA 1Z7Qc 2BC5A 5A6BD 4LLCA 2PFDA 3VAYA 4U5HA 3POVA 3NKEA 5IY5C 1WTYA 2Q9CA 1H9GA 4XPXA 1ORYA 1EI7A 5DQZA 1RKEA 3WHNA 5F5FA 1BZ4A 2VC9A 4MW8A 1JMWA 3J06A 2P7VA 4AL1A 3RKOF 1G4WR 3MBGA 3PMRA 4EBJA 1A41A 2NSFA 3U9MA 2YEVA 3ZWIA 2A68F 4YT4A 3C8GA 2WZFA 1U0BB 1LI5A 1CPRA 3M79A 1A7EA 4AL0A 4F4BA 4ZLCA 1YJGA 1Z23A 1ZW3A 2XRHA 4GYTA 5A6KA 1YARO 1EQ1A 2EILC 2WB7A 4PR9A 4EIYA 1NSGB 1H6GA 1AUEA 5JS5A 5KYYA 2X0CA 3R7CA 4CX9A 3GWNA 3TULA 2OEVA 1R5ID 2PX3A 3AG4C 4EUKB 4MTOA 2XXAB 5D92A 5L0DA 5A6JA 2VH3A 1OCCC 2DYRC 3C62A 3RFYA 1C17M 1VYKA 4OIOF 2PP4A 1V74B 3FXHA 1XWJA 3N0TA 4MTFA 3V7OA 4JEAA 4NC3A 3ZTMA 3LESA 3PHF2 3EH2A 1UFBA 1ORSC 3G4XA 4PJNA 5BQIA 3EFOA 2WVOA 3F46A 2EINC 3EHMA 4A4AA 3AG2C 2NUPB 1T6UA 1VLTA 3DZAA 3O10A 4G0HA 4P6IC 5EK0A 1TKNA 5JVEA 2LP4A 4CSAC 4B6IA 3KMIA 2LD6A 4YL3A 1K40A 5KYYB 4IAQA 2OJED 4C7OA 1U89A 3T6GB 3U0CA 1ZYRF 2XLEA 4EHPA 4YT8A 3NYLA 3ABMC 3PCVA 1IW7F 3JYHA 1BBHA 4BJ5C 1FNTc 2O9XA 4IRUA 1WGWA 2CYDA 3EJNA 3IPMO 3MFNA 5DVWA 3U8VA 3SXMA 5HSWA 1TWHA 4CIPA 3UMIA 3JRMO 4HEAJ 2CNWA 2YRFA 5TJ5E 2V3CC 2YKZA 3ASNC 4XLNF 1Q0GA 1L7CA 2CNWD 4I44A 3RQFA 3U3BA 5BQGA 2R7XA 4C3DA 4DBQA 2RSEB 3AOUA 1GGQA 3AQBA 4E17A 1QLEC 3EH1A 2XSEA 3FOPA 4HFFB 1AEPA 4JRZA 3MLGA 2DI3A 3FVYA 3RIPA 4E7ZA 1DOWA 3C63A 4YT5A 5A6AA 2P0NA 3K1HA 4PFOA 4FAPB 3O6XA 1TFKB 3N2ZB 3SYNA 3L8IA 4C7OB 3WG7C 4N4WA 3TJ5A 2NSGA 3U2MA 5FZTA 3IQCA 4J7YA 3IHUA 3ZIBA 1BR2A 2ICWG 2YQYA 2I15A 5B1AC 5JSLA 3TD7A 2A6EF 1HMDA 2R7UA 1OR2A 4NY3A 2YLDA 3R2PA 1Z3IX 5COGA 3GM2A 2AWCA 3QW0A 2L6FA 3K6BA 1T6IA 3TK0A 1ZU4A 2YL7A 1FFTC 1NBBA 2AP3A 2IYLD 3EGDA 3V5YA 3ZDLA 4KI2A 1JR8A 3MX3A 4NCQA 4JJGA 2Q4FA 3RF3A 3Q6MA 1J8YF 2Y39A 2AWYA 3EFOB 1H7IA 3SNHA 1D0ZA 2L6GA 5CI9A 1O5HA 2ZXRA 2J7PA 2YWAA 3B0UX 1G4US 4NTBA 3U8PA 1DOVA 3UR3C 4AK9A 2EPKX 5D91A 3KKBA 1RXQA 3E70C 4MVRA 2EIJC 2KYHA 3VYWA 1T9KA 4MVQA 3SXZA 1T6QA 3K66A 1YZAA 3JZ0A 3DAFA 3NMJA 3I4UA 3DM5A 2WZLA 1JOGA 5BQHA 2B0JA 4YN0B 4YWQA 4MTGA 3DKAA 3KYJA 2R7VA 1TWGA 4PFPA 1O87A 4OD5A 2F22A 1CGME 4LACB 3B71A 4QI2A 3M1CB 4KNVA 1OXBA 4P9FA 4U5BE 1G8XA 3F47A 4CDVA 4DRHB 4WGZA 3RVZA 4MNDA 4O6NA 4UDVA 2YVKA 4PJJA 4D4NA 1MNDA 3K1IA 1OCZC 3AJMA 3FOOA 3NKDA 2JPUA 4JCHA 3DJNB 1E85A 1HE1A 2VB6A 3IQ5A 3U9JA 1E83A 3HNIA 4Q5SF 4U5DE 2MYSA 2ZXPA 5KYXA 2TMVP 4DXWA 1PCXA 1M57C 2CCYA 4AE4A 2LFDA 1VYIA 2HSQA 3U3FA 4HFKB 2L6HA 4H4KC 5DS4A 3GEHA 1CGNA 3CQZA 2J9WA 1ZHWA 2J9BA 3SXYA 3E9VA 4XEVA 1E2XA 2MHRA 5COFA 3TJ6A 1FR0A 3KPHA 1WASA 2E87A 1W2WA 1K04A 1OXKA 3V5ZA 3LNRA 1Q0MA 4YL0A 3H2VA 2C03A 2EPLX 2DYSC 3UGPA 3N24A 4MVMA 5GPGB 4U5GA 2GWWA 4U9DA 3C7JA 2HUJA 3SEOA 3NRHA 1QQ3A 4FESA 3EZHA 2XM0A 3V5XA 1RCPA 1WN0A 4BJTA 3HNLA 3FMSA 5AC4A 1NZEA 256BA 2BE5F 2J7PD 2LCHA 3H65A 4MVOA 1I4YA 1N1CA 2IXPA 2NUTB 3NYMA 4Z9HA 3NYJA 1APCA 3EG9B 5F5HA 3US6A 4DVYP 4JE9A 1HE9A 1HW1A 1E86A 3NG1A 3T9OA 2LK4A 3QVYA 2L7AA 4E0IA 3W8IA 1E84A 1OR3A 3DE8A 1H9TA 2Y69C 4JVSA 4BJ5A 2Q7RA 2XS1A 4CS8A 1YAUO 1FMVA 3ZQYA 3RYLA 1YYJA 2QY9A 2XLDA 3W2WA 3QTHA 1CGOA 1MNEA 3TOLA 3X2QC 2HJ3A 3AQCA 3QMKA 2P1AA 2NUPA 1GQAA 1O3UA 4JTCB 4XPWA 4C3EA 1LKXA 1OW6A 2HMQA 2LQGA 1ZZPA 3LAYA 3Q7GA 1T01A 4CS7A 2YL1A 1OCOC 2HZ8A 3LUTB 4X0RA 4WGYA 1Q0FA 4BEMJ 2J9UA 4U5EE 1I4ZA 1JRAA 2PX0A 4I3MA 4E0HA 4JKVA 4PK4A 2QE9A 2L9JA 4DJ9A 2YZSA 1NU7D 2IOQA 3EPVA 2HMZA 1LVKA 4O6MA 4JW1A 4QDLA 4XPYA 5L3VA 4BEJA 2IM8A 2GAQA 2I8BA 2W4MA 3BRJA 3LS0A 3JT1A 4G78A 1JPNA 4L6RA 4Z9JA 3ATPA 4JC7A 1VTMP 4WABA 5E2QA 3S0XA 1MMNA 2Z15A 3LLIA 4OINF 1MMAA 5JP7A 4NQFA 1NG1A 3C8ZA 4P9TA 3T6BA 4JJFA 2R7RA 4AX2A 4IAOA 1YLMA 2V26A 3W4YA 4BJ1A 3SZRA 1EKYA 2D5RB 3TQOA 4WJ0A 1RMVA 4C3BA 2IXOA 4LDQA 1NU9C 4A2NB 5DLJA 2JD3A 5E3AA 1ORJA 4ER9A 4LLEA 3HNJA 5K0IA 1Y6DA 1TFOB 1TWCA 4W8KA 3ITFA 1HY5A 2D4UA 1FTSA 1WWPA 2P6VA 1B68A 1YZCA 3I5PA 1Q0DA 1TR2A 1OQCA 1M2VB 2FAPB 3AGUA 1KNYA 4MW3A 1WATA 3FHDA 3G50A 5CIVA 4YJWA 2J45A 4Q4ZF 1ZU5A 4XEFA 3GM3A 1LM3B 5AGFA 3CAXA 1BDJB 1LPEA 4I1OB 1SMYF 3ZC4A 1LE2A 4N6HA 3AG1C 4EWCA 2HSBA 2QLAA 2IXNA 3GANA 5KYWB 1M6TA 2R7OA 3QW1A 3AGTA 3RVYA 1M2OA 3JCUQ 4YL1A 3FAPB 1YVIA 3NMIA 4ULWA 3W8HA 4BG0A 4XLPF 1MQVA 5JT4A 2R03A 5KYNA 2Q9BA 2LFFA 3FDQA 2W9YA 3S9OA 2YLIA 4CDYA 1RJ9B 4I1MA 4FX5A 1M2VA 2J0XA 4JCZA 4M63A 4AE4B 2G3VA 1Z6AA 2Y3DA 3FAJA 2JX0A 1SZIA 2XL4A 3H2UA 4CBEA 2AVKA 3JTLO 4G7OF 4K1OA 4DOZA 2QTVA 4OIPF 2RD9A 2Q3TA 3GORA 4N6CA 2EPMX 3L0IA 2BL2A 4D4XA 3L8JA 1T5OA 3K1IC 1YA9A 2J9VA 1NLXA
chains in the Genus database with same CATH topology
1GS9A 1NFOA 1OR3A 1B68A 1EA8A 1EQ1A 1NFNA 3S84A 1H7IA 1AEPA 1YA9A 1LS4A 1LPEA 1OR2A 1BZ4A 2KC3A 1LE2A 3R2PA 1LE4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GS9 A;  1NFO A;  1OR3 A;  1B68 A;  1EA8 A;  1EQ1 A;  1NFN A;  3S84 A;  1H7I A;  1AEP A;  1YA9 A;  1LS4 A;  1LPE A;  1OR2 A;  1BZ4 A;  2KC3 A;  1LE2 A;  3R2P A;  1LE4 A; 
#chains in the Genus database with same CATH topology
 3L1M A;  2IXM A;  1S05 A;  1ZW2 A;  2LSE A;  4EKW A;  3DWW A;  1C02 A;  3DE9 A;  5KYW A;  3EHN A;  1I5N A;  1RJ9 A;  4U5C E;  1YDI A;  2WL8 A;  2XS8 A;  2NG1 A;  5F28 E;  3JYY A;  5EHH A;  1KTM A;  2P61 A;  3A9C A;  2WVN A;  5CI8 A;  3M15 A;  1ZVZ A;  1A0B A;  3CZ6 A;  1S7Z A;  2R05 A;  1HW2 A;  2L81 A;  3IQ6 A;  1OKK D;  2FFH A;  4LDK A;  4U5F E;  2DGJ A;  3C8G D;  3HNK A;  3DD7 A;  3KH2 A;  3B0V C;  3U2L A;  1QPU A;  1V55 C;  3NMK A;  4MQ9 F;  4E7S A;  5DS5 A;  4J30 B;  2YLG A;  4EBK A;  5JLI A;  2EIM C;  2IBF A;  4U9E A;  2KGO A;  1TWA A;  1M56 C;  5L0J A;  3I5Q A;  1FMW A;  1LI7 A;  4BJ6 A;  1D0Y A;  3S28 A;  3OA1 A;  1ZHT A;  3B9Q A;  3ASO C;  3OWT A;  2CDQ A;  4IAR A;  4N06 A;  1VOM A;  4IB4 A;  2R7W A;  2QNL A;  1LS1 A;  2HFI A;  3LS1 A;  2OU6 A;  5DQT A;  4Z9I A;  5AC5 A;  3GWL A;  2G62 A;  3DJU B;  4K0D A;  4IJJ A;  3GEI A;  4Q7C A;  3SP1 A;  4YK5 A;  5B3I A;  5FCL A;  3RQG A;  1LS4 A;  3KYI A;  5JUA A;  5L0G A;  2EPO A;  4DVZ A;  4JTD B;  3ECS A;  2PBE A;  3O55 A;  4PJM A;  5E3C A;  1QSP A;  2G3K A;  4CS9 C;  1Y4C A;  1JPJ A;  1PD0 A;  3A11 A;  3ZG1 A;  3ABL C;  2ZD9 A;  2XXA A;  3LJB A;  3O39 A;  3GEE A;  3U5S A;  2AU5 A;  4IWB A;  1ZHX A;  5L3Q A;  1KU2 A;  4CDA A;  2M4E A;  4QI0 A;  1V4A A;  1G5Z A;  1R4T A;  1F1M A;  1VB5 A;  3LNM B;  4OD4 A;  1Z63 A;  3SXK A;  2GDC A;  2C04 A;  3MYF A;  2H7V C;  2Y3G A;  2HKV A;  4CSA A;  2A1D D;  2FGY A;  3W2V A;  4MVS A;  2VCB A;  3LLK A;  2HV6 A;  2Q9A A;  2XM4 A;  1XZP A;  2OQM A;  3GM1 A;  2XLW A;  4YT2 A;  3MYI A;  3Q7L A;  5T3T A;  4BPM A;  3UMH A;  1Q0K A;  5A6B A;  1FFH A;  1QZX A;  3JRT A;  3DXJ F;  4W8P A;  2R7S A;  2OG2 A;  2CGE A;  2R7Q A;  1UG7 A;  1K05 A;  2HV7 A;  4HE8 D;  4LER A;  4R32 A;  1ZHZ A;  1MMG A;  3IQT A;  4H54 A;  5T3W A;  3X1O A;  1OKK A;  1FAP B;  1NFN A;  3JSE O;  2XL8 A;  5L0F A;  3HTK C;  4RD9 A;  2KW3 C;  5B1B C;  4O7G A;  4O79 A;  3DM9 B;  1D1A A;  5KYU A;  3WAQ A;  3RQE A;  3EGD B;  4JEB A;  5HV9 A;  2Y3H A;  4G7Z F;  1JAF A;  1CPQ A;  3UMK A;  5JRA A;  2H7B A;  2VAS A;  4GQH A;  3ZSU A;  1A7D A;  3CSK A;  3HKK A;  4G7H F;  2R02 A;  2H8A A;  3K7D A;  2OCC C;  1OW7 A;  1GS9 A;  1D0X A;  5KYU B;  2LIG A;  5BUO A;  5L0C A;  2NPU A;  1V54 C;  1HMO A;  2HJM A;  4JUR I;  4JTA B;  2M64 A;  3UNG C;  2ZXW C;  1XZQ A;  4O6Y A;  3HJC A;  3LEV A;  5L0I A;  1GM5 A;  2UUH A;  2KC3 A;  2KK1 A;  2KNH A;  2QUP A;  3ABK C;  4LDR A;  1QKR A;  2W45 A;  1SF8 A;  1SYQ A;  4NTF A;  3WOD F;  1D1B A;  3NDB B;  3RW0 A;  3L34 A;  2ETS A;  4ZLD A;  4DRI B;  3EQL F;  3RH3 A;  4CJG A;  5COM A;  2WVQ A;  2KSF A;  3B29 A;  5B3S C;  4EBB A;  3PDM P;  1EA8 A;  2J8W A;  2MWQ A;  2A69 F;  4PAC A;  1VLS A;  2DB4 A;  2OEX A;  4RBN A;  4JIO A;  4ULV A;  4ONS A;  5E33 A;  3TOM A;  4K7B A;  2PF4 E;  1A7V A;  3QVZ A;  2XLH A;  4GEH A;  1ST6 A;  2GFH A;  1QVX A;  1BR4 A;  1RKC A;  4J32 B;  2Y3B A;  4MVU A;  1LIH A;  4XQ1 A;  3VRC A;  2J0W A;  4DRJ B;  5L0H A;  2VCC A;  1SR2 A;  4CIH A;  3AG3 C;  4J7T A;  4NTA A;  4E18 A;  1TQG A;  2GA0 A;  2R25 A;  3ZQV A;  2A6H F;  3DI5 A;  2ZPA A;  1OW8 A;  4MVZ A;  3DAG A;  1U6H A;  2OOC A;  2XL6 A;  2XLV A;  3M4C A;  2VCA A;  2KQ9 A;  1BR1 A;  2H7O A;  2ASR A;  3EGX B;  3OEO A;  3QZC A;  5KYX B;  3G4Z A;  3DMD A;  2UUI A;  3T4R A;  2OJQ A;  3KL4 A;  3S84 A;  1VK5 A;  2W4B A;  3S29 A;  3VM6 A;  1WOL A;  1PD1 A;  4BJ6 C;  4DBR A;  4FWV A;  3JSZ A;  1PV3 A;  4KBL A;  2YL3 A;  2HS5 A;  3EG9 A;  4JZA A;  4RDA A;  4ANJ A;  1YA7 O;  3EGX A;  3Q6N A;  2Q00 A;  2B0H A;  4CJO A;  2NUT A;  3K33 A;  1LE4 A;  2KJG A;  2YHS A;  3CEX A;  5EGY A;  4KNW A;  4KC9 A;  1C03 A;  1OCR C;  4PJL A;  2CW0 F;  2ZXO A;  3IEE A;  2XLM A;  4OIR F;  1Z5Z A;  2WZG A;  5T1D B;  3T6J A;  2A0U A;  1J8M F;  1ZHY A;  3ZVR A;  5A69 A;  3UGO A;  3LEO A;  5DS6 A;  1IZM A;  1MMD A;  1YYX A;  1VMA A;  3M4B A;  3GOD A;  4CS8 C;  1RKE B;  4IGG A;  3B0P A;  2EPN A;  2X51 A;  3C8G B;  2YL0 A;  1NFO A;  3ZTZ A;  3S90 A;  2XLO A;  1D1C A;  3C18 A;  2R9R B;  4CS9 A;  2R7T A;  3BEH A;  1AVO B;  3EZI A;  4MS2 A;  4XEK A;  2PNO A;  1L3P A;  4XTK A;  2OKU A;  2EIK C;  3VF0 A;  4XWJ A;  3S27 A;  4OIQ F;  2A0B A;  2J46 A;  3HLZ A;  1Z7Q c;  2BC5 A;  5A6B D;  4LLC A;  2PFD A;  3VAY A;  4U5H A;  3POV A;  3NKE A;  5IY5 C;  1WTY A;  2Q9C A;  1H9G A;  4XPX A;  1ORY A;  1EI7 A;  5DQZ A;  1RKE A;  3WHN A;  5F5F A;  1BZ4 A;  2VC9 A;  4MW8 A;  1JMW A;  3J06 A;  2P7V A;  4AL1 A;  3RKO F;  1G4W R;  3MBG A;  3PMR A;  4EBJ A;  1A41 A;  2NSF A;  3U9M A;  2YEV A;  3ZWI A;  2A68 F;  4YT4 A;  3C8G A;  2WZF A;  1U0B B;  1LI5 A;  1CPR A;  3M79 A;  1A7E A;  4AL0 A;  4F4B A;  4ZLC A;  1YJG A;  1Z23 A;  1ZW3 A;  2XRH A;  4GYT A;  5A6K A;  1YAR O;  1EQ1 A;  2EIL C;  2WB7 A;  4PR9 A;  4EIY A;  1NSG B;  1H6G A;  1AUE A;  5JS5 A;  5KYY A;  2X0C A;  3R7C A;  4CX9 A;  3GWN A;  3TUL A;  2OEV A;  1R5I D;  2PX3 A;  3AG4 C;  4EUK B;  4MTO A;  2XXA B;  5D92 A;  5L0D A;  5A6J A;  2VH3 A;  1OCC C;  2DYR C;  3C62 A;  3RFY A;  1C17 M;  1VYK A;  4OIO F;  2PP4 A;  1V74 B;  3FXH A;  1XWJ A;  3N0T A;  4MTF A;  3V7O A;  4JEA A;  4NC3 A;  3ZTM A;  3LES A;  3PHF 2;  3EH2 A;  1UFB A;  1ORS C;  3G4X A;  4PJN A;  5BQI A;  3EFO A;  2WVO A;  3F46 A;  2EIN C;  3EHM A;  4A4A A;  3AG2 C;  2NUP B;  1T6U A;  1VLT A;  3DZA A;  3O10 A;  4G0H A;  4P6I C;  5EK0 A;  1TKN A;  5JVE A;  2LP4 A;  4CSA C;  4B6I A;  3KMI A;  2LD6 A;  4YL3 A;  1K40 A;  5KYY B;  4IAQ A;  2OJE D;  4C7O A;  1U89 A;  3T6G B;  3U0C A;  1ZYR F;  2XLE A;  4EHP A;  4YT8 A;  3NYL A;  3ABM C;  3PCV A;  1IW7 F;  3JYH A;  1BBH A;  4BJ5 C;  1FNT c;  2O9X A;  4IRU A;  1WGW A;  2CYD A;  3EJN A;  3IPM O;  3MFN A;  5DVW A;  3U8V A;  3SXM A;  5HSW A;  1TWH A;  4CIP A;  3UMI A;  3JRM O;  4HEA J;  2CNW A;  2YRF A;  5TJ5 E;  2V3C C;  2YKZ A;  3ASN C;  4XLN F;  1Q0G A;  1L7C A;  2CNW D;  4I44 A;  3RQF A;  3U3B A;  5BQG A;  2R7X A;  4C3D A;  4DBQ A;  2RSE B;  3AOU A;  1GGQ A;  3AQB A;  4E17 A;  1QLE C;  3EH1 A;  2XSE A;  3FOP A;  4HFF B;  1AEP A;  4JRZ A;  3MLG A;  2DI3 A;  3FVY A;  3RIP A;  4E7Z A;  1DOW A;  3C63 A;  4YT5 A;  5A6A A;  2P0N A;  3K1H A;  4PFO A;  4FAP B;  3O6X A;  1TFK B;  3N2Z B;  3SYN A;  3L8I A;  4C7O B;  3WG7 C;  4N4W A;  3TJ5 A;  2NSG A;  3U2M A;  5FZT A;  3IQC A;  4J7Y A;  3IHU A;  3ZIB A;  1BR2 A;  2ICW G;  2YQY A;  2I15 A;  5B1A C;  5JSL A;  3TD7 A;  2A6E F;  1HMD A;  2R7U A;  1OR2 A;  4NY3 A;  2YLD A;  3R2P A;  1Z3I X;  5COG A;  3GM2 A;  2AWC A;  3QW0 A;  2L6F A;  3K6B A;  1T6I A;  3TK0 A;  1ZU4 A;  2YL7 A;  1FFT C;  1NBB A;  2AP3 A;  2IYL D;  3EGD A;  3V5Y A;  3ZDL A;  4KI2 A;  1JR8 A;  3MX3 A;  4NCQ A;  4JJG A;  2Q4F A;  3RF3 A;  3Q6M A;  1J8Y F;  2Y39 A;  2AWY A;  3EFO B;  1H7I A;  3SNH A;  1D0Z A;  2L6G A;  5CI9 A;  1O5H A;  2ZXR A;  2J7P A;  2YWA A;  3B0U X;  1G4U S;  4NTB A;  3U8P A;  1DOV A;  3UR3 C;  4AK9 A;  2EPK X;  5D91 A;  3KKB A;  1RXQ A;  3E70 C;  4MVR A;  2EIJ C;  2KYH A;  3VYW A;  1T9K A;  4MVQ A;  3SXZ A;  1T6Q A;  3K66 A;  1YZA A;  3JZ0 A;  3DAF A;  3NMJ A;  3I4U A;  3DM5 A;  2WZL A;  1JOG A;  5BQH A;  2B0J A;  4YN0 B;  4YWQ A;  4MTG A;  3DKA A;  3KYJ A;  2R7V A;  1TWG A;  4PFP A;  1O87 A;  4OD5 A;  2F22 A;  1CGM E;  4LAC B;  3B71 A;  4QI2 A;  3M1C B;  4KNV A;  1OXB A;  4P9F A;  4U5B E;  1G8X A;  3F47 A;  4CDV A;  4DRH B;  4WGZ A;  3RVZ A;  4MND A;  4O6N A;  4UDV A;  2YVK A;  4PJJ A;  4D4N A;  1MND A;  3K1I A;  1OCZ C;  3AJM A;  3FOO A;  3NKD A;  2JPU A;  4JCH A;  3DJN B;  1E85 A;  1HE1 A;  2VB6 A;  3IQ5 A;  3U9J A;  1E83 A;  3HNI A;  4Q5S F;  4U5D E;  2MYS A;  2ZXP A;  5KYX A;  2TMV P;  4DXW A;  1PCX A;  1M57 C;  2CCY A;  4AE4 A;  2LFD A;  1VYI A;  2HSQ A;  3U3F A;  4HFK B;  2L6H A;  4H4K C;  5DS4 A;  3GEH A;  1CGN A;  3CQZ A;  2J9W A;  1ZHW A;  2J9B A;  3SXY A;  3E9V A;  4XEV A;  1E2X A;  2MHR A;  5COF A;  3TJ6 A;  1FR0 A;  3KPH A;  1WAS A;  2E87 A;  1W2W A;  1K04 A;  1OXK A;  3V5Z A;  3LNR A;  1Q0M A;  4YL0 A;  3H2V A;  2C03 A;  2EPL X;  2DYS C;  3UGP A;  3N24 A;  4MVM A;  5GPG B;  4U5G A;  2GWW A;  4U9D A;  3C7J A;  2HUJ A;  3SEO A;  3NRH A;  1QQ3 A;  4FES A;  3EZH A;  2XM0 A;  3V5X A;  1RCP A;  1WN0 A;  4BJT A;  3HNL A;  3FMS A;  5AC4 A;  1NZE A;  256B A;  2BE5 F;  2J7P D;  2LCH A;  3H65 A;  4MVO A;  1I4Y A;  1N1C A;  2IXP A;  2NUT B;  3NYM A;  4Z9H A;  3NYJ A;  1APC A;  3EG9 B;  5F5H A;  3US6 A;  4DVY P;  4JE9 A;  1HE9 A;  1HW1 A;  1E86 A;  3NG1 A;  3T9O A;  2LK4 A;  3QVY A;  2L7A A;  4E0I A;  3W8I A;  1E84 A;  1OR3 A;  3DE8 A;  1H9T A;  2Y69 C;  4JVS A;  4BJ5 A;  2Q7R A;  2XS1 A;  4CS8 A;  1YAU O;  1FMV A;  3ZQY A;  3RYL A;  1YYJ A;  2QY9 A;  2XLD A;  3W2W A;  3QTH A;  1CGO A;  1MNE A;  3TOL A;  3X2Q C;  2HJ3 A;  3AQC A;  3QMK A;  2P1A A;  2NUP A;  1GQA A;  1O3U A;  4JTC B;  4XPW A;  4C3E A;  1LKX A;  1OW6 A;  2HMQ A;  2LQG A;  1ZZP A;  3LAY A;  3Q7G A;  1T01 A;  4CS7 A;  2YL1 A;  1OCO C;  2HZ8 A;  3LUT B;  4X0R A;  4WGY A;  1Q0F A;  4BEM J;  2J9U A;  4U5E E;  1I4Z A;  1JRA A;  2PX0 A;  4I3M A;  4E0H A;  4JKV A;  4PK4 A;  2QE9 A;  2L9J A;  4DJ9 A;  2YZS A;  1NU7 D;  2IOQ A;  3EPV A;  2HMZ A;  1LVK A;  4O6M A;  4JW1 A;  4QDL A;  4XPY A;  5L3V A;  4BEJ A;  2IM8 A;  2GAQ A;  2I8B A;  2W4M A;  3BRJ A;  3LS0 A;  3JT1 A;  4G78 A;  1JPN A;  4L6R A;  4Z9J A;  3ATP A;  4JC7 A;  1VTM P;  4WAB A;  5E2Q A;  3S0X A;  1MMN A;  2Z15 A;  3LLI A;  4OIN F;  1MMA A;  5JP7 A;  4NQF A;  1NG1 A;  3C8Z A;  4P9T A;  3T6B A;  4JJF A;  2R7R A;  4AX2 A;  4IAO A;  1YLM A;  2V26 A;  3W4Y A;  4BJ1 A;  3SZR A;  1EKY A;  2D5R B;  3TQO A;  4WJ0 A;  1RMV A;  4C3B A;  2IXO A;  4LDQ A;  1NU9 C;  4A2N B;  5DLJ A;  2JD3 A;  5E3A A;  1ORJ A;  4ER9 A;  4LLE A;  3HNJ A;  5K0I A;  1Y6D A;  1TFO B;  1TWC A;  4W8K A;  3ITF A;  1HY5 A;  2D4U A;  1FTS A;  1WWP A;  2P6V A;  1B68 A;  1YZC A;  3I5P A;  1Q0D A;  1TR2 A;  1OQC A;  1M2V B;  2FAP B;  3AGU A;  1KNY A;  4MW3 A;  1WAT A;  3FHD A;  3G50 A;  5CIV A;  4YJW A;  2J45 A;  4Q4Z F;  1ZU5 A;  4XEF A;  3GM3 A;  1LM3 B;  5AGF A;  3CAX A;  1BDJ B;  1LPE A;  4I1O B;  1SMY F;  3ZC4 A;  1LE2 A;  4N6H A;  3AG1 C;  4EWC A;  2HSB A;  2QLA A;  2IXN A;  3GAN A;  5KYW B;  1M6T A;  2R7O A;  3QW1 A;  3AGT A;  3RVY A;  1M2O A;  3JCU Q;  4YL1 A;  3FAP B;  1YVI A;  3NMI A;  4ULW A;  3W8H A;  4BG0 A;  4XLP F;  1MQV A;  5JT4 A;  2R03 A;  5KYN A;  2Q9B A;  2LFF A;  3FDQ A;  2W9Y A;  3S9O A;  2YLI A;  4CDY A;  1RJ9 B;  4I1M A;  4FX5 A;  1M2V A;  2J0X A;  4JCZ A;  4M63 A;  4AE4 B;  2G3V A;  1Z6A A;  2Y3D A;  3FAJ A;  2JX0 A;  1SZI A;  2XL4 A;  3H2U A;  4CBE A;  2AVK A;  3JTL O;  4G7O F;  4K1O A;  4DOZ A;  2QTV A;  4OIP F;  2RD9 A;  2Q3T A;  3GOR A;  4N6C A;  2EPM X;  3L0I A;  2BL2 A;  4D4X A;  3L8J A;  1T5O A;  3K1I C;  1YA9 A;  2J9V A;  1NLX A; 
#chains in the Genus database with same CATH homology
 1GS9 A;  1NFO A;  1OR3 A;  1B68 A;  1EA8 A;  1EQ1 A;  1NFN A;  3S84 A;  1H7I A;  1AEP A;  1YA9 A;  1LS4 A;  1LPE A;  1OR2 A;  1BZ4 A;  2KC3 A;  1LE2 A;  3R2P A;  1LE4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...