1EQ1A

Nmr structure of an exchangeable apolipoprotein-manduca sexta apolipophorin-iii
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
166
structure length
166
Chain Sequence
DAPAGGNAFEEMEKHAKEFQKTFSEQFNSLVNSKNTQDFNKALKDGSDSVLQQLSAFSSSLQGAISDANGKAKEALEQARQNVEKTAEELRKAHPDVEKEANAFKDKLQAAVQTTVQESQKLAKEVASNMEETNKKLAPKIKQAYDDFVKHAEEVQKKLHEAATKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APOLIPOPHORIN-III
publication title Structural basis for the conformational adaptability of apolipophorin III, a helix-bundle exchangeable apolipoprotein
pubmed doi rcsb
source organism Manduca sexta
molecule tags Lipid binding protein
total genus 46
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2000-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07464 ApoLp-III Apolipophorin-III precursor (apoLp-III)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1eq1A00
1LS4A 1OR3A 1EQ1A 1OR2A 1AEPA 1H7IA 2KC3A 1LPEA 1BZ4A 1NFOA 3S84A 1EA8A 1GS9A 1YA9A 3R2PA 1NFNA 1B68A 1LE4A 1LE2A
chains in the Genus database with same CATH superfamily
1NBBA 4BJ6A 1RCPA 2CYDA 3UMHA 4YL0A 2OEVA 3JTLO 3U5SA 4IAOA 2H7BA 3C62A 5E2QA 1ZYRF 2V3CC 1S7ZA 3U0CA 2G3VA 3JRMO 4PACA 1MMDA 1QLEC 2YVKA 3DJUB 4J32B 2YHSA 3FAPB 1BR2A 3EHNA 4BJ6C 1BZ4A 3KYJA 1V54C 4YT8A 2Y3GA 1F1MA 2L6GA 4JTAB 3WAQA 4MVUA 3ZQYA 4A2NB 4G7ZF 1ZZPA 4XEKA 3SP1A 3U8PA 3R2PA 3A9CA 2BE5F 2CNWD 1LVKA 4AL0A 4NTAA 2A1DD 3K7DA 4A4AA 2NSFA 3LNRA 2LFDA 5JLIA 1OKKD 1VLSA 3NG1A 1FNTc 1RKEA 1M2VB 2LSEA 3M1CB 1E85A 2YLDA 1ORYA 3BRJA 1DOWA 4XPXA 4WGZA 1EQ1A 1LIHA 2PP4A 3T6JA 1WASA 4KNWA 1JOGA 1FTSA 3C7JA 4MTGA 2XSEA 4CX9A 5AC5A 1H9GA 1LM3B 4MTOA 3X2QC 2J7PD 1T01A 2PF4E 1YVIA 1G4US 2EPOA 4DRJB 2OEXA 4ULVA 1PCXA 3WHNA 2GAQA 1BDJB 1NZEA 1BBHA 2DYRC 1EA8A 2ICWG 2YL7A 2VCCA 2R7RA 2G62A 3MX3A 1CGNA 3HKKA 2KSFA 3HNKA 3HNLA 3W2WA 3WODF 4ANJA 5AC4A 3PHF2 3S84A 1LE2A 4ER9A 2NPUA 5FCLA 3EJNA 3EGDB 4N4WA 5COFA 1YLMA 4YK5A 5KYUB 4YT5A 3GM2A 2H8AA 1E2XA 1OW7A 1OR3A 2HZ8A 2R7UA 5IY5C 1ZW3A 4Z9IA 4DOZA 3X1OA 4FAPB 4CIPA 1Z6AA 3TD7A 3WG7C 3U9MA 1VLTA 5FZTA 4DRHB 3C8ZA 3JYYA 5JUAA 2P7VA 2YWAA 3GODA 3QW1A 5L0GA 4Q4ZF 3CSKA 4W8PA 1H6GA 3KYIA 4BJTA 1OCOC 5EGYA 1TWCA 4OD4A 2YRFA 4JEBA 4N6HA 4PJLA 1L3PA 2HV6A 1FR0A 2M64A 4MVOA 3UMIA 2VCBA 1TWAA 2Q7RA 1R5ID 1SR2A 2A6HF 1RXQA 5KYYB 1HY5A 2ETSA 3B0VC 1I4ZA 3L8JA 3NRHA 4NY3A 3S29A 3DKAA 3DXJF 1OQCA 1YA7O 2R7OA 1WATA 3ITFA 3OWTA 5B3IA 3ZDLA 2M4EA 4KI2A 3QTHA 2A0UA 1Z3IX 4JC7A 3ZTMA 2Y3BA 4O6MA 4XLNF 4AK9A 1U89A 2CCYA 1LI5A 2XLEA 3GANA 3C8GA 3EGXB 3G50A 3T9OA 4G7HF 4RD9A 1HMDA 1K40A 1OR2A 4QI2A 4PFPA 3K1IA 2BC5A 5BQGA 2OKUA 5EHHA 3U3BA 3O39A 2EIKC 3I5PA 4XWJA 1OCRC 1Q0KA 2IXOA 2OQMA 2LP4A 2OJED 5E3AA 3SXYA 2W4BA 3DE9A 3PCVA 1OW8A 4J7YA 1GS9A 1G5ZA 4C7OB 1NLXA 3GM3A 2R7VA 1PD0A 3EFOB 3C18A 1RMVA 3L0IA 4MVQA 3RYLA 3SNHA 5B1BC 2EINC 4WJ0A 2NSGA 1S05A 3K1IC 4JTDB 4P9TA 2A69F 2AWCA 2HJ3A 3N24A 4JEAA 4OD5A 2GWWA 1CPRA 1VB5A 2J0WA 1YDIA 3QZCA 2WB7A 3JSEO 2LFFA 4U5GA 1GQAA 1JPNA 5TJ5E 3LJBA 3NKEA 2X51A 4U5HA 4IAQA 2OU6A 5JRAA 3N2ZB 1D0XA 3GORA 5B1AC 4JIOA 2HMZA 1Y6DA 1OCZC 2KYHA 3HNJA 3LNMB 3SXMA 4O6YA 2DB4A 3R7CA 2MHRA 4JKVA 4UDVA 3UNGC 4ULWA 4KBLA 1YA9A 2C03A 1VYKA 2FFHA 3C8GD 1Y4CA 3EG9A 4JURI 5GPGB 3VYWA 5L0IA 5L0JA 1EKYA 4U5BE 3LUTB 1WTYA 5A69A 4O79A 4EHPA 1SYQA 3U2MA 3UGPA 3TK0A 4BG0A 3NDBB 4LERA 2OOCA 5T3WA 1FAPB 4CBEA 3VM6A 1O5HA 4G0HA 5L0CA 1CPQA 5CI8A 3AGUA 1WGWA 3TQOA 4JVSA 1C17M 1MNEA 2XM4A 4NQFA 4L6RA 3L1MA 3DI5A 3MLGA 5DS6A 2AU5A 3MYFA 3U9JA 2B0HA 3I4UA 3J06A 1TFOB 3JCUQ 2P6VA 3L34A 3NKDA 5BQIA 1PV3A 2D4UA 4NC3A 4HFFB 2YQYA 3KL4A 2J9VA 4GQHA 5KYWB 1J8YF 1YARO 4H54A 4AL1A 1A7VA 1RJ9A 3M79A 2DGJA 3TJ5A 3EPVA 4CS9A 2L81A 3UMKA 2YKZA 2FGYA 3FOPA 3LS0A 5D91A 3ZVRA 1GM5A 5KYXA 3QVZA 2WZLA 4U5DE 2XLVA 3NMIA 1Z23A 2C04A 3W2VA 2YEVA 2R9RB 1MNDA 3W8IA 1G4WR 3QVYA 1C02A 2OCCC 4EBJA 1M6TA 2W4MA 3K6BA 2LD6A 2UUHA 4LACB 2WZFA 5E3CA 5KYNA 4XEVA 1TKNA 2J9UA 2WZGA 3SZRA 3DD7A 2L7AA 2ZPAA 4CS9C 1TR2A 2NG1A 1I5NA 1JRAA 2KJGA 2I8BA 4MVZA 4CJOA 4F4BA 2XLMA 1ZHXA 1BR4A 3B9QA 4LDQA 3SEOA 2VASA 2XLWA 4XPWA 4BJ5A 5DVWA 2JPUA 1HE1A 1K05A 1NFNA 2Q00A 1B68A 2J45A 2VCAA 3N0TA 4Z9JA 4O7GA 1TFKB 2EPLX 2GFHA 3GM1A 4HE8D 2R03A 1RKEB 2XLOA 3AOUA 4YN0B 1UG7A 1ZHZA 2F22A 4KNVA 2EIMC 3U8VA 4D4XA 4BEMJ 1FFTC 2PX3A 2XL8A 2VH3A 3JYHA 4MVSA 1LI7A 3TOLA 1R4TA 3FAJA 2RD9A 1KNYA 3HJCA 4U5FE 3ATPA 3MFNA 2LK4A 2H7VC 4BJ5C 3RKOF 3UGOA 4NCQA 4ZLDA 4FWVA 2EILC 2R02A 4E0HA 1FMWA 3LLKA 3ASNC 1T5OA 1MMAA 2KC3A 4IWBA 2XXAA 5CIVA 4AE4A 2VB6A 1NFOA 3IQ6A 3L8IA 1D1BA 3O10A 3SXKA 5L3VA 1OCCC 4PK4A 2A0BA 2CW0F 3IQTA 2QTVA 4MVRA 1I4YA 2XRHA 3AG4C 2PNOA 1QVXA 2E87A 3ABKC 3RIPA 1SMYF 3CAXA 4WABA 4CSAA 3S28A 1LE4A 4YT2A 4LDKA 1TWHA 1HW1A 3RQGA 1FMVA 4IJJA 5A6JA 3GWLA 4DXWA 4EUKB 4NTFA 4I1OB 5DS5A 2QNLA 1T9KA 3VF0A 2HSQA 5L0DA 3Q6NA 1OW6A 4EKWA 1ZHTA 4K0DA 1APCA 1V74B 2EIJC 1MQVA 1YYXA 2NUPA 3RVZA 4OIOF 3NYMA 2J9BA 1W2WA 3S90A 1ZU5A 3S27A 4CSAC 5A6BA 1A0BA 3EH1A 3EQLF 3TOMA 2ZXOA 3LESA 3DAFA 4U5EE 1JR8A 3NYJA 4XQ1A 4BJ1A 3DAGA 3DE8A 2AP3A 3F47A 2Q9BA 2D5RB 5DQTA 2HV7A 5JT4A 3RQEA 2YL1A 3Q7LA 4JTCB 2HJMA 2EPKX 2V26A 4C3BA 3CQZA 3IPMO 3TULA 3ZQVA 4E17A 3B0PA 3HTKC 4OIRF 4X0RA 1VYIA 3O6XA 2HS5A 2A68F 3H65A 4O6NA 4RDAA 4IRUA 3C8GB 4QDLA 3RW0A 1SZIA 4Q7CA 2H7OA 4IARA 4MNDA 1G8XA 5L0FA 2DI3A 3G4ZA 1HMOA 5COGA 1YAUO 2NUTA 1XZQA 2YZSA 1D0YA 4RBNA 3LAYA 4DRIB 2MWQA 5JVEA 4W8KA 1JMWA 3ZIBA 1WN0A 3IQ5A 2Q9AA 4I44A 1UFBA 4IGGA 5JS5A 2G3KA 3UR3C 1QQ3A 256BA 3O55A 1M56C 4GYTA 4DJ9A 4NTBA 4K1OA 1N1CA 3FHDA 5AGFA 3AG1C 3T4RA 4ONSA 5A6BD 2ZXWC 3B0UX 4DBRA 4JZAA 2O9XA 1U0BB 3FXHA 2YLIA 3S9OA 1QPUA 2R05A 2P0NA 2PFDA 1OXKA 2P61A 2OJQA 2W45A 3LS1A 4YL3A 5DLJA 4C3DA 2A6EF 1JAFA 1D1AA 1DOVA 2WVQA 2ASRA 5DQZA 2KW3C 4KC9A 3QMKA 2CGEA 1OKKA 1L7CA 3AG2C 3LEOA 1PD1A 2XLDA 4MQ9F 2VC9A 3QW0A 4XPYA 3T6GB 3T6BA 1E83A 1NU7D 3A11A 3PDMP 3W8HA 2WVNA 4J7TA 2KK1A 2J0XA 2QE9A 1BR1A 3GEHA 3EG9B 3JT1A 1C03A 1K04A 1O87A 4P9FA 2R7SA 3KPHA 5DS4A 2R7WA 2J7PA 3BEHA 3K33A 5T1DB 4C3EA 2Y69C 3NMKA 1LS4A 2QLAA 1GGQA 5D92A 1H9TA 1VK5A 2OG2A 5BUOA 2R7QA 4FESA 5L0HA 1M2VA 4IB4A 3EZHA 4YWQA 3DJNB 2J9WA 4MW8A 3TJ6A 3US6A 4BEJA 4BPMA 5B3SC 1KU2A 3HNIA 2QUPA 3OA1A 4HFKB 2R7XA 2ZXPA 3M15A 2CDQA 2XS8A 1HW2A 1ZHYA 2WVOA 4JRZA 3LEVA 1ZU4A 2Q9CA 1E84A 4CDVA 1IW7F 1A7EA 2FAPB 2I15A 3DM5A 3GEEA 3ZC4A 4DBQA 1ZW2A 1VTMP 2Z15A 3RQFA 2PBEA 2Q3TA 1RJ9B 4YT4A 3SXZA 1T6IA 1T6UA 3AQCA 5JSLA 4FX5A 2HFIA 2IXPA 3JRTA 1D0ZA 5KYXB 1TQGA 3IQCA 3EGDA 2JD3A 4U5CE 4MVMA 3ZSUA 4XTKA 3V7OA 3CEXA 1ORSC 5KYUA 2L9JA 3FMSA 3W4YA 4EIYA 4U9DA 1VOMA 2KGOA 3E9VA 4OINF 4CS7A 5F28E 2AVKA 3DWWA 3FOOA 4ZLCA 2XS1A 1O3UA 3JZ0A 4I3MA 2HKVA 4I1MA 4JCZA 1V4AA 3V5YA 1AEPA 2EPNA 1YYJA 2J8WA 3MBGA 4P6IC 2HSBA 2Y3DA 3GWNA 4DVZA 4R32A 2IXMA 4PFOA 5A6KA 2AWYA 2KNHA 5EK0A 4JJGA 3KH2A 1WWPA 1EI7A 2YL3A 3GEIA 3PMRA 2DYSC 2W9YA 5T3TA 1A41A 2IM8A 2YLGA 2ZXRA 1Z7Qc 3RVYA 5KYYA 3IEEA 4PJJA 1U6HA 1YJGA 4CJGA 2TMVP 2XL4A 5BQHA 1Q0FA 2R25A 1ZVZA 1Z5ZA 4E7SA 1RKCA 1SF8A 2KQ9A 2LCHA 3NMJA 2XL6A 4PR9A 4E0IA 3M4CA 1A7DA 2QY9A 3V5ZA 4DVYP 1Q0DA 3ZG1A 3EGXA 4G78A 1CGOA 2MYSA 4N06A 4AX2A 3S0XA 2IYLD 2GA0A 3IHUA 3CZ6A 2XXAB 1NSGB 3JSZA 2IOQA 3KMIA 4PJMA 4AE4B 4CS8A 1KTMA 3VRCA 4J30B 3ASOC 4N6CA 2IXNA 2YL0A 1OXBA 3KKBA 4M63A 4E7ZA 4OIQF 4Q5SF 2Y39A 3ZWIA 3C63A 3LLIA 2P1AA 3H2UA 5K0IA 4JE9A 3RH3A 4EBKA 3F46A 3I5QA 4PJNA 3HLZA 4C7OA 1HE9A 3AJMA 3FVYA 3EFOA 2HMQA 3DM9B 2LIGA 1AVOB 3ECSA 2WL8A 2EPMX 1D1CA 4QI0A 1M2OA 4B6IA 3EZIA 4CS8C 1ST6A 1MMGA 4MS2A 5CI9A 4D4NA 4CDYA 3SYNA 5A6AA 1IZMA 2L6HA 4EBBA 1QZXA 1V55C 1Q0GA 4G7OF 1T6QA 2NUPB 1ZHWA 4CDAA 4HEAJ 1ORJA 3B71A 5F5HA 1Z63A 1M57C 1XZPA 3AG3C 4K7BA 2XM0A 3AQBA 4Z9HA 2ZD9A 2BL2A 1H7IA 4WGYA 4H4KC 1LPEA 2Y3HA 1MMNA 2B0JA 3MYIA 1E86A 2XLHA 1NG1A 3B29A 3U2LA 1QKRA 5COMA 3V5XA 1FFHA 1YZAA 4E18A 3Q6MA 3ABLC 1CGME 4JW1A 4LLEA 3E70C 3RFYA 4MW3A 1QSPA 2GDCA 1XWJA 5HV9A 4XEFA 4YJWA 4CIHA 2R7TA 4XLPF 4U9EA 3ZTZA 3EH2A 4YL1A 2X0CA 3VAYA 4LLCA 1LS1A 1YZCA 1TWGA 1LKXA 1JPJA 4JJFA 2J46A 1AUEA 3DZAA 5JP7A 3EHMA 5HSWA 3POVA 2CNWA 2NUTB 2Q4FA 2RSEB 3Q7GA 3U3FA 3FDQA 3G4XA 3H2VA 2LQGA 3NYLA 2IBFA 1WOLA 5L3QA 2PX0A 3DMDA 1VMAA 3K66A 3ABMC 4OIPF 1Q0MA 3AGTA 3OEOA 3M4BA 4JCHA 4LDRA 4MTFA 1J8MF 2HUJA 3RF3A 4EWCA 5KYWA 5E33A 1NU9C 2JX0A 5F5FA 2L6FA 3K1HA 2UUIA 4GEHA
chains in the Genus database with same CATH topology
1LS4A 1OR3A 1EQ1A 1OR2A 1AEPA 1H7IA 2KC3A 1LPEA 1BZ4A 1NFOA 3S84A 1EA8A 1GS9A 1YA9A 3R2PA 1NFNA 1B68A 1LE4A 1LE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LS4 A;  1OR3 A;  1EQ1 A;  1OR2 A;  1AEP A;  1H7I A;  2KC3 A;  1LPE A;  1BZ4 A;  1NFO A;  3S84 A;  1EA8 A;  1GS9 A;  1YA9 A;  3R2P A;  1NFN A;  1B68 A;  1LE4 A;  1LE2 A; 
#chains in the Genus database with same CATH topology
 1NBB A;  4BJ6 A;  1RCP A;  2CYD A;  3UMH A;  4YL0 A;  2OEV A;  3JTL O;  3U5S A;  4IAO A;  2H7B A;  3C62 A;  5E2Q A;  1ZYR F;  2V3C C;  1S7Z A;  3U0C A;  2G3V A;  3JRM O;  4PAC A;  1MMD A;  1QLE C;  2YVK A;  3DJU B;  4J32 B;  2YHS A;  3FAP B;  1BR2 A;  3EHN A;  4BJ6 C;  1BZ4 A;  3KYJ A;  1V54 C;  4YT8 A;  2Y3G A;  1F1M A;  2L6G A;  4JTA B;  3WAQ A;  4MVU A;  3ZQY A;  4A2N B;  4G7Z F;  1ZZP A;  4XEK A;  3SP1 A;  3U8P A;  3R2P A;  3A9C A;  2BE5 F;  2CNW D;  1LVK A;  4AL0 A;  4NTA A;  2A1D D;  3K7D A;  4A4A A;  2NSF A;  3LNR A;  2LFD A;  5JLI A;  1OKK D;  1VLS A;  3NG1 A;  1FNT c;  1RKE A;  1M2V B;  2LSE A;  3M1C B;  1E85 A;  2YLD A;  1ORY A;  3BRJ A;  1DOW A;  4XPX A;  4WGZ A;  1EQ1 A;  1LIH A;  2PP4 A;  3T6J A;  1WAS A;  4KNW A;  1JOG A;  1FTS A;  3C7J A;  4MTG A;  2XSE A;  4CX9 A;  5AC5 A;  1H9G A;  1LM3 B;  4MTO A;  3X2Q C;  2J7P D;  1T01 A;  2PF4 E;  1YVI A;  1G4U S;  2EPO A;  4DRJ B;  2OEX A;  4ULV A;  1PCX A;  3WHN A;  2GAQ A;  1BDJ B;  1NZE A;  1BBH A;  2DYR C;  1EA8 A;  2ICW G;  2YL7 A;  2VCC A;  2R7R A;  2G62 A;  3MX3 A;  1CGN A;  3HKK A;  2KSF A;  3HNK A;  3HNL A;  3W2W A;  3WOD F;  4ANJ A;  5AC4 A;  3PHF 2;  3S84 A;  1LE2 A;  4ER9 A;  2NPU A;  5FCL A;  3EJN A;  3EGD B;  4N4W A;  5COF A;  1YLM A;  4YK5 A;  5KYU B;  4YT5 A;  3GM2 A;  2H8A A;  1E2X A;  1OW7 A;  1OR3 A;  2HZ8 A;  2R7U A;  5IY5 C;  1ZW3 A;  4Z9I A;  4DOZ A;  3X1O A;  4FAP B;  4CIP A;  1Z6A A;  3TD7 A;  3WG7 C;  3U9M A;  1VLT A;  5FZT A;  4DRH B;  3C8Z A;  3JYY A;  5JUA A;  2P7V A;  2YWA A;  3GOD A;  3QW1 A;  5L0G A;  4Q4Z F;  3CSK A;  4W8P A;  1H6G A;  3KYI A;  4BJT A;  1OCO C;  5EGY A;  1TWC A;  4OD4 A;  2YRF A;  4JEB A;  4N6H A;  4PJL A;  1L3P A;  2HV6 A;  1FR0 A;  2M64 A;  4MVO A;  3UMI A;  2VCB A;  1TWA A;  2Q7R A;  1R5I D;  1SR2 A;  2A6H F;  1RXQ A;  5KYY B;  1HY5 A;  2ETS A;  3B0V C;  1I4Z A;  3L8J A;  3NRH A;  4NY3 A;  3S29 A;  3DKA A;  3DXJ F;  1OQC A;  1YA7 O;  2R7O A;  1WAT A;  3ITF A;  3OWT A;  5B3I A;  3ZDL A;  2M4E A;  4KI2 A;  3QTH A;  2A0U A;  1Z3I X;  4JC7 A;  3ZTM A;  2Y3B A;  4O6M A;  4XLN F;  4AK9 A;  1U89 A;  2CCY A;  1LI5 A;  2XLE A;  3GAN A;  3C8G A;  3EGX B;  3G50 A;  3T9O A;  4G7H F;  4RD9 A;  1HMD A;  1K40 A;  1OR2 A;  4QI2 A;  4PFP A;  3K1I A;  2BC5 A;  5BQG A;  2OKU A;  5EHH A;  3U3B A;  3O39 A;  2EIK C;  3I5P A;  4XWJ A;  1OCR C;  1Q0K A;  2IXO A;  2OQM A;  2LP4 A;  2OJE D;  5E3A A;  3SXY A;  2W4B A;  3DE9 A;  3PCV A;  1OW8 A;  4J7Y A;  1GS9 A;  1G5Z A;  4C7O B;  1NLX A;  3GM3 A;  2R7V A;  1PD0 A;  3EFO B;  3C18 A;  1RMV A;  3L0I A;  4MVQ A;  3RYL A;  3SNH A;  5B1B C;  2EIN C;  4WJ0 A;  2NSG A;  1S05 A;  3K1I C;  4JTD B;  4P9T A;  2A69 F;  2AWC A;  2HJ3 A;  3N24 A;  4JEA A;  4OD5 A;  2GWW A;  1CPR A;  1VB5 A;  2J0W A;  1YDI A;  3QZC A;  2WB7 A;  3JSE O;  2LFF A;  4U5G A;  1GQA A;  1JPN A;  5TJ5 E;  3LJB A;  3NKE A;  2X51 A;  4U5H A;  4IAQ A;  2OU6 A;  5JRA A;  3N2Z B;  1D0X A;  3GOR A;  5B1A C;  4JIO A;  2HMZ A;  1Y6D A;  1OCZ C;  2KYH A;  3HNJ A;  3LNM B;  3SXM A;  4O6Y A;  2DB4 A;  3R7C A;  2MHR A;  4JKV A;  4UDV A;  3UNG C;  4ULW A;  4KBL A;  1YA9 A;  2C03 A;  1VYK A;  2FFH A;  3C8G D;  1Y4C A;  3EG9 A;  4JUR I;  5GPG B;  3VYW A;  5L0I A;  5L0J A;  1EKY A;  4U5B E;  3LUT B;  1WTY A;  5A69 A;  4O79 A;  4EHP A;  1SYQ A;  3U2M A;  3UGP A;  3TK0 A;  4BG0 A;  3NDB B;  4LER A;  2OOC A;  5T3W A;  1FAP B;  4CBE A;  3VM6 A;  1O5H A;  4G0H A;  5L0C A;  1CPQ A;  5CI8 A;  3AGU A;  1WGW A;  3TQO A;  4JVS A;  1C17 M;  1MNE A;  2XM4 A;  4NQF A;  4L6R A;  3L1M A;  3DI5 A;  3MLG A;  5DS6 A;  2AU5 A;  3MYF A;  3U9J A;  2B0H A;  3I4U A;  3J06 A;  1TFO B;  3JCU Q;  2P6V A;  3L34 A;  3NKD A;  5BQI A;  1PV3 A;  2D4U A;  4NC3 A;  4HFF B;  2YQY A;  3KL4 A;  2J9V A;  4GQH A;  5KYW B;  1J8Y F;  1YAR O;  4H54 A;  4AL1 A;  1A7V A;  1RJ9 A;  3M79 A;  2DGJ A;  3TJ5 A;  3EPV A;  4CS9 A;  2L81 A;  3UMK A;  2YKZ A;  2FGY A;  3FOP A;  3LS0 A;  5D91 A;  3ZVR A;  1GM5 A;  5KYX A;  3QVZ A;  2WZL A;  4U5D E;  2XLV A;  3NMI A;  1Z23 A;  2C04 A;  3W2V A;  2YEV A;  2R9R B;  1MND A;  3W8I A;  1G4W R;  3QVY A;  1C02 A;  2OCC C;  4EBJ A;  1M6T A;  2W4M A;  3K6B A;  2LD6 A;  2UUH A;  4LAC B;  2WZF A;  5E3C A;  5KYN A;  4XEV A;  1TKN A;  2J9U A;  2WZG A;  3SZR A;  3DD7 A;  2L7A A;  2ZPA A;  4CS9 C;  1TR2 A;  2NG1 A;  1I5N A;  1JRA A;  2KJG A;  2I8B A;  4MVZ A;  4CJO A;  4F4B A;  2XLM A;  1ZHX A;  1BR4 A;  3B9Q A;  4LDQ A;  3SEO A;  2VAS A;  2XLW A;  4XPW A;  4BJ5 A;  5DVW A;  2JPU A;  1HE1 A;  1K05 A;  1NFN A;  2Q00 A;  1B68 A;  2J45 A;  2VCA A;  3N0T A;  4Z9J A;  4O7G A;  1TFK B;  2EPL X;  2GFH A;  3GM1 A;  4HE8 D;  2R03 A;  1RKE B;  2XLO A;  3AOU A;  4YN0 B;  1UG7 A;  1ZHZ A;  2F22 A;  4KNV A;  2EIM C;  3U8V A;  4D4X A;  4BEM J;  1FFT C;  2PX3 A;  2XL8 A;  2VH3 A;  3JYH A;  4MVS A;  1LI7 A;  3TOL A;  1R4T A;  3FAJ A;  2RD9 A;  1KNY A;  3HJC A;  4U5F E;  3ATP A;  3MFN A;  2LK4 A;  2H7V C;  4BJ5 C;  3RKO F;  3UGO A;  4NCQ A;  4ZLD A;  4FWV A;  2EIL C;  2R02 A;  4E0H A;  1FMW A;  3LLK A;  3ASN C;  1T5O A;  1MMA A;  2KC3 A;  4IWB A;  2XXA A;  5CIV A;  4AE4 A;  2VB6 A;  1NFO A;  3IQ6 A;  3L8I A;  1D1B A;  3O10 A;  3SXK A;  5L3V A;  1OCC C;  4PK4 A;  2A0B A;  2CW0 F;  3IQT A;  2QTV A;  4MVR A;  1I4Y A;  2XRH A;  3AG4 C;  2PNO A;  1QVX A;  2E87 A;  3ABK C;  3RIP A;  1SMY F;  3CAX A;  4WAB A;  4CSA A;  3S28 A;  1LE4 A;  4YT2 A;  4LDK A;  1TWH A;  1HW1 A;  3RQG A;  1FMV A;  4IJJ A;  5A6J A;  3GWL A;  4DXW A;  4EUK B;  4NTF A;  4I1O B;  5DS5 A;  2QNL A;  1T9K A;  3VF0 A;  2HSQ A;  5L0D A;  3Q6N A;  1OW6 A;  4EKW A;  1ZHT A;  4K0D A;  1APC A;  1V74 B;  2EIJ C;  1MQV A;  1YYX A;  2NUP A;  3RVZ A;  4OIO F;  3NYM A;  2J9B A;  1W2W A;  3S90 A;  1ZU5 A;  3S27 A;  4CSA C;  5A6B A;  1A0B A;  3EH1 A;  3EQL F;  3TOM A;  2ZXO A;  3LES A;  3DAF A;  4U5E E;  1JR8 A;  3NYJ A;  4XQ1 A;  4BJ1 A;  3DAG A;  3DE8 A;  2AP3 A;  3F47 A;  2Q9B A;  2D5R B;  5DQT A;  2HV7 A;  5JT4 A;  3RQE A;  2YL1 A;  3Q7L A;  4JTC B;  2HJM A;  2EPK X;  2V26 A;  4C3B A;  3CQZ A;  3IPM O;  3TUL A;  3ZQV A;  4E17 A;  3B0P A;  3HTK C;  4OIR F;  4X0R A;  1VYI A;  3O6X A;  2HS5 A;  2A68 F;  3H65 A;  4O6N A;  4RDA A;  4IRU A;  3C8G B;  4QDL A;  3RW0 A;  1SZI A;  4Q7C A;  2H7O A;  4IAR A;  4MND A;  1G8X A;  5L0F A;  2DI3 A;  3G4Z A;  1HMO A;  5COG A;  1YAU O;  2NUT A;  1XZQ A;  2YZS A;  1D0Y A;  4RBN A;  3LAY A;  4DRI B;  2MWQ A;  5JVE A;  4W8K A;  1JMW A;  3ZIB A;  1WN0 A;  3IQ5 A;  2Q9A A;  4I44 A;  1UFB A;  4IGG A;  5JS5 A;  2G3K A;  3UR3 C;  1QQ3 A;  256B A;  3O55 A;  1M56 C;  4GYT A;  4DJ9 A;  4NTB A;  4K1O A;  1N1C A;  3FHD A;  5AGF A;  3AG1 C;  3T4R A;  4ONS A;  5A6B D;  2ZXW C;  3B0U X;  4DBR A;  4JZA A;  2O9X A;  1U0B B;  3FXH A;  2YLI A;  3S9O A;  1QPU A;  2R05 A;  2P0N A;  2PFD A;  1OXK A;  2P61 A;  2OJQ A;  2W45 A;  3LS1 A;  4YL3 A;  5DLJ A;  4C3D A;  2A6E F;  1JAF A;  1D1A A;  1DOV A;  2WVQ A;  2ASR A;  5DQZ A;  2KW3 C;  4KC9 A;  3QMK A;  2CGE A;  1OKK A;  1L7C A;  3AG2 C;  3LEO A;  1PD1 A;  2XLD A;  4MQ9 F;  2VC9 A;  3QW0 A;  4XPY A;  3T6G B;  3T6B A;  1E83 A;  1NU7 D;  3A11 A;  3PDM P;  3W8H A;  2WVN A;  4J7T A;  2KK1 A;  2J0X A;  2QE9 A;  1BR1 A;  3GEH A;  3EG9 B;  3JT1 A;  1C03 A;  1K04 A;  1O87 A;  4P9F A;  2R7S A;  3KPH A;  5DS4 A;  2R7W A;  2J7P A;  3BEH A;  3K33 A;  5T1D B;  4C3E A;  2Y69 C;  3NMK A;  1LS4 A;  2QLA A;  1GGQ A;  5D92 A;  1H9T A;  1VK5 A;  2OG2 A;  5BUO A;  2R7Q A;  4FES A;  5L0H A;  1M2V A;  4IB4 A;  3EZH A;  4YWQ A;  3DJN B;  2J9W A;  4MW8 A;  3TJ6 A;  3US6 A;  4BEJ A;  4BPM A;  5B3S C;  1KU2 A;  3HNI A;  2QUP A;  3OA1 A;  4HFK B;  2R7X A;  2ZXP A;  3M15 A;  2CDQ A;  2XS8 A;  1HW2 A;  1ZHY A;  2WVO A;  4JRZ A;  3LEV A;  1ZU4 A;  2Q9C A;  1E84 A;  4CDV A;  1IW7 F;  1A7E A;  2FAP B;  2I15 A;  3DM5 A;  3GEE A;  3ZC4 A;  4DBQ A;  1ZW2 A;  1VTM P;  2Z15 A;  3RQF A;  2PBE A;  2Q3T A;  1RJ9 B;  4YT4 A;  3SXZ A;  1T6I A;  1T6U A;  3AQC A;  5JSL A;  4FX5 A;  2HFI A;  2IXP A;  3JRT A;  1D0Z A;  5KYX B;  1TQG A;  3IQC A;  3EGD A;  2JD3 A;  4U5C E;  4MVM A;  3ZSU A;  4XTK A;  3V7O A;  3CEX A;  1ORS C;  5KYU A;  2L9J A;  3FMS A;  3W4Y A;  4EIY A;  4U9D A;  1VOM A;  2KGO A;  3E9V A;  4OIN F;  4CS7 A;  5F28 E;  2AVK A;  3DWW A;  3FOO A;  4ZLC A;  2XS1 A;  1O3U A;  3JZ0 A;  4I3M A;  2HKV A;  4I1M A;  4JCZ A;  1V4A A;  3V5Y A;  1AEP A;  2EPN A;  1YYJ A;  2J8W A;  3MBG A;  4P6I C;  2HSB A;  2Y3D A;  3GWN A;  4DVZ A;  4R32 A;  2IXM A;  4PFO A;  5A6K A;  2AWY A;  2KNH A;  5EK0 A;  4JJG A;  3KH2 A;  1WWP A;  1EI7 A;  2YL3 A;  3GEI A;  3PMR A;  2DYS C;  2W9Y A;  5T3T A;  1A41 A;  2IM8 A;  2YLG A;  2ZXR A;  1Z7Q c;  3RVY A;  5KYY A;  3IEE A;  4PJJ A;  1U6H A;  1YJG A;  4CJG A;  2TMV P;  2XL4 A;  5BQH A;  1Q0F A;  2R25 A;  1ZVZ A;  1Z5Z A;  4E7S A;  1RKC A;  1SF8 A;  2KQ9 A;  2LCH A;  3NMJ A;  2XL6 A;  4PR9 A;  4E0I A;  3M4C A;  1A7D A;  2QY9 A;  3V5Z A;  4DVY P;  1Q0D A;  3ZG1 A;  3EGX A;  4G78 A;  1CGO A;  2MYS A;  4N06 A;  4AX2 A;  3S0X A;  2IYL D;  2GA0 A;  3IHU A;  3CZ6 A;  2XXA B;  1NSG B;  3JSZ A;  2IOQ A;  3KMI A;  4PJM A;  4AE4 B;  4CS8 A;  1KTM A;  3VRC A;  4J30 B;  3ASO C;  4N6C A;  2IXN A;  2YL0 A;  1OXB A;  3KKB A;  4M63 A;  4E7Z A;  4OIQ F;  4Q5S F;  2Y39 A;  3ZWI A;  3C63 A;  3LLI A;  2P1A A;  3H2U A;  5K0I A;  4JE9 A;  3RH3 A;  4EBK A;  3F46 A;  3I5Q A;  4PJN A;  3HLZ A;  4C7O A;  1HE9 A;  3AJM A;  3FVY A;  3EFO A;  2HMQ A;  3DM9 B;  2LIG A;  1AVO B;  3ECS A;  2WL8 A;  2EPM X;  1D1C A;  4QI0 A;  1M2O A;  4B6I A;  3EZI A;  4CS8 C;  1ST6 A;  1MMG A;  4MS2 A;  5CI9 A;  4D4N A;  4CDY A;  3SYN A;  5A6A A;  1IZM A;  2L6H A;  4EBB A;  1QZX A;  1V55 C;  1Q0G A;  4G7O F;  1T6Q A;  2NUP B;  1ZHW A;  4CDA A;  4HEA J;  1ORJ A;  3B71 A;  5F5H A;  1Z63 A;  1M57 C;  1XZP A;  3AG3 C;  4K7B A;  2XM0 A;  3AQB A;  4Z9H A;  2ZD9 A;  2BL2 A;  1H7I A;  4WGY A;  4H4K C;  1LPE A;  2Y3H A;  1MMN A;  2B0J A;  3MYI A;  1E86 A;  2XLH A;  1NG1 A;  3B29 A;  3U2L A;  1QKR A;  5COM A;  3V5X A;  1FFH A;  1YZA A;  4E18 A;  3Q6M A;  3ABL C;  1CGM E;  4JW1 A;  4LLE A;  3E70 C;  3RFY A;  4MW3 A;  1QSP A;  2GDC A;  1XWJ A;  5HV9 A;  4XEF A;  4YJW A;  4CIH A;  2R7T A;  4XLP F;  4U9E A;  3ZTZ A;  3EH2 A;  4YL1 A;  2X0C A;  3VAY A;  4LLC A;  1LS1 A;  1YZC A;  1TWG A;  1LKX A;  1JPJ A;  4JJF A;  2J46 A;  1AUE A;  3DZA A;  5JP7 A;  3EHM A;  5HSW A;  3POV A;  2CNW A;  2NUT B;  2Q4F A;  2RSE B;  3Q7G A;  3U3F A;  3FDQ A;  3G4X A;  3H2V A;  2LQG A;  3NYL A;  2IBF A;  1WOL A;  5L3Q A;  2PX0 A;  3DMD A;  1VMA A;  3K66 A;  3ABM C;  4OIP F;  1Q0M A;  3AGT A;  3OEO A;  3M4B A;  4JCH A;  4LDR A;  4MTF A;  1J8M F;  2HUJ A;  3RF3 A;  4EWC A;  5KYW A;  5E33 A;  1NU9 C;  2JX0 A;  5F5F A;  2L6F A;  3K1H A;  2UUI A;  4GEH A; 
#chains in the Genus database with same CATH homology
 1LS4 A;  1OR3 A;  1EQ1 A;  1OR2 A;  1AEP A;  1H7I A;  2KC3 A;  1LPE A;  1BZ4 A;  1NFO A;  3S84 A;  1EA8 A;  1GS9 A;  1YA9 A;  3R2P A;  1NFN A;  1B68 A;  1LE4 A;  1LE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...