1EQ1A

Nmr structure of an exchangeable apolipoprotein-manduca sexta apolipophorin-iii
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
166
structure length
166
Chain Sequence
DAPAGGNAFEEMEKHAKEFQKTFSEQFNSLVNSKNTQDFNKALKDGSDSVLQQLSAFSSSLQGAISDANGKAKEALEQARQNVEKTAEELRKAHPDVEKEANAFKDKLQAAVQTTVQESQKLAKEVASNMEETNKKLAPKIKQAYDDFVKHAEEVQKKLHEAATKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords APOLIPOPHORIN-III
publication title Structural basis for the conformational adaptability of apolipophorin III, a helix-bundle exchangeable apolipoprotein
pubmed doi rcsb
source organism Manduca sexta
total genus 46
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2000-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07464 ApoLp-III Apolipophorin-III precursor (apoLp-III)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1eq1A00
1BZ4A 1LE4A 1OR2A 1OR3A 1NFOA 1YA9A 1GS9A 1LS4A 1EA8A 1EQ1A 3R2PA 1LE2A 1LPEA 1H7IA 3S84A 2KC3A 1B68A 1AEPA 1NFNA
chains in the Genus database with same CATH superfamily
2W9YA 3LEVA 3TJ6A 4DXWA 4G7OF 3M4CA 1MNEA 3Q6MA 1ZU4A 4JTDB 3U3BA 1MNDA 3ZVRA 1OR3A 3GANA 4XPWA 3JYHA 2CYDA 4J7TA 2R7VA 3UGPA 3I5PA 4DVYP 4I1OB 4YK5A 2R02A 3IHUA 4F4BA 3DE9A 3JRTA 2Z15A 5L0IA 4JJGA 4XEVA 4MTGA 1WATA 2XL4A 4FAPB 2VCAA 2W4MA 3U5SA 2VCCA 3O55A 2J0XA 1YDIA 2PFDA 3KPHA 2LQGA 4A2NB 2VASA 1M57C 2A0BA 2IM8A 3EFOB 5EHHA 3T6JA 4WGZA 3S84A 5BQHA 1MMGA 2YZSA 3K33A 2KC3A 2L7AA 4RD9A 4UDVA 2I8BA 3E70C 3JCUQ 4LERA 4K0DA 4U5FE 4XQ1A 1OW7A 2V26A 5KYYB 1FFTC 4DOZA 2KJGA 2B0HA 4BG0A 3QW1A 3ZWIA 3AGUA 2VCBA 2R7WA 1JPJA 1M56C 4EBJA 3SP1A 1KTMA 3N24A 4PR9A 1RMVA 5B1BC 2QNLA 1L3PA 4JKVA 5DQZA 1E84A 2EPKX 4U5GA 3PCVA 4J7YA 4OD5A 4M63A 5KYWA 4DJ9A 3Q7LA 2LCHA 1GS9A 4JURI 3A11A 3AG4C 1SMYF 2A1DD 4K7BA 2Q3TA 1WTYA 1D1BA 1U0BB 5B3IA 3C7JA 3CEXA 5COFA 4QI0A 5E33A 5JUAA 2P1AA 3U9JA 1M2OA 1QZXA 1TWHA 2B0JA 2NUTB 1R4TA 2UUIA 3ZDLA 1T9KA 4CJGA 4W8KA 3TJ5A 1Q0MA 4BJTA 4G7HF 2R05A 3L8JA 4JTAB 1ZZPA 5DS4A 5DLJA 1RCPA 1A7VA 3LLKA 2MWQA 2GA0A 3K6BA 4JIOA 1LS1A 4CSAC 3MYFA 4LDRA 4K1OA 4IWBA 3SEOA 2EPMX 1FMVA 1ORJA 2WVNA 3ZG1A 4E7ZA 1QVXA 3A9CA 3K66A 3NMJA 2HZ8A 1NG1A 4JCHA 1CGME 3TD7A 1T5OA 2R7TA 4U5CE 2XLVA 1CGNA 4OD4A 1QQ3A 2XXAB 1JOGA 3DMDA 5JS5A 2RSEB 4CBEA 1B68A 2EIMC 2GFHA 4WJ0A 5L3VA 2BL2A 3R7CA 2OG2A 5A69A 4OIQF 1Q0KA 4PFOA 1ZW3A 3IPMO 4H4KC 2XS1A 1FAPB 3EHMA 3FHDA 3UMHA 3U2MA 1FNTc 1BR1A 4YN0B 2EILC 2XLOA 3JTLO 3OA1A 2Q9CA 1K05A 1FMWA 2IOQA 4OIOF 2A6HF 1TWCA 4XLPF 3FMSA 1ZHWA 2WZFA 4MW3A 5EK0A 3DKAA 3G4XA 4BJ6A 2XM0A 1IW7F 2ETSA 3CSKA 3HNLA 4AL0A 4XTKA 4LLCA 3S28A 4GEHA 3Q6NA 2NG1A 4U5HA 1PV3A 4PFPA 3RVZA 2DI3A 3EGXA 1D0YA 4E17A 3TOLA 3HTKC 2YEVA 4ULVA 3HJCA 3POVA 4PJMA 2V3CC 2HV6A 2LSEA 3LLIA 3LUTB 5KYWB 1VLTA 2A6EF 2AWCA 2YLGA 3DD7A 4KC9A 3W8IA 2OQMA 2OEVA 4Q5SF 4Q7CA 4P9FA 3TK0A 1AVOB 2YL0A 1WN0A 5T3WA 4BEJA 1Q0GA 3AQBA 3O10A 3DM5A 1FTSA 1G8XA 2VB6A 5BQGA 2A68F 2PX3A 4IGGA 3LEOA 2VH3A 4JCZA 2PP4A 2R7XA 4N4WA 1HW2A 3X1OA 1NFOA 3HNIA 3HNJA 1SF8A 1NU7D 1ORYA 3LS0A 2PX0A 2L6HA 1CGOA 3AG1C 3RVYA 3C62A 1CPRA 2XRHA 2XLWA 1XZQA 2WZGA 3U0CA 2WVQA 1D1AA 3SNHA 1M2VA 1RJ9A 2BC5A 5L0DA 4NTBA 2HFIA 4MVQA 2G62A 2KNHA 4MS2A 3U3FA 2I15A 2JX0A 3NKDA 4WABA 2M4EA 4XPXA 1VYIA 2KYHA 5DQTA 3TOMA 1I4ZA 4R32A 4XWJA 4N06A 2ZXWC 1SZIA 3C8GD 1LVKA 4GQHA 1KU2A 1OR2A 4JEAA 4NC3A 5AC4A 3GWNA 4P9TA 5KYUA 1WGWA 1QSPA 5D92A 5L0HA 4I1MA 3S0XA 3TULA 3EH1A 2R7RA 3L1MA 2R03A 4JVSA 1Z6AA 4D4NA 3DAFA 4GYTA 1PD0A 5BQIA 1XWJA 2Q9BA 2AVKA 1ZHZA 2ZXOA 3LNMB 3SYNA 2Y39A 1E83A 4YT2A 1V55C 256BA 5COMA 2CW0F 3LESA 3VM6A 3RQEA 3HKKA 2PF4E 2NSGA 1OCZC 1BR2A 3FAJA 3FOPA 3DXJF 4OINF 4CX9A 4AK9A 5A6AA 1LI7A 1DOWA 3EGXB 3GEEA 2CCYA 4O6NA 1Y6DA 2J9BA 1YZAA 3C8GA 4QDLA 1J8YF 3BRJA 3W4YA 4AE4B 1PD1A 2EIKC 2ZXRA 3NMKA 1TR2A 4C7OA 3LJBA 4NTFA 4JZAA 2JD3A 4XPYA 1HE1A 2AU5A 3NRHA 4LDKA 2RD9A 1C03A 3DZAA 2FFHA 2LFDA 5L0JA 4RDAA 4EBBA 4I3MA 1MMNA 3GEIA 3ECSA 4EUKB 1YARO 2XL8A 3S27A 1BDJB 2BE5F 2XLEA 4Z9HA 4A4AA 3EHNA 1I4YA 2WB7A 2YWAA 3GORA 3HLZA 3L0IA 1ZVZA 2YLDA 4YJWA 1WOLA 4YT4A 3FDQA 4BJ5A 1FFHA 1T6QA 3EG9A 1CPQA 2MHRA 2OEXA 3UNGC 3QW0A 3OWTA 1RKCA 4PK4A 3WG7C 1LM3B 1NZEA 3DAGA 1OCOC 2OU6A 2ZPAA 4JC7A 5B3SC 1OW8A 1DOVA 2FAPB 3AQCA 4L6RA 5KYXA 1M6TA 4C3BA 3MX3A 4CIHA 2CGEA 4KNWA 2O9XA 5L0CA 3G4ZA 4CDAA 2NUPA 1YA9A 2Y3BA 2IBFA 2IXNA 1OCCC 2J7PD 2J8WA 2JPUA 4EKWA 4AX2A 4ZLCA 4KI2A 2HSBA 3IQ5A 3O39A 4MTOA 3T4RA 1OQCA 1JPNA 4ONSA 4MTFA 2Q4FA 5KYUB 3KYJA 5JRAA 1D1CA 2KSFA 4CDVA 2P0NA 1VLSA 2HS5A 5B1AC 1E85A 5L0GA 3DM9B 2IXPA 1U89A 4EBKA 2YL3A 3VYWA 2J9VA 4DVZA 4O7GA 3EH2A 4NTAA 2HMZA 3NG1A 4HE8D 1GM5A 3V5YA 2YLIA 4JEBA 3W2WA 4MVOA 1YA7O 2YQYA 3RKOF 4DRJB 1RKEA 1OW6A 3B71A 1E2XA 3K1IA 1D0XA 2G3VA 1U6HA 1LKXA 2J7PA 4ULWA 3JT1A 3M1CB 1NSGB 2XM4A 1NU9C 3TQOA 2EPOA 3DE8A 3FVYA 2ASRA 5COGA 5HV9A 5DVWA 3L8IA 1XZPA 1L7CA 3MBGA 2GWWA 2XS8A 4YL3A 4LACB 4OIRF 4C7OB 1ZHXA 4YWQA 3ABKC 3DJUB 2OKUA 2Q7RA 1NLXA 2H7OA 1BR4A 4B6IA 4DRHB 1G4US 2D4UA 1D0ZA 2QUPA 2W4BA 5JT4A 3CAXA 3VF0A 2D5RB 2HUJA 4PACA 2ZXPA 1O87A 3I5QA 4CS9A 4NY3A 2TMVP 4IARA 4ER9A 1QPUA 3Q7GA 2A0UA 3T6GB 3T6BA 5L3QA 3B0UX 3O6XA 1ZYRF 1V4AA 1ST6A 3C18A 1WASA 2J9WA 3L34A 3H2UA 4PJLA 4Z9JA 3ZTZA 1HMOA 3U8VA 5JLIA 3R2PA 3RFYA 3NYJA 5KYYA 4U9DA 1APCA 1VK5A 4MVRA 5JP7A 3KYIA 4YT8A 5AC5A 1Z63A 2HSQA 2LK4A 4EIYA 3B29A 1LPEA 1LIHA 2NUPB 2R25A 2Y69C 4IB4A 4LLEA 4YT5A 3ZQYA 5IY5C 4CSAA 3ABMC 2P6VA 4MVZA 3V5ZA 3H65A 1QKRA 2XLDA 2YVKA 3GM2A 2J45A 3MLGA 4KNVA 4BJ5C 2R7SA 1A7DA 3LAYA 4EHPA 3PMRA 5CI8A 3RF3A 3T9OA 1VB5A 5F5FA 1YLMA 1R5ID 2XL6A 3B9QA 1T6UA 4IAQA 4MNDA 1Z3IX 2E87A 2PNOA 4U5DE 2P7VA 4QI2A 4X0RA 2HMQA 4J30B 3UMKA 3AG2C 3LS1A 2A69F 1ZHTA 3DWWA 2LIGA 1GGQA 3PHF2 2HKVA 4DRIB 3PDMP 3EQLF 3RQGA 2DYRC 3GM3A 3SZRA 1OXKA 1YZCA 2IXOA 1K40A 2R9RB 1T01A 3QVZA 3S9OA 1FR0A 2YL7A 4FESA 5A6BD 1A41A 2LD6A 2QE9A 2ZD9A 3JYYA 3B0VC 2LP4A 2L81A 4O6YA 2EIJC 2HV7A 4CS8A 2WZLA 2XLHA 1NBBA 2CDQA 3EGDA 3W8HA 4MVSA 2UUHA 4FX5A 5T1DB 5FZTA 2XXAA 3NYMA 2YRFA 4Z9IA 3SXMA 1IZMA 3WHNA 2X51A 2L9JA 1TFKB 2F22A 4JE9A 1V54C 2EPNA 4BPMA 2P61A 5A6KA 5K0IA 3VRCA 5BUOA 5EGYA 4MVUA 2J46A 3K1IC 1YJGA 1Z7Qc 1F1MA 3RW0A 4N6CA 1TKNA 2H7BA 3ITFA 4XEKA 2KQ9A 3M79A 4BJ6C 4JJFA 1JMWA 3IQCA 3U9MA 1PCXA 1G5ZA 3FAPB 4FWVA 4JTCB 3GODA 4RBNA 2VC9A 4W8PA 3UR3C 3WAQA 5A6BA 1HMDA 4P6IC 2NSFA 1KNYA 3F46A 3IEEA 3F47A 1SR2A 2ICWG 1E86A 1G4WR 2KW3C 3EPVA 2X0CA 4PJNA 3JSZA 2LFFA 3QZCA 3RH3A 3C8ZA 4IRUA 4G7ZF 2GDCA 3AG3C 1JR8A 2DB4A 1H6GA 1A7EA 1M2VB 1RJ9B 1MQVA 2YKZA 1Q0FA 3M4BA 1T6IA 2Q00A 2XLMA 2H7VC 2OJED 4CS9C 2R7UA 4O6MA 3V7OA 3KL4A 1LS4A 2W45A 5AGFA 3B0PA 3KH2A 2Y3GA 4HEAJ 2Y3HA 3MYIA 3ASOC 4U5BE 4PJJA 1YVIA 1ZHYA 2KGOA 5DS6A 2HJ3A 4G0HA 4H54A 1JRAA 1VOMA 2CNWD 1TWAA 3AGTA 4G78A 4ANJA 2J9UA 2L6GA 1H7IA 3S90A 3CZ6A 2C03A 1C17M 1TFOB 4WGYA 1Y4CA 1ZW2A 2XSEA 3RIPA 4XLNF 3ZTMA 4BEMJ 5A6JA 2H8AA 3NKEA 4OIPF 4E18A 1VMAA 3AJMA 3QVYA 4HFKB 5E2QA 3BEHA 3S29A 2QTVA 2WVOA 1LE4A 1MMAA 3GWLA 5JVEA 4XEFA 4J32B 4MVMA 3WODF 4AL1A 3EZHA 5CIVA 1BBHA 1EA8A 3US6A 3EGDB 1RXQA 3NYLA 4JW1A 3SXYA 2MYSA 5CI9A 5GPGB 2M64A 1HE9A 3C8GB 1A0BA 1I5NA 3FXHA 3LNRA 2CNWA 5KYNA 1LE2A 3ZC4A 4E7SA 4CJOA 3QMKA 3ZQVA 4Q4ZF 3N0TA 3ZSUA 1MMDA 2Y3DA 1OCRC 1J8MF 3HNKA 4D4XA 1TQGA 3RQFA 4CDYA 1WWPA 3NMIA 3NDBB 1NFNA 1BZ4A 2C04A 3IQTA 4CS8C 2R7OA 3AOUA 2Q9AA 1VYKA 1OKKD 3EFOA 4IJJA 2IYLD 1Z23A 4LDQA 4YL0A 5E3AA 2OCCC 4DBRA 2EPLX 3K1HA 1W2WA 3EG9B 2PBEA 1H9TA 1EKYA 4C3EA 5FCLA 1C02A 3V5XA 3ATPA 4MQ9F 4EWCA 5E3CA 2IXMA 4U9EA 1EQ1A 4N6HA 1Q0DA 1YYJA 3KMIA 5F5HA 5KYXB 3M15A 3JSEO 4JRZA 2HJMA 4AE4A 2NPUA 1VTMP 1S05A 4CIPA 2GAQA 3OEOA 3DJNB 4C3DA 4I44A 3RYLA 1HY5A 4DBQA 2DYSC 3W2VA 2AWYA 3FOOA 3J06A 1ZU5A 5L0FA 5TJ5E 4MW8A 1ORSC 4BJ1A 1V74B 2L6FA 3E9VA 3MFNA 5HSWA 2KK1A 4ZLDA 2OJQA 1QLEC 1O5HA 3CQZA 3SXKA 3JZ0A 3ZIBA 1UFBA 3UGOA 1OKKA 2J0WA 1OXBA 2YHSA 3N2ZB 2G3KA 4E0IA 2R7QA 3C63A 3H2VA 4YL1A 3I4UA 3KKBA 4KBLA 3ABLC 5F28E 2NUTA 1TWGA 2OOCA 4CS7A 5DS5A 2EINC 3EJNA 3G50A 3U8PA 3ASNC 1LI5A 3JRMO 4NQFA 2YL1A 4U5EE 5D91A 3GEHA 2QY9A 4IAOA 1O3UA 3K7DA 1AUEA 1HW1A 2FGYA 3EZIA 2QLAA 3DI5A 3GM1A 3QTHA 4HFFB 1UG7A 5T3TA 1EI7A 1H9GA 1K04A 2WL8A 2DGJA 3UMIA 1RKEB 3SXZA 3X2QC 3U2LA 2AP3A 3IQ6A 5JSLA 3VAYA 1YAUO 1YYXA 4O79A 4E0HA 1Z5ZA 1S7ZA 1SYQA 4NCQA 1AEPA 1JAFA 1GQAA 1N1CA
chains in the Genus database with same CATH topology
1BZ4A 1LE4A 1OR2A 1OR3A 1NFOA 1YA9A 1GS9A 1LS4A 1EA8A 1EQ1A 3R2PA 1LE2A 1LPEA 1H7IA 3S84A 2KC3A 1B68A 1AEPA 1NFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BZ4 A;  1LE4 A;  1OR2 A;  1OR3 A;  1NFO A;  1YA9 A;  1GS9 A;  1LS4 A;  1EA8 A;  1EQ1 A;  3R2P A;  1LE2 A;  1LPE A;  1H7I A;  3S84 A;  2KC3 A;  1B68 A;  1AEP A;  1NFN A; 
#chains in the Genus database with same CATH topology
 2W9Y A;  3LEV A;  3TJ6 A;  4DXW A;  4G7O F;  3M4C A;  1MNE A;  3Q6M A;  1ZU4 A;  4JTD B;  3U3B A;  1MND A;  3ZVR A;  1OR3 A;  3GAN A;  4XPW A;  3JYH A;  2CYD A;  4J7T A;  2R7V A;  3UGP A;  3I5P A;  4DVY P;  4I1O B;  4YK5 A;  2R02 A;  3IHU A;  4F4B A;  3DE9 A;  3JRT A;  2Z15 A;  5L0I A;  4JJG A;  4XEV A;  4MTG A;  1WAT A;  2XL4 A;  4FAP B;  2VCA A;  2W4M A;  3U5S A;  2VCC A;  3O55 A;  2J0X A;  1YDI A;  2PFD A;  3KPH A;  2LQG A;  4A2N B;  2VAS A;  1M57 C;  2A0B A;  2IM8 A;  3EFO B;  5EHH A;  3T6J A;  4WGZ A;  3S84 A;  5BQH A;  1MMG A;  2YZS A;  3K33 A;  2KC3 A;  2L7A A;  4RD9 A;  4UDV A;  2I8B A;  3E70 C;  3JCU Q;  4LER A;  4K0D A;  4U5F E;  4XQ1 A;  1OW7 A;  2V26 A;  5KYY B;  1FFT C;  4DOZ A;  2KJG A;  2B0H A;  4BG0 A;  3QW1 A;  3ZWI A;  3AGU A;  2VCB A;  2R7W A;  1JPJ A;  1M56 C;  4EBJ A;  3SP1 A;  1KTM A;  3N24 A;  4PR9 A;  1RMV A;  5B1B C;  2QNL A;  1L3P A;  4JKV A;  5DQZ A;  1E84 A;  2EPK X;  4U5G A;  3PCV A;  4J7Y A;  4OD5 A;  4M63 A;  5KYW A;  4DJ9 A;  3Q7L A;  2LCH A;  1GS9 A;  4JUR I;  3A11 A;  3AG4 C;  1SMY F;  2A1D D;  4K7B A;  2Q3T A;  1WTY A;  1D1B A;  1U0B B;  5B3I A;  3C7J A;  3CEX A;  5COF A;  4QI0 A;  5E33 A;  5JUA A;  2P1A A;  3U9J A;  1M2O A;  1QZX A;  1TWH A;  2B0J A;  2NUT B;  1R4T A;  2UUI A;  3ZDL A;  1T9K A;  4CJG A;  4W8K A;  3TJ5 A;  1Q0M A;  4BJT A;  4G7H F;  2R05 A;  3L8J A;  4JTA B;  1ZZP A;  5DS4 A;  5DLJ A;  1RCP A;  1A7V A;  3LLK A;  2MWQ A;  2GA0 A;  3K6B A;  4JIO A;  1LS1 A;  4CSA C;  3MYF A;  4LDR A;  4K1O A;  4IWB A;  3SEO A;  2EPM X;  1FMV A;  1ORJ A;  2WVN A;  3ZG1 A;  4E7Z A;  1QVX A;  3A9C A;  3K66 A;  3NMJ A;  2HZ8 A;  1NG1 A;  4JCH A;  1CGM E;  3TD7 A;  1T5O A;  2R7T A;  4U5C E;  2XLV A;  1CGN A;  4OD4 A;  1QQ3 A;  2XXA B;  1JOG A;  3DMD A;  5JS5 A;  2RSE B;  4CBE A;  1B68 A;  2EIM C;  2GFH A;  4WJ0 A;  5L3V A;  2BL2 A;  3R7C A;  2OG2 A;  5A69 A;  4OIQ F;  1Q0K A;  4PFO A;  1ZW3 A;  3IPM O;  4H4K C;  2XS1 A;  1FAP B;  3EHM A;  3FHD A;  3UMH A;  3U2M A;  1FNT c;  1BR1 A;  4YN0 B;  2EIL C;  2XLO A;  3JTL O;  3OA1 A;  2Q9C A;  1K05 A;  1FMW A;  2IOQ A;  4OIO F;  2A6H F;  1TWC A;  4XLP F;  3FMS A;  1ZHW A;  2WZF A;  4MW3 A;  5EK0 A;  3DKA A;  3G4X A;  4BJ6 A;  2XM0 A;  1IW7 F;  2ETS A;  3CSK A;  3HNL A;  4AL0 A;  4XTK A;  4LLC A;  3S28 A;  4GEH A;  3Q6N A;  2NG1 A;  4U5H A;  1PV3 A;  4PFP A;  3RVZ A;  2DI3 A;  3EGX A;  1D0Y A;  4E17 A;  3TOL A;  3HTK C;  2YEV A;  4ULV A;  3HJC A;  3POV A;  4PJM A;  2V3C C;  2HV6 A;  2LSE A;  3LLI A;  3LUT B;  5KYW B;  1VLT A;  2A6E F;  2AWC A;  2YLG A;  3DD7 A;  4KC9 A;  3W8I A;  2OQM A;  2OEV A;  4Q5S F;  4Q7C A;  4P9F A;  3TK0 A;  1AVO B;  2YL0 A;  1WN0 A;  5T3W A;  4BEJ A;  1Q0G A;  3AQB A;  3O10 A;  3DM5 A;  1FTS A;  1G8X A;  2VB6 A;  5BQG A;  2A68 F;  2PX3 A;  4IGG A;  3LEO A;  2VH3 A;  4JCZ A;  2PP4 A;  2R7X A;  4N4W A;  1HW2 A;  3X1O A;  1NFO A;  3HNI A;  3HNJ A;  1SF8 A;  1NU7 D;  1ORY A;  3LS0 A;  2PX0 A;  2L6H A;  1CGO A;  3AG1 C;  3RVY A;  3C62 A;  1CPR A;  2XRH A;  2XLW A;  1XZQ A;  2WZG A;  3U0C A;  2WVQ A;  1D1A A;  3SNH A;  1M2V A;  1RJ9 A;  2BC5 A;  5L0D A;  4NTB A;  2HFI A;  4MVQ A;  2G62 A;  2KNH A;  4MS2 A;  3U3F A;  2I15 A;  2JX0 A;  3NKD A;  4WAB A;  2M4E A;  4XPX A;  1VYI A;  2KYH A;  5DQT A;  3TOM A;  1I4Z A;  4R32 A;  4XWJ A;  4N06 A;  2ZXW C;  1SZI A;  3C8G D;  1LVK A;  4GQH A;  1KU2 A;  1OR2 A;  4JEA A;  4NC3 A;  5AC4 A;  3GWN A;  4P9T A;  5KYU A;  1WGW A;  1QSP A;  5D92 A;  5L0H A;  4I1M A;  3S0X A;  3TUL A;  3EH1 A;  2R7R A;  3L1M A;  2R03 A;  4JVS A;  1Z6A A;  4D4N A;  3DAF A;  4GYT A;  1PD0 A;  5BQI A;  1XWJ A;  2Q9B A;  2AVK A;  1ZHZ A;  2ZXO A;  3LNM B;  3SYN A;  2Y39 A;  1E83 A;  4YT2 A;  1V55 C;  256B A;  5COM A;  2CW0 F;  3LES A;  3VM6 A;  3RQE A;  3HKK A;  2PF4 E;  2NSG A;  1OCZ C;  1BR2 A;  3FAJ A;  3FOP A;  3DXJ F;  4OIN F;  4CX9 A;  4AK9 A;  5A6A A;  1LI7 A;  1DOW A;  3EGX B;  3GEE A;  2CCY A;  4O6N A;  1Y6D A;  2J9B A;  1YZA A;  3C8G A;  4QDL A;  1J8Y F;  3BRJ A;  3W4Y A;  4AE4 B;  1PD1 A;  2EIK C;  2ZXR A;  3NMK A;  1TR2 A;  4C7O A;  3LJB A;  4NTF A;  4JZA A;  2JD3 A;  4XPY A;  1HE1 A;  2AU5 A;  3NRH A;  4LDK A;  2RD9 A;  1C03 A;  3DZA A;  2FFH A;  2LFD A;  5L0J A;  4RDA A;  4EBB A;  4I3M A;  1MMN A;  3GEI A;  3ECS A;  4EUK B;  1YAR O;  2XL8 A;  3S27 A;  1BDJ B;  2BE5 F;  2XLE A;  4Z9H A;  4A4A A;  3EHN A;  1I4Y A;  2WB7 A;  2YWA A;  3GOR A;  3HLZ A;  3L0I A;  1ZVZ A;  2YLD A;  4YJW A;  1WOL A;  4YT4 A;  3FDQ A;  4BJ5 A;  1FFH A;  1T6Q A;  3EG9 A;  1CPQ A;  2MHR A;  2OEX A;  3UNG C;  3QW0 A;  3OWT A;  1RKC A;  4PK4 A;  3WG7 C;  1LM3 B;  1NZE A;  3DAG A;  1OCO C;  2OU6 A;  2ZPA A;  4JC7 A;  5B3S C;  1OW8 A;  1DOV A;  2FAP B;  3AQC A;  4L6R A;  5KYX A;  1M6T A;  4C3B A;  3MX3 A;  4CIH A;  2CGE A;  4KNW A;  2O9X A;  5L0C A;  3G4Z A;  4CDA A;  2NUP A;  1YA9 A;  2Y3B A;  2IBF A;  2IXN A;  1OCC C;  2J7P D;  2J8W A;  2JPU A;  4EKW A;  4AX2 A;  4ZLC A;  4KI2 A;  2HSB A;  3IQ5 A;  3O39 A;  4MTO A;  3T4R A;  1OQC A;  1JPN A;  4ONS A;  4MTF A;  2Q4F A;  5KYU B;  3KYJ A;  5JRA A;  1D1C A;  2KSF A;  4CDV A;  2P0N A;  1VLS A;  2HS5 A;  5B1A C;  1E85 A;  5L0G A;  3DM9 B;  2IXP A;  1U89 A;  4EBK A;  2YL3 A;  3VYW A;  2J9V A;  4DVZ A;  4O7G A;  3EH2 A;  4NTA A;  2HMZ A;  3NG1 A;  4HE8 D;  1GM5 A;  3V5Y A;  2YLI A;  4JEB A;  3W2W A;  4MVO A;  1YA7 O;  2YQY A;  3RKO F;  4DRJ B;  1RKE A;  1OW6 A;  3B71 A;  1E2X A;  3K1I A;  1D0X A;  2G3V A;  1U6H A;  1LKX A;  2J7P A;  4ULW A;  3JT1 A;  3M1C B;  1NSG B;  2XM4 A;  1NU9 C;  3TQO A;  2EPO A;  3DE8 A;  3FVY A;  2ASR A;  5COG A;  5HV9 A;  5DVW A;  3L8I A;  1XZP A;  1L7C A;  3MBG A;  2GWW A;  2XS8 A;  4YL3 A;  4LAC B;  4OIR F;  4C7O B;  1ZHX A;  4YWQ A;  3ABK C;  3DJU B;  2OKU A;  2Q7R A;  1NLX A;  2H7O A;  1BR4 A;  4B6I A;  4DRH B;  1G4U S;  2D4U A;  1D0Z A;  2QUP A;  2W4B A;  5JT4 A;  3CAX A;  3VF0 A;  2D5R B;  2HUJ A;  4PAC A;  2ZXP A;  1O87 A;  3I5Q A;  4CS9 A;  4NY3 A;  2TMV P;  4IAR A;  4ER9 A;  1QPU A;  3Q7G A;  2A0U A;  3T6G B;  3T6B A;  5L3Q A;  3B0U X;  3O6X A;  1ZYR F;  1V4A A;  1ST6 A;  3C18 A;  1WAS A;  2J9W A;  3L34 A;  3H2U A;  4PJL A;  4Z9J A;  3ZTZ A;  1HMO A;  3U8V A;  5JLI A;  3R2P A;  3RFY A;  3NYJ A;  5KYY A;  4U9D A;  1APC A;  1VK5 A;  4MVR A;  5JP7 A;  3KYI A;  4YT8 A;  5AC5 A;  1Z63 A;  2HSQ A;  2LK4 A;  4EIY A;  3B29 A;  1LPE A;  1LIH A;  2NUP B;  2R25 A;  2Y69 C;  4IB4 A;  4LLE A;  4YT5 A;  3ZQY A;  5IY5 C;  4CSA A;  3ABM C;  2P6V A;  4MVZ A;  3V5Z A;  3H65 A;  1QKR A;  2XLD A;  2YVK A;  3GM2 A;  2J45 A;  3MLG A;  4KNV A;  4BJ5 C;  2R7S A;  1A7D A;  3LAY A;  4EHP A;  3PMR A;  5CI8 A;  3RF3 A;  3T9O A;  1VB5 A;  5F5F A;  1YLM A;  1R5I D;  2XL6 A;  3B9Q A;  1T6U A;  4IAQ A;  4MND A;  1Z3I X;  2E87 A;  2PNO A;  4U5D E;  2P7V A;  4QI2 A;  4X0R A;  2HMQ A;  4J30 B;  3UMK A;  3AG2 C;  3LS1 A;  2A69 F;  1ZHT A;  3DWW A;  2LIG A;  1GGQ A;  3PHF 2;  2HKV A;  4DRI B;  3PDM P;  3EQL F;  3RQG A;  2DYR C;  3GM3 A;  3SZR A;  1OXK A;  1YZC A;  2IXO A;  1K40 A;  2R9R B;  1T01 A;  3QVZ A;  3S9O A;  1FR0 A;  2YL7 A;  4FES A;  5A6B D;  1A41 A;  2LD6 A;  2QE9 A;  2ZD9 A;  3JYY A;  3B0V C;  2LP4 A;  2L81 A;  4O6Y A;  2EIJ C;  2HV7 A;  4CS8 A;  2WZL A;  2XLH A;  1NBB A;  2CDQ A;  3EGD A;  3W8H A;  4MVS A;  2UUH A;  4FX5 A;  5T1D B;  5FZT A;  2XXA A;  3NYM A;  2YRF A;  4Z9I A;  3SXM A;  1IZM A;  3WHN A;  2X51 A;  2L9J A;  1TFK B;  2F22 A;  4JE9 A;  1V54 C;  2EPN A;  4BPM A;  2P61 A;  5A6K A;  5K0I A;  3VRC A;  5BUO A;  5EGY A;  4MVU A;  2J46 A;  3K1I C;  1YJG A;  1Z7Q c;  1F1M A;  3RW0 A;  4N6C A;  1TKN A;  2H7B A;  3ITF A;  4XEK A;  2KQ9 A;  3M79 A;  4BJ6 C;  4JJF A;  1JMW A;  3IQC A;  3U9M A;  1PCX A;  1G5Z A;  3FAP B;  4FWV A;  4JTC B;  3GOD A;  4RBN A;  2VC9 A;  4W8P A;  3UR3 C;  3WAQ A;  5A6B A;  1HMD A;  4P6I C;  2NSF A;  1KNY A;  3F46 A;  3IEE A;  3F47 A;  1SR2 A;  2ICW G;  1E86 A;  1G4W R;  2KW3 C;  3EPV A;  2X0C A;  4PJN A;  3JSZ A;  2LFF A;  3QZC A;  3RH3 A;  3C8Z A;  4IRU A;  4G7Z F;  2GDC A;  3AG3 C;  1JR8 A;  2DB4 A;  1H6G A;  1A7E A;  1M2V B;  1RJ9 B;  1MQV A;  2YKZ A;  1Q0F A;  3M4B A;  1T6I A;  2Q00 A;  2XLM A;  2H7V C;  2OJE D;  4CS9 C;  2R7U A;  4O6M A;  3V7O A;  3KL4 A;  1LS4 A;  2W45 A;  5AGF A;  3B0P A;  3KH2 A;  2Y3G A;  4HEA J;  2Y3H A;  3MYI A;  3ASO C;  4U5B E;  4PJJ A;  1YVI A;  1ZHY A;  2KGO A;  5DS6 A;  2HJ3 A;  4G0H A;  4H54 A;  1JRA A;  1VOM A;  2CNW D;  1TWA A;  3AGT A;  4G78 A;  4ANJ A;  2J9U A;  2L6G A;  1H7I A;  3S90 A;  3CZ6 A;  2C03 A;  1C17 M;  1TFO B;  4WGY A;  1Y4C A;  1ZW2 A;  2XSE A;  3RIP A;  4XLN F;  3ZTM A;  4BEM J;  5A6J A;  2H8A A;  3NKE A;  4OIP F;  4E18 A;  1VMA A;  3AJM A;  3QVY A;  4HFK B;  5E2Q A;  3BEH A;  3S29 A;  2QTV A;  2WVO A;  1LE4 A;  1MMA A;  3GWL A;  5JVE A;  4XEF A;  4J32 B;  4MVM A;  3WOD F;  4AL1 A;  3EZH A;  5CIV A;  1BBH A;  1EA8 A;  3US6 A;  3EGD B;  1RXQ A;  3NYL A;  4JW1 A;  3SXY A;  2MYS A;  5CI9 A;  5GPG B;  2M64 A;  1HE9 A;  3C8G B;  1A0B A;  1I5N A;  3FXH A;  3LNR A;  2CNW A;  5KYN A;  1LE2 A;  3ZC4 A;  4E7S A;  4CJO A;  3QMK A;  3ZQV A;  4Q4Z F;  3N0T A;  3ZSU A;  1MMD A;  2Y3D A;  1OCR C;  1J8M F;  3HNK A;  4D4X A;  1TQG A;  3RQF A;  4CDY A;  1WWP A;  3NMI A;  3NDB B;  1NFN A;  1BZ4 A;  2C04 A;  3IQT A;  4CS8 C;  2R7O A;  3AOU A;  2Q9A A;  1VYK A;  1OKK D;  3EFO A;  4IJJ A;  2IYL D;  1Z23 A;  4LDQ A;  4YL0 A;  5E3A A;  2OCC C;  4DBR A;  2EPL X;  3K1H A;  1W2W A;  3EG9 B;  2PBE A;  1H9T A;  1EKY A;  4C3E A;  5FCL A;  1C02 A;  3V5X A;  3ATP A;  4MQ9 F;  4EWC A;  5E3C A;  2IXM A;  4U9E A;  1EQ1 A;  4N6H A;  1Q0D A;  1YYJ A;  3KMI A;  5F5H A;  5KYX B;  3M15 A;  3JSE O;  4JRZ A;  2HJM A;  4AE4 A;  2NPU A;  1VTM P;  1S05 A;  4CIP A;  2GAQ A;  3OEO A;  3DJN B;  4C3D A;  4I44 A;  3RYL A;  1HY5 A;  4DBQ A;  2DYS C;  3W2V A;  2AWY A;  3FOO A;  3J06 A;  1ZU5 A;  5L0F A;  5TJ5 E;  4MW8 A;  1ORS C;  4BJ1 A;  1V74 B;  2L6F A;  3E9V A;  3MFN A;  5HSW A;  2KK1 A;  4ZLD A;  2OJQ A;  1QLE C;  1O5H A;  3CQZ A;  3SXK A;  3JZ0 A;  3ZIB A;  1UFB A;  3UGO A;  1OKK A;  2J0W A;  1OXB A;  2YHS A;  3N2Z B;  2G3K A;  4E0I A;  2R7Q A;  3C63 A;  3H2V A;  4YL1 A;  3I4U A;  3KKB A;  4KBL A;  3ABL C;  5F28 E;  2NUT A;  1TWG A;  2OOC A;  4CS7 A;  5DS5 A;  2EIN C;  3EJN A;  3G50 A;  3U8P A;  3ASN C;  1LI5 A;  3JRM O;  4NQF A;  2YL1 A;  4U5E E;  5D91 A;  3GEH A;  2QY9 A;  4IAO A;  1O3U A;  3K7D A;  1AUE A;  1HW1 A;  2FGY A;  3EZI A;  2QLA A;  3DI5 A;  3GM1 A;  3QTH A;  4HFF B;  1UG7 A;  5T3T A;  1EI7 A;  1H9G A;  1K04 A;  2WL8 A;  2DGJ A;  3UMI A;  1RKE B;  3SXZ A;  3X2Q C;  3U2L A;  2AP3 A;  3IQ6 A;  5JSL A;  3VAY A;  1YAU O;  1YYX A;  4O79 A;  4E0H A;  1Z5Z A;  1S7Z A;  1SYQ A;  4NCQ A;  1AEP A;  1JAF A;  1GQA A;  1N1C A; 
#chains in the Genus database with same CATH homology
 1BZ4 A;  1LE4 A;  1OR2 A;  1OR3 A;  1NFO A;  1YA9 A;  1GS9 A;  1LS4 A;  1EA8 A;  1EQ1 A;  3R2P A;  1LE2 A;  1LPE A;  1H7I A;  3S84 A;  2KC3 A;  1B68 A;  1AEP A;  1NFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...