1EQ1A

Nmr structure of an exchangeable apolipoprotein-manduca sexta apolipophorin-iii
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
166
structure length
166
Chain Sequence
DAPAGGNAFEEMEKHAKEFQKTFSEQFNSLVNSKNTQDFNKALKDGSDSVLQQLSAFSSSLQGAISDANGKAKEALEQARQNVEKTAEELRKAHPDVEKEANAFKDKLQAAVQTTVQESQKLAKEVASNMEETNKKLAPKIKQAYDDFVKHAEEVQKKLHEAATKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APOLIPOPHORIN-III
publication title Structural basis for the conformational adaptability of apolipophorin III, a helix-bundle exchangeable apolipoprotein
pubmed doi rcsb
source organism Manduca sexta
molecule tags Lipid binding protein
total genus 46
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2000-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07464 ApoLp-III Apolipophorin-III precursor (apoLp-III)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1eq1A00
1LE4A 1BZ4A 1H7IA 1LS4A 1AEPA 1LE2A 3R2PA 1LPEA 1OR2A 1B68A 1EA8A 3S84A 1YA9A 1NFNA 1EQ1A 1NFOA 2KC3A 1OR3A 1GS9A
chains in the Genus database with same CATH superfamily
4H54A 3V5YA 2QE9A 1TFOB 2X51A 1JPJA 2KQ9A 2EPMX 4IAQA 1GQAA 3G4XA 1LS4A 5CI9A 5L3VA 3DWWA 3G4ZA 4JVSA 2W45A 3U2LA 3IPMO 3TULA 3DE9A 1ZHXA 1YDIA 4KNWA 5HSWA 4NCQA 3DKAA 1PCXA 2A69F 1YVIA 4FX5A 3EFOB 5L0GA 5L0HA 3OEOA 1FNTc 2AU5A 2ZPAA 4J7YA 1A0BA 5AGFA 4PK4A 2XM0A 4P6IC 3CSKA 1RCPA 4Q4ZF 2DYRC 4CDYA 2O9XA 1JRAA 2DGJA 5AC5A 4HEAJ 3LLIA 4O6NA 3NMIA 1K40A 3NRHA 4F4BA 3EG9B 3NKEA 4ULWA 3C63A 2HSQA 2Y3GA 2OJED 1E86A 2NG1A 2QY9A 1OXBA 1Y4CA 2J9VA 3AQCA 3GM3A 1Z7Qc 3ZTMA 2R03A 4E18A 5E33A 1S05A 1VOMA 4U5DE 5L0FA 1D0YA 4MTOA 2HS5A 2HFIA 4R32A 2PNOA 3EH2A 2DYSC 1WTYA 1A7EA 2W9YA 4JIOA 4K7BA 1EKYA 5KYXA 3ZSUA 3K33A 2V26A 3RKOF 4CIPA 1HE9A 2VCBA 1GM5A 4G7OF 3VAYA 3E9VA 3H65A 3UMIA 3KYJA 4XLNF 4LACB 3SXMA 3ZC4A 3O55A 1EQ1A 4MVSA 2L6FA 5A69A 3N0TA 4JZAA 4DJ9A 2EPLX 5A6BA 2VH3A 2Q7RA 3CQZA 3RQFA 5JSLA 4AE4B 1BR4A 3T6JA 2R7TA 2IXOA 1V55C 4PFPA 3W8IA 1XZPA 3L8IA 3B71A 4O79A 3A9CA 2YEVA 4WGYA 5JRAA 2OCCC 2PX3A 3DMDA 2OOCA 3EHNA 4OD5A 1TKNA 3H2VA 1LI7A 5A6KA 3FHDA 1LI5A 3DAFA 3FAPB 4AX2A 1K05A 5BQHA 3QW1A 2IXPA 2KSFA 4EUKB 3SP1A 1E85A 2XXAA 3MFNA 1YA9A 2CW0F 1JOGA 3HNJA 2HV6A 1JMWA 2HJ3A 3SXKA 1M2OA 3GODA 3NMKA 3PDMP 1ZU4A 3NYLA 4RDAA 4OIRF 2HKVA 3VYWA 4UDVA 4E0HA 2CNWA 2HV7A 2IBFA 1LPEA 2IM8A 3GWNA 4FAPB 4DBRA 4IARA 5A6BD 4N6CA 2J0WA 4ANJA 5A6AA 5JVEA 3GEHA 1A41A 1KU2A 3HTKC 3NDBB 2Q9CA 1G4WR 2UUIA 3ABMC 3RFYA 1ST6A 2LSEA 2R02A 4W8KA 4AL0A 2P61A 3R2PA 1NG1A 5KYUB 1M56C 4DOZA 2PP4A 1SR2A 4OIPF 1YZCA 3X1OA 3DM5A 1VK5A 1YZAA 4CS8A 3ABKC 1XWJA 4PACA 5JP7A 2KK1A 3TOMA 4IGGA 4YT5A 1C03A 2QNLA 4KI2A 4MNDA 1I4ZA 2A1DD 2TMVP 1WOLA 2H7OA 4BJ6C 1E2XA 4CS7A 1EI7A 1TR2A 2HUJA 1VB5A 4N4WA 2Q9AA 4PJJA 2Q4FA 3AG4C 3MYIA 3U8PA 2I15A 4NTFA 3B9QA 3FOPA 4E0IA 3NKDA 5BUOA 4Z9HA 3ZQYA 3ZWIA 5L0CA 2LIGA 1TWHA 3PMRA 4IRUA 2CNWD 3JCUQ 4U5EE 1D1CA 5HV9A 3LS0A 4Z9JA 3M15A 1TQGA 1SYQA 1HW1A 2IXNA 2LCHA 3O39A 4CS9C 4D4XA 4EKWA 2R9RB 1R4TA 2XM4A 4C7OB 2W4MA 3LUTB 4QDLA 3UGOA 4KNVA 1T01A 2EIKC 2P1AA 2PX0A 3QW0A 1N1CA 2NPUA 3MYFA 1V4AA 4K0DA 2MHRA 1M2VA 1FMWA 1TWCA 3FOOA 3JZ0A 4NTAA 2QTVA 3S29A 1YARO 4Z9IA 1WN0A 1J8YF 1Z6AA 2ZXPA 4KBLA 1LS1A 1HW2A 3RYLA 1HE1A 1MMGA 1ZHTA 2M64A 2XL4A 4ZLDA 2B0HA 2R25A 2JPUA 2QUPA 3EZIA 1RMVA 4XPXA 1A7DA 3LNRA 5E2QA 2CDQA 3M4CA 2FGYA 1HY5A 2DB4A 5JS5A 4U5BE 1DOVA 3I4UA 3EGDB 1APCA 3J06A 1O5HA 4A4AA 1TWGA 3DZAA 4ULVA 3S28A 4BEJA 3I5PA 1ZW2A 3FVYA 1E83A 3WG7C 4YL3A 2EIMC 2EILC 5F28E 4CJOA 4PJMA 4MS2A 3BRJA 5L0IA 1OW6A 1ORYA 1AVOB 3AGUA 4JW1A 5D91A 2KJGA 2AWCA 1LVKA 4HE8D 3U9JA 2XS8A 5JT4A 4C7OA 1CGME 4K1OA 5D92A 2JX0A 1BR2A 3VM6A 1JR8A 5KYYA 4CSAA 2OG2A 2L9JA 2YL1A 1GS9A 2A6HF 3CEXA 1FMVA 3C8GB 3KKBA 5EGYA 2LP4A 1H7IA 3OWTA 4PJLA 3LAYA 3QVYA 4JEAA 2OU6A 4J7TA 3NMJA 4CBEA 4C3DA 2WVNA 4MVOA 4JC7A 1FFHA 1K04A 1OQCA 1SZIA 3ITFA 2YL0A 4WGZA 3OA1A 1D1BA 4RBNA 2A0UA 3K1HA 2C04A 3F46A 1C17M 3L8JA 4I1MA 5E3CA 3ZTZA 4IAOA 3S84A 4P9FA 4YL0A 1CGNA 1IZMA 3HNKA 3RQEA 4OINF 2HMZA 2ICWG 4DRHB 2VC9A 5A6JA 2M4EA 4N06A 3U3BA 4A2NB 2KNHA 3EFOA 4JJFA 3IQTA 3U9MA 3UR3C 3W8HA 1MQVA 3WHNA 3E70C 4U9EA 4LDKA 4X0RA 2LQGA 2Y3BA 4J30B 2Y3HA 2D5RB 5IY5C 2YHSA 1WGWA 4M63A 2FAPB 1UG7A 3Q7GA 4PR9A 2KGOA 1ZZPA 1OCCC 3JTLO 4MVZA 1ZW3A 1FTSA 1QKRA 1M57C 1TFKB 3EG9A 3F47A 3K7DA 2Y39A 3C8GA 4LDQA 3TK0A 3U0CA 2XLWA 3GM2A 5AC4A 1NU7D 2C03A 2Y3DA 3HKKA 1IW7F 2L6GA 1G8XA 2XL6A 1LIHA 2A6EF 4MW3A 4Q5SF 2GA0A 1MNDA 1T9KA 4WJ0A 1GGQA 1ORJA 1Z5ZA 2WB7A 4HFKB 2PBEA 3KH2A 2BE5F 3Q7LA 4KC9A 4D4NA 2YZSA 2OEVA 4DVYP 1QVXA 4NY3A 2Q00A 4C3BA 4EIYA 1PV3A 2A0BA 3PHF2 2R7SA 1D1AA 3KYIA 4NC3A 3V5XA 1UFBA 1E84A 3B29A 2I8BA 2PF4E 3S27A 4DXWA 1QQ3A 2ETSA 1YYXA 2XLDA 5B1BC 1C02A 3LEVA 3VRCA 4BEMJ 4DBQA 4XWJA 1O3UA 3JT1A 1O87A 3TJ6A 4Q7CA 2WVOA 4AE4A 5KYWB 1VMAA 2H7BA 3L1MA 4I1OB 3PCVA 4U5CE 4CDAA 3B0UX 2H7VC 2RSEB 2E87A 3K6BA 2OQMA 1MMDA 3VF0A 4BJ1A 2NUPB 1XZQA 1YA7O 3C8GD 4MVQA 4QI0A 3TJ5A 3C7JA 2VB6A 2YL3A 3EGXB 3JRTA 5L0JA 3JYYA 1RKCA 4HFFB 5B3SC 3K1IC 3RIPA 2L7AA 3ZIBA 2YLDA 4LLEA 1RKEB 3I5QA 4DRIB 4MVUA 1QPUA 3GWLA 3UGPA 1Z63A 4CS8C 4XPWA 3C62A 3U8VA 2AWYA 3NYJA 4DRJB 3O6XA 4JEBA 4BJTA 5JLIA 3B0VC 2F22A 2J7PD 2LD6A 3T4RA 2GWWA 3Q6MA 4JTAB 3T9OA 5JUAA 2GFHA 2J9WA 3DE8A 1BZ4A 2V3CC 3H2UA 4E7ZA 5T3TA 2LFDA 1NZEA 1Y6DA 3B0PA 1NLXA 4NQFA 5EHHA 2J0XA 3HNLA 4B6IA 1T5OA 2EIJC 2NUTB 4BJ5A 3WAQA 4MW8A 3U5SA 4XQ1A 2LK4A 3GEEA 3AOUA 2HMQA 2NSGA 2IOQA 4GQHA 3LJBA 4CIHA 1BDJB 1ORSC 2RD9A 3TD7A 3FAJA 5KYUA 5L0DA 4U5GA 3C8ZA 3DI5A 4XPYA 1Q0KA 4G7HF 1ZYRF 4ER9A 4QI2A 3JSEO 2VCAA 3CAXA 1AUEA 4YK5A 1G5ZA 2ZXRA 1VLTA 3QVZA 3W2VA 3ASOC 3GANA 2H8AA 4JTDB 3SNHA 5CIVA 1JAFA 2YWAA 3EPVA 3AG1C 4JKVA 3TOLA 2D4UA 3V5ZA 4EHPA 1OW8A 1NSGB 3FXHA 2GAQA 4JJGA 1U6HA 1Z23A 3SZRA 4YL1A 4BJ6A 1NU9C 1B68A 1EA8A 2VASA 4LERA 3L0IA 2MWQA 3A11A 4OD4A 1BR1A 4E7SA 3KL4A 3LEOA 1MMAA 4JE9A 2XLOA 1QZXA 2Q3TA 3DJNB 4EBBA 1CPQA 4FWVA 1Q0MA 1NFNA 4XTKA 1OKKA 5FZTA 3RVZA 3ECSA 1WWPA 3V7OA 5GPGB 1OCZC 4ZLCA 4PFOA 4IB4A 2P6VA 5BQIA 4C3EA 3M4BA 4JCHA 3DXJF 3T6BA 4CJGA 3SEOA 1PD1A 1JPNA 4CSAC 3L34A 2J46A 5T1DB 1AEPA 2QLAA 2ZXWC 4RD9A 3W4YA 1DOWA 2AVKA 5KYXB 5B3IA 2OKUA 4P9TA 5COMA 1T6QA 4MVRA 3SXYA 5DQZA 2YQYA 3EJNA 2R7OA 2AP3A 2LFFA 3EGDA 2YVKA 3MBGA 4GEHA 3SYNA 2ASRA 2XLVA 1FFTC 2WZFA 3U2MA 1V54C 1LKXA 1U0BB 5F5HA 5DQTA 3FDQA 2J45A 2HSBA 4XEFA 1A7VA 3AJMA 1H9GA 4AK9A 2WZGA 3ATPA 2PFDA 3DJUB 4FESA 1T6IA 2EPOA 1FR0A 2YKZA 1H9TA 2W4BA 4CDVA 1OKKD 4WABA 5B1AC 4MTFA 2YLGA 2R7UA 2VCCA 4N6HA 1D0XA 1QLEC 1ZHWA 4O6YA 4DVZA 2IYLD 5TJ5E 4U9DA 2EINC 3CZ6A 3LNMB 3X2QC 1G4US 2XXAB 3DD7A 3JSZA 5COFA 1TWAA 3AG2C 2Q9BA 3DM9B 1VYIA 5DS6A 2JD3A 2IXMA 5DVWA 4YN0B 1RJ9B 2J9UA 2XLEA 2ZXOA 3K66A 4MQ9F 2Z15A 3W2WA 5L3QA 4U5FE 2R7XA 1YJGA 2HZ8A 3KMIA 1V74B 2A68F 1W2WA 5KYNA 3QMKA 4JRZA 1WASA 2OEXA 2CYDA 2J7PA 3RVYA 3NG1A 1RXQA 4G0HA 2YRFA 3M79A 4YJWA 1BBHA 5DLJA 1YLMA 3MX3A 4IJJA 2R7VA 1LE4A 2UUHA 4LDRA 1Q0FA 1MNEA 1U89A 1ZHYA 5F5FA 1YYJA 1OW7A 2G3KA 1T6UA 4PJNA 3LS1A 3UMHA 3BEHA 256BA 2R7RA 2X0CA 1R5ID 3MLGA 5FCLA 2CCYA 1I5NA 2R7QA 1LE2A 3JRMO 3NYMA 1FAPB 3LESA 4JURI 5COGA 2XLHA 2XLMA 3IQ6A 3QTHA 3EH1A 1HMOA 2P0NA 3ABLC 3JYHA 3ZVRA 3GEIA 3N24A 4EWCA 3Q6NA 4CX9A 1VLSA 4EBJA 4I3MA 4J32B 3DAGA 5E3AA 1H6GA 2L6HA 4EBKA 3AG3C 4YT4A 4OIQF 1RJ9A 1OCOC 3RF3A 2R7WA 2FFHA 4MTGA 2P7VA 3EHMA 3UMKA 5DS4A 3U3FA 2KC3A 1Z3IX 1L3PA 2KW3C 4YT8A 1VTMP 1NBBA 3IQCA 2WVQA 3IHUA 2R05A 4O6MA 3RQGA 4JTCB 1KNYA 4E17A 1Q0DA 2J8WA 4NTBA 1I4YA 3RH3A 5EK0A 2L81A 2DI3A 1D0ZA 4GYTA 3K1IA 4XEKA 3S90A 4IWBA 2BC5A 4OIOF 1VYKA 2Y69C 2XL8A 2EPKX 1M2VB 4BG0A 3ZDLA 5KYWA 5DS5A 1CGOA 2B0JA 1WATA 1M6TA 1SMYF 2OJQA 3FMSA 4H4KC 1ZHZA 3M1CB 4L6RA 4MVMA 1PD0A 4W8PA 2NUPA 3S9OA 3WODF 4BJ5C 2CGEA 2YLIA 2GDCA 2ZD9A 3EZHA 3EQLF 5BQGA 5T3WA 2MYSA 2BL2A 3EGXA 3IQ5A 3N2ZB 2J9BA 3IEEA 1YAUO 1RKEA 2XS1A 4LLCA 4YWQA 1OR3A 3O10A 2YL7A 3S0XA 2G62A 1ZU5A 4CS9A 2XRHA 3HJCA 1CPRA 2XSEA 3C18A 3QZCA 3R7CA 4AL1A 1OCRC 3HNIA 1OXKA 1J8MF 2KYHA 4O7GA 3T6GB 3US6A 3ZG1A 2NSFA 5K0IA 1OR2A 3GM1A 3HLZA 3RW0A 1L7CA 2G3VA 2WZLA 3G50A 3ZQVA 5KYYB 3AGTA 3AQBA 4U5HA 5CI8A 3GORA 2NUTA 3LLKA 3SXZA 1SF8A 4G7ZF 3ASNC 1HMDA 1F1MA 4I44A 3TQOA 1Q0GA 1S7ZA 1LM3B 4JCZA 4ONSA 3UNGC 2HJMA 4YT2A 1NFOA 1QSPA 2WL8A 3KPHA 4BPMA 4XEVA 1KTMA 1MMNA 4XLPF 4G78A 3POVA 2EPNA 1ZVZA
chains in the Genus database with same CATH topology
1LE4A 1BZ4A 1H7IA 1LS4A 1AEPA 1LE2A 3R2PA 1LPEA 1OR2A 1B68A 1EA8A 3S84A 1YA9A 1NFNA 1EQ1A 1NFOA 2KC3A 1OR3A 1GS9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LE4 A;  1BZ4 A;  1H7I A;  1LS4 A;  1AEP A;  1LE2 A;  3R2P A;  1LPE A;  1OR2 A;  1B68 A;  1EA8 A;  3S84 A;  1YA9 A;  1NFN A;  1EQ1 A;  1NFO A;  2KC3 A;  1OR3 A;  1GS9 A; 
#chains in the Genus database with same CATH topology
 4H54 A;  3V5Y A;  2QE9 A;  1TFO B;  2X51 A;  1JPJ A;  2KQ9 A;  2EPM X;  4IAQ A;  1GQA A;  3G4X A;  1LS4 A;  5CI9 A;  5L3V A;  3DWW A;  3G4Z A;  4JVS A;  2W45 A;  3U2L A;  3IPM O;  3TUL A;  3DE9 A;  1ZHX A;  1YDI A;  4KNW A;  5HSW A;  4NCQ A;  3DKA A;  1PCX A;  2A69 F;  1YVI A;  4FX5 A;  3EFO B;  5L0G A;  5L0H A;  3OEO A;  1FNT c;  2AU5 A;  2ZPA A;  4J7Y A;  1A0B A;  5AGF A;  4PK4 A;  2XM0 A;  4P6I C;  3CSK A;  1RCP A;  4Q4Z F;  2DYR C;  4CDY A;  2O9X A;  1JRA A;  2DGJ A;  5AC5 A;  4HEA J;  3LLI A;  4O6N A;  3NMI A;  1K40 A;  3NRH A;  4F4B A;  3EG9 B;  3NKE A;  4ULW A;  3C63 A;  2HSQ A;  2Y3G A;  2OJE D;  1E86 A;  2NG1 A;  2QY9 A;  1OXB A;  1Y4C A;  2J9V A;  3AQC A;  3GM3 A;  1Z7Q c;  3ZTM A;  2R03 A;  4E18 A;  5E33 A;  1S05 A;  1VOM A;  4U5D E;  5L0F A;  1D0Y A;  4MTO A;  2HS5 A;  2HFI A;  4R32 A;  2PNO A;  3EH2 A;  2DYS C;  1WTY A;  1A7E A;  2W9Y A;  4JIO A;  4K7B A;  1EKY A;  5KYX A;  3ZSU A;  3K33 A;  2V26 A;  3RKO F;  4CIP A;  1HE9 A;  2VCB A;  1GM5 A;  4G7O F;  3VAY A;  3E9V A;  3H65 A;  3UMI A;  3KYJ A;  4XLN F;  4LAC B;  3SXM A;  3ZC4 A;  3O55 A;  1EQ1 A;  4MVS A;  2L6F A;  5A69 A;  3N0T A;  4JZA A;  4DJ9 A;  2EPL X;  5A6B A;  2VH3 A;  2Q7R A;  3CQZ A;  3RQF A;  5JSL A;  4AE4 B;  1BR4 A;  3T6J A;  2R7T A;  2IXO A;  1V55 C;  4PFP A;  3W8I A;  1XZP A;  3L8I A;  3B71 A;  4O79 A;  3A9C A;  2YEV A;  4WGY A;  5JRA A;  2OCC C;  2PX3 A;  3DMD A;  2OOC A;  3EHN A;  4OD5 A;  1TKN A;  3H2V A;  1LI7 A;  5A6K A;  3FHD A;  1LI5 A;  3DAF A;  3FAP B;  4AX2 A;  1K05 A;  5BQH A;  3QW1 A;  2IXP A;  2KSF A;  4EUK B;  3SP1 A;  1E85 A;  2XXA A;  3MFN A;  1YA9 A;  2CW0 F;  1JOG A;  3HNJ A;  2HV6 A;  1JMW A;  2HJ3 A;  3SXK A;  1M2O A;  3GOD A;  3NMK A;  3PDM P;  1ZU4 A;  3NYL A;  4RDA A;  4OIR F;  2HKV A;  3VYW A;  4UDV A;  4E0H A;  2CNW A;  2HV7 A;  2IBF A;  1LPE A;  2IM8 A;  3GWN A;  4FAP B;  4DBR A;  4IAR A;  5A6B D;  4N6C A;  2J0W A;  4ANJ A;  5A6A A;  5JVE A;  3GEH A;  1A41 A;  1KU2 A;  3HTK C;  3NDB B;  2Q9C A;  1G4W R;  2UUI A;  3ABM C;  3RFY A;  1ST6 A;  2LSE A;  2R02 A;  4W8K A;  4AL0 A;  2P61 A;  3R2P A;  1NG1 A;  5KYU B;  1M56 C;  4DOZ A;  2PP4 A;  1SR2 A;  4OIP F;  1YZC A;  3X1O A;  3DM5 A;  1VK5 A;  1YZA A;  4CS8 A;  3ABK C;  1XWJ A;  4PAC A;  5JP7 A;  2KK1 A;  3TOM A;  4IGG A;  4YT5 A;  1C03 A;  2QNL A;  4KI2 A;  4MND A;  1I4Z A;  2A1D D;  2TMV P;  1WOL A;  2H7O A;  4BJ6 C;  1E2X A;  4CS7 A;  1EI7 A;  1TR2 A;  2HUJ A;  1VB5 A;  4N4W A;  2Q9A A;  4PJJ A;  2Q4F A;  3AG4 C;  3MYI A;  3U8P A;  2I15 A;  4NTF A;  3B9Q A;  3FOP A;  4E0I A;  3NKD A;  5BUO A;  4Z9H A;  3ZQY A;  3ZWI A;  5L0C A;  2LIG A;  1TWH A;  3PMR A;  4IRU A;  2CNW D;  3JCU Q;  4U5E E;  1D1C A;  5HV9 A;  3LS0 A;  4Z9J A;  3M15 A;  1TQG A;  1SYQ A;  1HW1 A;  2IXN A;  2LCH A;  3O39 A;  4CS9 C;  4D4X A;  4EKW A;  2R9R B;  1R4T A;  2XM4 A;  4C7O B;  2W4M A;  3LUT B;  4QDL A;  3UGO A;  4KNV A;  1T01 A;  2EIK C;  2P1A A;  2PX0 A;  3QW0 A;  1N1C A;  2NPU A;  3MYF A;  1V4A A;  4K0D A;  2MHR A;  1M2V A;  1FMW A;  1TWC A;  3FOO A;  3JZ0 A;  4NTA A;  2QTV A;  3S29 A;  1YAR O;  4Z9I A;  1WN0 A;  1J8Y F;  1Z6A A;  2ZXP A;  4KBL A;  1LS1 A;  1HW2 A;  3RYL A;  1HE1 A;  1MMG A;  1ZHT A;  2M64 A;  2XL4 A;  4ZLD A;  2B0H A;  2R25 A;  2JPU A;  2QUP A;  3EZI A;  1RMV A;  4XPX A;  1A7D A;  3LNR A;  5E2Q A;  2CDQ A;  3M4C A;  2FGY A;  1HY5 A;  2DB4 A;  5JS5 A;  4U5B E;  1DOV A;  3I4U A;  3EGD B;  1APC A;  3J06 A;  1O5H A;  4A4A A;  1TWG A;  3DZA A;  4ULV A;  3S28 A;  4BEJ A;  3I5P A;  1ZW2 A;  3FVY A;  1E83 A;  3WG7 C;  4YL3 A;  2EIM C;  2EIL C;  5F28 E;  4CJO A;  4PJM A;  4MS2 A;  3BRJ A;  5L0I A;  1OW6 A;  1ORY A;  1AVO B;  3AGU A;  4JW1 A;  5D91 A;  2KJG A;  2AWC A;  1LVK A;  4HE8 D;  3U9J A;  2XS8 A;  5JT4 A;  4C7O A;  1CGM E;  4K1O A;  5D92 A;  2JX0 A;  1BR2 A;  3VM6 A;  1JR8 A;  5KYY A;  4CSA A;  2OG2 A;  2L9J A;  2YL1 A;  1GS9 A;  2A6H F;  3CEX A;  1FMV A;  3C8G B;  3KKB A;  5EGY A;  2LP4 A;  1H7I A;  3OWT A;  4PJL A;  3LAY A;  3QVY A;  4JEA A;  2OU6 A;  4J7T A;  3NMJ A;  4CBE A;  4C3D A;  2WVN A;  4MVO A;  4JC7 A;  1FFH A;  1K04 A;  1OQC A;  1SZI A;  3ITF A;  2YL0 A;  4WGZ A;  3OA1 A;  1D1B A;  4RBN A;  2A0U A;  3K1H A;  2C04 A;  3F46 A;  1C17 M;  3L8J A;  4I1M A;  5E3C A;  3ZTZ A;  4IAO A;  3S84 A;  4P9F A;  4YL0 A;  1CGN A;  1IZM A;  3HNK A;  3RQE A;  4OIN F;  2HMZ A;  2ICW G;  4DRH B;  2VC9 A;  5A6J A;  2M4E A;  4N06 A;  3U3B A;  4A2N B;  2KNH A;  3EFO A;  4JJF A;  3IQT A;  3U9M A;  3UR3 C;  3W8H A;  1MQV A;  3WHN A;  3E70 C;  4U9E A;  4LDK A;  4X0R A;  2LQG A;  2Y3B A;  4J30 B;  2Y3H A;  2D5R B;  5IY5 C;  2YHS A;  1WGW A;  4M63 A;  2FAP B;  1UG7 A;  3Q7G A;  4PR9 A;  2KGO A;  1ZZP A;  1OCC C;  3JTL O;  4MVZ A;  1ZW3 A;  1FTS A;  1QKR A;  1M57 C;  1TFK B;  3EG9 A;  3F47 A;  3K7D A;  2Y39 A;  3C8G A;  4LDQ A;  3TK0 A;  3U0C A;  2XLW A;  3GM2 A;  5AC4 A;  1NU7 D;  2C03 A;  2Y3D A;  3HKK A;  1IW7 F;  2L6G A;  1G8X A;  2XL6 A;  1LIH A;  2A6E F;  4MW3 A;  4Q5S F;  2GA0 A;  1MND A;  1T9K A;  4WJ0 A;  1GGQ A;  1ORJ A;  1Z5Z A;  2WB7 A;  4HFK B;  2PBE A;  3KH2 A;  2BE5 F;  3Q7L A;  4KC9 A;  4D4N A;  2YZS A;  2OEV A;  4DVY P;  1QVX A;  4NY3 A;  2Q00 A;  4C3B A;  4EIY A;  1PV3 A;  2A0B A;  3PHF 2;  2R7S A;  1D1A A;  3KYI A;  4NC3 A;  3V5X A;  1UFB A;  1E84 A;  3B29 A;  2I8B A;  2PF4 E;  3S27 A;  4DXW A;  1QQ3 A;  2ETS A;  1YYX A;  2XLD A;  5B1B C;  1C02 A;  3LEV A;  3VRC A;  4BEM J;  4DBQ A;  4XWJ A;  1O3U A;  3JT1 A;  1O87 A;  3TJ6 A;  4Q7C A;  2WVO A;  4AE4 A;  5KYW B;  1VMA A;  2H7B A;  3L1M A;  4I1O B;  3PCV A;  4U5C E;  4CDA A;  3B0U X;  2H7V C;  2RSE B;  2E87 A;  3K6B A;  2OQM A;  1MMD A;  3VF0 A;  4BJ1 A;  2NUP B;  1XZQ A;  1YA7 O;  3C8G D;  4MVQ A;  4QI0 A;  3TJ5 A;  3C7J A;  2VB6 A;  2YL3 A;  3EGX B;  3JRT A;  5L0J A;  3JYY A;  1RKC A;  4HFF B;  5B3S C;  3K1I C;  3RIP A;  2L7A A;  3ZIB A;  2YLD A;  4LLE A;  1RKE B;  3I5Q A;  4DRI B;  4MVU A;  1QPU A;  3GWL A;  3UGP A;  1Z63 A;  4CS8 C;  4XPW A;  3C62 A;  3U8V A;  2AWY A;  3NYJ A;  4DRJ B;  3O6X A;  4JEB A;  4BJT A;  5JLI A;  3B0V C;  2F22 A;  2J7P D;  2LD6 A;  3T4R A;  2GWW A;  3Q6M A;  4JTA B;  3T9O A;  5JUA A;  2GFH A;  2J9W A;  3DE8 A;  1BZ4 A;  2V3C C;  3H2U A;  4E7Z A;  5T3T A;  2LFD A;  1NZE A;  1Y6D A;  3B0P A;  1NLX A;  4NQF A;  5EHH A;  2J0X A;  3HNL A;  4B6I A;  1T5O A;  2EIJ C;  2NUT B;  4BJ5 A;  3WAQ A;  4MW8 A;  3U5S A;  4XQ1 A;  2LK4 A;  3GEE A;  3AOU A;  2HMQ A;  2NSG A;  2IOQ A;  4GQH A;  3LJB A;  4CIH A;  1BDJ B;  1ORS C;  2RD9 A;  3TD7 A;  3FAJ A;  5KYU A;  5L0D A;  4U5G A;  3C8Z A;  3DI5 A;  4XPY A;  1Q0K A;  4G7H F;  1ZYR F;  4ER9 A;  4QI2 A;  3JSE O;  2VCA A;  3CAX A;  1AUE A;  4YK5 A;  1G5Z A;  2ZXR A;  1VLT A;  3QVZ A;  3W2V A;  3ASO C;  3GAN A;  2H8A A;  4JTD B;  3SNH A;  5CIV A;  1JAF A;  2YWA A;  3EPV A;  3AG1 C;  4JKV A;  3TOL A;  2D4U A;  3V5Z A;  4EHP A;  1OW8 A;  1NSG B;  3FXH A;  2GAQ A;  4JJG A;  1U6H A;  1Z23 A;  3SZR A;  4YL1 A;  4BJ6 A;  1NU9 C;  1B68 A;  1EA8 A;  2VAS A;  4LER A;  3L0I A;  2MWQ A;  3A11 A;  4OD4 A;  1BR1 A;  4E7S A;  3KL4 A;  3LEO A;  1MMA A;  4JE9 A;  2XLO A;  1QZX A;  2Q3T A;  3DJN B;  4EBB A;  1CPQ A;  4FWV A;  1Q0M A;  1NFN A;  4XTK A;  1OKK A;  5FZT A;  3RVZ A;  3ECS A;  1WWP A;  3V7O A;  5GPG B;  1OCZ C;  4ZLC A;  4PFO A;  4IB4 A;  2P6V A;  5BQI A;  4C3E A;  3M4B A;  4JCH A;  3DXJ F;  3T6B A;  4CJG A;  3SEO A;  1PD1 A;  1JPN A;  4CSA C;  3L34 A;  2J46 A;  5T1D B;  1AEP A;  2QLA A;  2ZXW C;  4RD9 A;  3W4Y A;  1DOW A;  2AVK A;  5KYX B;  5B3I A;  2OKU A;  4P9T A;  5COM A;  1T6Q A;  4MVR A;  3SXY A;  5DQZ A;  2YQY A;  3EJN A;  2R7O A;  2AP3 A;  2LFF A;  3EGD A;  2YVK A;  3MBG A;  4GEH A;  3SYN A;  2ASR A;  2XLV A;  1FFT C;  2WZF A;  3U2M A;  1V54 C;  1LKX A;  1U0B B;  5F5H A;  5DQT A;  3FDQ A;  2J45 A;  2HSB A;  4XEF A;  1A7V A;  3AJM A;  1H9G A;  4AK9 A;  2WZG A;  3ATP A;  2PFD A;  3DJU B;  4FES A;  1T6I A;  2EPO A;  1FR0 A;  2YKZ A;  1H9T A;  2W4B A;  4CDV A;  1OKK D;  4WAB A;  5B1A C;  4MTF A;  2YLG A;  2R7U A;  2VCC A;  4N6H A;  1D0X A;  1QLE C;  1ZHW A;  4O6Y A;  4DVZ A;  2IYL D;  5TJ5 E;  4U9D A;  2EIN C;  3CZ6 A;  3LNM B;  3X2Q C;  1G4U S;  2XXA B;  3DD7 A;  3JSZ A;  5COF A;  1TWA A;  3AG2 C;  2Q9B A;  3DM9 B;  1VYI A;  5DS6 A;  2JD3 A;  2IXM A;  5DVW A;  4YN0 B;  1RJ9 B;  2J9U A;  2XLE A;  2ZXO A;  3K66 A;  4MQ9 F;  2Z15 A;  3W2W A;  5L3Q A;  4U5F E;  2R7X A;  1YJG A;  2HZ8 A;  3KMI A;  1V74 B;  2A68 F;  1W2W A;  5KYN A;  3QMK A;  4JRZ A;  1WAS A;  2OEX A;  2CYD A;  2J7P A;  3RVY A;  3NG1 A;  1RXQ A;  4G0H A;  2YRF A;  3M79 A;  4YJW A;  1BBH A;  5DLJ A;  1YLM A;  3MX3 A;  4IJJ A;  2R7V A;  1LE4 A;  2UUH A;  4LDR A;  1Q0F A;  1MNE A;  1U89 A;  1ZHY A;  5F5F A;  1YYJ A;  1OW7 A;  2G3K A;  1T6U A;  4PJN A;  3LS1 A;  3UMH A;  3BEH A;  256B A;  2R7R A;  2X0C A;  1R5I D;  3MLG A;  5FCL A;  2CCY A;  1I5N A;  2R7Q A;  1LE2 A;  3JRM O;  3NYM A;  1FAP B;  3LES A;  4JUR I;  5COG A;  2XLH A;  2XLM A;  3IQ6 A;  3QTH A;  3EH1 A;  1HMO A;  2P0N A;  3ABL C;  3JYH A;  3ZVR A;  3GEI A;  3N24 A;  4EWC A;  3Q6N A;  4CX9 A;  1VLS A;  4EBJ A;  4I3M A;  4J32 B;  3DAG A;  5E3A A;  1H6G A;  2L6H A;  4EBK A;  3AG3 C;  4YT4 A;  4OIQ F;  1RJ9 A;  1OCO C;  3RF3 A;  2R7W A;  2FFH A;  4MTG A;  2P7V A;  3EHM A;  3UMK A;  5DS4 A;  3U3F A;  2KC3 A;  1Z3I X;  1L3P A;  2KW3 C;  4YT8 A;  1VTM P;  1NBB A;  3IQC A;  2WVQ A;  3IHU A;  2R05 A;  4O6M A;  3RQG A;  4JTC B;  1KNY A;  4E17 A;  1Q0D A;  2J8W A;  4NTB A;  1I4Y A;  3RH3 A;  5EK0 A;  2L81 A;  2DI3 A;  1D0Z A;  4GYT A;  3K1I A;  4XEK A;  3S90 A;  4IWB A;  2BC5 A;  4OIO F;  1VYK A;  2Y69 C;  2XL8 A;  2EPK X;  1M2V B;  4BG0 A;  3ZDL A;  5KYW A;  5DS5 A;  1CGO A;  2B0J A;  1WAT A;  1M6T A;  1SMY F;  2OJQ A;  3FMS A;  4H4K C;  1ZHZ A;  3M1C B;  4L6R A;  4MVM A;  1PD0 A;  4W8P A;  2NUP A;  3S9O A;  3WOD F;  4BJ5 C;  2CGE A;  2YLI A;  2GDC A;  2ZD9 A;  3EZH A;  3EQL F;  5BQG A;  5T3W A;  2MYS A;  2BL2 A;  3EGX A;  3IQ5 A;  3N2Z B;  2J9B A;  3IEE A;  1YAU O;  1RKE A;  2XS1 A;  4LLC A;  4YWQ A;  1OR3 A;  3O10 A;  2YL7 A;  3S0X A;  2G62 A;  1ZU5 A;  4CS9 A;  2XRH A;  3HJC A;  1CPR A;  2XSE A;  3C18 A;  3QZC A;  3R7C A;  4AL1 A;  1OCR C;  3HNI A;  1OXK A;  1J8M F;  2KYH A;  4O7G A;  3T6G B;  3US6 A;  3ZG1 A;  2NSF A;  5K0I A;  1OR2 A;  3GM1 A;  3HLZ A;  3RW0 A;  1L7C A;  2G3V A;  2WZL A;  3G50 A;  3ZQV A;  5KYY B;  3AGT A;  3AQB A;  4U5H A;  5CI8 A;  3GOR A;  2NUT A;  3LLK A;  3SXZ A;  1SF8 A;  4G7Z F;  3ASN C;  1HMD A;  1F1M A;  4I44 A;  3TQO A;  1Q0G A;  1S7Z A;  1LM3 B;  4JCZ A;  4ONS A;  3UNG C;  2HJM A;  4YT2 A;  1NFO A;  1QSP A;  2WL8 A;  3KPH A;  4BPM A;  4XEV A;  1KTM A;  1MMN A;  4XLP F;  4G78 A;  3POV A;  2EPN A;  1ZVZ A; 
#chains in the Genus database with same CATH homology
 1LE4 A;  1BZ4 A;  1H7I A;  1LS4 A;  1AEP A;  1LE2 A;  3R2P A;  1LPE A;  1OR2 A;  1B68 A;  1EA8 A;  3S84 A;  1YA9 A;  1NFN A;  1EQ1 A;  1NFO A;  2KC3 A;  1OR3 A;  1GS9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...