4I1MA

Crystal structure of the legionella pneumophila gap domain of lepb
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
297
structure length
285
Chain Sequence
SILELKPLTLLMTSSTSFSETINQWADILKTTDMEKFSFDSNPINLLELVKQFNLYVDELAITCEANNVWATPNLFALYDNSGGEAIHGHAFVPYYKESIVLRRLFTVDPNTFNLSRFAAFEGPCQLYCAAHADSAWVKIQTLLTLGNGIINTLKIIKQAQAFGIDEAVTENLKALKEQFIAFQLAEADIKESLKAPSNKESEFFYPIDEKALAKMNGYQLATICLEELNSPKPSPLIERILSNKKFWKRINSAFESGVFKGRTDDPAGKIAKIREWHQLLQISG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LepB
publication title Mechanism of Rab1b deactivation by the Legionella pneumophila GAP LepB.
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila
molecule tags Hydrolase
total genus 104
structure length 285
sequence length 297
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18172 LepB_GAP_N LepB GAP domain N-terminal subdomain
A PF18227 LepB_GAP_C LepB GAP domain C-terminal subdomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1700 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4i1mA01
1.25.40.830 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4i1mA02
4I1OB 4I1MA 4IRUA 4JVSA 4JW1A
chains in the Genus database with same CATH superfamily
4PJLA 4HORA 1VOMA 2IOQA 1BBHA 2IEJA 5DS6A 3LEWA 1U89A 3PDNA 5LCWJ 3VAYA 3L82A 4C0MA 3ATPA 1EI7A 3LXUX 3AU5A 4YN0B 5CECB 3PE4A 3POVA 3AG1C 3C62A 3PRZA 3LS0A 3FDQA 2WVNA 3ZHEB 1APCA 2Q7RA 4EZLA 4M7CA 3FUIA 2HV6A 2F8YA 5LX8A 5FJYA 3SGHA 4O60A 3U3FA 1TJFA 1WY6A 1NL4A 4GA0A 3UUXA 2L9BA 4RG9A 1ZU5A 1A7EA 2R7RA 2PP4A 4NQFA 1QBQA 3ABME 4HBDA 5EYPF 2J9WA 3CSFA 4EHMA 2WXJA 4G11A 3LLIA 4CGVA 4LSZE 2PX0A 3U4TA 3FTWA 3U64A 5LFAA 3IHVA 1Z3IX 3FTVA 2GFHA 2WVIA 1DNPA 4XWJA 3KL4A 4RD9A 4J8DA 3K1IC 5J90A 3AQBA 4N5QA 1UOHA 3ZRHA 5CEAA 5B1BE 3H65A 2VASA 3R7QA 5CMWA 4YJWA 3OTNA 2OV8A 1OWMA 2TMVP 4AL1A 1FT1A 3FMSA 4G24A 3ZWIA 3Q4AB 1S63A 5D2MC 2LUHA 3Q7AA 1QQ3A 5ENQD 3MV3B 3AU4A 2P1AA 1XZQA 3GM1A 3UMHA 2G3KA 2XRHA 3O55A 5BQHA 4UDVA 4J8FA 3FU0A 1V54C 4Q69A 1V54E 3KEAA 3OAWA 4U07A 5HKPA 2A5UA 2KZTA 3CHQA 2OOCA 2QZAA 4OIQF 2XLMA 4B93B 3FOPA 3B0PA 2LFFA 3ABKE 3LDZA 4WGZA 4WWNA 1TNBA 4L7TA 4UWFA 4CIHA 3GODA 2PQNA 4HE8D 3PUJA 3CHMA 3DJUB 2XLVA 1IZMA 4E0IA 2XZDG 3PZDA 5H7PA 1NBBA 2XENA 1K3ZD 2OEXA 1H19A 3QZCA 4AJWA 3FU3A 3LEOA 3LNRA 3EHQA 2GRPB 3T9OA 4JB8P 1MMNA 3OXGA 1OR2A 2EILE 1JWFA 3UTMA 5FCLA 1MQVA 3EHNA 2P9KG 3O10A 2XLWA 5KBAA 1K1BA 3V30A 5HV9A 3K7DA 3KSQA 3JT1A 4F4BA 3UMVA 3B13A 1LD8A 1Z5SC 1PY1A 4TUMA 2OJQA 1OCCE 4CCAA 4MVOA 1ZHXA 3ZYLA 3M4CA 4J8EA 2VJ8A 3PEUB 3HDXA 4DJ9A 3L9TA 4YDYA 3U9JA 3GM2A 4U0UA 3LJ3A 4FX5A 5ENRD 4BTAA 4ANUA 2AVPA 5CHEE 3U2MA 4MS2A 3B7BA 3DAFA 4DX1A 2OOEA 5FZTA 1JR8A 3EUVA 2IONA 3QW1A 4YWQA 2EIME 3EH2A 1ZVZA 3NMKA 2NUTB 2L6BA 3EJNA 3ULQA 3CK8A 3GZ1A 4PH4B 3X2QE 3FEXA 5KJMA 1F1MA 5B3SC 4B89A 2FAPB 3IQTA 2XPYA 1PD0A 4F1SA 5E2QA 5COFA 2WL8A 3ZVRA 4ANVA 1HMDA 2YZSA 4YDWA 5KYXB 4EHPA 3RO2A 1U3DA 4DX5D 1E8WA 4WNFA 5A23A 3FOOA 1D9SA 1NZNA 4J7TA 3ASHA 4IN3B 4HOSA 4ILHB 2CGEA 2WXIA 4O7GA 1JCQA 1NA3A 2ICWG 3EGDA 3LY8A 3MKQB 2DB4A 3UNGC 2XXAB 4KZ0A 1ZBPA 4U5EE 4U5DE 4HNAD 3ZGQA 3U5SA 3PZ4A 2BTDA 3KS2A 2QNLA 3HNJA 2Q9BA 1O87A 1Z6AA 2CHXA 2RG8A 5LOZA 1M2VA 1UG7A 1O5HA 2V5QC 2UY1B 4D4XA 1PC2A 3DSTA 4JD2G 2YQYA 3VM6A 4JHRA 1H0AA 3JCKC 4KT6B 3UKRG 5BQGA 4O1PA 3PHF2 3RQFA 1N1CA 4LLCA 2Y3GA 4LRZA 4P6IC 4PR9A 4RQIA 2ASRA 3B7UX 2AP3A 5D66A 2P61A 3FAJA 1SA4A 3SD5A 1ELWA 2FI7A 1G3NB 2OEVA 3TAXA 1HZ4A 4HFKB 4TXPA 4JTDB 5HQ8A 1MNEA 5EHHA 2A6EF 4JVSA 4EUKB 4LACB 2EIKE 2VTBB 3FVYA 2QLAA 4GTQA 1ZW3A 2W9YA 3B9QA 3FUMA 3U0CA 2KCKA 3LJNA 4N6CA 2NUPA 3JYHA 2M63A 1LI5A 1N95A 2PL2A 4K0RA 3CZ6A 3JRTA 1SVXA 3ITFA 2KBXA 3EZHA 1ORSC 2GGFA 2I1KA 3P1UA 5D92A 1YYHA 5EGYA 2LAHA 4ATGA 5L0IA 4CS8A 3QOUA 1ZW2A 3EIJA 1D8EA 4HEAJ 3W8IA 2OVFA 2XGMA 1E7VA 4BWRA 1WATA 3IEGA 4JJGA 1WM5A 2M64A 4IAQA 3OXFA 3VYWA 1T6QA 1ZU2A 1P5QA 3ULYA 4IAOA 5JP7A 3FTYA 4U96D 2W45A 3UGOA 4AE4A 4XZ4A 2LO6A 3BEHA 4N5CA 2NG1A 1WOLA 2J0WA 2EPNA 2H7OA 4OVVA 3NZUA 2OCCE 3AG3E 3ML9A 1N4PA 1D8DA 3OEOA 4ULVA 4E85A 4ZLDA 2GRMA 2VSOE 2XHEA 5F28E 4DX7D 5HSWA 1UJKA 3QWPA 2AWIA 4BX8A 3K66A 4RG6A 5A7DB 4BJ1A 3FH8A 5G05C 4AM9A 4G23A 3DKAA 1ORJA 3ZTZA 1G5ZA 4AIFA 2YVKA 4UWGA 5JJ6A 4DLQA 4HRMB 4I43A 3SEOA 2J7PD 4XEFA 2IOSA 2H7BA 3D9LA 2FO1E 2NXPA 5B3IA 1TN8A 1TYQG 4CSAC 2WXRA 4YL0A 3PNTB 4XPYA 3DM5A 4XLPF 3Q6NA 2LXMA 3U9WA 3AG4C 4GTTA 5KCMA 3BRJA 4HOQA 3DEPA 3ZPJA 1FFTC 3I5QA 1Z6TA 4C3EA 5EYLA 1QKRA 4FADA 1E7UA 4ZLCA 4Z9IA 3MX3A 4YL1A 3FEYA 2A4ZA 4AX2A 3ASFA 2GRRB 4C3DA 2R7SA 1D1AA 2C04A 1LS1A 5D0OD 2PFDA 5JSLA 4DVZA 4FULA 5DLJA 3SYNA 2PM7A 3JQ1A 1D0XA 1WG0A 3D9MA 3TGOA 1TNOA 3HRAA 1N4SA 5GPGB 4XTKA 4AY5A 4V3IA 3FUKA 5AENA 3NKDA 3T9KA 1Q0KA 5DVWA 1WN0A 3SXKA 3B0UX 3AS8A 5ITZF 1VB5A 4KYOB 5DBKA 2J9UA 2RSEB 5KYWB 4G7OF 3PS6A 3M1CB 2XRZA 4WNGA 2AXZA 3SF4A 3SFYA 3UPVA 1JPJA 3E70C 4PK4A 5AC5A 1WDYA 3UT4A 3EG9A 4HB5A 4BT9A 2Y3AA 4MS6A 4R7LA 3CVLA 5KYUA 3UMIA 3TJPA 2YINA 1TKNA 4WNDA 4DI3A 2H8AA 5FZRA 2MWQA 2IQCA 2EPOA 2OQMA 4CIPA 3V2OA 4XI0A 4EECA 1SMYF 5LP0A 3FDHA 3TWXA 4U0ZA 2EQXA 2FEZA 1RJ9B 4LCTA 4WWOA 2IYLD 3RU0A 3FUFA 5HS0A 2WXPA 2X51A 3CVQA 5DQTA 2YNQA 3JTLO 4EPZA 4BTBA 2P0NA 2ZXWE 1MX6A 3IHUA 1OKKD 3IQ5A 3S28A 5L0JA 2DYSC 2WXQA 3U3WA 3K6BA 3VLEA 2IF4A 4KXKB 4HFFB 4GTRA 1YVIA 4YDOA 3GZ2A 5JHAA 2D4UA 2PF4E 2JEKA 5FT9A 3AOUA 4BY6A 4N2QA 5KNHD 3UIOC 2DZOA 2YL1A 4GMLA 4AXHA 4MQ9F 4ACKA 3UM3A 4IJJA 5J08A 2J46A 4GMRA 4K5AB 4D10C 2WXLA 1MJ0A 3JUIA 3SO8A 3ZHEA 2W4MA 1D0ZA 4I1OB 2AW6A 4JEUA 2AXUA 4U7EB 3AS5A 3APDA 4PS3A 1TQGA 3C8ZA 3NRHA 1M2OA 2R5SA 2YLGA 1KNYA 5G2NA 1OW8A 3KSLA 1T6UA 4UI9C 3HYMB 5KNGA 1PCXA 3C18A 2PNOA 1OCZC 1OWOA 4FC8A 5IY5E 3AG2C 3DBSA 4W8KA 1JOGA 2RKKA 4JHJA 3GEEA 1ZZPA 1I4ZA 2LQGA 2P7VA 2E2EA 2CNWA 3RIPA 2VCCA 2HS5A 2IXNA 2R2LA 3HVEA 3R9MA 4LUNU 5G04J 4MTOA 2QYUA 3W9GA 4KBQA 3C5RA 4K03A 3G4ZA 3LUTB 3ZIMA 1CGME 4HI8A 2YL0A 3UXGA 4K0DA 5FTPA 3O6XA 2OG2A 4ILGA 2P9SG 3D3MA 4PACA 5C1DA 2ZGDA 1YJGA 3SBTB 1AUEA 4OIPF 1OXBA 2A69F 3PDMP 3FU6A 1RMVA 3DRAA 3S2AA 4L23A 3DD7A 3E37A 2BE5F 4I1MA 1SW6A 4YK5A 3QB2A 3EQLF 2XRYA 1OCOC 5KJLA 1RW2A 3TG5A 4XKBA 2ETSA 1ZHZA 4MKTA 3ZFWA 1VMAA 3ECSA 3L1MA 3VTYA 3QARA 1DVPA 2R7OA 3G2WA 4G78A 2EPLX 2XCBA 3ZYMA 3HKKA 2LIGA 3E9VA 4L9PA 3E4BA 1MQSA 1TNYA 3W2VA 5EIDA 1FAPB 4IGGA 3QC1A 2XPIA 5E76A 3S9OA 4WABA 1E84A 3Q73A 2ETAA 4GQHA 3D9HA 2L6FA 2R7VA 3H2UA 2V3CC 1OW6A 3U8VA 3KAEA 3DSUA 3JUEA 4I6JA 3CVWA 3RKVA 3HXFA 5EIBE 4YT2A 1AWCB 2YLIA 2EIJE 1YA7O 5BV0A 3CAXA 2P2CP 1HW2A 5ANLA 5CRUA 1AEPA 4PJMA 5CIVA 1WTYA 2DWZA 3FUNA 1G8XA 1FT2A 2R7UA 1ZHWA 3Q6MA 3AJIA 4MBGA 1KT0A 2F37A 3E33A 2XEHA 5BUZA 2L6JA 3ABMC 3V7OA 1U6HA 2LXLA 1U3CA 1J8MF 3RO3A 2AJAA 3QWWA 4I17A 1UJJA 4GYOA 5BQIA 1OT8A 2BC5A 5CEDB 3IXEA 4XKCA 2NUTA 4E6HA 1A17A 4HQDA 4CT0A 4IRUA 1N0RA 3C72A 3LKUA 2Y3DA 5B1BC 1S70B 3ASOE 2R7WA 3Q47B 3Q49B 4FP7A 4XX5A 4BFRA 3U66A 2X3MA 2A0UA 2Y3HA 4ANWA 5CI8A 2H6HA 4XQ1A 3PUKA 3CHRA 4QQIA 1TEZA 2ZD9A 3IHYA 3CVUA 4NIKA 2A68F 4L2LA 5A6BA 3QDNA 4CS9C 4NTBA 2WB2A 4K1OA 3RQEA 2PM6A 2NPUA 3G50A 3DXKG 2VC9A 4JEAA 4EKWA 1K1AA 5DS5A 4I44A 4ABNA 5JVEA 4BX9A 3FULA 3Q7LA 1OW7A 3CVXA 5ENNA 2EPKX 1A41A 1XWJA 2PQRA 3RJVA 2LFDA 1DOVA 4QDLA 1KPSB 2XXAA 2H7VC 4I9EA 3EFOB 4DI4A 1NZEA 2VGXB 4W9RA 3ABKC 2D5RB 3DWWA 2KATA 3RVZA 4NCQA 4JKVA 2YHCA 3BUAA 1I4YA 4CDRA 3PVLA 4ONSA 2UY1A 2XLHA 5BT1A 4LEUA 2LK4A 2LNIA 3V5ZA 2AWYA 2QTVA 3EZIA 4U63A 4BG0A 1BDJB 2R05A 5AIJA 4GYTA 4MVZA 3JXIA 3MCXA 3B71A 2R17C 3GW4A 2EILC 2HM8A 2HZ8A 1OXJA 1TWGA 2V0PA 2WXKA 4H7XA 3ZIBA 2L6GA 4GPMA 3LVRE 5T3WA 2MYSA 4TUUA 3EU9A 2KYHA 3FH5A 2HMZA 3L54A 4UI9K 4FHJA 1B89A 1OCCC 2LP4A 1QLEC 2BL2A 4XEKA 2Y0BG 1D0YA 5HI7A 5FINA 3HXBA 2P9IG 1Z23A 3APFA 3EDTB 3DE8A 4XPWA 3F47A 4AP2A 5JJ7A 3CSTA 4KMOA 2BEDA 3D9NA 3DPYA 3SBSA 1FVHA 2HSQA 4U8HA 2IXOA 4EBAA 2A6HF 3LJBA 3K9IA 2WVOA 3RRMB 1OXKA 1TN6A 2EIMC 4N6HA 1V74B 2P9LG 3UX4A 1CGNA 3C3OA 3PREA 1JPLA 1HO8A 3ZG1A 3CEQA 3X2QC 1YAUO 2H6FA 4WJ0A 5AARA 1GQAA 3KEZA 4HOUA 3TG4A 2WM9A 5F5FA 4C0EA 2I6HA 4Z9JA 5JUAA 2G3VA 3ZDLA 5ARFA 4Q94A 2J8WA 4MW8A 2J08A 2KSFA 3GORA 1E96B 4JC7A 1JUQA 3HNIA 2IOLA 3TWUA 2WB7A 3EPVA 3B0VC 3DI5A 4IWBA 4MVUA 2DBAA 4ZFHA 5BV1A 4F6RD 1WASA 3E34A 3RW0A 5AJLA 3ZYQA 3BEEA 3CVYA 2XCCA 4EZKA 4NACA 4UWLA 3C63A 4I2WA 3V2XA 3TWQA 1U2VG 3WODF 4U0SA 4CYMD 4OAVB 4FJYA 4FLHA 1XNFA 1IXVA 4NQ0A 1TWAA 1O1SA 2A0BA 3JQ0A 3LVQE 4JRZA 5DS4A 2L9JA 4E7ZA 3HXCA 5FQ8A 3IQ6A 2LSVA 4GU5A 3B95A 4BJ5C 3D9PA 5TJ5E 2MRIA 2IBFA 3LPZA 1V4AA 3QMKA 4F53A 1A7VA 1RZ4A 2AU5A 1Y6IA 3RRNB 3QVYA 2KZTB 1Y4CA 4PUCA 1JCRA 2CG3A 4JA9A 3HHMA 4ANXA 2EINE 4JEBA 4I6EA 5ENPD 4A55A 1HY5A 1UG3A 3DAGA 4J8YA 3ZYKA 4BJ6C 4PDXA 2PX3A 1LVKA 1WGWA 3RH3A 1IQUA 2WXMA 3FHDA 3E32A 1CPRA 3FTSA 3U8PA 3IKOB 2EIKC 5AQAA 2F22A 3TWTA 4U5CE 3NYLA 4WUYA 2C0MA 2Y69E 2WMOA 4LDQA 2ZGGA 4DK5A 4HRLA 2HMQA 4IB4A 2QY9A 2F0YA 3HXDA 2P9NG 3BQOA 4GAAA 5EK0A 4JHKA 256BA 5G05J 1HW1A 4XPXA 2YHSA 1Q0FA 3QKYA 1O5MA 4I6GA 5F5HA 4A4AA 2FO7A 2ETBA 4K5BA 4N3CA 2HR2A 4LDRA 4ANJA 4H4KC 4N39A 3B7TA 5CERB 2ETCA 4GPKA 3S7JA 3LCAA 3MYVA 5CMYA 4APOA 4ER9A 3Q79A 5KYYA 3SZ7A 4BSXA 2KC7A 4DRJB 2OCCC 3AG3C 3AQCA 1C02A 2FFHA 3I4UA 3G2UA 1JMWA 2I9CA 3PNLB 4URKA 4CDNA 3OWTA 3ZC4A 2HSBA 2IFUA 2CYDA 2WVQA 5E75A 2YKZA 4U9DA 4GA1A 4K5CA 5E3AA 5ENOD 4OIOF 2PBEA 2NYJA 1OCRE 3L08A 1TN7A 2GRQB 2GRNB 1O1RA 5CCMA 4WGYA 3I3NA 1K8KG 4E18A 2DI3A 4W8PA 2MYOA 5JHBA 2GA0A 3EHRA 3SHFA 3ABLE 3ISMC 3OA1A 3CVNA 1H2TC 2DIWA 1IQRA 2YL3A 3PZ1A 4P9FA 3V5YA 4BETA 1Q2ZA 3NF1A 5EKQD 5D0QD 1MNDA 3PE3A 4DRXE 1MHQA 3DXMG 5B1AE 2NSZA 1M56C 3FHEA 2CHZA 3I4GA 1HF8A 4GB9A 3MYIA 4FA6A 3FXHA 2CG2A 2KGOA 4JEHA 2B0JA 2BF0X 2LSEA 3M15A 4IARA 2O9XA 5D91A 2J49A 1FMWA 3RK6A 3CVVA 3K33A 3NMIA 1VYKA 2WXOA 3CR3A 4O6YA 3K1IA 2YLDA 2Y4UA 5DQZA 3QVZA 4Q4ZF 5T3RA 5BPPA 4UWKA 4L1BA 1ZB1A 2RFMA 3GEHA 1EYHA 3U9MA 3UM1A 1Q0GA 3TL5A 1A0BA 5T3TA 1TJCA 1N94A 3U2LA 2IO2C 1OWPA 3D9JA 4CS9A 4EZJA 1L7CA 3R2PA 1UFBA 5AAOA 4F1PA 2NUPB 5G55A 3T8KA 5M72A 4MVRA 1LM3B 2CCYA 1L3PA 4LDKA 1HX8A 3FTUA 4HRNA 3ZVVA 4RVBA 2J9BA 2WMNA 3J5QB 3RRUA 2JPUA 1JCSA 2WQ6A 3SQVA 3DSXA 4LNBA 3WHNA 3ASNE 3M4BA 4OINF 2HYZA 1NFNA 3RF3A 1G4WR 1E90A 2XL6A 4MNDA 3FTXA 1A7DA 2ZXOA 4CZ2D 4JCHA 2H6GA 1NLXA 3CKCA 4KZCA 1JRAA 1YZAA 2J0XA 4KNVA 3HNLA 3TQOA 3KD7A 4JE9A 4AE4B 2R59A 3EH1A 3TWRA 4DX6D 4DLOA 4G26A 4C7OB 3LAYA 1UW4B 1BI8B 4UI9J 3PCVA 4TXQA 2VB6A 2ZXWC 3EHMA 2W4BA 3L8IA 1QQEA 3DZAA 3FP3A 4Y6CA 3FH7A 4CGWA 3RFYA 1M57C 2C0LA 4FWVA 3L17A 3C7JA 4A3TA 3ZW3A 3B7SA 3GWNA 3C8GA 1H2UA 1LE2A 4NTAA 1LPEA 3TK0A 4UWHA 1TWHA 4FU3A 1S7ZA 4U5GA 3MV2B 1HU3A 4AOFA 3NMJA 1H6KA 1BLXB 1OQCA 2LD6A 3Q7FA 2X6JA 1W2WA 1HS6A 1N4RA 4GZ5A 5CRVA 1DCEA 3ASDA 3L6AA 4DPRA 1MZCA 4YT4A 2A5EA 3K1HA 4AY6A 5CI9A 5BUOA 4H7YA 5JA4D 2Y1LE 3SNXA 4CDAA 2E0IA 3ESKA 3US6A 1HH8A 4MRUA 1KLXA 4CBEA 5L0DA 4Q96A 4LG6A 1KU2A 2XZTG 3X1OA 4RLYA 3SNHA 1LE4A 1H6OA 4BESA 2XM4A 4LNGA 2NSFA 3QW0A 4YL3A 5IY5C 1TR4A 2R9RB 3LY9A 5ANRA 1D1BA 4MVMA 2XQ0A 3PZ3A 3VTXA 2FGYA 4JCZA 1KZPA 3TWSA 2JABA 3HTKC 1NA0A 4N3BA 3AS4A 3UR3C 4U5BE 4ATZD 4A1GA 4HLEA 3DSVA 4DJAA 2YL7A 5ENTD 1S0PA 3U3BA 3HLZA 4Q7CA 4HVBA 3KKBA 1SZAA 1E8ZA 3JYSA 1LS4A 1IKND 3CK9A 4I2ZA 1RKEB 3T6JA 1OWLA 4N06A 3VLFA 3ZQVA 4GYWA 1GW6A 2BUGA 2V8SE 3S7FA 3SY2A 1AP7A 3GZSA 3A9CA 3S27A 2V5FA 3CHOA 3R7CA 3LYAA 3O39A 4UQXA 4P29A 3URZA 1HMOA 5JMND 3AGTA 1HG5A 2ZU6B 5EX0A 3EFOA 2VGXA 1HE8A 1BZ4A 1KT1A 3B29A 4BT8A 1CPQA 3NYMA 1G4US 4GTOA 5C2YA 3LESA 2XGSA 4CS8C 4JJFA 4PJNA 2DYRE 4P9TA 1SF8A 2ZPAA 2J8SD 3DSWA 4KNWA 3L16A 1NFOA 2HUJA 1X81A 2R02A 4X0RA 5FQ7A 1YZCA 4YDEA 4LNUD 2KW3C 1L5JA 2WXHA 3PZ2A 3WG7E 2Z15A 3UM2A 3ASGA 1EKYA 2QE9A 4RSYA 1GM5A 5KWDA 1YYJA 3SFZA 3PMRA 3IBEA 3ZXSA 3GM3A 2L0TB 3T6BA 3C3QA 3CQCB 2EIJC 4DVYP 1DOWA 2PZIA 1NU7D 4TV3A 4AVXA 1E86A 2XGOA 1LIHA 4E0HA 1H9TA 2WQHA 1CGOA 4NRHB 2L7AA 4GZ3A 3QNKA 4PFOA 3CK7A 3IEEA 3MEKA 4PS8A 4AEZC 3CIAA 3JCUQ 1VLTA 2C03A 3CVPA 2P6VA 1LF8A 4DXWA 1MX4A 4C3BA 3NOCD 1JPNA 1EPUA 3AG1E 1K04A 3FUJA 3LLKA 3VLDA 1BPOA 4XIFA 4OYSA 1GS9A 4G8LA 3ZSUA 1QYMA 3Q7GA 2KJGA 4HS2A 1W3BA 4BPMA 2GWWA 4KVOA 3ZQYA 3EGXB 1QSPA 1WAO1 4I1AA 2VYIA 3ASOC 1O3UA 3C8GD 5CCLA 4DUIA 2UUIA 4WNEA 3JZ0A 4O6NA 5KYXA 2ZISA 2KCVA 3G4XA 3CSKA 1N54A 5COGA 2B0OE 3HVEB 4JIOA 1VYIA 2YEVA 1SQMA 3Q15A 4EIYA 4CSAA 1U0BB 5ARGA 1D1CA 2R7XA 5AQ7A 2KNHA 3UT8A 3NB2A 1H2VC 2J4DA 5LCWC 2RD9A 3MKQA 3RYLA 4G0HA 3NAWA 3NKEA 2X6KA 2B0HA 4GTVA 1R5ID 1LD7A 3DPDA 2MHKA 2AVKA 3MYFA 1WWPA 1YA0A 1H7IA 3NDBB 4E17A 3T6GB 1T6IA 2X6IA 3O4ZA 4OAUC 4GCNA 4B94A 1BR2A 1IHBA 3BG0B 3ZUVB 2RD0A 1ZYRF 4G7ZF 2KM4A 5E33A 3DMDA 3T4RA 1N0QA 4GTSA 5EDSA 3G2VA 2WZLA 1Q0MA 2CNWD 4CDYA 3C3RA 5BXUA 3TJ6A 2KCLA 3IV0A 1HFAA 3S7DA 3UIPC 2QY7A 3S84A 2WXGA 1INZA 1H6GA 4YT8A 4U8YD 4ZHBA 2VCBA 3CHSA 2DCPA 4G7HF 3ZEFA 5KJNA 1T9KA 2IM8A 2XPZA 2I2OA 4JURI 2PNNA 1RKCA 5ENSD 2WZGA 4GZDA 2VTBA 1ST6A 4BEPA 3IQCA 1RCPA 2Q00A 5FWQA 4I9CA 3LS1A 3UKUG 4DX2A 3LS8A 4N2SA 1H6PA 2KQ9A 1BU9A 1FFHA 2CFUA 1TFKB 4GZ6A 3JYYA 4K7BA 3TOLA 3FTZA 4JA7A 2MHRA 2CFZA 2WXFA 1Z5ZA 4AK9A 5BNWA 2WQ7A 1PV3A 1ZU4A 5COMA 1TFOB 5L0HA 2XM0A 3A11A 2ILRA 2GAQA 5FIOA 1HE1A 3RIBA 1NG1A 2BKKB 2LCHA 4B0ZA 4U5FE 2A1DD 2J7PA 3KYIA 1E8YA 2P9PG 4DBQA 3HG0D 2VSYA 5L3QA 5AQ9A 1E8XA 4GA2A 1IHGA 3O48A 2OVBA 4YVOA 1PAQA 2X6FA 3UINC 2HJMA 4NURA 4UQZA 3E30A 3MJWA 4U8VD 5K0IA 5CBNA 4ME2A 1NFIE 4A3VA 1A5EA 2IO3C 1FPPA 4JTCB 2WPVA 4F3VA 1ZHYA 1Y8MA 3EU5A 2I8BA 2JD3A 1ELKA 4FLBA 3Q9NC 2XS1A 5B3SE 1I5NA 2QFCA 1S64A 3T5VA 2CHWA 3MKRA 1B68A 3RAUA 5A69A 4GEHA 5HRYA 1NU9C 4O6FA 4NC3A 2M4EA 4Z9HA 1J8YF 3S7BA 3N24A 3ULEG 2WXNA 2EPMX 2Y39A 3T8MA 2Q9CA 2VSNA 4DRIB 4XE0A 3LNMB 5AN8A 3FU5A 3NG1A 2IXPA 3CHPA 3SXYA 5AYWD 3QAQA 2Q9AA 1PD1A 2IU1A 1FMVA 1XZPA 2UUHA 4X8QA 2EINC 1N52A 4AV7A 4J7YA 3PH0C 4F7AA 4EBBA 4NTFA 2I15A 3MZLB 3HNKA 3L22A 3Q9UC 2B6CA 2J09A 2HJ3A 2J4BA 4G2VA 4EWCA 1N9AA 1SA5A 5A6KA 3CQGB 2VGEA 3JXJA 3FUHA 5A6BD 4N4WA 3TJ5A 3OXLA 3QK0A 5A6CA 1VLSA 2Y69C 2QUPA 3HJCA 4O79A 1VK5A 3KYJA 4Z68A 4CS7A 4E7SA 4JC8A 3C98A 5KYWA 4MTFA 5AC4A 1BR1A 3G2SA 3IPMO 4KBLA 1SZ9A 3G2TA 3P2BA 2E87A 3UM0A 1MX2A 1FCHA 4C48B 2L0IA 2OEWA 5EILA 3V31A 3I5PA 4CDMA 4JW1A 2Y3BA 3ONLA 2Y4TA 1UN8A 3N0TA 1OKKA 4BEJA 2H6IA 1IW7F 1BD8A 3QJZA 3GANA 4MVSA 2Q3TA 2R03A 4HLLA 5EX3A 3W4YA 4UQYA 1BR4A 1EF1C 3DM9B 3MLGA 4B6IA 4MVQA 3NZSA 3CQZA 3NYJA 3FUEA 2FBNA 3MBGA 3GWLA 2JLBA 2DZNA 3MA5A 3HXEA 2X6HA 1RJ9A 3SP1A 4GTPA 2XL8A 2XLOA 4GTMA 4QFVA 3UMKA 2R7QA 3VRCA 1OCRC 4FJZA 1MYOA 5AQBA 2GROB 3ZU7B 4J30B 3UGPA 1MMDA 4C7OA 3J5PA 1EDUA 4YT5A 4CJGA 5FZSA 2XEEA 5DIZA 3ABLC 3L13A 1EA8A 2OJED 3DWLG 4JXTA 4EBKA 3N71A 4OVUA 5BXOA 1OY3D 4MTGA 1RXQA 2V4HC 3S90A 1H9GA 3L0IA 4O6MA 5T1DB 4OIRF 3W2WA 3EGDB 4GCOA 1MMAA 4C9BB 1V55C 4L6RA 1V55E 2P9UG 5B1AC 2L81A 5JS5A 4J0UA 4DBRA 4DRHB 3BU8A 3SXZA 2MOWA 2FULA 5AJDA 2RFAA 1TR2A 2R25A 4XEVA 2YHEA 4PS7A 4QI0A 3NQPA 4JZAA 1M2VB 1ELRA 1FR0A 1QZ2A 5KYNA 1TWCA 4J7WA 3N2ZB 3TXNA 3JSEO 3AG4E 1ORYA 1IYGA 4Q5SF 5CBOA 2NC9A 2ZXPA 3GEIA 2VSXE 3KH2A 3FUDA 4O1OA 1KZOA 1FNTc 4WWPA 3NOGD 4G1TA 4M3OA 1HE9A 4UUCA 4A1SA 4PJJA 3DJNB 4CEMA 2FF4A 1X5BA 4J32B 1Z63A 3MFNA 3GYZA 2LSUA 3ZTMA 2XSEA 1DC2A 1YDIA 1ZHTA 1YLMA 4CDVA 4GZCA 3TD7A 1YCSB 3TWWA 2IXMA 1HG2A 1SR2A 2GRLA 2VQ2A 2ZXRA 4BEMJ 3TOMA 2XEVA 1E85A 4G25A 4CX9A 3DXJF 2KK1A 1VDYA 3JRMO 4RDAA 1DCQA 1O1TA 3S0XA 3ASNC 5AGFA 3H2VA 1RKEA 3F46A 3D9OA 4APFA 3KPHA 3SXMA 2HE0A 5JLIA 3SI5A 1KTMA 2YWAA 2F8XK 5L0GA 1QVXA 1XGWA 3D9KA 2GDCA 3TULA 3UT7A 2J07A 4M63A 4Y6WA 2Q4FA 2G62A 1QNFA 3FFLA 3AGUA 1Q0DA 3AAAC 4XEIG 1VTMP 3ML8A 1Z7Qc 1JAFA 2UWJG 1OUVA 3RKOF 4XLNF 3I4RB 3SZRA 2NSGA 4U9EA 3RQGA 2CW0F 3VF0A 5KYYB 2XLEA 2QYJA 3DEOA 3EIQC 2XL4A 4MLPA 5E3CA 2ONDA 2V26A 1NP7A 1S05A 4H54A 3M79A 3ESLA 1K05A 2P58C 3ZN3A 1MMGA 4CRWA 4N3AA 2Q7FA 4U04A 4TXRA 1SZIA 3SFXA 1NI1A 1YA9A 2YRFA 1E2XA 4JZYA 4YVQC 2YQ8A 3CKBA 1K40A 4CT4A 3KMIA 3DSSA 5L0FA 2ZIRA 5L0CA 3UI2A 5JRAA 2I1JA 2VGYA 2LAIA 2DYSE 5FQ4A 2QC9A 1GGQA 2V4LA 2XLDA 3HIZA 4BERA 3ZXPA 4GYYA 3V5XA 3PEVB 4U5HA 1C17M 3LY7A 3Q5MA 4HFGA 4G8KA 3D9IA 3AJMA 3Q75A 5BW8C 2JX0A 1TNUA 4OD5A 1UN9A 4ULWA 1T5OA 4EBJA 1BI7B 1AVOB 3FAPB 3QWVA 4FHKA 4U95D 1T01A 1Y6DA 1Z3YA 2KXPC 4JL0A 3CV0A 3CGHA 3FWVA 3J06A 3FY4A 1SYQA 4XI9A 2HKVA 1QZXA 3V79K 5L3VA 1FVFA 4B8CB 2HFIA 2CDQA 4D4NA 3EGXA 3B7RL 3UQ3A 4B8AA 5FQ6A 1R4TA 3W8HA 1OWNA 4FESA 3ENEA 1FTSA 1OCZE 5A6AA 3AG2E 4HOTA 4TRQA 5JJTA 4LERA 3R9AB 1M6TA 3ZKJA 3APCA 3QTHA 1YARO 3MGBA 4RBNA 4HI9A 2DVWA 4EQFA 1Z3XA 2J45A 2X38A 5A6JA 2GW1A 3WXXA 4BJ5A 4FAPB 2C2LA 4A2NB 2IY0C 3EG9B 3JSZA 3WAQA 4QI2A 5JT4A 1C03A 4I3MA 4L2YA 2XS8A 1JWGA 4GMJA 3RSEG 2VH3A 1LKXA 4LLEA 1LI7A 4J6IA 5KYUB 4KC9A 2X0CA 3S29A 2AXVA 1N4QA 2BKGA 4BJ6A 1NSGB 1YYXA 4JTAB 3RVYA 2HO1A 3R7RA 5T4YA 1N11A 5KJKA 4CJOA 2R7TA 4MW3A 2J9VA 3DE9A 1LTXA 4A63B 2DYRC 1HXIA 5FZQA 1OR3A 4IYPA 3L34A 4WAFA 3ONKA 4YNDA 3BG1B 3ZNGA 1OCOE 5EN5D 4AL0A 4KVMA 3CEXA 4OD4A 3NBNB 5T8IA 3F6QA 2OKUA 4HXIA 2VCAA 3WG7C 2L6HA 3TWVA 4NY3A 3CLJA 4R32A 4ACLA 2HV7A 2AWCA 2IJGX 1YMPA 5G04C 3Q78A 4IULA 4J8SA 4JPSA 4KI2A 2KC3A 1EQ1A 1TNZA 4EBAG 3T5XA 2J9QA 3W9FA 2OU6A 3C8GB 4PFPA 3LEVA 4DOZA 2WZFA 4ILIA 1E83A 1QPUA 2DGJA 3TXMA 4BSZB 4BJTA 3L8JA
chains in the Genus database with same CATH topology
4PJLA 4HORA 1VOMA 2IOQA 5DS6A 3LEWA 3PDNA 5LCWJ 3VAYA 4C0MA 3LXUX 3AU5A 4YN0B 3PE4A 3POVA 3AG1C 3PRZA 3LS0A 3FDQA 2WVNA 3ZHEB 4EZLA 3FUIA 2HV6A 5LX8A 5FJYA 3SGHA 1TJFA 1WY6A 4GA0A 3UUXA 2L9BA 4RG9A 1ZU5A 2R7RA 2PP4A 2J9WA 3CSFA 2WXJA 4G11A 3LLIA 4CGVA 2PX0A 3U4TA 3FTWA 3U64A 5LFAA 3IHVA 1Z3IX 3FTVA 2GFHA 2WVIA 1DNPA 4XWJA 3KL4A 4RD9A 4J8DA 3K1IC 5J90A 3AQBA 3ZRHA 3H65A 2VASA 3R7QA 5CMWA 4YJWA 3OTNA 2OV8A 1OWMA 4G24A 3Q4AB 3MV3B 3AU4A 3UMHA 2G3KA 2XRHA 4J8FA 3FU0A 1V54C 4Q69A 3OAWA 4U07A 2A5UA 2KZTA 3CHQA 4OIQF 3B0PA 3LDZA 4WWNA 4L7TA 4UWFA 4CIHA 3GODA 2PQNA 4HE8D 3PUJA 3CHMA 3DJUB 1IZMA 3PZDA 1H19A 3QZCA 4AJWA 3FU3A 3LNRA 1MMNA 3OXGA 1JWFA 5FCLA 3EHNA 3K7DA 3JT1A 4F4BA 3UMVA 3B13A 1PY1A 4CCAA 1ZHXA 3ZYLA 4J8EA 2VJ8A 3PEUB 3HDXA 4U0UA 3LJ3A 4FX5A 4BTAA 4ANUA 2AVPA 5CHEE 3DAFA 2OOEA 2IONA 4YWQA 3EH2A 2NUTB 3EJNA 3ULQA 3CK8A 3GZ1A 4PH4B 3FEXA 5KJMA 5B3SC 4B89A 2XPYA 1PD0A 4F1SA 5E2QA 4ANVA 2WL8A 3ZVRA 2YZSA 5KYXB 3RO2A 1U3DA 1E8WA 4WNFA 5A23A 1NZNA 3ASHA 4IN3B 4HOSA 4ILHB 2CGEA 2WXIA 4O7GA 1NA3A 3EGDA 3LY8A 3MKQB 3UNGC 2XXAB 4KZ0A 1ZBPA 4U5EE 4U5DE 3ZGQA 2BTDA 3KS2A 2Q9BA 1O87A 1Z6AA 2CHXA 2RG8A 5LOZA 1M2VA 1O5HA 2UY1B 1PC2A 4JHRA 1H0AA 3JCKC 4KT6B 3PHF2 1N1CA 4LLCA 2Y3GA 4LRZA 4P6IC 3B7UX 3FAJA 3SD5A 1ELWA 2FI7A 3TAXA 4HFKB 1HZ4A 5HQ8A 1MNEA 5EHHA 2A6EF 4JVSA 4LACB 2VTBB 3FVYA 2W9YA 3B9QA 3FUMA 2KCKA 2NUPA 3JYHA 2M63A 2PL2A 4K0RA 3CZ6A 3JRTA 3ITFA 3EZHA 2GGFA 2I1KA 3P1UA 5D92A 5EGYA 2LAHA 4ATGA 4CS8A 3QOUA 3EIJA 4HEAJ 3W8IA 2OVFA 2XGMA 1E7VA 4BWRA 3IEGA 4JJGA 1WM5A 3OXFA 3VYWA 1ZU2A 1P5QA 4IAOA 3FTYA 2W45A 3UGOA 4AE4A 4XZ4A 2LO6A 4N5CA 2NG1A 2J0WA 2H7OA 4OVVA 3NZUA 3ML9A 3OEOA 4E85A 4ZLDA 2GRMA 2VSOE 2XHEA 5HSWA 1UJKA 3QWPA 2AWIA 4BX8A 3K66A 4RG6A 5A7DB 4BJ1A 3FH8A 5G05C 4AM9A 4G23A 4AIFA 4UWGA 5JJ6A 4DLQA 4I43A 3SEOA 2J7PD 2IOSA 2H7BA 3D9LA 2NXPA 4CSAC 2WXRA 3PNTB 3DM5A 4XLPF 3Q6NA 3U9WA 3AG4C 5KCMA 4HOQA 3ZPJA 1FFTC 3I5QA 1Z6TA 4C3EA 4FADA 1E7UA 4ZLCA 3MX3A 3FEYA 2A4ZA 4AX2A 3ASFA 4C3DA 2R7SA 1D1AA 2C04A 1LS1A 5D0OD 2PFDA 4DVZA 4FULA 5DLJA 3SYNA 2PM7A 3JQ1A 1D0XA 3D9MA 3TGOA 4XTKA 4AY5A 4V3IA 3FUKA 5AENA 3NKDA 5DVWA 3AS8A 3B0UX 4KYOB 5DBKA 2J9UA 5KYWB 4G7OF 3PS6A 3M1CB 2XRZA 4WNGA 2AXZA 3SF4A 3UPVA 1JPJA 3E70C 4PK4A 3UT4A 3EG9A 4BT9A 2Y3AA 4MS6A 4R7LA 3CVLA 5KYUA 3UMIA 3TJPA 2YINA 1TKNA 4WNDA 4DI3A 5FZRA 2MWQA 2IQCA 4XI0A 4EECA 1SMYF 5LP0A 3FDHA 4U0ZA 2EQXA 2FEZA 1RJ9B 4LCTA 4WWOA 2IYLD 3RU0A 3FUFA 2WXPA 2X51A 3CVQA 5DQTA 2YNQA 4EPZA 4BTBA 1OKKD 3S28A 2DYSC 2WXQA 3U3WA 3K6BA 3VLEA 2IF4A 4KXKB 4HFFB 3GZ2A 5JHAA 2PF4E 2JEKA 5FT9A 4BY6A 4N2QA 4GMLA 4AXHA 4MQ9F 4ACKA 4IJJA 5J08A 2J46A 4D10C 2WXLA 3JUIA 3ZHEA 2W4MA 1D0ZA 4I1OB 2AW6A 4JEUA 2AXUA 3AS5A 3APDA 4PS3A 3NRHA 1M2OA 2R5SA 5G2NA 4UI9C 3HYMB 1PCXA 1OCZC 1OWOA 4FC8A 3AG2C 3DBSA 4W8KA 4JHJA 2P7VA 2E2EA 2CNWA 3RIPA 2IXNA 3HVEA 4LUNU 5G04J 4KBQA 4K03A 3ZIMA 4K0DA 5FTPA 3O6XA 2OG2A 4ILGA 3D3MA 5C1DA 3SBTB 4OIPF 2A69F 3FU6A 3S2AA 4L23A 3DD7A 2BE5F 4I1MA 3QB2A 3EQLF 2XRYA 1OCOC 5KJLA 3TG5A 4XKBA 1ZHZA 4MKTA 3ZFWA 1VMAA 3ECSA 3VTYA 3QARA 1DVPA 2R7OA 3G2WA 2XCBA 3ZYMA 3E9VA 3E4BA 1MQSA 3W2VA 3QC1A 2XPIA 5E76A 2R7VA 2V3CC 3KAEA 4I6JA 3CVWA 3RKVA 4YT2A 5BV0A 5ANLA 4PJMA 3FUNA 1G8XA 2R7UA 1ZHWA 3Q6MA 1KT0A 5BUZA 2L6JA 3ABMC 3V7OA 1U3CA 1J8MF 3RO3A 3QWWA 4I17A 1UJJA 4GYOA 4XKCA 2NUTA 4E6HA 1A17A 4CT0A 4IRUA 3LKUA 2Y3DA 5B1BC 3Q47B 2R7WA 4FP7A 3Q49B 4XX5A 4BFRA 3U66A 2X3MA 2Y3HA 4ANWA 5CI8A 3PUKA 3CHRA 1TEZA 3IHYA 3CVUA 2A68F 4L2LA 3QDNA 4CS9C 2WB2A 2PM6A 5DS5A 4I44A 4ABNA 4BX9A 3FULA 3Q7LA 3CVXA 5ENNA 2PQRA 3RJVA 4QDLA 2XXAA 2H7VC 4I9EA 3EFOB 4DI4A 1NZEA 2VGXB 4W9RA 3ABKC 2D5RB 2KATA 2YHCA 4CDRA 3PVLA 2UY1A 5BT1A 4LEUA 2LNIA 2QTVA 3EZIA 4U63A 4BG0A 5AIJA 4GYTA 3MCXA 2R17C 3GW4A 2EILC 2HM8A 1TWGA 2V0PA 2WXKA 4H7XA 3ZIBA 3LVRE 5T3WA 2MYSA 4TUUA 3FH5A 3L54A 4UI9K 4FHJA 1B89A 1OCCC 1QLEC 1D0YA 5HI7A 1Z23A 3APFA 3EDTB 5JJ7A 3F47A 4AP2A 3CSTA 4KMOA 3D9NA 3SBSA 4U8HA 1FVHA 2IXOA 4EBAA 2A6HF 3LJBA 3K9IA 2WVOA 3RRMB 2EIMC 3UX4A 3PREA 1JPLA 1HO8A 3ZG1A 3CEQA 3X2QC 4WJ0A 4HOUA 3KEZA 3TG4A 2WM9A 5F5FA 4C0EA 2I6HA 2G3VA 5ARFA 4Q94A 2J08A 1E96B 1JUQA 2IOLA 2WB7A 3EPVA 3B0VC 4IWBA 2DBAA 5BV1A 3ZYQA 5AJLA 3BEEA 3CVYA 2XCCA 4EZKA 4NACA 4UWLA 4I2WA 3WODF 4U0SA 4FJYA 4FLHA 1XNFA 4NQ0A 1TWAA 3JQ0A 3LVQE 5DS4A 2L9JA 4E7ZA 5FQ8A 2LSVA 4GU5A 4BJ5C 3D9PA 2MRIA 3LPZA 3QMKA 4F53A 1Y6IA 3RRNB 2KZTB 4PUCA 2CG3A 4JA9A 3HHMA 4ANXA 4I6EA 4A55A 1UG3A 3DAGA 3ZYKA 4PDXA 4BJ6C 2PX3A 1LVKA 1WGWA 3RH3A 1IQUA 2WXMA 3FHDA 3FTSA 3IKOB 2EIKC 4U5CE 3NYLA 4WUYA 2C0MA 2WMOA 4DK5A 2QY9A 4GAAA 4JHKA 5G05J 2YHSA 3QKYA 4I6GA 5F5HA 2FO7A 4N3CA 2HR2A 4ANJA 4H4KC 4N39A 3B7TA 4GPKA 3S7JA 3LCAA 3MYVA 5CMYA 4APOA 5KYYA 3SZ7A 4BSXA 2KC7A 2OCCC 3AG3C 3AQCA 2FFHA 3I4UA 3G2UA 2I9CA 3PNLB 4URKA 4CDNA 3OWTA 3ZC4A 2IFUA 2WVQA 5E75A 4GA1A 5E3AA 4OIOF 3L08A 5CCMA 3I3NA 5JHBA 3SHFA 3OA1A 3CVNA 1H2TC 2DIWA 1IQRA 3NF1A 5EKQD 5D0QD 1MNDA 3PE3A 1MHQA 2NSZA 1M56C 3FHEA 2CHZA 3I4GA 1HF8A 4GB9A 4FA6A 2CG2A 2KGOA 4JEHA 2B0JA 2BF0X 2LSEA 2O9XA 5D91A 2J49A 1FMWA 3RK6A 3CVVA 3K33A 1VYKA 2WXOA 3CR3A 4O6YA 2Y4UA 5DQZA 4Q4ZF 5T3RA 5BPPA 4UWKA 4L1BA 1EYHA 3TL5A 5T3TA 1TJCA 1OWPA 3D9JA 4CS9A 4EZJA 2NUPB 5G55A 5M72A 1HX8A 3FTUA 3ZVVA 4RVBA 2WMNA 3RRUA 2WQ6A 2HYZA 4OINF 1E90A 4MNDA 3FTXA 2ZXOA 4JCHA 3CKCA 4KZCA 2J0XA 4KNVA 3KD7A 4AE4B 2R59A 3EH1A 4DLOA 4G26A 4C7OB 3LAYA 1UW4B 4UI9J 2VB6A 2ZXWC 3EHMA 2W4BA 3FP3A 1QQEA 3DZAA 4Y6CA 3FH7A 4CGWA 3RFYA 1M57C 2C0LA 4FWVA 3L17A 4A3TA 3ZW3A 3B7SA 1H2UA 4UWHA 1TWHA 4FU3A 1S7ZA 4U5GA 3MV2B 1HU3A 4AOFA 1H6KA 2X6JA 1W2WA 1HS6A 4GZ5A 3ASDA 3L6AA 4DPRA 4YT4A 3K1HA 4AY6A 5CI9A 5BUOA 4H7YA 3SNXA 2E0IA 3ESKA 1HH8A 4MRUA 1KLXA 4CBEA 4Q96A 1KU2A 3X1OA 3SNHA 5IY5C 5ANRA 3LY9A 1D1BA 2XQ0A 3VTXA 2FGYA 3HTKC 1NA0A 4N3BA 3AS4A 3UR3C 4U5BE 4A1GA 4HLEA 4DJAA 1S0PA 3HLZA 4Q7CA 4HVBA 3KKBA 1SZAA 1E8ZA 3JYSA 3CK9A 4I2ZA 3T6JA 1OWLA 4N06A 3VLFA 4GYWA 2V8SE 1GW6A 2BUGA 3S7FA 3GZSA 3S27A 2V5FA 3CHOA 3LYAA 3O39A 4UQXA 4P29A 3URZA 1HG5A 2ZU6B 5EX0A 3EFOA 2VGXA 1HE8A 1KT1A 4BT8A 3NYMA 5C2YA 3LESA 2XGSA 4CS8C 4JJFA 4PJNA 1SF8A 2ZPAA 4KNWA 3L16A 4X0RA 5FQ7A 2KW3C 1L5JA 2WXHA 2Z15A 3ASGA 4RSYA 3SFZA 3PMRA 3IBEA 3ZXSA 2L0TB 3T6BA 3CQCB 2EIJC 4DVYP 2PZIA 1NU7D 4TV3A 4AVXA 2XGOA 2WQHA 4NRHB 4GZ3A 3QNKA 4PFOA 3CK7A 3IEEA 3MEKA 4PS8A 4AEZC 3CIAA 3JCUQ 2C03A 3CVPA 2P6VA 1LF8A 4C3BA 1JPNA 1EPUA 3FUJA 3LLKA 3VLDA 1BPOA 4XIFA 4OYSA 3ZSUA 3Q7GA 2KJGA 4HS2A 1W3BA 4KVOA 3EGXB 1WAO1 4I1AA 2VYIA 3ASOC 5CCLA 4WNEA 4O6NA 5KYXA 2KCVA 3CSKA 1N54A 3HVEB 1VYIA 2YEVA 1SQMA 3Q15A 4CSAA 5ARGA 1D1CA 2R7XA 2KNHA 3UT8A 1H2VC 2J4DA 5LCWC 3MKQA 3RYLA 4G0HA 3NKEA 2X6KA 3DPDA 2MHKA 1YA0A 3NDBB 3O4ZA 2X6IA 4GCNA 4B94A 1BR2A 3BG0B 2RD0A 1ZYRF 4G7ZF 2KM4A 5E33A 3DMDA 3T4RA 5EDSA 3G2VA 2WZLA 2CNWD 2KCLA 3IV0A 1HFAA 3S7DA 2QY7A 2WXGA 1INZA 4YT8A 3CHSA 2DCPA 4G7HF 3ZEFA 5KJNA 2XPZA 2I2OA 4JURI 2WZGA 4GZDA 2VTBA 1ST6A 5FWQA 4I9CA 3LS1A 4N2SA 3LS8A 2KQ9A 1FFHA 2CFUA 4GZ6A 4K7BA 3FTZA 4JA7A 2CFZA 2WXFA 1Z5ZA 4AK9A 5BNWA 2WQ7A 1ZU4A 2ILRA 3RIBA 4B0ZA 1NG1A 4U5FE 2A1DD 2J7PA 1E8YA 4DBQA 2VSYA 5L3QA 1E8XA 4GA2A 1IHGA 3O48A 2OVBA 4YVOA 1PAQA 2X6FA 4NURA 4UQZA 3MJWA 4ME2A 4A3VA 2WPVA 4F3VA 1ZHYA 1Y8MA 2I8BA 2JD3A 1ELKA 4FLBA 2QFCA 3T5VA 2CHWA 3MKRA 4GEHA 1NU9C 4O6FA 2M4EA 1J8YF 3S7BA 3N24A 2WXNA 2Y39A 3T8MA 2Q9CA 2VSNA 4XE0A 3FU5A 3NG1A 2IXPA 3CHPA 5AYWD 3QAQA 2Q9AA 1PD1A 2IU1A 1FMVA 2EINC 1N52A 4AV7A 3PH0C 4F7AA 4EBBA 3MZLB 3L22A 4G2VA 2J09A 2J4BA 4EWCA 3CQGB 3FUHA 3OXLA 3QK0A 5A6CA 2Y69C 3HJCA 4O79A 1VK5A 4CS7A 4E7SA 4JC8A 3C98A 5KYWA 1BR1A 3G2SA 4KBLA 1SZ9A 3G2TA 3P2BA 2E87A 1FCHA 2L0IA 3I5PA 4CDMA 4JW1A 2Y3BA 3ONLA 2Y4TA 1UN8A 3N0TA 1OKKA 4BEJA 1IW7F 3QJZA 3GANA 2Q3TA 5EX3A 4UQYA 1BR4A 1EF1C 3DM9B 3MLGA 4B6IA 3NZSA 3CQZA 3NYJA 3FUEA 2FBNA 2JLBA 3MA5A 2X6HA 1RJ9A 3SP1A 4QFVA 3UMKA 2R7QA 1OCRC 4FJZA 4J30B 3UGPA 1MMDA 4C7OA 1EDUA 4YT5A 5FZSA 5DIZA 3ABLC 3L13A 4JXTA 3N71A 4OVUA 3L0IA 4O6MA 5T1DB 4OIRF 3W2WA 3EGDB 4GCOA 1MMAA 4C9BB 1V55C 5B1AC 2L81A 4J0UA 4DBRA 2MOWA 2FULA 5AJDA 1TR2A 4PS7A 2YHEA 4QI0A 3NQPA 4JZAA 1M2VB 1ELRA 1QZ2A 5KYNA 1TWCA 3N2ZB 3TXNA 1IYGA 4Q5SF 2NC9A 2ZXPA 2VSXE 3KH2A 3FUDA 4WWPA 4G1TA 4M3OA 4A1SA 4PJJA 3DJNB 4CEMA 2FF4A 1X5BA 4J32B 1Z63A 3GYZA 2LSUA 2XSEA 1ZHTA 4GZCA 3TD7A 2IXMA 1HG2A 2GRLA 2VQ2A 2ZXRA 2XEVA 4G25A 3DXJF 1VDYA 4RDAA 3S0XA 3ASNC 3F46A 3D9OA 4APFA 3SI5A 1XGWA 3D9KA 3UT7A 2J07A 4M63A 4Y6WA 2G62A 1QNFA 3FFLA 3ML8A 2UWJG 1OUVA 3RKOF 4XLNF 3I4RB 3SZRA 2CW0F 5KYYB 3EIQC 2XL4A 4MLPA 5E3CA 2ONDA 2V26A 1NP7A 3ESLA 2P58C 3ZN3A 1MMGA 4CRWA 4N3AA 2Q7FA 4U04A 1SZIA 4JZYA 4YVQC 2YQ8A 3CKBA 4CT4A 3KMIA 2I1JA 2VGYA 2LAIA 5FQ4A 2V4LA 3HIZA 4GYYA 3PEVB 4U5HA 3LY7A 3Q5MA 4HFGA 3D9IA 5BW8C 4OD5A 1UN9A 4ULWA 3QWVA 4FHKA 1Z3YA 4JL0A 3CV0A 3CGHA 3FWVA 3FY4A 4XI9A 1QZXA 5L3VA 1FVFA 4B8CB 2CDQA 3EGXA 3B7RL 3UQ3A 4B8AA 5FQ6A 3W8HA 1OWNA 4FESA 3ENEA 1FTSA 4HOTA 4TRQA 5JJTA 4LERA 3R9AB 3APCA 3MGBA 4RBNA 4EQFA 1Z3XA 2J45A 2X38A 2GW1A 3WXXA 4BJ5A 2C2LA 4A2NB 3EG9B 3JSZA 4QI2A 4I3MA 4L2YA 1JWGA 4GMJA 2VH3A 1LKXA 4LLEA 4J6IA 5KYUB 4KC9A 2AXVA 3S29A 4BJ6A 2HO1A 3R7RA 5T4YA 5KJKA 2R7TA 2J9VA 2DYRC 1HXIA 5FZQA 4IYPA 3L34A 4WAFA 3ONKA 4YNDA 3BG1B 4KVMA 4OD4A 5T8IA 4HXIA 3WG7C 4NY3A 3CLJA 4ACLA 2HV7A 2IJGX 5G04C 4IULA 4J8SA 4JPSA 4KI2A 4EBAG 3T5XA 2J9QA 4PFPA 3LEVA 4DOZA 2WZFA 4ILIA 2DGJA 3TXMA 4BJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I1O B;  4I1M A;  4IRU A;  4JVS A;  4JW1 A; 
#chains in the Genus database with same CATH topology
 4PJL A;  4HOR A;  1VOM A;  2IOQ A;  1BBH A;  2IEJ A;  5DS6 A;  3LEW A;  1U89 A;  3PDN A;  5LCW J;  3VAY A;  3L82 A;  4C0M A;  3ATP A;  1EI7 A;  3LXU X;  3AU5 A;  4YN0 B;  5CEC B;  3PE4 A;  3POV A;  3AG1 C;  3C62 A;  3PRZ A;  3LS0 A;  3FDQ A;  2WVN A;  3ZHE B;  1APC A;  2Q7R A;  4EZL A;  4M7C A;  3FUI A;  2HV6 A;  2F8Y A;  5LX8 A;  5FJY A;  3SGH A;  4O60 A;  3U3F A;  1TJF A;  1WY6 A;  1NL4 A;  4GA0 A;  3UUX A;  2L9B A;  4RG9 A;  1ZU5 A;  1A7E A;  2R7R A;  2PP4 A;  4NQF A;  1QBQ A;  3ABM E;  4HBD A;  5EYP F;  2J9W A;  3CSF A;  4EHM A;  2WXJ A;  4G11 A;  3LLI A;  4CGV A;  4LSZ E;  2PX0 A;  3U4T A;  3FTW A;  3U64 A;  5LFA A;  3IHV A;  1Z3I X;  3FTV A;  2GFH A;  2WVI A;  1DNP A;  4XWJ A;  3KL4 A;  4RD9 A;  4J8D A;  3K1I C;  5J90 A;  3AQB A;  4N5Q A;  1UOH A;  3ZRH A;  5CEA A;  5B1B E;  3H65 A;  2VAS A;  3R7Q A;  5CMW A;  4YJW A;  3OTN A;  2OV8 A;  1OWM A;  2TMV P;  4AL1 A;  1FT1 A;  3FMS A;  4G24 A;  3ZWI A;  3Q4A B;  1S63 A;  5D2M C;  2LUH A;  3Q7A A;  1QQ3 A;  5ENQ D;  3MV3 B;  3AU4 A;  2P1A A;  1XZQ A;  3GM1 A;  3UMH A;  2G3K A;  2XRH A;  3O55 A;  5BQH A;  4UDV A;  4J8F A;  3FU0 A;  1V54 C;  4Q69 A;  1V54 E;  3KEA A;  3OAW A;  4U07 A;  5HKP A;  2A5U A;  2KZT A;  3CHQ A;  2OOC A;  2QZA A;  4OIQ F;  2XLM A;  4B93 B;  3FOP A;  3B0P A;  2LFF A;  3ABK E;  3LDZ A;  4WGZ A;  4WWN A;  1TNB A;  4L7T A;  4UWF A;  4CIH A;  3GOD A;  2PQN A;  4HE8 D;  3PUJ A;  3CHM A;  3DJU B;  2XLV A;  1IZM A;  4E0I A;  2XZD G;  3PZD A;  5H7P A;  1NBB A;  2XEN A;  1K3Z D;  2OEX A;  1H19 A;  3QZC A;  4AJW A;  3FU3 A;  3LEO A;  3LNR A;  3EHQ A;  2GRP B;  3T9O A;  4JB8 P;  1MMN A;  3OXG A;  1OR2 A;  2EIL E;  1JWF A;  3UTM A;  5FCL A;  1MQV A;  3EHN A;  2P9K G;  3O10 A;  2XLW A;  5KBA A;  1K1B A;  3V30 A;  5HV9 A;  3K7D A;  3KSQ A;  3JT1 A;  4F4B A;  3UMV A;  3B13 A;  1LD8 A;  1Z5S C;  1PY1 A;  4TUM A;  2OJQ A;  1OCC E;  4CCA A;  4MVO A;  1ZHX A;  3ZYL A;  3M4C A;  4J8E A;  2VJ8 A;  3PEU B;  3HDX A;  4DJ9 A;  3L9T A;  4YDY A;  3U9J A;  3GM2 A;  4U0U A;  3LJ3 A;  4FX5 A;  5ENR D;  4BTA A;  4ANU A;  2AVP A;  5CHE E;  3U2M A;  4MS2 A;  3B7B A;  3DAF A;  4DX1 A;  2OOE A;  5FZT A;  1JR8 A;  3EUV A;  2ION A;  3QW1 A;  4YWQ A;  2EIM E;  3EH2 A;  1ZVZ A;  3NMK A;  2NUT B;  2L6B A;  3EJN A;  3ULQ A;  3CK8 A;  3GZ1 A;  4PH4 B;  3X2Q E;  3FEX A;  5KJM A;  1F1M A;  5B3S C;  4B89 A;  2FAP B;  3IQT A;  2XPY A;  1PD0 A;  4F1S A;  5E2Q A;  5COF A;  2WL8 A;  3ZVR A;  4ANV A;  1HMD A;  2YZS A;  4YDW A;  5KYX B;  4EHP A;  3RO2 A;  1U3D A;  4DX5 D;  1E8W A;  4WNF A;  5A23 A;  3FOO A;  1D9S A;  1NZN A;  4J7T A;  3ASH A;  4IN3 B;  4HOS A;  4ILH B;  2CGE A;  2WXI A;  4O7G A;  1JCQ A;  1NA3 A;  2ICW G;  3EGD A;  3LY8 A;  3MKQ B;  2DB4 A;  3UNG C;  2XXA B;  4KZ0 A;  1ZBP A;  4U5E E;  4U5D E;  4HNA D;  3ZGQ A;  3U5S A;  3PZ4 A;  2BTD A;  3KS2 A;  2QNL A;  3HNJ A;  2Q9B A;  1O87 A;  1Z6A A;  2CHX A;  2RG8 A;  5LOZ A;  1M2V A;  1UG7 A;  1O5H A;  2V5Q C;  2UY1 B;  4D4X A;  1PC2 A;  3DST A;  4JD2 G;  2YQY A;  3VM6 A;  4JHR A;  1H0A A;  3JCK C;  4KT6 B;  3UKR G;  5BQG A;  4O1P A;  3PHF 2;  3RQF A;  1N1C A;  4LLC A;  2Y3G A;  4LRZ A;  4P6I C;  4PR9 A;  4RQI A;  2ASR A;  3B7U X;  2AP3 A;  5D66 A;  2P61 A;  3FAJ A;  1SA4 A;  3SD5 A;  1ELW A;  2FI7 A;  1G3N B;  2OEV A;  3TAX A;  1HZ4 A;  4HFK B;  4TXP A;  4JTD B;  5HQ8 A;  1MNE A;  5EHH A;  2A6E F;  4JVS A;  4EUK B;  4LAC B;  2EIK E;  2VTB B;  3FVY A;  2QLA A;  4GTQ A;  1ZW3 A;  2W9Y A;  3B9Q A;  3FUM A;  3U0C A;  2KCK A;  3LJN A;  4N6C A;  2NUP A;  3JYH A;  2M63 A;  1LI5 A;  1N95 A;  2PL2 A;  4K0R A;  3CZ6 A;  3JRT A;  1SVX A;  3ITF A;  2KBX A;  3EZH A;  1ORS C;  2GGF A;  2I1K A;  3P1U A;  5D92 A;  1YYH A;  5EGY A;  2LAH A;  4ATG A;  5L0I A;  4CS8 A;  3QOU A;  1ZW2 A;  3EIJ A;  1D8E A;  4HEA J;  3W8I A;  2OVF A;  2XGM A;  1E7V A;  4BWR A;  1WAT A;  3IEG A;  4JJG A;  1WM5 A;  2M64 A;  4IAQ A;  3OXF A;  3VYW A;  1T6Q A;  1ZU2 A;  1P5Q A;  3ULY A;  4IAO A;  5JP7 A;  3FTY A;  4U96 D;  2W45 A;  3UGO A;  4AE4 A;  4XZ4 A;  2LO6 A;  3BEH A;  4N5C A;  2NG1 A;  1WOL A;  2J0W A;  2EPN A;  2H7O A;  4OVV A;  3NZU A;  2OCC E;  3AG3 E;  3ML9 A;  1N4P A;  1D8D A;  3OEO A;  4ULV A;  4E85 A;  4ZLD A;  2GRM A;  2VSO E;  2XHE A;  5F28 E;  4DX7 D;  5HSW A;  1UJK A;  3QWP A;  2AWI A;  4BX8 A;  3K66 A;  4RG6 A;  5A7D B;  4BJ1 A;  3FH8 A;  5G05 C;  4AM9 A;  4G23 A;  3DKA A;  1ORJ A;  3ZTZ A;  1G5Z A;  4AIF A;  2YVK A;  4UWG A;  5JJ6 A;  4DLQ A;  4HRM B;  4I43 A;  3SEO A;  2J7P D;  4XEF A;  2IOS A;  2H7B A;  3D9L A;  2FO1 E;  2NXP A;  5B3I A;  1TN8 A;  1TYQ G;  4CSA C;  2WXR A;  4YL0 A;  3PNT B;  4XPY A;  3DM5 A;  4XLP F;  3Q6N A;  2LXM A;  3U9W A;  3AG4 C;  4GTT A;  5KCM A;  3BRJ A;  4HOQ A;  3DEP A;  3ZPJ A;  1FFT C;  3I5Q A;  1Z6T A;  4C3E A;  5EYL A;  1QKR A;  4FAD A;  1E7U A;  4ZLC A;  4Z9I A;  3MX3 A;  4YL1 A;  3FEY A;  2A4Z A;  4AX2 A;  3ASF A;  2GRR B;  4C3D A;  2R7S A;  1D1A A;  2C04 A;  1LS1 A;  5D0O D;  2PFD A;  5JSL A;  4DVZ A;  4FUL A;  5DLJ A;  3SYN A;  2PM7 A;  3JQ1 A;  1D0X A;  1WG0 A;  3D9M A;  3TGO A;  1TNO A;  3HRA A;  1N4S A;  5GPG B;  4XTK A;  4AY5 A;  4V3I A;  3FUK A;  5AEN A;  3NKD A;  3T9K A;  1Q0K A;  5DVW A;  1WN0 A;  3SXK A;  3B0U X;  3AS8 A;  5ITZ F;  1VB5 A;  4KYO B;  5DBK A;  2J9U A;  2RSE B;  5KYW B;  4G7O F;  3PS6 A;  3M1C B;  2XRZ A;  4WNG A;  2AXZ A;  3SF4 A;  3SFY A;  3UPV A;  1JPJ A;  3E70 C;  4PK4 A;  5AC5 A;  1WDY A;  3UT4 A;  3EG9 A;  4HB5 A;  4BT9 A;  2Y3A A;  4MS6 A;  4R7L A;  3CVL A;  5KYU A;  3UMI A;  3TJP A;  2YIN A;  1TKN A;  4WND A;  4DI3 A;  2H8A A;  5FZR A;  2MWQ A;  2IQC A;  2EPO A;  2OQM A;  4CIP A;  3V2O A;  4XI0 A;  4EEC A;  1SMY F;  5LP0 A;  3FDH A;  3TWX A;  4U0Z A;  2EQX A;  2FEZ A;  1RJ9 B;  4LCT A;  4WWO A;  2IYL D;  3RU0 A;  3FUF A;  5HS0 A;  2WXP A;  2X51 A;  3CVQ A;  5DQT A;  2YNQ A;  3JTL O;  4EPZ A;  4BTB A;  2P0N A;  2ZXW E;  1MX6 A;  3IHU A;  1OKK D;  3IQ5 A;  3S28 A;  5L0J A;  2DYS C;  2WXQ A;  3U3W A;  3K6B A;  3VLE A;  2IF4 A;  4KXK B;  4HFF B;  4GTR A;  1YVI A;  4YDO A;  3GZ2 A;  5JHA A;  2D4U A;  2PF4 E;  2JEK A;  5FT9 A;  3AOU A;  4BY6 A;  4N2Q A;  5KNH D;  3UIO C;  2DZO A;  2YL1 A;  4GML A;  4AXH A;  4MQ9 F;  4ACK A;  3UM3 A;  4IJJ A;  5J08 A;  2J46 A;  4GMR A;  4K5A B;  4D10 C;  2WXL A;  1MJ0 A;  3JUI A;  3SO8 A;  3ZHE A;  2W4M A;  1D0Z A;  4I1O B;  2AW6 A;  4JEU A;  2AXU A;  4U7E B;  3AS5 A;  3APD A;  4PS3 A;  1TQG A;  3C8Z A;  3NRH A;  1M2O A;  2R5S A;  2YLG A;  1KNY A;  5G2N A;  1OW8 A;  3KSL A;  1T6U A;  4UI9 C;  3HYM B;  5KNG A;  1PCX A;  3C18 A;  2PNO A;  1OCZ C;  1OWO A;  4FC8 A;  5IY5 E;  3AG2 C;  3DBS A;  4W8K A;  1JOG A;  2RKK A;  4JHJ A;  3GEE A;  1ZZP A;  1I4Z A;  2LQG A;  2P7V A;  2E2E A;  2CNW A;  3RIP A;  2VCC A;  2HS5 A;  2IXN A;  2R2L A;  3HVE A;  3R9M A;  4LUN U;  5G04 J;  4MTO A;  2QYU A;  3W9G A;  4KBQ A;  3C5R A;  4K03 A;  3G4Z A;  3LUT B;  3ZIM A;  1CGM E;  4HI8 A;  2YL0 A;  3UXG A;  4K0D A;  5FTP A;  3O6X A;  2OG2 A;  4ILG A;  2P9S G;  3D3M A;  4PAC A;  5C1D A;  2ZGD A;  1YJG A;  3SBT B;  1AUE A;  4OIP F;  1OXB A;  2A69 F;  3PDM P;  3FU6 A;  1RMV A;  3DRA A;  3S2A A;  4L23 A;  3DD7 A;  3E37 A;  2BE5 F;  4I1M A;  1SW6 A;  4YK5 A;  3QB2 A;  3EQL F;  2XRY A;  1OCO C;  5KJL A;  1RW2 A;  3TG5 A;  4XKB A;  2ETS A;  1ZHZ A;  4MKT A;  3ZFW A;  1VMA A;  3ECS A;  3L1M A;  3VTY A;  3QAR A;  1DVP A;  2R7O A;  3G2W A;  4G78 A;  2EPL X;  2XCB A;  3ZYM A;  3HKK A;  2LIG A;  3E9V A;  4L9P A;  3E4B A;  1MQS A;  1TNY A;  3W2V A;  5EID A;  1FAP B;  4IGG A;  3QC1 A;  2XPI A;  5E76 A;  3S9O A;  4WAB A;  1E84 A;  3Q73 A;  2ETA A;  4GQH A;  3D9H A;  2L6F A;  2R7V A;  3H2U A;  2V3C C;  1OW6 A;  3U8V A;  3KAE A;  3DSU A;  3JUE A;  4I6J A;  3CVW A;  3RKV A;  3HXF A;  5EIB E;  4YT2 A;  1AWC B;  2YLI A;  2EIJ E;  1YA7 O;  5BV0 A;  3CAX A;  2P2C P;  1HW2 A;  5ANL A;  5CRU A;  1AEP A;  4PJM A;  5CIV A;  1WTY A;  2DWZ A;  3FUN A;  1G8X A;  1FT2 A;  2R7U A;  1ZHW A;  3Q6M A;  3AJI A;  4MBG A;  1KT0 A;  2F37 A;  3E33 A;  2XEH A;  5BUZ A;  2L6J A;  3ABM C;  3V7O A;  1U6H A;  2LXL A;  1U3C A;  1J8M F;  3RO3 A;  2AJA A;  3QWW A;  4I17 A;  1UJJ A;  4GYO A;  5BQI A;  1OT8 A;  2BC5 A;  5CED B;  3IXE A;  4XKC A;  2NUT A;  4E6H A;  1A17 A;  4HQD A;  4CT0 A;  4IRU A;  1N0R A;  3C72 A;  3LKU A;  2Y3D A;  5B1B C;  1S70 B;  3ASO E;  2R7W A;  3Q47 B;  3Q49 B;  4FP7 A;  4XX5 A;  4BFR A;  3U66 A;  2X3M A;  2A0U A;  2Y3H A;  4ANW A;  5CI8 A;  2H6H A;  4XQ1 A;  3PUK A;  3CHR A;  4QQI A;  1TEZ A;  2ZD9 A;  3IHY A;  3CVU A;  4NIK A;  2A68 F;  4L2L A;  5A6B A;  3QDN A;  4CS9 C;  4NTB A;  2WB2 A;  4K1O A;  3RQE A;  2PM6 A;  2NPU A;  3G50 A;  3DXK G;  2VC9 A;  4JEA A;  4EKW A;  1K1A A;  5DS5 A;  4I44 A;  4ABN A;  5JVE A;  4BX9 A;  3FUL A;  3Q7L A;  1OW7 A;  3CVX A;  5ENN A;  2EPK X;  1A41 A;  1XWJ A;  2PQR A;  3RJV A;  2LFD A;  1DOV A;  4QDL A;  1KPS B;  2XXA A;  2H7V C;  4I9E A;  3EFO B;  4DI4 A;  1NZE A;  2VGX B;  4W9R A;  3ABK C;  2D5R B;  3DWW A;  2KAT A;  3RVZ A;  4NCQ A;  4JKV A;  2YHC A;  3BUA A;  1I4Y A;  4CDR A;  3PVL A;  4ONS A;  2UY1 A;  2XLH A;  5BT1 A;  4LEU A;  2LK4 A;  2LNI A;  3V5Z A;  2AWY A;  2QTV A;  3EZI A;  4U63 A;  4BG0 A;  1BDJ B;  2R05 A;  5AIJ A;  4GYT A;  4MVZ A;  3JXI A;  3MCX A;  3B71 A;  2R17 C;  3GW4 A;  2EIL C;  2HM8 A;  2HZ8 A;  1OXJ A;  1TWG A;  2V0P A;  2WXK A;  4H7X A;  3ZIB A;  2L6G A;  4GPM A;  3LVR E;  5T3W A;  2MYS A;  4TUU A;  3EU9 A;  2KYH A;  3FH5 A;  2HMZ A;  3L54 A;  4UI9 K;  4FHJ A;  1B89 A;  1OCC C;  2LP4 A;  1QLE C;  2BL2 A;  4XEK A;  2Y0B G;  1D0Y A;  5HI7 A;  5FIN A;  3HXB A;  2P9I G;  1Z23 A;  3APF A;  3EDT B;  3DE8 A;  4XPW A;  3F47 A;  4AP2 A;  5JJ7 A;  3CST A;  4KMO A;  2BED A;  3D9N A;  3DPY A;  3SBS A;  1FVH A;  2HSQ A;  4U8H A;  2IXO A;  4EBA A;  2A6H F;  3LJB A;  3K9I A;  2WVO A;  3RRM B;  1OXK A;  1TN6 A;  2EIM C;  4N6H A;  1V74 B;  2P9L G;  3UX4 A;  1CGN A;  3C3O A;  3PRE A;  1JPL A;  1HO8 A;  3ZG1 A;  3CEQ A;  3X2Q C;  1YAU O;  2H6F A;  4WJ0 A;  5AAR A;  1GQA A;  3KEZ A;  4HOU A;  3TG4 A;  2WM9 A;  5F5F A;  4C0E A;  2I6H A;  4Z9J A;  5JUA A;  2G3V A;  3ZDL A;  5ARF A;  4Q94 A;  2J8W A;  4MW8 A;  2J08 A;  2KSF A;  3GOR A;  1E96 B;  4JC7 A;  1JUQ A;  3HNI A;  2IOL A;  3TWU A;  2WB7 A;  3EPV A;  3B0V C;  3DI5 A;  4IWB A;  4MVU A;  2DBA A;  4ZFH A;  5BV1 A;  4F6R D;  1WAS A;  3E34 A;  3RW0 A;  5AJL A;  3ZYQ A;  3BEE A;  3CVY A;  2XCC A;  4EZK A;  4NAC A;  4UWL A;  3C63 A;  4I2W A;  3V2X A;  3TWQ A;  1U2V G;  3WOD F;  4U0S A;  4CYM D;  4OAV B;  4FJY A;  4FLH A;  1XNF A;  1IXV A;  4NQ0 A;  1TWA A;  1O1S A;  2A0B A;  3JQ0 A;  3LVQ E;  4JRZ A;  5DS4 A;  2L9J A;  4E7Z A;  3HXC A;  5FQ8 A;  3IQ6 A;  2LSV A;  4GU5 A;  3B95 A;  4BJ5 C;  3D9P A;  5TJ5 E;  2MRI A;  2IBF A;  3LPZ A;  1V4A A;  3QMK A;  4F53 A;  1A7V A;  1RZ4 A;  2AU5 A;  1Y6I A;  3RRN B;  3QVY A;  2KZT B;  1Y4C A;  4PUC A;  1JCR A;  2CG3 A;  4JA9 A;  3HHM A;  4ANX A;  2EIN E;  4JEB A;  4I6E A;  5ENP D;  4A55 A;  1HY5 A;  1UG3 A;  3DAG A;  4J8Y A;  3ZYK A;  4BJ6 C;  4PDX A;  2PX3 A;  1LVK A;  1WGW A;  3RH3 A;  1IQU A;  2WXM A;  3FHD A;  3E32 A;  1CPR A;  3FTS A;  3U8P A;  3IKO B;  2EIK C;  5AQA A;  2F22 A;  3TWT A;  4U5C E;  3NYL A;  4WUY A;  2C0M A;  2Y69 E;  2WMO A;  4LDQ A;  2ZGG A;  4DK5 A;  4HRL A;  2HMQ A;  4IB4 A;  2QY9 A;  2F0Y A;  3HXD A;  2P9N G;  3BQO A;  4GAA A;  5EK0 A;  4JHK A;  256B A;  5G05 J;  1HW1 A;  4XPX A;  2YHS A;  1Q0F A;  3QKY A;  1O5M A;  4I6G A;  5F5H A;  4A4A A;  2FO7 A;  2ETB A;  4K5B A;  4N3C A;  2HR2 A;  4LDR A;  4ANJ A;  4H4K C;  4N39 A;  3B7T A;  5CER B;  2ETC A;  4GPK A;  3S7J A;  3LCA A;  3MYV A;  5CMY A;  4APO A;  4ER9 A;  3Q79 A;  5KYY A;  3SZ7 A;  4BSX A;  2KC7 A;  4DRJ B;  2OCC C;  3AG3 C;  3AQC A;  1C02 A;  2FFH A;  3I4U A;  3G2U A;  1JMW A;  2I9C A;  3PNL B;  4URK A;  4CDN A;  3OWT A;  3ZC4 A;  2HSB A;  2IFU A;  2CYD A;  2WVQ A;  5E75 A;  2YKZ A;  4U9D A;  4GA1 A;  4K5C A;  5E3A A;  5ENO D;  4OIO F;  2PBE A;  2NYJ A;  1OCR E;  3L08 A;  1TN7 A;  2GRQ B;  2GRN B;  1O1R A;  5CCM A;  4WGY A;  3I3N A;  1K8K G;  4E18 A;  2DI3 A;  4W8P A;  2MYO A;  5JHB A;  2GA0 A;  3EHR A;  3SHF A;  3ABL E;  3ISM C;  3OA1 A;  3CVN A;  1H2T C;  2DIW A;  1IQR A;  2YL3 A;  3PZ1 A;  4P9F A;  3V5Y A;  4BET A;  1Q2Z A;  3NF1 A;  5EKQ D;  5D0Q D;  1MND A;  3PE3 A;  4DRX E;  1MHQ A;  3DXM G;  5B1A E;  2NSZ A;  1M56 C;  3FHE A;  2CHZ A;  3I4G A;  1HF8 A;  4GB9 A;  3MYI A;  4FA6 A;  3FXH A;  2CG2 A;  2KGO A;  4JEH A;  2B0J A;  2BF0 X;  2LSE A;  3M15 A;  4IAR A;  2O9X A;  5D91 A;  2J49 A;  1FMW A;  3RK6 A;  3CVV A;  3K33 A;  3NMI A;  1VYK A;  2WXO A;  3CR3 A;  4O6Y A;  3K1I A;  2YLD A;  2Y4U A;  5DQZ A;  3QVZ A;  4Q4Z F;  5T3R A;  5BPP A;  4UWK A;  4L1B A;  1ZB1 A;  2RFM A;  3GEH A;  1EYH A;  3U9M A;  3UM1 A;  1Q0G A;  3TL5 A;  1A0B A;  5T3T A;  1TJC A;  1N94 A;  3U2L A;  2IO2 C;  1OWP A;  3D9J A;  4CS9 A;  4EZJ A;  1L7C A;  3R2P A;  1UFB A;  5AAO A;  4F1P A;  2NUP B;  5G55 A;  3T8K A;  5M72 A;  4MVR A;  1LM3 B;  2CCY A;  1L3P A;  4LDK A;  1HX8 A;  3FTU A;  4HRN A;  3ZVV A;  4RVB A;  2J9B A;  2WMN A;  3J5Q B;  3RRU A;  2JPU A;  1JCS A;  2WQ6 A;  3SQV A;  3DSX A;  4LNB A;  3WHN A;  3ASN E;  3M4B A;  4OIN F;  2HYZ A;  1NFN A;  3RF3 A;  1G4W R;  1E90 A;  2XL6 A;  4MND A;  3FTX A;  1A7D A;  2ZXO A;  4CZ2 D;  4JCH A;  2H6G A;  1NLX A;  3CKC A;  4KZC A;  1JRA A;  1YZA A;  2J0X A;  4KNV A;  3HNL A;  3TQO A;  3KD7 A;  4JE9 A;  4AE4 B;  2R59 A;  3EH1 A;  3TWR A;  4DX6 D;  4DLO A;  4G26 A;  4C7O B;  3LAY A;  1UW4 B;  1BI8 B;  4UI9 J;  3PCV A;  4TXQ A;  2VB6 A;  2ZXW C;  3EHM A;  2W4B A;  3L8I A;  1QQE A;  3DZA A;  3FP3 A;  4Y6C A;  3FH7 A;  4CGW A;  3RFY A;  1M57 C;  2C0L A;  4FWV A;  3L17 A;  3C7J A;  4A3T A;  3ZW3 A;  3B7S A;  3GWN A;  3C8G A;  1H2U A;  1LE2 A;  4NTA A;  1LPE A;  3TK0 A;  4UWH A;  1TWH A;  4FU3 A;  1S7Z A;  4U5G A;  3MV2 B;  1HU3 A;  4AOF A;  3NMJ A;  1H6K A;  1BLX B;  1OQC A;  2LD6 A;  3Q7F A;  2X6J A;  1W2W A;  1HS6 A;  1N4R A;  4GZ5 A;  5CRV A;  1DCE A;  3ASD A;  3L6A A;  4DPR A;  1MZC A;  4YT4 A;  2A5E A;  3K1H A;  4AY6 A;  5CI9 A;  5BUO A;  4H7Y A;  5JA4 D;  2Y1L E;  3SNX A;  4CDA A;  2E0I A;  3ESK A;  3US6 A;  1HH8 A;  4MRU A;  1KLX A;  4CBE A;  5L0D A;  4Q96 A;  4LG6 A;  1KU2 A;  2XZT G;  3X1O A;  4RLY A;  3SNH A;  1LE4 A;  1H6O A;  4BES A;  2XM4 A;  4LNG A;  2NSF A;  3QW0 A;  4YL3 A;  5IY5 C;  1TR4 A;  2R9R B;  3LY9 A;  5ANR A;  1D1B A;  4MVM A;  2XQ0 A;  3PZ3 A;  3VTX A;  2FGY A;  4JCZ A;  1KZP A;  3TWS A;  2JAB A;  3HTK C;  1NA0 A;  4N3B A;  3AS4 A;  3UR3 C;  4U5B E;  4ATZ D;  4A1G A;  4HLE A;  3DSV A;  4DJA A;  2YL7 A;  5ENT D;  1S0P A;  3U3B A;  3HLZ A;  4Q7C A;  4HVB A;  3KKB A;  1SZA A;  1E8Z A;  3JYS A;  1LS4 A;  1IKN D;  3CK9 A;  4I2Z A;  1RKE B;  3T6J A;  1OWL A;  4N06 A;  3VLF A;  3ZQV A;  4GYW A;  1GW6 A;  2BUG A;  2V8S E;  3S7F A;  3SY2 A;  1AP7 A;  3GZS A;  3A9C A;  3S27 A;  2V5F A;  3CHO A;  3R7C A;  3LYA A;  3O39 A;  4UQX A;  4P29 A;  3URZ A;  1HMO A;  5JMN D;  3AGT A;  1HG5 A;  2ZU6 B;  5EX0 A;  3EFO A;  2VGX A;  1HE8 A;  1BZ4 A;  1KT1 A;  3B29 A;  4BT8 A;  1CPQ A;  3NYM A;  1G4U S;  4GTO A;  5C2Y A;  3LES A;  2XGS A;  4CS8 C;  4JJF A;  4PJN A;  2DYR E;  4P9T A;  1SF8 A;  2ZPA A;  2J8S D;  3DSW A;  4KNW A;  3L16 A;  1NFO A;  2HUJ A;  1X81 A;  2R02 A;  4X0R A;  5FQ7 A;  1YZC A;  4YDE A;  4LNU D;  2KW3 C;  1L5J A;  2WXH A;  3PZ2 A;  3WG7 E;  2Z15 A;  3UM2 A;  3ASG A;  1EKY A;  2QE9 A;  4RSY A;  1GM5 A;  5KWD A;  1YYJ A;  3SFZ A;  3PMR A;  3IBE A;  3ZXS A;  3GM3 A;  2L0T B;  3T6B A;  3C3Q A;  3CQC B;  2EIJ C;  4DVY P;  1DOW A;  2PZI A;  1NU7 D;  4TV3 A;  4AVX A;  1E86 A;  2XGO A;  1LIH A;  4E0H A;  1H9T A;  2WQH A;  1CGO A;  4NRH B;  2L7A A;  4GZ3 A;  3QNK A;  4PFO A;  3CK7 A;  3IEE A;  3MEK A;  4PS8 A;  4AEZ C;  3CIA A;  3JCU Q;  1VLT A;  2C03 A;  3CVP A;  2P6V A;  1LF8 A;  4DXW A;  1MX4 A;  4C3B A;  3NOC D;  1JPN A;  1EPU A;  3AG1 E;  1K04 A;  3FUJ A;  3LLK A;  3VLD A;  1BPO A;  4XIF A;  4OYS A;  1GS9 A;  4G8L A;  3ZSU A;  1QYM A;  3Q7G A;  2KJG A;  4HS2 A;  1W3B A;  4BPM A;  2GWW A;  4KVO A;  3ZQY A;  3EGX B;  1QSP A;  1WAO 1;  4I1A A;  2VYI A;  3ASO C;  1O3U A;  3C8G D;  5CCL A;  4DUI A;  2UUI A;  4WNE A;  3JZ0 A;  4O6N A;  5KYX A;  2ZIS A;  2KCV A;  3G4X A;  3CSK A;  1N54 A;  5COG A;  2B0O E;  3HVE B;  4JIO A;  1VYI A;  2YEV A;  1SQM A;  3Q15 A;  4EIY A;  4CSA A;  1U0B B;  5ARG A;  1D1C A;  2R7X A;  5AQ7 A;  2KNH A;  3UT8 A;  3NB2 A;  1H2V C;  2J4D A;  5LCW C;  2RD9 A;  3MKQ A;  3RYL A;  4G0H A;  3NAW A;  3NKE A;  2X6K A;  2B0H A;  4GTV A;  1R5I D;  1LD7 A;  3DPD A;  2MHK A;  2AVK A;  3MYF A;  1WWP A;  1YA0 A;  1H7I A;  3NDB B;  4E17 A;  3T6G B;  1T6I A;  2X6I A;  3O4Z A;  4OAU C;  4GCN A;  4B94 A;  1BR2 A;  1IHB A;  3BG0 B;  3ZUV B;  2RD0 A;  1ZYR F;  4G7Z F;  2KM4 A;  5E33 A;  3DMD A;  3T4R A;  1N0Q A;  4GTS A;  5EDS A;  3G2V A;  2WZL A;  1Q0M A;  2CNW D;  4CDY A;  3C3R A;  5BXU A;  3TJ6 A;  2KCL A;  3IV0 A;  1HFA A;  3S7D A;  3UIP C;  2QY7 A;  3S84 A;  2WXG A;  1INZ A;  1H6G A;  4YT8 A;  4U8Y D;  4ZHB A;  2VCB A;  3CHS A;  2DCP A;  4G7H F;  3ZEF A;  5KJN A;  1T9K A;  2IM8 A;  2XPZ A;  2I2O A;  4JUR I;  2PNN A;  1RKC A;  5ENS D;  2WZG A;  4GZD A;  2VTB A;  1ST6 A;  4BEP A;  3IQC A;  1RCP A;  2Q00 A;  5FWQ A;  4I9C A;  3LS1 A;  3UKU G;  4DX2 A;  3LS8 A;  4N2S A;  1H6P A;  2KQ9 A;  1BU9 A;  1FFH A;  2CFU A;  1TFK B;  4GZ6 A;  3JYY A;  4K7B A;  3TOL A;  3FTZ A;  4JA7 A;  2MHR A;  2CFZ A;  2WXF A;  1Z5Z A;  4AK9 A;  5BNW A;  2WQ7 A;  1PV3 A;  1ZU4 A;  5COM A;  1TFO B;  5L0H A;  2XM0 A;  3A11 A;  2ILR A;  2GAQ A;  5FIO A;  1HE1 A;  3RIB A;  1NG1 A;  2BKK B;  2LCH A;  4B0Z A;  4U5F E;  2A1D D;  2J7P A;  3KYI A;  1E8Y A;  2P9P G;  4DBQ A;  3HG0 D;  2VSY A;  5L3Q A;  5AQ9 A;  1E8X A;  4GA2 A;  1IHG A;  3O48 A;  2OVB A;  4YVO A;  1PAQ A;  2X6F A;  3UIN C;  2HJM A;  4NUR A;  4UQZ A;  3E30 A;  3MJW A;  4U8V D;  5K0I A;  5CBN A;  4ME2 A;  1NFI E;  4A3V A;  1A5E A;  2IO3 C;  1FPP A;  4JTC B;  2WPV A;  4F3V A;  1ZHY A;  1Y8M A;  3EU5 A;  2I8B A;  2JD3 A;  1ELK A;  4FLB A;  3Q9N C;  2XS1 A;  5B3S E;  1I5N A;  2QFC A;  1S64 A;  3T5V A;  2CHW A;  3MKR A;  1B68 A;  3RAU A;  5A69 A;  4GEH A;  5HRY A;  1NU9 C;  4O6F A;  4NC3 A;  2M4E A;  4Z9H A;  1J8Y F;  3S7B A;  3N24 A;  3ULE G;  2WXN A;  2EPM X;  2Y39 A;  3T8M A;  2Q9C A;  2VSN A;  4DRI B;  4XE0 A;  3LNM B;  5AN8 A;  3FU5 A;  3NG1 A;  2IXP A;  3CHP A;  3SXY A;  5AYW D;  3QAQ A;  2Q9A A;  1PD1 A;  2IU1 A;  1FMV A;  1XZP A;  2UUH A;  4X8Q A;  2EIN C;  1N52 A;  4AV7 A;  4J7Y A;  3PH0 C;  4F7A A;  4EBB A;  4NTF A;  2I15 A;  3MZL B;  3HNK A;  3L22 A;  3Q9U C;  2B6C A;  2J09 A;  2HJ3 A;  2J4B A;  4G2V A;  4EWC A;  1N9A A;  1SA5 A;  5A6K A;  3CQG B;  2VGE A;  3JXJ A;  3FUH A;  5A6B D;  4N4W A;  3TJ5 A;  3OXL A;  3QK0 A;  5A6C A;  1VLS A;  2Y69 C;  2QUP A;  3HJC A;  4O79 A;  1VK5 A;  3KYJ A;  4Z68 A;  4CS7 A;  4E7S A;  4JC8 A;  3C98 A;  5KYW A;  4MTF A;  5AC4 A;  1BR1 A;  3G2S A;  3IPM O;  4KBL A;  1SZ9 A;  3G2T A;  3P2B A;  2E87 A;  3UM0 A;  1MX2 A;  1FCH A;  4C48 B;  2L0I A;  2OEW A;  5EIL A;  3V31 A;  3I5P A;  4CDM A;  4JW1 A;  2Y3B A;  3ONL A;  2Y4T A;  1UN8 A;  3N0T A;  1OKK A;  4BEJ A;  2H6I A;  1IW7 F;  1BD8 A;  3QJZ A;  3GAN A;  4MVS A;  2Q3T A;  2R03 A;  4HLL A;  5EX3 A;  3W4Y A;  4UQY A;  1BR4 A;  1EF1 C;  3DM9 B;  3MLG A;  4B6I A;  4MVQ A;  3NZS A;  3CQZ A;  3NYJ A;  3FUE A;  2FBN A;  3MBG A;  3GWL A;  2JLB A;  2DZN A;  3MA5 A;  3HXE A;  2X6H A;  1RJ9 A;  3SP1 A;  4GTP A;  2XL8 A;  2XLO A;  4GTM A;  4QFV A;  3UMK A;  2R7Q A;  3VRC A;  1OCR C;  4FJZ A;  1MYO A;  5AQB A;  2GRO B;  3ZU7 B;  4J30 B;  3UGP A;  1MMD A;  4C7O A;  3J5P A;  1EDU A;  4YT5 A;  4CJG A;  5FZS A;  2XEE A;  5DIZ A;  3ABL C;  3L13 A;  1EA8 A;  2OJE D;  3DWL G;  4JXT A;  4EBK A;  3N71 A;  4OVU A;  5BXO A;  1OY3 D;  4MTG A;  1RXQ A;  2V4H C;  3S90 A;  1H9G A;  3L0I A;  4O6M A;  5T1D B;  4OIR F;  3W2W A;  3EGD B;  4GCO A;  1MMA A;  4C9B B;  1V55 C;  4L6R A;  1V55 E;  2P9U G;  5B1A C;  2L81 A;  5JS5 A;  4J0U A;  4DBR A;  4DRH B;  3BU8 A;  3SXZ A;  2MOW A;  2FUL A;  5AJD A;  2RFA A;  1TR2 A;  2R25 A;  4XEV A;  2YHE A;  4PS7 A;  4QI0 A;  3NQP A;  4JZA A;  1M2V B;  1ELR A;  1FR0 A;  1QZ2 A;  5KYN A;  1TWC A;  4J7W A;  3N2Z B;  3TXN A;  3JSE O;  3AG4 E;  1ORY A;  1IYG A;  4Q5S F;  5CBO A;  2NC9 A;  2ZXP A;  3GEI A;  2VSX E;  3KH2 A;  3FUD A;  4O1O A;  1KZO A;  1FNT c;  4WWP A;  3NOG D;  4G1T A;  4M3O A;  1HE9 A;  4UUC A;  4A1S A;  4PJJ A;  3DJN B;  4CEM A;  2FF4 A;  1X5B A;  4J32 B;  1Z63 A;  3MFN A;  3GYZ A;  2LSU A;  3ZTM A;  2XSE A;  1DC2 A;  1YDI A;  1ZHT A;  1YLM A;  4CDV A;  4GZC A;  3TD7 A;  1YCS B;  3TWW A;  2IXM A;  1HG2 A;  1SR2 A;  2GRL A;  2VQ2 A;  2ZXR A;  4BEM J;  3TOM A;  2XEV A;  1E85 A;  4G25 A;  4CX9 A;  3DXJ F;  2KK1 A;  1VDY A;  3JRM O;  4RDA A;  1DCQ A;  1O1T A;  3S0X A;  3ASN C;  5AGF A;  3H2V A;  1RKE A;  3F46 A;  3D9O A;  4APF A;  3KPH A;  3SXM A;  2HE0 A;  5JLI A;  3SI5 A;  1KTM A;  2YWA A;  2F8X K;  5L0G A;  1QVX A;  1XGW A;  3D9K A;  2GDC A;  3TUL A;  3UT7 A;  2J07 A;  4M63 A;  4Y6W A;  2Q4F A;  2G62 A;  1QNF A;  3FFL A;  3AGU A;  1Q0D A;  3AAA C;  4XEI G;  1VTM P;  3ML8 A;  1Z7Q c;  1JAF A;  2UWJ G;  1OUV A;  3RKO F;  4XLN F;  3I4R B;  3SZR A;  2NSG A;  4U9E A;  3RQG A;  2CW0 F;  3VF0 A;  5KYY B;  2XLE A;  2QYJ A;  3DEO A;  3EIQ C;  2XL4 A;  4MLP A;  5E3C A;  2OND A;  2V26 A;  1NP7 A;  1S05 A;  4H54 A;  3M79 A;  3ESL A;  1K05 A;  2P58 C;  3ZN3 A;  1MMG A;  4CRW A;  4N3A A;  2Q7F A;  4U04 A;  4TXR A;  1SZI A;  3SFX A;  1NI1 A;  1YA9 A;  2YRF A;  1E2X A;  4JZY A;  4YVQ C;  2YQ8 A;  3CKB A;  1K40 A;  4CT4 A;  3KMI A;  3DSS A;  5L0F A;  2ZIR A;  5L0C A;  3UI2 A;  5JRA A;  2I1J A;  2VGY A;  2LAI A;  2DYS E;  5FQ4 A;  2QC9 A;  1GGQ A;  2V4L A;  2XLD A;  3HIZ A;  4BER A;  3ZXP A;  4GYY A;  3V5X A;  3PEV B;  4U5H A;  1C17 M;  3LY7 A;  3Q5M A;  4HFG A;  4G8K A;  3D9I A;  3AJM A;  3Q75 A;  5BW8 C;  2JX0 A;  1TNU A;  4OD5 A;  1UN9 A;  4ULW A;  1T5O A;  4EBJ A;  1BI7 B;  1AVO B;  3FAP B;  3QWV A;  4FHK A;  4U95 D;  1T01 A;  1Y6D A;  1Z3Y A;  2KXP C;  4JL0 A;  3CV0 A;  3CGH A;  3FWV A;  3J06 A;  3FY4 A;  1SYQ A;  4XI9 A;  2HKV A;  1QZX A;  3V79 K;  5L3V A;  1FVF A;  4B8C B;  2HFI A;  2CDQ A;  4D4N A;  3EGX A;  3B7R L;  3UQ3 A;  4B8A A;  5FQ6 A;  1R4T A;  3W8H A;  1OWN A;  4FES A;  3ENE A;  1FTS A;  1OCZ E;  5A6A A;  3AG2 E;  4HOT A;  4TRQ A;  5JJT A;  4LER A;  3R9A B;  1M6T A;  3ZKJ A;  3APC A;  3QTH A;  1YAR O;  3MGB A;  4RBN A;  4HI9 A;  2DVW A;  4EQF A;  1Z3X A;  2J45 A;  2X38 A;  5A6J A;  2GW1 A;  3WXX A;  4BJ5 A;  4FAP B;  2C2L A;  4A2N B;  2IY0 C;  3EG9 B;  3JSZ A;  3WAQ A;  4QI2 A;  5JT4 A;  1C03 A;  4I3M A;  4L2Y A;  2XS8 A;  1JWG A;  4GMJ A;  3RSE G;  2VH3 A;  1LKX A;  4LLE A;  1LI7 A;  4J6I A;  5KYU B;  4KC9 A;  2X0C A;  3S29 A;  2AXV A;  1N4Q A;  2BKG A;  4BJ6 A;  1NSG B;  1YYX A;  4JTA B;  3RVY A;  2HO1 A;  3R7R A;  5T4Y A;  1N11 A;  5KJK A;  4CJO A;  2R7T A;  4MW3 A;  2J9V A;  3DE9 A;  1LTX A;  4A63 B;  2DYR C;  1HXI A;  5FZQ A;  1OR3 A;  4IYP A;  3L34 A;  4WAF A;  3ONK A;  4YND A;  3BG1 B;  3ZNG A;  1OCO E;  5EN5 D;  4AL0 A;  4KVM A;  3CEX A;  4OD4 A;  3NBN B;  5T8I A;  3F6Q A;  2OKU A;  4HXI A;  2VCA A;  3WG7 C;  2L6H A;  3TWV A;  4NY3 A;  3CLJ A;  4R32 A;  4ACL A;  2HV7 A;  2AWC A;  2IJG X;  1YMP A;  5G04 C;  3Q78 A;  4IUL A;  4J8S A;  4JPS A;  4KI2 A;  2KC3 A;  1EQ1 A;  1TNZ A;  4EBA G;  3T5X A;  2J9Q A;  3W9F A;  2OU6 A;  3C8G B;  4PFP A;  3LEV A;  4DOZ A;  2WZF A;  4ILI A;  1E83 A;  1QPU A;  2DGJ A;  3TXM A;  4BSZ B;  4BJT A;  3L8J A; 
#chains in the Genus database with same CATH homology
 4PJL A;  4HOR A;  1VOM A;  2IOQ A;  5DS6 A;  3LEW A;  3PDN A;  5LCW J;  3VAY A;  4C0M A;  3LXU X;  3AU5 A;  4YN0 B;  3PE4 A;  3POV A;  3AG1 C;  3PRZ A;  3LS0 A;  3FDQ A;  2WVN A;  3ZHE B;  4EZL A;  3FUI A;  2HV6 A;  5LX8 A;  5FJY A;  3SGH A;  1TJF A;  1WY6 A;  4GA0 A;  3UUX A;  2L9B A;  4RG9 A;  1ZU5 A;  2R7R A;  2PP4 A;  2J9W A;  3CSF A;  2WXJ A;  4G11 A;  3LLI A;  4CGV A;  2PX0 A;  3U4T A;  3FTW A;  3U64 A;  5LFA A;  3IHV A;  1Z3I X;  3FTV A;  2GFH A;  2WVI A;  1DNP A;  4XWJ A;  3KL4 A;  4RD9 A;  4J8D A;  3K1I C;  5J90 A;  3AQB A;  3ZRH A;  3H65 A;  2VAS A;  3R7Q A;  5CMW A;  4YJW A;  3OTN A;  2OV8 A;  1OWM A;  4G24 A;  3Q4A B;  3MV3 B;  3AU4 A;  3UMH A;  2G3K A;  2XRH A;  4J8F A;  3FU0 A;  1V54 C;  4Q69 A;  3OAW A;  4U07 A;  2A5U A;  2KZT A;  3CHQ A;  4OIQ F;  3B0P A;  3LDZ A;  4WWN A;  4L7T A;  4UWF A;  4CIH A;  3GOD A;  2PQN A;  4HE8 D;  3PUJ A;  3CHM A;  3DJU B;  1IZM A;  3PZD A;  1H19 A;  3QZC A;  4AJW A;  3FU3 A;  3LNR A;  1MMN A;  3OXG A;  1JWF A;  5FCL A;  3EHN A;  3K7D A;  3JT1 A;  4F4B A;  3UMV A;  3B13 A;  1PY1 A;  4CCA A;  1ZHX A;  3ZYL A;  4J8E A;  2VJ8 A;  3PEU B;  3HDX A;  4U0U A;  3LJ3 A;  4FX5 A;  4BTA A;  4ANU A;  2AVP A;  5CHE E;  3DAF A;  2OOE A;  2ION A;  4YWQ A;  3EH2 A;  2NUT B;  3EJN A;  3ULQ A;  3CK8 A;  3GZ1 A;  4PH4 B;  3FEX A;  5KJM A;  5B3S C;  4B89 A;  2XPY A;  1PD0 A;  4F1S A;  5E2Q A;  4ANV A;  2WL8 A;  3ZVR A;  2YZS A;  5KYX B;  3RO2 A;  1U3D A;  1E8W A;  4WNF A;  5A23 A;  1NZN A;  3ASH A;  4IN3 B;  4HOS A;  4ILH B;  2CGE A;  2WXI A;  4O7G A;  1NA3 A;  3EGD A;  3LY8 A;  3MKQ B;  3UNG C;  2XXA B;  4KZ0 A;  1ZBP A;  4U5E E;  4U5D E;  3ZGQ A;  2BTD A;  3KS2 A;  2Q9B A;  1O87 A;  1Z6A A;  2CHX A;  2RG8 A;  5LOZ A;  1M2V A;  1O5H A;  2UY1 B;  1PC2 A;  4JHR A;  1H0A A;  3JCK C;  4KT6 B;  3PHF 2;  1N1C A;  4LLC A;  2Y3G A;  4LRZ A;  4P6I C;  3B7U X;  3FAJ A;  3SD5 A;  1ELW A;  2FI7 A;  3TAX A;  4HFK B;  1HZ4 A;  5HQ8 A;  1MNE A;  5EHH A;  2A6E F;  4JVS A;  4LAC B;  2VTB B;  3FVY A;  2W9Y A;  3B9Q A;  3FUM A;  2KCK A;  2NUP A;  3JYH A;  2M63 A;  2PL2 A;  4K0R A;  3CZ6 A;  3JRT A;  3ITF A;  3EZH A;  2GGF A;  2I1K A;  3P1U A;  5D92 A;  5EGY A;  2LAH A;  4ATG A;  4CS8 A;  3QOU A;  3EIJ A;  4HEA J;  3W8I A;  2OVF A;  2XGM A;  1E7V A;  4BWR A;  3IEG A;  4JJG A;  1WM5 A;  3OXF A;  3VYW A;  1ZU2 A;  1P5Q A;  4IAO A;  3FTY A;  2W45 A;  3UGO A;  4AE4 A;  4XZ4 A;  2LO6 A;  4N5C A;  2NG1 A;  2J0W A;  2H7O A;  4OVV A;  3NZU A;  3ML9 A;  3OEO A;  4E85 A;  4ZLD A;  2GRM A;  2VSO E;  2XHE A;  5HSW A;  1UJK A;  3QWP A;  2AWI A;  4BX8 A;  3K66 A;  4RG6 A;  5A7D B;  4BJ1 A;  3FH8 A;  5G05 C;  4AM9 A;  4G23 A;  4AIF A;  4UWG A;  5JJ6 A;  4DLQ A;  4I43 A;  3SEO A;  2J7P D;  2IOS A;  2H7B A;  3D9L A;  2NXP A;  4CSA C;  2WXR A;  3PNT B;  3DM5 A;  4XLP F;  3Q6N A;  3U9W A;  3AG4 C;  5KCM A;  4HOQ A;  3ZPJ A;  1FFT C;  3I5Q A;  1Z6T A;  4C3E A;  4FAD A;  1E7U A;  4ZLC A;  3MX3 A;  3FEY A;  2A4Z A;  4AX2 A;  3ASF A;  4C3D A;  2R7S A;  1D1A A;  2C04 A;  1LS1 A;  5D0O D;  2PFD A;  4DVZ A;  4FUL A;  5DLJ A;  3SYN A;  2PM7 A;  3JQ1 A;  1D0X A;  3D9M A;  3TGO A;  4XTK A;  4AY5 A;  4V3I A;  3FUK A;  5AEN A;  3NKD A;  5DVW A;  3AS8 A;  3B0U X;  4KYO B;  5DBK A;  2J9U A;  5KYW B;  4G7O F;  3PS6 A;  3M1C B;  2XRZ A;  4WNG A;  2AXZ A;  3SF4 A;  3UPV A;  1JPJ A;  3E70 C;  4PK4 A;  3UT4 A;  3EG9 A;  4BT9 A;  2Y3A A;  4MS6 A;  4R7L A;  3CVL A;  5KYU A;  3UMI A;  3TJP A;  2YIN A;  1TKN A;  4WND A;  4DI3 A;  5FZR A;  2MWQ A;  2IQC A;  4XI0 A;  4EEC A;  1SMY F;  5LP0 A;  3FDH A;  4U0Z A;  2EQX A;  2FEZ A;  1RJ9 B;  4LCT A;  4WWO A;  2IYL D;  3RU0 A;  3FUF A;  2WXP A;  2X51 A;  3CVQ A;  5DQT A;  2YNQ A;  4EPZ A;  4BTB A;  1OKK D;  3S28 A;  2DYS C;  2WXQ A;  3U3W A;  3K6B A;  3VLE A;  2IF4 A;  4KXK B;  4HFF B;  3GZ2 A;  5JHA A;  2PF4 E;  2JEK A;  5FT9 A;  4BY6 A;  4N2Q A;  4GML A;  4AXH A;  4MQ9 F;  4ACK A;  4IJJ A;  5J08 A;  2J46 A;  4D10 C;  2WXL A;  3JUI A;  3ZHE A;  2W4M A;  1D0Z A;  4I1O B;  2AW6 A;  4JEU A;  2AXU A;  3AS5 A;  3APD A;  4PS3 A;  3NRH A;  1M2O A;  2R5S A;  5G2N A;  4UI9 C;  3HYM B;  1PCX A;  1OCZ C;  1OWO A;  4FC8 A;  3AG2 C;  3DBS A;  4W8K A;  4JHJ A;  2P7V A;  2E2E A;  2CNW A;  3RIP A;  2IXN A;  3HVE A;  4LUN U;  5G04 J;  4KBQ A;  4K03 A;  3ZIM A;  4K0D A;  5FTP A;  3O6X A;  2OG2 A;  4ILG A;  3D3M A;  5C1D A;  3SBT B;  4OIP F;  2A69 F;  3FU6 A;  3S2A A;  4L23 A;  3DD7 A;  2BE5 F;  4I1M A;  3QB2 A;  3EQL F;  2XRY A;  1OCO C;  5KJL A;  3TG5 A;  4XKB A;  1ZHZ A;  4MKT A;  3ZFW A;  1VMA A;  3ECS A;  3VTY A;  3QAR A;  1DVP A;  2R7O A;  3G2W A;  2XCB A;  3ZYM A;  3E9V A;  3E4B A;  1MQS A;  3W2V A;  3QC1 A;  2XPI A;  5E76 A;  2R7V A;  2V3C C;  3KAE A;  4I6J A;  3CVW A;  3RKV A;  4YT2 A;  5BV0 A;  5ANL A;  4PJM A;  3FUN A;  1G8X A;  2R7U A;  1ZHW A;  3Q6M A;  1KT0 A;  5BUZ A;  2L6J A;  3ABM C;  3V7O A;  1U3C A;  1J8M F;  3RO3 A;  3QWW A;  4I17 A;  1UJJ A;  4GYO A;  4XKC A;  2NUT A;  4E6H A;  1A17 A;  4CT0 A;  4IRU A;  3LKU A;  2Y3D A;  5B1B C;  3Q47 B;  2R7W A;  4FP7 A;  3Q49 B;  4XX5 A;  4BFR A;  3U66 A;  2X3M A;  2Y3H A;  4ANW A;  5CI8 A;  3PUK A;  3CHR A;  1TEZ A;  3IHY A;  3CVU A;  2A68 F;  4L2L A;  3QDN A;  4CS9 C;  2WB2 A;  2PM6 A;  5DS5 A;  4I44 A;  4ABN A;  4BX9 A;  3FUL A;  3Q7L A;  3CVX A;  5ENN A;  2PQR A;  3RJV A;  4QDL A;  2XXA A;  2H7V C;  4I9E A;  3EFO B;  4DI4 A;  1NZE A;  2VGX B;  4W9R A;  3ABK C;  2D5R B;  2KAT A;  2YHC A;  4CDR A;  3PVL A;  2UY1 A;  5BT1 A;  4LEU A;  2LNI A;  2QTV A;  3EZI A;  4U63 A;  4BG0 A;  5AIJ A;  4GYT A;  3MCX A;  2R17 C;  3GW4 A;  2EIL C;  2HM8 A;  1TWG A;  2V0P A;  2WXK A;  4H7X A;  3ZIB A;  3LVR E;  5T3W A;  2MYS A;  4TUU A;  3FH5 A;  3L54 A;  4UI9 K;  4FHJ A;  1B89 A;  1OCC C;  1QLE C;  1D0Y A;  5HI7 A;  1Z23 A;  3APF A;  3EDT B;  5JJ7 A;  3F47 A;  4AP2 A;  3CST A;  4KMO A;  3D9N A;  3SBS A;  4U8H A;  1FVH A;  2IXO A;  4EBA A;  2A6H F;  3LJB A;  3K9I A;  2WVO A;  3RRM B;  2EIM C;  3UX4 A;  3PRE A;  1JPL A;  1HO8 A;  3ZG1 A;  3CEQ A;  3X2Q C;  4WJ0 A;  4HOU A;  3KEZ A;  3TG4 A;  2WM9 A;  5F5F A;  4C0E A;  2I6H A;  2G3V A;  5ARF A;  4Q94 A;  2J08 A;  1E96 B;  1JUQ A;  2IOL A;  2WB7 A;  3EPV A;  3B0V C;  4IWB A;  2DBA A;  5BV1 A;  3ZYQ A;  5AJL A;  3BEE A;  3CVY A;  2XCC A;  4EZK A;  4NAC A;  4UWL A;  4I2W A;  3WOD F;  4U0S A;  4FJY A;  4FLH A;  1XNF A;  4NQ0 A;  1TWA A;  3JQ0 A;  3LVQ E;  5DS4 A;  2L9J A;  4E7Z A;  5FQ8 A;  2LSV A;  4GU5 A;  4BJ5 C;  3D9P A;  2MRI A;  3LPZ A;  3QMK A;  4F53 A;  1Y6I A;  3RRN B;  2KZT B;  4PUC A;  2CG3 A;  4JA9 A;  3HHM A;  4ANX A;  4I6E A;  4A55 A;  1UG3 A;  3DAG A;  3ZYK A;  4PDX A;  4BJ6 C;  2PX3 A;  1LVK A;  1WGW A;  3RH3 A;  1IQU A;  2WXM A;  3FHD A;  3FTS A;  3IKO B;  2EIK C;  4U5C E;  3NYL A;  4WUY A;  2C0M A;  2WMO A;  4DK5 A;  2QY9 A;  4GAA A;  4JHK A;  5G05 J;  2YHS A;  3QKY A;  4I6G A;  5F5H A;  2FO7 A;  4N3C A;  2HR2 A;  4ANJ A;  4H4K C;  4N39 A;  3B7T A;  4GPK A;  3S7J A;  3LCA A;  3MYV A;  5CMY A;  4APO A;  5KYY A;  3SZ7 A;  4BSX A;  2KC7 A;  2OCC C;  3AG3 C;  3AQC A;  2FFH A;  3I4U A;  3G2U A;  2I9C A;  3PNL B;  4URK A;  4CDN A;  3OWT A;  3ZC4 A;  2IFU A;  2WVQ A;  5E75 A;  4GA1 A;  5E3A A;  4OIO F;  3L08 A;  5CCM A;  3I3N A;  5JHB A;  3SHF A;  3OA1 A;  3CVN A;  1H2T C;  2DIW A;  1IQR A;  3NF1 A;  5EKQ D;  5D0Q D;  1MND A;  3PE3 A;  1MHQ A;  2NSZ A;  1M56 C;  3FHE A;  2CHZ A;  3I4G A;  1HF8 A;  4GB9 A;  4FA6 A;  2CG2 A;  2KGO A;  4JEH A;  2B0J A;  2BF0 X;  2LSE A;  2O9X A;  5D91 A;  2J49 A;  1FMW A;  3RK6 A;  3CVV A;  3K33 A;  1VYK A;  2WXO A;  3CR3 A;  4O6Y A;  2Y4U A;  5DQZ A;  4Q4Z F;  5T3R A;  5BPP A;  4UWK A;  4L1B A;  1EYH A;  3TL5 A;  5T3T A;  1TJC A;  1OWP A;  3D9J A;  4CS9 A;  4EZJ A;  2NUP B;  5G55 A;  5M72 A;  1HX8 A;  3FTU A;  3ZVV A;  4RVB A;  2WMN A;  3RRU A;  2WQ6 A;  2HYZ A;  4OIN F;  1E90 A;  4MND A;  3FTX A;  2ZXO A;  4JCH A;  3CKC A;  4KZC A;  2J0X A;  4KNV A;  3KD7 A;  4AE4 B;  2R59 A;  3EH1 A;  4DLO A;  4G26 A;  4C7O B;  3LAY A;  1UW4 B;  4UI9 J;  2VB6 A;  2ZXW C;  3EHM A;  2W4B A;  3FP3 A;  1QQE A;  3DZA A;  4Y6C A;  3FH7 A;  4CGW A;  3RFY A;  1M57 C;  2C0L A;  4FWV A;  3L17 A;  4A3T A;  3ZW3 A;  3B7S A;  1H2U A;  4UWH A;  1TWH A;  4FU3 A;  1S7Z A;  4U5G A;  3MV2 B;  1HU3 A;  4AOF A;  1H6K A;  2X6J A;  1W2W A;  1HS6 A;  4GZ5 A;  3ASD A;  3L6A A;  4DPR A;  4YT4 A;  3K1H A;  4AY6 A;  5CI9 A;  5BUO A;  4H7Y A;  3SNX A;  2E0I A;  3ESK A;  1HH8 A;  4MRU A;  1KLX A;  4CBE A;  4Q96 A;  1KU2 A;  3X1O A;  3SNH A;  5IY5 C;  5ANR A;  3LY9 A;  1D1B A;  2XQ0 A;  3VTX A;  2FGY A;  3HTK C;  1NA0 A;  4N3B A;  3AS4 A;  3UR3 C;  4U5B E;  4A1G A;  4HLE A;  4DJA A;  1S0P A;  3HLZ A;  4Q7C A;  4HVB A;  3KKB A;  1SZA A;  1E8Z A;  3JYS A;  3CK9 A;  4I2Z A;  3T6J A;  1OWL A;  4N06 A;  3VLF A;  4GYW A;  2V8S E;  1GW6 A;  2BUG A;  3S7F A;  3GZS A;  3S27 A;  2V5F A;  3CHO A;  3LYA A;  3O39 A;  4UQX A;  4P29 A;  3URZ A;  1HG5 A;  2ZU6 B;  5EX0 A;  3EFO A;  2VGX A;  1HE8 A;  1KT1 A;  4BT8 A;  3NYM A;  5C2Y A;  3LES A;  2XGS A;  4CS8 C;  4JJF A;  4PJN A;  1SF8 A;  2ZPA A;  4KNW A;  3L16 A;  4X0R A;  5FQ7 A;  2KW3 C;  1L5J A;  2WXH A;  2Z15 A;  3ASG A;  4RSY A;  3SFZ A;  3PMR A;  3IBE A;  3ZXS A;  2L0T B;  3T6B A;  3CQC B;  2EIJ C;  4DVY P;  2PZI A;  1NU7 D;  4TV3 A;  4AVX A;  2XGO A;  2WQH A;  4NRH B;  4GZ3 A;  3QNK A;  4PFO A;  3CK7 A;  3IEE A;  3MEK A;  4PS8 A;  4AEZ C;  3CIA A;  3JCU Q;  2C03 A;  3CVP A;  2P6V A;  1LF8 A;  4C3B A;  1JPN A;  1EPU A;  3FUJ A;  3LLK A;  3VLD A;  1BPO A;  4XIF A;  4OYS A;  3ZSU A;  3Q7G A;  2KJG A;  4HS2 A;  1W3B A;  4KVO A;  3EGX B;  1WAO 1;  4I1A A;  2VYI A;  3ASO C;  5CCL A;  4WNE A;  4O6N A;  5KYX A;  2KCV A;  3CSK A;  1N54 A;  3HVE B;  1VYI A;  2YEV A;  1SQM A;  3Q15 A;  4CSA A;  5ARG A;  1D1C A;  2R7X A;  2KNH A;  3UT8 A;  1H2V C;  2J4D A;  5LCW C;  3MKQ A;  3RYL A;  4G0H A;  3NKE A;  2X6K A;  3DPD A;  2MHK A;  1YA0 A;  3NDB B;  3O4Z A;  2X6I A;  4GCN A;  4B94 A;  1BR2 A;  3BG0 B;  2RD0 A;  1ZYR F;  4G7Z F;  2KM4 A;  5E33 A;  3DMD A;  3T4R A;  5EDS A;  3G2V A;  2WZL A;  2CNW D;  2KCL A;  3IV0 A;  1HFA A;  3S7D A;  2QY7 A;  2WXG A;  1INZ A;  4YT8 A;  3CHS A;  2DCP A;  4G7H F;  3ZEF A;  5KJN A;  2XPZ A;  2I2O A;  4JUR I;  2WZG A;  4GZD A;  2VTB A;  1ST6 A;  5FWQ A;  4I9C A;  3LS1 A;  4N2S A;  3LS8 A;  2KQ9 A;  1FFH A;  2CFU A;  4GZ6 A;  4K7B A;  3FTZ A;  4JA7 A;  2CFZ A;  2WXF A;  1Z5Z A;  4AK9 A;  5BNW A;  2WQ7 A;  1ZU4 A;  2ILR A;  3RIB A;  4B0Z A;  1NG1 A;  4U5F E;  2A1D D;  2J7P A;  1E8Y A;  4DBQ A;  2VSY A;  5L3Q A;  1E8X A;  4GA2 A;  1IHG A;  3O48 A;  2OVB A;  4YVO A;  1PAQ A;  2X6F A;  4NUR A;  4UQZ A;  3MJW A;  4ME2 A;  4A3V A;  2WPV A;  4F3V A;  1ZHY A;  1Y8M A;  2I8B A;  2JD3 A;  1ELK A;  4FLB A;  2QFC A;  3T5V A;  2CHW A;  3MKR A;  4GEH A;  1NU9 C;  4O6F A;  2M4E A;  1J8Y F;  3S7B A;  3N24 A;  2WXN A;  2Y39 A;  3T8M A;  2Q9C A;  2VSN A;  4XE0 A;  3FU5 A;  3NG1 A;  2IXP A;  3CHP A;  5AYW D;  3QAQ A;  2Q9A A;  1PD1 A;  2IU1 A;  1FMV A;  2EIN C;  1N52 A;  4AV7 A;  3PH0 C;  4F7A A;  4EBB A;  3MZL B;  3L22 A;  4G2V A;  2J09 A;  2J4B A;  4EWC A;  3CQG B;  3FUH A;  3OXL A;  3QK0 A;  5A6C A;  2Y69 C;  3HJC A;  4O79 A;  1VK5 A;  4CS7 A;  4E7S A;  4JC8 A;  3C98 A;  5KYW A;  1BR1 A;  3G2S A;  4KBL A;  1SZ9 A;  3G2T A;  3P2B A;  2E87 A;  1FCH A;  2L0I A;  3I5P A;  4CDM A;  4JW1 A;  2Y3B A;  3ONL A;  2Y4T A;  1UN8 A;  3N0T A;  1OKK A;  4BEJ A;  1IW7 F;  3QJZ A;  3GAN A;  2Q3T A;  5EX3 A;  4UQY A;  1BR4 A;  1EF1 C;  3DM9 B;  3MLG A;  4B6I A;  3NZS A;  3CQZ A;  3NYJ A;  3FUE A;  2FBN A;  2JLB A;  3MA5 A;  2X6H A;  1RJ9 A;  3SP1 A;  4QFV A;  3UMK A;  2R7Q A;  1OCR C;  4FJZ A;  4J30 B;  3UGP A;  1MMD A;  4C7O A;  1EDU A;  4YT5 A;  5FZS A;  5DIZ A;  3ABL C;  3L13 A;  4JXT A;  3N71 A;  4OVU A;  3L0I A;  4O6M A;  5T1D B;  4OIR F;  3W2W A;  3EGD B;  4GCO A;  1MMA A;  4C9B B;  1V55 C;  5B1A C;  2L81 A;  4J0U A;  4DBR A;  2MOW A;  2FUL A;  5AJD A;  1TR2 A;  4PS7 A;  2YHE A;  4QI0 A;  3NQP A;  4JZA A;  1M2V B;  1ELR A;  1QZ2 A;  5KYN A;  1TWC A;  3N2Z B;  3TXN A;  1IYG A;  4Q5S F;  2NC9 A;  2ZXP A;  2VSX E;  3KH2 A;  3FUD A;  4WWP A;  4G1T A;  4M3O A;  4A1S A;  4PJJ A;  3DJN B;  4CEM A;  2FF4 A;  1X5B A;  4J32 B;  1Z63 A;  3GYZ A;  2LSU A;  2XSE A;  1ZHT A;  4GZC A;  3TD7 A;  2IXM A;  1HG2 A;  2GRL A;  2VQ2 A;  2ZXR A;  2XEV A;  4G25 A;  3DXJ F;  1VDY A;  4RDA A;  3S0X A;  3ASN C;  3F46 A;  3D9O A;  4APF A;  3SI5 A;  1XGW A;  3D9K A;  3UT7 A;  2J07 A;  4M63 A;  4Y6W A;  2G62 A;  1QNF A;  3FFL A;  3ML8 A;  2UWJ G;  1OUV A;  3RKO F;  4XLN F;  3I4R B;  3SZR A;  2CW0 F;  5KYY B;  3EIQ C;  2XL4 A;  4MLP A;  5E3C A;  2OND A;  2V26 A;  1NP7 A;  3ESL A;  2P58 C;  3ZN3 A;  1MMG A;  4CRW A;  4N3A A;  2Q7F A;  4U04 A;  1SZI A;  4JZY A;  4YVQ C;  2YQ8 A;  3CKB A;  4CT4 A;  3KMI A;  2I1J A;  2VGY A;  2LAI A;  5FQ4 A;  2V4L A;  3HIZ A;  4GYY A;  3PEV B;  4U5H A;  3LY7 A;  3Q5M A;  4HFG A;  3D9I A;  5BW8 C;  4OD5 A;  1UN9 A;  4ULW A;  3QWV A;  4FHK A;  1Z3Y A;  4JL0 A;  3CV0 A;  3CGH A;  3FWV A;  3FY4 A;  4XI9 A;  1QZX A;  5L3V A;  1FVF A;  4B8C B;  2CDQ A;  3EGX A;  3B7R L;  3UQ3 A;  4B8A A;  5FQ6 A;  3W8H A;  1OWN A;  4FES A;  3ENE A;  1FTS A;  4HOT A;  4TRQ A;  5JJT A;  4LER A;  3R9A B;  3APC A;  3MGB A;  4RBN A;  4EQF A;  1Z3X A;  2J45 A;  2X38 A;  2GW1 A;  3WXX A;  4BJ5 A;  2C2L A;  4A2N B;  3EG9 B;  3JSZ A;  4QI2 A;  4I3M A;  4L2Y A;  1JWG A;  4GMJ A;  2VH3 A;  1LKX A;  4LLE A;  4J6I A;  5KYU B;  4KC9 A;  2AXV A;  3S29 A;  4BJ6 A;  2HO1 A;  3R7R A;  5T4Y A;  5KJK A;  2R7T A;  2J9V A;  2DYR C;  1HXI A;  5FZQ A;  4IYP A;  3L34 A;  4WAF A;  3ONK A;  4YND A;  3BG1 B;  4KVM A;  4OD4 A;  5T8I A;  4HXI A;  3WG7 C;  4NY3 A;  3CLJ A;  4ACL A;  2HV7 A;  2IJG X;  5G04 C;  4IUL A;  4J8S A;  4JPS A;  4KI2 A;  4EBA G;  3T5X A;  2J9Q A;  4PFP A;  3LEV A;  4DOZ A;  2WZF A;  4ILI A;  2DGJ A;  3TXM A;  4BJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...