4I1MA

Crystal structure of the legionella pneumophila gap domain of lepb
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
297
structure length
285
Chain Sequence
SILELKPLTLLMTSSTSFSETINQWADILKTTDMEKFSFDSNPINLLELVKQFNLYVDELAITCEANNVWATPNLFALYDNSGGEAIHGHAFVPYYKESIVLRRLFTVDPNTFNLSRFAAFEGPCQLYCAAHADSAWVKIQTLLTLGNGIINTLKIIKQAQAFGIDEAVTENLKALKEQFIAFQLAEADIKESLKAPSNKESEFFYPIDEKALAKMNGYQLATICLEELNSPKPSPLIERILSNKKFWKRINSAFESGVFKGRTDDPAGKIAKIREWHQLLQISG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LepB
publication title Mechanism of Rab1b deactivation by the Legionella pneumophila GAP LepB.
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila
molecule tags Hydrolase
total genus 104
structure length 285
sequence length 297
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18172 LepB_GAP_N LepB GAP domain N-terminal subdomain
A PF18227 LepB_GAP_C LepB GAP domain C-terminal subdomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1700 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4i1mA01
1.25.40.830 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4i1mA02
4I1MA 4JW1A 4JVSA 4I1OB 4IRUA
chains in the Genus database with same CATH superfamily
3LDZA 1RXQA 2YL3A 4NTFA 2IU1A 4FJZA 4UQZA 4O6NA 2B0OE 3LPZA 3I5PA 4J7YA 1QNFA 2XM4A 3TQOA 3PVLA 3CK9A 4G11A 3DSVA 5HV9A 3UXGA 4GZ3A 1D8EA 4UUCA 4RSYA 1OW8A 4AX2A 1Q0GA 4NTBA 5BW8C 3KAEA 2AWCA 1WWPA 4J7TA 3PDMP 1QQ3A 3ZIMA 1U6HA 5KJMA 4XIFA 2WB7A 3CVXA 4WNDA 1HY5A 1E8YA 3GWLA 4XEFA 5J90A 1IZMA 1OCCC 5BT1A 5JT4A 3CHSA 2DCPA 2KC3A 4CRWA 2HSQA 3BG1B 2G3KA 1V54E 3ZG1A 3L13A 5KYUA 4O6MA 3D9NA 1Y6IA 1QYMA 1A17A 2W4BA 2EPNA 2LNIA 4HS2A 1JAFA 3APDA 3B0VC 2MOWA 3DAFA 4TRQA 4QI2A 5BNWA 1O87A 3LXUX 3C62A 4ER9A 4U5EE 1ZHTA 2YZSA 2C2LA 4CDYA 1BLXB 3FTUA 3ONLA 4URKA 1Q0FA 2ZGDA 2R02A 3KSLA 2WM9A 1TWGA 2VGEA 4YVQC 3D9HA 4F1SA 2RFAA 2YLDA 2VASA 3LEOA 1Z5SC 2QFCA 4FC8A 4KMOA 3GW4A 4DVYP 2Y1LE 3FAPB 1QZ2A 5GPGB 3V5YA 4L7TA 4PR9A 1UJJA 2GRNB 2NUPB 1BU9A 5T3RA 3K1HA 3AS4A 1HFAA 3FUNA 1ST6A 3RRMB 2GRPB 2XCCA 2VGXA 1ZYRF 2F0YA 3W9FA 3ZXPA 1ELRA 4FESA 1TNZA 3SXMA 1SA5A 3U9MA 4C48B 3DM5A 1MMGA 3ZKJA 2F22A 3QC1A 1A7EA 5F28E 2PNOA 3IQ5A 2LCHA 3S29A 1IQUA 2ZXOA 5D91A 2Q9BA 1SZAA 5L0JA 3DAGA 3DSWA 4LNUD 3D3MA 2Y4UA 3TWXA 2IXPA 2XPYA 4J8FA 1JPLA 4BEJA 2V5QC 2Y69C 2D4UA 1OCOC 1FCHA 3DPYA 2UY1A 2ZGGA 1O1RA 3SXYA 2NSFA 5LP0A 2OJED 3TXNA 4B8AA 3L16A 3WG7E 1N54A 2A68F 5JHBA 2Y0BG 2WXHA 4UWKA 1A7VA 3A11A 1ZBPA 2Y3BA 3DWLG 1K8KG 2J4DA 2Y4TA 3AS8A 3US6A 4U95D 4AIFA 5JRAA 3D9MA 3FOOA 3FAJA 1RW2A 2RD0A 1OCRC 3U3WA 3R9AB 3UX4A 4PFOA 2ETBA 1KPSB 3NKEA 4G7OF 4KVOA 5AN8A 3N0TA 4HXIA 3S7JA 4AK9A 3ZHEA 3ZFWA 2LSEA 4N39A 3UT4A 3FHEA 2KBXA 4ABNA 3DD7A 2VCAA 2LXMA 2HYZA 5D2MC 3TJ6A 3EHQA 3T4RA 4B6IA 5ITZF 5L3VA 2A69F 3GZ1A 2WMNA 4LDQA 2EINE 4F4BA 4AOFA 4GYYA 5B3SE 4DJ9A 3CV0A 1N52A 3TAXA 4IJJA 4AEZC 4BSZB 1OWNA 2VC9A 3CHQA 2C0LA 4AL1A 3AG2C 2DVWA 3E37A 3V79K 1YA7O 3ZTMA 2EIJE 3B29A 3AG4C 1X81A 2VSXE 3G2SA 3FMSA 2AWIA 3NMJA 1JPJA 1TR2A 4FHJA 2BF0X 3AGTA 3ENEA 2R7WA 1Z23A 2LIGA 2VSNA 1YJGA 2P61A 5COFA 2CDQA 4WGYA 2J45A 2VSOE 2J07A 3J5PA 4N6CA 3SBSA 4XEIG 1OR2A 5FZTA 2P7VA 3CIAA 4XQ1A 2A5EA 2PBEA 4HVBA 3L08A 3H2VA 5FIOA 2YEVA 3UT8A 3QOUA 3FH5A 3ZVRA 2IFUA 2XXAA 1H6PA 1MX6A 2CYDA 2CHZA 5DS6A 2NSZA 3OXFA 1TWAA 1MYOA 1H7IA 1Z63A 4U5GA 3R2PA 2UY1B 4OVUA 1WGWA 3GORA 2A5UA 5CRUA 1SQMA 3FY4A 3GEIA 2LUHA 5BPPA 1T5OA 2IJGX 1ORYA 3LYAA 3OAWA 3UNGC 3GYZA 3DSUA 1FR0A 3ULYA 4AY5A 5M72A 3CR3A 1TYQG 2TMVP 3Q9UC 1HW1A 1L3PA 4KC9A 4QFVA 3PUJA 3C3RA 5LCWC 1N11A 3UMVA 5EKQD 4HOQA 5FZRA 1R5ID 3PS6A 5FTPA 3ULEG 4OD5A 3UTMA 2KQ9A 4HOUA 3MKRA 3ZHEB 3ECSA 4E6HA 5B1BC 4QI0A 3SFYA 1E96B 4W9RA 3JCKC 2KYHA 4CIHA 2L7AA 1ZZPA 4IB4A 4GZ5A 2X6HA 3RW0A 3QJZA 3D9OA 3O48A 5CMYA 2P9IG 3PNLB 2L0IA 1YYJA 2BL2A 3QWVA 1NG1A 1OWPA 4KT6B 1YZCA 4LDRA 1KT0A 3K7DA 3EH2A 2FFHA 3K9IA 4IWBA 4GEHA 3PH0C 1Q0MA 4P6IC 3T6BA 2J9BA 4HLEA 1OW7A 4MTOA 4ME2A 4Z9HA 3UPVA 3S28A 2XLOA 5ANRA 3LVRE 5IY5E 3VLEA 1VLSA 3TOLA 3UM2A 1G8XA 2PFDA 5K0IA 1RCPA 3EGXA 4O79A 1PC2A 3B9QA 1TNUA 3OTNA 3DKAA 3S7BA 2OEVA 4U9DA 1IHGA 1OCZC 4MW8A 3CVYA 4NQFA 1E7UA 2AU5A 5ENQD 2G3VA 3I4UA 4DRJB 4EUKB 2XENA 3DBSA 4GTOA 4PS7A 3LEVA 3B7BA 4PS8A 1MX2A 1OW6A 4XLPF 4G23A 2FAPB 2XRZA 3ZPJA 5E3CA 1V55C 1ZHWA 1GW6A 3IHVA 3ZTZA 3FHDA 2WXPA 2KM4A 2X38A 4CJOA 3ABKC 4YL1A 2WB2A 1T6QA 5AENA 2V5FA 4C7OA 1UW4B 2PP4A 4RG6A 2P1AA 2OJQA 3A9CA 2P9PG 4AP2A 3W8IA 2HM8A 4MQ9F 1SVXA 1HMDA 4U5HA 3FUJA 5BV0A 4C3BA 4DOZA 2XXAB 1NA0A 3ZN3A 5B3IA 2EILE 3Q73A 1Z5ZA 5DQZA 5KYYA 2QYUA 2VCBA 4MVZA 4XZ4A 3WAQA 3QWPA 3B7SA 3KYIA 4KZ0A 3NF1A 3QKYA 3DSSA 4F1PA 4I44A 3EQLF 1LD7A 5ENRD 3E70C 4APOA 4PJNA 1FVHA 4A63B 2IY0C 3IEEA 3NKDA 2R05A 3DJUB 5L0HA 4I9CA 4OD4A 3EU9A 4G8KA 1S05A 3MX3A 1U2VG 3L8JA 4ANVA 4U8YD 5FZQA 2P9UG 1R4TA 5KBAA 4DBQA 1WOLA 1N4RA 2AXUA 4E17A 3CQZA 1XZPA 4WUYA 3CVQA 3CVPA 1V74B 2FF4A 3LS1A 2YINA 4MS2A 3FTYA 1K1AA 3UM0A 3FU5A 1VOMA 2YLGA 1YZAA 2XLHA 4N3AA 4BX8A 4JEBA 2I2OA 2IONA 1S0PA 1RMVA 3EUVA 3U5SA 1JCSA 1OXKA 1W2WA 1OQCA 2BKGA 2V4HC 3G2VA 2JLBA 3L82A 4B89A 3PEUB 3EIQC 1X5BA 3SZRA 3DE8A 4RG9A 4Z68A 4F53A 2GRLA 4EZJA 2LAIA 3D9PA 2HKVA 3NYMA 3URZA 4JEUA 2EIME 3TWSA 3D9IA 4ULWA 1HE9A 3ZVVA 3NYJA 3ZYLA 3PDNA 4EBKA 4UWGA 1ZW2A 3RU0A 3H65A 4HOSA 5JS5A 1NI1A 5G55A 3SNHA 2DYSC 2CGEA 5KNGA 3UGOA 3PZ1A 2OKUA 2X0CA 3UM3A 3NOGD 1YLMA 2A0UA 4WAFA 3VF0A 2VGYA 4BEPA 3GANA 3ML9A 4M3OA 3TJPA 5J08A 4WJ0A 2P9LG 2HR2A 3LEWA 4GCNA 4A2NB 4N3BA 4BJ5A 4UWLA 1LM3B 3VYWA 1EYHA 2J08A 3IHYA 2M64A 1Z7Qc 4J0UA 1OKKD 2WXIA 5T8IA 4KNVA 4DLOA 2CFZA 3FH8A 3FVYA 3ZDLA 3K6BA 1U3DA 3X2QE 4A3TA 3CSFA 2ZXPA 1SYQA 4KNWA 4ANJA 3LY9A 4GTRA 4F3VA 4C7OB 4JJFA 4GB9A 3TGOA 3PZDA 1I4ZA 4PH4B 5B1AC 5EK0A 5DVWA 1B89A 2JEKA 1VYIA 2KJGA 4G0HA 2XPIA 5A6BD 3Q79A 4LRZA 3BRJA 3E32A 3HJCA 4X0RA 4UWHA 4B93B 3ZIBA 2H6IA 3Q78A 4MS6A 1EF1C 3CKBA 1ZHZA 2R7VA 2A4ZA 2WXJA 3G4XA 4J30B 1XZQA 4NY3A 5BUZA 4GTTA 1MMAA 2VCCA 2DYRE 2IQCA 2PNNA 1MQSA 3RKVA 3ULQA 3EU5A 3DXMG 3C63A 4GU5A 4E7ZA 3I4RB 4L2LA 3SFZA 5A23A 3MFNA 2YVKA 3QW1A 3FUEA 2OVFA 1N94A 3L8IA 4Q96A 4G25A 2J7PD 4CS7A 4AV7A 5A6JA 1HU3A 1K40A 2J9UA 2OOCA 3N24A 4CDMA 4G26A 2IOQA 2NUPA 5FCLA 3R7CA 3E9VA 2R9RB 4IGGA 3O55A 3ITFA 1VTMP 3R7RA 4DRXE 4IN3B 4DX6D 2WVQA 3GM1A 2Q9CA 3JZ0A 3EGDB 2IF4A 4RD9A 3CEQA 3HNIA 4R32A 2JD3A 1XGWA 3FH7A 4JZYA 5AIJA 1UFBA 3DXKG 3RYLA 2EPMX 1TN7A 3R9MA 1C02A 3ABME 3AU4A 5JA4D 4JEAA 2J49A 3J5QB 1GGQA 4M63A 4BETA 3EH1A 3G2UA 2FEZA 2R17C 3B7RL 5FZSA 2L81A 3Q7FA 3X1OA 1O1TA 2FI7A 1LTXA 3BEEA 4OAUC 4MRUA 3CAXA 1NU7D 2VH3A 3MYVA 4LACB 4PFPA 4K7BA 4OIRF 2KNHA 1SA4A 5JJ7A 4ILIA 3Q6MA 1BD8A 1TNYA 4BTAA 3RO2A 2G62A 2LP4A 3DI5A 3ZRHA 4MVQA 4U04A 1WN0A 3N71A 4O6YA 3ZQYA 4O1PA 4KYOB 3U64A 1K1BA 1TWCA 3JRMO 2V3CC 5C1DA 5G05C 3NRHA 1WAO1 3LJNA 2E87A 3Q75A 3MKQB 4TXPA 3EG9B 2L6JA 3KEZA 1TR4A 5BQGA 2IM8A 4DXWA 3U8VA 1KZOA 5CI8A 3HDXA 1D1AA 3ML8A 3TG5A 3UM1A 5LFAA 2RFMA 4E0IA 3NMKA 4EHPA 1HW2A 1K05A 4MVOA 3LY7A 5D92A 1FAPB 2XEHA 2L9BA 3HYMB 5CMWA 3OEOA 4G7HF 1A41A 3QDNA 5AQ7A 1OXBA 4E85A 4CGVA 4FADA 3AGUA 5CBOA 2OEWA 2ZXWE 1H9GA 2HS5A 1WG0A 3RQEA 4DX5D 3SGHA 4EPZA 4RQIA 2QTVA 1H2VC 3IBEA 1JPNA 3FTXA 1DVPA 1FT2A 1GS9A 3RVYA 3SXZA 3JYSA 4EKWA 3HNLA 1NLXA 1MQVA 4HFKB 3KPHA 3SFXA 2XSEA 2HSBA 2FO1E 4J8EA 4YT4A 4KVMA 3HXCA 3UKRG 1SZIA 2OU6A 5AGFA 2KCLA 1EPUA 4YT2A 3CVNA 3TWUA 3TULA 2Y3HA 1YVIA 4XPXA 4I6GA 4NRHB 2XPZA 1RJ9A 2R25A 4ZHBA 2B0JA 2PM7A 2I9CA 1WATA 1BR4A 3C7JA 5EHHA 5HI7A 4F7AA 5G04C 1H19A 3VTXA 1IW7F 1OT8A 5KNHD 1ZB1A 3CVWA 1DOWA 3M15A 3GZ2A 5JSLA 4BTBA 4N2QA 1Y6DA 4ATZD 3VTYA 3JT1A 4EWCA 1PD0A 1V4AA 2FULA 5COGA 2WQ7A 3OXLA 2ILRA 4J8DA 3HLZA 3AQCA 5LCWJ 4GMLA 2DBAA 1NP7A 2HO1A 4FP7A 3EDTB 2I1JA 1LE4A 1QBQA 4A4AA 4EHMA 4OINF 2AVPA 2WVIA 1QPUA 4V3IA 4GQHA 5TJ5E 3S2AA 3U3FA 3NZUA 4UDVA 1H6GA 1OCCE 4CJGA 2KZTA 2P9SG 4TUUA 2LK4A 2VTBB 1JCRA 4DX7D 4WNGA 4EZLA 4ANUA 256BA 4BEMJ 3OXGA 2HE0A 1IHBA 2XRHA 2MWQA 3TOMA 1OWOA 1L7CA 4APFA 4JC8A 5CRVA 2XEEA 1LI7A 4DPRA 3EHNA 5DIZA 2JX0A 4GPMA 4BJ1A 5AQAA 2HFIA 2NXPA 4HQDA 3CGHA 2MHKA 3W4YA 3AG1C 3C5RA 1IKND 2L0TB 5L0FA 5A6CA 5G2NA 4YNDA 3UKUG 5BXUA 4CSAC 3SEOA 1O5HA 3ABLC 5L0GA 3AS5A 3T8MA 4MW3A 1E84A 3FUFA 4U5DE 1QLEC 2ZIRA 3ASNC 3DMDA 3G2WA 5AJDA 3FTZA 3HXFA 3L22A 2E2EA 3PZ2A 3V7OA 5BV1A 5DBKA 1ORJA 1EKYA 3K1IC 3RVZA 2J8WA 5FT9A 3PUKA 2Q7RA 4DVZA 2ETAA 3HNJA 2KK1A 5CECB 1SZ9A 1U89A 4E18A 4IAOA 4Q94A 2XM0A 1ORSC 4ZFHA 3UIOC 2WQ6A 1T6IA 2XLWA 2PL2A 1JWGA 4L2YA 4G1TA 1N0QA 1NZNA 3AOUA 4J8YA 2WZGA 2P0NA 5EIDA 1BI8B 4N06A 5AAOA 4LNGA 1RJ9B 1KLXA 4EECA 3W8HA 4CCAA 1I5NA 3L0IA 5EX3A 3CK8A 1HG5A 1LD8A 2W9YA 1ZHYA 3WXXA 1B68A 3S9OA 3KS2A 3G4ZA 2H8AA 3LAYA 2KATA 4DUIA 5EIBE 3P1UA 2L6GA 4PACA 1E8WA 3MGBA 2BKKB 3VLFA 1Q0DA 3FUDA 1UG3A 4HI9A 3RIBA 4PDXA 2Y69E 1OWMA 3FUHA 3MV3B 1OCOE 5BUOA 2J46A 4H7XA 1HS6A 4CT4A 1PY1A 4KBLA 2AW6A 4EBAG 3U66A 3JQ1A 2YNQA 3ZC4A 4C0EA 1YYXA 4Q5SF 4HB5A 1YYHA 2ZD9A 4LCTA 5HKPA 2L6FA 2H6GA 1FTSA 2KZTB 4DI4A 2XZDG 3IXEA 4K1OA 3CEXA 1S7ZA 1KT1A 3NDBB 1MJ0A 1FVFA 1HG2A 3UQ3A 2PM6A 1PD1A 3U4TA 4CS9C 3QAQA 3TWWA 1H6OA 2AXVA 3QK0A 4GZ6A 3QNKA 4CIPA 4U7EB 3T5XA 3UINC 1OCRE 5LX8A 3NBNB 3V31A 2AJAA 1HZ4A 1G5ZA 4CDNA 1Z3XA 2YRFA 1U0BB 5H7PA 4CSAA 4XE0A 4I1MA 4G78A 2Q4FA 4XX5A 4I6JA 5L3QA 2IXOA 1TEZA 4WGZA 1FT1A 3V2OA 1DCQA 4BJ6C 3RK6A 3Q9NC 3L6AA 4GTMA 1AVOB 3T9OA 3AG3C 2C0MA 4C9BB 2PZIA 2CG3A 4XWJA 2LXLA 3U2MA 4HNAD 2W4MA 2F8XK 4JC7A 4CZ2D 3K33A 1TN8A 3PCVA 3ZYMA 3ASOC 1TQGA 4KZCA 2VSYA 4HOTA 2CNWD 4MNDA 3VM6A 4O60A 4JVSA 2J09A 1H2UA 3AG2E 1D1BA 2OVBA 2NUTA 5C2YA 3U8PA 2J4BA 3C8GD 3Q49B 3C8GA 3AG4E 3HXDA 3Q47B 2WVOA 5CCMA 3B13A 1P5QA 2L6HA 4Z9JA 1NZEA 3D9JA 5FQ8A 4I43A 2WXFA 2Y3AA 5HQ8A 2QNLA 4ZLDA 2H6HA 5JLIA 4GAAA 3C18A 2DZOA 2RG8A 4QQIA 3S7DA 3DEPA 3IQ6A 4KBQA 2FBNA 3APFA 3UI2A 3DRAA 4N4WA 1BZ4A 2A6EF 2JPUA 4I1OB 3TK0A 2OV8A 3M1CB 4YJWA 3T6GB 4Z9IA 3O39A 2HV7A 2X3MA 2GFHA 3BQOA 3KMIA 3APCA 2OCCC 4FWVA 5KJNA 2E0IA 5BQIA 1AEPA 4U63A 1HE8A 5AQBA 2R7XA 3S90A 4XI0A 4A1SA 4B0ZA 4UWFA 3DM9B 1MNEA 1WTYA 2OOEA 3TXMA 3JYYA 2YL7A 2IOLA 2IO3C 3MLGA 3UMIA 1UN8A 2I8BA 1U3CA 3CVVA 3LS0A 2VYIA 1S64A 3S0XA 3WODF 2VJ8A 4GA0A 3IQCA 1LI5A 2BC5A 4ILHB 5KWDA 4W8KA 4NCQA 4U0UA 3GM2A 1I4YA 3C8ZA 3LLKA 4IAQA 3Q15A 4FU3A 4LEUA 3W2WA 2XL4A 1HXIA 3Q7LA 2YL0A 4K0RA 4MVMA 3B71A 4O6FA 3OWTA 4YL3A 4I17A 2WZFA 4JA9A 5B1BE 3FU0A 4Q69A 3T6JA 3FFLA 1QVXA 4A1GA 3PREA 1NFOA 5ARFA 1LIHA 3U0CA 3FDQA 2KCVA 4PJLA 1K04A 2BUGA 2XL8A 1MX4A 3D9LA 3EGDA 3QARA 3RSEG 3ZGQA 4BY6A 1TKNA 5KYXA 4NACA 5G05J 4JA7A 5A7DB 4U8VD 1WDYA 1IQRA 3ESLA 2A1DD 2H7VC 1TN6A 3IQTA 5FJYA 2KW3C 4ILGA 3DZAA 4IRUA 4MTGA 5CHEE 2ZU6B 2X6KA 3NZSA 3JUEA 1OCZE 3HG0D 1BBHA 2NUTB 3T8KA 2DZNA 3C8GB 3JCUQ 4IARA 2EIKC 1VB5A 2QC9A 2XEVA 3HIZA 2LFFA 4JTDB 3SD5A 5BQHA 1V55E 4LG6A 3BG0B 3ZYKA 4GYWA 2WZLA 4LLEA 3P2BA 3SF4A 4MVSA 4IYPA 2YWAA 3ABKE 2YL1A 5KCMA 1RZ4A 4U5BE 1ZVZA 3JSEO 4XPYA 1ELWA 4RDAA 2P9NG 4I3MA 1OKKA 2HJ3A 3S27A 4B94A 3MKQA 3MBGA 3EG9A 3LLIA 1LVKA 4PK4A 3C98A 1SF8A 4FX5A 3TL5A 2A6HF 2WQHA 1LKXA 1E8XA 4D10C 2WXNA 1PV3A 2Y39A 1VDYA 1JOGA 4H54A 3R7QA 4HE8D 3I3NA 2GRRB 4I2ZA 4JRZA 4E7SA 2QLAA 1TFKB 2X6JA 2NC9A 3RF3A 1TWHA 2EQXA 5A6BA 4ZLCA 5BXOA 3HXEA 4YT8A 4JZAA 2UUIA 3GEHA 4A3VA 3KYJA 4E0HA 2ZISA 4NIKA 3Q4AB 5E33A 2OEXA 2YQYA 3SYNA 4FLHA 2QZAA 1DNPA 4AVXA 4G8LA 2GW1A 3B7TA 5AC4A 4OYSA 3DSXA 2MHRA 2R7SA 1BR2A 2IXNA 4HLLA 4DK5A 5G04J 1V54C 1WM5A 4EZKA 2H7OA 4CGWA 2OG2A 1M2OA 1BI7B 2J7PA 1H2TC 3ZNGA 4DJAA 3EJNA 3FWVA 4DLQA 5DLJA 2Y3DA 3QZCA 4HRMB 1D9SA 3BUAA 1AWCB 2X6FA 3ESKA 4GMJA 1YCSB 4OIOF 1J8YF 3TD7A 3KL4A 3TWQA 3SY2A 4OAVB 3MYIA 1E8ZA 1N4PA 1MNDA 1LF8A 2LD6A 2PF4E 1MMNA 5KYXB 4LERA 5JP7A 3RIPA 4CDRA 3DXJF 5ENSD 2DYSE 4WNFA 2B0HA 2BE5F 2IYLD 4XEVA 1OWLA 3CZ6A 4DX2A 2YHEA 1ZW3A 1XWJA 3RQGA 1GM5A 4CT0A 3FUMA 3PNTB 4JHJA 4MVUA 2YHSA 5EYLA 2J0XA 3M79A 1SW6A 3O6XA 3RRUA 2L6BA 3ASDA 5T4YA 1Z3IX 3V5XA 1E83A 1G4WR 4N2SA 1LS1A 4UI9C 2XGOA 3E34A 5E76A 3AJIA 1ZHXA 1Z6AA 5KYWB 3HRAA 1H9TA 4LNBA 5A6KA 4EBBA 2UUHA 3KH2A 2VB6A 4GYOA 2VTBA 4WNEA 2J8SD 2ONDA 3LCAA 4UQXA 3W9GA 2XS8A 5AARA 4MLPA 1UOHA 5B1AE 3GODA 2PX0A 3MA5A 3DEOA 5JJTA 4NURA 3KSQA 3EZHA 5AYWD 1O1SA 3HTKC 2EPKX 4C3EA 1A5EA 1C03A 2LSUA 2CFUA 2WMOA 5D0QD 3M4CA 2I1KA 2NYJA 4HEAJ 5T3TA 2QE9A 1W3BA 2AVKA 5FINA 3MV2B 3N2ZB 4RBNA 4WWNA 3Q6NA 1GQAA 2DI3A 3EIJA 2LQGA 3SI5A 1DOVA 3WG7C 4JPSA 3HHMA 3BU8A 4GTSA 2XL6A 1N0RA 5T1DB 4EBJA 1JCQA 1OY3D 2WXQA 4TXQA 4XPWA 5D66A 2R7OA 1TFOB 2Q3TA 3E30A 4X8QA 1MMDA 5FQ4A 4U5FE 3LUTB 3KEAA 3QMKA 4P9FA 2B6CA 3O4ZA 5ARGA 4GZCA 4CDAA 3RQFA 4F6RD 1ZU5A 1CGOA 2D5RB 1D0ZA 4XEKA 1M56C 3TWVA 5JMND 1NU9C 2OQMA 2KXPC 4H7YA 4BT8A 2X51A 4U8HA 1VYKA 3LJ3A 4XTKA 1M6TA 4DRHB 3NQPA 5COMA 2IXMA 4OIQF 3QW0A 3UT7A 2GAQA 3PMRA 1VLTA 5DS4A 3BEHA 2PQNA 3GEEA 3G50A 4GYTA 5HSWA 4NTAA 2XLEA 1EI7A 4TV3A 4EQFA 1YDIA 2F37A 1A0BA 2R5SA 4AL0A 2EINC 3FU6A 4YN0B 2I15A 1D1CA 4J6IA 5B3SC 3CHOA 2P6VA 4XKBA 3ZSUA 4DX1A 4ONSA 3LESA 4PJJA 5EX0A 4Q4ZF 5CEAA 3RAUA 5L0CA 2I6HA 1JMWA 2ZPAA 3D9KA 2HV6A 4BPMA 1D0XA 1E90A 4DBRA 4M7CA 1XNFA 4AE4B 4JKVA 2EPLX 3VRCA 3EFOB 1BDJB 2EIJC 4ATGA 4BERA 3C3OA 5JHAA 2ETCA 3L17A 1YARO 4YT5A 1SMYF 3B7UX 3AAAC 3VAYA 2P58C 4MKTA 5CERB 1AUEA 2MYSA 4JXTA 2R2LA 4L23A 3RRNB 2F8YA 2AXZA 3C72A 3F6QA 5E2QA 2XRYA 3U9JA 3RH3A 3E4BA 2QYJA 4UQYA 2JABA 4AXHA 2YQ8A 2Z15A 3OA1A 4U0ZA 1O3UA 4JCZA 2YHCA 1HH8A 4IULA 1G3NB 3DPDA 2DWZA 4HRNA 3DJNB 3S7FA 3Q7GA 4ANWA 3F46A 3ASFA 4LUNU 1NFIE 2IEJA 5E3AA 3U3BA 3Q7AA 2DGJA 4BFRA 5EN5D 4JHKA 2NPUA 2XCBA 4CEMA 1F1MA 1O5MA 2QY7A 3LS8A 1TJCA 4YVOA 3TG4A 3FU3A 4LLCA 2WXGA 3LNMB 3PEVB 2CHWA 2PQRA 3SO8A 4FULA 5KYUB 3PZ4A 4GA1A 5A69A 3ZEFA 2VQ2A 3FEXA 4HI8A 2RSEB 3DSTA 5ENOD 4PJMA 3JQ0A 4P29A 3V2XA 3MJWA 3FXHA 2R7TA 3POVA 4NQ0A 3MYFA 3AQBA 1N4QA 4EBAA 3MCXA 3L54A 2AWYA 3FULA 2BTDA 1HO8A 1T9KA 2CHXA 3ZUVB 5JVEA 3I5QA 4R7LA 3L34A 2IO2C 1Y8MA 3SNXA 4HORA 5ENPD 1FMVA 3JSZA 3CK7A 4ACLA 5KJKA 5F5HA 4WWOA 1QSPA 4JIOA 2J9QA 2GA0A 4YDYA 4AJWA 2WXLA 1Y4CA 1TNBA 1YA0A 5L0IA 1K3ZD 2CCYA 3WHNA 3CSTA 2BEDA 1N1CA 3IEGA 2HJMA 5T3WA 1ZU2A 5CI9A 3LKUA 2C04A 3RKOF 1NSGB 5LOZA 5IY5C 3CSKA 3U2LA 2Y3GA 4HFFB 3J06A 2VGXB 4GPKA 4I6EA 4HFGA 1N95A 1DCEA 4JCHA 1T6UA 4DRIB 4JE9A 1N4SA 5ANLA 2EPOA 2GROB 2R59A 4KI2A 4CYMD 1TJFA 1FFHA 1HX8A 2PX3A 4D4NA 4GTVA 2HMQA 3RFYA 3HNKA 3DE9A 4UI9K 4WABA 2L9JA 3FTSA 4JEHA 3RJVA 2Q9AA 4Y6WA 1L5JA 2MYOA 3UGPA 2KC7A 4OVVA 5CIVA 4JD2G 4LDKA 4I2WA 3HVEA 2UWJG 1UJKA 4ACKA 3O10A 1FNTc 2ICWG 3AG1E 3EHMA 1PCXA 4N6HA 1OUVA 4O7GA 4GTQA 3RO3A 4J8SA 4YWQA 2EILC 1UN9A 2O9XA 5FWQA 4U5CE 1J8MF 3Q5MA 1E2XA 2LFDA 5EILA 3NG1A 4OIPF 3ABLE 4FA6A 3VLDA 3T5VA 2HMZA 2LSVA 4LSZE 4AY6A 1EQ1A 2V8SE 3U9WA 3CKCA 1JWFA 1C17M 1IYGA 3V30A 1TNOA 1FFTC 3ASNE 3E33A 1Z3YA 4FJYA 4P9TA 2HZ8A 4MTFA 1JRAA 2YLIA 3W2VA 4CDVA 3K1IA 4A55A 1ELKA 2KGOA 1HE1A 1APCA 4C3DA 5FQ6A 1YAUO 2CG2A 3CQGB 2CNWA 3CVLA 3PE4A 3G2TA 3IKOB 3PZ3A 4K03A 3JRTA 1S63A 4L9PA 1E85A 3FUKA 1JR8A 2IOSA 3FP3A 3JXJA 2R7UA 1EA8A 3M4BA 5DQTA 1EDUA 4JB8P 4JURI 4L6RA 1LPEA 2R7RA 4L1BA 1INZA 1AP7A 2J0WA 4ULVA 1MHQA 3CHRA 1M57C 4AM9A 4N5QA 5EYPF 1RKEA 4CX9A 2XS1A 2KCKA 2EIMC 3ONKA 2W45A 2GDCA 4Q7CA 4U07A 1PAQA 4JHRA 5JJ6A 1S70B 3T9KA 3LNRA 3UMKA 2WPVA 4O1OA 1M2VA 2MRIA 3MEKA 3NAWA 2Q00A 4MBGA 5CEDB 2C03A 5F5FA 4N5CA 4GTPA 3I4GA 3H2UA 3NOCD 1VK5A 2XLVA 4I1AA 2ASRA 5HS0A 4BJ5C 4FHKA 4MVRA 3PE3A 5ENNA 4CS9A 3SXKA 4G24A 3ZXSA 3ASGA 5D0OD 4YL0A 3C3QA 2V0PA 5E75A 4XKCA 1MZCA 4CS8C 3X2QC 3B95A 1NBBA 4C0MA 1QZXA 4WWPA 3HVEB 1KZPA 5EGYA 3L1MA 2IBFA 3K66A 2XGMA 1CPQA 3PHF2 1OR3A 2R7QA 2XGSA 1HF8A 1A7DA 3ZW3A 2FO7A 3EZIA 2H7BA 3GWNA 3CQCB 2XZTG 2DB4A 2QUPA 4BJ6A 2R03A 5HRYA 2RKKA 2J9VA 1KNYA 5KYNA 3CLJA 5EDSA 3IPMO 3GZSA 5JUAA 4FLBA 5AJLA 1Q2ZA 3AG3E 5DS5A 4K5CA 1WASA 3SP1A 2RD9A 4GCOA 3AU5A 4JTCB 1CPRA 3QB2A 4PS3A 4UI9J 2DYRC 2WL8A 1KTMA 4XLNF 4BG0A 2WXRA 3FEYA 3HXBA 2ZXRA 3ASOE 4PUCA 1E7VA 3FTWA 2CW0F 3ZU7B 2WXKA 3L9TA 3ZYQA 4U96D 4JW1A 3S84A 1OXJA 1NL4A 1H6KA 2AP3A 2NSGA 2A0BA 2M4EA 1BR1A 3B0UX 4W8PA 3UIPC 1DC2A 1NA3A 3EPVA 1YMPA 1H0AA 2WVNA 2XQ0A 5KJLA 2YKZA 2FGYA 1D0YA 3QVYA 3CVUA 1UG7A 3UUXA 1Z6TA 4NC3A 1HMOA 3CHPA 3JUIA 1RKCA 1QQEA 5KYWA 3MZLB 1RKEB 1KU2A 3EHRA 3TWRA 4HBDA 3ABMC 4BJTA 3KD7A 3EGXB 4ANXA 1Q0KA 2ETSA 1G4US 1CGME 1VMAA 2P2CP 5ENTD 2LAHA 2OCCE 3LJBA 3TJ5A 1D8DA 2H6FA 1M2VB 3ZQVA 3IHUA 2QY9A 3ISMC 2XHEA 3ZWIA 3HKKA 4XI9A 4YDEA 2DIWA 4DI3A 3KKBA 3B0PA 2X6IA 4J32B 3PRZA 3QWWA 1SR2A 2GRQB 2XLDA 4CS8A 3SQVA 4I9EA 2GGFA 1WY6A 3DWWA 4D4XA 3TWTA 4QDLA 4G2VA 4GA2A 3NB2A 3CHMA 5CCLA 5AQ9A 2XLMA 4TXRA 2WXMA 1T01A 4G7ZF 4RVBA 3UMHA 4N3CA 3SHFA 3GM3A 4YK5A 1FPPA 1YA9A 2NG1A 3JTLO 4BWRA 5A6AA 4JTAB 5KYYB 3LVQE 2GWWA 4U9EA 2J9WA 4YDWA 3QTHA 3IV0A 2M63A 3FDHA 3F47A 1LE2A 1JUQA 3UR3C 2P9KG 1IXVA 4KXKB 4BSXA 3NMIA 4K0DA 4FAPB 3FTVA 3AJMA 4K5AB 2ZXWC 3LY8A 4YDOA 2Q7FA 1E86A 1N9AA 4BX9A 1FMWA 4TUMA 3SZ7A 1LS4A 1QKRA 3SBTB 4BESA 4CBEA 4J7WA 4Y6CA 5L0DA 2WXOA 3JXIA 5AC5A 1ZU4A 2KSFA 2HUJA 3ASHA 1BPOA 4BT9A 4GMRA 3NYLA 2EIKE 4B8CB 4HRLA 3FOPA 4EIYA 4GZDA 2V26A 5FQ7A 4JJGA 1NFNA 2GRMA 4AE4A 4RLYA 4U0SA 4JL0A 4K5BA 5CBNA 4H4KC 3EFOA 3JYHA 3FUIA 2LO6A 3ATPA 1CGNA 2V4LA 3QVZA 3V5ZA
chains in the Genus database with same CATH topology
3LDZA 2IU1A 4FJZA 4UQZA 4O6NA 3LPZA 3I5PA 1QNFA 3PVLA 3CK9A 4G11A 4GZ3A 4RSYA 4AX2A 5BW8C 3KAEA 3ZIMA 5KJMA 4XIFA 2WB7A 3CVXA 4WNDA 1E8YA 5J90A 1IZMA 1OCCC 5BT1A 3CHSA 2DCPA 4CRWA 3BG1B 2G3KA 3ZG1A 3L13A 5KYUA 4O6MA 3D9NA 1Y6IA 1A17A 2W4BA 2LNIA 4HS2A 3APDA 3B0VC 2MOWA 3DAFA 4TRQA 4QI2A 5BNWA 1O87A 3LXUX 4U5EE 1ZHTA 2YZSA 2C2LA 3FTUA 3ONLA 4URKA 2WM9A 1TWGA 4YVQC 4F1SA 2VASA 2QFCA 4FC8A 4KMOA 3GW4A 4DVYP 1QZ2A 4L7TA 1UJJA 2NUPB 5T3RA 3K1HA 3AS4A 1HFAA 3FUNA 1ST6A 3RRMB 2XCCA 2VGXA 1ZYRF 1ELRA 4FESA 3DM5A 1MMGA 3QC1A 3S29A 1IQUA 2ZXOA 5D91A 2Q9BA 1SZAA 3DAGA 3D3MA 2Y4UA 2IXPA 2XPYA 4J8FA 1JPLA 4BEJA 2Y69C 1OCOC 1FCHA 2UY1A 5LP0A 3TXNA 4B8AA 3L16A 1N54A 2A68F 5JHBA 2WXHA 4UWKA 1ZBPA 2Y3BA 2J4DA 2Y4TA 3AS8A 4AIFA 3D9MA 3U3WA 3FAJA 2RD0A 1OCRC 3R9AB 3UX4A 4PFOA 3NKEA 4G7OF 4KVOA 3N0TA 4HXIA 3S7JA 4AK9A 3ZHEA 3ZFWA 2LSEA 4N39A 3UT4A 3FHEA 4ABNA 3DD7A 2HYZA 3T4RA 4B6IA 5L3VA 2A69F 3GZ1A 2WMNA 4AOFA 4F4BA 4GYYA 3CV0A 1N52A 3TAXA 4IJJA 4AEZC 1OWNA 3CHQA 2C0LA 3AG2C 3AG4C 2VSXE 3G2SA 2AWIA 1JPJA 4FHJA 1TR2A 2BF0X 3ENEA 2R7WA 1Z23A 2VSNA 2CDQA 2J45A 2VSOE 2J07A 3SBSA 2P7VA 3CIAA 4HVBA 3L08A 2YEVA 3UT8A 3QOUA 3FH5A 3ZVRA 2IFUA 2XXAA 2CHZA 5DS6A 2NSZA 3OXFA 1TWAA 1Z63A 4U5GA 2UY1B 4OVUA 1WGWA 2A5UA 1SQMA 3FY4A 5BPPA 2IJGX 3LYAA 3OAWA 3UNGC 3GYZA 4AY5A 5M72A 3CR3A 4KC9A 4QFVA 3PUJA 5LCWC 3UMVA 5EKQD 4HOQA 5FZRA 3PS6A 5FTPA 4OD5A 2KQ9A 4HOUA 3MKRA 3ZHEB 3ECSA 4E6HA 5B1BC 4QI0A 1E96B 4W9RA 3JCKC 4CIHA 4GZ5A 2X6HA 3QJZA 3D9OA 3O48A 5CMYA 3PNLB 2L0IA 3QWVA 1NG1A 1OWPA 4KT6B 1KT0A 3K7DA 3EH2A 2FFHA 3K9IA 4IWBA 4GEHA 3PH0C 4P6IC 3T6BA 4HLEA 4ME2A 3UPVA 3S28A 5ANRA 3LVRE 3VLEA 1G8XA 2PFDA 3EGXA 4O79A 1PC2A 3B9QA 3OTNA 3S7BA 1IHGA 1OCZC 3CVYA 1E7UA 2G3VA 3I4UA 3DBSA 4PS7A 3LEVA 4PS8A 4XLPF 4G23A 2XRZA 3ZPJA 5E3CA 1V55C 1ZHWA 1GW6A 3IHVA 3FHDA 2WXPA 2KM4A 2X38A 3ABKC 2WB2A 5AENA 2V5FA 4C7OA 1UW4B 2PP4A 4RG6A 4AP2A 3W8IA 2HM8A 4MQ9F 4U5HA 3FUJA 5BV0A 4C3BA 4DOZA 2XXAB 1NA0A 3ZN3A 1Z5ZA 5DQZA 5KYYA 4XZ4A 3QWPA 3B7SA 4KZ0A 3NF1A 3QKYA 4I44A 3EQLF 3E70C 4APOA 4PJNA 1FVHA 3IEEA 3NKDA 3DJUB 4I9CA 4OD4A 3MX3A 4ANVA 5FZQA 4DBQA 2AXUA 3CQZA 4WUYA 3CVQA 3CVPA 2FF4A 3LS1A 2YINA 3FTYA 3FU5A 1VOMA 4N3AA 4BX8A 2I2OA 2IONA 1S0PA 1W2WA 3G2VA 2JLBA 4B89A 3PEUB 3EIQC 1X5BA 3SZRA 4RG9A 4F53A 2GRLA 4EZJA 2LAIA 3D9PA 3NYMA 3URZA 4JEUA 3D9IA 4ULWA 3ZVVA 3NYJA 3ZYLA 3PDNA 4UWGA 3RU0A 3H65A 4HOSA 5G55A 3SNHA 2DYSC 2CGEA 3UGOA 4WAFA 2VGYA 3GANA 3ML9A 4M3OA 3TJPA 5J08A 4WJ0A 3LEWA 2HR2A 4GCNA 4A2NB 4N3BA 4BJ5A 4UWLA 3VYWA 1EYHA 2J08A 3IHYA 4J0UA 1OKKD 2WXIA 5T8IA 4KNVA 4DLOA 2CFZA 3FH8A 3FVYA 3K6BA 1U3DA 4A3TA 3CSFA 2ZXPA 4KNWA 4ANJA 3LY9A 4F3VA 4C7OB 4JJFA 4GB9A 3TGOA 3PZDA 4PH4B 5B1AC 5DVWA 1B89A 2JEKA 1VYIA 2KJGA 4G0HA 2XPIA 4LRZA 3HJCA 4X0RA 4UWHA 3ZIBA 4MS6A 1EF1C 3CKBA 1ZHZA 2R7VA 2A4ZA 2WXJA 4J30B 4NY3A 5BUZA 1MMAA 2IQCA 1MQSA 3RKVA 3ULQA 4GU5A 4E7ZA 3I4RB 4L2LA 3SFZA 5A23A 3FUEA 2OVFA 4Q96A 4G25A 2J7PD 4CS7A 4AV7A 1HU3A 2J9UA 3N24A 4CDMA 4G26A 2IOQA 2NUPA 5FCLA 3E9VA 3ITFA 3R7RA 4IN3B 2WVQA 2Q9CA 3EGDB 2IF4A 4RD9A 3CEQA 4JZYA 2JD3A 1XGWA 3FH7A 5AIJA 3RYLA 3AU4A 2J49A 4M63A 3EH1A 3G2UA 2FEZA 2R17C 3B7RL 5FZSA 2L81A 3X1OA 3BEEA 2FI7A 4MRUA 1NU7D 2VH3A 3MYVA 4LACB 4PFPA 4K7BA 4OIRF 2KNHA 5JJ7A 4ILIA 3Q6MA 4BTAA 3RO2A 2G62A 3ZRHA 4U04A 3N71A 4O6YA 3U64A 4KYOB 1TWCA 2V3CC 5C1DA 5G05C 3NRHA 1WAO1 2E87A 3MKQB 3EG9B 2L6JA 3KEZA 5CI8A 3HDXA 1D1AA 3ML8A 3TG5A 5LFAA 3LY7A 5D92A 2L9BA 3HYMB 5CMWA 3OEOA 4G7HF 3QDNA 4E85A 4CGVA 4FADA 3SGHA 4EPZA 2QTVA 1H2VC 3IBEA 1JPNA 3FTXA 1DVPA 3JYSA 4HFKB 2XSEA 4J8EA 4YT4A 4KVMA 1SZIA 2KCLA 1EPUA 4YT2A 3CVNA 2Y3HA 4I6GA 4NRHB 2XPZA 1RJ9A 2B0JA 2PM7A 2I9CA 1BR4A 5EHHA 5HI7A 4F7AA 5G04C 1H19A 3VTXA 1IW7F 3CVWA 3GZ2A 4BTBA 4N2QA 3VTYA 3JT1A 4EWCA 1PD0A 2FULA 2WQ7A 3OXLA 2ILRA 4J8DA 3HLZA 3AQCA 5LCWJ 4GMLA 2DBAA 1NP7A 2HO1A 4FP7A 3EDTB 2I1JA 4OINF 2AVPA 2WVIA 4V3IA 3S2AA 3NZUA 2KZTA 4TUUA 2VTBB 4WNGA 4EZLA 4ANUA 3OXGA 2XRHA 2MWQA 1OWOA 4APFA 4JC8A 4DPRA 3EHNA 5DIZA 4BJ1A 2NXPA 3CGHA 2MHKA 3AG1C 2L0TB 5A6CA 5G2NA 4YNDA 4CSAC 3SEOA 1O5HA 3ABLC 3AS5A 3T8MA 3FUFA 4U5DE 1QLEC 3ASNC 3DMDA 3G2WA 5AJDA 3FTZA 3L22A 2E2EA 3V7OA 5BV1A 5DBKA 3K1IC 5FT9A 3PUKA 4DVZA 1SZ9A 4IAOA 4Q94A 2WQ6A 2PL2A 1JWGA 4L2YA 4G1TA 1NZNA 2WZGA 4N06A 1RJ9B 1KLXA 4EECA 3W8HA 4CCAA 3L0IA 5EX3A 3CK8A 1HG5A 2W9YA 1ZHYA 3WXXA 3KS2A 3LAYA 2KATA 3P1UA 1E8WA 3MGBA 3VLFA 3FUDA 1UG3A 3RIBA 4PDXA 1OWMA 3FUHA 3MV3B 5BUOA 2J46A 4H7XA 1HS6A 4CT4A 1PY1A 4KBLA 2AW6A 4EBAG 3U66A 3JQ1A 2YNQA 3ZC4A 4C0EA 4Q5SF 4LCTA 1FTSA 2KZTB 4DI4A 1S7ZA 1KT1A 3NDBB 1FVFA 1HG2A 3UQ3A 2PM6A 1PD1A 3U4TA 4CS9C 3QAQA 3T5XA 2AXVA 3QK0A 4GZ6A 3QNKA 5LX8A 1HZ4A 4CDNA 1Z3XA 4CSAA 4XE0A 4I1MA 4XX5A 4I6JA 5L3QA 2IXOA 1TEZA 4BJ6C 3RK6A 3L6AA 3AG3C 2C0MA 4C9BB 2PZIA 2CG3A 4XWJA 2W4MA 3K33A 3ZYMA 3ASOC 4KZCA 2VSYA 4HOTA 2CNWD 4MNDA 4JVSA 2J09A 1H2UA 1D1BA 2OVBA 2NUTA 5C2YA 2J4BA 3Q49B 5CCMA 3Q47B 2WVOA 3B13A 1P5QA 1NZEA 3D9JA 5FQ8A 4I43A 2WXFA 2Y3AA 5HQ8A 4ZLDA 4GAAA 2RG8A 3S7DA 4KBQA 2FBNA 3APFA 2A6EF 4I1OB 2OV8A 3M1CB 4YJWA 3O39A 2HV7A 2X3MA 2GFHA 3KMIA 3APCA 2OCCC 4FWVA 5KJNA 2E0IA 4U63A 1HE8A 2R7XA 4XI0A 4A1SA 4B0ZA 4UWFA 3DM9B 1MNEA 2OOEA 3TXMA 2IOLA 3MLGA 3UMIA 1UN8A 2I8BA 1U3CA 3CVVA 3LS0A 2VYIA 3S0XA 3WODF 2VJ8A 4GA0A 4ILHB 4W8KA 4U0UA 3LLKA 3Q15A 4FU3A 4LEUA 3W2WA 2XL4A 1HXIA 3Q7LA 4K0RA 4O6FA 3OWTA 4I17A 2WZFA 4JA9A 3FU0A 4Q69A 3T6JA 3FFLA 4A1GA 3PREA 5ARFA 3FDQA 2KCVA 4PJLA 2BUGA 3D9LA 3EGDA 3QARA 3ZGQA 4BY6A 1TKNA 5KYXA 4NACA 5G05J 4JA7A 5A7DB 1IQRA 3ESLA 2A1DD 2H7VC 5FJYA 2KW3C 4ILGA 3DZAA 4IRUA 5CHEE 2ZU6B 2X6KA 3NZSA 2NUTB 3JCUQ 2EIKC 2XEVA 3HIZA 3SD5A 3BG0B 3ZYKA 4GYWA 2WZLA 4LLEA 3P2BA 3SF4A 4IYPA 5KCMA 4U5BE 1ELWA 4RDAA 4I3MA 1OKKA 3S27A 4B94A 3MKQA 3EG9A 3LLIA 1LVKA 4PK4A 3C98A 1SF8A 4FX5A 3TL5A 2A6HF 2WQHA 1LKXA 1E8XA 4D10C 2WXNA 2Y39A 1VDYA 3R7QA 4HE8D 3I3NA 4I2ZA 4E7SA 2X6JA 2NC9A 1TWHA 2EQXA 4ZLCA 4YT8A 4JZAA 4A3VA 3Q4AB 5E33A 3SYNA 4FLHA 1DNPA 4AVXA 2GW1A 3B7TA 4OYSA 2R7SA 1BR2A 2IXNA 4DK5A 5G04J 1V54C 1WM5A 4EZKA 2H7OA 4CGWA 2OG2A 1M2OA 2J7PA 1H2TC 4DJAA 3EJNA 3FWVA 4DLQA 5DLJA 2Y3DA 3QZCA 2X6FA 3ESKA 4GMJA 4OIOF 1J8YF 3TD7A 3KL4A 1E8ZA 1MNDA 1LF8A 2PF4E 1MMNA 5KYXB 4LERA 3RIPA 4CDRA 3DXJF 4WNFA 2IYLD 2BE5F 1OWLA 3CZ6A 2YHEA 4CT0A 3FUMA 3PNTB 4JHJA 2YHSA 2J0XA 3O6XA 3RRUA 3ASDA 5T4YA 1Z3IX 4N2SA 1LS1A 4UI9C 2XGOA 5E76A 1ZHXA 1Z6AA 5KYWB 4EBBA 3KH2A 2VB6A 4GYOA 2VTBA 4WNEA 2ONDA 3LCAA 4UQXA 4MLPA 3GODA 2PX0A 3MA5A 5JJTA 4NURA 3EZHA 5AYWD 3HTKC 4C3EA 2LSUA 2CFUA 2WMOA 5D0QD 2I1KA 4HEAJ 5T3TA 1W3BA 3MV2B 3N2ZB 4RBNA 4WWNA 3Q6NA 3SI5A 3EIJA 3WG7C 4JPSA 3HHMA 5T1DB 2WXQA 2R7OA 2Q3TA 1MMDA 5FQ4A 4U5FE 3QMKA 3O4ZA 5ARGA 4GZCA 1ZU5A 2D5RB 1D0ZA 1M56C 1NU9C 4H7YA 4BT8A 2X51A 4U8HA 1VYKA 3LJ3A 4XTKA 3NQPA 2IXMA 4OIQF 3UT7A 3PMRA 5DS4A 2PQNA 4GYTA 5HSWA 4EQFA 4TV3A 2R5SA 2EINC 3FU6A 4YN0B 1D1CA 4J6IA 5B3SC 3CHOA 2P6VA 4XKBA 3ZSUA 3LESA 4PJJA 5EX0A 4Q4ZF 2I6HA 2ZPAA 3D9KA 2HV6A 1E90A 1D0XA 4DBRA 1XNFA 4AE4B 3EFOB 2EIJC 4ATGA 5JHAA 3L17A 4YT5A 1SMYF 3B7UX 3VAYA 2P58C 4MKTA 2MYSA 4JXTA 4L23A 3RRNB 2AXZA 5E2QA 2XRYA 3RH3A 3E4BA 4UQYA 4AXHA 2YQ8A 2Z15A 3OA1A 4U0ZA 2YHCA 1HH8A 4IULA 3DPDA 3DJNB 3S7FA 3Q7GA 4ANWA 3F46A 3ASFA 4LUNU 5E3AA 2DGJA 4BFRA 4JHKA 2XCBA 4CEMA 2QY7A 3LS8A 1TJCA 4YVOA 3TG4A 3FU3A 4LLCA 2WXGA 3PEVB 2CHWA 2PQRA 4FULA 5KYUB 4GA1A 3ZEFA 2VQ2A 3FEXA 4PJMA 3JQ0A 4P29A 3MJWA 2R7TA 3POVA 4NQ0A 3AQBA 4EBAA 3MCXA 3L54A 3FULA 2BTDA 1HO8A 2CHXA 3I5QA 4R7LA 3L34A 1Y8MA 3SNXA 4HORA 1FMVA 3JSZA 3CK7A 4ACLA 5KJKA 5F5HA 4WWOA 2J9QA 4AJWA 2WXLA 1YA0A 3CSTA 1N1CA 3IEGA 5T3WA 1ZU2A 5CI9A 3LKUA 2C04A 3RKOF 5LOZA 5IY5C 3CSKA 2Y3GA 4HFFB 2VGXB 4GPKA 4I6EA 4HFGA 4JCHA 5ANLA 2R59A 4KI2A 1TJFA 1FFHA 1HX8A 2PX3A 3RFYA 4UI9K 2L9JA 3FTSA 4JEHA 3RJVA 2Q9AA 4Y6WA 1L5JA 3UGPA 2KC7A 4OVVA 4I2WA 3HVEA 2UWJG 1UJKA 4ACKA 3EHMA 1PCXA 1OUVA 4O7GA 3RO3A 4J8SA 4YWQA 2EILC 1UN9A 2O9XA 5FWQA 4U5CE 1J8MF 3Q5MA 3NG1A 4OIPF 4FA6A 3VLDA 3T5VA 2LSVA 4AY6A 2V8SE 3U9WA 3CKCA 1JWFA 1IYGA 1FFTC 1Z3YA 4FJYA 3W2VA 4A55A 1ELKA 2KGOA 4C3DA 5FQ6A 2CG2A 3CQGB 2CNWA 3CVLA 3PE4A 3G2TA 3IKOB 4K03A 3JRTA 3FUKA 2IOSA 3FP3A 2R7UA 5DQTA 1EDUA 4JURI 2R7RA 4L1BA 1INZA 2J0WA 1MHQA 3CHRA 1M57C 4AM9A 2KCKA 2EIMC 3ONKA 2W45A 4Q7CA 4U07A 1PAQA 4JHRA 5JJ6A 3LNRA 3UMKA 2WPVA 1M2VA 2MRIA 3MEKA 2C03A 5F5FA 4N5CA 3I4GA 1VK5A 4I1AA 4BJ5C 4FHKA 3PE3A 5ENNA 4CS9A 4G24A 3ZXSA 3ASGA 5D0OD 2V0PA 5E75A 4XKCA 4CS8C 3X2QC 4C0MA 1QZXA 4WWPA 3HVEB 5EGYA 3K66A 2XGMA 3PHF2 2XGSA 2R7QA 1HF8A 3ZW3A 2FO7A 3EZIA 2H7BA 3CQCB 4BJ6A 2J9VA 5KYNA 3CLJA 5EDSA 3GZSA 4FLBA 5AJLA 5DS5A 3SP1A 4GCOA 3AU5A 3QB2A 4PS3A 4UI9J 2DYRC 2WL8A 4XLNF 4BG0A 2WXRA 3FEYA 2ZXRA 4PUCA 1E7VA 3FTWA 2CW0F 2WXKA 3ZYQA 4JW1A 1H6KA 2M4EA 1BR1A 3B0UX 1NA3A 3EPVA 1H0AA 2WVNA 2XQ0A 5KJLA 2FGYA 1D0YA 3CVUA 3UUXA 1Z6TA 3CHPA 3JUIA 1QQEA 5KYWA 3MZLB 1KU2A 3ABMC 4BJTA 3KD7A 3EGXB 4ANXA 1VMAA 2LAHA 3LJBA 1M2VB 2QY9A 2XHEA 4XI9A 2DIWA 4DI3A 3KKBA 3B0PA 2X6IA 4J32B 3PRZA 3QWWA 4CS8A 4I9EA 2GGFA 1WY6A 4QDLA 4G2VA 4GA2A 3CHMA 5CCLA 2WXMA 4G7ZF 4RVBA 3UMHA 4N3CA 3SHFA 2NG1A 4BWRA 5KYYB 3LVQE 2J9WA 3IV0A 2M63A 3FDHA 3F47A 1JUQA 3UR3C 4KXKB 4BSXA 4K0DA 3FTVA 2ZXWC 3LY8A 2Q7FA 4BX9A 1FMWA 3SZ7A 3SBTB 4CBEA 4Y6CA 2WXOA 1ZU4A 3ASHA 1BPOA 4BT9A 3NYLA 4B8CB 4GZDA 2V26A 5FQ7A 4JJGA 2GRMA 4AE4A 4U0SA 4JL0A 4H4KC 3EFOA 3JYHA 3FUIA 2LO6A 2V4LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I1M A;  4JW1 A;  4JVS A;  4I1O B;  4IRU A; 
#chains in the Genus database with same CATH topology
 3LDZ A;  1RXQ A;  2YL3 A;  4NTF A;  2IU1 A;  4FJZ A;  4UQZ A;  4O6N A;  2B0O E;  3LPZ A;  3I5P A;  4J7Y A;  1QNF A;  2XM4 A;  3TQO A;  3PVL A;  3CK9 A;  4G11 A;  3DSV A;  5HV9 A;  3UXG A;  4GZ3 A;  1D8E A;  4UUC A;  4RSY A;  1OW8 A;  4AX2 A;  1Q0G A;  4NTB A;  5BW8 C;  3KAE A;  2AWC A;  1WWP A;  4J7T A;  3PDM P;  1QQ3 A;  3ZIM A;  1U6H A;  5KJM A;  4XIF A;  2WB7 A;  3CVX A;  4WND A;  1HY5 A;  1E8Y A;  3GWL A;  4XEF A;  5J90 A;  1IZM A;  1OCC C;  5BT1 A;  5JT4 A;  3CHS A;  2DCP A;  2KC3 A;  4CRW A;  2HSQ A;  3BG1 B;  2G3K A;  1V54 E;  3ZG1 A;  3L13 A;  5KYU A;  4O6M A;  3D9N A;  1Y6I A;  1QYM A;  1A17 A;  2W4B A;  2EPN A;  2LNI A;  4HS2 A;  1JAF A;  3APD A;  3B0V C;  2MOW A;  3DAF A;  4TRQ A;  4QI2 A;  5BNW A;  1O87 A;  3LXU X;  3C62 A;  4ER9 A;  4U5E E;  1ZHT A;  2YZS A;  2C2L A;  4CDY A;  1BLX B;  3FTU A;  3ONL A;  4URK A;  1Q0F A;  2ZGD A;  2R02 A;  3KSL A;  2WM9 A;  1TWG A;  2VGE A;  4YVQ C;  3D9H A;  4F1S A;  2RFA A;  2YLD A;  2VAS A;  3LEO A;  1Z5S C;  2QFC A;  4FC8 A;  4KMO A;  3GW4 A;  4DVY P;  2Y1L E;  3FAP B;  1QZ2 A;  5GPG B;  3V5Y A;  4L7T A;  4PR9 A;  1UJJ A;  2GRN B;  2NUP B;  1BU9 A;  5T3R A;  3K1H A;  3AS4 A;  1HFA A;  3FUN A;  1ST6 A;  3RRM B;  2GRP B;  2XCC A;  2VGX A;  1ZYR F;  2F0Y A;  3W9F A;  3ZXP A;  1ELR A;  4FES A;  1TNZ A;  3SXM A;  1SA5 A;  3U9M A;  4C48 B;  3DM5 A;  1MMG A;  3ZKJ A;  2F22 A;  3QC1 A;  1A7E A;  5F28 E;  2PNO A;  3IQ5 A;  2LCH A;  3S29 A;  1IQU A;  2ZXO A;  5D91 A;  2Q9B A;  1SZA A;  5L0J A;  3DAG A;  3DSW A;  4LNU D;  3D3M A;  2Y4U A;  3TWX A;  2IXP A;  2XPY A;  4J8F A;  1JPL A;  4BEJ A;  2V5Q C;  2Y69 C;  2D4U A;  1OCO C;  1FCH A;  3DPY A;  2UY1 A;  2ZGG A;  1O1R A;  3SXY A;  2NSF A;  5LP0 A;  2OJE D;  3TXN A;  4B8A A;  3L16 A;  3WG7 E;  1N54 A;  2A68 F;  5JHB A;  2Y0B G;  2WXH A;  4UWK A;  1A7V A;  3A11 A;  1ZBP A;  2Y3B A;  3DWL G;  1K8K G;  2J4D A;  2Y4T A;  3AS8 A;  3US6 A;  4U95 D;  4AIF A;  5JRA A;  3D9M A;  3FOO A;  3FAJ A;  1RW2 A;  2RD0 A;  1OCR C;  3U3W A;  3R9A B;  3UX4 A;  4PFO A;  2ETB A;  1KPS B;  3NKE A;  4G7O F;  4KVO A;  5AN8 A;  3N0T A;  4HXI A;  3S7J A;  4AK9 A;  3ZHE A;  3ZFW A;  2LSE A;  4N39 A;  3UT4 A;  3FHE A;  2KBX A;  4ABN A;  3DD7 A;  2VCA A;  2LXM A;  2HYZ A;  5D2M C;  3TJ6 A;  3EHQ A;  3T4R A;  4B6I A;  5ITZ F;  5L3V A;  2A69 F;  3GZ1 A;  2WMN A;  4LDQ A;  2EIN E;  4F4B A;  4AOF A;  4GYY A;  5B3S E;  4DJ9 A;  3CV0 A;  1N52 A;  3TAX A;  4IJJ A;  4AEZ C;  4BSZ B;  1OWN A;  2VC9 A;  3CHQ A;  2C0L A;  4AL1 A;  3AG2 C;  2DVW A;  3E37 A;  3V79 K;  1YA7 O;  3ZTM A;  2EIJ E;  3B29 A;  3AG4 C;  1X81 A;  2VSX E;  3G2S A;  3FMS A;  2AWI A;  3NMJ A;  1JPJ A;  1TR2 A;  4FHJ A;  2BF0 X;  3AGT A;  3ENE A;  2R7W A;  1Z23 A;  2LIG A;  2VSN A;  1YJG A;  2P61 A;  5COF A;  2CDQ A;  4WGY A;  2J45 A;  2VSO E;  2J07 A;  3J5P A;  4N6C A;  3SBS A;  4XEI G;  1OR2 A;  5FZT A;  2P7V A;  3CIA A;  4XQ1 A;  2A5E A;  2PBE A;  4HVB A;  3L08 A;  3H2V A;  5FIO A;  2YEV A;  3UT8 A;  3QOU A;  3FH5 A;  3ZVR A;  2IFU A;  2XXA A;  1H6P A;  1MX6 A;  2CYD A;  2CHZ A;  5DS6 A;  2NSZ A;  3OXF A;  1TWA A;  1MYO A;  1H7I A;  1Z63 A;  4U5G A;  3R2P A;  2UY1 B;  4OVU A;  1WGW A;  3GOR A;  2A5U A;  5CRU A;  1SQM A;  3FY4 A;  3GEI A;  2LUH A;  5BPP A;  1T5O A;  2IJG X;  1ORY A;  3LYA A;  3OAW A;  3UNG C;  3GYZ A;  3DSU A;  1FR0 A;  3ULY A;  4AY5 A;  5M72 A;  3CR3 A;  1TYQ G;  2TMV P;  3Q9U C;  1HW1 A;  1L3P A;  4KC9 A;  4QFV A;  3PUJ A;  3C3R A;  5LCW C;  1N11 A;  3UMV A;  5EKQ D;  4HOQ A;  5FZR A;  1R5I D;  3PS6 A;  5FTP A;  3ULE G;  4OD5 A;  3UTM A;  2KQ9 A;  4HOU A;  3MKR A;  3ZHE B;  3ECS A;  4E6H A;  5B1B C;  4QI0 A;  3SFY A;  1E96 B;  4W9R A;  3JCK C;  2KYH A;  4CIH A;  2L7A A;  1ZZP A;  4IB4 A;  4GZ5 A;  2X6H A;  3RW0 A;  3QJZ A;  3D9O A;  3O48 A;  5CMY A;  2P9I G;  3PNL B;  2L0I A;  1YYJ A;  2BL2 A;  3QWV A;  1NG1 A;  1OWP A;  4KT6 B;  1YZC A;  4LDR A;  1KT0 A;  3K7D A;  3EH2 A;  2FFH A;  3K9I A;  4IWB A;  4GEH A;  3PH0 C;  1Q0M A;  4P6I C;  3T6B A;  2J9B A;  4HLE A;  1OW7 A;  4MTO A;  4ME2 A;  4Z9H A;  3UPV A;  3S28 A;  2XLO A;  5ANR A;  3LVR E;  5IY5 E;  3VLE A;  1VLS A;  3TOL A;  3UM2 A;  1G8X A;  2PFD A;  5K0I A;  1RCP A;  3EGX A;  4O79 A;  1PC2 A;  3B9Q A;  1TNU A;  3OTN A;  3DKA A;  3S7B A;  2OEV A;  4U9D A;  1IHG A;  1OCZ C;  4MW8 A;  3CVY A;  4NQF A;  1E7U A;  2AU5 A;  5ENQ D;  2G3V A;  3I4U A;  4DRJ B;  4EUK B;  2XEN A;  3DBS A;  4GTO A;  4PS7 A;  3LEV A;  3B7B A;  4PS8 A;  1MX2 A;  1OW6 A;  4XLP F;  4G23 A;  2FAP B;  2XRZ A;  3ZPJ A;  5E3C A;  1V55 C;  1ZHW A;  1GW6 A;  3IHV A;  3ZTZ A;  3FHD A;  2WXP A;  2KM4 A;  2X38 A;  4CJO A;  3ABK C;  4YL1 A;  2WB2 A;  1T6Q A;  5AEN A;  2V5F A;  4C7O A;  1UW4 B;  2PP4 A;  4RG6 A;  2P1A A;  2OJQ A;  3A9C A;  2P9P G;  4AP2 A;  3W8I A;  2HM8 A;  4MQ9 F;  1SVX A;  1HMD A;  4U5H A;  3FUJ A;  5BV0 A;  4C3B A;  4DOZ A;  2XXA B;  1NA0 A;  3ZN3 A;  5B3I A;  2EIL E;  3Q73 A;  1Z5Z A;  5DQZ A;  5KYY A;  2QYU A;  2VCB A;  4MVZ A;  4XZ4 A;  3WAQ A;  3QWP A;  3B7S A;  3KYI A;  4KZ0 A;  3NF1 A;  3QKY A;  3DSS A;  4F1P A;  4I44 A;  3EQL F;  1LD7 A;  5ENR D;  3E70 C;  4APO A;  4PJN A;  1FVH A;  4A63 B;  2IY0 C;  3IEE A;  3NKD A;  2R05 A;  3DJU B;  5L0H A;  4I9C A;  4OD4 A;  3EU9 A;  4G8K A;  1S05 A;  3MX3 A;  1U2V G;  3L8J A;  4ANV A;  4U8Y D;  5FZQ A;  2P9U G;  1R4T A;  5KBA A;  4DBQ A;  1WOL A;  1N4R A;  2AXU A;  4E17 A;  3CQZ A;  1XZP A;  4WUY A;  3CVQ A;  3CVP A;  1V74 B;  2FF4 A;  3LS1 A;  2YIN A;  4MS2 A;  3FTY A;  1K1A A;  3UM0 A;  3FU5 A;  1VOM A;  2YLG A;  1YZA A;  2XLH A;  4N3A A;  4BX8 A;  4JEB A;  2I2O A;  2ION A;  1S0P A;  1RMV A;  3EUV A;  3U5S A;  1JCS A;  1OXK A;  1W2W A;  1OQC A;  2BKG A;  2V4H C;  3G2V A;  2JLB A;  3L82 A;  4B89 A;  3PEU B;  3EIQ C;  1X5B A;  3SZR A;  3DE8 A;  4RG9 A;  4Z68 A;  4F53 A;  2GRL A;  4EZJ A;  2LAI A;  3D9P A;  2HKV A;  3NYM A;  3URZ A;  4JEU A;  2EIM E;  3TWS A;  3D9I A;  4ULW A;  1HE9 A;  3ZVV A;  3NYJ A;  3ZYL A;  3PDN A;  4EBK A;  4UWG A;  1ZW2 A;  3RU0 A;  3H65 A;  4HOS A;  5JS5 A;  1NI1 A;  5G55 A;  3SNH A;  2DYS C;  2CGE A;  5KNG A;  3UGO A;  3PZ1 A;  2OKU A;  2X0C A;  3UM3 A;  3NOG D;  1YLM A;  2A0U A;  4WAF A;  3VF0 A;  2VGY A;  4BEP A;  3GAN A;  3ML9 A;  4M3O A;  3TJP A;  5J08 A;  4WJ0 A;  2P9L G;  2HR2 A;  3LEW A;  4GCN A;  4A2N B;  4N3B A;  4BJ5 A;  4UWL A;  1LM3 B;  3VYW A;  1EYH A;  2J08 A;  3IHY A;  2M64 A;  1Z7Q c;  4J0U A;  1OKK D;  2WXI A;  5T8I A;  4KNV A;  4DLO A;  2CFZ A;  3FH8 A;  3FVY A;  3ZDL A;  3K6B A;  1U3D A;  3X2Q E;  4A3T A;  3CSF A;  2ZXP A;  1SYQ A;  4KNW A;  4ANJ A;  3LY9 A;  4GTR A;  4F3V A;  4C7O B;  4JJF A;  4GB9 A;  3TGO A;  3PZD A;  1I4Z A;  4PH4 B;  5B1A C;  5EK0 A;  5DVW A;  1B89 A;  2JEK A;  1VYI A;  2KJG A;  4G0H A;  2XPI A;  5A6B D;  3Q79 A;  4LRZ A;  3BRJ A;  3E32 A;  3HJC A;  4X0R A;  4UWH A;  4B93 B;  3ZIB A;  2H6I A;  3Q78 A;  4MS6 A;  1EF1 C;  3CKB A;  1ZHZ A;  2R7V A;  2A4Z A;  2WXJ A;  3G4X A;  4J30 B;  1XZQ A;  4NY3 A;  5BUZ A;  4GTT A;  1MMA A;  2VCC A;  2DYR E;  2IQC A;  2PNN A;  1MQS A;  3RKV A;  3ULQ A;  3EU5 A;  3DXM G;  3C63 A;  4GU5 A;  4E7Z A;  3I4R B;  4L2L A;  3SFZ A;  5A23 A;  3MFN A;  2YVK A;  3QW1 A;  3FUE A;  2OVF A;  1N94 A;  3L8I A;  4Q96 A;  4G25 A;  2J7P D;  4CS7 A;  4AV7 A;  5A6J A;  1HU3 A;  1K40 A;  2J9U A;  2OOC A;  3N24 A;  4CDM A;  4G26 A;  2IOQ A;  2NUP A;  5FCL A;  3R7C A;  3E9V A;  2R9R B;  4IGG A;  3O55 A;  3ITF A;  1VTM P;  3R7R A;  4DRX E;  4IN3 B;  4DX6 D;  2WVQ A;  3GM1 A;  2Q9C A;  3JZ0 A;  3EGD B;  2IF4 A;  4RD9 A;  3CEQ A;  3HNI A;  4R32 A;  2JD3 A;  1XGW A;  3FH7 A;  4JZY A;  5AIJ A;  1UFB A;  3DXK G;  3RYL A;  2EPM X;  1TN7 A;  3R9M A;  1C02 A;  3ABM E;  3AU4 A;  5JA4 D;  4JEA A;  2J49 A;  3J5Q B;  1GGQ A;  4M63 A;  4BET A;  3EH1 A;  3G2U A;  2FEZ A;  2R17 C;  3B7R L;  5FZS A;  2L81 A;  3Q7F A;  3X1O A;  1O1T A;  2FI7 A;  1LTX A;  3BEE A;  4OAU C;  4MRU A;  3CAX A;  1NU7 D;  2VH3 A;  3MYV A;  4LAC B;  4PFP A;  4K7B A;  4OIR F;  2KNH A;  1SA4 A;  5JJ7 A;  4ILI A;  3Q6M A;  1BD8 A;  1TNY A;  4BTA A;  3RO2 A;  2G62 A;  2LP4 A;  3DI5 A;  3ZRH A;  4MVQ A;  4U04 A;  1WN0 A;  3N71 A;  4O6Y A;  3ZQY A;  4O1P A;  4KYO B;  3U64 A;  1K1B A;  1TWC A;  3JRM O;  2V3C C;  5C1D A;  5G05 C;  3NRH A;  1WAO 1;  3LJN A;  2E87 A;  3Q75 A;  3MKQ B;  4TXP A;  3EG9 B;  2L6J A;  3KEZ A;  1TR4 A;  5BQG A;  2IM8 A;  4DXW A;  3U8V A;  1KZO A;  5CI8 A;  3HDX A;  1D1A A;  3ML8 A;  3TG5 A;  3UM1 A;  5LFA A;  2RFM A;  4E0I A;  3NMK A;  4EHP A;  1HW2 A;  1K05 A;  4MVO A;  3LY7 A;  5D92 A;  1FAP B;  2XEH A;  2L9B A;  3HYM B;  5CMW A;  3OEO A;  4G7H F;  1A41 A;  3QDN A;  5AQ7 A;  1OXB A;  4E85 A;  4CGV A;  4FAD A;  3AGU A;  5CBO A;  2OEW A;  2ZXW E;  1H9G A;  2HS5 A;  1WG0 A;  3RQE A;  4DX5 D;  3SGH A;  4EPZ A;  4RQI A;  2QTV A;  1H2V C;  3IBE A;  1JPN A;  3FTX A;  1DVP A;  1FT2 A;  1GS9 A;  3RVY A;  3SXZ A;  3JYS A;  4EKW A;  3HNL A;  1NLX A;  1MQV A;  4HFK B;  3KPH A;  3SFX A;  2XSE A;  2HSB A;  2FO1 E;  4J8E A;  4YT4 A;  4KVM A;  3HXC A;  3UKR G;  1SZI A;  2OU6 A;  5AGF A;  2KCL A;  1EPU A;  4YT2 A;  3CVN A;  3TWU A;  3TUL A;  2Y3H A;  1YVI A;  4XPX A;  4I6G A;  4NRH B;  2XPZ A;  1RJ9 A;  2R25 A;  4ZHB A;  2B0J A;  2PM7 A;  2I9C A;  1WAT A;  1BR4 A;  3C7J A;  5EHH A;  5HI7 A;  4F7A A;  5G04 C;  1H19 A;  3VTX A;  1IW7 F;  1OT8 A;  5KNH D;  1ZB1 A;  3CVW A;  1DOW A;  3M15 A;  3GZ2 A;  5JSL A;  4BTB A;  4N2Q A;  1Y6D A;  4ATZ D;  3VTY A;  3JT1 A;  4EWC A;  1PD0 A;  1V4A A;  2FUL A;  5COG A;  2WQ7 A;  3OXL A;  2ILR A;  4J8D A;  3HLZ A;  3AQC A;  5LCW J;  4GML A;  2DBA A;  1NP7 A;  2HO1 A;  4FP7 A;  3EDT B;  2I1J A;  1LE4 A;  1QBQ A;  4A4A A;  4EHM A;  4OIN F;  2AVP A;  2WVI A;  1QPU A;  4V3I A;  4GQH A;  5TJ5 E;  3S2A A;  3U3F A;  3NZU A;  4UDV A;  1H6G A;  1OCC E;  4CJG A;  2KZT A;  2P9S G;  4TUU A;  2LK4 A;  2VTB B;  1JCR A;  4DX7 D;  4WNG A;  4EZL A;  4ANU A;  256B A;  4BEM J;  3OXG A;  2HE0 A;  1IHB A;  2XRH A;  2MWQ A;  3TOM A;  1OWO A;  1L7C A;  4APF A;  4JC8 A;  5CRV A;  2XEE A;  1LI7 A;  4DPR A;  3EHN A;  5DIZ A;  2JX0 A;  4GPM A;  4BJ1 A;  5AQA A;  2HFI A;  2NXP A;  4HQD A;  3CGH A;  2MHK A;  3W4Y A;  3AG1 C;  3C5R A;  1IKN D;  2L0T B;  5L0F A;  5A6C A;  5G2N A;  4YND A;  3UKU G;  5BXU A;  4CSA C;  3SEO A;  1O5H A;  3ABL C;  5L0G A;  3AS5 A;  3T8M A;  4MW3 A;  1E84 A;  3FUF A;  4U5D E;  1QLE C;  2ZIR A;  3ASN C;  3DMD A;  3G2W A;  5AJD A;  3FTZ A;  3HXF A;  3L22 A;  2E2E A;  3PZ2 A;  3V7O A;  5BV1 A;  5DBK A;  1ORJ A;  1EKY A;  3K1I C;  3RVZ A;  2J8W A;  5FT9 A;  3PUK A;  2Q7R A;  4DVZ A;  2ETA A;  3HNJ A;  2KK1 A;  5CEC B;  1SZ9 A;  1U89 A;  4E18 A;  4IAO A;  4Q94 A;  2XM0 A;  1ORS C;  4ZFH A;  3UIO C;  2WQ6 A;  1T6I A;  2XLW A;  2PL2 A;  1JWG A;  4L2Y A;  4G1T A;  1N0Q A;  1NZN A;  3AOU A;  4J8Y A;  2WZG A;  2P0N A;  5EID A;  1BI8 B;  4N06 A;  5AAO A;  4LNG A;  1RJ9 B;  1KLX A;  4EEC A;  3W8H A;  4CCA A;  1I5N A;  3L0I A;  5EX3 A;  3CK8 A;  1HG5 A;  1LD8 A;  2W9Y A;  1ZHY A;  3WXX A;  1B68 A;  3S9O A;  3KS2 A;  3G4Z A;  2H8A A;  3LAY A;  2KAT A;  4DUI A;  5EIB E;  3P1U A;  2L6G A;  4PAC A;  1E8W A;  3MGB A;  2BKK B;  3VLF A;  1Q0D A;  3FUD A;  1UG3 A;  4HI9 A;  3RIB A;  4PDX A;  2Y69 E;  1OWM A;  3FUH A;  3MV3 B;  1OCO E;  5BUO A;  2J46 A;  4H7X A;  1HS6 A;  4CT4 A;  1PY1 A;  4KBL A;  2AW6 A;  4EBA G;  3U66 A;  3JQ1 A;  2YNQ A;  3ZC4 A;  4C0E A;  1YYX A;  4Q5S F;  4HB5 A;  1YYH A;  2ZD9 A;  4LCT A;  5HKP A;  2L6F A;  2H6G A;  1FTS A;  2KZT B;  4DI4 A;  2XZD G;  3IXE A;  4K1O A;  3CEX A;  1S7Z A;  1KT1 A;  3NDB B;  1MJ0 A;  1FVF A;  1HG2 A;  3UQ3 A;  2PM6 A;  1PD1 A;  3U4T A;  4CS9 C;  3QAQ A;  3TWW A;  1H6O A;  2AXV A;  3QK0 A;  4GZ6 A;  3QNK A;  4CIP A;  4U7E B;  3T5X A;  3UIN C;  1OCR E;  5LX8 A;  3NBN B;  3V31 A;  2AJA A;  1HZ4 A;  1G5Z A;  4CDN A;  1Z3X A;  2YRF A;  1U0B B;  5H7P A;  4CSA A;  4XE0 A;  4I1M A;  4G78 A;  2Q4F A;  4XX5 A;  4I6J A;  5L3Q A;  2IXO A;  1TEZ A;  4WGZ A;  1FT1 A;  3V2O A;  1DCQ A;  4BJ6 C;  3RK6 A;  3Q9N C;  3L6A A;  4GTM A;  1AVO B;  3T9O A;  3AG3 C;  2C0M A;  4C9B B;  2PZI A;  2CG3 A;  4XWJ A;  2LXL A;  3U2M A;  4HNA D;  2W4M A;  2F8X K;  4JC7 A;  4CZ2 D;  3K33 A;  1TN8 A;  3PCV A;  3ZYM A;  3ASO C;  1TQG A;  4KZC A;  2VSY A;  4HOT A;  2CNW D;  4MND A;  3VM6 A;  4O60 A;  4JVS A;  2J09 A;  1H2U A;  3AG2 E;  1D1B A;  2OVB A;  2NUT A;  5C2Y A;  3U8P A;  2J4B A;  3C8G D;  3Q49 B;  3C8G A;  3AG4 E;  3HXD A;  3Q47 B;  2WVO A;  5CCM A;  3B13 A;  1P5Q A;  2L6H A;  4Z9J A;  1NZE A;  3D9J A;  5FQ8 A;  4I43 A;  2WXF A;  2Y3A A;  5HQ8 A;  2QNL A;  4ZLD A;  2H6H A;  5JLI A;  4GAA A;  3C18 A;  2DZO A;  2RG8 A;  4QQI A;  3S7D A;  3DEP A;  3IQ6 A;  4KBQ A;  2FBN A;  3APF A;  3UI2 A;  3DRA A;  4N4W A;  1BZ4 A;  2A6E F;  2JPU A;  4I1O B;  3TK0 A;  2OV8 A;  3M1C B;  4YJW A;  3T6G B;  4Z9I A;  3O39 A;  2HV7 A;  2X3M A;  2GFH A;  3BQO A;  3KMI A;  3APC A;  2OCC C;  4FWV A;  5KJN A;  2E0I A;  5BQI A;  1AEP A;  4U63 A;  1HE8 A;  5AQB A;  2R7X A;  3S90 A;  4XI0 A;  4A1S A;  4B0Z A;  4UWF A;  3DM9 B;  1MNE A;  1WTY A;  2OOE A;  3TXM A;  3JYY A;  2YL7 A;  2IOL A;  2IO3 C;  3MLG A;  3UMI A;  1UN8 A;  2I8B A;  1U3C A;  3CVV A;  3LS0 A;  2VYI A;  1S64 A;  3S0X A;  3WOD F;  2VJ8 A;  4GA0 A;  3IQC A;  1LI5 A;  2BC5 A;  4ILH B;  5KWD A;  4W8K A;  4NCQ A;  4U0U A;  3GM2 A;  1I4Y A;  3C8Z A;  3LLK A;  4IAQ A;  3Q15 A;  4FU3 A;  4LEU A;  3W2W A;  2XL4 A;  1HXI A;  3Q7L A;  2YL0 A;  4K0R A;  4MVM A;  3B71 A;  4O6F A;  3OWT A;  4YL3 A;  4I17 A;  2WZF A;  4JA9 A;  5B1B E;  3FU0 A;  4Q69 A;  3T6J A;  3FFL A;  1QVX A;  4A1G A;  3PRE A;  1NFO A;  5ARF A;  1LIH A;  3U0C A;  3FDQ A;  2KCV A;  4PJL A;  1K04 A;  2BUG A;  2XL8 A;  1MX4 A;  3D9L A;  3EGD A;  3QAR A;  3RSE G;  3ZGQ A;  4BY6 A;  1TKN A;  5KYX A;  4NAC A;  5G05 J;  4JA7 A;  5A7D B;  4U8V D;  1WDY A;  1IQR A;  3ESL A;  2A1D D;  2H7V C;  1TN6 A;  3IQT A;  5FJY A;  2KW3 C;  4ILG A;  3DZA A;  4IRU A;  4MTG A;  5CHE E;  2ZU6 B;  2X6K A;  3NZS A;  3JUE A;  1OCZ E;  3HG0 D;  1BBH A;  2NUT B;  3T8K A;  2DZN A;  3C8G B;  3JCU Q;  4IAR A;  2EIK C;  1VB5 A;  2QC9 A;  2XEV A;  3HIZ A;  2LFF A;  4JTD B;  3SD5 A;  5BQH A;  1V55 E;  4LG6 A;  3BG0 B;  3ZYK A;  4GYW A;  2WZL A;  4LLE A;  3P2B A;  3SF4 A;  4MVS A;  4IYP A;  2YWA A;  3ABK E;  2YL1 A;  5KCM A;  1RZ4 A;  4U5B E;  1ZVZ A;  3JSE O;  4XPY A;  1ELW A;  4RDA A;  2P9N G;  4I3M A;  1OKK A;  2HJ3 A;  3S27 A;  4B94 A;  3MKQ A;  3MBG A;  3EG9 A;  3LLI A;  1LVK A;  4PK4 A;  3C98 A;  1SF8 A;  4FX5 A;  3TL5 A;  2A6H F;  2WQH A;  1LKX A;  1E8X A;  4D10 C;  2WXN A;  1PV3 A;  2Y39 A;  1VDY A;  1JOG A;  4H54 A;  3R7Q A;  4HE8 D;  3I3N A;  2GRR B;  4I2Z A;  4JRZ A;  4E7S A;  2QLA A;  1TFK B;  2X6J A;  2NC9 A;  3RF3 A;  1TWH A;  2EQX A;  5A6B A;  4ZLC A;  5BXO A;  3HXE A;  4YT8 A;  4JZA A;  2UUI A;  3GEH A;  4A3V A;  3KYJ A;  4E0H A;  2ZIS A;  4NIK A;  3Q4A B;  5E33 A;  2OEX A;  2YQY A;  3SYN A;  4FLH A;  2QZA A;  1DNP A;  4AVX A;  4G8L A;  2GW1 A;  3B7T A;  5AC4 A;  4OYS A;  3DSX A;  2MHR A;  2R7S A;  1BR2 A;  2IXN A;  4HLL A;  4DK5 A;  5G04 J;  1V54 C;  1WM5 A;  4EZK A;  2H7O A;  4CGW A;  2OG2 A;  1M2O A;  1BI7 B;  2J7P A;  1H2T C;  3ZNG A;  4DJA A;  3EJN A;  3FWV A;  4DLQ A;  5DLJ A;  2Y3D A;  3QZC A;  4HRM B;  1D9S A;  3BUA A;  1AWC B;  2X6F A;  3ESK A;  4GMJ A;  1YCS B;  4OIO F;  1J8Y F;  3TD7 A;  3KL4 A;  3TWQ A;  3SY2 A;  4OAV B;  3MYI A;  1E8Z A;  1N4P A;  1MND A;  1LF8 A;  2LD6 A;  2PF4 E;  1MMN A;  5KYX B;  4LER A;  5JP7 A;  3RIP A;  4CDR A;  3DXJ F;  5ENS D;  2DYS E;  4WNF A;  2B0H A;  2BE5 F;  2IYL D;  4XEV A;  1OWL A;  3CZ6 A;  4DX2 A;  2YHE A;  1ZW3 A;  1XWJ A;  3RQG A;  1GM5 A;  4CT0 A;  3FUM A;  3PNT B;  4JHJ A;  4MVU A;  2YHS A;  5EYL A;  2J0X A;  3M79 A;  1SW6 A;  3O6X A;  3RRU A;  2L6B A;  3ASD A;  5T4Y A;  1Z3I X;  3V5X A;  1E83 A;  1G4W R;  4N2S A;  1LS1 A;  4UI9 C;  2XGO A;  3E34 A;  5E76 A;  3AJI A;  1ZHX A;  1Z6A A;  5KYW B;  3HRA A;  1H9T A;  4LNB A;  5A6K A;  4EBB A;  2UUH A;  3KH2 A;  2VB6 A;  4GYO A;  2VTB A;  4WNE A;  2J8S D;  2OND A;  3LCA A;  4UQX A;  3W9G A;  2XS8 A;  5AAR A;  4MLP A;  1UOH A;  5B1A E;  3GOD A;  2PX0 A;  3MA5 A;  3DEO A;  5JJT A;  4NUR A;  3KSQ A;  3EZH A;  5AYW D;  1O1S A;  3HTK C;  2EPK X;  4C3E A;  1A5E A;  1C03 A;  2LSU A;  2CFU A;  2WMO A;  5D0Q D;  3M4C A;  2I1K A;  2NYJ A;  4HEA J;  5T3T A;  2QE9 A;  1W3B A;  2AVK A;  5FIN A;  3MV2 B;  3N2Z B;  4RBN A;  4WWN A;  3Q6N A;  1GQA A;  2DI3 A;  3EIJ A;  2LQG A;  3SI5 A;  1DOV A;  3WG7 C;  4JPS A;  3HHM A;  3BU8 A;  4GTS A;  2XL6 A;  1N0R A;  5T1D B;  4EBJ A;  1JCQ A;  1OY3 D;  2WXQ A;  4TXQ A;  4XPW A;  5D66 A;  2R7O A;  1TFO B;  2Q3T A;  3E30 A;  4X8Q A;  1MMD A;  5FQ4 A;  4U5F E;  3LUT B;  3KEA A;  3QMK A;  4P9F A;  2B6C A;  3O4Z A;  5ARG A;  4GZC A;  4CDA A;  3RQF A;  4F6R D;  1ZU5 A;  1CGO A;  2D5R B;  1D0Z A;  4XEK A;  1M56 C;  3TWV A;  5JMN D;  1NU9 C;  2OQM A;  2KXP C;  4H7Y A;  4BT8 A;  2X51 A;  4U8H A;  1VYK A;  3LJ3 A;  4XTK A;  1M6T A;  4DRH B;  3NQP A;  5COM A;  2IXM A;  4OIQ F;  3QW0 A;  3UT7 A;  2GAQ A;  3PMR A;  1VLT A;  5DS4 A;  3BEH A;  2PQN A;  3GEE A;  3G50 A;  4GYT A;  5HSW A;  4NTA A;  2XLE A;  1EI7 A;  4TV3 A;  4EQF A;  1YDI A;  2F37 A;  1A0B A;  2R5S A;  4AL0 A;  2EIN C;  3FU6 A;  4YN0 B;  2I15 A;  1D1C A;  4J6I A;  5B3S C;  3CHO A;  2P6V A;  4XKB A;  3ZSU A;  4DX1 A;  4ONS A;  3LES A;  4PJJ A;  5EX0 A;  4Q4Z F;  5CEA A;  3RAU A;  5L0C A;  2I6H A;  1JMW A;  2ZPA A;  3D9K A;  2HV6 A;  4BPM A;  1D0X A;  1E90 A;  4DBR A;  4M7C A;  1XNF A;  4AE4 B;  4JKV A;  2EPL X;  3VRC A;  3EFO B;  1BDJ B;  2EIJ C;  4ATG A;  4BER A;  3C3O A;  5JHA A;  2ETC A;  3L17 A;  1YAR O;  4YT5 A;  1SMY F;  3B7U X;  3AAA C;  3VAY A;  2P58 C;  4MKT A;  5CER B;  1AUE A;  2MYS A;  4JXT A;  2R2L A;  4L23 A;  3RRN B;  2F8Y A;  2AXZ A;  3C72 A;  3F6Q A;  5E2Q A;  2XRY A;  3U9J A;  3RH3 A;  3E4B A;  2QYJ A;  4UQY A;  2JAB A;  4AXH A;  2YQ8 A;  2Z15 A;  3OA1 A;  4U0Z A;  1O3U A;  4JCZ A;  2YHC A;  1HH8 A;  4IUL A;  1G3N B;  3DPD A;  2DWZ A;  4HRN A;  3DJN B;  3S7F A;  3Q7G A;  4ANW A;  3F46 A;  3ASF A;  4LUN U;  1NFI E;  2IEJ A;  5E3A A;  3U3B A;  3Q7A A;  2DGJ A;  4BFR A;  5EN5 D;  4JHK A;  2NPU A;  2XCB A;  4CEM A;  1F1M A;  1O5M A;  2QY7 A;  3LS8 A;  1TJC A;  4YVO A;  3TG4 A;  3FU3 A;  4LLC A;  2WXG A;  3LNM B;  3PEV B;  2CHW A;  2PQR A;  3SO8 A;  4FUL A;  5KYU B;  3PZ4 A;  4GA1 A;  5A69 A;  3ZEF A;  2VQ2 A;  3FEX A;  4HI8 A;  2RSE B;  3DST A;  5ENO D;  4PJM A;  3JQ0 A;  4P29 A;  3V2X A;  3MJW A;  3FXH A;  2R7T A;  3POV A;  4NQ0 A;  3MYF A;  3AQB A;  1N4Q A;  4EBA A;  3MCX A;  3L54 A;  2AWY A;  3FUL A;  2BTD A;  1HO8 A;  1T9K A;  2CHX A;  3ZUV B;  5JVE A;  3I5Q A;  4R7L A;  3L34 A;  2IO2 C;  1Y8M A;  3SNX A;  4HOR A;  5ENP D;  1FMV A;  3JSZ A;  3CK7 A;  4ACL A;  5KJK A;  5F5H A;  4WWO A;  1QSP A;  4JIO A;  2J9Q A;  2GA0 A;  4YDY A;  4AJW A;  2WXL A;  1Y4C A;  1TNB A;  1YA0 A;  5L0I A;  1K3Z D;  2CCY A;  3WHN A;  3CST A;  2BED A;  1N1C A;  3IEG A;  2HJM A;  5T3W A;  1ZU2 A;  5CI9 A;  3LKU A;  2C04 A;  3RKO F;  1NSG B;  5LOZ A;  5IY5 C;  3CSK A;  3U2L A;  2Y3G A;  4HFF B;  3J06 A;  2VGX B;  4GPK A;  4I6E A;  4HFG A;  1N95 A;  1DCE A;  4JCH A;  1T6U A;  4DRI B;  4JE9 A;  1N4S A;  5ANL A;  2EPO A;  2GRO B;  2R59 A;  4KI2 A;  4CYM D;  1TJF A;  1FFH A;  1HX8 A;  2PX3 A;  4D4N A;  4GTV A;  2HMQ A;  3RFY A;  3HNK A;  3DE9 A;  4UI9 K;  4WAB A;  2L9J A;  3FTS A;  4JEH A;  3RJV A;  2Q9A A;  4Y6W A;  1L5J A;  2MYO A;  3UGP A;  2KC7 A;  4OVV A;  5CIV A;  4JD2 G;  4LDK A;  4I2W A;  3HVE A;  2UWJ G;  1UJK A;  4ACK A;  3O10 A;  1FNT c;  2ICW G;  3AG1 E;  3EHM A;  1PCX A;  4N6H A;  1OUV A;  4O7G A;  4GTQ A;  3RO3 A;  4J8S A;  4YWQ A;  2EIL C;  1UN9 A;  2O9X A;  5FWQ A;  4U5C E;  1J8M F;  3Q5M A;  1E2X A;  2LFD A;  5EIL A;  3NG1 A;  4OIP F;  3ABL E;  4FA6 A;  3VLD A;  3T5V A;  2HMZ A;  2LSV A;  4LSZ E;  4AY6 A;  1EQ1 A;  2V8S E;  3U9W A;  3CKC A;  1JWF A;  1C17 M;  1IYG A;  3V30 A;  1TNO A;  1FFT C;  3ASN E;  3E33 A;  1Z3Y A;  4FJY A;  4P9T A;  2HZ8 A;  4MTF A;  1JRA A;  2YLI A;  3W2V A;  4CDV A;  3K1I A;  4A55 A;  1ELK A;  2KGO A;  1HE1 A;  1APC A;  4C3D A;  5FQ6 A;  1YAU O;  2CG2 A;  3CQG B;  2CNW A;  3CVL A;  3PE4 A;  3G2T A;  3IKO B;  3PZ3 A;  4K03 A;  3JRT A;  1S63 A;  4L9P A;  1E85 A;  3FUK A;  1JR8 A;  2IOS A;  3FP3 A;  3JXJ A;  2R7U A;  1EA8 A;  3M4B A;  5DQT A;  1EDU A;  4JB8 P;  4JUR I;  4L6R A;  1LPE A;  2R7R A;  4L1B A;  1INZ A;  1AP7 A;  2J0W A;  4ULV A;  1MHQ A;  3CHR A;  1M57 C;  4AM9 A;  4N5Q A;  5EYP F;  1RKE A;  4CX9 A;  2XS1 A;  2KCK A;  2EIM C;  3ONK A;  2W45 A;  2GDC A;  4Q7C A;  4U07 A;  1PAQ A;  4JHR A;  5JJ6 A;  1S70 B;  3T9K A;  3LNR A;  3UMK A;  2WPV A;  4O1O A;  1M2V A;  2MRI A;  3MEK A;  3NAW A;  2Q00 A;  4MBG A;  5CED B;  2C03 A;  5F5F A;  4N5C A;  4GTP A;  3I4G A;  3H2U A;  3NOC D;  1VK5 A;  2XLV A;  4I1A A;  2ASR A;  5HS0 A;  4BJ5 C;  4FHK A;  4MVR A;  3PE3 A;  5ENN A;  4CS9 A;  3SXK A;  4G24 A;  3ZXS A;  3ASG A;  5D0O D;  4YL0 A;  3C3Q A;  2V0P A;  5E75 A;  4XKC A;  1MZC A;  4CS8 C;  3X2Q C;  3B95 A;  1NBB A;  4C0M A;  1QZX A;  4WWP A;  3HVE B;  1KZP A;  5EGY A;  3L1M A;  2IBF A;  3K66 A;  2XGM A;  1CPQ A;  3PHF 2;  1OR3 A;  2R7Q A;  2XGS A;  1HF8 A;  1A7D A;  3ZW3 A;  2FO7 A;  3EZI A;  2H7B A;  3GWN A;  3CQC B;  2XZT G;  2DB4 A;  2QUP A;  4BJ6 A;  2R03 A;  5HRY A;  2RKK A;  2J9V A;  1KNY A;  5KYN A;  3CLJ A;  5EDS A;  3IPM O;  3GZS A;  5JUA A;  4FLB A;  5AJL A;  1Q2Z A;  3AG3 E;  5DS5 A;  4K5C A;  1WAS A;  3SP1 A;  2RD9 A;  4GCO A;  3AU5 A;  4JTC B;  1CPR A;  3QB2 A;  4PS3 A;  4UI9 J;  2DYR C;  2WL8 A;  1KTM A;  4XLN F;  4BG0 A;  2WXR A;  3FEY A;  3HXB A;  2ZXR A;  3ASO E;  4PUC A;  1E7V A;  3FTW A;  2CW0 F;  3ZU7 B;  2WXK A;  3L9T A;  3ZYQ A;  4U96 D;  4JW1 A;  3S84 A;  1OXJ A;  1NL4 A;  1H6K A;  2AP3 A;  2NSG A;  2A0B A;  2M4E A;  1BR1 A;  3B0U X;  4W8P A;  3UIP C;  1DC2 A;  1NA3 A;  3EPV A;  1YMP A;  1H0A A;  2WVN A;  2XQ0 A;  5KJL A;  2YKZ A;  2FGY A;  1D0Y A;  3QVY A;  3CVU A;  1UG7 A;  3UUX A;  1Z6T A;  4NC3 A;  1HMO A;  3CHP A;  3JUI A;  1RKC A;  1QQE A;  5KYW A;  3MZL B;  1RKE B;  1KU2 A;  3EHR A;  3TWR A;  4HBD A;  3ABM C;  4BJT A;  3KD7 A;  3EGX B;  4ANX A;  1Q0K A;  2ETS A;  1G4U S;  1CGM E;  1VMA A;  2P2C P;  5ENT D;  2LAH A;  2OCC E;  3LJB A;  3TJ5 A;  1D8D A;  2H6F A;  1M2V B;  3ZQV A;  3IHU A;  2QY9 A;  3ISM C;  2XHE A;  3ZWI A;  3HKK A;  4XI9 A;  4YDE A;  2DIW A;  4DI3 A;  3KKB A;  3B0P A;  2X6I A;  4J32 B;  3PRZ A;  3QWW A;  1SR2 A;  2GRQ B;  2XLD A;  4CS8 A;  3SQV A;  4I9E A;  2GGF A;  1WY6 A;  3DWW A;  4D4X A;  3TWT A;  4QDL A;  4G2V A;  4GA2 A;  3NB2 A;  3CHM A;  5CCL A;  5AQ9 A;  2XLM A;  4TXR A;  2WXM A;  1T01 A;  4G7Z F;  4RVB A;  3UMH A;  4N3C A;  3SHF A;  3GM3 A;  4YK5 A;  1FPP A;  1YA9 A;  2NG1 A;  3JTL O;  4BWR A;  5A6A A;  4JTA B;  5KYY B;  3LVQ E;  2GWW A;  4U9E A;  2J9W A;  4YDW A;  3QTH A;  3IV0 A;  2M63 A;  3FDH A;  3F47 A;  1LE2 A;  1JUQ A;  3UR3 C;  2P9K G;  1IXV A;  4KXK B;  4BSX A;  3NMI A;  4K0D A;  4FAP B;  3FTV A;  3AJM A;  4K5A B;  2ZXW C;  3LY8 A;  4YDO A;  2Q7F A;  1E86 A;  1N9A A;  4BX9 A;  1FMW A;  4TUM A;  3SZ7 A;  1LS4 A;  1QKR A;  3SBT B;  4BES A;  4CBE A;  4J7W A;  4Y6C A;  5L0D A;  2WXO A;  3JXI A;  5AC5 A;  1ZU4 A;  2KSF A;  2HUJ A;  3ASH A;  1BPO A;  4BT9 A;  4GMR A;  3NYL A;  2EIK E;  4B8C B;  4HRL A;  3FOP A;  4EIY A;  4GZD A;  2V26 A;  5FQ7 A;  4JJG A;  1NFN A;  2GRM A;  4AE4 A;  4RLY A;  4U0S A;  4JL0 A;  4K5B A;  5CBN A;  4H4K C;  3EFO A;  3JYH A;  3FUI A;  2LO6 A;  3ATP A;  1CGN A;  2V4L A;  3QVZ A;  3V5Z A; 
#chains in the Genus database with same CATH homology
 3LDZ A;  2IU1 A;  4FJZ A;  4UQZ A;  4O6N A;  3LPZ A;  3I5P A;  1QNF A;  3PVL A;  3CK9 A;  4G11 A;  4GZ3 A;  4RSY A;  4AX2 A;  5BW8 C;  3KAE A;  3ZIM A;  5KJM A;  4XIF A;  2WB7 A;  3CVX A;  4WND A;  1E8Y A;  5J90 A;  1IZM A;  1OCC C;  5BT1 A;  3CHS A;  2DCP A;  4CRW A;  3BG1 B;  2G3K A;  3ZG1 A;  3L13 A;  5KYU A;  4O6M A;  3D9N A;  1Y6I A;  1A17 A;  2W4B A;  2LNI A;  4HS2 A;  3APD A;  3B0V C;  2MOW A;  3DAF A;  4TRQ A;  4QI2 A;  5BNW A;  1O87 A;  3LXU X;  4U5E E;  1ZHT A;  2YZS A;  2C2L A;  3FTU A;  3ONL A;  4URK A;  2WM9 A;  1TWG A;  4YVQ C;  4F1S A;  2VAS A;  2QFC A;  4FC8 A;  4KMO A;  3GW4 A;  4DVY P;  1QZ2 A;  4L7T A;  1UJJ A;  2NUP B;  5T3R A;  3K1H A;  3AS4 A;  1HFA A;  3FUN A;  1ST6 A;  3RRM B;  2XCC A;  2VGX A;  1ZYR F;  1ELR A;  4FES A;  3DM5 A;  1MMG A;  3QC1 A;  3S29 A;  1IQU A;  2ZXO A;  5D91 A;  2Q9B A;  1SZA A;  3DAG A;  3D3M A;  2Y4U A;  2IXP A;  2XPY A;  4J8F A;  1JPL A;  4BEJ A;  2Y69 C;  1OCO C;  1FCH A;  2UY1 A;  5LP0 A;  3TXN A;  4B8A A;  3L16 A;  1N54 A;  2A68 F;  5JHB A;  2WXH A;  4UWK A;  1ZBP A;  2Y3B A;  2J4D A;  2Y4T A;  3AS8 A;  4AIF A;  3D9M A;  3U3W A;  3FAJ A;  2RD0 A;  1OCR C;  3R9A B;  3UX4 A;  4PFO A;  3NKE A;  4G7O F;  4KVO A;  3N0T A;  4HXI A;  3S7J A;  4AK9 A;  3ZHE A;  3ZFW A;  2LSE A;  4N39 A;  3UT4 A;  3FHE A;  4ABN A;  3DD7 A;  2HYZ A;  3T4R A;  4B6I A;  5L3V A;  2A69 F;  3GZ1 A;  2WMN A;  4AOF A;  4F4B A;  4GYY A;  3CV0 A;  1N52 A;  3TAX A;  4IJJ A;  4AEZ C;  1OWN A;  3CHQ A;  2C0L A;  3AG2 C;  3AG4 C;  2VSX E;  3G2S A;  2AWI A;  1JPJ A;  4FHJ A;  1TR2 A;  2BF0 X;  3ENE A;  2R7W A;  1Z23 A;  2VSN A;  2CDQ A;  2J45 A;  2VSO E;  2J07 A;  3SBS A;  2P7V A;  3CIA A;  4HVB A;  3L08 A;  2YEV A;  3UT8 A;  3QOU A;  3FH5 A;  3ZVR A;  2IFU A;  2XXA A;  2CHZ A;  5DS6 A;  2NSZ A;  3OXF A;  1TWA A;  1Z63 A;  4U5G A;  2UY1 B;  4OVU A;  1WGW A;  2A5U A;  1SQM A;  3FY4 A;  5BPP A;  2IJG X;  3LYA A;  3OAW A;  3UNG C;  3GYZ A;  4AY5 A;  5M72 A;  3CR3 A;  4KC9 A;  4QFV A;  3PUJ A;  5LCW C;  3UMV A;  5EKQ D;  4HOQ A;  5FZR A;  3PS6 A;  5FTP A;  4OD5 A;  2KQ9 A;  4HOU A;  3MKR A;  3ZHE B;  3ECS A;  4E6H A;  5B1B C;  4QI0 A;  1E96 B;  4W9R A;  3JCK C;  4CIH A;  4GZ5 A;  2X6H A;  3QJZ A;  3D9O A;  3O48 A;  5CMY A;  3PNL B;  2L0I A;  3QWV A;  1NG1 A;  1OWP A;  4KT6 B;  1KT0 A;  3K7D A;  3EH2 A;  2FFH A;  3K9I A;  4IWB A;  4GEH A;  3PH0 C;  4P6I C;  3T6B A;  4HLE A;  4ME2 A;  3UPV A;  3S28 A;  5ANR A;  3LVR E;  3VLE A;  1G8X A;  2PFD A;  3EGX A;  4O79 A;  1PC2 A;  3B9Q A;  3OTN A;  3S7B A;  1IHG A;  1OCZ C;  3CVY A;  1E7U A;  2G3V A;  3I4U A;  3DBS A;  4PS7 A;  3LEV A;  4PS8 A;  4XLP F;  4G23 A;  2XRZ A;  3ZPJ A;  5E3C A;  1V55 C;  1ZHW A;  1GW6 A;  3IHV A;  3FHD A;  2WXP A;  2KM4 A;  2X38 A;  3ABK C;  2WB2 A;  5AEN A;  2V5F A;  4C7O A;  1UW4 B;  2PP4 A;  4RG6 A;  4AP2 A;  3W8I A;  2HM8 A;  4MQ9 F;  4U5H A;  3FUJ A;  5BV0 A;  4C3B A;  4DOZ A;  2XXA B;  1NA0 A;  3ZN3 A;  1Z5Z A;  5DQZ A;  5KYY A;  4XZ4 A;  3QWP A;  3B7S A;  4KZ0 A;  3NF1 A;  3QKY A;  4I44 A;  3EQL F;  3E70 C;  4APO A;  4PJN A;  1FVH A;  3IEE A;  3NKD A;  3DJU B;  4I9C A;  4OD4 A;  3MX3 A;  4ANV A;  5FZQ A;  4DBQ A;  2AXU A;  3CQZ A;  4WUY A;  3CVQ A;  3CVP A;  2FF4 A;  3LS1 A;  2YIN A;  3FTY A;  3FU5 A;  1VOM A;  4N3A A;  4BX8 A;  2I2O A;  2ION A;  1S0P A;  1W2W A;  3G2V A;  2JLB A;  4B89 A;  3PEU B;  3EIQ C;  1X5B A;  3SZR A;  4RG9 A;  4F53 A;  2GRL A;  4EZJ A;  2LAI A;  3D9P A;  3NYM A;  3URZ A;  4JEU A;  3D9I A;  4ULW A;  3ZVV A;  3NYJ A;  3ZYL A;  3PDN A;  4UWG A;  3RU0 A;  3H65 A;  4HOS A;  5G55 A;  3SNH A;  2DYS C;  2CGE A;  3UGO A;  4WAF A;  2VGY A;  3GAN A;  3ML9 A;  4M3O A;  3TJP A;  5J08 A;  4WJ0 A;  3LEW A;  2HR2 A;  4GCN A;  4A2N B;  4N3B A;  4BJ5 A;  4UWL A;  3VYW A;  1EYH A;  2J08 A;  3IHY A;  4J0U A;  1OKK D;  2WXI A;  5T8I A;  4KNV A;  4DLO A;  2CFZ A;  3FH8 A;  3FVY A;  3K6B A;  1U3D A;  4A3T A;  3CSF A;  2ZXP A;  4KNW A;  4ANJ A;  3LY9 A;  4F3V A;  4C7O B;  4JJF A;  4GB9 A;  3TGO A;  3PZD A;  4PH4 B;  5B1A C;  5DVW A;  1B89 A;  2JEK A;  1VYI A;  2KJG A;  4G0H A;  2XPI A;  4LRZ A;  3HJC A;  4X0R A;  4UWH A;  3ZIB A;  4MS6 A;  1EF1 C;  3CKB A;  1ZHZ A;  2R7V A;  2A4Z A;  2WXJ A;  4J30 B;  4NY3 A;  5BUZ A;  1MMA A;  2IQC A;  1MQS A;  3RKV A;  3ULQ A;  4GU5 A;  4E7Z A;  3I4R B;  4L2L A;  3SFZ A;  5A23 A;  3FUE A;  2OVF A;  4Q96 A;  4G25 A;  2J7P D;  4CS7 A;  4AV7 A;  1HU3 A;  2J9U A;  3N24 A;  4CDM A;  4G26 A;  2IOQ A;  2NUP A;  5FCL A;  3E9V A;  3ITF A;  3R7R A;  4IN3 B;  2WVQ A;  2Q9C A;  3EGD B;  2IF4 A;  4RD9 A;  3CEQ A;  4JZY A;  2JD3 A;  1XGW A;  3FH7 A;  5AIJ A;  3RYL A;  3AU4 A;  2J49 A;  4M63 A;  3EH1 A;  3G2U A;  2FEZ A;  2R17 C;  3B7R L;  5FZS A;  2L81 A;  3X1O A;  3BEE A;  2FI7 A;  4MRU A;  1NU7 D;  2VH3 A;  3MYV A;  4LAC B;  4PFP A;  4K7B A;  4OIR F;  2KNH A;  5JJ7 A;  4ILI A;  3Q6M A;  4BTA A;  3RO2 A;  2G62 A;  3ZRH A;  4U04 A;  3N71 A;  4O6Y A;  3U64 A;  4KYO B;  1TWC A;  2V3C C;  5C1D A;  5G05 C;  3NRH A;  1WAO 1;  2E87 A;  3MKQ B;  3EG9 B;  2L6J A;  3KEZ A;  5CI8 A;  3HDX A;  1D1A A;  3ML8 A;  3TG5 A;  5LFA A;  3LY7 A;  5D92 A;  2L9B A;  3HYM B;  5CMW A;  3OEO A;  4G7H F;  3QDN A;  4E85 A;  4CGV A;  4FAD A;  3SGH A;  4EPZ A;  2QTV A;  1H2V C;  3IBE A;  1JPN A;  3FTX A;  1DVP A;  3JYS A;  4HFK B;  2XSE A;  4J8E A;  4YT4 A;  4KVM A;  1SZI A;  2KCL A;  1EPU A;  4YT2 A;  3CVN A;  2Y3H A;  4I6G A;  4NRH B;  2XPZ A;  1RJ9 A;  2B0J A;  2PM7 A;  2I9C A;  1BR4 A;  5EHH A;  5HI7 A;  4F7A A;  5G04 C;  1H19 A;  3VTX A;  1IW7 F;  3CVW A;  3GZ2 A;  4BTB A;  4N2Q A;  3VTY A;  3JT1 A;  4EWC A;  1PD0 A;  2FUL A;  2WQ7 A;  3OXL A;  2ILR A;  4J8D A;  3HLZ A;  3AQC A;  5LCW J;  4GML A;  2DBA A;  1NP7 A;  2HO1 A;  4FP7 A;  3EDT B;  2I1J A;  4OIN F;  2AVP A;  2WVI A;  4V3I A;  3S2A A;  3NZU A;  2KZT A;  4TUU A;  2VTB B;  4WNG A;  4EZL A;  4ANU A;  3OXG A;  2XRH A;  2MWQ A;  1OWO A;  4APF A;  4JC8 A;  4DPR A;  3EHN A;  5DIZ A;  4BJ1 A;  2NXP A;  3CGH A;  2MHK A;  3AG1 C;  2L0T B;  5A6C A;  5G2N A;  4YND A;  4CSA C;  3SEO A;  1O5H A;  3ABL C;  3AS5 A;  3T8M A;  3FUF A;  4U5D E;  1QLE C;  3ASN C;  3DMD A;  3G2W A;  5AJD A;  3FTZ A;  3L22 A;  2E2E A;  3V7O A;  5BV1 A;  5DBK A;  3K1I C;  5FT9 A;  3PUK A;  4DVZ A;  1SZ9 A;  4IAO A;  4Q94 A;  2WQ6 A;  2PL2 A;  1JWG A;  4L2Y A;  4G1T A;  1NZN A;  2WZG A;  4N06 A;  1RJ9 B;  1KLX A;  4EEC A;  3W8H A;  4CCA A;  3L0I A;  5EX3 A;  3CK8 A;  1HG5 A;  2W9Y A;  1ZHY A;  3WXX A;  3KS2 A;  3LAY A;  2KAT A;  3P1U A;  1E8W A;  3MGB A;  3VLF A;  3FUD A;  1UG3 A;  3RIB A;  4PDX A;  1OWM A;  3FUH A;  3MV3 B;  5BUO A;  2J46 A;  4H7X A;  1HS6 A;  4CT4 A;  1PY1 A;  4KBL A;  2AW6 A;  4EBA G;  3U66 A;  3JQ1 A;  2YNQ A;  3ZC4 A;  4C0E A;  4Q5S F;  4LCT A;  1FTS A;  2KZT B;  4DI4 A;  1S7Z A;  1KT1 A;  3NDB B;  1FVF A;  1HG2 A;  3UQ3 A;  2PM6 A;  1PD1 A;  3U4T A;  4CS9 C;  3QAQ A;  3T5X A;  2AXV A;  3QK0 A;  4GZ6 A;  3QNK A;  5LX8 A;  1HZ4 A;  4CDN A;  1Z3X A;  4CSA A;  4XE0 A;  4I1M A;  4XX5 A;  4I6J A;  5L3Q A;  2IXO A;  1TEZ A;  4BJ6 C;  3RK6 A;  3L6A A;  3AG3 C;  2C0M A;  4C9B B;  2PZI A;  2CG3 A;  4XWJ A;  2W4M A;  3K33 A;  3ZYM A;  3ASO C;  4KZC A;  2VSY A;  4HOT A;  2CNW D;  4MND A;  4JVS A;  2J09 A;  1H2U A;  1D1B A;  2OVB A;  2NUT A;  5C2Y A;  2J4B A;  3Q49 B;  5CCM A;  3Q47 B;  2WVO A;  3B13 A;  1P5Q A;  1NZE A;  3D9J A;  5FQ8 A;  4I43 A;  2WXF A;  2Y3A A;  5HQ8 A;  4ZLD A;  4GAA A;  2RG8 A;  3S7D A;  4KBQ A;  2FBN A;  3APF A;  2A6E F;  4I1O B;  2OV8 A;  3M1C B;  4YJW A;  3O39 A;  2HV7 A;  2X3M A;  2GFH A;  3KMI A;  3APC A;  2OCC C;  4FWV A;  5KJN A;  2E0I A;  4U63 A;  1HE8 A;  2R7X A;  4XI0 A;  4A1S A;  4B0Z A;  4UWF A;  3DM9 B;  1MNE A;  2OOE A;  3TXM A;  2IOL A;  3MLG A;  3UMI A;  1UN8 A;  2I8B A;  1U3C A;  3CVV A;  3LS0 A;  2VYI A;  3S0X A;  3WOD F;  2VJ8 A;  4GA0 A;  4ILH B;  4W8K A;  4U0U A;  3LLK A;  3Q15 A;  4FU3 A;  4LEU A;  3W2W A;  2XL4 A;  1HXI A;  3Q7L A;  4K0R A;  4O6F A;  3OWT A;  4I17 A;  2WZF A;  4JA9 A;  3FU0 A;  4Q69 A;  3T6J A;  3FFL A;  4A1G A;  3PRE A;  5ARF A;  3FDQ A;  2KCV A;  4PJL A;  2BUG A;  3D9L A;  3EGD A;  3QAR A;  3ZGQ A;  4BY6 A;  1TKN A;  5KYX A;  4NAC A;  5G05 J;  4JA7 A;  5A7D B;  1IQR A;  3ESL A;  2A1D D;  2H7V C;  5FJY A;  2KW3 C;  4ILG A;  3DZA A;  4IRU A;  5CHE E;  2ZU6 B;  2X6K A;  3NZS A;  2NUT B;  3JCU Q;  2EIK C;  2XEV A;  3HIZ A;  3SD5 A;  3BG0 B;  3ZYK A;  4GYW A;  2WZL A;  4LLE A;  3P2B A;  3SF4 A;  4IYP A;  5KCM A;  4U5B E;  1ELW A;  4RDA A;  4I3M A;  1OKK A;  3S27 A;  4B94 A;  3MKQ A;  3EG9 A;  3LLI A;  1LVK A;  4PK4 A;  3C98 A;  1SF8 A;  4FX5 A;  3TL5 A;  2A6H F;  2WQH A;  1LKX A;  1E8X A;  4D10 C;  2WXN A;  2Y39 A;  1VDY A;  3R7Q A;  4HE8 D;  3I3N A;  4I2Z A;  4E7S A;  2X6J A;  2NC9 A;  1TWH A;  2EQX A;  4ZLC A;  4YT8 A;  4JZA A;  4A3V A;  3Q4A B;  5E33 A;  3SYN A;  4FLH A;  1DNP A;  4AVX A;  2GW1 A;  3B7T A;  4OYS A;  2R7S A;  1BR2 A;  2IXN A;  4DK5 A;  5G04 J;  1V54 C;  1WM5 A;  4EZK A;  2H7O A;  4CGW A;  2OG2 A;  1M2O A;  2J7P A;  1H2T C;  4DJA A;  3EJN A;  3FWV A;  4DLQ A;  5DLJ A;  2Y3D A;  3QZC A;  2X6F A;  3ESK A;  4GMJ A;  4OIO F;  1J8Y F;  3TD7 A;  3KL4 A;  1E8Z A;  1MND A;  1LF8 A;  2PF4 E;  1MMN A;  5KYX B;  4LER A;  3RIP A;  4CDR A;  3DXJ F;  4WNF A;  2IYL D;  2BE5 F;  1OWL A;  3CZ6 A;  2YHE A;  4CT0 A;  3FUM A;  3PNT B;  4JHJ A;  2YHS A;  2J0X A;  3O6X A;  3RRU A;  3ASD A;  5T4Y A;  1Z3I X;  4N2S A;  1LS1 A;  4UI9 C;  2XGO A;  5E76 A;  1ZHX A;  1Z6A A;  5KYW B;  4EBB A;  3KH2 A;  2VB6 A;  4GYO A;  2VTB A;  4WNE A;  2OND A;  3LCA A;  4UQX A;  4MLP A;  3GOD A;  2PX0 A;  3MA5 A;  5JJT A;  4NUR A;  3EZH A;  5AYW D;  3HTK C;  4C3E A;  2LSU A;  2CFU A;  2WMO A;  5D0Q D;  2I1K A;  4HEA J;  5T3T A;  1W3B A;  3MV2 B;  3N2Z B;  4RBN A;  4WWN A;  3Q6N A;  3SI5 A;  3EIJ A;  3WG7 C;  4JPS A;  3HHM A;  5T1D B;  2WXQ A;  2R7O A;  2Q3T A;  1MMD A;  5FQ4 A;  4U5F E;  3QMK A;  3O4Z A;  5ARG A;  4GZC A;  1ZU5 A;  2D5R B;  1D0Z A;  1M56 C;  1NU9 C;  4H7Y A;  4BT8 A;  2X51 A;  4U8H A;  1VYK A;  3LJ3 A;  4XTK A;  3NQP A;  2IXM A;  4OIQ F;  3UT7 A;  3PMR A;  5DS4 A;  2PQN A;  4GYT A;  5HSW A;  4EQF A;  4TV3 A;  2R5S A;  2EIN C;  3FU6 A;  4YN0 B;  1D1C A;  4J6I A;  5B3S C;  3CHO A;  2P6V A;  4XKB A;  3ZSU A;  3LES A;  4PJJ A;  5EX0 A;  4Q4Z F;  2I6H A;  2ZPA A;  3D9K A;  2HV6 A;  1E90 A;  1D0X A;  4DBR A;  1XNF A;  4AE4 B;  3EFO B;  2EIJ C;  4ATG A;  5JHA A;  3L17 A;  4YT5 A;  1SMY F;  3B7U X;  3VAY A;  2P58 C;  4MKT A;  2MYS A;  4JXT A;  4L23 A;  3RRN B;  2AXZ A;  5E2Q A;  2XRY A;  3RH3 A;  3E4B A;  4UQY A;  4AXH A;  2YQ8 A;  2Z15 A;  3OA1 A;  4U0Z A;  2YHC A;  1HH8 A;  4IUL A;  3DPD A;  3DJN B;  3S7F A;  3Q7G A;  4ANW A;  3F46 A;  3ASF A;  4LUN U;  5E3A A;  2DGJ A;  4BFR A;  4JHK A;  2XCB A;  4CEM A;  2QY7 A;  3LS8 A;  1TJC A;  4YVO A;  3TG4 A;  3FU3 A;  4LLC A;  2WXG A;  3PEV B;  2CHW A;  2PQR A;  4FUL A;  5KYU B;  4GA1 A;  3ZEF A;  2VQ2 A;  3FEX A;  4PJM A;  3JQ0 A;  4P29 A;  3MJW A;  2R7T A;  3POV A;  4NQ0 A;  3AQB A;  4EBA A;  3MCX A;  3L54 A;  3FUL A;  2BTD A;  1HO8 A;  2CHX A;  3I5Q A;  4R7L A;  3L34 A;  1Y8M A;  3SNX A;  4HOR A;  1FMV A;  3JSZ A;  3CK7 A;  4ACL A;  5KJK A;  5F5H A;  4WWO A;  2J9Q A;  4AJW A;  2WXL A;  1YA0 A;  3CST A;  1N1C A;  3IEG A;  5T3W A;  1ZU2 A;  5CI9 A;  3LKU A;  2C04 A;  3RKO F;  5LOZ A;  5IY5 C;  3CSK A;  2Y3G A;  4HFF B;  2VGX B;  4GPK A;  4I6E A;  4HFG A;  4JCH A;  5ANL A;  2R59 A;  4KI2 A;  1TJF A;  1FFH A;  1HX8 A;  2PX3 A;  3RFY A;  4UI9 K;  2L9J A;  3FTS A;  4JEH A;  3RJV A;  2Q9A A;  4Y6W A;  1L5J A;  3UGP A;  2KC7 A;  4OVV A;  4I2W A;  3HVE A;  2UWJ G;  1UJK A;  4ACK A;  3EHM A;  1PCX A;  1OUV A;  4O7G A;  3RO3 A;  4J8S A;  4YWQ A;  2EIL C;  1UN9 A;  2O9X A;  5FWQ A;  4U5C E;  1J8M F;  3Q5M A;  3NG1 A;  4OIP F;  4FA6 A;  3VLD A;  3T5V A;  2LSV A;  4AY6 A;  2V8S E;  3U9W A;  3CKC A;  1JWF A;  1IYG A;  1FFT C;  1Z3Y A;  4FJY A;  3W2V A;  4A55 A;  1ELK A;  2KGO A;  4C3D A;  5FQ6 A;  2CG2 A;  3CQG B;  2CNW A;  3CVL A;  3PE4 A;  3G2T A;  3IKO B;  4K03 A;  3JRT A;  3FUK A;  2IOS A;  3FP3 A;  2R7U A;  5DQT A;  1EDU A;  4JUR I;  2R7R A;  4L1B A;  1INZ A;  2J0W A;  1MHQ A;  3CHR A;  1M57 C;  4AM9 A;  2KCK A;  2EIM C;  3ONK A;  2W45 A;  4Q7C A;  4U07 A;  1PAQ A;  4JHR A;  5JJ6 A;  3LNR A;  3UMK A;  2WPV A;  1M2V A;  2MRI A;  3MEK A;  2C03 A;  5F5F A;  4N5C A;  3I4G A;  1VK5 A;  4I1A A;  4BJ5 C;  4FHK A;  3PE3 A;  5ENN A;  4CS9 A;  4G24 A;  3ZXS A;  3ASG A;  5D0O D;  2V0P A;  5E75 A;  4XKC A;  4CS8 C;  3X2Q C;  4C0M A;  1QZX A;  4WWP A;  3HVE B;  5EGY A;  3K66 A;  2XGM A;  3PHF 2;  2XGS A;  2R7Q A;  1HF8 A;  3ZW3 A;  2FO7 A;  3EZI A;  2H7B A;  3CQC B;  4BJ6 A;  2J9V A;  5KYN A;  3CLJ A;  5EDS A;  3GZS A;  4FLB A;  5AJL A;  5DS5 A;  3SP1 A;  4GCO A;  3AU5 A;  3QB2 A;  4PS3 A;  4UI9 J;  2DYR C;  2WL8 A;  4XLN F;  4BG0 A;  2WXR A;  3FEY A;  2ZXR A;  4PUC A;  1E7V A;  3FTW A;  2CW0 F;  2WXK A;  3ZYQ A;  4JW1 A;  1H6K A;  2M4E A;  1BR1 A;  3B0U X;  1NA3 A;  3EPV A;  1H0A A;  2WVN A;  2XQ0 A;  5KJL A;  2FGY A;  1D0Y A;  3CVU A;  3UUX A;  1Z6T A;  3CHP A;  3JUI A;  1QQE A;  5KYW A;  3MZL B;  1KU2 A;  3ABM C;  4BJT A;  3KD7 A;  3EGX B;  4ANX A;  1VMA A;  2LAH A;  3LJB A;  1M2V B;  2QY9 A;  2XHE A;  4XI9 A;  2DIW A;  4DI3 A;  3KKB A;  3B0P A;  2X6I A;  4J32 B;  3PRZ A;  3QWW A;  4CS8 A;  4I9E A;  2GGF A;  1WY6 A;  4QDL A;  4G2V A;  4GA2 A;  3CHM A;  5CCL A;  2WXM A;  4G7Z F;  4RVB A;  3UMH A;  4N3C A;  3SHF A;  2NG1 A;  4BWR A;  5KYY B;  3LVQ E;  2J9W A;  3IV0 A;  2M63 A;  3FDH A;  3F47 A;  1JUQ A;  3UR3 C;  4KXK B;  4BSX A;  4K0D A;  3FTV A;  2ZXW C;  3LY8 A;  2Q7F A;  4BX9 A;  1FMW A;  3SZ7 A;  3SBT B;  4CBE A;  4Y6C A;  2WXO A;  1ZU4 A;  3ASH A;  1BPO A;  4BT9 A;  3NYL A;  4B8C B;  4GZD A;  2V26 A;  5FQ7 A;  4JJG A;  2GRM A;  4AE4 A;  4U0S A;  4JL0 A;  4H4K C;  3EFO A;  3JYH A;  3FUI A;  2LO6 A;  2V4L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...