4I1MA

Crystal structure of the legionella pneumophila gap domain of lepb
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
297
structure length
285
Chain Sequence
b'SILELKPLTLLMTSSTSFSETINQWADILKTTDMEKFSFDSNPINLLELVKQFNLYVDELAITCEANNVWATPNLFALYDNSGGEAIHGHAFVPYYKESIVLRRLFTVDPNTFNLSRFAAFEGPCQLYCAAHADSAWVKIQTLLTLGNGIINTLKIIKQAQAFGIDEAVTENLKALKEQFIAFQLAEADIKESLKAPSNKESEFFYPIDEKALAKMNGYQLATICLEELNSPKPSPLIERILSNKKFWKRINSAFESGVFKGRTDDPAGKIAKIREWHQLLQISG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LepB
molecule tags Hydrolase
source organism Legionella pneumophila subsp. pneumophila
publication title Mechanism of Rab1b deactivation by the Legionella pneumophila GAP LepB.
pubmed doi rcsb
total genus 104
structure length 285
sequence length 297
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18172 LepB_GAP_N LepB GAP domain N-terminal subdomain
A PF18227 LepB_GAP_C LepB GAP domain C-terminal subdomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1700 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4i1mA01
1.25.40.830 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4i1mA02
4JW1A 4JVSA 4I1OB 4I1MA 4IRUA
chains in the Genus database with same CATH superfamily
4TUUA 5KNGA 4CX9A 1DCEA 3KEZA 3UGOA 4K7BA 4Y6WA 2A68F 2R5SA 1Z6AA 1BI7B 2I1KA 3ZUVB 3ONLA 2O9XA 3TL5A 2J46A 5T4YA 2ETBA 2AWCA 5TJ5E 3R7RA 5CEAA 1Y6IA 4YL1A 1W3BA 2DZNA 3QWVA 2R2LA 2VSXE 2VGYA 4F1SA 5KWDA 1EDUA 3C3OA 1ORYA 4O60A 3FTUA 4CT0A 2R7VA 4JC7A 3A9CA 5BV0A 4OIPF 1P5QA 3ULQA 3T5XA 1C02A 3AJIA 3ESLA 3T8KA 2CG2A 3TXNA 2KW3C 4CSAC 4BWRA 4AY6A 2FO1E 3U4TA 1R5ID 3JCUQ 4J7YA 2WMNA 4MW8A 1PY1A 4IJJA 3ABKC 3WAQA 3J06A 3EHRA 1LS1A 3RF3A 3L9TA 4L2YA 5BNWA 1WM5A 3HXDA 3PNLB 3JUEA 3EH2A 4CBEA 4ABNA 3RRMB 2XSEA 1N54A 3D9OA 4LSZE 4BESA 3L6AA 3R2PA 1N0QA 4WWOA 4MVQA 1ZB1A 1OR2A 3APFA 1BR2A 5FTPA 1JOGA 2J8SD 4G24A 4WGZA 2VTBB 3SP1A 1LD8A 2LAIA 2P61A 3FTXA 1QLEC 3C18A 2F8XK 4DX5D 4I9CA 2FI7A 3FVYA 3I4GA 2M4EA 5CCLA 3N71A 1M6TA 3VYWA 2F22A 2PNNA 4GMRA 1RKEA 3MEKA 1G4US 4C0MA 2XCCA 5KYWB 5JMND 3CGHA 3AG4E 4YDEA 3IHUA 4EQFA 3K7DA 1EI7A 4F53A 2KCKA 3PE4A 3Q5MA 3LEWA 3US6A 3CVQA 4FP7A 3ZHEB 4KVOA 2XENA 1V4AA 4GZ5A 4AVXA 5HV9A 4UWLA 3D9PA 5CBNA 4FJYA 1E8WA 2CG3A 2GDCA 3RQEA 4FULA 4PFPA 3G2VA 4GYYA 2H8AA 4DXWA 3UQ3A 1TWAA 1AWCB 3PRZA 4XI0A 2Q3TA 2A1DD 3FUDA 4NQFA 3B7BA 2DYSC 1X81A 4JURI 4ILGA 1AEPA 4ZLDA 3Q79A 5CECB 2J49A 3AG4C 1ZVZA 5KNHD 4PJMA 3EHNA 2B6CA 2EIME 4FX5A 4LNUD 4C48B 1OWNA 3DSVA 4CDVA 4GYOA 3AU5A 4EIYA 1H6PA 1PD0A 4KI2A 3AS8A 2NSZA 1LI7A 2R7OA 3LVQE 3T9OA 5EDSA 2L9BA 2AU5A 3HXCA 3V2XA 3SFZA 1JCSA 2OJED 2KATA 3EZIA 3P2BA 4MNDA 5ARFA 2RKKA 3GZ2A 3QDNA 3UUXA 3RVZA 2DVWA 3IBEA 4BJ6A 5L0IA 2OOCA 3CSFA 3BEEA 3DXKG 4U95D 3S90A 2XLHA 4HOSA 4N5CA 3PZDA 4IWBA 4XKCA 4TXRA 4I17A 1VK5A 3CHPA 1Z5SC 4GTPA 2Y4UA 4LERA 1OW8A 4X0RA 2C0LA 5J90A 4DBQA 5E33A 3WXXA 3ZYKA 3I5PA 3CEXA 2PZIA 3PHF2 1U3DA 4EHPA 3DZAA 4HXIA 3FAPB 3TWVA 2ICWG 4NACA 4XEFA 3ZSUA 5AYWD 4XE0A 2DWZA 2PX0A 4YDWA 3NKEA 4WJ0A 5A6BD 2J4BA 5G05J 1HXIA 5BQIA 2J45A 4YN0B 3OTNA 3OAWA 3QMKA 5D0QD 2HJ3A 3X1OA 2OJQA 2CCYA 2L6GA 256BA 2VGXA 5FQ6A 5AC5A 1ELWA 1MX2A 4HLLA 3HRAA 2DYSE 3DJNB 1ZHYA 5KYWA 1N1CA 1U6HA 4PH4B 1U0BB 3ZTZA 2LXLA 1Q2ZA 4WNGA 5D92A 4N5QA 3LS8A 2WVQA 4LCTA 4E0HA 1OT8A 4K5CA 5CERB 1NI1A 2B0OE 4GTQA 4UQZA 3U66A 4GPMA 3AG1E 1PC2A 4F7AA 2XCBA 5CCMA 3ZNGA 2IO3C 4TXQA 3EU5A 2AWIA 3HNLA 3UMVA 4HI9A 2J08A 4RVBA 1KT1A 5EIBE 4XPWA 4XKBA 1ELRA 4DX7D 4ILHB 2XPYA 2R59A 4JW1A 4M63A 1Z63A 1TNOA 1QQEA 4I1OB 4L9PA 2P7VA 1N9AA 3L13A 4OIOF 3L8JA 2DYRE 3FTSA 4BX9A 2NSGA 1OR3A 4JL0A 1D8DA 2CHXA 3AG3C 4K0RA 3HVEB 3DJUB 4XPXA 1HE1A 4J32B 4G7OF 3FHDA 5DQTA 5E76A 2KCVA 4M3OA 3ITFA 3MBGA 2WXNA 2WQHA 3TQOA 1RJ9B 4ER9A 4CGWA 3V5XA 2KK1A 1FPPA 2J09A 3TG4A 4J7WA 1IZMA 2BL2A 1OXJA 3TD7A 1QZ2A 5T1DB 3TWUA 2F0YA 3PUJA 5BT1A 1LF8A 3RKOF 2PM6A 4K5BA 3SXMA 3GODA 2VB6A 2EIMC 4PJNA 3F47A 1HG5A 1YA0A 3B9QA 3U2MA 3ZYQA 1FCHA 3M4BA 1SVXA 4EBJA 2LIGA 1LE2A 4YNDA 4HFFB 2VTBA 4YJWA 4YT4A 3ZDLA 2JPUA 1N94A 3D9HA 2MRIA 3I3NA 3MKRA 1DOVA 5L0CA 4BSZB 3UXGA 3TWQA 2LFFA 3RW0A 3NQPA 3H65A 4D4NA 3C8GB 3MFNA 1UW4B 3DSSA 3ZYMA 3SD5A 1YJGA 1K04A 1X5BA 4RLYA 4GPKA 4U96D 5JUAA 3U3BA 1IW7F 3IQCA 3K6BA 3AQBA 5KYYA 1BD8A 1TN7A 3BG0B 4RG6A 1NU7D 1B68A 4A1GA 2WZFA 2D5RB 1XGWA 1F1MA 4DI3A 1H2TC 3C63A 2J7PA 2XQ0A 4CDRA 1OWLA 1N52A 3QK0A 1H2UA 5HS0A 1HMDA 5CHEE 3U9MA 3JCKC 4EBBA 4BX8A 4E85A 3B7TA 3BUAA 4U63A 3W8HA 3JQ1A 4KXKB 2P6VA 1A0BA 3EH1A 4JE9A 4NQ0A 4BT8A 1KPSB 1YCSB 4I6JA 3AG1C 4A3TA 2BKKB 3HG0D 5AQBA 2YINA 3QARA 3PMRA 4LACB 4QI0A 4CS8C 3AG2C 2LSUA 2LFDA 2XGOA 4B6IA 4N06A 3LJNA 3UM3A 2OV8A 2LUHA 4N3CA 4U5GA 4DRXE 4HB5A 1WTYA 1GGQA 2JX0A 4B89A 2XM4A 1DC2A 3LY7A 2KJGA 1T6UA 2EIKC 4JCZA 3D9MA 3W8IA 1L5JA 2EPMX 3D9JA 4DLOA 1NA0A 3QC1A 4C7OA 4HLEA 2P9KG 2P58C 5K0IA 4JEUA 2EPNA 2VCCA 2R7RA 4HS2A 3HHMA 4UQXA 3RO3A 4N3BA 2V5QC 2WXQA 4L2LA 3APCA 3NZUA 3FXHA 1RJ9A 3VM6A 5EYLA 3TWRA 1J8YF 1JPNA 3NYLA 4XEVA 5L0DA 4MVUA 2G3KA 4RDAA 5G05C 2DYRC 4CJOA 1PAQA 3EHQA 3U3WA 2Y3HA 5CBOA 3PZ3A 2B0HA 3EGDA 2X6FA 2WZGA 3R9MA 2LD6A 5COFA 2ONDA 3POVA 4GZ3A 5BPPA 5EX0A 5DS6A 4JTAB 1MX4A 2IXPA 4JKVA 2GGFA 3TWSA 4J8YA 2FF4A 3EU9A 3CVWA 1QZXA 2L81A 2YRFA 4J7TA 2XZDG 1EYHA 1D0XA 5T3RA 2VCBA 3Q7GA 1WOLA 5AIJA 1E85A 4KMOA 4U7EB 2J9WA 1FFTC 1HF8A 5ENOD 3QNKA 2GRQB 1QQ3A 3AG2E 1O1RA 2P9SG 3ZU7B 5L3VA 3O4ZA 3UT4A 1VOMA 4DX2A 3SEOA 4U5BE 1GS9A 4IRUA 3F6QA 3CV0A 4O6NA 4OVVA 3DMDA 3IHVA 4FLHA 4U0UA 3G4XA 2IM8A 1PV3A 4I1MA 3ZVVA 4OAVB 3FH8A 2AVKA 1HMOA 4R32A 4ULWA 2AW6A 2BE5F 2L6FA 1JWFA 4JRZA 5EGYA 1H19A 1TNZA 2IO2C 1DCQA 4UQYA 3L82A 1QNFA 5J08A 3V2OA 5CRVA 1RMVA 3K66A 1C17M 3D9NA 3AJMA 2KC3A 3RYLA 1I4ZA 2ZD9A 2P9IG 3EUVA 3FU5A 3FTVA 3CQZA 3O10A 3IKOB 3DSTA 2WQ6A 3DXMG 3E9VA 5C1DA 5A6BA 3IPMO 4U5EE 4ZLCA 4I6GA 4H7YA 2KQ9A 4ME2A 2PNOA 3DM5A 3QAQA 4MS2A 1NFIE 1ZU2A 2LCHA 3LS1A 2R03A 3K33A 4YL3A 1OQCA 4B8AA 5COMA 2GA0A 4DJ9A 4AOFA 4MKTA 2UY1A 2YL1A 4DOZA 4B0ZA 2OU6A 3S29A 3DE9A 3FUFA 1Y6DA 3Q15A 1DOWA 2HZ8A 4N2QA 2OKUA 2AVPA 2WXHA 2UUIA 2BF0X 4K1OA 2KNHA 1TJCA 2FAPB 3RQFA 3D9KA 4L1BA 2VSYA 5F5HA 1T01A 3FP3A 3Q47B 2X0CA 1OKKA 4YK5A 2LSVA 4XZ4A 4QFVA 3K1IA 4JVSA 1GQAA 1UG7A 2DB4A 2PM7A 1LPEA 3LUTB 3SQVA 2JEKA 4EBAG 3TXMA 3LLKA 4U9EA 4DX6D 2WB2A 3V31A 4OAUC 3DM9B 1H9GA 2Y3DA 3NYMA 4ATGA 3JSEO 3EJNA 4NY3A 2LAHA 4OINF 3AS5A 2Y3BA 1ZU4A 1JUQA 4PS8A 4EZJA 2PQNA 3GM3A 1HW1A 2GRLA 1VB5A 3EFOB 4LEUA 2C03A 4XQ1A 5KYXA 3EG9A 2IOQA 3SHFA 1NP7A 3N0TA 4A3VA 5LCWC 3KYIA 4AM9A 2NUPA 4U5FE 3ZYLA 4F1PA 2QNLA 1E86A 1ELKA 5EILA 2RSEB 3PREA 5L3QA 1E8YA 4WUYA 5KBAA 2JABA 3LY8A 1Q0KA 3G2UA 4Q5SF 1FR0A 4FLBA 2A0BA 1VYKA 4OIRF 2CYDA 5G04C 2KC7A 2XL4A 3R9AB 5JHAA 3X2QE 1RKEB 1JR8A 2P9LG 3MYFA 2I6HA 3RAUA 3GZSA 4A4AA 1G3NB 5BXOA 2FULA 5FCLA 4IYPA 1TNBA 3LNRA 4W8PA 3LKUA 5E75A 3RFYA 2AJAA 4GZDA 1Z5ZA 1C03A 1MJ0A 2R7TA 3S7JA 1OXKA 1JCRA 2H7OA 2UY1B 1YZAA 4LDRA 5FZTA 4E7ZA 1XNFA 2A4ZA 5A6KA 1MQVA 2XS8A 3U64A 3CSTA 2RG8A 3C8GA 2J9UA 3E4BA 3FUKA 1UJJA 4NTBA 4OIQF 2WXRA 4MRUA 5KYUB 4BJ5C 3P1UA 3C62A 5AARA 4F6RD 5ENRD 1BR4A 1TWGA 2LQGA 2TMVP 1IQUA 1OCCC 3IQ5A 3QB2A 1WY6A 2XLVA 3T6BA 2EPLX 3BQOA 1SR2A 3FUIA 4EZKA 4WABA 2W4BA 3NOCD 1M2OA 4DUIA 4Z9JA 4WWNA 3UI2A 3CQGB 3Q49B 3PZ4A 3FULA 4BTAA 5GPGB 4Z9IA 3ABKE 3RQGA 3ASHA 4ANXA 3GM2A 3SY2A 2J0XA 3E33A 2H6HA 2VH3A 4KBLA 2XRHA 4MVZA 1ORJA 3QVYA 5COGA 2WXGA 3TJ6A 5FWQA 1ZU5A 1HX8A 3I4RB 1Z7Qc 1L3PA 3RRNB 1HFAA 3RJVA 4BT9A 4E7SA 5HKPA 2XLMA 2XHEA 4I2ZA 2Y39A 4JA7A 3HLZA 4E6HA 4YT2A 4FC8A 2V0PA 4QI2A 3UT7A 5CI8A 4UI9K 2WXJA 3QW1A 3S9OA 4UWFA 3FDQA 2OG2A 2ETSA 4O7GA 3PS6A 1FTSA 1LM3B 3G2SA 1HH8A 2OVFA 4GA2A 4BEPA 4FHJA 5JA4D 3NMJA 3PCVA 4U0SA 4BFRA 5LFAA 3GW4A 4TRQA 3LCAA 4L6RA 4XEKA 5AN8A 3SXKA 2CFUA 2DIWA 1EA8A 2H6GA 4LLCA 3ZGQA 3B7UX 1N4QA 3U8PA 5AQAA 2YHCA 4MVSA 2QC9A 5CI9A 1LI5A 2LXMA 3AS4A 5JS5A 1I5NA 2LP4A 1TEZA 3HNJA 2GROB 1YDIA 1N4SA 2F8YA 2L0TB 4CYMD 4F4BA 2D4UA 1U2VG 1QYMA 2WXMA 2OOEA 1TFKB 1ZHTA 1U3CA 3QJZA 3HXFA 4AL1A 5AQ7A 4CDYA 3G2TA 3Q4AB 2HYZA 1H0AA 1YMPA 3CVPA 4J8EA 1N4PA 4EPZA 3ATPA 4U5DE 5BV1A 5BQGA 3Q6MA 1JAFA 3CZ6A 2AWYA 1V54C 2Y0BG 2EILE 2XS1A 3NBNB 3T8MA 1TNUA 2I2OA 3CK9A 1FMVA 4KZCA 3JYHA 3QOUA 1WATA 2R7UA 5AAOA 3CK8A 4LG6A 1JMWA 1YYXA 2YHSA 4XPYA 3AOUA 5FZSA 5BUOA 4ANVA 1LVKA 2HMZA 1A41A 3HDXA 1IHGA 5KYYB 3FUEA 4G7HF 3B0PA 1SA5A 2V26A 4DBRA 5FZRA 3RSEG 3ZXPA 3JXJA 2GAQA 1TJFA 3SF4A 2A69F 1SMYF 3ZW3A 4I9EA 4H4KC 3FEXA 2X6HA 3KS2A 1K05A 3ZIMA 3ZIBA 1TFOB 3ZN3A 3MJWA 3PDNA 5L0FA 2QE9A 3MYIA 4DVZA 1SZIA 4HOUA 2GFHA 2CNWA 5A7DB 1IXVA 1NL4A 1CPQA 1LIHA 1I4YA 3ASDA 4MVOA 1ZYRF 2IQCA 1EF1C 2HR2A 3DEOA 2NC9A 1AP7A 1OKKD 1T9KA 2L9JA 5JSLA 3Q6NA 3AGTA 2YEVA 5KJNA 4KT6B 1BZ4A 1BBHA 2IEJA 4B94A 3FY4A 3ULYA 3UPVA 4ATZD 2L6HA 3SFYA 1HW2A 2C0MA 4HRNA 4A63B 3FH5A 1M2VB 4J8FA 4LNBA 4CGVA 5M72A 1TN8A 3OXLA 3DWLG 1HE9A 2EPOA 1SF8A 5AQ9A 5JJ6A 4GCOA 3EG9B 4GTMA 3LPZA 4JPSA 1E7VA 4BETA 3EIQC 3RIPA 3MCXA 3H2VA 4BJ5A 3BRJA 4AXHA 3M4CA 2YQ8A 4P9TA 1S70B 1SQMA 4RQIA 1MNDA 3HNKA 5G04J 3M1CB 4JEHA 4APOA 4N39A 2DI3A 4GEHA 1E8ZA 3FHEA 3QWWA 2HS5A 2C04A 4MVMA 4RD9A 2VC9A 3E30A 4LNGA 3FMSA 3UINC 1O3UA 1Q0GA 4I6EA 2FFHA 3ASNC 3ABLE 2IXOA 1V55C 2XL8A 3QVZA 3GYZA 2YWAA 4JZAA 2HJMA 4Y6CA 3ZVRA 1Z3IX 4G26A 1ZHXA 3ZHEA 5E3CA 3NG1A 4I2WA 3U2LA 3C8ZA 2CFZA 1MMGA 3O6XA 3OXFA 3DSXA 3E34A 3ML9A 3Q9UC 2MYSA 4PJLA 3CHMA 2V4HC 3FAJA 1JWGA 3PDMP 1TYQG 3UMHA 3AG3E 3PEUB 2IFUA 3JYSA 3S7DA 4CEMA 5H7PA 1QVXA 2Q00A 3CHOA 4DI4A 3S7FA 1N11A 1V54E 1NSGB 1K1AA 2KYHA 5EX3A 1VLSA 3C72A 4AK9A 3EZHA 1UN8A 3CVNA 3EIJA 1D1CA 1YAUO 4WNDA 4U5HA 1LKXA 1G8XA 2EILC 5F28E 4UDVA 4DRIB 1RZ4A 4KNVA 4WWPA 4BTBA 3JYYA 1SYQA 2AXVA 5LOZA 1JPLA 3TG5A 3IQ6A 4JHRA 4I3MA 1BLXB 3KL4A 5DQZA 1LD7A 2JD3A 2NPUA 5LX8A 1QPUA 2KCLA 1CPRA 2GRRB 5AGFA 2Y3GA 3ZKJA 4J0UA 2W45A 2ILRA 3B7SA 4XI9A 2XPIA 4OYSA 3ZFWA 3ZQYA 2XXAB 2J9QA 3SZRA 4L23A 4MTOA 2BC5A 3Q78A 4CIHA 2NSFA 3GEEA 3UGPA 4JEAA 4LRZA 1A5EA 4UWGA 5ENQD 5G2NA 1ZW3A 3CKBA 5DS4A 3O55A 4G1TA 4O1PA 1U89A 4KVMA 3FU6A 2XM0A 3GORA 1XWJA 1MMDA 4YT8A 3S2AA 1NFOA 1RKCA 1NA3A 3IV0A 4TUMA 2L6BA 3X2QC 2NXPA 1OCZC 2WZLA 2OCCC 1N0RA 5JT4A 1IYGA 4APFA 3IHYA 3E32A 1ZW2A 3CHQA 2W9YA 5EHHA 2J0WA 5F5FA 1KLXA 2QYUA 2XRYA 5IY5C 3PEVB 3DD7A 1WASA 5BUZA 2EPKX 4HOTA 1H9TA 3EGXB 1M56C 4GA1A 3UIPC 3A11A 4G78A 3ASFA 3KAEA 3LY9A 3Q7FA 2OQMA 4O6FA 4ILIA 4NURA 2R7WA 4G2VA 4N3AA 3CVUA 2WVOA 3FOPA 1SA4A 3VLEA 3TJ5A 5ANLA 1NBBA 1K3ZD 3M79A 1CGNA 4FAPB 1FFHA 3AQCA 1VDYA 1L7CA 3QKYA 4NCQA 4YL0A 4G0HA 5FJYA 1NG1A 2E87A 5B1AC 2PBEA 4CDMA 3EGDB 1D9SA 3ZRHA 4RBNA 3TGOA 3CLJA 4LUNU 2EIJC 4XLNF 3UKUG 1TWHA 3K1HA 1IQRA 4IB4A 4EWCA 2XL6A 2V8SE 3ECSA 3L22A 2R7XA 1VTMP 4BSXA 2MWQA 1OXBA 4Z68A 2XXAA 3HIZA 4BEJA 4GYTA 3NDBB 1SZAA 2WPVA 3EGXA 4EECA 3MYVA 2P1AA 4PK4A 3UIOC 2XGSA 2H7VC 2M63A 2R05A 3APDA 1BPOA 3PZ2A 2L7AA 2NYJA 1HU3A 3GWLA 2VYIA 4Z9HA 3KD7A 4CT4A 2LO6A 3HKKA 2E0IA 4QQIA 2Q9AA 2RFMA 4JCHA 4CRWA 4UI9C 3PUKA 1NU9C 2XLOA 4MTFA 2J07A 4G8KA 4CS9C 4O1OA 4KZ0A 4N6HA 3Q9NC 5T3TA 4G8LA 2P9NG 4WNFA 2RD9A 1PCXA 3CVLA 1K8KG 3IEGA 2YLIA 1DNPA 2YL0A 2J4DA 4BY6A 2GWWA 1YLMA 4A2NB 4GMLA 1FT1A 2A5UA 3LJBA 3RKVA 3WG7C 4O79A 1O1TA 4PACA 2I8BA 3JTLO 4HE8D 1E90A 1E8XA 2IYLD 2EIJE 2BTDA 2QTVA 4N4WA 3LEOA 3CQCB 5B3IA 5EKQD 2CNWD 5A23A 2ZGGA 5JJTA 4P6IC 1UJKA 3FUJA 3UTMA 3CVYA 1H6KA 1M2VA 3WODF 1ZHZA 2LSEA 3DXJF 1YA7O 1H2VC 1APCA 2WM9A 3KKBA 2CHZA 2IF4A 5DVWA 1O5MA 4JC8A 4PDXA 5B1BC 3CK7A 3DBSA 3CIAA 3PNTB 1WAO1 2FEZA 1DVPA 4CDNA 2ZISA 2ZU6B 5CMWA 4MS6A 4HRMB 1Y8MA 4PJJA 2E2EA 1QBQA 1E7UA 3IEEA 3NF1A 3L0IA 5CEDB 4CJGA 4FWVA 1E83A 2ASRA 1FT2A 4MLPA 4Q69A 4XLPF 3C8GD 5KYUA 3WG7E 1ZZPA 3K1IC 2IXNA 3LS0A 1SW6A 1FAPB 2YNQA 3MGBA 4GZ6A 4U0ZA 4NIKA 1FNTc 1Q0FA 2P9PG 2ZPAA 3NOGD 3V5YA 4JJGA 4MVRA 3UKRG 1CGME 4DLQA 5KJKA 3VLFA 1BI8B 2EQXA 3LEVA 3T9KA 3U0CA 1AVOB 4J8DA 2ZXWC 2XPZA 1N95A 2XLEA 3HXEA 4H7XA 2GW1A 5E3AA 1LS4A 3SGHA 2HM8A 4LDKA 4HBDA 4U07A 2P2CP 5JP7A 4LLEA 2LNIA 2Q4FA 5A6JA 4FHKA 3CHSA 3LVRE 1KZPA 3FUMA 2H6FA 5ITZF 4GB9A 2G3VA 2IU1A 3LJ3A 4IULA 3SYNA 4C0EA 2Z15A 3Q7LA 1NZNA 4XWJA 3GEHA 4JIOA 4AL0A 1UN9A 2VGXB 3ABMC 4CS9A 3ZPJA 4I1AA 4GTRA 3U3FA 1FVHA 4JEBA 3W2WA 2V5FA 5EN5D 2X38A 3LYAA 3UNGC 1O5HA 2WVIA 1UFBA 1RCPA 3HYMB 3NKDA 2CGEA 3NYJA 2Y4TA 5L0HA 4EHMA 5LCWJ 1XZQA 4U04A 4IGGA 3VRCA 1J8MF 4CZ2D 1K1BA 3FTYA 3DPYA 2LK4A 3CKCA 3G2WA 2R9RB 4NRHB 2HV7A 3UM0A 2EIKE 4U5CE 3JZ0A 4DRHB 4DK5A 3ZG1A 1OW6A 4KBQA 3PVLA 2A0UA 2J8WA 2CHWA 2W4MA 3KMIA 1N4RA 2UWJG 3SBSA 4D10C 3DWWA 3U8VA 4JTCB 4GTTA 5HRYA 1QSPA 2YQYA 2WXOA 2NUPB 1MHQA 4E17A 2YVKA 1S64A 4JTDB 4E0IA 3B13A 3S7BA 3GANA 4F3VA 1JPJA 2KBXA 3DPDA 1WWPA 3EQLF 3S27A 2Y69C 5JHBA 2QLAA 5AENA 2XEVA 4UWHA 5A69A 4BPMA 2HFIA 4J6IA 4Q96A 4B8CB 4JA9A 4OD5A 4N6CA 2YZSA 4BERA 4YT5A 2F37A 4KC9A 3BEHA 4HRLA 3NB2A 2P9UG 1T5OA 4GU5A 2YLGA 2ZXOA 3S28A 2HUJA 3JQ0A 4J30B 1OWPA 4HNAD 4M7CA 3N2ZB 5FQ7A 3RU0A 3D3MA 3URZA 1HS6A 1WGWA 3DSWA 3M15A 4EKWA 3I4UA 2DCPA 4HI8A 2AP3A 4A55A 2L0IA 3B0VC 4CCAA 3KPHA 1KTMA 1Q0MA 3TULA 3AU4A 2RFAA 3VLDA 5DS5A 3C7JA 4PUCA 5FINA 5FZQA 4GTVA 1D0YA 4AP2A 4C3DA 2JLBA 3NRHA 1FVFA 2I15A 3EHMA 4XTKA 4BEMJ 3CVXA 5BQHA 3CHRA 4KNWA 3B7RL 3FOOA 3MV3B 3QTHA 3Q73A 1Z6TA 3T4RA 3FH7A 3T5VA 1KZOA 3B29A 2WB7A 1A7VA 3CSKA 4IAOA 2WXLA 2Q7FA 2KSFA 2PF4E 1TWCA 4GMJA 2J9BA 1NZEA 1EKYA 1T6IA 3F46A 4ZHBA 3MKQB 3RO2A 4YDYA 3ASOE 2PFDA 1UG3A 4AY5A 2VSNA 3FUNA 2FBNA 3SFXA 2QUPA 2A6HF 1MYOA 4K03A 1HY5A 3B71A 4AE4A 4HFKB 2EINC 2X6IA 2VGEA 2PX3A 2WXIA 4FESA 3T6JA 2CDQA 4HORA 2PQRA 3KSLA 3ZQVA 4I44A 3W2VA 5CIVA 4U8VD 2MHRA 2ZIRA 3C3RA 5B1AE 3FFLA 2Y3AA 2ETAA 1OCCE 2HO1A 4K0DA 3ABME 4DPRA 4HEAJ 2CW0F 3NMIA 4BJ1A 2M64A 3NZSA 3T6GB 3LXUX 2DZOA 3ZXSA 4U8YD 1ZBPA 3O48A 5HQ8A 1SZ9A 2R7SA 3SXZA 3RRUA 3TOLA 3G50A 1A17A 4UWKA 3MKQA 1Z3XA 3W9FA 2QY7A 1K40A 3L16A 1HE8A 4GZCA 2QYJA 4TXPA 3OXGA 4ZFHA 2XZTG 1WG0A 4C3BA 3WHNA 5ENPD 1G4WR 3C3QA 3JRMO 2DGJA 2ZGDA 3LAYA 1NFNA 5JRAA 4G11A 5JVEA 4ANWA 4J8SA 2I9CA 2MOWA 3LESA 4L7TA 3H2UA 2YLDA 1B89A 3VTXA 1NLXA 1IKND 5FT9A 2DBAA 3J5QB 1Y4CA 2AXZA 1OWMA 5ENTD 3KYJA 1GW6A 4HVBA 4OD4A 2YHEA 4EBKA 1S63A 3TAXA 4AV7A 3B0UX 4MTGA 1YZCA 2V3CC 1MX6A 5FQ8A 5ARGA 5AJDA 3UMIA 5AC4A 1RXQA 1T6QA 4GAAA 1XZPA 3G4ZA 1AUEA 3HVEA 3JUIA 4Q4ZF 2WQ7A 2YL3A 1OUVA 4QDLA 4PS3A 1WN0A 4CIPA 3MX3A 3UM1A 1W2WA 2X6KA 3W4YA 1D1BA 1YVIA 3DAGA 2J9VA 3U5SA 1OCOC 4BG0A 3RK6A 3KEAA 1INZA 3AAAC 2A5EA 4U8HA 5FQ4A 4CS8A 5L0JA 5JLIA 1M57C 5KCMA 5T8IA 3QWPA 2NUTB 1A7DA 3UT8A 1VYIA 2R7QA 2YL7A 4JJFA 2FGYA 2XGMA 3KH2A 5DIZA 3JT1A 4U9DA 1JCQA 2BUGA 2WMOA 2EINE 3FU3A 4ACKA 1QKRA 2HKVA 4G23A 3ESKA 2QFCA 4JHKA 3DE8A 4LDQA 1UOHA 3L34A 3JXIA 3ZEFA 1H6GA 4RSYA 4C3EA 4JHJA 4DX1A 4X8QA 1OCRC 3HTKC 5B3SC 1WDYA 4GYWA 4ONSA 4W8KA 3L1MA 1BR1A 3HJCA 3UR3C 2X6JA 2IONA 2R17C 5DBKA 5AJLA 5E2QA 4IARA 3GZ1A 1Q0DA 2KZTB 3V7OA 3J5PA 5ANRA 1H7IA 1BDJB 2X51A 3LDZA 4YWQA 1KT0A 2X3MA 4FADA 4Q94A 2HSBA 4AX2A 2BKGA 3VF0A 4FJZA 4YVQC 2MHKA 3OA1A 4URKA 2WXKA 5D2MC 4FA6A 2RD0A 3L8IA 1TQGA 1E96B 3VAYA 3DI5A 5DLJA 1OCZE 4I43A 1TR4A 2P0NA 5B3SE 2V4LA 3MA5A 1O1SA 1VMAA 3CEQA 1GM5A 4TV3A 4EZLA 3ZTMA 2KM4A 4R7LA 2GRPB 2J7PD 1D1AA 5D0OD 1D8EA 3FEYA 4XEIG 4K5AB 4XX5A 1R4TA 4GQHA 2GRNB 2XEHA 3L17A 5JJ7A 3HNIA 4E18A 3UM2A 3CVVA 3V5ZA 2UUHA 4W9RA 4NTFA 3EPVA 1VLTA 3KSQA 1S7ZA 4FU3A 1S05A 3CAXA 3LNMB 1OCOE 3D9IA 3PZ1A 5FIOA 1A7EA 5G55A 1G5ZA 1H6OA 1HZ4A 5KYNA 3FTZA 4C7OB 2AXUA 1MNEA 4PR9A 4KYOB 5KYXB 4HQDA 4O6MA 2VQ2A 1HG2A 4G7ZF 3DAFA 1S0PA 3JSZA 4CS7A 3GM1A 2ZXPA 2NG1A 3IXEA 1YYJA 4P9FA 3TK0A 3FDHA 1FMWA 2OCCE 4HOQA 3DSUA 5BXUA 1MMAA 4BJ6C 5BW8C 3OWTA 2L6JA 1E84A 2XLWA 2VJ8A 3SXYA 3D9LA 1RW2A 2Q7RA 1TN6A 4JB8P 4PS7A 1EQ1A 3ISMC 4JD2G 2IY0C 1LE4A 4MBGA 2PP4A 2HSQA 2XEEA 3BG1B 2IOSA 4RG9A 1MQSA 3TWWA 5IY5E 3MZLB 3SZ7A 5A6CA 3DKAA 4BJTA 3OEOA 4OVUA 1E2XA 2HV6A 4WNEA 1ST6A 4JXTA 4CSAA 5CMYA 2KGOA 2VASA 2QZAA 4JZYA 3S0XA 3SBTB 2I1JA 2G62A 2VSOE 2YKZA 1OCRE 3ULEG 4WAFA 3ABLC 3E70C 2GRMA 3ASNE 1V74B 3C98A 3HXBA 4GA0A 3ZC4A 2ZXRA 2NUTA 4ULVA 2H6IA 1OWOA 3FUHA 5LP0A 2MYOA 1OY3D 5T3WA 5D91A 2QY9A 4NC3A 5A6AA 3SNHA 3E37A 1JRAA 1PD1A 2R25A 2C2LA 2IBFA 4GTSA 3ENEA 2Y1LE 2ETCA 4ANUA 4WGYA 3UMKA 3SNXA 4UI9J 2Q9BA 2OEWA 4B93B 3S84A 1Z23A 2WXPA 3VTYA 4DJAA 5EIDA 5HI7A 3DRAA 2WXFA 3EDTB 4ANJA 2IJGX 4IN3B 2ZXWE 2IOLA 1YA9A 3R7CA 2PL2A 3L54A 2WL8A 3FWVA 5KJLA 5D66A 3AGUA 1KU2A 4CDAA 3GEIA 4GCNA 1Z3YA 3TWTA 1YYHA 4P29A 2OEVA 4GTOA 2R02A 3EFOA 3NAWA 2OVBA 4C9BB 1HO8A 2H7BA 3TOMA 3NMKA 2OEXA 2VCAA 4O6YA 1OW7A 4D4XA 1V55E 3PE3A 3SO8A 4EBAA 1CGOA 1BU9A 4DVYP 3W9GA 5EK0A 3QZCA 3V79K 3SI5A 5HSWA 1ZHWA 1KNYA 3U9WA 4HFGA 3UX4A 3V30A 3PH0C 2XRZA 1MMNA 3U9JA 4EUKB 5B1BE 3C5RA 3L08A 1LTXA 2FO7A 2XLDA 3ONKA 3RIBA 3FTWA 3RH3A 1D0ZA 4V3IA 4YDOA 4AIFA 4XIFA 4H54A 1TNYA 2HMQA 2A6EF 5L0GA 2WVNA 3B95A 3GWNA 4NTAA 3ML8A 4G25A 3IQTA 4DRJB 3FU0A 3Q75A 2BEDA 2Q9CA 5ENSD 4AE4B 3LLIA 1TKNA 3K9IA 3JRTA 2Y69E 1EPUA 3MV2B 4ACLA 5KJMA 2HE0A 4UUCA 2B0JA 1MZCA 1ORSC 3MLGA 1TR2A 4IAQA 3QW0A 3R7QA 2KXPC 3RVYA 5C2YA 3I5QA 5ENNA 4AEZC 2IXMA 3ASOC 3O39A 3ZWIA 1O87A 3DEPA 3Q7AA 1YARO 4A1SA 3TJPA 4Q7CA 4PFOA 2KZTA 5CRUA 5EYPF 4MQ9F 1IHBA 3ASGA 3BU8A 3CR3A 3N24A 4AJWA 3TWXA 4YVOA 4N2SA 4MW3A
chains in the Genus database with same CATH topology
4TUUA 3KEZA 3UGOA 4K7BA 4Y6WA 2A68F 2R5SA 1Z6AA 2I1KA 3ONLA 2O9XA 3TL5A 2J46A 5T4YA 3R7RA 1Y6IA 1W3BA 3QWVA 2VSXE 2VGYA 4F1SA 1EDUA 3FTUA 4CT0A 2R7VA 5BV0A 4OIPF 1P5QA 3ULQA 3T5XA 3ESLA 3TXNA 2CG2A 2KW3C 4CSAC 4BWRA 4AY6A 3U4TA 3JCUQ 2WMNA 1PY1A 4IJJA 3ABKC 1LS1A 4L2YA 5BNWA 1WM5A 3PNLB 3EH2A 4CBEA 4ABNA 3RRMB 2XSEA 1N54A 3D9OA 3L6AA 4WWOA 3APFA 1BR2A 5FTPA 4G24A 2VTBB 3SP1A 2LAIA 3FTXA 1QLEC 4I9CA 2FI7A 3FVYA 3I4GA 2M4EA 5CCLA 3N71A 3VYWA 4C0MA 3MEKA 2XCCA 5KYWB 3CGHA 4EQFA 3K7DA 4F53A 2KCKA 3PE4A 3Q5MA 3LEWA 3CVQA 4FP7A 3ZHEB 4KVOA 4GZ5A 4AVXA 4UWLA 3D9PA 4FJYA 1E8WA 2CG3A 4FULA 4PFPA 3G2VA 4GYYA 3UQ3A 1TWAA 3PRZA 4XI0A 2Q3TA 2A1DD 3FUDA 2DYSC 4JURI 4ILGA 4ZLDA 2J49A 3AG4C 4PJMA 3EHNA 4FX5A 1OWNA 4GYOA 3AU5A 1PD0A 4KI2A 3AS8A 2NSZA 2R7OA 3LVQE 5EDSA 2L9BA 3SFZA 2KATA 3EZIA 3P2BA 4MNDA 5ARFA 3GZ2A 3QDNA 3UUXA 3IBEA 4BJ6A 3CSFA 3BEEA 4HOSA 4N5CA 3PZDA 4IWBA 4XKCA 4I17A 1VK5A 3CHPA 2Y4UA 4LERA 4X0RA 2C0LA 5J90A 4DBQA 5E33A 3WXXA 3ZYKA 3I5PA 2PZIA 3PHF2 1U3DA 3DZAA 4HXIA 4NACA 3ZSUA 5AYWD 4XE0A 2PX0A 3NKEA 4WJ0A 2J4BA 5G05J 1HXIA 2J45A 4YN0B 3OTNA 3OAWA 3QMKA 5D0QD 3X1OA 2VGXA 5FQ6A 1ELWA 3DJNB 1ZHYA 5KYWA 1N1CA 4PH4B 4WNGA 5D92A 3LS8A 2WVQA 4LCTA 4UQZA 3U66A 4F7AA 1PC2A 2XCBA 5CCMA 2AWIA 3UMVA 2J08A 4RVBA 1KT1A 4XKBA 1ELRA 4ILHB 2XPYA 2R59A 4JW1A 4M63A 1Z63A 1QQEA 4I1OB 2P7VA 3L13A 4OIOF 3FTSA 4BX9A 4JL0A 2CHXA 3AG3C 4K0RA 3HVEB 3DJUB 4J32B 4G7OF 3FHDA 5DQTA 5E76A 2KCVA 4M3OA 3ITFA 2WXNA 2WQHA 1RJ9B 4CGWA 2J09A 3TG4A 1IZMA 3TD7A 1QZ2A 5T1DB 3PUJA 5BT1A 1LF8A 3RKOF 2PM6A 3GODA 2VB6A 2EIMC 4PJNA 3F47A 1HG5A 1YA0A 3B9QA 3ZYQA 1FCHA 4YNDA 4HFFB 2VTBA 4YJWA 4YT4A 2MRIA 3I3NA 3MKRA 3NQPA 3H65A 3ZYMA 1UW4B 3SD5A 1X5BA 4GPKA 1IW7F 3K6BA 3AQBA 5KYYA 3BG0B 4RG6A 1NU7D 4A1GA 2WZFA 2D5RB 1XGWA 4DI3A 1H2TC 2J7PA 2XQ0A 4CDRA 1OWLA 1N52A 3QK0A 1H2UA 5CHEE 3JCKC 4EBBA 4BX8A 4E85A 3B7TA 4U63A 3W8HA 3JQ1A 4KXKB 2P6VA 3EH1A 4NQ0A 4BT8A 4I6JA 3AG1C 4A3TA 2YINA 3QARA 3PMRA 4LACB 4QI0A 4CS8C 3AG2C 2LSUA 2XGOA 4B6IA 4N06A 2OV8A 4N3CA 4U5GA 4B89A 3LY7A 2KJGA 2EIKC 3D9MA 3W8IA 1L5JA 3D9JA 4DLOA 1NA0A 3QC1A 4C7OA 4HLEA 2P58C 4JEUA 2R7RA 4HS2A 3HHMA 4UQXA 3RO3A 4N3BA 2WXQA 4L2LA 3APCA 3NZUA 1RJ9A 1J8YF 1JPNA 3NYLA 5G05C 2G3KA 4RDAA 2DYRC 1PAQA 3U3WA 2Y3HA 3EGDA 2X6FA 2WZGA 2ONDA 3POVA 4GZ3A 5BPPA 5EX0A 5DS6A 2IXPA 2GGFA 2FF4A 3CVWA 1QZXA 2L81A 1EYHA 1D0XA 5T3RA 3Q7GA 5AIJA 4KMOA 2J9WA 1FFTC 1HF8A 3QNKA 5L3VA 3UT4A 3O4ZA 1VOMA 3SEOA 4U5BE 4IRUA 3CV0A 4O6NA 4OVVA 3DMDA 3IHVA 4FLHA 4U0UA 4I1MA 3ZVVA 3FH8A 4ULWA 2AW6A 2BE5F 1JWFA 5EGYA 1H19A 4UQYA 1QNFA 5J08A 3K66A 3D9NA 3RYLA 3FU5A 3FTVA 3CQZA 3IKOB 2WQ6A 3E9VA 5C1DA 4U5EE 4ZLCA 4I6GA 4H7YA 2KQ9A 4ME2A 3DM5A 3QAQA 1ZU2A 3LS1A 3K33A 4B8AA 4AOFA 4MKTA 2UY1A 4DOZA 4B0ZA 3S29A 3FUFA 3Q15A 4N2QA 2AVPA 2WXHA 2BF0X 1TJCA 2KNHA 3D9KA 4L1BA 2VSYA 5F5HA 3FP3A 3Q47B 1OKKA 2LSVA 4XZ4A 4QFVA 4JVSA 2PM7A 2JEKA 4EBAG 3TXMA 3LLKA 2WB2A 3DM9B 2Y3DA 3NYMA 4ATGA 3EJNA 4NY3A 2LAHA 4OINF 3AS5A 2Y3BA 1ZU4A 1JUQA 4PS8A 4EZJA 2PQNA 2GRLA 3EFOB 4LEUA 2C03A 5KYXA 3EG9A 2IOQA 3SHFA 1NP7A 3N0TA 4A3VA 5LCWC 4AM9A 2NUPA 4U5FE 3ZYLA 1ELKA 3PREA 5L3QA 1E8YA 4WUYA 3LY8A 3G2UA 4Q5SF 4FLBA 4OIRF 1VYKA 5G04C 2KC7A 2XL4A 3R9AB 5JHAA 2I6HA 3GZSA 2FULA 5FCLA 4IYPA 3LNRA 3LKUA 5E75A 3RFYA 4GZDA 1Z5ZA 2R7TA 3S7JA 2H7OA 2UY1B 4E7ZA 2A4ZA 1XNFA 3U64A 3CSTA 2RG8A 2J9UA 3E4BA 3FUKA 1UJJA 4OIQF 2WXRA 4MRUA 5KYUB 4BJ5C 3P1UA 1BR4A 1TWGA 1IQUA 1OCCC 3QB2A 1WY6A 3T6BA 3FUIA 4EZKA 2W4BA 1M2OA 4WWNA 3CQGB 3Q49B 3FULA 4BTAA 3ASHA 4ANXA 2J0XA 2VH3A 4KBLA 2XRHA 2WXGA 5FWQA 1ZU5A 1HX8A 3I4RB 3RRNB 1HFAA 3RJVA 4BT9A 4E7SA 2XHEA 4I2ZA 2Y39A 4JA7A 3HLZA 4E6HA 4YT2A 4FC8A 2V0PA 4QI2A 3UT7A 5CI8A 4UI9K 2WXJA 4UWFA 3FDQA 2OG2A 4O7GA 3PS6A 1FTSA 3G2SA 1HH8A 2OVFA 4GA2A 4FHJA 4U0SA 4BFRA 5LFAA 3GW4A 4TRQA 3LCAA 2CFUA 2DIWA 4LLCA 3ZGQA 3B7UX 2YHCA 5CI9A 3AS4A 1TEZA 2L0TB 4F4BA 2WXMA 2OOEA 1ZHTA 1U3CA 3QJZA 3G2TA 3Q4AB 2HYZA 1H0AA 3CVPA 4J8EA 4EPZA 4U5DE 5BV1A 3Q6MA 3CZ6A 1V54C 3T8MA 2I2OA 3CK9A 1FMVA 4KZCA 3JYHA 3QOUA 2R7UA 3CK8A 2YHSA 5FZSA 5BUOA 4ANVA 1LVKA 3HDXA 1IHGA 5KYYB 3FUEA 4G7HF 3B0PA 2V26A 4DBRA 5FZRA 1TJFA 3SF4A 2A69F 1SMYF 3ZW3A 4I9EA 4H4KC 3FEXA 2X6HA 3KS2A 3ZIMA 3ZIBA 3ZN3A 3MJWA 3PDNA 4DVZA 1SZIA 4HOUA 2GFHA 2CNWA 5A7DB 3ASDA 1ZYRF 2IQCA 1EF1C 2HR2A 2NC9A 1OKKD 2L9JA 3Q6NA 2YEVA 5KJNA 4KT6B 4B94A 3FY4A 3UPVA 2C0MA 3FH5A 1M2VB 4J8FA 4CGVA 5M72A 3OXLA 1SF8A 5JJ6A 4GCOA 3EG9B 3LPZA 4JPSA 1E7VA 3EIQC 3RIPA 3MCXA 4BJ5A 4AXHA 2YQ8A 1SQMA 1MNDA 5G04J 3M1CB 4JEHA 4APOA 4N39A 3FHEA 4GEHA 1E8ZA 3QWWA 2C04A 4RD9A 4I6EA 2FFHA 3ASNC 2IXOA 1V55C 3GYZA 4JZAA 4Y6CA 3ZVRA 1Z3IX 4G26A 1ZHXA 3ZHEA 5E3CA 3NG1A 4I2WA 2CFZA 1MMGA 3O6XA 3OXFA 3ML9A 2MYSA 4PJLA 3CHMA 3FAJA 1JWGA 3UMHA 3PEUB 2IFUA 3JYSA 3S7DA 4CEMA 3CHOA 4DI4A 3S7FA 5EX3A 4AK9A 3EZHA 1UN8A 3CVNA 3EIJA 1D1CA 4WNDA 4U5HA 1LKXA 1G8XA 2EILC 4KNVA 4WWPA 4BTBA 2AXVA 5LOZA 1JPLA 3TG5A 4JHRA 4I3MA 3KL4A 5DQZA 2JD3A 5LX8A 2KCLA 2Y3GA 4J0UA 2W45A 2ILRA 3B7SA 4XI9A 2XPIA 4OYSA 3ZFWA 2XXAB 2J9QA 3SZRA 4L23A 4CIHA 3UGPA 4LRZA 4UWGA 5G2NA 3CKBA 5DS4A 4G1TA 4KVMA 3FU6A 1MMDA 4YT8A 3S2AA 1NA3A 3IV0A 3X2QC 2NXPA 1OCZC 2WZLA 2OCCC 1IYGA 4APFA 3IHYA 3CHQA 2W9YA 5EHHA 2J0WA 5F5FA 1KLXA 2XRYA 5IY5C 3PEVB 3DD7A 5BUZA 4HOTA 3EGXB 1M56C 4GA1A 3ASFA 3KAEA 3LY9A 4O6FA 4ILIA 4NURA 2R7WA 4G2VA 4N3AA 3CVUA 2WVOA 3VLEA 5ANLA 1FFHA 3AQCA 1VDYA 3QKYA 4G0HA 5FJYA 1NG1A 2E87A 5B1AC 4CDMA 3EGDB 3ZRHA 4RBNA 3TGOA 3CLJA 4LUNU 2EIJC 4XLNF 1TWHA 3K1HA 1IQRA 4EWCA 2V8SE 3ECSA 3L22A 2R7XA 4BSXA 2MWQA 2XXAA 3HIZA 4BEJA 4GYTA 3NDBB 1SZAA 2WPVA 3EGXA 4EECA 3MYVA 4PK4A 2XGSA 2H7VC 2M63A 3APDA 1BPOA 1HU3A 2VYIA 3KD7A 4CT4A 2LO6A 2E0IA 2Q9AA 4JCHA 4CRWA 4UI9C 3PUKA 1NU9C 2J07A 4CS9C 4KZ0A 5T3TA 4WNFA 1PCXA 3CVLA 3IEGA 1DNPA 4BY6A 2J4DA 4A2NB 4GMLA 2A5UA 3LJBA 3RKVA 3WG7C 4O79A 2I8BA 4HE8D 1E90A 1E8XA 2IYLD 2BTDA 2QTVA 3CQCB 5EKQD 2CNWD 5A23A 5JJTA 4P6IC 1UJKA 3FUJA 3CVYA 1H6KA 1M2VA 3WODF 1ZHZA 2LSEA 3DXJF 1H2VC 2WM9A 3KKBA 2CHZA 2IF4A 5DVWA 4JC8A 4PDXA 5B1BC 3CK7A 3DBSA 3CIAA 3PNTB 1WAO1 2FEZA 1DVPA 4CDNA 2ZU6B 5CMWA 4MS6A 1Y8MA 4PJJA 2E2EA 1E7UA 3IEEA 3NF1A 3L0IA 4FWVA 4MLPA 4Q69A 4XLPF 5KYUA 3K1IC 2IXNA 3LS0A 2YNQA 3MGBA 4GZ6A 4U0ZA 2ZPAA 4JJGA 4DLQA 5KJKA 3VLFA 2EQXA 3LEVA 4J8DA 2ZXWC 2XPZA 4H7XA 2GW1A 5E3AA 3SGHA 2HM8A 4U07A 4LLEA 2LNIA 4FHKA 3CHSA 3LVRE 3FUMA 4GB9A 2G3VA 2IU1A 3LJ3A 4IULA 3SYNA 4C0EA 2Z15A 3Q7LA 1NZNA 4XWJA 1UN9A 2VGXB 3ABMC 4CS9A 3ZPJA 4I1AA 1FVHA 3W2WA 2V5FA 2X38A 3LYAA 3UNGC 1O5HA 2WVIA 3HYMB 3NKDA 2CGEA 3NYJA 2Y4TA 5LCWJ 4U04A 1J8MF 3FTYA 4NRHB 3CKCA 3G2WA 2HV7A 4U5CE 4DK5A 3ZG1A 4KBQA 3PVLA 2CHWA 2W4MA 3KMIA 2UWJG 3SBSA 4D10C 2WXOA 2NUPB 1MHQA 3B13A 3S7BA 3GANA 4F3VA 1JPJA 3DPDA 3EQLF 3S27A 2Y69C 5JHBA 5AENA 2XEVA 4UWHA 4J6IA 4Q96A 4B8CB 4JA9A 4OD5A 2YZSA 4YT5A 4KC9A 4GU5A 2ZXOA 3S28A 3JQ0A 4J30B 3RU0A 3URZA 5FQ7A 1OWPA 3N2ZB 3D3MA 1HS6A 1WGWA 3I4UA 2DCPA 4A55A 2L0IA 3B0VC 4CCAA 3AU4A 3VLDA 5DS5A 4PUCA 5FZQA 1D0YA 4AP2A 4C3DA 2JLBA 3NRHA 1FVFA 3EHMA 4XTKA 3CVXA 3CHRA 4KNWA 3B7RL 3MV3B 1Z6TA 3T4RA 3FH7A 3T5VA 2WB7A 3CSKA 4IAOA 2WXLA 2Q7FA 2PF4E 1TWCA 4GMJA 1NZEA 3F46A 3MKQB 3RO2A 2PFDA 1UG3A 4AY5A 2VSNA 3FUNA 2FBNA 2A6HF 4K03A 4AE4A 4HFKB 2EINC 2X6IA 2PX3A 2WXIA 4FESA 3T6JA 2CDQA 4HORA 2PQRA 4I44A 3W2VA 3FFLA 2Y3AA 2HO1A 4K0DA 4DPRA 4HEAJ 2CW0F 4BJ1A 3NZSA 3LXUX 3ZXSA 1ZBPA 3O48A 5HQ8A 1SZ9A 2R7SA 3RRUA 1A17A 4UWKA 3MKQA 1Z3XA 2QY7A 3L16A 1HE8A 4GZCA 3OXGA 4C3BA 2DGJA 3LAYA 4G11A 4ANWA 4J8SA 2I9CA 2MOWA 3LESA 4L7TA 1B89A 3VTXA 5FT9A 2DBAA 2AXZA 1OWMA 1GW6A 4HVBA 4OD4A 2YHEA 3TAXA 4AV7A 3B0UX 2V3CC 5FQ8A 5ARGA 5AJDA 3UMIA 4GAAA 3HVEA 3JUIA 4Q4ZF 2WQ7A 1OUVA 4QDLA 4PS3A 3MX3A 1W2WA 2X6KA 1D1BA 3DAGA 2J9VA 1OCOC 4BG0A 3RK6A 1INZA 4U8HA 5FQ4A 4CS8A 1M57C 5KCMA 5T8IA 3QWPA 2NUTB 3UT8A 1VYIA 2R7QA 4JJFA 2XGMA 2FGYA 3KH2A 5DIZA 3JT1A 2BUGA 3FU3A 2WMOA 4ACKA 4G23A 3ESKA 2QFCA 4JHKA 3L34A 3ZEFA 4RSYA 4C3EA 4JHJA 1OCRC 3HTKC 5B3SC 4GYWA 4W8KA 3UR3C 1BR1A 3HJCA 2X6JA 2IONA 2R17C 5DBKA 5AJLA 5E2QA 3GZ1A 2KZTB 3V7OA 5ANRA 2X51A 3LDZA 4YWQA 1KT0A 2X3MA 4FADA 4Q94A 4AX2A 4YVQC 4FJZA 2MHKA 3OA1A 4URKA 2WXKA 4FA6A 2RD0A 1E96B 3VAYA 5DLJA 4I43A 2V4LA 3MA5A 1VMAA 3CEQA 4TV3A 4EZLA 2KM4A 4R7LA 2J7PD 1D1AA 5D0OD 3FEYA 4XX5A 3L17A 5JJ7A 3CVVA 4W9RA 3EPVA 1S7ZA 4FU3A 3D9IA 5G55A 1HZ4A 5KYNA 3FTZA 4C7OB 2AXUA 1MNEA 4KYOB 5KYXB 4O6MA 2VQ2A 1HG2A 4G7ZF 3DAFA 1S0PA 3JSZA 4CS7A 2ZXPA 2NG1A 3FDHA 1FMWA 4HOQA 1MMAA 4BJ6C 5BW8C 3OWTA 2L6JA 2VJ8A 3D9LA 4PS7A 2PP4A 3BG1B 2IOSA 4RG9A 1MQSA 3MZLB 3SZ7A 5A6CA 4BJTA 3OEOA 4OVUA 2HV6A 4WNEA 1ST6A 4JXTA 4CSAA 5CMYA 2KGOA 2VASA 4JZYA 3S0XA 3SBTB 2I1JA 2G62A 2VSOE 4WAFA 3ABLC 3E70C 2GRMA 3C98A 4GA0A 3ZC4A 2ZXRA 2NUTA 1OWOA 3FUHA 5LP0A 5T3WA 5D91A 2QY9A 3SNHA 1PD1A 2C2LA 3ENEA 4ANUA 3UMKA 3SNXA 4UI9J 2Q9BA 1Z23A 2WXPA 3VTYA 4DJAA 5HI7A 2WXFA 3EDTB 4ANJA 2IJGX 4IN3B 2IOLA 2PL2A 3L54A 2WL8A 3FWVA 5KJLA 1KU2A 4GCNA 1Z3YA 4P29A 3EFOA 2OVBA 4C9BB 1HO8A 2H7BA 3PE3A 4O6YA 4EBAA 4DVYP 3QZCA 3SI5A 5HSWA 1ZHWA 3U9WA 4HFGA 3UX4A 3PH0C 2XRZA 1MMNA 3L08A 2FO7A 3ONKA 3RIBA 3FTWA 3RH3A 1D0ZA 4V3IA 4AIFA 4XIFA 2A6EF 2WVNA 3ML8A 4G25A 3FU0A 2Q9CA 4AE4B 3LLIA 1TKNA 3K9IA 3JRTA 1EPUA 3MV2B 4ACLA 5KJMA 2B0JA 3MLGA 1TR2A 3R7QA 5C2YA 3I5QA 5ENNA 4AEZC 2IXMA 3ASOC 3O39A 1O87A 4A1SA 3TJPA 4Q7CA 4PFOA 2KZTA 4MQ9F 3ASGA 3CR3A 3N24A 4AJWA 4YVOA 4N2SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JW1 A;  4JVS A;  4I1O B;  4I1M A;  4IRU A; 
#chains in the Genus database with same CATH topology
 4TUU A;  5KNG A;  4CX9 A;  1DCE A;  3KEZ A;  3UGO A;  4K7B A;  4Y6W A;  2A68 F;  2R5S A;  1Z6A A;  1BI7 B;  2I1K A;  3ZUV B;  3ONL A;  2O9X A;  3TL5 A;  2J46 A;  5T4Y A;  2ETB A;  2AWC A;  5TJ5 E;  3R7R A;  5CEA A;  1Y6I A;  4YL1 A;  1W3B A;  2DZN A;  3QWV A;  2R2L A;  2VSX E;  2VGY A;  4F1S A;  5KWD A;  1EDU A;  3C3O A;  1ORY A;  4O60 A;  3FTU A;  4CT0 A;  2R7V A;  4JC7 A;  3A9C A;  5BV0 A;  4OIP F;  1P5Q A;  3ULQ A;  3T5X A;  1C02 A;  3AJI A;  3ESL A;  3T8K A;  2CG2 A;  3TXN A;  2KW3 C;  4CSA C;  4BWR A;  4AY6 A;  2FO1 E;  3U4T A;  1R5I D;  3JCU Q;  4J7Y A;  2WMN A;  4MW8 A;  1PY1 A;  4IJJ A;  3ABK C;  3WAQ A;  3J06 A;  3EHR A;  1LS1 A;  3RF3 A;  3L9T A;  4L2Y A;  5BNW A;  1WM5 A;  3HXD A;  3PNL B;  3JUE A;  3EH2 A;  4CBE A;  4ABN A;  3RRM B;  2XSE A;  1N54 A;  3D9O A;  4LSZ E;  4BES A;  3L6A A;  3R2P A;  1N0Q A;  4WWO A;  4MVQ A;  1ZB1 A;  1OR2 A;  3APF A;  1BR2 A;  5FTP A;  1JOG A;  2J8S D;  4G24 A;  4WGZ A;  2VTB B;  3SP1 A;  1LD8 A;  2LAI A;  2P61 A;  3FTX A;  1QLE C;  3C18 A;  2F8X K;  4DX5 D;  4I9C A;  2FI7 A;  3FVY A;  3I4G A;  2M4E A;  5CCL A;  3N71 A;  1M6T A;  3VYW A;  2F22 A;  2PNN A;  4GMR A;  1RKE A;  3MEK A;  1G4U S;  4C0M A;  2XCC A;  5KYW B;  5JMN D;  3CGH A;  3AG4 E;  4YDE A;  3IHU A;  4EQF A;  3K7D A;  1EI7 A;  4F53 A;  2KCK A;  3PE4 A;  3Q5M A;  3LEW A;  3US6 A;  3CVQ A;  4FP7 A;  3ZHE B;  4KVO A;  2XEN A;  1V4A A;  4GZ5 A;  4AVX A;  5HV9 A;  4UWL A;  3D9P A;  5CBN A;  4FJY A;  1E8W A;  2CG3 A;  2GDC A;  3RQE A;  4FUL A;  4PFP A;  3G2V A;  4GYY A;  2H8A A;  4DXW A;  3UQ3 A;  1TWA A;  1AWC B;  3PRZ A;  4XI0 A;  2Q3T A;  2A1D D;  3FUD A;  4NQF A;  3B7B A;  2DYS C;  1X81 A;  4JUR I;  4ILG A;  1AEP A;  4ZLD A;  3Q79 A;  5CEC B;  2J49 A;  3AG4 C;  1ZVZ A;  5KNH D;  4PJM A;  3EHN A;  2B6C A;  2EIM E;  4FX5 A;  4LNU D;  4C48 B;  1OWN A;  3DSV A;  4CDV A;  4GYO A;  3AU5 A;  4EIY A;  1H6P A;  1PD0 A;  4KI2 A;  3AS8 A;  2NSZ A;  1LI7 A;  2R7O A;  3LVQ E;  3T9O A;  5EDS A;  2L9B A;  2AU5 A;  3HXC A;  3V2X A;  3SFZ A;  1JCS A;  2OJE D;  2KAT A;  3EZI A;  3P2B A;  4MND A;  5ARF A;  2RKK A;  3GZ2 A;  3QDN A;  3UUX A;  3RVZ A;  2DVW A;  3IBE A;  4BJ6 A;  5L0I A;  2OOC A;  3CSF A;  3BEE A;  3DXK G;  4U95 D;  3S90 A;  2XLH A;  4HOS A;  4N5C A;  3PZD A;  4IWB A;  4XKC A;  4TXR A;  4I17 A;  1VK5 A;  3CHP A;  1Z5S C;  4GTP A;  2Y4U A;  4LER A;  1OW8 A;  4X0R A;  2C0L A;  5J90 A;  4DBQ A;  5E33 A;  3WXX A;  3ZYK A;  3I5P A;  3CEX A;  2PZI A;  3PHF 2;  1U3D A;  4EHP A;  3DZA A;  4HXI A;  3FAP B;  3TWV A;  2ICW G;  4NAC A;  4XEF A;  3ZSU A;  5AYW D;  4XE0 A;  2DWZ A;  2PX0 A;  4YDW A;  3NKE A;  4WJ0 A;  5A6B D;  2J4B A;  5G05 J;  1HXI A;  5BQI A;  2J45 A;  4YN0 B;  3OTN A;  3OAW A;  3QMK A;  5D0Q D;  2HJ3 A;  3X1O A;  2OJQ A;  2CCY A;  2L6G A;  256B A;  2VGX A;  5FQ6 A;  5AC5 A;  1ELW A;  1MX2 A;  4HLL A;  3HRA A;  2DYS E;  3DJN B;  1ZHY A;  5KYW A;  1N1C A;  1U6H A;  4PH4 B;  1U0B B;  3ZTZ A;  2LXL A;  1Q2Z A;  4WNG A;  5D92 A;  4N5Q A;  3LS8 A;  2WVQ A;  4LCT A;  4E0H A;  1OT8 A;  4K5C A;  5CER B;  1NI1 A;  2B0O E;  4GTQ A;  4UQZ A;  3U66 A;  4GPM A;  3AG1 E;  1PC2 A;  4F7A A;  2XCB A;  5CCM A;  3ZNG A;  2IO3 C;  4TXQ A;  3EU5 A;  2AWI A;  3HNL A;  3UMV A;  4HI9 A;  2J08 A;  4RVB A;  1KT1 A;  5EIB E;  4XPW A;  4XKB A;  1ELR A;  4DX7 D;  4ILH B;  2XPY A;  2R59 A;  4JW1 A;  4M63 A;  1Z63 A;  1TNO A;  1QQE A;  4I1O B;  4L9P A;  2P7V A;  1N9A A;  3L13 A;  4OIO F;  3L8J A;  2DYR E;  3FTS A;  4BX9 A;  2NSG A;  1OR3 A;  4JL0 A;  1D8D A;  2CHX A;  3AG3 C;  4K0R A;  3HVE B;  3DJU B;  4XPX A;  1HE1 A;  4J32 B;  4G7O F;  3FHD A;  5DQT A;  5E76 A;  2KCV A;  4M3O A;  3ITF A;  3MBG A;  2WXN A;  2WQH A;  3TQO A;  1RJ9 B;  4ER9 A;  4CGW A;  3V5X A;  2KK1 A;  1FPP A;  2J09 A;  3TG4 A;  4J7W A;  1IZM A;  2BL2 A;  1OXJ A;  3TD7 A;  1QZ2 A;  5T1D B;  3TWU A;  2F0Y A;  3PUJ A;  5BT1 A;  1LF8 A;  3RKO F;  2PM6 A;  4K5B A;  3SXM A;  3GOD A;  2VB6 A;  2EIM C;  4PJN A;  3F47 A;  1HG5 A;  1YA0 A;  3B9Q A;  3U2M A;  3ZYQ A;  1FCH A;  3M4B A;  1SVX A;  4EBJ A;  2LIG A;  1LE2 A;  4YND A;  4HFF B;  2VTB A;  4YJW A;  4YT4 A;  3ZDL A;  2JPU A;  1N94 A;  3D9H A;  2MRI A;  3I3N A;  3MKR A;  1DOV A;  5L0C A;  4BSZ B;  3UXG A;  3TWQ A;  2LFF A;  3RW0 A;  3NQP A;  3H65 A;  4D4N A;  3C8G B;  3MFN A;  1UW4 B;  3DSS A;  3ZYM A;  3SD5 A;  1YJG A;  1K04 A;  1X5B A;  4RLY A;  4GPK A;  4U96 D;  5JUA A;  3U3B A;  1IW7 F;  3IQC A;  3K6B A;  3AQB A;  5KYY A;  1BD8 A;  1TN7 A;  3BG0 B;  4RG6 A;  1NU7 D;  1B68 A;  4A1G A;  2WZF A;  2D5R B;  1XGW A;  1F1M A;  4DI3 A;  1H2T C;  3C63 A;  2J7P A;  2XQ0 A;  4CDR A;  1OWL A;  1N52 A;  3QK0 A;  1H2U A;  5HS0 A;  1HMD A;  5CHE E;  3U9M A;  3JCK C;  4EBB A;  4BX8 A;  4E85 A;  3B7T A;  3BUA A;  4U63 A;  3W8H A;  3JQ1 A;  4KXK B;  2P6V A;  1A0B A;  3EH1 A;  4JE9 A;  4NQ0 A;  4BT8 A;  1KPS B;  1YCS B;  4I6J A;  3AG1 C;  4A3T A;  2BKK B;  3HG0 D;  5AQB A;  2YIN A;  3QAR A;  3PMR A;  4LAC B;  4QI0 A;  4CS8 C;  3AG2 C;  2LSU A;  2LFD A;  2XGO A;  4B6I A;  4N06 A;  3LJN A;  3UM3 A;  2OV8 A;  2LUH A;  4N3C A;  4U5G A;  4DRX E;  4HB5 A;  1WTY A;  1GGQ A;  2JX0 A;  4B89 A;  2XM4 A;  1DC2 A;  3LY7 A;  2KJG A;  1T6U A;  2EIK C;  4JCZ A;  3D9M A;  3W8I A;  1L5J A;  2EPM X;  3D9J A;  4DLO A;  1NA0 A;  3QC1 A;  4C7O A;  4HLE A;  2P9K G;  2P58 C;  5K0I A;  4JEU A;  2EPN A;  2VCC A;  2R7R A;  4HS2 A;  3HHM A;  4UQX A;  3RO3 A;  4N3B A;  2V5Q C;  2WXQ A;  4L2L A;  3APC A;  3NZU A;  3FXH A;  1RJ9 A;  3VM6 A;  5EYL A;  3TWR A;  1J8Y F;  1JPN A;  3NYL A;  4XEV A;  5L0D A;  4MVU A;  2G3K A;  4RDA A;  5G05 C;  2DYR C;  4CJO A;  1PAQ A;  3EHQ A;  3U3W A;  2Y3H A;  5CBO A;  3PZ3 A;  2B0H A;  3EGD A;  2X6F A;  2WZG A;  3R9M A;  2LD6 A;  5COF A;  2OND A;  3POV A;  4GZ3 A;  5BPP A;  5EX0 A;  5DS6 A;  4JTA B;  1MX4 A;  2IXP A;  4JKV A;  2GGF A;  3TWS A;  4J8Y A;  2FF4 A;  3EU9 A;  3CVW A;  1QZX A;  2L81 A;  2YRF A;  4J7T A;  2XZD G;  1EYH A;  1D0X A;  5T3R A;  2VCB A;  3Q7G A;  1WOL A;  5AIJ A;  1E85 A;  4KMO A;  4U7E B;  2J9W A;  1FFT C;  1HF8 A;  5ENO D;  3QNK A;  2GRQ B;  1QQ3 A;  3AG2 E;  1O1R A;  2P9S G;  3ZU7 B;  5L3V A;  3O4Z A;  3UT4 A;  1VOM A;  4DX2 A;  3SEO A;  4U5B E;  1GS9 A;  4IRU A;  3F6Q A;  3CV0 A;  4O6N A;  4OVV A;  3DMD A;  3IHV A;  4FLH A;  4U0U A;  3G4X A;  2IM8 A;  1PV3 A;  4I1M A;  3ZVV A;  4OAV B;  3FH8 A;  2AVK A;  1HMO A;  4R32 A;  4ULW A;  2AW6 A;  2BE5 F;  2L6F A;  1JWF A;  4JRZ A;  5EGY A;  1H19 A;  1TNZ A;  2IO2 C;  1DCQ A;  4UQY A;  3L82 A;  1QNF A;  5J08 A;  3V2O A;  5CRV A;  1RMV A;  3K66 A;  1C17 M;  3D9N A;  3AJM A;  2KC3 A;  3RYL A;  1I4Z A;  2ZD9 A;  2P9I G;  3EUV A;  3FU5 A;  3FTV A;  3CQZ A;  3O10 A;  3IKO B;  3DST A;  2WQ6 A;  3DXM G;  3E9V A;  5C1D A;  5A6B A;  3IPM O;  4U5E E;  4ZLC A;  4I6G A;  4H7Y A;  2KQ9 A;  4ME2 A;  2PNO A;  3DM5 A;  3QAQ A;  4MS2 A;  1NFI E;  1ZU2 A;  2LCH A;  3LS1 A;  2R03 A;  3K33 A;  4YL3 A;  1OQC A;  4B8A A;  5COM A;  2GA0 A;  4DJ9 A;  4AOF A;  4MKT A;  2UY1 A;  2YL1 A;  4DOZ A;  4B0Z A;  2OU6 A;  3S29 A;  3DE9 A;  3FUF A;  1Y6D A;  3Q15 A;  1DOW A;  2HZ8 A;  4N2Q A;  2OKU A;  2AVP A;  2WXH A;  2UUI A;  2BF0 X;  4K1O A;  2KNH A;  1TJC A;  2FAP B;  3RQF A;  3D9K A;  4L1B A;  2VSY A;  5F5H A;  1T01 A;  3FP3 A;  3Q47 B;  2X0C A;  1OKK A;  4YK5 A;  2LSV A;  4XZ4 A;  4QFV A;  3K1I A;  4JVS A;  1GQA A;  1UG7 A;  2DB4 A;  2PM7 A;  1LPE A;  3LUT B;  3SQV A;  2JEK A;  4EBA G;  3TXM A;  3LLK A;  4U9E A;  4DX6 D;  2WB2 A;  3V31 A;  4OAU C;  3DM9 B;  1H9G A;  2Y3D A;  3NYM A;  4ATG A;  3JSE O;  3EJN A;  4NY3 A;  2LAH A;  4OIN F;  3AS5 A;  2Y3B A;  1ZU4 A;  1JUQ A;  4PS8 A;  4EZJ A;  2PQN A;  3GM3 A;  1HW1 A;  2GRL A;  1VB5 A;  3EFO B;  4LEU A;  2C03 A;  4XQ1 A;  5KYX A;  3EG9 A;  2IOQ A;  3SHF A;  1NP7 A;  3N0T A;  4A3V A;  5LCW C;  3KYI A;  4AM9 A;  2NUP A;  4U5F E;  3ZYL A;  4F1P A;  2QNL A;  1E86 A;  1ELK A;  5EIL A;  2RSE B;  3PRE A;  5L3Q A;  1E8Y A;  4WUY A;  5KBA A;  2JAB A;  3LY8 A;  1Q0K A;  3G2U A;  4Q5S F;  1FR0 A;  4FLB A;  2A0B A;  1VYK A;  4OIR F;  2CYD A;  5G04 C;  2KC7 A;  2XL4 A;  3R9A B;  5JHA A;  3X2Q E;  1RKE B;  1JR8 A;  2P9L G;  3MYF A;  2I6H A;  3RAU A;  3GZS A;  4A4A A;  1G3N B;  5BXO A;  2FUL A;  5FCL A;  4IYP A;  1TNB A;  3LNR A;  4W8P A;  3LKU A;  5E75 A;  3RFY A;  2AJA A;  4GZD A;  1Z5Z A;  1C03 A;  1MJ0 A;  2R7T A;  3S7J A;  1OXK A;  1JCR A;  2H7O A;  2UY1 B;  1YZA A;  4LDR A;  5FZT A;  4E7Z A;  1XNF A;  2A4Z A;  5A6K A;  1MQV A;  2XS8 A;  3U64 A;  3CST A;  2RG8 A;  3C8G A;  2J9U A;  3E4B A;  3FUK A;  1UJJ A;  4NTB A;  4OIQ F;  2WXR A;  4MRU A;  5KYU B;  4BJ5 C;  3P1U A;  3C62 A;  5AAR A;  4F6R D;  5ENR D;  1BR4 A;  1TWG A;  2LQG A;  2TMV P;  1IQU A;  1OCC C;  3IQ5 A;  3QB2 A;  1WY6 A;  2XLV A;  3T6B A;  2EPL X;  3BQO A;  1SR2 A;  3FUI A;  4EZK A;  4WAB A;  2W4B A;  3NOC D;  1M2O A;  4DUI A;  4Z9J A;  4WWN A;  3UI2 A;  3CQG B;  3Q49 B;  3PZ4 A;  3FUL A;  4BTA A;  5GPG B;  4Z9I A;  3ABK E;  3RQG A;  3ASH A;  4ANX A;  3GM2 A;  3SY2 A;  2J0X A;  3E33 A;  2H6H A;  2VH3 A;  4KBL A;  2XRH A;  4MVZ A;  1ORJ A;  3QVY A;  5COG A;  2WXG A;  3TJ6 A;  5FWQ A;  1ZU5 A;  1HX8 A;  3I4R B;  1Z7Q c;  1L3P A;  3RRN B;  1HFA A;  3RJV A;  4BT9 A;  4E7S A;  5HKP A;  2XLM A;  2XHE A;  4I2Z A;  2Y39 A;  4JA7 A;  3HLZ A;  4E6H A;  4YT2 A;  4FC8 A;  2V0P A;  4QI2 A;  3UT7 A;  5CI8 A;  4UI9 K;  2WXJ A;  3QW1 A;  3S9O A;  4UWF A;  3FDQ A;  2OG2 A;  2ETS A;  4O7G A;  3PS6 A;  1FTS A;  1LM3 B;  3G2S A;  1HH8 A;  2OVF A;  4GA2 A;  4BEP A;  4FHJ A;  5JA4 D;  3NMJ A;  3PCV A;  4U0S A;  4BFR A;  5LFA A;  3GW4 A;  4TRQ A;  3LCA A;  4L6R A;  4XEK A;  5AN8 A;  3SXK A;  2CFU A;  2DIW A;  1EA8 A;  2H6G A;  4LLC A;  3ZGQ A;  3B7U X;  1N4Q A;  3U8P A;  5AQA A;  2YHC A;  4MVS A;  2QC9 A;  5CI9 A;  1LI5 A;  2LXM A;  3AS4 A;  5JS5 A;  1I5N A;  2LP4 A;  1TEZ A;  3HNJ A;  2GRO B;  1YDI A;  1N4S A;  2F8Y A;  2L0T B;  4CYM D;  4F4B A;  2D4U A;  1U2V G;  1QYM A;  2WXM A;  2OOE A;  1TFK B;  1ZHT A;  1U3C A;  3QJZ A;  3HXF A;  4AL1 A;  5AQ7 A;  4CDY A;  3G2T A;  3Q4A B;  2HYZ A;  1H0A A;  1YMP A;  3CVP A;  4J8E A;  1N4P A;  4EPZ A;  3ATP A;  4U5D E;  5BV1 A;  5BQG A;  3Q6M A;  1JAF A;  3CZ6 A;  2AWY A;  1V54 C;  2Y0B G;  2EIL E;  2XS1 A;  3NBN B;  3T8M A;  1TNU A;  2I2O A;  3CK9 A;  1FMV A;  4KZC A;  3JYH A;  3QOU A;  1WAT A;  2R7U A;  5AAO A;  3CK8 A;  4LG6 A;  1JMW A;  1YYX A;  2YHS A;  4XPY A;  3AOU A;  5FZS A;  5BUO A;  4ANV A;  1LVK A;  2HMZ A;  1A41 A;  3HDX A;  1IHG A;  5KYY B;  3FUE A;  4G7H F;  3B0P A;  1SA5 A;  2V26 A;  4DBR A;  5FZR A;  3RSE G;  3ZXP A;  3JXJ A;  2GAQ A;  1TJF A;  3SF4 A;  2A69 F;  1SMY F;  3ZW3 A;  4I9E A;  4H4K C;  3FEX A;  2X6H A;  3KS2 A;  1K05 A;  3ZIM A;  3ZIB A;  1TFO B;  3ZN3 A;  3MJW A;  3PDN A;  5L0F A;  2QE9 A;  3MYI A;  4DVZ A;  1SZI A;  4HOU A;  2GFH A;  2CNW A;  5A7D B;  1IXV A;  1NL4 A;  1CPQ A;  1LIH A;  1I4Y A;  3ASD A;  4MVO A;  1ZYR F;  2IQC A;  1EF1 C;  2HR2 A;  3DEO A;  2NC9 A;  1AP7 A;  1OKK D;  1T9K A;  2L9J A;  5JSL A;  3Q6N A;  3AGT A;  2YEV A;  5KJN A;  4KT6 B;  1BZ4 A;  1BBH A;  2IEJ A;  4B94 A;  3FY4 A;  3ULY A;  3UPV A;  4ATZ D;  2L6H A;  3SFY A;  1HW2 A;  2C0M A;  4HRN A;  4A63 B;  3FH5 A;  1M2V B;  4J8F A;  4LNB A;  4CGV A;  5M72 A;  1TN8 A;  3OXL A;  3DWL G;  1HE9 A;  2EPO A;  1SF8 A;  5AQ9 A;  5JJ6 A;  4GCO A;  3EG9 B;  4GTM A;  3LPZ A;  4JPS A;  1E7V A;  4BET A;  3EIQ C;  3RIP A;  3MCX A;  3H2V A;  4BJ5 A;  3BRJ A;  4AXH A;  3M4C A;  2YQ8 A;  4P9T A;  1S70 B;  1SQM A;  4RQI A;  1MND A;  3HNK A;  5G04 J;  3M1C B;  4JEH A;  4APO A;  4N39 A;  2DI3 A;  4GEH A;  1E8Z A;  3FHE A;  3QWW A;  2HS5 A;  2C04 A;  4MVM A;  4RD9 A;  2VC9 A;  3E30 A;  4LNG A;  3FMS A;  3UIN C;  1O3U A;  1Q0G A;  4I6E A;  2FFH A;  3ASN C;  3ABL E;  2IXO A;  1V55 C;  2XL8 A;  3QVZ A;  3GYZ A;  2YWA A;  4JZA A;  2HJM A;  4Y6C A;  3ZVR A;  1Z3I X;  4G26 A;  1ZHX A;  3ZHE A;  5E3C A;  3NG1 A;  4I2W A;  3U2L A;  3C8Z A;  2CFZ A;  1MMG A;  3O6X A;  3OXF A;  3DSX A;  3E34 A;  3ML9 A;  3Q9U C;  2MYS A;  4PJL A;  3CHM A;  2V4H C;  3FAJ A;  1JWG A;  3PDM P;  1TYQ G;  3UMH A;  3AG3 E;  3PEU B;  2IFU A;  3JYS A;  3S7D A;  4CEM A;  5H7P A;  1QVX A;  2Q00 A;  3CHO A;  4DI4 A;  3S7F A;  1N11 A;  1V54 E;  1NSG B;  1K1A A;  2KYH A;  5EX3 A;  1VLS A;  3C72 A;  4AK9 A;  3EZH A;  1UN8 A;  3CVN A;  3EIJ A;  1D1C A;  1YAU O;  4WND A;  4U5H A;  1LKX A;  1G8X A;  2EIL C;  5F28 E;  4UDV A;  4DRI B;  1RZ4 A;  4KNV A;  4WWP A;  4BTB A;  3JYY A;  1SYQ A;  2AXV A;  5LOZ A;  1JPL A;  3TG5 A;  3IQ6 A;  4JHR A;  4I3M A;  1BLX B;  3KL4 A;  5DQZ A;  1LD7 A;  2JD3 A;  2NPU A;  5LX8 A;  1QPU A;  2KCL A;  1CPR A;  2GRR B;  5AGF A;  2Y3G A;  3ZKJ A;  4J0U A;  2W45 A;  2ILR A;  3B7S A;  4XI9 A;  2XPI A;  4OYS A;  3ZFW A;  3ZQY A;  2XXA B;  2J9Q A;  3SZR A;  4L23 A;  4MTO A;  2BC5 A;  3Q78 A;  4CIH A;  2NSF A;  3GEE A;  3UGP A;  4JEA A;  4LRZ A;  1A5E A;  4UWG A;  5ENQ D;  5G2N A;  1ZW3 A;  3CKB A;  5DS4 A;  3O55 A;  4G1T A;  4O1P A;  1U89 A;  4KVM A;  3FU6 A;  2XM0 A;  3GOR A;  1XWJ A;  1MMD A;  4YT8 A;  3S2A A;  1NFO A;  1RKC A;  1NA3 A;  3IV0 A;  4TUM A;  2L6B A;  3X2Q C;  2NXP A;  1OCZ C;  2WZL A;  2OCC C;  1N0R A;  5JT4 A;  1IYG A;  4APF A;  3IHY A;  3E32 A;  1ZW2 A;  3CHQ A;  2W9Y A;  5EHH A;  2J0W A;  5F5F A;  1KLX A;  2QYU A;  2XRY A;  5IY5 C;  3PEV B;  3DD7 A;  1WAS A;  5BUZ A;  2EPK X;  4HOT A;  1H9T A;  3EGX B;  1M56 C;  4GA1 A;  3UIP C;  3A11 A;  4G78 A;  3ASF A;  3KAE A;  3LY9 A;  3Q7F A;  2OQM A;  4O6F A;  4ILI A;  4NUR A;  2R7W A;  4G2V A;  4N3A A;  3CVU A;  2WVO A;  3FOP A;  1SA4 A;  3VLE A;  3TJ5 A;  5ANL A;  1NBB A;  1K3Z D;  3M79 A;  1CGN A;  4FAP B;  1FFH A;  3AQC A;  1VDY A;  1L7C A;  3QKY A;  4NCQ A;  4YL0 A;  4G0H A;  5FJY A;  1NG1 A;  2E87 A;  5B1A C;  2PBE A;  4CDM A;  3EGD B;  1D9S A;  3ZRH A;  4RBN A;  3TGO A;  3CLJ A;  4LUN U;  2EIJ C;  4XLN F;  3UKU G;  1TWH A;  3K1H A;  1IQR A;  4IB4 A;  4EWC A;  2XL6 A;  2V8S E;  3ECS A;  3L22 A;  2R7X A;  1VTM P;  4BSX A;  2MWQ A;  1OXB A;  4Z68 A;  2XXA A;  3HIZ A;  4BEJ A;  4GYT A;  3NDB B;  1SZA A;  2WPV A;  3EGX A;  4EEC A;  3MYV A;  2P1A A;  4PK4 A;  3UIO C;  2XGS A;  2H7V C;  2M63 A;  2R05 A;  3APD A;  1BPO A;  3PZ2 A;  2L7A A;  2NYJ A;  1HU3 A;  3GWL A;  2VYI A;  4Z9H A;  3KD7 A;  4CT4 A;  2LO6 A;  3HKK A;  2E0I A;  4QQI A;  2Q9A A;  2RFM A;  4JCH A;  4CRW A;  4UI9 C;  3PUK A;  1NU9 C;  2XLO A;  4MTF A;  2J07 A;  4G8K A;  4CS9 C;  4O1O A;  4KZ0 A;  4N6H A;  3Q9N C;  5T3T A;  4G8L A;  2P9N G;  4WNF A;  2RD9 A;  1PCX A;  3CVL A;  1K8K G;  3IEG A;  2YLI A;  1DNP A;  2YL0 A;  2J4D A;  4BY6 A;  2GWW A;  1YLM A;  4A2N B;  4GML A;  1FT1 A;  2A5U A;  3LJB A;  3RKV A;  3WG7 C;  4O79 A;  1O1T A;  4PAC A;  2I8B A;  3JTL O;  4HE8 D;  1E90 A;  1E8X A;  2IYL D;  2EIJ E;  2BTD A;  2QTV A;  4N4W A;  3LEO A;  3CQC B;  5B3I A;  5EKQ D;  2CNW D;  5A23 A;  2ZGG A;  5JJT A;  4P6I C;  1UJK A;  3FUJ A;  3UTM A;  3CVY A;  1H6K A;  1M2V A;  3WOD F;  1ZHZ A;  2LSE A;  3DXJ F;  1YA7 O;  1H2V C;  1APC A;  2WM9 A;  3KKB A;  2CHZ A;  2IF4 A;  5DVW A;  1O5M A;  4JC8 A;  4PDX A;  5B1B C;  3CK7 A;  3DBS A;  3CIA A;  3PNT B;  1WAO 1;  2FEZ A;  1DVP A;  4CDN A;  2ZIS A;  2ZU6 B;  5CMW A;  4MS6 A;  4HRM B;  1Y8M A;  4PJJ A;  2E2E A;  1QBQ A;  1E7U A;  3IEE A;  3NF1 A;  3L0I A;  5CED B;  4CJG A;  4FWV A;  1E83 A;  2ASR A;  1FT2 A;  4MLP A;  4Q69 A;  4XLP F;  3C8G D;  5KYU A;  3WG7 E;  1ZZP A;  3K1I C;  2IXN A;  3LS0 A;  1SW6 A;  1FAP B;  2YNQ A;  3MGB A;  4GZ6 A;  4U0Z A;  4NIK A;  1FNT c;  1Q0F A;  2P9P G;  2ZPA A;  3NOG D;  3V5Y A;  4JJG A;  4MVR A;  3UKR G;  1CGM E;  4DLQ A;  5KJK A;  3VLF A;  1BI8 B;  2EQX A;  3LEV A;  3T9K A;  3U0C A;  1AVO B;  4J8D A;  2ZXW C;  2XPZ A;  1N95 A;  2XLE A;  3HXE A;  4H7X A;  2GW1 A;  5E3A A;  1LS4 A;  3SGH A;  2HM8 A;  4LDK A;  4HBD A;  4U07 A;  2P2C P;  5JP7 A;  4LLE A;  2LNI A;  2Q4F A;  5A6J A;  4FHK A;  3CHS A;  3LVR E;  1KZP A;  3FUM A;  2H6F A;  5ITZ F;  4GB9 A;  2G3V A;  2IU1 A;  3LJ3 A;  4IUL A;  3SYN A;  4C0E A;  2Z15 A;  3Q7L A;  1NZN A;  4XWJ A;  3GEH A;  4JIO A;  4AL0 A;  1UN9 A;  2VGX B;  3ABM C;  4CS9 A;  3ZPJ A;  4I1A A;  4GTR A;  3U3F A;  1FVH A;  4JEB A;  3W2W A;  2V5F A;  5EN5 D;  2X38 A;  3LYA A;  3UNG C;  1O5H A;  2WVI A;  1UFB A;  1RCP A;  3HYM B;  3NKD A;  2CGE A;  3NYJ A;  2Y4T A;  5L0H A;  4EHM A;  5LCW J;  1XZQ A;  4U04 A;  4IGG A;  3VRC A;  1J8M F;  4CZ2 D;  1K1B A;  3FTY A;  3DPY A;  2LK4 A;  3CKC A;  3G2W A;  2R9R B;  4NRH B;  2HV7 A;  3UM0 A;  2EIK E;  4U5C E;  3JZ0 A;  4DRH B;  4DK5 A;  3ZG1 A;  1OW6 A;  4KBQ A;  3PVL A;  2A0U A;  2J8W A;  2CHW A;  2W4M A;  3KMI A;  1N4R A;  2UWJ G;  3SBS A;  4D10 C;  3DWW A;  3U8V A;  4JTC B;  4GTT A;  5HRY A;  1QSP A;  2YQY A;  2WXO A;  2NUP B;  1MHQ A;  4E17 A;  2YVK A;  1S64 A;  4JTD B;  4E0I A;  3B13 A;  3S7B A;  3GAN A;  4F3V A;  1JPJ A;  2KBX A;  3DPD A;  1WWP A;  3EQL F;  3S27 A;  2Y69 C;  5JHB A;  2QLA A;  5AEN A;  2XEV A;  4UWH A;  5A69 A;  4BPM A;  2HFI A;  4J6I A;  4Q96 A;  4B8C B;  4JA9 A;  4OD5 A;  4N6C A;  2YZS A;  4BER A;  4YT5 A;  2F37 A;  4KC9 A;  3BEH A;  4HRL A;  3NB2 A;  2P9U G;  1T5O A;  4GU5 A;  2YLG A;  2ZXO A;  3S28 A;  2HUJ A;  3JQ0 A;  4J30 B;  1OWP A;  4HNA D;  4M7C A;  3N2Z B;  5FQ7 A;  3RU0 A;  3D3M A;  3URZ A;  1HS6 A;  1WGW A;  3DSW A;  3M15 A;  4EKW A;  3I4U A;  2DCP A;  4HI8 A;  2AP3 A;  4A55 A;  2L0I A;  3B0V C;  4CCA A;  3KPH A;  1KTM A;  1Q0M A;  3TUL A;  3AU4 A;  2RFA A;  3VLD A;  5DS5 A;  3C7J A;  4PUC A;  5FIN A;  5FZQ A;  4GTV A;  1D0Y A;  4AP2 A;  4C3D A;  2JLB A;  3NRH A;  1FVF A;  2I15 A;  3EHM A;  4XTK A;  4BEM J;  3CVX A;  5BQH A;  3CHR A;  4KNW A;  3B7R L;  3FOO A;  3MV3 B;  3QTH A;  3Q73 A;  1Z6T A;  3T4R A;  3FH7 A;  3T5V A;  1KZO A;  3B29 A;  2WB7 A;  1A7V A;  3CSK A;  4IAO A;  2WXL A;  2Q7F A;  2KSF A;  2PF4 E;  1TWC A;  4GMJ A;  2J9B A;  1NZE A;  1EKY A;  1T6I A;  3F46 A;  4ZHB A;  3MKQ B;  3RO2 A;  4YDY A;  3ASO E;  2PFD A;  1UG3 A;  4AY5 A;  2VSN A;  3FUN A;  2FBN A;  3SFX A;  2QUP A;  2A6H F;  1MYO A;  4K03 A;  1HY5 A;  3B71 A;  4AE4 A;  4HFK B;  2EIN C;  2X6I A;  2VGE A;  2PX3 A;  2WXI A;  4FES A;  3T6J A;  2CDQ A;  4HOR A;  2PQR A;  3KSL A;  3ZQV A;  4I44 A;  3W2V A;  5CIV A;  4U8V D;  2MHR A;  2ZIR A;  3C3R A;  5B1A E;  3FFL A;  2Y3A A;  2ETA A;  1OCC E;  2HO1 A;  4K0D A;  3ABM E;  4DPR A;  4HEA J;  2CW0 F;  3NMI A;  4BJ1 A;  2M64 A;  3NZS A;  3T6G B;  3LXU X;  2DZO A;  3ZXS A;  4U8Y D;  1ZBP A;  3O48 A;  5HQ8 A;  1SZ9 A;  2R7S A;  3SXZ A;  3RRU A;  3TOL A;  3G50 A;  1A17 A;  4UWK A;  3MKQ A;  1Z3X A;  3W9F A;  2QY7 A;  1K40 A;  3L16 A;  1HE8 A;  4GZC A;  2QYJ A;  4TXP A;  3OXG A;  4ZFH A;  2XZT G;  1WG0 A;  4C3B A;  3WHN A;  5ENP D;  1G4W R;  3C3Q A;  3JRM O;  2DGJ A;  2ZGD A;  3LAY A;  1NFN A;  5JRA A;  4G11 A;  5JVE A;  4ANW A;  4J8S A;  2I9C A;  2MOW A;  3LES A;  4L7T A;  3H2U A;  2YLD A;  1B89 A;  3VTX A;  1NLX A;  1IKN D;  5FT9 A;  2DBA A;  3J5Q B;  1Y4C A;  2AXZ A;  1OWM A;  5ENT D;  3KYJ A;  1GW6 A;  4HVB A;  4OD4 A;  2YHE A;  4EBK A;  1S63 A;  3TAX A;  4AV7 A;  3B0U X;  4MTG A;  1YZC A;  2V3C C;  1MX6 A;  5FQ8 A;  5ARG A;  5AJD A;  3UMI A;  5AC4 A;  1RXQ A;  1T6Q A;  4GAA A;  1XZP A;  3G4Z A;  1AUE A;  3HVE A;  3JUI A;  4Q4Z F;  2WQ7 A;  2YL3 A;  1OUV A;  4QDL A;  4PS3 A;  1WN0 A;  4CIP A;  3MX3 A;  3UM1 A;  1W2W A;  2X6K A;  3W4Y A;  1D1B A;  1YVI A;  3DAG A;  2J9V A;  3U5S A;  1OCO C;  4BG0 A;  3RK6 A;  3KEA A;  1INZ A;  3AAA C;  2A5E A;  4U8H A;  5FQ4 A;  4CS8 A;  5L0J A;  5JLI A;  1M57 C;  5KCM A;  5T8I A;  3QWP A;  2NUT B;  1A7D A;  3UT8 A;  1VYI A;  2R7Q A;  2YL7 A;  4JJF A;  2FGY A;  2XGM A;  3KH2 A;  5DIZ A;  3JT1 A;  4U9D A;  1JCQ A;  2BUG A;  2WMO A;  2EIN E;  3FU3 A;  4ACK A;  1QKR A;  2HKV A;  4G23 A;  3ESK A;  2QFC A;  4JHK A;  3DE8 A;  4LDQ A;  1UOH A;  3L34 A;  3JXI A;  3ZEF A;  1H6G A;  4RSY A;  4C3E A;  4JHJ A;  4DX1 A;  4X8Q A;  1OCR C;  3HTK C;  5B3S C;  1WDY A;  4GYW A;  4ONS A;  4W8K A;  3L1M A;  1BR1 A;  3HJC A;  3UR3 C;  2X6J A;  2ION A;  2R17 C;  5DBK A;  5AJL A;  5E2Q A;  4IAR A;  3GZ1 A;  1Q0D A;  2KZT B;  3V7O A;  3J5P A;  5ANR A;  1H7I A;  1BDJ B;  2X51 A;  3LDZ A;  4YWQ A;  1KT0 A;  2X3M A;  4FAD A;  4Q94 A;  2HSB A;  4AX2 A;  2BKG A;  3VF0 A;  4FJZ A;  4YVQ C;  2MHK A;  3OA1 A;  4URK A;  2WXK A;  5D2M C;  4FA6 A;  2RD0 A;  3L8I A;  1TQG A;  1E96 B;  3VAY A;  3DI5 A;  5DLJ A;  1OCZ E;  4I43 A;  1TR4 A;  2P0N A;  5B3S E;  2V4L A;  3MA5 A;  1O1S A;  1VMA A;  3CEQ A;  1GM5 A;  4TV3 A;  4EZL A;  3ZTM A;  2KM4 A;  4R7L A;  2GRP B;  2J7P D;  1D1A A;  5D0O D;  1D8E A;  3FEY A;  4XEI G;  4K5A B;  4XX5 A;  1R4T A;  4GQH A;  2GRN B;  2XEH A;  3L17 A;  5JJ7 A;  3HNI A;  4E18 A;  3UM2 A;  3CVV A;  3V5Z A;  2UUH A;  4W9R A;  4NTF A;  3EPV A;  1VLT A;  3KSQ A;  1S7Z A;  4FU3 A;  1S05 A;  3CAX A;  3LNM B;  1OCO E;  3D9I A;  3PZ1 A;  5FIO A;  1A7E A;  5G55 A;  1G5Z A;  1H6O A;  1HZ4 A;  5KYN A;  3FTZ A;  4C7O B;  2AXU A;  1MNE A;  4PR9 A;  4KYO B;  5KYX B;  4HQD A;  4O6M A;  2VQ2 A;  1HG2 A;  4G7Z F;  3DAF A;  1S0P A;  3JSZ A;  4CS7 A;  3GM1 A;  2ZXP A;  2NG1 A;  3IXE A;  1YYJ A;  4P9F A;  3TK0 A;  3FDH A;  1FMW A;  2OCC E;  4HOQ A;  3DSU A;  5BXU A;  1MMA A;  4BJ6 C;  5BW8 C;  3OWT A;  2L6J A;  1E84 A;  2XLW A;  2VJ8 A;  3SXY A;  3D9L A;  1RW2 A;  2Q7R A;  1TN6 A;  4JB8 P;  4PS7 A;  1EQ1 A;  3ISM C;  4JD2 G;  2IY0 C;  1LE4 A;  4MBG A;  2PP4 A;  2HSQ A;  2XEE A;  3BG1 B;  2IOS A;  4RG9 A;  1MQS A;  3TWW A;  5IY5 E;  3MZL B;  3SZ7 A;  5A6C A;  3DKA A;  4BJT A;  3OEO A;  4OVU A;  1E2X A;  2HV6 A;  4WNE A;  1ST6 A;  4JXT A;  4CSA A;  5CMY A;  2KGO A;  2VAS A;  2QZA A;  4JZY A;  3S0X A;  3SBT B;  2I1J A;  2G62 A;  2VSO E;  2YKZ A;  1OCR E;  3ULE G;  4WAF A;  3ABL C;  3E70 C;  2GRM A;  3ASN E;  1V74 B;  3C98 A;  3HXB A;  4GA0 A;  3ZC4 A;  2ZXR A;  2NUT A;  4ULV A;  2H6I A;  1OWO A;  3FUH A;  5LP0 A;  2MYO A;  1OY3 D;  5T3W A;  5D91 A;  2QY9 A;  4NC3 A;  5A6A A;  3SNH A;  3E37 A;  1JRA A;  1PD1 A;  2R25 A;  2C2L A;  2IBF A;  4GTS A;  3ENE A;  2Y1L E;  2ETC A;  4ANU A;  4WGY A;  3UMK A;  3SNX A;  4UI9 J;  2Q9B A;  2OEW A;  4B93 B;  3S84 A;  1Z23 A;  2WXP A;  3VTY A;  4DJA A;  5EID A;  5HI7 A;  3DRA A;  2WXF A;  3EDT B;  4ANJ A;  2IJG X;  4IN3 B;  2ZXW E;  2IOL A;  1YA9 A;  3R7C A;  2PL2 A;  3L54 A;  2WL8 A;  3FWV A;  5KJL A;  5D66 A;  3AGU A;  1KU2 A;  4CDA A;  3GEI A;  4GCN A;  1Z3Y A;  3TWT A;  1YYH A;  4P29 A;  2OEV A;  4GTO A;  2R02 A;  3EFO A;  3NAW A;  2OVB A;  4C9B B;  1HO8 A;  2H7B A;  3TOM A;  3NMK A;  2OEX A;  2VCA A;  4O6Y A;  1OW7 A;  4D4X A;  1V55 E;  3PE3 A;  3SO8 A;  4EBA A;  1CGO A;  1BU9 A;  4DVY P;  3W9G A;  5EK0 A;  3QZC A;  3V79 K;  3SI5 A;  5HSW A;  1ZHW A;  1KNY A;  3U9W A;  4HFG A;  3UX4 A;  3V30 A;  3PH0 C;  2XRZ A;  1MMN A;  3U9J A;  4EUK B;  5B1B E;  3C5R A;  3L08 A;  1LTX A;  2FO7 A;  2XLD A;  3ONK A;  3RIB A;  3FTW A;  3RH3 A;  1D0Z A;  4V3I A;  4YDO A;  4AIF A;  4XIF A;  4H54 A;  1TNY A;  2HMQ A;  2A6E F;  5L0G A;  2WVN A;  3B95 A;  3GWN A;  4NTA A;  3ML8 A;  4G25 A;  3IQT A;  4DRJ B;  3FU0 A;  3Q75 A;  2BED A;  2Q9C A;  5ENS D;  4AE4 B;  3LLI A;  1TKN A;  3K9I A;  3JRT A;  2Y69 E;  1EPU A;  3MV2 B;  4ACL A;  5KJM A;  2HE0 A;  4UUC A;  2B0J A;  1MZC A;  1ORS C;  3MLG A;  1TR2 A;  4IAQ A;  3QW0 A;  3R7Q A;  2KXP C;  3RVY A;  5C2Y A;  3I5Q A;  5ENN A;  4AEZ C;  2IXM A;  3ASO C;  3O39 A;  3ZWI A;  1O87 A;  3DEP A;  3Q7A A;  1YAR O;  4A1S A;  3TJP A;  4Q7C A;  4PFO A;  2KZT A;  5CRU A;  5EYP F;  4MQ9 F;  1IHB A;  3ASG A;  3BU8 A;  3CR3 A;  3N24 A;  4AJW A;  3TWX A;  4YVO A;  4N2S A;  4MW3 A; 
#chains in the Genus database with same CATH homology
 4TUU A;  3KEZ A;  3UGO A;  4K7B A;  4Y6W A;  2A68 F;  2R5S A;  1Z6A A;  2I1K A;  3ONL A;  2O9X A;  3TL5 A;  2J46 A;  5T4Y A;  3R7R A;  1Y6I A;  1W3B A;  3QWV A;  2VSX E;  2VGY A;  4F1S A;  1EDU A;  3FTU A;  4CT0 A;  2R7V A;  5BV0 A;  4OIP F;  1P5Q A;  3ULQ A;  3T5X A;  3ESL A;  3TXN A;  2CG2 A;  2KW3 C;  4CSA C;  4BWR A;  4AY6 A;  3U4T A;  3JCU Q;  2WMN A;  1PY1 A;  4IJJ A;  3ABK C;  1LS1 A;  4L2Y A;  5BNW A;  1WM5 A;  3PNL B;  3EH2 A;  4CBE A;  4ABN A;  3RRM B;  2XSE A;  1N54 A;  3D9O A;  3L6A A;  4WWO A;  3APF A;  1BR2 A;  5FTP A;  4G24 A;  2VTB B;  3SP1 A;  2LAI A;  3FTX A;  1QLE C;  4I9C A;  2FI7 A;  3FVY A;  3I4G A;  2M4E A;  5CCL A;  3N71 A;  3VYW A;  4C0M A;  3MEK A;  2XCC A;  5KYW B;  3CGH A;  4EQF A;  3K7D A;  4F53 A;  2KCK A;  3PE4 A;  3Q5M A;  3LEW A;  3CVQ A;  4FP7 A;  3ZHE B;  4KVO A;  4GZ5 A;  4AVX A;  4UWL A;  3D9P A;  4FJY A;  1E8W A;  2CG3 A;  4FUL A;  4PFP A;  3G2V A;  4GYY A;  3UQ3 A;  1TWA A;  3PRZ A;  4XI0 A;  2Q3T A;  2A1D D;  3FUD A;  2DYS C;  4JUR I;  4ILG A;  4ZLD A;  2J49 A;  3AG4 C;  4PJM A;  3EHN A;  4FX5 A;  1OWN A;  4GYO A;  3AU5 A;  1PD0 A;  4KI2 A;  3AS8 A;  2NSZ A;  2R7O A;  3LVQ E;  5EDS A;  2L9B A;  3SFZ A;  2KAT A;  3EZI A;  3P2B A;  4MND A;  5ARF A;  3GZ2 A;  3QDN A;  3UUX A;  3IBE A;  4BJ6 A;  3CSF A;  3BEE A;  4HOS A;  4N5C A;  3PZD A;  4IWB A;  4XKC A;  4I17 A;  1VK5 A;  3CHP A;  2Y4U A;  4LER A;  4X0R A;  2C0L A;  5J90 A;  4DBQ A;  5E33 A;  3WXX A;  3ZYK A;  3I5P A;  2PZI A;  3PHF 2;  1U3D A;  3DZA A;  4HXI A;  4NAC A;  3ZSU A;  5AYW D;  4XE0 A;  2PX0 A;  3NKE A;  4WJ0 A;  2J4B A;  5G05 J;  1HXI A;  2J45 A;  4YN0 B;  3OTN A;  3OAW A;  3QMK A;  5D0Q D;  3X1O A;  2VGX A;  5FQ6 A;  1ELW A;  3DJN B;  1ZHY A;  5KYW A;  1N1C A;  4PH4 B;  4WNG A;  5D92 A;  3LS8 A;  2WVQ A;  4LCT A;  4UQZ A;  3U66 A;  4F7A A;  1PC2 A;  2XCB A;  5CCM A;  2AWI A;  3UMV A;  2J08 A;  4RVB A;  1KT1 A;  4XKB A;  1ELR A;  4ILH B;  2XPY A;  2R59 A;  4JW1 A;  4M63 A;  1Z63 A;  1QQE A;  4I1O B;  2P7V A;  3L13 A;  4OIO F;  3FTS A;  4BX9 A;  4JL0 A;  2CHX A;  3AG3 C;  4K0R A;  3HVE B;  3DJU B;  4J32 B;  4G7O F;  3FHD A;  5DQT A;  5E76 A;  2KCV A;  4M3O A;  3ITF A;  2WXN A;  2WQH A;  1RJ9 B;  4CGW A;  2J09 A;  3TG4 A;  1IZM A;  3TD7 A;  1QZ2 A;  5T1D B;  3PUJ A;  5BT1 A;  1LF8 A;  3RKO F;  2PM6 A;  3GOD A;  2VB6 A;  2EIM C;  4PJN A;  3F47 A;  1HG5 A;  1YA0 A;  3B9Q A;  3ZYQ A;  1FCH A;  4YND A;  4HFF B;  2VTB A;  4YJW A;  4YT4 A;  2MRI A;  3I3N A;  3MKR A;  3NQP A;  3H65 A;  3ZYM A;  1UW4 B;  3SD5 A;  1X5B A;  4GPK A;  1IW7 F;  3K6B A;  3AQB A;  5KYY A;  3BG0 B;  4RG6 A;  1NU7 D;  4A1G A;  2WZF A;  2D5R B;  1XGW A;  4DI3 A;  1H2T C;  2J7P A;  2XQ0 A;  4CDR A;  1OWL A;  1N52 A;  3QK0 A;  1H2U A;  5CHE E;  3JCK C;  4EBB A;  4BX8 A;  4E85 A;  3B7T A;  4U63 A;  3W8H A;  3JQ1 A;  4KXK B;  2P6V A;  3EH1 A;  4NQ0 A;  4BT8 A;  4I6J A;  3AG1 C;  4A3T A;  2YIN A;  3QAR A;  3PMR A;  4LAC B;  4QI0 A;  4CS8 C;  3AG2 C;  2LSU A;  2XGO A;  4B6I A;  4N06 A;  2OV8 A;  4N3C A;  4U5G A;  4B89 A;  3LY7 A;  2KJG A;  2EIK C;  3D9M A;  3W8I A;  1L5J A;  3D9J A;  4DLO A;  1NA0 A;  3QC1 A;  4C7O A;  4HLE A;  2P58 C;  4JEU A;  2R7R A;  4HS2 A;  3HHM A;  4UQX A;  3RO3 A;  4N3B A;  2WXQ A;  4L2L A;  3APC A;  3NZU A;  1RJ9 A;  1J8Y F;  1JPN A;  3NYL A;  5G05 C;  2G3K A;  4RDA A;  2DYR C;  1PAQ A;  3U3W A;  2Y3H A;  3EGD A;  2X6F A;  2WZG A;  2OND A;  3POV A;  4GZ3 A;  5BPP A;  5EX0 A;  5DS6 A;  2IXP A;  2GGF A;  2FF4 A;  3CVW A;  1QZX A;  2L81 A;  1EYH A;  1D0X A;  5T3R A;  3Q7G A;  5AIJ A;  4KMO A;  2J9W A;  1FFT C;  1HF8 A;  3QNK A;  5L3V A;  3UT4 A;  3O4Z A;  1VOM A;  3SEO A;  4U5B E;  4IRU A;  3CV0 A;  4O6N A;  4OVV A;  3DMD A;  3IHV A;  4FLH A;  4U0U A;  4I1M A;  3ZVV A;  3FH8 A;  4ULW A;  2AW6 A;  2BE5 F;  1JWF A;  5EGY A;  1H19 A;  4UQY A;  1QNF A;  5J08 A;  3K66 A;  3D9N A;  3RYL A;  3FU5 A;  3FTV A;  3CQZ A;  3IKO B;  2WQ6 A;  3E9V A;  5C1D A;  4U5E E;  4ZLC A;  4I6G A;  4H7Y A;  2KQ9 A;  4ME2 A;  3DM5 A;  3QAQ A;  1ZU2 A;  3LS1 A;  3K33 A;  4B8A A;  4AOF A;  4MKT A;  2UY1 A;  4DOZ A;  4B0Z A;  3S29 A;  3FUF A;  3Q15 A;  4N2Q A;  2AVP A;  2WXH A;  2BF0 X;  1TJC A;  2KNH A;  3D9K A;  4L1B A;  2VSY A;  5F5H A;  3FP3 A;  3Q47 B;  1OKK A;  2LSV A;  4XZ4 A;  4QFV A;  4JVS A;  2PM7 A;  2JEK A;  4EBA G;  3TXM A;  3LLK A;  2WB2 A;  3DM9 B;  2Y3D A;  3NYM A;  4ATG A;  3EJN A;  4NY3 A;  2LAH A;  4OIN F;  3AS5 A;  2Y3B A;  1ZU4 A;  1JUQ A;  4PS8 A;  4EZJ A;  2PQN A;  2GRL A;  3EFO B;  4LEU A;  2C03 A;  5KYX A;  3EG9 A;  2IOQ A;  3SHF A;  1NP7 A;  3N0T A;  4A3V A;  5LCW C;  4AM9 A;  2NUP A;  4U5F E;  3ZYL A;  1ELK A;  3PRE A;  5L3Q A;  1E8Y A;  4WUY A;  3LY8 A;  3G2U A;  4Q5S F;  4FLB A;  4OIR F;  1VYK A;  5G04 C;  2KC7 A;  2XL4 A;  3R9A B;  5JHA A;  2I6H A;  3GZS A;  2FUL A;  5FCL A;  4IYP A;  3LNR A;  3LKU A;  5E75 A;  3RFY A;  4GZD A;  1Z5Z A;  2R7T A;  3S7J A;  2H7O A;  2UY1 B;  4E7Z A;  2A4Z A;  1XNF A;  3U64 A;  3CST A;  2RG8 A;  2J9U A;  3E4B A;  3FUK A;  1UJJ A;  4OIQ F;  2WXR A;  4MRU A;  5KYU B;  4BJ5 C;  3P1U A;  1BR4 A;  1TWG A;  1IQU A;  1OCC C;  3QB2 A;  1WY6 A;  3T6B A;  3FUI A;  4EZK A;  2W4B A;  1M2O A;  4WWN A;  3CQG B;  3Q49 B;  3FUL A;  4BTA A;  3ASH A;  4ANX A;  2J0X A;  2VH3 A;  4KBL A;  2XRH A;  2WXG A;  5FWQ A;  1ZU5 A;  1HX8 A;  3I4R B;  3RRN B;  1HFA A;  3RJV A;  4BT9 A;  4E7S A;  2XHE A;  4I2Z A;  2Y39 A;  4JA7 A;  3HLZ A;  4E6H A;  4YT2 A;  4FC8 A;  2V0P A;  4QI2 A;  3UT7 A;  5CI8 A;  4UI9 K;  2WXJ A;  4UWF A;  3FDQ A;  2OG2 A;  4O7G A;  3PS6 A;  1FTS A;  3G2S A;  1HH8 A;  2OVF A;  4GA2 A;  4FHJ A;  4U0S A;  4BFR A;  5LFA A;  3GW4 A;  4TRQ A;  3LCA A;  2CFU A;  2DIW A;  4LLC A;  3ZGQ A;  3B7U X;  2YHC A;  5CI9 A;  3AS4 A;  1TEZ A;  2L0T B;  4F4B A;  2WXM A;  2OOE A;  1ZHT A;  1U3C A;  3QJZ A;  3G2T A;  3Q4A B;  2HYZ A;  1H0A A;  3CVP A;  4J8E A;  4EPZ A;  4U5D E;  5BV1 A;  3Q6M A;  3CZ6 A;  1V54 C;  3T8M A;  2I2O A;  3CK9 A;  1FMV A;  4KZC A;  3JYH A;  3QOU A;  2R7U A;  3CK8 A;  2YHS A;  5FZS A;  5BUO A;  4ANV A;  1LVK A;  3HDX A;  1IHG A;  5KYY B;  3FUE A;  4G7H F;  3B0P A;  2V26 A;  4DBR A;  5FZR A;  1TJF A;  3SF4 A;  2A69 F;  1SMY F;  3ZW3 A;  4I9E A;  4H4K C;  3FEX A;  2X6H A;  3KS2 A;  3ZIM A;  3ZIB A;  3ZN3 A;  3MJW A;  3PDN A;  4DVZ A;  1SZI A;  4HOU A;  2GFH A;  2CNW A;  5A7D B;  3ASD A;  1ZYR F;  2IQC A;  1EF1 C;  2HR2 A;  2NC9 A;  1OKK D;  2L9J A;  3Q6N A;  2YEV A;  5KJN A;  4KT6 B;  4B94 A;  3FY4 A;  3UPV A;  2C0M A;  3FH5 A;  1M2V B;  4J8F A;  4CGV A;  5M72 A;  3OXL A;  1SF8 A;  5JJ6 A;  4GCO A;  3EG9 B;  3LPZ A;  4JPS A;  1E7V A;  3EIQ C;  3RIP A;  3MCX A;  4BJ5 A;  4AXH A;  2YQ8 A;  1SQM A;  1MND A;  5G04 J;  3M1C B;  4JEH A;  4APO A;  4N39 A;  3FHE A;  4GEH A;  1E8Z A;  3QWW A;  2C04 A;  4RD9 A;  4I6E A;  2FFH A;  3ASN C;  2IXO A;  1V55 C;  3GYZ A;  4JZA A;  4Y6C A;  3ZVR A;  1Z3I X;  4G26 A;  1ZHX A;  3ZHE A;  5E3C A;  3NG1 A;  4I2W A;  2CFZ A;  1MMG A;  3O6X A;  3OXF A;  3ML9 A;  2MYS A;  4PJL A;  3CHM A;  3FAJ A;  1JWG A;  3UMH A;  3PEU B;  2IFU A;  3JYS A;  3S7D A;  4CEM A;  3CHO A;  4DI4 A;  3S7F A;  5EX3 A;  4AK9 A;  3EZH A;  1UN8 A;  3CVN A;  3EIJ A;  1D1C A;  4WND A;  4U5H A;  1LKX A;  1G8X A;  2EIL C;  4KNV A;  4WWP A;  4BTB A;  2AXV A;  5LOZ A;  1JPL A;  3TG5 A;  4JHR A;  4I3M A;  3KL4 A;  5DQZ A;  2JD3 A;  5LX8 A;  2KCL A;  2Y3G A;  4J0U A;  2W45 A;  2ILR A;  3B7S A;  4XI9 A;  2XPI A;  4OYS A;  3ZFW A;  2XXA B;  2J9Q A;  3SZR A;  4L23 A;  4CIH A;  3UGP A;  4LRZ A;  4UWG A;  5G2N A;  3CKB A;  5DS4 A;  4G1T A;  4KVM A;  3FU6 A;  1MMD A;  4YT8 A;  3S2A A;  1NA3 A;  3IV0 A;  3X2Q C;  2NXP A;  1OCZ C;  2WZL A;  2OCC C;  1IYG A;  4APF A;  3IHY A;  3CHQ A;  2W9Y A;  5EHH A;  2J0W A;  5F5F A;  1KLX A;  2XRY A;  5IY5 C;  3PEV B;  3DD7 A;  5BUZ A;  4HOT A;  3EGX B;  1M56 C;  4GA1 A;  3ASF A;  3KAE A;  3LY9 A;  4O6F A;  4ILI A;  4NUR A;  2R7W A;  4G2V A;  4N3A A;  3CVU A;  2WVO A;  3VLE A;  5ANL A;  1FFH A;  3AQC A;  1VDY A;  3QKY A;  4G0H A;  5FJY A;  1NG1 A;  2E87 A;  5B1A C;  4CDM A;  3EGD B;  3ZRH A;  4RBN A;  3TGO A;  3CLJ A;  4LUN U;  2EIJ C;  4XLN F;  1TWH A;  3K1H A;  1IQR A;  4EWC A;  2V8S E;  3ECS A;  3L22 A;  2R7X A;  4BSX A;  2MWQ A;  2XXA A;  3HIZ A;  4BEJ A;  4GYT A;  3NDB B;  1SZA A;  2WPV A;  3EGX A;  4EEC A;  3MYV A;  4PK4 A;  2XGS A;  2H7V C;  2M63 A;  3APD A;  1BPO A;  1HU3 A;  2VYI A;  3KD7 A;  4CT4 A;  2LO6 A;  2E0I A;  2Q9A A;  4JCH A;  4CRW A;  4UI9 C;  3PUK A;  1NU9 C;  2J07 A;  4CS9 C;  4KZ0 A;  5T3T A;  4WNF A;  1PCX A;  3CVL A;  3IEG A;  1DNP A;  4BY6 A;  2J4D A;  4A2N B;  4GML A;  2A5U A;  3LJB A;  3RKV A;  3WG7 C;  4O79 A;  2I8B A;  4HE8 D;  1E90 A;  1E8X A;  2IYL D;  2BTD A;  2QTV A;  3CQC B;  5EKQ D;  2CNW D;  5A23 A;  5JJT A;  4P6I C;  1UJK A;  3FUJ A;  3CVY A;  1H6K A;  1M2V A;  3WOD F;  1ZHZ A;  2LSE A;  3DXJ F;  1H2V C;  2WM9 A;  3KKB A;  2CHZ A;  2IF4 A;  5DVW A;  4JC8 A;  4PDX A;  5B1B C;  3CK7 A;  3DBS A;  3CIA A;  3PNT B;  1WAO 1;  2FEZ A;  1DVP A;  4CDN A;  2ZU6 B;  5CMW A;  4MS6 A;  1Y8M A;  4PJJ A;  2E2E A;  1E7U A;  3IEE A;  3NF1 A;  3L0I A;  4FWV A;  4MLP A;  4Q69 A;  4XLP F;  5KYU A;  3K1I C;  2IXN A;  3LS0 A;  2YNQ A;  3MGB A;  4GZ6 A;  4U0Z A;  2ZPA A;  4JJG A;  4DLQ A;  5KJK A;  3VLF A;  2EQX A;  3LEV A;  4J8D A;  2ZXW C;  2XPZ A;  4H7X A;  2GW1 A;  5E3A A;  3SGH A;  2HM8 A;  4U07 A;  4LLE A;  2LNI A;  4FHK A;  3CHS A;  3LVR E;  3FUM A;  4GB9 A;  2G3V A;  2IU1 A;  3LJ3 A;  4IUL A;  3SYN A;  4C0E A;  2Z15 A;  3Q7L A;  1NZN A;  4XWJ A;  1UN9 A;  2VGX B;  3ABM C;  4CS9 A;  3ZPJ A;  4I1A A;  1FVH A;  3W2W A;  2V5F A;  2X38 A;  3LYA A;  3UNG C;  1O5H A;  2WVI A;  3HYM B;  3NKD A;  2CGE A;  3NYJ A;  2Y4T A;  5LCW J;  4U04 A;  1J8M F;  3FTY A;  4NRH B;  3CKC A;  3G2W A;  2HV7 A;  4U5C E;  4DK5 A;  3ZG1 A;  4KBQ A;  3PVL A;  2CHW A;  2W4M A;  3KMI A;  2UWJ G;  3SBS A;  4D10 C;  2WXO A;  2NUP B;  1MHQ A;  3B13 A;  3S7B A;  3GAN A;  4F3V A;  1JPJ A;  3DPD A;  3EQL F;  3S27 A;  2Y69 C;  5JHB A;  5AEN A;  2XEV A;  4UWH A;  4J6I A;  4Q96 A;  4B8C B;  4JA9 A;  4OD5 A;  2YZS A;  4YT5 A;  4KC9 A;  4GU5 A;  2ZXO A;  3S28 A;  3JQ0 A;  4J30 B;  3RU0 A;  3URZ A;  5FQ7 A;  1OWP A;  3N2Z B;  3D3M A;  1HS6 A;  1WGW A;  3I4U A;  2DCP A;  4A55 A;  2L0I A;  3B0V C;  4CCA A;  3AU4 A;  3VLD A;  5DS5 A;  4PUC A;  5FZQ A;  1D0Y A;  4AP2 A;  4C3D A;  2JLB A;  3NRH A;  1FVF A;  3EHM A;  4XTK A;  3CVX A;  3CHR A;  4KNW A;  3B7R L;  3MV3 B;  1Z6T A;  3T4R A;  3FH7 A;  3T5V A;  2WB7 A;  3CSK A;  4IAO A;  2WXL A;  2Q7F A;  2PF4 E;  1TWC A;  4GMJ A;  1NZE A;  3F46 A;  3MKQ B;  3RO2 A;  2PFD A;  1UG3 A;  4AY5 A;  2VSN A;  3FUN A;  2FBN A;  2A6H F;  4K03 A;  4AE4 A;  4HFK B;  2EIN C;  2X6I A;  2PX3 A;  2WXI A;  4FES A;  3T6J A;  2CDQ A;  4HOR A;  2PQR A;  4I44 A;  3W2V A;  3FFL A;  2Y3A A;  2HO1 A;  4K0D A;  4DPR A;  4HEA J;  2CW0 F;  4BJ1 A;  3NZS A;  3LXU X;  3ZXS A;  1ZBP A;  3O48 A;  5HQ8 A;  1SZ9 A;  2R7S A;  3RRU A;  1A17 A;  4UWK A;  3MKQ A;  1Z3X A;  2QY7 A;  3L16 A;  1HE8 A;  4GZC A;  3OXG A;  4C3B A;  2DGJ A;  3LAY A;  4G11 A;  4ANW A;  4J8S A;  2I9C A;  2MOW A;  3LES A;  4L7T A;  1B89 A;  3VTX A;  5FT9 A;  2DBA A;  2AXZ A;  1OWM A;  1GW6 A;  4HVB A;  4OD4 A;  2YHE A;  3TAX A;  4AV7 A;  3B0U X;  2V3C C;  5FQ8 A;  5ARG A;  5AJD A;  3UMI A;  4GAA A;  3HVE A;  3JUI A;  4Q4Z F;  2WQ7 A;  1OUV A;  4QDL A;  4PS3 A;  3MX3 A;  1W2W A;  2X6K A;  1D1B A;  3DAG A;  2J9V A;  1OCO C;  4BG0 A;  3RK6 A;  1INZ A;  4U8H A;  5FQ4 A;  4CS8 A;  1M57 C;  5KCM A;  5T8I A;  3QWP A;  2NUT B;  3UT8 A;  1VYI A;  2R7Q A;  4JJF A;  2XGM A;  2FGY A;  3KH2 A;  5DIZ A;  3JT1 A;  2BUG A;  3FU3 A;  2WMO A;  4ACK A;  4G23 A;  3ESK A;  2QFC A;  4JHK A;  3L34 A;  3ZEF A;  4RSY A;  4C3E A;  4JHJ A;  1OCR C;  3HTK C;  5B3S C;  4GYW A;  4W8K A;  3UR3 C;  1BR1 A;  3HJC A;  2X6J A;  2ION A;  2R17 C;  5DBK A;  5AJL A;  5E2Q A;  3GZ1 A;  2KZT B;  3V7O A;  5ANR A;  2X51 A;  3LDZ A;  4YWQ A;  1KT0 A;  2X3M A;  4FAD A;  4Q94 A;  4AX2 A;  4YVQ C;  4FJZ A;  2MHK A;  3OA1 A;  4URK A;  2WXK A;  4FA6 A;  2RD0 A;  1E96 B;  3VAY A;  5DLJ A;  4I43 A;  2V4L A;  3MA5 A;  1VMA A;  3CEQ A;  4TV3 A;  4EZL A;  2KM4 A;  4R7L A;  2J7P D;  1D1A A;  5D0O D;  3FEY A;  4XX5 A;  3L17 A;  5JJ7 A;  3CVV A;  4W9R A;  3EPV A;  1S7Z A;  4FU3 A;  3D9I A;  5G55 A;  1HZ4 A;  5KYN A;  3FTZ A;  4C7O B;  2AXU A;  1MNE A;  4KYO B;  5KYX B;  4O6M A;  2VQ2 A;  1HG2 A;  4G7Z F;  3DAF A;  1S0P A;  3JSZ A;  4CS7 A;  2ZXP A;  2NG1 A;  3FDH A;  1FMW A;  4HOQ A;  1MMA A;  4BJ6 C;  5BW8 C;  3OWT A;  2L6J A;  2VJ8 A;  3D9L A;  4PS7 A;  2PP4 A;  3BG1 B;  2IOS A;  4RG9 A;  1MQS A;  3MZL B;  3SZ7 A;  5A6C A;  4BJT A;  3OEO A;  4OVU A;  2HV6 A;  4WNE A;  1ST6 A;  4JXT A;  4CSA A;  5CMY A;  2KGO A;  2VAS A;  4JZY A;  3S0X A;  3SBT B;  2I1J A;  2G62 A;  2VSO E;  4WAF A;  3ABL C;  3E70 C;  2GRM A;  3C98 A;  4GA0 A;  3ZC4 A;  2ZXR A;  2NUT A;  1OWO A;  3FUH A;  5LP0 A;  5T3W A;  5D91 A;  2QY9 A;  3SNH A;  1PD1 A;  2C2L A;  3ENE A;  4ANU A;  3UMK A;  3SNX A;  4UI9 J;  2Q9B A;  1Z23 A;  2WXP A;  3VTY A;  4DJA A;  5HI7 A;  2WXF A;  3EDT B;  4ANJ A;  2IJG X;  4IN3 B;  2IOL A;  2PL2 A;  3L54 A;  2WL8 A;  3FWV A;  5KJL A;  1KU2 A;  4GCN A;  1Z3Y A;  4P29 A;  3EFO A;  2OVB A;  4C9B B;  1HO8 A;  2H7B A;  3PE3 A;  4O6Y A;  4EBA A;  4DVY P;  3QZC A;  3SI5 A;  5HSW A;  1ZHW A;  3U9W A;  4HFG A;  3UX4 A;  3PH0 C;  2XRZ A;  1MMN A;  3L08 A;  2FO7 A;  3ONK A;  3RIB A;  3FTW A;  3RH3 A;  1D0Z A;  4V3I A;  4AIF A;  4XIF A;  2A6E F;  2WVN A;  3ML8 A;  4G25 A;  3FU0 A;  2Q9C A;  4AE4 B;  3LLI A;  1TKN A;  3K9I A;  3JRT A;  1EPU A;  3MV2 B;  4ACL A;  5KJM A;  2B0J A;  3MLG A;  1TR2 A;  3R7Q A;  5C2Y A;  3I5Q A;  5ENN A;  4AEZ C;  2IXM A;  3ASO C;  3O39 A;  1O87 A;  4A1S A;  3TJP A;  4Q7C A;  4PFO A;  2KZT A;  4MQ9 F;  3ASG A;  3CR3 A;  3N24 A;  4AJW A;  4YVO A;  4N2S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...