4I1MA

Crystal structure of the legionella pneumophila gap domain of lepb
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
297
structure length
285
Chain Sequence
SILELKPLTLLMTSSTSFSETINQWADILKTTDMEKFSFDSNPINLLELVKQFNLYVDELAITCEANNVWATPNLFALYDNSGGEAIHGHAFVPYYKESIVLRRLFTVDPNTFNLSRFAAFEGPCQLYCAAHADSAWVKIQTLLTLGNGIINTLKIIKQAQAFGIDEAVTENLKALKEQFIAFQLAEADIKESLKAPSNKESEFFYPIDEKALAKMNGYQLATICLEELNSPKPSPLIERILSNKKFWKRINSAFESGVFKGRTDDPAGKIAKIREWHQLLQISG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords LepB
publication title Mechanism of Rab1b deactivation by the Legionella pneumophila GAP LepB.
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila
total genus 104
structure length 285
sequence length 297
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18172 LepB_GAP_N LepB GAP domain N-terminal subdomain
A PF18227 LepB_GAP_C LepB GAP domain C-terminal subdomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1700 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4i1mA01
1.25.40.830 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4i1mA02
4IRUA 4I1MA 4I1OB 4JW1A 4JVSA
chains in the Genus database with same CATH superfamily
5E33A 5J90A 1SZIA 4C7OA 1K1AA 5JMND 2YL1A 2NXPA 3CEXA 3APDA 5ENTD 5JP7A 1FPPA 2LO6A 4AE4B 3FXHA 3OXGA 3LEVA 5FINA 4WUYA 4HEAJ 4GZDA 1XNFA 1G4US 2OJQA 2LSEA 4FLBA 5CRVA 2R5SA 3Q49B 5ANRA 2GW1A 3WHNA 1OCOC 2YEVA 4M7CA 1MMAA 2LIGA 5ENQD 1RXQA 1APCA 3R9MA 3LNMB 3TOLA 1QZ2A 3DEOA 2BC5A 2Y4UA 4N3CA 1OKKA 3SO8A 4KYOB 3R7CA 1LI5A 4P29A 1TR4A 4QDLA 3FUHA 5BXOA 4PJLA 4I6JA 3AJIA 4I17A 3GZ2A 5CRUA 3DZAA 3CQZA 5ARGA 4NQFA 4LCTA 3B13A 3NG1A 4JHJA 4FWVA 4GMJA 1NZEA 1OT8A 3U66A 1M2VA 5D66A 1D0YA 4D4XA 4CSAA 3LUTB 3SZ7A 4LNBA 2R7VA 2VSOE 2VASA 5LCWC 3L54A 2P58C 3UI2A 2ZXPA 3FEYA 4PK4A 3LAYA 4I1MA 2WXNA 2ZU6B 4I1OB 2WVOA 2XLHA 5AYWD 3FH7A 4GTRA 1CPQA 2NG1A 2HO1A 1OCCC 4BEMJ 4FJZA 2KQ9A 3PH0C 4UDVA 2XQ0A 5AENA 4DX2A 2XCBA 2HYZA 2DGJA 2JLBA 3QW1A 3CQGB 4KBQA 2LAIA 1A17A 4I44A 2XENA 3TK0A 5HSWA 3S7DA 2LQGA 2OOCA 4HBDA 1C03A 2P9SG 5L3QA 2DBAA 5E3AA 4DVZA 4GZ3A 4JXTA 4TXQA 5T3WA 3FTWA 4GB9A 1H6KA 4ULWA 3EFOB 3TJ6A 4DRIB 2X6FA 2M4EA 4BT8A 5A23A 2AVPA 1U3CA 5DS6A 5DQZA 2J7PA 4L2LA 3CVWA 3IV0A 3PEVB 3FTXA 4WNFA 5EYPF 2JEKA 3RO2A 2EIJC 2PFDA 1AP7A 4BSZB 2GFHA 2V5QC 3BG1B 4JURI 3HXFA 1PC2A 3E30A 4ANXA 3JUIA 1OUVA 5DVWA 3FUEA 4CCAA 1PV3A 5G05J 4N2SA 2PX3A 2XM4A 3FU3A 5JHAA 1U0BB 1W2WA 4QI0A 4YN0B 1MX2A 1PCXA 2I1KA 4PH4B 1ZBPA 4DRHB 3LEWA 1DOVA 3ZGQA 1LTXA 2QYJA 3QMKA 1QLEC 3CR3A 4GYTA 4MVZA 2XXAB 2UY1A 5AJDA 1N9AA 3LVQE 2CDQA 3FOOA 4JJGA 2BUGA 5B3SC 2G3VA 2Y4TA 5AJLA 5A6CA 3D9PA 4HRMB 3MA5A 2X6KA 4XI0A 3G2SA 1Z6AA 3W8IA 2OV8A 2KCKA 1HZ4A 3V5YA 2HM8A 1E8XA 2M63A 3S28A 4AOFA 3LXUX 4U5BE 3H2UA 4YT2A 1LKXA 2AU5A 2GRLA 4AL0A 4BJ5A 3PZ1A 3EGXA 2C03A 4YT5A 4JEHA 4NY3A 4G2VA 3QDNA 3DSXA 4XTKA 2V4LA 2RD9A 2M64A 4I2WA 1OCZE 1DVPA 3UTMA 3L22A 4ZLDA 3ZN3A 2IOSA 3T8KA 3FUIA 2KZTB 1VYKA 2EINC 4CJGA 2ILRA 3US6A 3I3NA 4P9TA 3DE9A 4J7TA 1YA7O 2IOQA 3E9VA 2Q7RA 1Y8MA 3UMIA 4EHMA 4GQHA 5KYXB 3L6AA 5E3CA 4ULVA 4UQZA 1SA4A 1OQCA 2YQ8A 4HRLA 3V7OA 2YLDA 3I5QA 2AXVA 4I1AA 1FFHA 1RMVA 3AG1C 3FMSA 3L08A 4E7ZA 1FNTc 4PJNA 3LY9A 3FOPA 4X0RA 5F28E 5CEAA 3POVA 3PRZA 4TV3A 2WXRA 4D4NA 3PDNA 3MYFA 1QYMA 3WAQA 2VQ2A 1CPRA 1I4YA 3DXJF 3EGDB 1C17M 4IAOA 4U5EE 3Q79A 4BJ6A 1DNPA 1L5JA 2QYUA 2DYSE 3DAFA 2XCCA 3MCXA 2EPOA 3SXYA 5JS5A 1RZ4A 2Y3AA 3CIAA 4RG9A 1JCRA 1R4TA 1S70B 5KCMA 4K5AB 3NAWA 5KYYA 4PJMA 2XRZA 3DMDA 4YL1A 3CEQA 1L7CA 3ASFA 3ABMC 4H54A 1MQVA 3RQFA 4K0RA 1MNDA 5BXUA 5LP0A 4N2QA 5L0GA 3B7RL 3G2TA 4JCHA 4J0UA 4JE9A 3U3FA 2IF4A 2OQMA 1OR3A 2DYRC 3FDHA 3KEZA 2LSUA 3T9KA 3LY8A 3S7FA 4IAQA 1N4QA 4A2NB 1KT1A 4ATGA 1ZW2A 3RSEG 1A7EA 3TQOA 3AG3E 1O5HA 1ZW3A 3ZDLA 1BR4A 4A1GA 4BFRA 3W2WA 3K1HA 2DI3A 1UW4B 4UUCA 1D9SA 4H7XA 4QI2A 2XLOA 1F1MA 2YHCA 4LDRA 2ZXWE 2IOLA 3LDZA 2J8WA 4RDAA 3ZHEA 2B0HA 4OIOF 1JMWA 1IZMA 3DPYA 2R59A 5DIZA 1OW6A 3F6QA 2Q00A 2X3MA 3KYJA 3NKEA 4MBGA 3UNGC 5BNWA 1FT1A 3R2PA 1H9GA 2J9VA 4O79A 1Z7Qc 5JRAA 3FAPB 3KMIA 3L9TA 4GPMA 3E4BA 3LYAA 3EZHA 3EU9A 3ZVVA 4PS3A 3QARA 1V55C 5T3RA 3ZRHA 3ESKA 1JAFA 3M1CB 3AU5A 2R05A 1BR2A 1QPUA 4MRUA 4N3BA 4CT4A 1TFKB 3V31A 3D9IA 3TGOA 5COFA 2VGEA 1SW6A 4DBQA 5KYUB 1GW6A 3EIQC 4XEIG 3EDTB 4B94A 2Z15A 5B1AC 2XLMA 1Z3YA 4JHKA 3QVZA 1TN7A 5HRYA 3ONLA 3ONKA 3Q73A 1E7VA 4GTVA 4OVVA 2H7BA 3EZIA 3E32A 3NYLA 1Z3XA 3ULQA 2CG2A 5L0IA 4CSAC 5ENPD 2CCYA 2X6JA 3I4GA 3Q6NA 3S0XA 3T9OA 4LUNU 5FIOA 3OA1A 4DJ9A 2J07A 1DCQA 3AGUA 1E83A 3PS6A 2DZNA 4P6IC 3FP3A 2B0JA 2IFUA 2IBFA 3RRUA 1O87A 5AAOA 1B68A 1TKNA 3RO3A 3DD7A 1TNOA 4C0MA 4JD2G 1H2VC 3L82A 4YWQA 5BQIA 2LNIA 3KKBA 5IY5C 2TMVP 2J9QA 5DLJA 3EHQA 3EHNA 4GPKA 2J9WA 4YNDA 4URKA 2YL7A 3ZWIA 1N54A 3I4UA 4PFPA 2A5EA 2VYIA 3QC1A 1TYQG 2CYDA 5KWDA 4DLQA 2EILE 5EIBE 4HFKB 1EPUA 3L8JA 2QFCA 2NPUA 3QWVA 3AJMA 3ITFA 2C2LA 5EN5D 3NBNB 4NTBA 3RW0A 1VLSA 2VTBB 2KSFA 1NI1A 5AQAA 2NSGA 1JOGA 1YVIA 3NF1A 3FHDA 1N95A 2JD3A 5JVEA 4FESA 1ZB1A 4IGGA 2YNQA 4CJOA 2A68F 1N4RA 1OW7A 5FQ7A 3CVLA 4NC3A 5BQGA 4BJTA 2O9XA 4B93B 1A0BA 2FI7A 4ILGA 4JEAA 4GA0A 3G4XA 3ZQYA 4AIFA 5FZTA 1DOWA 4N3AA 4UI9K 4F7AA 3CHPA 3H2VA 2F22A 2WXLA 4EBAG 1E2XA 3UR3C 4O6MA 3TWUA 4WWNA 2VSYA 3GEEA 1IKND 3M15A 4IWBA 1NL4A 3JRMO 1U2VG 1MZCA 3TJPA 2QC9A 3BUAA 4G0HA 1ZHWA 3G2WA 2FFHA 2FO1E 2XLWA 1D1BA 3C8GD 3HRAA 4U8HA 2G62A 2X6IA 1OCOE 5FJYA 3RIBA 2IONA 3B7BA 4RBNA 4ZHBA 4IARA 1ZU2A 4Q69A 3FWVA 1Q0FA 1UOHA 3SFZA 3ASOC 2H7VC 3JXJA 1RW2A 2VSNA 3SFYA 5JT4A 2NC9A 2NYJA 3CLJA 4KXKB 3FUJA 2ZXRA 4GTTA 3MKQB 4ANVA 2XPZA 3D9LA 2WQ7A 2W45A 1JPJA 4G7HF 4OIQF 3DPDA 4Z9IA 5DQTA 3SGHA 1OXJA 3DSSA 1SQMA 4YDEA 4KZ0A 4DJAA 2I8BA 4FHKA 3SI5A 5COMA 4BEJA 3ZXSA 4ACKA 3CSKA 1ORSC 1H19A 1HS6A 3CHOA 2Y3DA 4MS2A 2R7UA 2V4HC 3ZW3A 4ANUA 2J4DA 5D0QD 1UJJA 3W4YA 1N1CA 3ZNGA 3HXBA 2XEVA 4N5CA 1YA0A 3CQCB 3HXEA 4DX5D 3RJVA 5CECB 2ASRA 4JW1A 2HZ8A 3LESA 5JA4D 5AGFA 3M4CA 1OCCE 1KNYA 3TWWA 1NP7A 4WJ0A 4CDRA 1SZ9A 1WAO1 2XRYA 5EYLA 3O39A 3FUDA 2PX0A 3T4RA 2YLGA 3K1IA 1K05A 2Y3HA 3AG4C 1VB5A 5FTPA 2WMNA 4BJ6C 3DWWA 3M79A 5F5HA 5AARA 4MVMA 1BBHA 3EUVA 4JC8A 1JR8A 4AX2A 3HNIA 3G2VA 5G04J 3UKRG 2FO7A 4JA7A 4ILHB 4YL3A 2W4MA 2R7SA 4XLNF 1FFTC 1W3BA 3AS8A 5BQHA 4U9EA 5DBKA 1N52A 2GWWA 5T1DB 3HVEA 1Z3IX 4GCOA 3EG9A 2L6HA 4WABA 5CBOA 2YRFA 4XLPF 4OYSA 2Y0BG 4KVMA 2EIJE 4CEMA 1RJ9A 5JUAA 2L9JA 3VF0A 2QY7A 3PZ2A 4C3DA 5E75A 4QQIA 4AE4A 4C3EA 3NMJA 3FUMA 1H9TA 2IO2C 3EIJA 1YLMA 2LP4A 1J8MF 2XL4A 3WG7C 2VCBA 3FAJA 1N0RA 4HI9A 3FTVA 4AY5A 4G26A 1VLTA 3C8GA 5EDSA 4UQYA 4CS9A 4EHPA 3GM2A 5D91A 2AXZA 1RKCA 2NSFA 4G8LA 2Q3TA 4G24A 4N4WA 2NUTA 2EIMC 2ZGGA 3RVYA 3GEHA 5B3SE 3MEKA 1Q0DA 2XL6A 3VLEA 2B0OE 1E96B 5JJTA 2AVKA 1YYJA 1DCEA 1V74B 2R25A 1LS4A 3ABKC 5H7PA 1D1AA 4GTOA 2XS8A 3F46A 4G1TA 3EHMA 3LJNA 2IYLD 3CHMA 2R7RA 5GPGB 3T6JA 3MKRA 4G23A 2R7OA 5KJKA 3E37A 1MMDA 5ENNA 4E6HA 2EPKX 3J5PA 3I5PA 3CK7A 3SF4A 1A5EA 1KZOA 1KPSB 3FTYA 4GZ6A 3ZEFA 2R17C 2WXGA 4C7OB 5EX3A 2A6HF 2EINE 4BETA 4TRQA 3DXMG 4EBBA 3O6XA 2WXHA 1LE4A 1L3PA 4OIPF 4EPZA 3KEAA 2J08A 5JLIA 2L6GA 2ZGDA 5LCWJ 3AG1E 3JQ0A 4A3VA 4O1PA 3SHFA 5HQ8A 1Q0MA 2A5UA 1FMVA 1NA3A 4XIFA 3BEEA 3UT4A 2WZLA 3SBTB 4CGWA 5BV0A 2D5RB 4F3VA 4HS2A 2XRHA 4ANWA 5CBNA 5CMWA 3ZYKA 5D0OD 1TNZA 3HNJA 1LE2A 4CX9A 4FP7A 1E7UA 1E8ZA 2XHEA 5A69A 4K5BA 3NOGD 4M3OA 1C02A 2BF0X 4YVOA 2P9PG 2KYHA 1Z63A 3PREA 3SYNA 1HG5A 5K0IA 4DX7D 1M2VB 1BDJB 3DI5A 3JZ0A 2ETCA 1KTMA 5EKQD 3ABME 1MYOA 5D92A 4J8SA 3PHF2 4K1OA 3ASHA 3Q9NC 4JA9A 3RF3A 3CV0A 2E2EA 3URZA 3D9KA 1ORJA 3ISMC 4MTGA 3GZ1A 3TXMA 3I4RB 1ELKA 2P0NA 3V2XA 2XM0A 5ENSD 4CS8A 3ZKJA 4G8KA 2CFZA 1FT2A 1N11A 5A6BA 4CDAA 2FEZA 4K0DA 2KCVA 2FULA 1CGNA 3C98A 3IHVA 3QOUA 3NZSA 4Q94A 1S0PA 5KBAA 4FHJA 1VMAA 1PAQA 2J8SD 4MVOA 3TULA 1TWCA 1Y6IA 5C1DA 2LFDA 3SXMA 4F4BA 1JUQA 4L7TA 4DI4A 1ELRA 3RQGA 4BSXA 1A41A 3FH5A 4ZLCA 4NCQA 4HLLA 4EWCA 3CVYA 4E7SA 3MLGA 5FQ8A 5CEDB 1TWHA 3DSTA 2XEEA 3UXGA 3RAUA 3S7JA 3PE3A 3SBSA 4WWOA 2KGOA 3GM1A 2EPLX 2MWQA 2R02A 3AG2C 2CHWA 1EA8A 4KZCA 1TR2A 3Q7AA 1D1CA 3UIPC 1R5ID 3JTLO 1OWNA 1V55E 3O55A 4GAAA 3AQBA 4ATZD 4CGVA 4A63B 2P9LG 1LI7A 3LY7A 4EIYA 4V3IA 4JHRA 1KZPA 4JKVA 3V5ZA 3UMHA 4HE8D 3W9FA 2P9NG 1G5ZA 2IU1A 2J49A 1HE1A 2X51A 5B1AE 5J08A 4I9CA 3R9AB 1E86A 3GYZA 3P2BA 4WNDA 3RH3A 1YMPA 4MVRA 4N5QA 4ER9A 1IQRA 3ABLC 3DWLG 4KC9A 4B8AA 1U6HA 3TWXA 2R7WA 4DXWA 3FEXA 4KBLA 3AS5A 4RQIA 3F47A 3CVUA 4F6RD 2H6GA 4JIOA 3RU0A 1YCSB 2I2OA 4XZ4A 3G4ZA 1NFNA 2GRRB 1YDIA 3FHEA 4J7YA 3LNRA 4BEPA 5IY5E 3K6BA 4KMOA 2WZGA 3NRHA 3S84A 2WB2A 5EHHA 3FFLA 3EGXB 4TUMA 3L17A 3DM5A 4JVSA 2BE5F 2A0UA 3MJWA 3ZQVA 2BL2A 3IEEA 1V54C 2WZFA 4J8DA 4KNVA 5CCLA 5KNHD 3IHYA 2PQNA 3ZFWA 4QFVA 1O5MA 5TJ5E 4TXPA 3DKAA 4DX1A 4GEHA 4WGYA 2KCLA 3T5XA 3APFA 1IW7F 2PM7A 2ETSA 2GRMA 1QKRA 3CGHA 4DPRA 4NTAA 3V2OA 2P1AA 2DCPA 4XWJA 3U3WA 4U5HA 4Z68A 2HV6A 4E0HA 3T8MA 3KS2A 2KNHA 4W8PA 1OWMA 2NUPB 2J9BA 1MQSA 2LXMA 4GU5A 5KJNA 3DAGA 3AU4A 2XZTG 1VDYA 3LVRE 1RKEA 1OXKA 2VGYA 3FULA 4YL0A 4HI8A 3AOUA 2L0IA 3S29A 2HUJA 2KC7A 2WXQA 1CGME 5FWQA 3SXZA 4YT4A 4CDVA 4CS9C 2H6HA 4EZLA 1UN9A 3C18A 1OXBA 5LOZA 2P9UG 2VCCA 2J9UA 3L8IA 3LKUA 2ZD9A 3APCA 4XKBA 3LJ3A 4L2YA 3W2VA 4I2ZA 4GMLA 2VJ8A 2A4ZA 2EPMX 2MHRA 3ASOE 1JCSA 4ME2A 2L81A 3Q15A 5KYWA 2GRQB 2Y1LE 3HXDA 4UWKA 4F1SA 1LD7A 1TQGA 1K3ZD 2HV7A 3UM1A 2CW0F 1TNYA 5HS0A 1AEPA 1E84A 3MV2B 3T6GB 2OEVA 3CVQA 3UM3A 1Q0GA 3C7JA 3L1MA 2CHZA 3AGTA 3GODA 5KJLA 2ICWG 4XEKA 2OCCC 4CS7A 5A6AA 1I4ZA 3D9HA 3EHRA 2ZPAA 2GGFA 4DLOA 3ENEA 4CT0A 4J6IA 1GM5A 4NQ0A 4B6IA 4KVOA 2P7VA 2P61A 4JRZA 1P5QA 3ZHEB 3UX4A 1AVOB 2XEHA 3CHQA 3KPHA 3N2ZB 3CVXA 2L6FA 1MHQA 1ZU4A 3D3MA 4FX5A 3B9QA 2MHKA 4H7YA 5FZQA 4RSYA 1S63A 4OD4A 3UIOC 2YWAA 1YARO 2XSEA 2A0BA 1XZPA 5AN8A 4AV7A 3U3BA 1ZVZA 4I43A 2CNWD 2Y69E 2LD6A 1JPLA 3CKCA 1OCZC 4TXRA 1ST6A 1TEZA 3AG4E 4AY6A 2YQYA 2AP3A 3B29A 3WXXA 5HI7A 5HKPA 3ZYMA 1SA5A 3QB2A 1XWJA 2HSBA 2Q9AA 3JRTA 1VTMP 4HORA 3N71A 2PNNA 3MZLB 3MX3A 2LK4A 3MYIA 3UGOA 5JHBA 4HNAD 1K04A 1HFAA 1QSPA 2VGXB 5AQ7A 2WMOA 5EX0A 1O1SA 1QBQA 1D8EA 3BQOA 4L9PA 2A6EF 4FJYA 3BU8A 2QTVA 4WNGA 1FVFA 4CBEA 4YVQC 2KM4A 2AJAA 3PE4A 2V0PA 2XPIA 3RVZA 3LLKA 4GTMA 3FUFA 2YVKA 3V30A 3ZYQA 2Q9BA 3DSWA 4R7LA 3QVYA 1HMDA 2DYSC 2NSZA 3QWPA 4WAFA 1TN8A 4H4KC 5B1BC 1UG3A 3WG7E 1LPEA 3ZC4A 3ZU7B 3ML9A 1T5OA 4LSZE 3FVYA 4HVBA 1U89A 3C3QA 4LLCA 4BX8A 3NYJA 4GZCA 3J06A 4EBAA 5HV9A 2UWJG 1YAUO 1YA9A 5G05C 4JPSA 4Z9HA 1S64A 3NOCD 2EIKC 2EIME 3PNTB 4BERA 3UT8A 3LS1A 4XPYA 4Q5SF 4EBJA 5LFAA 1WN0A 3MKQA 3X2QC 1EF1C 3Q47B 3PMRA 3ZTZA 4HOSA 1GS9A 1K8KG 3ABKE 3S90A 4A4AA 3IQCA 1OWLA 3FU6A 4IB4A 4FC8A 3GWNA 2KJGA 3OXFA 1AWCB 1ZHYA 4LNUD 1GQAA 3Q9UC 4F1PA 4BJ5C 1G8XA 1MNEA 1M2OA 2RFMA 2OVFA 1SR2A 1ZYRF 4O7GA 1EQ1A 2XPYA 4U5FE 2VB6A 3ZUVB 4KNWA 4WWPA 2IY0C 2RKKA 4O60A 4G7ZF 2D4UA 3LS8A 2RSEB 2WM9A 3PEUB 1H2TC 2WXFA 2XLEA 1ELWA 3B95A 4P9FA 4AP2A 4BT9A 1BLXB 1HG2A 3BG0B 4MQ9F 2CNWA 3ECSA 2V8SE 3IXEA 1S7ZA 1HF8A 4MKTA 3CKBA 2OEWA 2J4BA 4J32B 3VTYA 2KATA 4U8VD 3VRCA 1ZHXA 1OKKD 2R9RB 3M4BA 3NMKA 3TG4A 5JJ7A 4FADA 2YKZA 4CDYA 4Y6WA 4E17A 2LSVA 2XLVA 3IQ6A 4N39A 3LLIA 4LEUA 2DVWA 3PNLB 2IXNA 4JTCB 2XGSA 2H6IA 3FTZA 3U0CA 1JWFA 4JZAA 2ONDA 1MMGA 4CIHA 1BI7B 1HX8A 4MVUA 5T4YA 3C3OA 3UM2A 3IBEA 1MX4A 4HOUA 1ORYA 1SMYF 2C04A 2C0MA 1T6QA 1LD8A 2CGEA 3E70C 3K33A 4OIRF 1E85A 3SXKA 2R7QA 2CFUA 1D8DA 3HYMB 3CVPA 1VK5A 3UINC 3U2LA 3ML8A 3O48A 5L0CA 3DEPA 1X81A 3PUKA 3TJ5A 2YL3A 3ZTMA 3ESLA 3B0VC 4MVQA 1INZA 2L7AA 4FA6A 2IJGX 4GYOA 4U9DA 3ASNC 1T9KA 4GTSA 2WVNA 2HJMA 4AK9A 2L6BA 2ZIRA 4BJ1A 2Q4FA 1KLXA 4C3BA 4XX5A 4HXIA 3DSVA 4RLYA 4F53A 4YDYA 1J8YF 1ZHZA 1N94A 5EILA 4L6RA 3V79K 2G3KA 4K7BA 4ONSA 3R7RA 3PZ4A 1FTSA 5CIVA 2DIWA 3U4TA 1QVXA 1HW2A 4NTFA 3S7BA 2LFFA 2Y3BA 4DOZA 3Q6MA 4JEBA 2J7PD 3WODF 1JCQA 4DVYP 3HVEB 3GM3A 3AG2E 4AEZC 1OCRC 3DJNB 1Z5ZA 3IPMO 3Q78A 3EU5A 4XKCA 1RJ9B 4NURA 2R03A 3JCUQ 1E8YA 1EI7A 1CGOA 3FDQA 4U8YD 4LDKA 3D9MA 2MYOA 4KI2A 2H8AA 1JRAA 1E8WA 3KAEA 5KYNA 2OJED 4LACB 3KSLA 4DUIA 3C72A 2XL8A 5T8IA 3RRMB 3E33A 3C8GB 4I9EA 4M63A 3U9MA 3ABLE 3TL5A 3RKVA 1H6OA 3RIPA 2JABA 5JJ6A 2WVQA 1G4WR 2MOWA 2NUTB 3SY2A 4XPWA 3HXCA 4I6EA 3ZPJA 1XGWA 3ATPA 4GA2A 1YYHA 3DRAA 3KYIA 1WDYA 3S9OA 4HOQA 4U5CE 4UWFA 2QY9A 4N6HA 4AXHA 3D9OA 3G2UA 4G11A 3R7QA 1WATA 4APOA 4YK5A 2V3CC 2WXPA 4J7WA 3Q7FA 5FT9A 4K5CA 2WPVA 4UWLA 3VTXA 4CZ2D 5BT1A 3VAYA 1B89A 5BV1A 4E85A 4FLHA 3EFOA 4LG6A 4CRWA 3BRJA 3JT1A 3TOMA 2WXKA 4K03A 3U2MA 3OAWA 4GA1A 2PQRA 1V54E 4AVXA 4MW8A 3EJNA 2WQHA 4Q96A 5BPPA 1ZZPA 2WB7A 1HE9A 4OD5A 1BZ4A 1NA0A 3ASGA 3L13A 4GYYA 2MYSA 4MW3A 4L23A 5BW8C 2AWIA 3UMVA 3HLZA 2VH3A 1NFIE 4X8QA 5L0JA 4CIPA 2V26A 256BA 2E87A 3NZUA 3FUKA 2AW6A 3TD7A 1TNBA 2HMZA 4EQFA 3O4ZA 2Y3GA 3QNKA 3Q7GA 1HXIA 3VM6A 2MRIA 2DYRE 1YZCA 1NBBA 4U0ZA 4IULA 2LCHA 3QK0A 5AIJA 1SZAA 3GWLA 3L0IA 2J46A 4DRJB 3PUJA 1TJCA 2XXAA 3LS0A 1QNFA 1OR2A 2C0LA 4B0ZA 5EIDA 1KT0A 3S27A 4LDQA 5COGA 4A55A 2IXOA 3DJUB 1HO8A 3HNKA 2OVBA 4HRNA 2PF4E 2RFAA 4I3MA 5FQ4A 2AWCA 4O6FA 1T01A 3PDMP 3GEIA 1Q0KA 3JQ1A 4RD9A 2ETBA 3U8VA 3ZIBA 4APFA 4G78A 3Q7LA 5CHEE 3QWWA 3QAQA 1Y4CA 1PD1A 2OOEA 5EK0A 2Q7FA 2UUHA 2KK1A 3C8ZA 1GGQA 4FAPB 1YZAA 4EBKA 4L1BA 4HOTA 5L3VA 3MV3B 2GROB 3B7SA 3HTKC 5DS5A 4IYPA 3HG0D 2KZTA 3KSQA 5D2MC 2F8YA 2OCCE 3NB2A 4PS7A 3U5SA 1OWOA 4PDXA 4PS8A 3W9GA 2XGOA 1EKYA 1IXVA 5KYXA 2RD0A 4U7EB 3RFYA 3QW0A 4HB5A 4FU3A 4ILIA 1PD0A 5CI9A 2ZISA 3LEOA 1H7IA 4JTAB 2P6VA 5DS4A 1H0AA 1K40A 2QNLA 3TWSA 2F8XK 2XGMA 4EUKB 5B3IA 3TXNA 2HE0A 5FQ6A 1QZXA 2WQ6A 5CI8A 2E0IA 3NMIA 4U0SA 1IHGA 3TG5A 4JCZA 2DZOA 4MTFA 2UY1B 1M56C 3BEHA 1FAPB 3ULEG 4BWRA 3EGDA 2KBXA 5BUZA 3OTNA 1ZU5A 2WXIA 1S05A 2GDCA 2YLIA 3IQTA 2CG3A 4ZFHA 3IHUA 2PNOA 3K66A 4U0UA 4EZKA 3B7UX 2OU6A 2AWYA 2JX0A 3KH2A 4HFGA 4PR9A 4U95D 5E76A 2ZXOA 4C9BB 4DK5A 3FUNA 4I6GA 3K1IC 1NU7D 5L0FA 4HQDA 5G2NA 4MNDA 4YT8A 3FU5A 4DBRA 4JZYA 4GTQA 3JYHA 3SQVA 3W8HA 2XLDA 2NUPA 4HLEA 5AC5A 4G25A 2YL0A 3L34A 2X0CA 1WOLA 2J0XA 3TWTA 4E0IA 3TWQA 3K7DA 5G04C 2X6HA 4GCNA 1NU9C 2A69F 3Q4AB 2QE9A 2L6JA 4JL0A 4PUCA 4BY6A 2X38A 3B7TA 4EECA 5M72A 4JJFA 4O6NA 5CMYA 3TWRA 5B1BE 3U9WA 2L0TB 4U5DE 4AL1A 4GMRA 3JUEA 3B0UX 4C48B 3JXIA 5ARFA 1UJKA 4JTDB 1K1BA 4MVSA 5BUOA 3RK6A 2OKUA 2J09A 3MYVA 2EIKE 4CDMA 1BD8A 3RQEA 1Z6TA 3KD7A 4UI9C 3X2QE 4YJWA 3SZRA 1WM5A 5FCLA 2YINA 2EPNA 1O1RA 1YJGA 2OEXA 4KT6B 3T6BA 1O1TA 1D0XA 4OAUC 2WXOA 5KYYB 3SD5A 4NIKA 4BTAA 4B8CB 3T5VA 5E2QA 3ASDA 4E18A 3LJBA 3Q5MA 1M57C 4PFOA 2P2CP 1KU2A 1DC2A 3NQPA 1TFOB 3B71A 5KYUA 4UWHA 4XI9A 3UM0A 4WNEA 5LX8A 3L16A 2WXMA 3RYLA 2PM6A 2JPUA 4JB8P 2XZDG 3VYWA 2EQXA 5ITZF 2F0YA 1MX6A 1RKEB 2R7TA 4Q7CA 5ENOD 3ZXPA 5EGYA 3HNLA 4N6CA 3NDBB 5KNGA 1O3UA 4OINF 2VC9A 3OXLA 4ANJA 3GORA 4LRZA 3GANA 1IQUA 2IEJA 3EH2A 4JC7A 3MBGA 2ETAA 1IHBA 1HH8A 2B6CA 1H6GA 3DE8A 3HKKA 3JYSA 4ABNA 1LS1A 2PL2A 3V5XA 1NLXA 2Q9CA 3CVVA 3C3RA 4J8YA 1BI8B 3QJZA 2HFIA 5KYWB 2P9IG 1OY3D 2BEDA 3OEOA 3DSUA 2YZSA 1WG0A 3IKOB 4EZJA 2HSQA 1NFOA 3MFNA 1TN6A 2LXLA 3JSZA 1A7DA 4PACA 3TWVA 3VLDA 1QQ3A 2VGXA 2VTBA 2GA0A 3IEGA 2KXPC 4FULA 4XE0A 3GW4A 3ZIMA 5A6KA 4GZ5A 4DX6D 3CHSA 3ZYLA 4ACLA 2GRPB 3A11A 1E90A 2HJ3A 2L9BA 1WGWA 2I15A 4W8KA 1XZQA 3D9JA 4XEVA 3A9CA 4JEUA 4WGZA 1SYQA 3GZSA 1I5NA 4YDWA 3TAXA 4BX9A 3UGPA 3N0TA 5A7DB 2QLAA 5L0DA 2YHSA 4OAVB 4J30B 1OW8A 1HMOA 5AQBA 3X1OA 2Y39A 1WTYA 2WL8A 3JSEO 1T6UA 5AQ9A 5T3TA 2IM8A 3PCVA 2AXUA 3K9IA 4GTPA 4XEFA 1TJFA 2QZAA 4BPMA 4CS8C 3ZG1A 4EKWA 3UT7A 1U3DA 3CSFA 1JPNA 3DBSA 5L0HA 3ASNE 3FTSA 1UFBA 3JYYA 1Y6DA 2FBNA 3CSTA 4B89A 4AJWA 1UN8A 1WY6A 2BTDA 4BESA 4CYMD 2VSXE 1Z5SC 3NKDA 3SNHA 2I6HA 4OVUA 3U64A 2IXPA 2HMQA 4DI3A 1YYXA 4HFFB 3CHRA 1LIHA 5AC4A 3SP1A 2R2LA 3FY4A 4RG6A 2IQCA 2A1DD 1ZHTA 2J0WA 3EQLF 1FCHA 2PZIA 5ENRD 1A7VA 3SNXA 3PZ3A 4LERA 3J5QB 2VCAA 1N4SA 1BU9A 3JCKC 4MS6A 1OCRE 1MJ0A 5F5FA 3NYMA 3RRNB 3VLFA 1VOMA 4O6YA 1TWAA 3FH8A 3CVNA 2FAPB 2IO3C 2W4BA 3AG3C 3RKOF 2P9KG 3O10A 1Z23A 1EDUA 4A1SA 2HKVA 3DM9B 2QUPA 3C63A 3U9JA 4RVBA 2ZXWC 2GAQA 3UKUG 2BKGA 3AQCA 1N4PA 4N06A 1PY1A 4IN3B 2F37A 2PBEA 3S2AA 3CK9A 4J8FA 4Y6CA 3CK8A 3FTUA 3UUXA 1T6IA 1LF8A 2OG2A 4O1OA 3SFXA 1WASA 3B0PA 4A3TA 4LLEA 4NRHB 5CCMA 4MTOA 3HDXA 1AUEA 4NACA 4U07A 3CAXA 1WWPA 4TUUA 3AAAC 1VYIA 4C0EA 4IRUA 2HS5A 4Q4ZF 3UQ3A 2FGYA 3G50A 2FF4A 4IJJA 5FZRA 1BPOA 1TNUA 3DXKG 3HJCA 3EH1A 1OWPA 2DWZA 1N0QA 4R32A 3OWTA 4XQ1A 1UG7A 3E34A 4J8EA 5G55A 4MLPA 5KJMA 3QZCA 2R7XA 4PJJA 1SF8A 4U5GA 1EYHA 3IQ5A 1BR1A 2LAHA 4AM9A 2CHXA 2KW3C 5ANLA 3QKYA 3LCAA 4Z9JA 1HY5A 5C2YA 2UUIA 2IXMA 3FU0A 2H6FA 2RG8A 2WVIA 4D10C 4W9RA 1HW1A 4U96D 3QTHA 3HHMA 2J45A 4UWGA 3SEOA 4BG0A 3PZDA 3AS4A 4UQXA 3KL4A 1SVXA 4DRXE 2Y69C 1HE8A 1Q2ZA 2GRNB 5FZSA 1IYGA 1D0ZA 1LM3B 3PVLA 4CDNA 4GYWA 4BTBA 5JSLA 1NSGB 4U04A 3LPZA 2V5FA 1LVKA 2H7OA 2WXJA 2LUHA 1H6PA 3ZSUA 1QQEA 2EILC 1JWGA 3ULYA 3UPVA 1NZNA 3C5RA 3MGBA 2PP4A 1FMWA 3P1UA 3CZ6A 1H2UA 4LNGA 2I1JA 2XS1A 4YDOA 5A6JA 3H65A 2YHEA 3N24A 3ZVRA 2BKKB 3HIZA 1M6TA 1G3NB 3U8PA 1V4AA 1MMNA 3EPVA 4U63A 4XPXA 2DB4A 1RCPA 3Q75A 2KC3A 3UMKA 2W9YA 1X5BA 1NG1A 3C62A 1FR0A 5CERB 3EG9B 2HR2A 3D9NA 1FVHA 4G7OF 2I9CA 1TWGA 1HU3A 4UI9J 5A6BD
chains in the Genus database with same CATH topology
5E33A 5J90A 1SZIA 4C7OA 2NXPA 3APDA 2LO6A 4AE4B 3OXGA 3LEVA 4WUYA 4HEAJ 4GZDA 1XNFA 2LSEA 4FLBA 2R5SA 3Q49B 5ANRA 2GW1A 1OCOC 2YEVA 1MMAA 1QZ2A 2Y4UA 4N3CA 1OKKA 4KYOB 4P29A 4QDLA 3FUHA 4PJLA 4I6JA 4I17A 3GZ2A 3DZAA 3CQZA 5ARGA 4LCTA 3B13A 3NG1A 4JHJA 4FWVA 4GMJA 1NZEA 3U66A 1M2VA 1D0YA 4CSAA 3SZ7A 2R7VA 2VSOE 2VASA 3L54A 2P58C 2ZXPA 3FEYA 4PK4A 3LAYA 4I1MA 2WXNA 2ZU6B 4I1OB 2WVOA 5AYWD 3FH7A 2NG1A 2HO1A 1OCCC 4FJZA 2KQ9A 3PH0C 2XQ0A 5AENA 2XCBA 2HYZA 2DGJA 2JLBA 3CQGB 4KBQA 2LAIA 1A17A 4I44A 5HSWA 3S7DA 5L3QA 2DBAA 5E3AA 4DVZA 4GZ3A 4JXTA 5T3WA 3FTWA 4GB9A 1H6KA 4ULWA 3EFOB 2X6FA 2M4EA 4BT8A 5A23A 2AVPA 1U3CA 5DS6A 5DQZA 2J7PA 4L2LA 3CVWA 3IV0A 3PEVB 3FTXA 4WNFA 2JEKA 3RO2A 2EIJC 2PFDA 2GFHA 3BG1B 4JURI 1PC2A 4ANXA 3JUIA 1OUVA 5DVWA 3FUEA 4CCAA 4N2SA 5G05J 2PX3A 3FU3A 5JHAA 1W2WA 4QI0A 4YN0B 1PCXA 2I1KA 4PH4B 1ZBPA 3LEWA 3ZGQA 3QMKA 1QLEC 3CR3A 4GYTA 2XXAB 2UY1A 5AJDA 3LVQE 2CDQA 4JJGA 2BUGA 5B3SC 2G3VA 2Y4TA 5AJLA 5A6CA 3D9PA 3MA5A 2X6KA 4XI0A 3G2SA 1Z6AA 3W8IA 2OV8A 2KCKA 1HZ4A 2HM8A 1E8XA 2M63A 3S28A 4AOFA 3LXUX 4U5BE 4YT2A 1LKXA 2GRLA 4BJ5A 3EGXA 2C03A 4YT5A 4JEHA 4NY3A 4G2VA 3QDNA 4XTKA 2V4LA 4I2WA 1DVPA 3L22A 4ZLDA 3ZN3A 2IOSA 3FUIA 2KZTB 1VYKA 2EINC 2ILRA 3I3NA 2IOQA 3E9VA 1Y8MA 3UMIA 5KYXB 3L6AA 5E3CA 4UQZA 2YQ8A 3V7OA 3I5QA 2AXVA 4I1AA 1FFHA 3AG1C 3L08A 4E7ZA 4PJNA 3LY9A 4X0RA 3POVA 3PRZA 4TV3A 2WXRA 3PDNA 2VQ2A 3DXJF 3EGDB 4IAOA 4U5EE 4BJ6A 1DNPA 1L5JA 3DAFA 2XCCA 3MCXA 2Y3AA 3CIAA 4RG9A 5KCMA 5KYYA 4PJMA 2XRZA 3DMDA 3CEQA 3ASFA 3ABMC 4K0RA 1MNDA 5LP0A 4N2QA 3B7RL 3G2TA 4JCHA 4J0UA 2IF4A 3KEZA 3FDHA 2DYRC 2LSUA 3LY8A 3S7FA 4ATGA 4A2NB 1KT1A 1O5HA 4A1GA 1BR4A 4BFRA 3W2WA 3K1HA 1UW4B 4H7XA 4QI2A 2YHCA 2IOLA 3LDZA 4RDAA 3ZHEA 4OIOF 1IZMA 2R59A 5DIZA 2X3MA 3NKEA 3UNGC 5BNWA 2J9VA 4O79A 3KMIA 3E4BA 3LYAA 3EZHA 3ZVVA 4PS3A 3QARA 1V55C 5T3RA 3ZRHA 3ESKA 3M1CB 3AU5A 1BR2A 4MRUA 4N3BA 4CT4A 3D9IA 3TGOA 4DBQA 5KYUB 1GW6A 3EIQC 3EDTB 4B94A 2Z15A 4JHKA 5B1AC 1Z3YA 5LCWC 3ONLA 3ONKA 1E7VA 4OVVA 2H7BA 3EZIA 3NYLA 1Z3XA 3ULQA 2CG2A 4CSAC 2X6JA 3I4GA 3Q6NA 3S0XA 4LUNU 3OA1A 2J07A 3PS6A 4P6IC 3FP3A 2B0JA 2IFUA 3RRUA 1O87A 1TKNA 3RO3A 3DD7A 4C0MA 1H2VC 4YWQA 2LNIA 3KKBA 5IY5C 2J9QA 5DLJA 3EHNA 4GPKA 2J9WA 4YNDA 4URKA 1N54A 3I4UA 4PFPA 2VYIA 3QC1A 4DLQA 4HFKB 1EPUA 2QFCA 3QWVA 3ITFA 2C2LA 2VTBB 3NF1A 3FHDA 2JD3A 4FESA 2YNQA 2A68F 5FQ7A 3CVLA 4BJTA 2O9XA 2FI7A 4ILGA 4GA0A 4AIFA 4N3AA 4UI9K 4F7AA 3CHPA 2WXLA 4EBAG 3UR3C 4O6MA 4WWNA 2VSYA 3TJPA 4IWBA 4G0HA 1ZHWA 3G2WA 2FFHA 1D1BA 4U8HA 2G62A 2X6IA 5FJYA 3RIBA 2IONA 4RBNA 1ZU2A 4Q69A 3FWVA 3SFZA 3ASOC 2H7VC 2VSNA 2NC9A 3CLJA 4KXKB 3FUJA 2ZXRA 3MKQB 4ANVA 2XPZA 3D9LA 2WQ7A 2W45A 1JPJA 4G7HF 4OIQF 3DPDA 5DQTA 3SGHA 1SQMA 4KZ0A 4DJAA 2I8BA 4FHKA 3SI5A 4BEJA 3ZXSA 4ACKA 3CSKA 1H19A 1HS6A 3CHOA 2Y3DA 2R7UA 3ZW3A 4ANUA 2J4DA 5D0QD 1UJJA 1N1CA 2XEVA 4N5CA 1YA0A 3CQCB 3RJVA 4JW1A 3LESA 1NP7A 4WJ0A 4CDRA 1SZ9A 1WAO1 2XRYA 3O39A 3FUDA 2PX0A 3T4RA 2Y3HA 3AG4C 5FTPA 2WMNA 4BJ6C 5F5HA 4JC8A 4AX2A 3G2VA 5G04J 2FO7A 4JA7A 4ILHB 2R7SA 2W4MA 4XLNF 1FFTC 1W3BA 3AS8A 5DBKA 1N52A 5T1DB 3HVEA 1Z3IX 4GCOA 3EG9A 4XLPF 4OYSA 4KVMA 4CEMA 1RJ9A 2L9JA 2QY7A 4C3DA 5E75A 4AE4A 4C3EA 3FUMA 3EIJA 1J8MF 2XL4A 3WG7C 3FAJA 3FTVA 4AY5A 4G26A 5EDSA 4UQYA 4CS9A 5D91A 2AXZA 2Q3TA 4G24A 2NUTA 2EIMC 3MEKA 3VLEA 1E96B 5JJTA 3ABKC 1D1AA 3F46A 4G1TA 3EHMA 2IYLD 3CHMA 2R7RA 4G23A 3T6JA 3MKRA 2R7OA 5KJKA 1MMDA 5ENNA 4E6HA 3I5PA 3CK7A 3SF4A 3FTYA 4GZ6A 3ZEFA 2R17C 2WXGA 4C7OB 5EX3A 2A6HF 4TRQA 4EBBA 3O6XA 2WXHA 4OIPF 4EPZA 2J08A 5LCWJ 3JQ0A 4A3VA 5HQ8A 3SHFA 2A5UA 3UT4A 1FMVA 1NA3A 4XIFA 3BEEA 2WZLA 3SBTB 4CGWA 5BV0A 2D5RB 4F3VA 4HS2A 2XRHA 4ANWA 5CMWA 3ZYKA 5D0OD 4FP7A 1E7UA 1E8ZA 2XHEA 4M3OA 2BF0X 4YVOA 1Z63A 3PREA 3SYNA 1HG5A 1M2VB 5EKQD 5D92A 4J8SA 3PHF2 3ASHA 4JA9A 3CV0A 2E2EA 3URZA 3D9KA 3GZ1A 3TXMA 3I4RB 1ELKA 4CS8A 2CFZA 2FEZA 4K0DA 2KCVA 2FULA 3C98A 3IHVA 3QOUA 3NZSA 4Q94A 1S0PA 4FHJA 1VMAA 1PAQA 1TWCA 1Y6IA 5C1DA 4F4BA 4DI4A 1JUQA 4L7TA 1ELRA 4BSXA 3FH5A 4ZLCA 4EWCA 3CVYA 4E7SA 3MLGA 5FQ8A 1TWHA 3S7JA 3PE3A 3SBSA 4WWOA 2KGOA 2MWQA 3AG2C 2CHWA 4KZCA 1TR2A 1D1CA 1OWNA 4GAAA 3AQBA 4CGVA 3LY7A 4V3IA 4JHRA 3UMHA 4HE8D 2J49A 2IU1A 2X51A 5J08A 4I9CA 3R9AB 3GYZA 3P2BA 4WNDA 3RH3A 1IQRA 3ABLC 4B8AA 4KC9A 2R7WA 3FEXA 4KBLA 3AS5A 3F47A 3CVUA 3RU0A 2I2OA 4XZ4A 3FHEA 3LNRA 3K6BA 4KMOA 2WZGA 3NRHA 2WB2A 5EHHA 3FFLA 3EGXB 3L17A 3DM5A 4JVSA 2BE5F 3MJWA 3IEEA 1V54C 2WZFA 4J8DA 4KNVA 5CCLA 3IHYA 2PQNA 3ZFWA 4QFVA 4GEHA 2KCLA 3T5XA 3APFA 1IW7F 2PM7A 2GRMA 3CGHA 4DPRA 2DCPA 4XWJA 3U3WA 4U5HA 2HV6A 3T8MA 3KS2A 2KNHA 1OWMA 2NUPB 1MQSA 4GU5A 5KJNA 3DAGA 3AU4A 1VDYA 3LVRE 2VGYA 3FULA 2L0IA 3S29A 2KC7A 2WXQA 5FWQA 4YT4A 4CS9C 4EZLA 1UN9A 5LOZA 2J9UA 3LKUA 3APCA 4XKBA 3LJ3A 4L2YA 3W2VA 4I2ZA 4GMLA 2VJ8A 2A4ZA 4ME2A 2L81A 3Q15A 5KYWA 4UWKA 4F1SA 2HV7A 2CW0F 3MV2B 3CVQA 2CHZA 3GODA 5KJLA 2OCCC 4CS7A 2ZPAA 2GGFA 4DLOA 3ENEA 4CT0A 4J6IA 4NQ0A 4B6IA 4KVOA 2P7VA 1P5QA 3ZHEB 3UX4A 3CHQA 3N2ZB 3CVXA 1MHQA 1ZU4A 3D3MA 4FX5A 3B9QA 2MHKA 4H7YA 5FZQA 4RSYA 4OD4A 2XSEA 4AV7A 4I43A 2CNWD 1JPLA 3CKCA 1OCZC 1ST6A 1TEZA 4AY6A 3WXXA 5HI7A 3ZYMA 3QB2A 2Q9AA 3JRTA 4HORA 3N71A 3MZLB 3MX3A 3UGOA 5JHBA 1HFAA 2VGXB 2WMOA 5EX0A 2A6EF 4FJYA 2QTVA 4WNGA 1FVFA 4CBEA 4YVQC 2KM4A 3PE4A 2V0PA 2XPIA 3LLKA 3FUFA 3ZYQA 2Q9BA 4R7LA 2DYSC 2NSZA 3QWPA 4WAFA 4H4KC 5B1BC 1UG3A 3ZC4A 3ML9A 3FVYA 4HVBA 4LLCA 4BX8A 3NYJA 4GZCA 4EBAA 2UWJG 5G05C 4JPSA 2EIKC 3PNTB 3UT8A 3LS1A 4Q5SF 5LFAA 3MKQA 3X2QC 1EF1C 3Q47B 3PMRA 4HOSA 1OWLA 3FU6A 4FC8A 3OXFA 2KJGA 1ZHYA 4BJ5C 1G8XA 1MNEA 1M2OA 2OVFA 1ZYRF 4O7GA 2XPYA 4U5FE 2VB6A 4KNWA 4WWPA 4G7ZF 3LS8A 2WM9A 3PEUB 1H2TC 2WXFA 4AP2A 1ELWA 4BT9A 1HG2A 3BG0B 4MQ9F 2CNWA 3ECSA 2V8SE 1S7ZA 1HF8A 4MKTA 3CKBA 2J4BA 4J32B 3VTYA 2KATA 1ZHXA 1OKKD 3TG4A 5JJ7A 4FADA 4Y6WA 2LSVA 4N39A 3LLIA 4LEUA 3PNLB 2IXNA 2XGSA 3FTZA 1JWFA 4JZAA 2ONDA 1MMGA 4CIHA 1HX8A 5T4YA 3IBEA 4HOUA 1SMYF 2C04A 2C0MA 2CGEA 3E70C 3K33A 4OIRF 2R7QA 2CFUA 3HYMB 3CVPA 1VK5A 3ML8A 3O48A 3PUKA 3ESLA 3B0VC 1INZA 4FA6A 2IJGX 4GYOA 3ASNC 2WVNA 4AK9A 4BJ1A 1KLXA 4C3BA 4XX5A 4HXIA 4F53A 1J8YF 1ZHZA 2G3KA 4K7BA 3R7RA 1FTSA 2DIWA 3U4TA 3S7BA 4DOZA 2Y3BA 3Q6MA 2J7PD 3WODF 4DVYP 3HVEB 4AEZC 1OCRC 3DJNB 1Z5ZA 4XKCA 1RJ9B 4NURA 3JCUQ 1E8YA 3FDQA 3D9MA 4KI2A 1E8WA 3KAEA 5KYNA 4LACB 5T8IA 3RRMB 4I9EA 4M63A 3TL5A 3RKVA 3RIPA 5JJ6A 2WVQA 2MOWA 2NUTB 4I6EA 3ZPJA 1XGWA 4GA2A 4HOQA 4UWFA 4U5CE 2QY9A 4AXHA 3D9OA 3G2UA 4G11A 3R7QA 4APOA 2V3CC 2WXPA 5FT9A 2WPVA 4UWLA 3VTXA 5BT1A 3VAYA 1B89A 5BV1A 4E85A 4FLHA 3EFOA 4CRWA 3JT1A 4K03A 2WXKA 3OAWA 4GA1A 2PQRA 4AVXA 3EJNA 2WQHA 4Q96A 5BPPA 2WB7A 4OD5A 3L13A 1NA0A 3ASGA 4GYYA 2MYSA 4L23A 5BW8C 2AWIA 3UMVA 3HLZA 2VH3A 2V26A 2E87A 3NZUA 3FUKA 2AW6A 3TD7A 4EQFA 3O4ZA 2Y3GA 3QNKA 3Q7GA 1HXIA 2MRIA 4U0ZA 4IULA 3QK0A 5AIJA 1SZAA 3L0IA 2J46A 3PUJA 1TJCA 2XXAA 3LS0A 1QNFA 4B0ZA 2C0LA 1KT0A 3S27A 4A55A 2IXOA 3DJUB 1HO8A 2OVBA 2PF4E 4I3MA 5FQ4A 4O6FA 3JQ1A 4RD9A 3ZIBA 4APFA 3Q7LA 5CHEE 3QWWA 3QAQA 1PD1A 2OOEA 2Q7FA 4L1BA 4HOTA 5L3VA 3MV3B 3B7SA 3HTKC 5DS5A 4IYPA 2KZTA 4PS7A 1OWOA 4PDXA 4PS8A 2XGOA 5KYXA 2RD0A 3RFYA 4FU3A 4ILIA 1PD0A 5CI9A 2P6VA 5DS4A 1H0AA 2XGMA 3TXNA 5FQ6A 1QZXA 2WQ6A 5CI8A 2E0IA 4U0SA 1IHGA 3TG5A 2UY1B 1M56C 4BWRA 3EGDA 5BUZA 3OTNA 1ZU5A 2WXIA 2CG3A 3K66A 4U0UA 4EZKA 3B7UX 3KH2A 4HFGA 5E76A 2ZXOA 4C9BB 4DK5A 3FUNA 4I6GA 3K1IC 1NU7D 5G2NA 4MNDA 4YT8A 3FU5A 4DBRA 4JZYA 3JYHA 3W8HA 2NUPA 4HLEA 4G25A 3L34A 2J0XA 3K7DA 5G04C 2X6HA 4GCNA 1NU9C 2A69F 3Q4AB 2L6JA 4JL0A 4PUCA 4BY6A 2X38A 3B7TA 4EECA 5M72A 4JJFA 4O6NA 5CMYA 3U9WA 2L0TB 4U5DE 3B0UX 5ARFA 1UJKA 5BUOA 3RK6A 2J09A 3MYVA 4CDMA 1Z6TA 3KD7A 4UI9C 4YJWA 3SZRA 1WM5A 5FCLA 2YINA 4KT6B 3T6BA 1D0XA 2WXOA 5KYYB 3SD5A 3T5VA 4BTAA 4B8CB 5E2QA 3ASDA 3LJBA 3Q5MA 1M57C 4PFOA 1KU2A 3NQPA 4XI9A 5KYUA 4UWHA 4WNEA 5LX8A 3L16A 2WXMA 3RYLA 2PM6A 3VYWA 2EQXA 2R7TA 4Q7CA 5EGYA 3NDBB 4OINF 3OXLA 4ANJA 4LRZA 3GANA 1IQUA 3EH2A 1HH8A 3JYSA 4ABNA 1LS1A 2PL2A 2Q9CA 3CVVA 3QJZA 5KYWB 3OEOA 2YZSA 3IKOB 4EZJA 3JSZA 3VLDA 2VGXA 2VTBA 3IEGA 4FULA 4XE0A 3GW4A 3ZIMA 4GZ5A 3CHSA 3ZYLA 4ACLA 1E90A 2L9BA 1WGWA 4W8KA 3D9JA 4JEUA 3GZSA 3TAXA 4BX9A 3UGPA 3N0TA 5A7DB 2YHSA 4J30B 3X1OA 2Y39A 2WL8A 5T3TA 2AXUA 3K9IA 1TJFA 4CS8C 3ZG1A 3UT7A 1U3DA 3CSFA 1JPNA 3DBSA 3FTSA 2FBNA 3CSTA 4B89A 4AJWA 1UN8A 1WY6A 2BTDA 2VSXE 3NKDA 3SNHA 2I6HA 4OVUA 3U64A 2IXPA 4DI3A 3CHRA 4HFFB 3SP1A 3FY4A 4RG6A 2IQCA 2A1DD 1ZHTA 2J0WA 3EQLF 1FCHA 2PZIA 3SNXA 4LERA 3JCKC 4MS6A 5F5FA 3NYMA 3RRNB 3VLFA 1VOMA 4O6YA 1TWAA 3FH8A 3CVNA 2W4BA 3AG3C 3RKOF 1Z23A 1EDUA 4A1SA 3DM9B 4RVBA 2ZXWC 3AQCA 4N06A 1PY1A 4IN3B 3S2AA 3CK9A 4J8FA 4Y6CA 3CK8A 3FTUA 3UUXA 1LF8A 2OG2A 3B0PA 4A3TA 4LLEA 4NRHB 5CCMA 3HDXA 4NACA 4U07A 4TUUA 1VYIA 4C0EA 4IRUA 4Q4ZF 3UQ3A 2FGYA 2FF4A 4IJJA 5FZRA 1BPOA 3HJCA 3EH1A 1OWPA 3OWTA 4J8EA 5G55A 4MLPA 5KJMA 3QZCA 2R7XA 4PJJA 1SF8A 4U5GA 1EYHA 1BR1A 2LAHA 4AM9A 2CHXA 2KW3C 5ANLA 3QKYA 3LCAA 5C2YA 2IXMA 3FU0A 2RG8A 2WVIA 4D10C 4W9RA 3HHMA 2J45A 4UWGA 3SEOA 4BG0A 3PZDA 3AS4A 4UQXA 3KL4A 2Y69C 1HE8A 5FZSA 1IYGA 1D0ZA 3PVLA 4CDNA 4GYWA 4BTBA 4U04A 3LPZA 2V5FA 1LVKA 2H7OA 2WXJA 3ZSUA 1QQEA 2EILC 1JWGA 3UPVA 1NZNA 3MGBA 2PP4A 1FMWA 3P1UA 3CZ6A 1H2UA 2I1JA 3H65A 2YHEA 3N24A 3ZVRA 3HIZA 1MMNA 3EPVA 4U63A 3UMKA 2W9YA 1X5BA 1NG1A 3EG9B 2HR2A 3D9NA 1FVHA 4G7OF 2I9CA 1TWGA 1HU3A 4UI9J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IRU A;  4I1M A;  4I1O B;  4JW1 A;  4JVS A; 
#chains in the Genus database with same CATH topology
 5E33 A;  5J90 A;  1SZI A;  4C7O A;  1K1A A;  5JMN D;  2YL1 A;  2NXP A;  3CEX A;  3APD A;  5ENT D;  5JP7 A;  1FPP A;  2LO6 A;  4AE4 B;  3FXH A;  3OXG A;  3LEV A;  5FIN A;  4WUY A;  4HEA J;  4GZD A;  1XNF A;  1G4U S;  2OJQ A;  2LSE A;  4FLB A;  5CRV A;  2R5S A;  3Q49 B;  5ANR A;  2GW1 A;  3WHN A;  1OCO C;  2YEV A;  4M7C A;  1MMA A;  2LIG A;  5ENQ D;  1RXQ A;  1APC A;  3R9M A;  3LNM B;  3TOL A;  1QZ2 A;  3DEO A;  2BC5 A;  2Y4U A;  4N3C A;  1OKK A;  3SO8 A;  4KYO B;  3R7C A;  1LI5 A;  4P29 A;  1TR4 A;  4QDL A;  3FUH A;  5BXO A;  4PJL A;  4I6J A;  3AJI A;  4I17 A;  3GZ2 A;  5CRU A;  3DZA A;  3CQZ A;  5ARG A;  4NQF A;  4LCT A;  3B13 A;  3NG1 A;  4JHJ A;  4FWV A;  4GMJ A;  1NZE A;  1OT8 A;  3U66 A;  1M2V A;  5D66 A;  1D0Y A;  4D4X A;  4CSA A;  3LUT B;  3SZ7 A;  4LNB A;  2R7V A;  2VSO E;  2VAS A;  5LCW C;  3L54 A;  2P58 C;  3UI2 A;  2ZXP A;  3FEY A;  4PK4 A;  3LAY A;  4I1M A;  2WXN A;  2ZU6 B;  4I1O B;  2WVO A;  2XLH A;  5AYW D;  3FH7 A;  4GTR A;  1CPQ A;  2NG1 A;  2HO1 A;  1OCC C;  4BEM J;  4FJZ A;  2KQ9 A;  3PH0 C;  4UDV A;  2XQ0 A;  5AEN A;  4DX2 A;  2XCB A;  2HYZ A;  2DGJ A;  2JLB A;  3QW1 A;  3CQG B;  4KBQ A;  2LAI A;  1A17 A;  4I44 A;  2XEN A;  3TK0 A;  5HSW A;  3S7D A;  2LQG A;  2OOC A;  4HBD A;  1C03 A;  2P9S G;  5L3Q A;  2DBA A;  5E3A A;  4DVZ A;  4GZ3 A;  4JXT A;  4TXQ A;  5T3W A;  3FTW A;  4GB9 A;  1H6K A;  4ULW A;  3EFO B;  3TJ6 A;  4DRI B;  2X6F A;  2M4E A;  4BT8 A;  5A23 A;  2AVP A;  1U3C A;  5DS6 A;  5DQZ A;  2J7P A;  4L2L A;  3CVW A;  3IV0 A;  3PEV B;  3FTX A;  4WNF A;  5EYP F;  2JEK A;  3RO2 A;  2EIJ C;  2PFD A;  1AP7 A;  4BSZ B;  2GFH A;  2V5Q C;  3BG1 B;  4JUR I;  3HXF A;  1PC2 A;  3E30 A;  4ANX A;  3JUI A;  1OUV A;  5DVW A;  3FUE A;  4CCA A;  1PV3 A;  5G05 J;  4N2S A;  2PX3 A;  2XM4 A;  3FU3 A;  5JHA A;  1U0B B;  1W2W A;  4QI0 A;  4YN0 B;  1MX2 A;  1PCX A;  2I1K A;  4PH4 B;  1ZBP A;  4DRH B;  3LEW A;  1DOV A;  3ZGQ A;  1LTX A;  2QYJ A;  3QMK A;  1QLE C;  3CR3 A;  4GYT A;  4MVZ A;  2XXA B;  2UY1 A;  5AJD A;  1N9A A;  3LVQ E;  2CDQ A;  3FOO A;  4JJG A;  2BUG A;  5B3S C;  2G3V A;  2Y4T A;  5AJL A;  5A6C A;  3D9P A;  4HRM B;  3MA5 A;  2X6K A;  4XI0 A;  3G2S A;  1Z6A A;  3W8I A;  2OV8 A;  2KCK A;  1HZ4 A;  3V5Y A;  2HM8 A;  1E8X A;  2M63 A;  3S28 A;  4AOF A;  3LXU X;  4U5B E;  3H2U A;  4YT2 A;  1LKX A;  2AU5 A;  2GRL A;  4AL0 A;  4BJ5 A;  3PZ1 A;  3EGX A;  2C03 A;  4YT5 A;  4JEH A;  4NY3 A;  4G2V A;  3QDN A;  3DSX A;  4XTK A;  2V4L A;  2RD9 A;  2M64 A;  4I2W A;  1OCZ E;  1DVP A;  3UTM A;  3L22 A;  4ZLD A;  3ZN3 A;  2IOS A;  3T8K A;  3FUI A;  2KZT B;  1VYK A;  2EIN C;  4CJG A;  2ILR A;  3US6 A;  3I3N A;  4P9T A;  3DE9 A;  4J7T A;  1YA7 O;  2IOQ A;  3E9V A;  2Q7R A;  1Y8M A;  3UMI A;  4EHM A;  4GQH A;  5KYX B;  3L6A A;  5E3C A;  4ULV A;  4UQZ A;  1SA4 A;  1OQC A;  2YQ8 A;  4HRL A;  3V7O A;  2YLD A;  3I5Q A;  2AXV A;  4I1A A;  1FFH A;  1RMV A;  3AG1 C;  3FMS A;  3L08 A;  4E7Z A;  1FNT c;  4PJN A;  3LY9 A;  3FOP A;  4X0R A;  5F28 E;  5CEA A;  3POV A;  3PRZ A;  4TV3 A;  2WXR A;  4D4N A;  3PDN A;  3MYF A;  1QYM A;  3WAQ A;  2VQ2 A;  1CPR A;  1I4Y A;  3DXJ F;  3EGD B;  1C17 M;  4IAO A;  4U5E E;  3Q79 A;  4BJ6 A;  1DNP A;  1L5J A;  2QYU A;  2DYS E;  3DAF A;  2XCC A;  3MCX A;  2EPO A;  3SXY A;  5JS5 A;  1RZ4 A;  2Y3A A;  3CIA A;  4RG9 A;  1JCR A;  1R4T A;  1S70 B;  5KCM A;  4K5A B;  3NAW A;  5KYY A;  4PJM A;  2XRZ A;  3DMD A;  4YL1 A;  3CEQ A;  1L7C A;  3ASF A;  3ABM C;  4H54 A;  1MQV A;  3RQF A;  4K0R A;  1MND A;  5BXU A;  5LP0 A;  4N2Q A;  5L0G A;  3B7R L;  3G2T A;  4JCH A;  4J0U A;  4JE9 A;  3U3F A;  2IF4 A;  2OQM A;  1OR3 A;  2DYR C;  3FDH A;  3KEZ A;  2LSU A;  3T9K A;  3LY8 A;  3S7F A;  4IAQ A;  1N4Q A;  4A2N B;  1KT1 A;  4ATG A;  1ZW2 A;  3RSE G;  1A7E A;  3TQO A;  3AG3 E;  1O5H A;  1ZW3 A;  3ZDL A;  1BR4 A;  4A1G A;  4BFR A;  3W2W A;  3K1H A;  2DI3 A;  1UW4 B;  4UUC A;  1D9S A;  4H7X A;  4QI2 A;  2XLO A;  1F1M A;  2YHC A;  4LDR A;  2ZXW E;  2IOL A;  3LDZ A;  2J8W A;  4RDA A;  3ZHE A;  2B0H A;  4OIO F;  1JMW A;  1IZM A;  3DPY A;  2R59 A;  5DIZ A;  1OW6 A;  3F6Q A;  2Q00 A;  2X3M A;  3KYJ A;  3NKE A;  4MBG A;  3UNG C;  5BNW A;  1FT1 A;  3R2P A;  1H9G A;  2J9V A;  4O79 A;  1Z7Q c;  5JRA A;  3FAP B;  3KMI A;  3L9T A;  4GPM A;  3E4B A;  3LYA A;  3EZH A;  3EU9 A;  3ZVV A;  4PS3 A;  3QAR A;  1V55 C;  5T3R A;  3ZRH A;  3ESK A;  1JAF A;  3M1C B;  3AU5 A;  2R05 A;  1BR2 A;  1QPU A;  4MRU A;  4N3B A;  4CT4 A;  1TFK B;  3V31 A;  3D9I A;  3TGO A;  5COF A;  2VGE A;  1SW6 A;  4DBQ A;  5KYU B;  1GW6 A;  3EIQ C;  4XEI G;  3EDT B;  4B94 A;  2Z15 A;  5B1A C;  2XLM A;  1Z3Y A;  4JHK A;  3QVZ A;  1TN7 A;  5HRY A;  3ONL A;  3ONK A;  3Q73 A;  1E7V A;  4GTV A;  4OVV A;  2H7B A;  3EZI A;  3E32 A;  3NYL A;  1Z3X A;  3ULQ A;  2CG2 A;  5L0I A;  4CSA C;  5ENP D;  2CCY A;  2X6J A;  3I4G A;  3Q6N A;  3S0X A;  3T9O A;  4LUN U;  5FIO A;  3OA1 A;  4DJ9 A;  2J07 A;  1DCQ A;  3AGU A;  1E83 A;  3PS6 A;  2DZN A;  4P6I C;  3FP3 A;  2B0J A;  2IFU A;  2IBF A;  3RRU A;  1O87 A;  5AAO A;  1B68 A;  1TKN A;  3RO3 A;  3DD7 A;  1TNO A;  4C0M A;  4JD2 G;  1H2V C;  3L82 A;  4YWQ A;  5BQI A;  2LNI A;  3KKB A;  5IY5 C;  2TMV P;  2J9Q A;  5DLJ A;  3EHQ A;  3EHN A;  4GPK A;  2J9W A;  4YND A;  4URK A;  2YL7 A;  3ZWI A;  1N54 A;  3I4U A;  4PFP A;  2A5E A;  2VYI A;  3QC1 A;  1TYQ G;  2CYD A;  5KWD A;  4DLQ A;  2EIL E;  5EIB E;  4HFK B;  1EPU A;  3L8J A;  2QFC A;  2NPU A;  3QWV A;  3AJM A;  3ITF A;  2C2L A;  5EN5 D;  3NBN B;  4NTB A;  3RW0 A;  1VLS A;  2VTB B;  2KSF A;  1NI1 A;  5AQA A;  2NSG A;  1JOG A;  1YVI A;  3NF1 A;  3FHD A;  1N95 A;  2JD3 A;  5JVE A;  4FES A;  1ZB1 A;  4IGG A;  2YNQ A;  4CJO A;  2A68 F;  1N4R A;  1OW7 A;  5FQ7 A;  3CVL A;  4NC3 A;  5BQG A;  4BJT A;  2O9X A;  4B93 B;  1A0B A;  2FI7 A;  4ILG A;  4JEA A;  4GA0 A;  3G4X A;  3ZQY A;  4AIF A;  5FZT A;  1DOW A;  4N3A A;  4UI9 K;  4F7A A;  3CHP A;  3H2V A;  2F22 A;  2WXL A;  4EBA G;  1E2X A;  3UR3 C;  4O6M A;  3TWU A;  4WWN A;  2VSY A;  3GEE A;  1IKN D;  3M15 A;  4IWB A;  1NL4 A;  3JRM O;  1U2V G;  1MZC A;  3TJP A;  2QC9 A;  3BUA A;  4G0H A;  1ZHW A;  3G2W A;  2FFH A;  2FO1 E;  2XLW A;  1D1B A;  3C8G D;  3HRA A;  4U8H A;  2G62 A;  2X6I A;  1OCO E;  5FJY A;  3RIB A;  2ION A;  3B7B A;  4RBN A;  4ZHB A;  4IAR A;  1ZU2 A;  4Q69 A;  3FWV A;  1Q0F A;  1UOH A;  3SFZ A;  3ASO C;  2H7V C;  3JXJ A;  1RW2 A;  2VSN A;  3SFY A;  5JT4 A;  2NC9 A;  2NYJ A;  3CLJ A;  4KXK B;  3FUJ A;  2ZXR A;  4GTT A;  3MKQ B;  4ANV A;  2XPZ A;  3D9L A;  2WQ7 A;  2W45 A;  1JPJ A;  4G7H F;  4OIQ F;  3DPD A;  4Z9I A;  5DQT A;  3SGH A;  1OXJ A;  3DSS A;  1SQM A;  4YDE A;  4KZ0 A;  4DJA A;  2I8B A;  4FHK A;  3SI5 A;  5COM A;  4BEJ A;  3ZXS A;  4ACK A;  3CSK A;  1ORS C;  1H19 A;  1HS6 A;  3CHO A;  2Y3D A;  4MS2 A;  2R7U A;  2V4H C;  3ZW3 A;  4ANU A;  2J4D A;  5D0Q D;  1UJJ A;  3W4Y A;  1N1C A;  3ZNG A;  3HXB A;  2XEV A;  4N5C A;  1YA0 A;  3CQC B;  3HXE A;  4DX5 D;  3RJV A;  5CEC B;  2ASR A;  4JW1 A;  2HZ8 A;  3LES A;  5JA4 D;  5AGF A;  3M4C A;  1OCC E;  1KNY A;  3TWW A;  1NP7 A;  4WJ0 A;  4CDR A;  1SZ9 A;  1WAO 1;  2XRY A;  5EYL A;  3O39 A;  3FUD A;  2PX0 A;  3T4R A;  2YLG A;  3K1I A;  1K05 A;  2Y3H A;  3AG4 C;  1VB5 A;  5FTP A;  2WMN A;  4BJ6 C;  3DWW A;  3M79 A;  5F5H A;  5AAR A;  4MVM A;  1BBH A;  3EUV A;  4JC8 A;  1JR8 A;  4AX2 A;  3HNI A;  3G2V A;  5G04 J;  3UKR G;  2FO7 A;  4JA7 A;  4ILH B;  4YL3 A;  2W4M A;  2R7S A;  4XLN F;  1FFT C;  1W3B A;  3AS8 A;  5BQH A;  4U9E A;  5DBK A;  1N52 A;  2GWW A;  5T1D B;  3HVE A;  1Z3I X;  4GCO A;  3EG9 A;  2L6H A;  4WAB A;  5CBO A;  2YRF A;  4XLP F;  4OYS A;  2Y0B G;  4KVM A;  2EIJ E;  4CEM A;  1RJ9 A;  5JUA A;  2L9J A;  3VF0 A;  2QY7 A;  3PZ2 A;  4C3D A;  5E75 A;  4QQI A;  4AE4 A;  4C3E A;  3NMJ A;  3FUM A;  1H9T A;  2IO2 C;  3EIJ A;  1YLM A;  2LP4 A;  1J8M F;  2XL4 A;  3WG7 C;  2VCB A;  3FAJ A;  1N0R A;  4HI9 A;  3FTV A;  4AY5 A;  4G26 A;  1VLT A;  3C8G A;  5EDS A;  4UQY A;  4CS9 A;  4EHP A;  3GM2 A;  5D91 A;  2AXZ A;  1RKC A;  2NSF A;  4G8L A;  2Q3T A;  4G24 A;  4N4W A;  2NUT A;  2EIM C;  2ZGG A;  3RVY A;  3GEH A;  5B3S E;  3MEK A;  1Q0D A;  2XL6 A;  3VLE A;  2B0O E;  1E96 B;  5JJT A;  2AVK A;  1YYJ A;  1DCE A;  1V74 B;  2R25 A;  1LS4 A;  3ABK C;  5H7P A;  1D1A A;  4GTO A;  2XS8 A;  3F46 A;  4G1T A;  3EHM A;  3LJN A;  2IYL D;  3CHM A;  2R7R A;  5GPG B;  3T6J A;  3MKR A;  4G23 A;  2R7O A;  5KJK A;  3E37 A;  1MMD A;  5ENN A;  4E6H A;  2EPK X;  3J5P A;  3I5P A;  3CK7 A;  3SF4 A;  1A5E A;  1KZO A;  1KPS B;  3FTY A;  4GZ6 A;  3ZEF A;  2R17 C;  2WXG A;  4C7O B;  5EX3 A;  2A6H F;  2EIN E;  4BET A;  4TRQ A;  3DXM G;  4EBB A;  3O6X A;  2WXH A;  1LE4 A;  1L3P A;  4OIP F;  4EPZ A;  3KEA A;  2J08 A;  5JLI A;  2L6G A;  2ZGD A;  5LCW J;  3AG1 E;  3JQ0 A;  4A3V A;  4O1P A;  3SHF A;  5HQ8 A;  1Q0M A;  2A5U A;  1FMV A;  1NA3 A;  4XIF A;  3BEE A;  3UT4 A;  2WZL A;  3SBT B;  4CGW A;  5BV0 A;  2D5R B;  4F3V A;  4HS2 A;  2XRH A;  4ANW A;  5CBN A;  5CMW A;  3ZYK A;  5D0O D;  1TNZ A;  3HNJ A;  1LE2 A;  4CX9 A;  4FP7 A;  1E7U A;  1E8Z A;  2XHE A;  5A69 A;  4K5B A;  3NOG D;  4M3O A;  1C02 A;  2BF0 X;  4YVO A;  2P9P G;  2KYH A;  1Z63 A;  3PRE A;  3SYN A;  1HG5 A;  5K0I A;  4DX7 D;  1M2V B;  1BDJ B;  3DI5 A;  3JZ0 A;  2ETC A;  1KTM A;  5EKQ D;  3ABM E;  1MYO A;  5D92 A;  4J8S A;  3PHF 2;  4K1O A;  3ASH A;  3Q9N C;  4JA9 A;  3RF3 A;  3CV0 A;  2E2E A;  3URZ A;  3D9K A;  1ORJ A;  3ISM C;  4MTG A;  3GZ1 A;  3TXM A;  3I4R B;  1ELK A;  2P0N A;  3V2X A;  2XM0 A;  5ENS D;  4CS8 A;  3ZKJ A;  4G8K A;  2CFZ A;  1FT2 A;  1N11 A;  5A6B A;  4CDA A;  2FEZ A;  4K0D A;  2KCV A;  2FUL A;  1CGN A;  3C98 A;  3IHV A;  3QOU A;  3NZS A;  4Q94 A;  1S0P A;  5KBA A;  4FHJ A;  1VMA A;  1PAQ A;  2J8S D;  4MVO A;  3TUL A;  1TWC A;  1Y6I A;  5C1D A;  2LFD A;  3SXM A;  4F4B A;  1JUQ A;  4L7T A;  4DI4 A;  1ELR A;  3RQG A;  4BSX A;  1A41 A;  3FH5 A;  4ZLC A;  4NCQ A;  4HLL A;  4EWC A;  3CVY A;  4E7S A;  3MLG A;  5FQ8 A;  5CED B;  1TWH A;  3DST A;  2XEE A;  3UXG A;  3RAU A;  3S7J A;  3PE3 A;  3SBS A;  4WWO A;  2KGO A;  3GM1 A;  2EPL X;  2MWQ A;  2R02 A;  3AG2 C;  2CHW A;  1EA8 A;  4KZC A;  1TR2 A;  3Q7A A;  1D1C A;  3UIP C;  1R5I D;  3JTL O;  1OWN A;  1V55 E;  3O55 A;  4GAA A;  3AQB A;  4ATZ D;  4CGV A;  4A63 B;  2P9L G;  1LI7 A;  3LY7 A;  4EIY A;  4V3I A;  4JHR A;  1KZP A;  4JKV A;  3V5Z A;  3UMH A;  4HE8 D;  3W9F A;  2P9N G;  1G5Z A;  2IU1 A;  2J49 A;  1HE1 A;  2X51 A;  5B1A E;  5J08 A;  4I9C A;  3R9A B;  1E86 A;  3GYZ A;  3P2B A;  4WND A;  3RH3 A;  1YMP A;  4MVR A;  4N5Q A;  4ER9 A;  1IQR A;  3ABL C;  3DWL G;  4KC9 A;  4B8A A;  1U6H A;  3TWX A;  2R7W A;  4DXW A;  3FEX A;  4KBL A;  3AS5 A;  4RQI A;  3F47 A;  3CVU A;  4F6R D;  2H6G A;  4JIO A;  3RU0 A;  1YCS B;  2I2O A;  4XZ4 A;  3G4Z A;  1NFN A;  2GRR B;  1YDI A;  3FHE A;  4J7Y A;  3LNR A;  4BEP A;  5IY5 E;  3K6B A;  4KMO A;  2WZG A;  3NRH A;  3S84 A;  2WB2 A;  5EHH A;  3FFL A;  3EGX B;  4TUM A;  3L17 A;  3DM5 A;  4JVS A;  2BE5 F;  2A0U A;  3MJW A;  3ZQV A;  2BL2 A;  3IEE A;  1V54 C;  2WZF A;  4J8D A;  4KNV A;  5CCL A;  5KNH D;  3IHY A;  2PQN A;  3ZFW A;  4QFV A;  1O5M A;  5TJ5 E;  4TXP A;  3DKA A;  4DX1 A;  4GEH A;  4WGY A;  2KCL A;  3T5X A;  3APF A;  1IW7 F;  2PM7 A;  2ETS A;  2GRM A;  1QKR A;  3CGH A;  4DPR A;  4NTA A;  3V2O A;  2P1A A;  2DCP A;  4XWJ A;  3U3W A;  4U5H A;  4Z68 A;  2HV6 A;  4E0H A;  3T8M A;  3KS2 A;  2KNH A;  4W8P A;  1OWM A;  2NUP B;  2J9B A;  1MQS A;  2LXM A;  4GU5 A;  5KJN A;  3DAG A;  3AU4 A;  2XZT G;  1VDY A;  3LVR E;  1RKE A;  1OXK A;  2VGY A;  3FUL A;  4YL0 A;  4HI8 A;  3AOU A;  2L0I A;  3S29 A;  2HUJ A;  2KC7 A;  2WXQ A;  1CGM E;  5FWQ A;  3SXZ A;  4YT4 A;  4CDV A;  4CS9 C;  2H6H A;  4EZL A;  1UN9 A;  3C18 A;  1OXB A;  5LOZ A;  2P9U G;  2VCC A;  2J9U A;  3L8I A;  3LKU A;  2ZD9 A;  3APC A;  4XKB A;  3LJ3 A;  4L2Y A;  3W2V A;  4I2Z A;  4GML A;  2VJ8 A;  2A4Z A;  2EPM X;  2MHR A;  3ASO E;  1JCS A;  4ME2 A;  2L81 A;  3Q15 A;  5KYW A;  2GRQ B;  2Y1L E;  3HXD A;  4UWK A;  4F1S A;  1LD7 A;  1TQG A;  1K3Z D;  2HV7 A;  3UM1 A;  2CW0 F;  1TNY A;  5HS0 A;  1AEP A;  1E84 A;  3MV2 B;  3T6G B;  2OEV A;  3CVQ A;  3UM3 A;  1Q0G A;  3C7J A;  3L1M A;  2CHZ A;  3AGT A;  3GOD A;  5KJL A;  2ICW G;  4XEK A;  2OCC C;  4CS7 A;  5A6A A;  1I4Z A;  3D9H A;  3EHR A;  2ZPA A;  2GGF A;  4DLO A;  3ENE A;  4CT0 A;  4J6I A;  1GM5 A;  4NQ0 A;  4B6I A;  4KVO A;  2P7V A;  2P61 A;  4JRZ A;  1P5Q A;  3ZHE B;  3UX4 A;  1AVO B;  2XEH A;  3CHQ A;  3KPH A;  3N2Z B;  3CVX A;  2L6F A;  1MHQ A;  1ZU4 A;  3D3M A;  4FX5 A;  3B9Q A;  2MHK A;  4H7Y A;  5FZQ A;  4RSY A;  1S63 A;  4OD4 A;  3UIO C;  2YWA A;  1YAR O;  2XSE A;  2A0B A;  1XZP A;  5AN8 A;  4AV7 A;  3U3B A;  1ZVZ A;  4I43 A;  2CNW D;  2Y69 E;  2LD6 A;  1JPL A;  3CKC A;  1OCZ C;  4TXR A;  1ST6 A;  1TEZ A;  3AG4 E;  4AY6 A;  2YQY A;  2AP3 A;  3B29 A;  3WXX A;  5HI7 A;  5HKP A;  3ZYM A;  1SA5 A;  3QB2 A;  1XWJ A;  2HSB A;  2Q9A A;  3JRT A;  1VTM P;  4HOR A;  3N71 A;  2PNN A;  3MZL B;  3MX3 A;  2LK4 A;  3MYI A;  3UGO A;  5JHB A;  4HNA D;  1K04 A;  1HFA A;  1QSP A;  2VGX B;  5AQ7 A;  2WMO A;  5EX0 A;  1O1S A;  1QBQ A;  1D8E A;  3BQO A;  4L9P A;  2A6E F;  4FJY A;  3BU8 A;  2QTV A;  4WNG A;  1FVF A;  4CBE A;  4YVQ C;  2KM4 A;  2AJA A;  3PE4 A;  2V0P A;  2XPI A;  3RVZ A;  3LLK A;  4GTM A;  3FUF A;  2YVK A;  3V30 A;  3ZYQ A;  2Q9B A;  3DSW A;  4R7L A;  3QVY A;  1HMD A;  2DYS C;  2NSZ A;  3QWP A;  4WAF A;  1TN8 A;  4H4K C;  5B1B C;  1UG3 A;  3WG7 E;  1LPE A;  3ZC4 A;  3ZU7 B;  3ML9 A;  1T5O A;  4LSZ E;  3FVY A;  4HVB A;  1U89 A;  3C3Q A;  4LLC A;  4BX8 A;  3NYJ A;  4GZC A;  3J06 A;  4EBA A;  5HV9 A;  2UWJ G;  1YAU O;  1YA9 A;  5G05 C;  4JPS A;  4Z9H A;  1S64 A;  3NOC D;  2EIK C;  2EIM E;  3PNT B;  4BER A;  3UT8 A;  3LS1 A;  4XPY A;  4Q5S F;  4EBJ A;  5LFA A;  1WN0 A;  3MKQ A;  3X2Q C;  1EF1 C;  3Q47 B;  3PMR A;  3ZTZ A;  4HOS A;  1GS9 A;  1K8K G;  3ABK E;  3S90 A;  4A4A A;  3IQC A;  1OWL A;  3FU6 A;  4IB4 A;  4FC8 A;  3GWN A;  2KJG A;  3OXF A;  1AWC B;  1ZHY A;  4LNU D;  1GQA A;  3Q9U C;  4F1P A;  4BJ5 C;  1G8X A;  1MNE A;  1M2O A;  2RFM A;  2OVF A;  1SR2 A;  1ZYR F;  4O7G A;  1EQ1 A;  2XPY A;  4U5F E;  2VB6 A;  3ZUV B;  4KNW A;  4WWP A;  2IY0 C;  2RKK A;  4O60 A;  4G7Z F;  2D4U A;  3LS8 A;  2RSE B;  2WM9 A;  3PEU B;  1H2T C;  2WXF A;  2XLE A;  1ELW A;  3B95 A;  4P9F A;  4AP2 A;  4BT9 A;  1BLX B;  1HG2 A;  3BG0 B;  4MQ9 F;  2CNW A;  3ECS A;  2V8S E;  3IXE A;  1S7Z A;  1HF8 A;  4MKT A;  3CKB A;  2OEW A;  2J4B A;  4J32 B;  3VTY A;  2KAT A;  4U8V D;  3VRC A;  1ZHX A;  1OKK D;  2R9R B;  3M4B A;  3NMK A;  3TG4 A;  5JJ7 A;  4FAD A;  2YKZ A;  4CDY A;  4Y6W A;  4E17 A;  2LSV A;  2XLV A;  3IQ6 A;  4N39 A;  3LLI A;  4LEU A;  2DVW A;  3PNL B;  2IXN A;  4JTC B;  2XGS A;  2H6I A;  3FTZ A;  3U0C A;  1JWF A;  4JZA A;  2OND A;  1MMG A;  4CIH A;  1BI7 B;  1HX8 A;  4MVU A;  5T4Y A;  3C3O A;  3UM2 A;  3IBE A;  1MX4 A;  4HOU A;  1ORY A;  1SMY F;  2C04 A;  2C0M A;  1T6Q A;  1LD8 A;  2CGE A;  3E70 C;  3K33 A;  4OIR F;  1E85 A;  3SXK A;  2R7Q A;  2CFU A;  1D8D A;  3HYM B;  3CVP A;  1VK5 A;  3UIN C;  3U2L A;  3ML8 A;  3O48 A;  5L0C A;  3DEP A;  1X81 A;  3PUK A;  3TJ5 A;  2YL3 A;  3ZTM A;  3ESL A;  3B0V C;  4MVQ A;  1INZ A;  2L7A A;  4FA6 A;  2IJG X;  4GYO A;  4U9D A;  3ASN C;  1T9K A;  4GTS A;  2WVN A;  2HJM A;  4AK9 A;  2L6B A;  2ZIR A;  4BJ1 A;  2Q4F A;  1KLX A;  4C3B A;  4XX5 A;  4HXI A;  3DSV A;  4RLY A;  4F53 A;  4YDY A;  1J8Y F;  1ZHZ A;  1N94 A;  5EIL A;  4L6R A;  3V79 K;  2G3K A;  4K7B A;  4ONS A;  3R7R A;  3PZ4 A;  1FTS A;  5CIV A;  2DIW A;  3U4T A;  1QVX A;  1HW2 A;  4NTF A;  3S7B A;  2LFF A;  2Y3B A;  4DOZ A;  3Q6M A;  4JEB A;  2J7P D;  3WOD F;  1JCQ A;  4DVY P;  3HVE B;  3GM3 A;  3AG2 E;  4AEZ C;  1OCR C;  3DJN B;  1Z5Z A;  3IPM O;  3Q78 A;  3EU5 A;  4XKC A;  1RJ9 B;  4NUR A;  2R03 A;  3JCU Q;  1E8Y A;  1EI7 A;  1CGO A;  3FDQ A;  4U8Y D;  4LDK A;  3D9M A;  2MYO A;  4KI2 A;  2H8A A;  1JRA A;  1E8W A;  3KAE A;  5KYN A;  2OJE D;  4LAC B;  3KSL A;  4DUI A;  3C72 A;  2XL8 A;  5T8I A;  3RRM B;  3E33 A;  3C8G B;  4I9E A;  4M63 A;  3U9M A;  3ABL E;  3TL5 A;  3RKV A;  1H6O A;  3RIP A;  2JAB A;  5JJ6 A;  2WVQ A;  1G4W R;  2MOW A;  2NUT B;  3SY2 A;  4XPW A;  3HXC A;  4I6E A;  3ZPJ A;  1XGW A;  3ATP A;  4GA2 A;  1YYH A;  3DRA A;  3KYI A;  1WDY A;  3S9O A;  4HOQ A;  4U5C E;  4UWF A;  2QY9 A;  4N6H A;  4AXH A;  3D9O A;  3G2U A;  4G11 A;  3R7Q A;  1WAT A;  4APO A;  4YK5 A;  2V3C C;  2WXP A;  4J7W A;  3Q7F A;  5FT9 A;  4K5C A;  2WPV A;  4UWL A;  3VTX A;  4CZ2 D;  5BT1 A;  3VAY A;  1B89 A;  5BV1 A;  4E85 A;  4FLH A;  3EFO A;  4LG6 A;  4CRW A;  3BRJ A;  3JT1 A;  3TOM A;  2WXK A;  4K03 A;  3U2M A;  3OAW A;  4GA1 A;  2PQR A;  1V54 E;  4AVX A;  4MW8 A;  3EJN A;  2WQH A;  4Q96 A;  5BPP A;  1ZZP A;  2WB7 A;  1HE9 A;  4OD5 A;  1BZ4 A;  1NA0 A;  3ASG A;  3L13 A;  4GYY A;  2MYS A;  4MW3 A;  4L23 A;  5BW8 C;  2AWI A;  3UMV A;  3HLZ A;  2VH3 A;  1NFI E;  4X8Q A;  5L0J A;  4CIP A;  2V26 A;  256B A;  2E87 A;  3NZU A;  3FUK A;  2AW6 A;  3TD7 A;  1TNB A;  2HMZ A;  4EQF A;  3O4Z A;  2Y3G A;  3QNK A;  3Q7G A;  1HXI A;  3VM6 A;  2MRI A;  2DYR E;  1YZC A;  1NBB A;  4U0Z A;  4IUL A;  2LCH A;  3QK0 A;  5AIJ A;  1SZA A;  3GWL A;  3L0I A;  2J46 A;  4DRJ B;  3PUJ A;  1TJC A;  2XXA A;  3LS0 A;  1QNF A;  1OR2 A;  2C0L A;  4B0Z A;  5EID A;  1KT0 A;  3S27 A;  4LDQ A;  5COG A;  4A55 A;  2IXO A;  3DJU B;  1HO8 A;  3HNK A;  2OVB A;  4HRN A;  2PF4 E;  2RFA A;  4I3M A;  5FQ4 A;  2AWC A;  4O6F A;  1T01 A;  3PDM P;  3GEI A;  1Q0K A;  3JQ1 A;  4RD9 A;  2ETB A;  3U8V A;  3ZIB A;  4APF A;  4G78 A;  3Q7L A;  5CHE E;  3QWW A;  3QAQ A;  1Y4C A;  1PD1 A;  2OOE A;  5EK0 A;  2Q7F A;  2UUH A;  2KK1 A;  3C8Z A;  1GGQ A;  4FAP B;  1YZA A;  4EBK A;  4L1B A;  4HOT A;  5L3V A;  3MV3 B;  2GRO B;  3B7S A;  3HTK C;  5DS5 A;  4IYP A;  3HG0 D;  2KZT A;  3KSQ A;  5D2M C;  2F8Y A;  2OCC E;  3NB2 A;  4PS7 A;  3U5S A;  1OWO A;  4PDX A;  4PS8 A;  3W9G A;  2XGO A;  1EKY A;  1IXV A;  5KYX A;  2RD0 A;  4U7E B;  3RFY A;  3QW0 A;  4HB5 A;  4FU3 A;  4ILI A;  1PD0 A;  5CI9 A;  2ZIS A;  3LEO A;  1H7I A;  4JTA B;  2P6V A;  5DS4 A;  1H0A A;  1K40 A;  2QNL A;  3TWS A;  2F8X K;  2XGM A;  4EUK B;  5B3I A;  3TXN A;  2HE0 A;  5FQ6 A;  1QZX A;  2WQ6 A;  5CI8 A;  2E0I A;  3NMI A;  4U0S A;  1IHG A;  3TG5 A;  4JCZ A;  2DZO A;  4MTF A;  2UY1 B;  1M56 C;  3BEH A;  1FAP B;  3ULE G;  4BWR A;  3EGD A;  2KBX A;  5BUZ A;  3OTN A;  1ZU5 A;  2WXI A;  1S05 A;  2GDC A;  2YLI A;  3IQT A;  2CG3 A;  4ZFH A;  3IHU A;  2PNO A;  3K66 A;  4U0U A;  4EZK A;  3B7U X;  2OU6 A;  2AWY A;  2JX0 A;  3KH2 A;  4HFG A;  4PR9 A;  4U95 D;  5E76 A;  2ZXO A;  4C9B B;  4DK5 A;  3FUN A;  4I6G A;  3K1I C;  1NU7 D;  5L0F A;  4HQD A;  5G2N A;  4MND A;  4YT8 A;  3FU5 A;  4DBR A;  4JZY A;  4GTQ A;  3JYH A;  3SQV A;  3W8H A;  2XLD A;  2NUP A;  4HLE A;  5AC5 A;  4G25 A;  2YL0 A;  3L34 A;  2X0C A;  1WOL A;  2J0X A;  3TWT A;  4E0I A;  3TWQ A;  3K7D A;  5G04 C;  2X6H A;  4GCN A;  1NU9 C;  2A69 F;  3Q4A B;  2QE9 A;  2L6J A;  4JL0 A;  4PUC A;  4BY6 A;  2X38 A;  3B7T A;  4EEC A;  5M72 A;  4JJF A;  4O6N A;  5CMY A;  3TWR A;  5B1B E;  3U9W A;  2L0T B;  4U5D E;  4AL1 A;  4GMR A;  3JUE A;  3B0U X;  4C48 B;  3JXI A;  5ARF A;  1UJK A;  4JTD B;  1K1B A;  4MVS A;  5BUO A;  3RK6 A;  2OKU A;  2J09 A;  3MYV A;  2EIK E;  4CDM A;  1BD8 A;  3RQE A;  1Z6T A;  3KD7 A;  4UI9 C;  3X2Q E;  4YJW A;  3SZR A;  1WM5 A;  5FCL A;  2YIN A;  2EPN A;  1O1R A;  1YJG A;  2OEX A;  4KT6 B;  3T6B A;  1O1T A;  1D0X A;  4OAU C;  2WXO A;  5KYY B;  3SD5 A;  4NIK A;  4BTA A;  4B8C B;  3T5V A;  5E2Q A;  3ASD A;  4E18 A;  3LJB A;  3Q5M A;  1M57 C;  4PFO A;  2P2C P;  1KU2 A;  1DC2 A;  3NQP A;  1TFO B;  3B71 A;  5KYU A;  4UWH A;  4XI9 A;  3UM0 A;  4WNE A;  5LX8 A;  3L16 A;  2WXM A;  3RYL A;  2PM6 A;  2JPU A;  4JB8 P;  2XZD G;  3VYW A;  2EQX A;  5ITZ F;  2F0Y A;  1MX6 A;  1RKE B;  2R7T A;  4Q7C A;  5ENO D;  3ZXP A;  5EGY A;  3HNL A;  4N6C A;  3NDB B;  5KNG A;  1O3U A;  4OIN F;  2VC9 A;  3OXL A;  4ANJ A;  3GOR A;  4LRZ A;  3GAN A;  1IQU A;  2IEJ A;  3EH2 A;  4JC7 A;  3MBG A;  2ETA A;  1IHB A;  1HH8 A;  2B6C A;  1H6G A;  3DE8 A;  3HKK A;  3JYS A;  4ABN A;  1LS1 A;  2PL2 A;  3V5X A;  1NLX A;  2Q9C A;  3CVV A;  3C3R A;  4J8Y A;  1BI8 B;  3QJZ A;  2HFI A;  5KYW B;  2P9I G;  1OY3 D;  2BED A;  3OEO A;  3DSU A;  2YZS A;  1WG0 A;  3IKO B;  4EZJ A;  2HSQ A;  1NFO A;  3MFN A;  1TN6 A;  2LXL A;  3JSZ A;  1A7D A;  4PAC A;  3TWV A;  3VLD A;  1QQ3 A;  2VGX A;  2VTB A;  2GA0 A;  3IEG A;  2KXP C;  4FUL A;  4XE0 A;  3GW4 A;  3ZIM A;  5A6K A;  4GZ5 A;  4DX6 D;  3CHS A;  3ZYL A;  4ACL A;  2GRP B;  3A11 A;  1E90 A;  2HJ3 A;  2L9B A;  1WGW A;  2I15 A;  4W8K A;  1XZQ A;  3D9J A;  4XEV A;  3A9C A;  4JEU A;  4WGZ A;  1SYQ A;  3GZS A;  1I5N A;  4YDW A;  3TAX A;  4BX9 A;  3UGP A;  3N0T A;  5A7D B;  2QLA A;  5L0D A;  2YHS A;  4OAV B;  4J30 B;  1OW8 A;  1HMO A;  5AQB A;  3X1O A;  2Y39 A;  1WTY A;  2WL8 A;  3JSE O;  1T6U A;  5AQ9 A;  5T3T A;  2IM8 A;  3PCV A;  2AXU A;  3K9I A;  4GTP A;  4XEF A;  1TJF A;  2QZA A;  4BPM A;  4CS8 C;  3ZG1 A;  4EKW A;  3UT7 A;  1U3D A;  3CSF A;  1JPN A;  3DBS A;  5L0H A;  3ASN E;  3FTS A;  1UFB A;  3JYY A;  1Y6D A;  2FBN A;  3CST A;  4B89 A;  4AJW A;  1UN8 A;  1WY6 A;  2BTD A;  4BES A;  4CYM D;  2VSX E;  1Z5S C;  3NKD A;  3SNH A;  2I6H A;  4OVU A;  3U64 A;  2IXP A;  2HMQ A;  4DI3 A;  1YYX A;  4HFF B;  3CHR A;  1LIH A;  5AC4 A;  3SP1 A;  2R2L A;  3FY4 A;  4RG6 A;  2IQC A;  2A1D D;  1ZHT A;  2J0W A;  3EQL F;  1FCH A;  2PZI A;  5ENR D;  1A7V A;  3SNX A;  3PZ3 A;  4LER A;  3J5Q B;  2VCA A;  1N4S A;  1BU9 A;  3JCK C;  4MS6 A;  1OCR E;  1MJ0 A;  5F5F A;  3NYM A;  3RRN B;  3VLF A;  1VOM A;  4O6Y A;  1TWA A;  3FH8 A;  3CVN A;  2FAP B;  2IO3 C;  2W4B A;  3AG3 C;  3RKO F;  2P9K G;  3O10 A;  1Z23 A;  1EDU A;  4A1S A;  2HKV A;  3DM9 B;  2QUP A;  3C63 A;  3U9J A;  4RVB A;  2ZXW C;  2GAQ A;  3UKU G;  2BKG A;  3AQC A;  1N4P A;  4N06 A;  1PY1 A;  4IN3 B;  2F37 A;  2PBE A;  3S2A A;  3CK9 A;  4J8F A;  4Y6C A;  3CK8 A;  3FTU A;  3UUX A;  1T6I A;  1LF8 A;  2OG2 A;  4O1O A;  3SFX A;  1WAS A;  3B0P A;  4A3T A;  4LLE A;  4NRH B;  5CCM A;  4MTO A;  3HDX A;  1AUE A;  4NAC A;  4U07 A;  3CAX A;  1WWP A;  4TUU A;  3AAA C;  1VYI A;  4C0E A;  4IRU A;  2HS5 A;  4Q4Z F;  3UQ3 A;  2FGY A;  3G50 A;  2FF4 A;  4IJJ A;  5FZR A;  1BPO A;  1TNU A;  3DXK G;  3HJC A;  3EH1 A;  1OWP A;  2DWZ A;  1N0Q A;  4R32 A;  3OWT A;  4XQ1 A;  1UG7 A;  3E34 A;  4J8E A;  5G55 A;  4MLP A;  5KJM A;  3QZC A;  2R7X A;  4PJJ A;  1SF8 A;  4U5G A;  1EYH A;  3IQ5 A;  1BR1 A;  2LAH A;  4AM9 A;  2CHX A;  2KW3 C;  5ANL A;  3QKY A;  3LCA A;  4Z9J A;  1HY5 A;  5C2Y A;  2UUI A;  2IXM A;  3FU0 A;  2H6F A;  2RG8 A;  2WVI A;  4D10 C;  4W9R A;  1HW1 A;  4U96 D;  3QTH A;  3HHM A;  2J45 A;  4UWG A;  3SEO A;  4BG0 A;  3PZD A;  3AS4 A;  4UQX A;  3KL4 A;  1SVX A;  4DRX E;  2Y69 C;  1HE8 A;  1Q2Z A;  2GRN B;  5FZS A;  1IYG A;  1D0Z A;  1LM3 B;  3PVL A;  4CDN A;  4GYW A;  4BTB A;  5JSL A;  1NSG B;  4U04 A;  3LPZ A;  2V5F A;  1LVK A;  2H7O A;  2WXJ A;  2LUH A;  1H6P A;  3ZSU A;  1QQE A;  2EIL C;  1JWG A;  3ULY A;  3UPV A;  1NZN A;  3C5R A;  3MGB A;  2PP4 A;  1FMW A;  3P1U A;  3CZ6 A;  1H2U A;  4LNG A;  2I1J A;  2XS1 A;  4YDO A;  5A6J A;  3H65 A;  2YHE A;  3N24 A;  3ZVR A;  2BKK B;  3HIZ A;  1M6T A;  1G3N B;  3U8P A;  1V4A A;  1MMN A;  3EPV A;  4U63 A;  4XPX A;  2DB4 A;  1RCP A;  3Q75 A;  2KC3 A;  3UMK A;  2W9Y A;  1X5B A;  1NG1 A;  3C62 A;  1FR0 A;  5CER B;  3EG9 B;  2HR2 A;  3D9N A;  1FVH A;  4G7O F;  2I9C A;  1TWG A;  1HU3 A;  4UI9 J;  5A6B D; 
#chains in the Genus database with same CATH homology
 5E33 A;  5J90 A;  1SZI A;  4C7O A;  2NXP A;  3APD A;  2LO6 A;  4AE4 B;  3OXG A;  3LEV A;  4WUY A;  4HEA J;  4GZD A;  1XNF A;  2LSE A;  4FLB A;  2R5S A;  3Q49 B;  5ANR A;  2GW1 A;  1OCO C;  2YEV A;  1MMA A;  1QZ2 A;  2Y4U A;  4N3C A;  1OKK A;  4KYO B;  4P29 A;  4QDL A;  3FUH A;  4PJL A;  4I6J A;  4I17 A;  3GZ2 A;  3DZA A;  3CQZ A;  5ARG A;  4LCT A;  3B13 A;  3NG1 A;  4JHJ A;  4FWV A;  4GMJ A;  1NZE A;  3U66 A;  1M2V A;  1D0Y A;  4CSA A;  3SZ7 A;  2R7V A;  2VSO E;  2VAS A;  3L54 A;  2P58 C;  2ZXP A;  3FEY A;  4PK4 A;  3LAY A;  4I1M A;  2WXN A;  2ZU6 B;  4I1O B;  2WVO A;  5AYW D;  3FH7 A;  2NG1 A;  2HO1 A;  1OCC C;  4FJZ A;  2KQ9 A;  3PH0 C;  2XQ0 A;  5AEN A;  2XCB A;  2HYZ A;  2DGJ A;  2JLB A;  3CQG B;  4KBQ A;  2LAI A;  1A17 A;  4I44 A;  5HSW A;  3S7D A;  5L3Q A;  2DBA A;  5E3A A;  4DVZ A;  4GZ3 A;  4JXT A;  5T3W A;  3FTW A;  4GB9 A;  1H6K A;  4ULW A;  3EFO B;  2X6F A;  2M4E A;  4BT8 A;  5A23 A;  2AVP A;  1U3C A;  5DS6 A;  5DQZ A;  2J7P A;  4L2L A;  3CVW A;  3IV0 A;  3PEV B;  3FTX A;  4WNF A;  2JEK A;  3RO2 A;  2EIJ C;  2PFD A;  2GFH A;  3BG1 B;  4JUR I;  1PC2 A;  4ANX A;  3JUI A;  1OUV A;  5DVW A;  3FUE A;  4CCA A;  4N2S A;  5G05 J;  2PX3 A;  3FU3 A;  5JHA A;  1W2W A;  4QI0 A;  4YN0 B;  1PCX A;  2I1K A;  4PH4 B;  1ZBP A;  3LEW A;  3ZGQ A;  3QMK A;  1QLE C;  3CR3 A;  4GYT A;  2XXA B;  2UY1 A;  5AJD A;  3LVQ E;  2CDQ A;  4JJG A;  2BUG A;  5B3S C;  2G3V A;  2Y4T A;  5AJL A;  5A6C A;  3D9P A;  3MA5 A;  2X6K A;  4XI0 A;  3G2S A;  1Z6A A;  3W8I A;  2OV8 A;  2KCK A;  1HZ4 A;  2HM8 A;  1E8X A;  2M63 A;  3S28 A;  4AOF A;  3LXU X;  4U5B E;  4YT2 A;  1LKX A;  2GRL A;  4BJ5 A;  3EGX A;  2C03 A;  4YT5 A;  4JEH A;  4NY3 A;  4G2V A;  3QDN A;  4XTK A;  2V4L A;  4I2W A;  1DVP A;  3L22 A;  4ZLD A;  3ZN3 A;  2IOS A;  3FUI A;  2KZT B;  1VYK A;  2EIN C;  2ILR A;  3I3N A;  2IOQ A;  3E9V A;  1Y8M A;  3UMI A;  5KYX B;  3L6A A;  5E3C A;  4UQZ A;  2YQ8 A;  3V7O A;  3I5Q A;  2AXV A;  4I1A A;  1FFH A;  3AG1 C;  3L08 A;  4E7Z A;  4PJN A;  3LY9 A;  4X0R A;  3POV A;  3PRZ A;  4TV3 A;  2WXR A;  3PDN A;  2VQ2 A;  3DXJ F;  3EGD B;  4IAO A;  4U5E E;  4BJ6 A;  1DNP A;  1L5J A;  3DAF A;  2XCC A;  3MCX A;  2Y3A A;  3CIA A;  4RG9 A;  5KCM A;  5KYY A;  4PJM A;  2XRZ A;  3DMD A;  3CEQ A;  3ASF A;  3ABM C;  4K0R A;  1MND A;  5LP0 A;  4N2Q A;  3B7R L;  3G2T A;  4JCH A;  4J0U A;  2IF4 A;  3KEZ A;  3FDH A;  2DYR C;  2LSU A;  3LY8 A;  3S7F A;  4ATG A;  4A2N B;  1KT1 A;  1O5H A;  4A1G A;  1BR4 A;  4BFR A;  3W2W A;  3K1H A;  1UW4 B;  4H7X A;  4QI2 A;  2YHC A;  2IOL A;  3LDZ A;  4RDA A;  3ZHE A;  4OIO F;  1IZM A;  2R59 A;  5DIZ A;  2X3M A;  3NKE A;  3UNG C;  5BNW A;  2J9V A;  4O79 A;  3KMI A;  3E4B A;  3LYA A;  3EZH A;  3ZVV A;  4PS3 A;  3QAR A;  1V55 C;  5T3R A;  3ZRH A;  3ESK A;  3M1C B;  3AU5 A;  1BR2 A;  4MRU A;  4N3B A;  4CT4 A;  3D9I A;  3TGO A;  4DBQ A;  5KYU B;  1GW6 A;  3EIQ C;  3EDT B;  4B94 A;  2Z15 A;  4JHK A;  5B1A C;  1Z3Y A;  5LCW C;  3ONL A;  3ONK A;  1E7V A;  4OVV A;  2H7B A;  3EZI A;  3NYL A;  1Z3X A;  3ULQ A;  2CG2 A;  4CSA C;  2X6J A;  3I4G A;  3Q6N A;  3S0X A;  4LUN U;  3OA1 A;  2J07 A;  3PS6 A;  4P6I C;  3FP3 A;  2B0J A;  2IFU A;  3RRU A;  1O87 A;  1TKN A;  3RO3 A;  3DD7 A;  4C0M A;  1H2V C;  4YWQ A;  2LNI A;  3KKB A;  5IY5 C;  2J9Q A;  5DLJ A;  3EHN A;  4GPK A;  2J9W A;  4YND A;  4URK A;  1N54 A;  3I4U A;  4PFP A;  2VYI A;  3QC1 A;  4DLQ A;  4HFK B;  1EPU A;  2QFC A;  3QWV A;  3ITF A;  2C2L A;  2VTB B;  3NF1 A;  3FHD A;  2JD3 A;  4FES A;  2YNQ A;  2A68 F;  5FQ7 A;  3CVL A;  4BJT A;  2O9X A;  2FI7 A;  4ILG A;  4GA0 A;  4AIF A;  4N3A A;  4UI9 K;  4F7A A;  3CHP A;  2WXL A;  4EBA G;  3UR3 C;  4O6M A;  4WWN A;  2VSY A;  3TJP A;  4IWB A;  4G0H A;  1ZHW A;  3G2W A;  2FFH A;  1D1B A;  4U8H A;  2G62 A;  2X6I A;  5FJY A;  3RIB A;  2ION A;  4RBN A;  1ZU2 A;  4Q69 A;  3FWV A;  3SFZ A;  3ASO C;  2H7V C;  2VSN A;  2NC9 A;  3CLJ A;  4KXK B;  3FUJ A;  2ZXR A;  3MKQ B;  4ANV A;  2XPZ A;  3D9L A;  2WQ7 A;  2W45 A;  1JPJ A;  4G7H F;  4OIQ F;  3DPD A;  5DQT A;  3SGH A;  1SQM A;  4KZ0 A;  4DJA A;  2I8B A;  4FHK A;  3SI5 A;  4BEJ A;  3ZXS A;  4ACK A;  3CSK A;  1H19 A;  1HS6 A;  3CHO A;  2Y3D A;  2R7U A;  3ZW3 A;  4ANU A;  2J4D A;  5D0Q D;  1UJJ A;  1N1C A;  2XEV A;  4N5C A;  1YA0 A;  3CQC B;  3RJV A;  4JW1 A;  3LES A;  1NP7 A;  4WJ0 A;  4CDR A;  1SZ9 A;  1WAO 1;  2XRY A;  3O39 A;  3FUD A;  2PX0 A;  3T4R A;  2Y3H A;  3AG4 C;  5FTP A;  2WMN A;  4BJ6 C;  5F5H A;  4JC8 A;  4AX2 A;  3G2V A;  5G04 J;  2FO7 A;  4JA7 A;  4ILH B;  2R7S A;  2W4M A;  4XLN F;  1FFT C;  1W3B A;  3AS8 A;  5DBK A;  1N52 A;  5T1D B;  3HVE A;  1Z3I X;  4GCO A;  3EG9 A;  4XLP F;  4OYS A;  4KVM A;  4CEM A;  1RJ9 A;  2L9J A;  2QY7 A;  4C3D A;  5E75 A;  4AE4 A;  4C3E A;  3FUM A;  3EIJ A;  1J8M F;  2XL4 A;  3WG7 C;  3FAJ A;  3FTV A;  4AY5 A;  4G26 A;  5EDS A;  4UQY A;  4CS9 A;  5D91 A;  2AXZ A;  2Q3T A;  4G24 A;  2NUT A;  2EIM C;  3MEK A;  3VLE A;  1E96 B;  5JJT A;  3ABK C;  1D1A A;  3F46 A;  4G1T A;  3EHM A;  2IYL D;  3CHM A;  2R7R A;  4G23 A;  3T6J A;  3MKR A;  2R7O A;  5KJK A;  1MMD A;  5ENN A;  4E6H A;  3I5P A;  3CK7 A;  3SF4 A;  3FTY A;  4GZ6 A;  3ZEF A;  2R17 C;  2WXG A;  4C7O B;  5EX3 A;  2A6H F;  4TRQ A;  4EBB A;  3O6X A;  2WXH A;  4OIP F;  4EPZ A;  2J08 A;  5LCW J;  3JQ0 A;  4A3V A;  5HQ8 A;  3SHF A;  2A5U A;  3UT4 A;  1FMV A;  1NA3 A;  4XIF A;  3BEE A;  2WZL A;  3SBT B;  4CGW A;  5BV0 A;  2D5R B;  4F3V A;  4HS2 A;  2XRH A;  4ANW A;  5CMW A;  3ZYK A;  5D0O D;  4FP7 A;  1E7U A;  1E8Z A;  2XHE A;  4M3O A;  2BF0 X;  4YVO A;  1Z63 A;  3PRE A;  3SYN A;  1HG5 A;  1M2V B;  5EKQ D;  5D92 A;  4J8S A;  3PHF 2;  3ASH A;  4JA9 A;  3CV0 A;  2E2E A;  3URZ A;  3D9K A;  3GZ1 A;  3TXM A;  3I4R B;  1ELK A;  4CS8 A;  2CFZ A;  2FEZ A;  4K0D A;  2KCV A;  2FUL A;  3C98 A;  3IHV A;  3QOU A;  3NZS A;  4Q94 A;  1S0P A;  4FHJ A;  1VMA A;  1PAQ A;  1TWC A;  1Y6I A;  5C1D A;  4F4B A;  4DI4 A;  1JUQ A;  4L7T A;  1ELR A;  4BSX A;  3FH5 A;  4ZLC A;  4EWC A;  3CVY A;  4E7S A;  3MLG A;  5FQ8 A;  1TWH A;  3S7J A;  3PE3 A;  3SBS A;  4WWO A;  2KGO A;  2MWQ A;  3AG2 C;  2CHW A;  4KZC A;  1TR2 A;  1D1C A;  1OWN A;  4GAA A;  3AQB A;  4CGV A;  3LY7 A;  4V3I A;  4JHR A;  3UMH A;  4HE8 D;  2J49 A;  2IU1 A;  2X51 A;  5J08 A;  4I9C A;  3R9A B;  3GYZ A;  3P2B A;  4WND A;  3RH3 A;  1IQR A;  3ABL C;  4B8A A;  4KC9 A;  2R7W A;  3FEX A;  4KBL A;  3AS5 A;  3F47 A;  3CVU A;  3RU0 A;  2I2O A;  4XZ4 A;  3FHE A;  3LNR A;  3K6B A;  4KMO A;  2WZG A;  3NRH A;  2WB2 A;  5EHH A;  3FFL A;  3EGX B;  3L17 A;  3DM5 A;  4JVS A;  2BE5 F;  3MJW A;  3IEE A;  1V54 C;  2WZF A;  4J8D A;  4KNV A;  5CCL A;  3IHY A;  2PQN A;  3ZFW A;  4QFV A;  4GEH A;  2KCL A;  3T5X A;  3APF A;  1IW7 F;  2PM7 A;  2GRM A;  3CGH A;  4DPR A;  2DCP A;  4XWJ A;  3U3W A;  4U5H A;  2HV6 A;  3T8M A;  3KS2 A;  2KNH A;  1OWM A;  2NUP B;  1MQS A;  4GU5 A;  5KJN A;  3DAG A;  3AU4 A;  1VDY A;  3LVR E;  2VGY A;  3FUL A;  2L0I A;  3S29 A;  2KC7 A;  2WXQ A;  5FWQ A;  4YT4 A;  4CS9 C;  4EZL A;  1UN9 A;  5LOZ A;  2J9U A;  3LKU A;  3APC A;  4XKB A;  3LJ3 A;  4L2Y A;  3W2V A;  4I2Z A;  4GML A;  2VJ8 A;  2A4Z A;  4ME2 A;  2L81 A;  3Q15 A;  5KYW A;  4UWK A;  4F1S A;  2HV7 A;  2CW0 F;  3MV2 B;  3CVQ A;  2CHZ A;  3GOD A;  5KJL A;  2OCC C;  4CS7 A;  2ZPA A;  2GGF A;  4DLO A;  3ENE A;  4CT0 A;  4J6I A;  4NQ0 A;  4B6I A;  4KVO A;  2P7V A;  1P5Q A;  3ZHE B;  3UX4 A;  3CHQ A;  3N2Z B;  3CVX A;  1MHQ A;  1ZU4 A;  3D3M A;  4FX5 A;  3B9Q A;  2MHK A;  4H7Y A;  5FZQ A;  4RSY A;  4OD4 A;  2XSE A;  4AV7 A;  4I43 A;  2CNW D;  1JPL A;  3CKC A;  1OCZ C;  1ST6 A;  1TEZ A;  4AY6 A;  3WXX A;  5HI7 A;  3ZYM A;  3QB2 A;  2Q9A A;  3JRT A;  4HOR A;  3N71 A;  3MZL B;  3MX3 A;  3UGO A;  5JHB A;  1HFA A;  2VGX B;  2WMO A;  5EX0 A;  2A6E F;  4FJY A;  2QTV A;  4WNG A;  1FVF A;  4CBE A;  4YVQ C;  2KM4 A;  3PE4 A;  2V0P A;  2XPI A;  3LLK A;  3FUF A;  3ZYQ A;  2Q9B A;  4R7L A;  2DYS C;  2NSZ A;  3QWP A;  4WAF A;  4H4K C;  5B1B C;  1UG3 A;  3ZC4 A;  3ML9 A;  3FVY A;  4HVB A;  4LLC A;  4BX8 A;  3NYJ A;  4GZC A;  4EBA A;  2UWJ G;  5G05 C;  4JPS A;  2EIK C;  3PNT B;  3UT8 A;  3LS1 A;  4Q5S F;  5LFA A;  3MKQ A;  3X2Q C;  1EF1 C;  3Q47 B;  3PMR A;  4HOS A;  1OWL A;  3FU6 A;  4FC8 A;  3OXF A;  2KJG A;  1ZHY A;  4BJ5 C;  1G8X A;  1MNE A;  1M2O A;  2OVF A;  1ZYR F;  4O7G A;  2XPY A;  4U5F E;  2VB6 A;  4KNW A;  4WWP A;  4G7Z F;  3LS8 A;  2WM9 A;  3PEU B;  1H2T C;  2WXF A;  4AP2 A;  1ELW A;  4BT9 A;  1HG2 A;  3BG0 B;  4MQ9 F;  2CNW A;  3ECS A;  2V8S E;  1S7Z A;  1HF8 A;  4MKT A;  3CKB A;  2J4B A;  4J32 B;  3VTY A;  2KAT A;  1ZHX A;  1OKK D;  3TG4 A;  5JJ7 A;  4FAD A;  4Y6W A;  2LSV A;  4N39 A;  3LLI A;  4LEU A;  3PNL B;  2IXN A;  2XGS A;  3FTZ A;  1JWF A;  4JZA A;  2OND A;  1MMG A;  4CIH A;  1HX8 A;  5T4Y A;  3IBE A;  4HOU A;  1SMY F;  2C04 A;  2C0M A;  2CGE A;  3E70 C;  3K33 A;  4OIR F;  2R7Q A;  2CFU A;  3HYM B;  3CVP A;  1VK5 A;  3ML8 A;  3O48 A;  3PUK A;  3ESL A;  3B0V C;  1INZ A;  4FA6 A;  2IJG X;  4GYO A;  3ASN C;  2WVN A;  4AK9 A;  4BJ1 A;  1KLX A;  4C3B A;  4XX5 A;  4HXI A;  4F53 A;  1J8Y F;  1ZHZ A;  2G3K A;  4K7B A;  3R7R A;  1FTS A;  2DIW A;  3U4T A;  3S7B A;  4DOZ A;  2Y3B A;  3Q6M A;  2J7P D;  3WOD F;  4DVY P;  3HVE B;  4AEZ C;  1OCR C;  3DJN B;  1Z5Z A;  4XKC A;  1RJ9 B;  4NUR A;  3JCU Q;  1E8Y A;  3FDQ A;  3D9M A;  4KI2 A;  1E8W A;  3KAE A;  5KYN A;  4LAC B;  5T8I A;  3RRM B;  4I9E A;  4M63 A;  3TL5 A;  3RKV A;  3RIP A;  5JJ6 A;  2WVQ A;  2MOW A;  2NUT B;  4I6E A;  3ZPJ A;  1XGW A;  4GA2 A;  4HOQ A;  4UWF A;  4U5C E;  2QY9 A;  4AXH A;  3D9O A;  3G2U A;  4G11 A;  3R7Q A;  4APO A;  2V3C C;  2WXP A;  5FT9 A;  2WPV A;  4UWL A;  3VTX A;  5BT1 A;  3VAY A;  1B89 A;  5BV1 A;  4E85 A;  4FLH A;  3EFO A;  4CRW A;  3JT1 A;  4K03 A;  2WXK A;  3OAW A;  4GA1 A;  2PQR A;  4AVX A;  3EJN A;  2WQH A;  4Q96 A;  5BPP A;  2WB7 A;  4OD5 A;  3L13 A;  1NA0 A;  3ASG A;  4GYY A;  2MYS A;  4L23 A;  5BW8 C;  2AWI A;  3UMV A;  3HLZ A;  2VH3 A;  2V26 A;  2E87 A;  3NZU A;  3FUK A;  2AW6 A;  3TD7 A;  4EQF A;  3O4Z A;  2Y3G A;  3QNK A;  3Q7G A;  1HXI A;  2MRI A;  4U0Z A;  4IUL A;  3QK0 A;  5AIJ A;  1SZA A;  3L0I A;  2J46 A;  3PUJ A;  1TJC A;  2XXA A;  3LS0 A;  1QNF A;  4B0Z A;  2C0L A;  1KT0 A;  3S27 A;  4A55 A;  2IXO A;  3DJU B;  1HO8 A;  2OVB A;  2PF4 E;  4I3M A;  5FQ4 A;  4O6F A;  3JQ1 A;  4RD9 A;  3ZIB A;  4APF A;  3Q7L A;  5CHE E;  3QWW A;  3QAQ A;  1PD1 A;  2OOE A;  2Q7F A;  4L1B A;  4HOT A;  5L3V A;  3MV3 B;  3B7S A;  3HTK C;  5DS5 A;  4IYP A;  2KZT A;  4PS7 A;  1OWO A;  4PDX A;  4PS8 A;  2XGO A;  5KYX A;  2RD0 A;  3RFY A;  4FU3 A;  4ILI A;  1PD0 A;  5CI9 A;  2P6V A;  5DS4 A;  1H0A A;  2XGM A;  3TXN A;  5FQ6 A;  1QZX A;  2WQ6 A;  5CI8 A;  2E0I A;  4U0S A;  1IHG A;  3TG5 A;  2UY1 B;  1M56 C;  4BWR A;  3EGD A;  5BUZ A;  3OTN A;  1ZU5 A;  2WXI A;  2CG3 A;  3K66 A;  4U0U A;  4EZK A;  3B7U X;  3KH2 A;  4HFG A;  5E76 A;  2ZXO A;  4C9B B;  4DK5 A;  3FUN A;  4I6G A;  3K1I C;  1NU7 D;  5G2N A;  4MND A;  4YT8 A;  3FU5 A;  4DBR A;  4JZY A;  3JYH A;  3W8H A;  2NUP A;  4HLE A;  4G25 A;  3L34 A;  2J0X A;  3K7D A;  5G04 C;  2X6H A;  4GCN A;  1NU9 C;  2A69 F;  3Q4A B;  2L6J A;  4JL0 A;  4PUC A;  4BY6 A;  2X38 A;  3B7T A;  4EEC A;  5M72 A;  4JJF A;  4O6N A;  5CMY A;  3U9W A;  2L0T B;  4U5D E;  3B0U X;  5ARF A;  1UJK A;  5BUO A;  3RK6 A;  2J09 A;  3MYV A;  4CDM A;  1Z6T A;  3KD7 A;  4UI9 C;  4YJW A;  3SZR A;  1WM5 A;  5FCL A;  2YIN A;  4KT6 B;  3T6B A;  1D0X A;  2WXO A;  5KYY B;  3SD5 A;  3T5V A;  4BTA A;  4B8C B;  5E2Q A;  3ASD A;  3LJB A;  3Q5M A;  1M57 C;  4PFO A;  1KU2 A;  3NQP A;  4XI9 A;  5KYU A;  4UWH A;  4WNE A;  5LX8 A;  3L16 A;  2WXM A;  3RYL A;  2PM6 A;  3VYW A;  2EQX A;  2R7T A;  4Q7C A;  5EGY A;  3NDB B;  4OIN F;  3OXL A;  4ANJ A;  4LRZ A;  3GAN A;  1IQU A;  3EH2 A;  1HH8 A;  3JYS A;  4ABN A;  1LS1 A;  2PL2 A;  2Q9C A;  3CVV A;  3QJZ A;  5KYW B;  3OEO A;  2YZS A;  3IKO B;  4EZJ A;  3JSZ A;  3VLD A;  2VGX A;  2VTB A;  3IEG A;  4FUL A;  4XE0 A;  3GW4 A;  3ZIM A;  4GZ5 A;  3CHS A;  3ZYL A;  4ACL A;  1E90 A;  2L9B A;  1WGW A;  4W8K A;  3D9J A;  4JEU A;  3GZS A;  3TAX A;  4BX9 A;  3UGP A;  3N0T A;  5A7D B;  2YHS A;  4J30 B;  3X1O A;  2Y39 A;  2WL8 A;  5T3T A;  2AXU A;  3K9I A;  1TJF A;  4CS8 C;  3ZG1 A;  3UT7 A;  1U3D A;  3CSF A;  1JPN A;  3DBS A;  3FTS A;  2FBN A;  3CST A;  4B89 A;  4AJW A;  1UN8 A;  1WY6 A;  2BTD A;  2VSX E;  3NKD A;  3SNH A;  2I6H A;  4OVU A;  3U64 A;  2IXP A;  4DI3 A;  3CHR A;  4HFF B;  3SP1 A;  3FY4 A;  4RG6 A;  2IQC A;  2A1D D;  1ZHT A;  2J0W A;  3EQL F;  1FCH A;  2PZI A;  3SNX A;  4LER A;  3JCK C;  4MS6 A;  5F5F A;  3NYM A;  3RRN B;  3VLF A;  1VOM A;  4O6Y A;  1TWA A;  3FH8 A;  3CVN A;  2W4B A;  3AG3 C;  3RKO F;  1Z23 A;  1EDU A;  4A1S A;  3DM9 B;  4RVB A;  2ZXW C;  3AQC A;  4N06 A;  1PY1 A;  4IN3 B;  3S2A A;  3CK9 A;  4J8F A;  4Y6C A;  3CK8 A;  3FTU A;  3UUX A;  1LF8 A;  2OG2 A;  3B0P A;  4A3T A;  4LLE A;  4NRH B;  5CCM A;  3HDX A;  4NAC A;  4U07 A;  4TUU A;  1VYI A;  4C0E A;  4IRU A;  4Q4Z F;  3UQ3 A;  2FGY A;  2FF4 A;  4IJJ A;  5FZR A;  1BPO A;  3HJC A;  3EH1 A;  1OWP A;  3OWT A;  4J8E A;  5G55 A;  4MLP A;  5KJM A;  3QZC A;  2R7X A;  4PJJ A;  1SF8 A;  4U5G A;  1EYH A;  1BR1 A;  2LAH A;  4AM9 A;  2CHX A;  2KW3 C;  5ANL A;  3QKY A;  3LCA A;  5C2Y A;  2IXM A;  3FU0 A;  2RG8 A;  2WVI A;  4D10 C;  4W9R A;  3HHM A;  2J45 A;  4UWG A;  3SEO A;  4BG0 A;  3PZD A;  3AS4 A;  4UQX A;  3KL4 A;  2Y69 C;  1HE8 A;  5FZS A;  1IYG A;  1D0Z A;  3PVL A;  4CDN A;  4GYW A;  4BTB A;  4U04 A;  3LPZ A;  2V5F A;  1LVK A;  2H7O A;  2WXJ A;  3ZSU A;  1QQE A;  2EIL C;  1JWG A;  3UPV A;  1NZN A;  3MGB A;  2PP4 A;  1FMW A;  3P1U A;  3CZ6 A;  1H2U A;  2I1J A;  3H65 A;  2YHE A;  3N24 A;  3ZVR A;  3HIZ A;  1MMN A;  3EPV A;  4U63 A;  3UMK A;  2W9Y A;  1X5B A;  1NG1 A;  3EG9 B;  2HR2 A;  3D9N A;  1FVH A;  4G7O F;  2I9C A;  1TWG A;  1HU3 A;  4UI9 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...