4I1MA

Crystal structure of the legionella pneumophila gap domain of lepb
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
297
structure length
285
Chain Sequence
SILELKPLTLLMTSSTSFSETINQWADILKTTDMEKFSFDSNPINLLELVKQFNLYVDELAITCEANNVWATPNLFALYDNSGGEAIHGHAFVPYYKESIVLRRLFTVDPNTFNLSRFAAFEGPCQLYCAAHADSAWVKIQTLLTLGNGIINTLKIIKQAQAFGIDEAVTENLKALKEQFIAFQLAEADIKESLKAPSNKESEFFYPIDEKALAKMNGYQLATICLEELNSPKPSPLIERILSNKKFWKRINSAFESGVFKGRTDDPAGKIAKIREWHQLLQISG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mechanism of Rab1b deactivation by the Legionella pneumophila GAP LepB.
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila
molecule tags Hydrolase
molecule keywords LepB
total genus 104
structure length 285
sequence length 297
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18172 LepB_GAP_N LepB GAP domain N-terminal subdomain
A PF18227 LepB_GAP_C LepB GAP domain C-terminal subdomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1700 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4i1mA01
1.25.40.830 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4i1mA02
4IRUA 4I1MA 4I1OB 4JVSA 4JW1A
chains in the Genus database with same CATH superfamily
2JABA 2YZSA 3DE9A 3D9HA 4Z9JA 4ULWA 3HXDA 3U4TA 3R7CA 1U6HA 5D0QD 4I17A 2GW1A 2XCBA 3VLEA 1IW7F 4I43A 3ZTZA 3MEKA 3BEHA 4FADA 5DS5A 3IQ5A 4E18A 2XPZA 4U5FE 1PC2A 3QVZA 2X6IA 2DGJA 4LG6A 3JUIA 2ZISA 3AG2C 3E9VA 2WPVA 3K33A 3SBSA 2VCCA 4JKVA 1ZW2A 2Y3DA 2IBFA 4XEIG 5BV0A 3ONLA 3UPVA 3D9IA 2WXKA 2GRNB 3E70C 3FAJA 4OAVB 1H19A 3ZPJA 3G4XA 4DJ9A 3HJCA 3FU6A 5AARA 2ICWG 3NOCD 3SQVA 4O6NA 4GTTA 5BPPA 1TN8A 1XGWA 3GM3A 4KMOA 2OV8A 3TG5A 5FT9A 4DX1A 4TRQA 4CCAA 1DNPA 4KZ0A 5ANRA 1ST6A 2IYLD 4WNEA 4Y6WA 3Q15A 1S64A 3JTLO 3D3MA 1H7IA 5DQTA 2G62A 2BC5A 3CVLA 4N2SA 4CBEA 3T8KA 2RSEB 4BTBA 1OW6A 4IULA 1OWLA 2AVKA 5B1AE 3B13A 3B7TA 2AWYA 4ILIA 3KEAA 4V3IA 1G5ZA 4L9PA 1M2VB 5F5HA 1QYMA 2H6FA 3JT1A 3GZSA 3HXCA 2DI3A 2QE9A 4A4AA 2O9XA 2AU5A 3Q9NC 4HS2A 3ULEG 3U3WA 3AG4E 3AGTA 1OT8A 5EYPF 5JHAA 2FGYA 5KYNA 1H9GA 3FEYA 4ANUA 3KKBA 3AS8A 4PDXA 4U96D 4DLQA 3RQEA 1H2TC 1D0XA 1SW6A 4C0MA 1E7VA 5L0DA 3SXMA 1YYHA 2XLEA 1D1AA 5FINA 2LK4A 2KZTA 1D8DA 2I2OA 5AC4A 3ZNGA 4Z9HA 2H6HA 3PZ1A 5HI7A 2LSVA 4GTMA 3ESLA 2ZU6B 1WATA 4JEHA 4E85A 5KYYB 2XLVA 1E86A 3DWWA 4YT8A 3MA5A 5BUOA 3T5VA 4YT4A 2WB7A 3A9CA 4YT5A 5KYXB 4G1TA 3WHNA 1SZ9A 2IXOA 3V5YA 1D0YA 3DSSA 3LEWA 1MQSA 3GANA 2HR2A 3SO8A 1SA4A 1KU2A 1OWNA 4AEZC 4CX9A 3SGHA 5AGFA 2MHKA 3ZIBA 2J4BA 1JCQA 4I6EA 1MMAA 4MVRA 3SD5A 4BEJA 1Z5SC 4C0EA 2WZFA 3M1CB 4U04A 4HOQA 3SNHA 4PS8A 5CCLA 4IN3B 1ORSC 1VDYA 5CI9A 4LDRA 4U5CE 4GCOA 3MKQB 1IYGA 4J7WA 1IKND 3E33A 4JA7A 1FR0A 4I1OB 3MGBA 2P9NG 3B29A 1FPPA 4MVSA 3K66A 2VCBA 3KSQA 4BT8A 3RVZA 1IQRA 5B3SC 3DEOA 3QB2A 2L81A 4F7AA 3CK8A 4XEVA 5ITZF 1NFOA 1ZHZA 3DD7A 4LNGA 1WWPA 1YMPA 5A6JA 4EBKA 3B0VC 1FMWA 1RMVA 3RO2A 2C0MA 4LDQA 3RJVA 3OEOA 2WXQA 5JS5A 2WL8A 1IXVA 1CGME 3CHQA 3EG9A 1ZYRF 2QY9A 4A3TA 4JE9A 2HKVA 3HNIA 4H54A 3MFNA 1T5OA 2YLDA 4YDWA 5B1AC 3U9JA 2HO1A 1K05A 1VOMA 3AG1C 2YHSA 3EHQA 1ZU2A 4N3AA 3RQFA 1LI7A 3PNLB 4AK9A 2NG1A 4BSZB 1HG2A 5AQAA 3ECSA 5DQZA 1FMVA 2F37A 2EPOA 1NBBA 3KPHA 3PZ3A 4EECA 3DPDA 1TQGA 2W45A 4HI8A 1GGQA 2KCLA 4I3MA 1BPOA 4TXPA 2OEWA 1A0BA 4J8SA 4O6FA 2CG2A 4GU5A 4F6RD 3TXMA 5IY5E 3ABME 1M56C 3L82A 2FEZA 2XEHA 5L3VA 3DAFA 3QC1A 2H7VC 2XL6A 4WGZA 3QMKA 5HS0A 1L7CA 3OA1A 1KZOA 3PUKA 1I4YA 2EIKE 3DJNB 2A5UA 2JPUA 3NYJA 3LVRE 3ZKJA 1DCEA 1I5NA 3S7JA 5B3IA 3ULYA 4BESA 3I4GA 2AWIA 4CDRA 2F0YA 1ZHXA 2M4EA 3FULA 1JPNA 3ZVRA 4GYTA 4JHKA 2R02A 1OKKD 2I8BA 3T6JA 1MX2A 4KI2A 2PF4E 2Y3HA 3BEEA 1EDUA 1LVKA 4WWPA 3T5XA 1JPJA 2Q00A 4LNUD 2XPYA 2GAQA 3QW1A 4I9EA 2QFCA 3LAYA 1YYXA 4KYOB 2P9SG 5L0HA 2WXPA 3L16A 4FC8A 4LUNU 1H2VC 2LUHA 1A7DA 3SHFA 3ABKE 1TNZA 3EU9A 5FTPA 5AJDA 2A1DD 5D2MC 4O79A 3NMIA 1N0RA 5F28E 2WM9A 4DVYP 2WZGA 3ONKA 4R7LA 4QFVA 3IEGA 3ZIMA 5CI8A 4HOTA 5A7DB 4C9BB 4JJGA 5FQ4A 2IONA 3CHMA 2P0NA 4CRWA 1M2VA 1HMOA 3PUJA 5A23A 2WQHA 4Z9IA 3U66A 4MRUA 2F22A 1A7VA 3QNKA 2X6JA 2E0IA 3PZ4A 3PRZA 2LFFA 2AP3A 3LUTB 4ANJA 3GEEA 4C7OB 5JA4D 5KYWB 1T6QA 3D9NA 5KJNA 1XNFA 3T6GB 4LNBA 2PX3A 3FH8A 5KJLA 2R05A 4D4XA 3IEEA 5HV9A 4UWHA 1BR1A 2J07A 3NB2A 4JB8P 1ZHTA 3B9QA 3WG7C 2ETAA 4GZDA 5ANLA 1KPSB 2OJED 3TXNA 5CEAA 4ULVA 3PNTB 5EHHA 1D8EA 2FO1E 3PCVA 4KNVA 4O1OA 1MX6A 4K0RA 4WWOA 3ASNE 4E0IA 5T3RA 3FUDA 4KT6B 3LEVA 4C3DA 3V79K 4N4WA 3ZYQA 5B1BC 2GFHA 4GZ5A 1JPLA 3Q4AB 4MTGA 4IYPA 5EX0A 4ZHBA 5BQGA 4EHPA 4C7OA 4GMLA 3G2SA 4B8CB 1WASA 2ZXPA 2NSZA 1M2OA 1W2WA 1JCSA 3MYIA 2XHEA 4ANWA 2XEVA 1SA5A 4H4KC 5L0GA 1HS6A 1S05A 3S90A 2A5EA 4CS7A 1O1TA 3FXHA 1HY5A 4CT0A 1QZ2A 4XEKA 5A6BD 1FNTc 3VTXA 2QNLA 1CGOA 4CDYA 3FH5A 2UUHA 3UKRG 1U89A 5AN8A 4E7SA 5KJKA 4C3BA 1T6UA 1XZQA 5AQ7A 1WM5A 3QAQA 5AYWD 3TWTA 2ETBA 4CS9A 4WAFA 2PM7A 5A6CA 3Q79A 2J9VA 3BQOA 4NIKA 1QBQA 5T4YA 1DCQA 2EPNA 4GTPA 5ENSD 4HXIA 4JVSA 1N0QA 1KT0A 1B68A 1TWCA 4PK4A 3FU3A 5ARFA 3RIPA 2XCCA 2XM0A 4G26A 2J4DA 1APCA 1UJJA 3U9WA 3URZA 3JZ0A 5G05J 2DYRC 1Z3YA 2J46A 3KH2A 4AP2A 3D9KA 4AL1A 1QLEC 3UT7A 3FEXA 3TG4A 1JUQA 3EUVA 2PQNA 1TFOB 2Y69C 3C8ZA 4XI9A 4IB4A 1FAPB 1PCXA 3SFZA 4BX9A 4CGWA 4AE4B 1B89A 2Y39A 3IBEA 3CIAA 2X0CA 1HZ4A 2FBNA 2WZLA 4WJ0A 1D0ZA 2YQ8A 1NLXA 3ZHEA 2XRYA 2IO3C 4G0HA 2HS5A 2VQ2A 3KS2A 3WG7E 4NCQA 3ZYKA 3CHSA 3FP3A 1WDYA 2WVNA 4HRLA 4UI9C 4FX5A 3C5RA 2Y3BA 3E34A 3TK0A 3VF0A 1J8YF 2VGXB 1QNFA 2UWJG 1YZAA 1JWGA 4HEAJ 2LAIA 3ZWIA 5JUAA 3HNLA 2KYHA 3EGDA 3CVVA 4MS2A 4CJGA 2J08A 3DM5A 3HYMB 3NKEA 2BUGA 3LNRA 4EHMA 2PP4A 2I9CA 1F1MA 2ILRA 3PEVB 2PZIA 1SF8A 3P1UA 4H7XA 4DXWA 3UM2A 3JCKC 4UQXA 5JJTA 3ZYMA 2KGOA 1R4TA 2ONDA 4K5BA 1OWPA 3C72A 3ESKA 2ZIRA 1T6IA 1YA7O 4GTVA 3J5PA 1RKCA 3I3NA 2Q4FA 1K1AA 4U8YD 1Z3IX 1NA3A 3EHNA 4CS8A 3MV3B 4AIFA 2MRIA 1WGWA 3JSZA 3ITFA 1GW6A 2KNHA 5KYYA 2CHZA 1L5JA 3DSVA 4N2QA 3ZGQA 1E8XA 1Q0MA 4P6IC 3S9OA 2WQ6A 3PDMP 3PHF2 4B93B 5JT4A 1LM3B 3FDQA 4JEAA 1BI7B 4Z68A 4AY5A 3Q49B 3APFA 3RKVA 2DVWA 3MJWA 4TUMA 4F1PA 1DOWA 5TJ5E 1OKKA 2YINA 5AC5A 1V54E 2J0XA 1E8YA 1QKRA 1HH8A 1HE8A 3FUJA 4IRUA 2NUTB 4G2VA 5CRUA 4FLBA 1TFKB 2DYRE 5FQ7A 2XXAB 3QVYA 2TMVP 2V5QC 2D5RB 3FUMA 4GYWA 5FWQA 1O1SA 2B6CA 3KEZA 1HFAA 2R7SA 4OIRF 4ANVA 3RH3A 1TYQG 4ER9A 3DZAA 3IV0A 3W4YA 3CK9A 3LKUA 3SZ7A 2OG2A 1FVHA 2Q9BA 1KZPA 5CMWA 5CRVA 4U5HA 2LXMA 3TULA 3SY2A 3UT4A 5D92A 1LD8A 1OXKA 5J08A 3EJNA 4NTBA 2H6GA 2EINE 5ENQD 2HV7A 3C8GD 1EA8A 3ISMC 2NUPB 3HNJA 3LY7A 3CKCA 3GZ1A 4MNDA 3MLGA 3ZXPA 1PD0A 4AV7A 4DI3A 3H2UA 4DBQA 3M15A 2M64A 1BI8B 4B0ZA 3FTVA 1H6KA 4G8LA 4PACA 1SYQA 3HKKA 3LLKA 3RAUA 3PVLA 5KYWA 2WXJA 4KC9A 1XWJA 4PUCA 3U64A 4KVMA 2IO2C 4N3CA 1JRAA 3S7FA 3VLDA 4RG9A 4MW8A 2Y1LE 2VJ8A 3JXIA 2DBAA 4JCZA 2VB6A 4AX2A 2R7UA 4BX8A 2P61A 3PE4A 4HORA 2WVOA 4FLHA 4XKCA 4XI0A 3E37A 3EZHA 3C63A 1DC2A 4AOFA 4BJ5C 3LJ3A 5T8IA 2IOSA 4CDMA 3LNMB 2GGFA 2CNWA 2VSYA 4AY6A 2HSBA 4AJWA 3ZQYA 5AJLA 1J8MF 1Z6TA 4P9TA 2EIJE 2DCPA 2OCCE 3LJNA 4RLYA 3ASGA 4OD5A 4BWRA 2WXIA 3SFXA 2GROB 2EPMX 4EKWA 4NTFA 1TR4A 1TJFA 1VB5A 1H9TA 2R7QA 4MVUA 4M7CA 3K1IA 3Q6MA 2PX0A 1RKEA 2E87A 4MVQA 4OIQF 3CHPA 5HRYA 2FAPB 2CYDA 2YNQA 4MTOA 3IHVA 3O48A 3UUXA 3CVUA 4YL1A 3DJUB 2HSQA 4D4NA 3D9JA 4AVXA 4IAQA 2NC9A 3J5QB 5G55A 3TWUA 3WODF 4K1OA 4LACB 2YHCA 3Q7FA 1E83A 4K03A 1MZCA 3FHEA 2KM4A 4RSYA 1E84A 4XLNF 2RFAA 1BZ4A 4EZJA 4UWKA 1N11A 4LDKA 2IF4A 3V2OA 3CEQA 3LJBA 4B8AA 2HE0A 2VTBA 2HYZA 3FU0A 3AU5A 2QLAA 4ME2A 4JRZA 1Y6IA 2ZXWE 4EZLA 2KK1A 4W8PA 4GCNA 3KYIA 2HMQA 5LX8A 1TN6A 1DVPA 2WXFA 1TNUA 3K7DA 1EI7A 1LKXA 3EQLF 3UX4A 1ORJA 4L23A 3BRJA 3AQBA 3PREA 1JOGA 2CG3A 3EPVA 2XLHA 3T4RA 5CBOA 2V4LA 4GZ6A 2R7WA 1ZHYA 1NZEA 3RKOF 1S70B 2X38A 3FUFA 3HXBA 3LY8A 4H7YA 3V5ZA 4Q96A 4N6HA 1BDJB 1V4AA 1UG3A 3T9KA 3MZLB 1AWCB 1RZ4A 3L9TA 1FVFA 3Q9UC 4OVVA 5T3WA 3SF4A 4BT9A 1YDIA 3K1IC 2WXRA 4AE4A 1HX8A 1LD7A 1YA9A 3O10A 2L9BA 4KVOA 3QTHA 4JD2G 3N71A 3JRMO 4HOSA 3U5SA 3GWLA 3CVWA 4DK5A 4G11A 5ENTD 4MLPA 2YL1A 4CDNA 5A69A 3Q7AA 1V55E 3S7BA 2XENA 2EIJC 3CK7A 2R5SA 4BJ5A 4JTAB 3MCXA 4KBLA 1WY6A 2IQCA 2CCYA 256BA 3LS8A 2EILC 1V74B 2LQGA 4YDEA 3HRAA 4J6IA 3DPYA 4TXRA 5A6BA 5ENNA 4K5CA 1O3UA 2EINC 3ZG1A 2RG8A 3E4BA 4GZ3A 5LCWJ 1RKEB 3EG9B 3LLIA 2A6EF 2XQ0A 5FIOA 2WVQA 3L1MA 4KBQA 2CW0F 3H2VA 4P9FA 3TQOA 3U8PA 2GA0A 1UG7A 4JA9A 4YL3A 3R7QA 1Q0KA 5T3TA 3G50A 3OAWA 4PJLA 3B7UX 4JTCB 5BT1A 4J7TA 3V30A 2JX0A 4K7BA 5AQ9A 3MV2B 5G04C 2A69F 4HE8D 1FFTC 1SR2A 2WVIA 2OJQA 1W3BA 2EIME 2D4UA 1Q2ZA 4JC7A 2YLIA 3RFYA 1N4QA 1MNEA 3HIZA 1BU9A 5COGA 1OCCE 2IXNA 1INZA 3DSUA 1AVOB 3OXGA 2J7PD 3PMRA 3ZYLA 1HMDA 3OXFA 2GDCA 3SYNA 4YDOA 4OVUA 4UWFA 4DRXE 4JZAA 1LPEA 3FTYA 4CGVA 4PS3A 3SFYA 5JHBA 1VTMP 3RF3A 2R7XA 2R7VA 4DLOA 1OCZE 3CGHA 3NYLA 3FUEA 5HKPA 3CHOA 2WB2A 5JP7A 2RKKA 3D9MA 1NL4A 4XLPF 4YL0A 3DKAA 5FJYA 2PNOA 3GM1A 5E75A 4HRNA 2B0JA 3DXMG 4OAUC 4FESA 1TEZA 2M63A 4M63A 3GEHA 2KCVA 4FULA 2WMOA 4M3OA 2P2CP 3FU5A 3CLJA 3IKOB 4EBAA 2X6HA 2LD6A 1JCRA 2CDQA 4U63A 4WUYA 4PFPA 2BKKB 2MHRA 2R25A 1T9KA 3M4CA 4BTAA 1V55C 2B0OE 2HUJA 1OR3A 3FOOA 3E32A 4LEUA 3FTUA 3TWRA 3CQCB 1K40A 1NSGB 3C3RA 3EGDB 3FDHA 3ZSUA 4DX6D 3SBTB 4TUUA 2DB4A 5FZTA 2OKUA 4E7ZA 2VGXA 3O39A 5KJMA 3HDXA 2ZXWC 2RD0A 5IY5C 2DYSC 2XGMA 2WXMA 1KLXA 2LCHA 3DXKG 1O5HA 2XS1A 2EPKX 2AXZA 3IHYA 3AAAC 3HVEB 4AL0A 2DZOA 3JYHA 3DI5A 5BXUA 4UDVA 2ZD9A 2QYJA 2F8XK 1MYOA 5H7PA 4NURA 2WMNA 4EQFA 4GTQA 4J8DA 1QPUA 5ENOD 1ZU5A 4U5GA 3DWLG 1YZCA 3H65A 5CEDB 3ASDA 4HVBA 2V5FA 2J9UA 2J0WA 4BEMJ 3C62A 1MMDA 3Q7LA 1T01A 2X51A 5JLIA 3CVPA 4UWLA 4K5AB 4U07A 2R7TA 3MKQA 4BY6A 2BEDA 3JQ1A 2WQ7A 5AENA 3OTNA 1FT2A 3FY4A 4ILGA 2OOEA 2ZXOA 3AG3C 4U0UA 1CGNA 2NSGA 1PD1A 3EDTB 4CDAA 4BPMA 4Q7CA 4FU3A 1OXJA 5LCWC 4Q5SF 4X8QA 4ILHB 3Q47B 3GW4A 5CBNA 4GMRA 5COMA 1TNYA 2Y4UA 3NZSA 2I6HA 3FAPB 4G23A 2NUPA 3RIBA 1ELRA 4NRHB 5DLJA 3VLFA 2LFDA 4BJ1A 3L22A 3TAXA 3DSWA 2L0TB 3C3OA 4IAOA 4OINF 5DIZA 3TWVA 5FQ8A 3APCA 1GS9A 2WXOA 4WGYA 3RYLA 2L6BA 4MW3A 4F3VA 3FUKA 1LS4A 2HV6A 4U0ZA 1E85A 3EHRA 4JW1A 5LOZA 4MKTA 1BR4A 4JJFA 3ZFWA 3Q7GA 4GTSA 2GRQB 4OD4A 3JCUQ 3X2QC 4Q4ZF 4LLEA 4FHJA 3HXFA 3ZQVA 4PJMA 3LS0A 3QW0A 3SXYA 3LDZA 2LAHA 3KD7A 5FCLA 1SQMA 4ZFHA 4YVQC 3UMVA 2OOCA 3FFLA 1Y4CA 2KC3A 1HW1A 4JXTA 2UUIA 1PAQA 1OQCA 1MJ0A 3KYJA 1TKNA 2LSEA 3TWWA 5EK0A 4XQ1A 2EQXA 5DBKA 3AG2E 2C04A 4BETA 1C02A 1N94A 5E3CA 4LLCA 3QJZA 3ASHA 1Z5ZA 2VGEA 2LP4A 3TOMA 3AQCA 1O1RA 3KAEA 3N0TA 4E17A 2XLMA 1H2UA 4UI9J 3CVYA 4ZLCA 1HU3A 3EFOA 1QSPA 3EGXB 5L3QA 1OCOC 2H6IA 2WXGA 2AJAA 3LXUX 2J9BA 3UIPC 5DVWA 4UQZA 4O6YA 5L0FA 3JQ0A 2PQRA 1QQ3A 4GMJA 1IHGA 3T8MA 4EZKA 2KZTB 1SMYF 1A5EA 2Q7FA 3C8GA 4XZ4A 1OCZC 3SZRA 2NYJA 4QDLA 1NZNA 2R2LA 3G2VA 3ZUVB 2KJGA 3K9IA 3GODA 3DAGA 5G05C 1N4SA 1WG0A 2L6FA 2AXUA 4I44A 4CSAA 4IGGA 1D1CA 3G2UA 5J90A 2OEXA 5EIDA 4A55A 4I1MA 3FUHA 5BW8C 2GRLA 5F5FA 3RQGA 3V5XA 3L6AA 5EILA 3TWXA 5KYUB 2Y3GA 3IHUA 2QYUA 5CHEE 3C7JA 3I5QA 1A17A 3DSXA 4CJOA 3TL5A 4JURI 1ELKA 3EIJA 2R17C 1Z7Qc 3NAWA 3B7SA 1MQVA 1G4WR 3S29A 1JAFA 3B7RL 1E90A 1RCPA 1OCRC 4F4BA 3UM3A 4F53A 2J09A 3PEUB 1G4US 4EUKB 3J06A 3CVXA 2I1JA 1ZW3A 3NMKA 1Q0GA 1I4ZA 3W9GA 2CNWD 3LEOA 3UM1A 4JEBA 3ASNC 1D1BA 1ZVZA 4MTFA 2HM8A 2RFMA 4DX5D 2DYSE 4ACKA 2YRFA 4A1GA 4YJWA 3FMSA 3CVNA 1L3PA 4J8YA 2FF4A 1IHBA 2OVFA 3PH0C 3FH7A 3T9OA 2ETSA 3R7RA 2ZXRA 4U5EE 3B7BA 2XLDA 2AXVA 4HQDA 5AQBA 1N4RA 3FHDA 2XZDG 4G7HF 4XKBA 3K1HA 2L6HA 2R59A 4ATZD 1TWHA 2NSFA 4X0RA 1JMWA 4GZCA 2H7BA 4WWNA 3O55A 4DJAA 3FTSA 4QI2A 5HQ8A 3DXJF 4DI4A 1ORYA 2XRHA 4MBGA 3AG3E 3QKYA 4PJNA 4YT2A 3M79A 2X3MA 2ZGGA 1VYKA 4KNWA 1H0AA 1GQAA 4NQ0A 2XLWA 1WTYA 2VSNA 1WOLA 1OUVA 3HG0D 2I15A 1A7EA 1E2XA 1YCSB 1OCOE 2XM4A 3UGOA 4CT4A 4HFKB 3CSTA 4JHJA 4WNGA 3I5PA 4N5QA 4G25A 2VH3A 4HOUA 2MWQA 4JEUA 1QVXA 5BV1A 5C1DA 4HLLA 3AGUA 2G3VA 2Y4TA 2J8SD 4E0HA 1ZB1A 1OR2A 3U3BA 3NZUA 4ATGA 4RVBA 4OYSA 3SI5A 1K04A 4J8FA 3VRCA 2LNIA 3AS5A 4G24A 4E6HA 2C2LA 4I9CA 3QDNA 4RDAA 4NY3A 1JWFA 3DMDA 3X2QE 4W8KA 1TN7A 4FJZA 1Y6DA 2Y3AA 5E33A 2G3KA 3AG1E 4HLEA 3VM6A 3T6BA 4A2NB 3AJMA 4J8EA 2J9WA 2VYIA 2HJ3A 1X81A 2LO6A 2IJGX 4N06A 1M6TA 3RK6A 4RBNA 4I6JA 1S7ZA 3S27A 3KSLA 1V54C 1SZIA 4KZCA 5M72A 1BLXB 2YHEA 3GM2A 3V7OA 2KXPC 4JTDB 3NQPA 3ABLC 5BQHA 1FFHA 2BF0X 1QZXA 1EQ1A 2ASRA 1MNDA 5L0CA 2YWAA 1NU9C 4MVZA 4HRMB 4PS7A 3UXGA 5ENPD 2CFZA 2KQ9A 5CMYA 3ABMC 1KNYA 5EGYA 4CEMA 2OQMA 3P2BA 2AWCA 3NYMA 4URKA 4LSZE 3L0IA 5B3SE 2UY1A 3E30A 4B89A 4RG6A 4GA0A 1TWGA 1YYJA 2P58C 3FTXA 1UN9A 1TWAA 2A0UA 2PNNA 2EIKC 5KYXA 4JC8A 2PM6A 4FAPB 4YVOA 4CS9C 3LESA 3W8IA 3UIOC 4BEPA 5D66A 2Q9AA 3BU8A 4U0SA 4DX7D 3X1OA 3JYYA 2Q9CA 4U8HA 1A41A 2QC9A 4RQIA 3W9FA 1FTSA 3MYVA 1H6GA 4GYOA 3Q75A 4JPSA 3TD7A 4DBRA 3DRAA 3LS1A 1WN0A 2WXLA 5CECB 4EWCA 2BL2A 3C98A 4MVMA 4ONSA 4O1PA 3O4ZA 3V31A 1OW8A 2HMZA 1EF1C 1K8KG 1Z3XA 2A0BA 1TJCA 1N54A 4LCTA 4ACLA 3CSFA 2IXMA 4TV3A 1TR2A 5HSWA 3B0UX 3MYFA 3HVEA 3L8JA 1N1CA 3CHRA 2C03A 4FJYA 5L0JA 4R32A 4XPWA 3ABKC 1OCRE 3FTZA 3FUIA 4U5DE 5FQ6A 3UINC 3S0XA 2YLGA 3ZXSA 1E8WA 4QI0A 1AEPA 1Z23A 4EBJA 1O5MA 2ZGDA 3F47A 4J7YA 2J49A 3DEPA 3LY9A 2J9QA 1VK5A 1EKYA 4U7EB 3ZEFA 2DWZA 2C0LA 4L1BA 2UY1B 3S2AA 1MMGA 4EBBA 2QTVA 4N39A 2XGSA 4XPXA 1HXIA 5G04J 2Q3TA 4CIHA 2X6KA 3ATPA 3GWNA 2X6FA 4GAAA 1P5QA 2KCKA 2WXNA 3QARA 3GEIA 2YKZA 3UNGC 4GB9A 3NDBB 5K0IA 3TWQA 1BBHA 2OU6A 2IXPA 1U0BB 4APFA 3APDA 1E8ZA 4FHKA 4EIYA 3PZ2A 2AVPA 3ABLE 3UT8A 2F8YA 3JXJA 5CCMA 3K6BA 3HHMA 2KC7A 1KTMA 3C8GB 2VC9A 3BG1B 3IPMO 2P7VA 3Q5MA 3RO3A 3SXKA 5BUZA 3BG0B 3NBNB 2FI7A 4O60A 3EIQC 1H6OA 4GTRA 4UWGA 5B1BE 2P9KG 4EPZA 4ABNA 4OIOF 4LRZA 2ETCA 2Y0BG 3LPZA 2I1KA 5DS6A 2EPLX 3UMHA 4RD9A 4NTAA 1X5BA 3ASOE 4MQ9F 3S28A 4G8KA 3EU5A 5KYUA 3ZHEB 3CSKA 4XWJA 4JCHA 4QQIA 1ZU4A 5JJ7A 3IQ6A 3FVYA 1VLTA 1Q0DA 1UJKA 1ZZPA 2CGEA 3RSEG 4HBDA 3TJ5A 4XTKA 4CS8C 1RW2A 5ENRD 5C2YA 4XEFA 2VCAA 3AS4A 3HXEA 4IWBA 2PBEA 1ELWA 3UGPA 3B95A 5LP0A 3UMIA 1LI5A 2L9JA 2AW6A 3QK0A 1OY3D 2W4MA 2YL7A 4MS6A 2OVBA 3N2ZB 2CHWA 3FOPA 3OWTA 1CPRA 2XLOA 3RRUA 3ZRHA 3CR3A 1VLSA 3UKUG 2YL0A 3W8HA 4XPYA 2P9IG 2H7OA 3EHMA 3CVQA 1S0PA 4GYYA 3QZCA 1SVXA 3EZIA 2BE5F 5BNWA 3IQTA 3ENEA 1CPQA 4Y6CA 1IQUA 3VTYA 1TNBA 5KBAA 4DPRA 1NU7D 4P29A 4PH4B 3LVQE 4DUIA 4DX2A 1BR2A 5JVEA 3CZ6A 3NOGD 4J32B 5FZRA 2ZPAA 1UOHA 1RJ9B 3POVA 2QUPA 3L54A 3GZ2A 3QWVA 4U95D 2V0PA 2V4HC 3ZC4A 3DE8A 3SNXA 2EILE 1U2VG 3NF1A 4ANXA 2Y69E 3PZDA 3OXLA 1HF8A 4DVZA 2IM8A 4OIPF 1NFIE 5JSLA 3U3FA 3MKRA 5JJ6A 3N24A 4U8VD 4WABA 2BKGA 2MYSA 2IOQA 2V3CC 3F46A 4L2YA 4APOA 2KSFA 4Q94A 3IQCA 4GQHA 3AJIA 4PJJA 5KNGA 4IARA 2HFIA 3JSEO 1NI1A 4U5BE 1UFBA 3RVYA 4L2LA 2XRZA 5G2NA 3R2PA 5EIBE 4CSAC 4Q69A 3G2WA 3GORA 4YDYA 2WXHA 3ZTMA 4BFRA 2XPIA 4CIPA 4NACA 1FT1A 4WNDA 5L0IA 2GRMA 4GPKA 1YAUO 2VASA 3TOLA 2JD3A 2R7OA 2H8AA 4N6CA 3CQGB 4DOZA 4BSXA 2VSOE 3ZN3A 1Z6AA 4W9RA 4CYMD 3PDNA 2A6HF 1OCCC 3ASOC 1GM5A 2FO7A 1YA0A 3L08A 5EDSA 2P6VA 4I1AA 2XL4A 3U2MA 2A4ZA 4C48B 3B0PA 2MYOA 3ASFA 5AIJA 4BJTA 2NPUA 3D9PA 4XX5A 4YWQA 2NUTA 5DS4A 4YN0B 2IU1A 4YNDA 1EYHA 2XS8A 3DM9B 4NQFA 3UI2A 3Q6NA 4BJ6C 3DSTA 3ML8A 2J7PA 2J8WA 1MMNA 4G78A 2L0IA 3NG1A 5EYLA 4B6IA 4G7OF 3D9LA 2QZAA 3Q73A 3S7DA 3HNKA 1HE1A 1KT1A 1PY1A 3R9MA 4WNFA 1E7UA 3L8IA 2DIWA 3NRHA 5GPGB 3NKDA 4I2WA 5BQIA 5T1DB 3QWWA 3S84A 4F1SA 1LE4A 2B0HA 1OWOA 2HZ8A 3US6A 5CIVA 1JR8A 1E96B 2CFUA 2GRPB 3U8VA 2IY0C 5D91A 3TJPA 4J30B 2J45A 2W4BA 2KATA 1C17M 1WAO1 3TGOA 3CEXA 5LFAA 2V8SE 5A6AA 5EN5D 2YEVA 1G3NB 3Q78A 3CAXA 1UN8A 5D0OD 4UQYA 3L13A 1ZBPA 3RRNB 3U0CA 3ZU7B 2XXAA 2Q7RA 3CKBA 1N4PA 1PV3A 1G8XA 3G2TA 3UM0A 4UUCA 4GEHA 1OWMA 3HLZA 3JRTA 2XZTG 3TWSA 4FA6A 3WAQA 4KXKB 2EIMC 4DRHB 1N9AA 3VYWA 4A1SA 3EH1A 1QQEA 1IZMA 2P9PG 4L6RA 2LSUA 3UQ3A 4U9EA 3JUEA 3AU4A 2KW3C 1MX4A 3PE3A 2RD9A 1NFNA 4BG0A 4EBAG 1DOVA 2GRRB 3I4UA 3PS6A 4HNAD 4GA2A 1SZAA 1YARO 3SEOA 2QY7A 1R5ID 3WXXA 3U2LA 5FZQA 3GYZA 4HI9A 3SXZA 5KNHD 1HG5A 2E2EA 1C03A 2YQYA 4BJ6A 3UTMA 3RW0A 3L17A 5EKQD 1LE2A 3ZVVA 5JMND 3IXEA 4HFFB 2R7RA 4A63B 1M57C 2P9UG 3BUAA 4BERA 3LCAA 1VYIA 4JL0A 5A6KA 4XE0A 2VSXE 3ZW3A 1UW4B 1YLMA 1NA0A 2W9YA 3HTKC 4PR9A 4JHRA 2KBXA 4CZ2D 2GWWA 3VAYA 4IJJA 4N3BA 3O6XA 1AUEA 2R03A 2CHXA 1U3DA 1YVIA 4PFOA 4I2ZA 1Q0FA 3UMKA 1LF8A 3B71A 3ML9A 3C18A 3QWPA 3EGXA 3EFOB 1NG1A 3L34A 3MBGA 2VTBB 5COFA 3AG4C 4TXQA 2XGOA 1U3CA 3D9OA 3G4ZA 3C3QA 2VGYA 3EH2A 3FTWA 2IFUA 2OCCC 3CQZA 1H6PA 3KL4A 4U9DA 3TJ6A 2XEEA 3V2XA 3UR3C 4K0DA 3U9MA 1FCHA 2LXLA 3I4RB 5BXOA 1S63A 3MX3A 4DRIB 1HE9A 3ULQA 4L7TA 1Z63A 2LIGA 2P1AA 2DZNA 1K1BA 1AP7A 4O7GA 1LTXA 4I6GA 3QOUA 4JIOA 3RU0A 5KWDA 4UI9K 1YJGA 4B94A 1ZHWA 3F6QA 2V26A 3JYSA 4GPMA 2A68F 3FWVA 2P9LG 2Z15A 4CDVA 5CERB 1OW7A 1O87A 2L6JA 4XIFA 4NC3A 3AOUA 1RJ9A 1TNOA 4J0UA 2FULA 3A11A 2MOWA 4N5CA 4HFGA 5FZSA 3NMJA 5JRAA 1K3ZD 4FWVA 5KCMA 1LIHA 4AM9A 3LYAA 3FUNA 3CV0A 3W2WA 1EPUA 4FP7A 2YL3A 2L6GA 1HO8A 1MHQA 2BTDA 5EX3A 2FFHA 3M4BA 3KMIA 2IOLA 3W2VA 1D9SA 4HB5A 3R9AB 3DBSA 4C3EA 4A3VA 1BD8A 2OEVA 4G7ZF 4GA1A 4MVOA 5E76A 4YK5A 2JLBA 2IEJA 4JZYA 4D10C 2XL8A 2L7AA 1Y8MA 2PL2A 2HJMA 2XSEA 2PFDA 1OXBA 4LERA 4O6MA 3SP1A 4ZLDA 5E2QA 1VMAA 1N95A 3ZDLA 1LS1A 5ARGA 3RRMB 4DRJB 1HW2A 5AAOA 2JEKA 5E3AA 2NXPA 1N52A 1RXQA 4AXHA 2R9RB 1XZPA 2YVKA 4GTOA 1NP7A
chains in the Genus database with same CATH topology
2YZSA 4ULWA 3U4TA 5D0QD 4I17A 2GW1A 2XCBA 3VLEA 1IW7F 4I43A 3MEKA 4FADA 5DS5A 2XPZA 4U5FE 1PC2A 2X6IA 2DGJA 3JUIA 3AG2C 3E9VA 2WPVA 3K33A 3SBSA 2Y3DA 5BV0A 3ONLA 3UPVA 3D9IA 2WXKA 3E70C 3FAJA 1H19A 3ZPJA 3HJCA 3FU6A 4O6NA 5BPPA 1XGWA 4KMOA 2OV8A 3TG5A 5FT9A 4TRQA 4CCAA 1DNPA 4KZ0A 5ANRA 1ST6A 2IYLD 4WNEA 4Y6WA 3Q15A 3D3MA 5DQTA 2G62A 3CVLA 4N2SA 4CBEA 4BTBA 4IULA 1OWLA 3B13A 3B7TA 4ILIA 4V3IA 1M2VB 5F5HA 3JT1A 3GZSA 2O9XA 4HS2A 3U3WA 5JHAA 2FGYA 5KYNA 3FEYA 4ANUA 3KKBA 3AS8A 4PDXA 4DLQA 1H2TC 1D0XA 4C0MA 1E7VA 1D1AA 2KZTA 2I2OA 5HI7A 2LSVA 3ESLA 2ZU6B 4JEHA 4E85A 5KYYB 4YT8A 3MA5A 5BUOA 3T5VA 4YT4A 2WB7A 4YT5A 5KYXB 4G1TA 1SZ9A 2IXOA 1D0YA 3LEWA 1MQSA 3GANA 2HR2A 1KU2A 4AEZC 1OWNA 3SGHA 2MHKA 3ZIBA 2J4BA 4I6EA 1MMAA 3SD5A 4BEJA 4C0EA 2WZFA 3M1CB 4U04A 4HOQA 3SNHA 4PS8A 5CCLA 4IN3B 1VDYA 5CI9A 4U5CE 4GCOA 3MKQB 1IYGA 4JA7A 4I1OB 3MGBA 3K66A 4BT8A 1IQRA 5B3SC 3QB2A 2L81A 4F7AA 3CK8A 1ZHZA 3DD7A 3B0VC 1FMWA 3RO2A 2C0MA 3RJVA 3OEOA 2WXQA 2WL8A 3CHQA 3EG9A 1ZYRF 2QY9A 4A3TA 5B1AC 2HO1A 3AG1C 1VOMA 2YHSA 1ZU2A 4N3AA 3PNLB 4AK9A 2NG1A 1HG2A 3ECSA 5DQZA 1FMVA 4EECA 3DPDA 2W45A 2KCLA 4I3MA 1BPOA 4J8SA 4O6FA 2CG2A 4GU5A 3TXMA 1M56C 2FEZA 5L3VA 3DAFA 3QC1A 2H7VC 3QMKA 3OA1A 3PUKA 3DJNB 2A5UA 3NYJA 3LVRE 3S7JA 3I4GA 2AWIA 4CDRA 1ZHXA 2M4EA 3FULA 1JPNA 3ZVRA 4GYTA 4JHKA 1OKKD 2I8BA 3T6JA 4KI2A 2PF4E 3BEEA 4WWPA 2Y3HA 1EDUA 1LVKA 3T5XA 1JPJA 2XPYA 4I9EA 2QFCA 3LAYA 4KYOB 2WXPA 3L16A 4FC8A 4LUNU 1H2VC 3SHFA 5FTPA 5AJDA 2A1DD 4O79A 2WM9A 3ONKA 4R7LA 4DVYP 2WZGA 4QFVA 3IEGA 3ZIMA 5CI8A 4HOTA 5A7DB 4C9BB 4JJGA 5FQ4A 2IONA 3CHMA 4CRWA 1M2VA 3PUJA 5A23A 2WQHA 3U66A 4MRUA 3QNKA 2X6JA 2E0IA 3PRZA 4ANJA 4C7OB 5KYWB 3D9NA 5KJNA 1XNFA 2PX3A 3FH8A 5KJLA 4UWHA 3IEEA 1BR1A 2J07A 1ZHTA 3B9QA 3WG7C 4GZDA 5ANLA 3TXNA 3PNTB 5EHHA 4KNVA 4K0RA 4WWOA 5T3RA 3FUDA 4KT6B 3LEVA 4C3DA 3ZYQA 5B1BC 2GFHA 4GZ5A 1JPLA 3Q4AB 4IYPA 5EX0A 4C7OA 4GMLA 3G2SA 4B8CB 2ZXPA 2NSZA 1M2OA 1W2WA 2XHEA 4ANWA 2XEVA 4H4KC 1HS6A 4CS7A 4CT0A 1QZ2A 3VTXA 3FH5A 4E7SA 5KJKA 4C3BA 1WM5A 3QAQA 5AYWD 4CS9A 4WAFA 2PM7A 5A6CA 2J9VA 5T4YA 4HXIA 4JVSA 1KT0A 1TWCA 4PK4A 3FU3A 5ARFA 3RIPA 2XCCA 4G26A 2J4DA 1UJJA 3U9WA 3URZA 5G05J 2DYRC 1Z3YA 2J46A 3KH2A 4AP2A 3D9KA 1QLEC 3UT7A 3FEXA 3TG4A 1JUQA 2PQNA 2Y69C 4XI9A 1PCXA 3SFZA 4BX9A 4CGWA 4AE4B 1B89A 2Y39A 3IBEA 3CIAA 1HZ4A 2FBNA 2WZLA 4WJ0A 1D0ZA 2YQ8A 3ZHEA 2XRYA 4G0HA 2VQ2A 3KS2A 3ZYKA 3CHSA 3FP3A 2WVNA 4UI9C 4FX5A 2Y3BA 1J8YF 2VGXB 1QNFA 2UWJG 1JWGA 4HEAJ 2LAIA 3EGDA 3CVVA 2J08A 3DM5A 3HYMB 3NKEA 2BUGA 3LNRA 2PP4A 2I9CA 2ILRA 3PEVB 2PZIA 1SF8A 3P1UA 4H7XA 3JCKC 4UQXA 5JJTA 3ZYMA 2KGOA 2ONDA 1OWPA 3ESKA 3I3NA 1Z3IX 1NA3A 3EHNA 4CS8A 3MV3B 4AIFA 2MRIA 1WGWA 3JSZA 3ITFA 1GW6A 2KNHA 5KYYA 2CHZA 1L5JA 4N2QA 3ZGQA 1E8XA 4P6IC 2WQ6A 3PHF2 3FDQA 4AY5A 3Q49B 3APFA 3RKVA 3MJWA 1OKKA 2YINA 2J0XA 1E8YA 1HH8A 1HE8A 3FUJA 4IRUA 2NUTB 4G2VA 4FLBA 5FQ7A 2XXAB 3FUMA 2D5RB 4GYWA 5FWQA 3KEZA 1HFAA 2R7SA 4OIRF 4ANVA 3RH3A 3DZAA 3IV0A 3CK9A 3LKUA 3SZ7A 2OG2A 1FVHA 2Q9BA 5CMWA 4U5HA 3UT4A 5D92A 5J08A 3EJNA 2HV7A 2NUPB 3LY7A 3CKCA 3GZ1A 4MNDA 3MLGA 1PD0A 4AV7A 4DI3A 4DBQA 4B0ZA 3FTVA 1H6KA 3LLKA 3PVLA 5KYWA 2WXJA 4KC9A 4PUCA 3U64A 4KVMA 4N3CA 3S7FA 3VLDA 4RG9A 2VJ8A 2DBAA 2R7UA 2VB6A 4AX2A 4BX8A 3PE4A 4HORA 2WVOA 4FLHA 4XKCA 4XI0A 3EZHA 4AOFA 4BJ5C 3LJ3A 5T8IA 2IOSA 4CDMA 2GGFA 2CNWA 2VSYA 4AY6A 4AJWA 5AJLA 1J8MF 1Z6TA 2DCPA 3ASGA 4OD5A 4BWRA 2WXIA 1TJFA 2R7QA 3Q6MA 2PX0A 2E87A 4OIQF 3CHPA 2YNQA 3UUXA 3IHVA 3O48A 3CVUA 3DJUB 3D9JA 4AVXA 2NC9A 5G55A 3WODF 4LACB 2YHCA 4K03A 3FHEA 2KM4A 4RSYA 4XLNF 4EZJA 4UWKA 2IF4A 3CEQA 3LJBA 4B8AA 2VTBA 2HYZA 3FU0A 3AU5A 4ME2A 1Y6IA 4EZLA 4GCNA 5LX8A 1DVPA 2WXFA 3K7DA 1LKXA 3EQLF 3UX4A 4L23A 3AQBA 3PREA 2CG3A 3EPVA 3T4RA 2V4LA 4GZ6A 2R7WA 1ZHYA 1NZEA 3RKOF 2X38A 3FUFA 3LY8A 4H7YA 4Q96A 1UG3A 3MZLB 1FVFA 4OVVA 5T3WA 3SF4A 4BT9A 3K1IC 2WXRA 4AE4A 1HX8A 2L9BA 4KVOA 3N71A 4HOSA 3CVWA 4DK5A 4G11A 4MLPA 4CDNA 3S7BA 2EIJC 3CK7A 2R5SA 4BJ5A 3MCXA 4KBLA 1WY6A 2IQCA 3LS8A 2EILC 4J6IA 5ENNA 2EINC 3ZG1A 2RG8A 3E4BA 4GZ3A 5LCWJ 3EG9B 3LLIA 2A6EF 2XQ0A 2WVQA 4KBQA 2CW0F 4JA9A 3R7QA 5T3TA 3OAWA 4PJLA 3B7UX 5BT1A 4K7BA 3MV2B 5G04C 2A69F 4HE8D 1FFTC 2WVIA 1W3BA 3RFYA 1MNEA 3HIZA 2IXNA 1INZA 3OXGA 2J7PD 3PMRA 3ZYLA 3OXFA 3SYNA 4OVUA 4UWFA 4JZAA 3FTYA 4CGVA 4PS3A 5JHBA 2R7XA 2R7VA 4DLOA 3CGHA 3NYLA 3FUEA 3CHOA 2WB2A 3D9MA 4XLPF 5FJYA 5E75A 2B0JA 4FESA 1TEZA 2M63A 4M63A 2KCVA 4FULA 2WMOA 4M3OA 3FU5A 3CLJA 3IKOB 4EBAA 2X6HA 2CDQA 4U63A 4WUYA 4PFPA 4BTAA 1V55C 4LEUA 3FTUA 3CQCB 3EGDB 3FDHA 3ZSUA 3SBTB 4TUUA 4E7ZA 2VGXA 3O39A 5KJMA 3HDXA 2ZXWC 2RD0A 5IY5C 2DYSC 2XGMA 2WXMA 1KLXA 1O5HA 3IHYA 2AXZA 3HVEB 3JYHA 4NURA 2WMNA 4EQFA 4J8DA 1ZU5A 4U5GA 3H65A 3ASDA 4HVBA 2V5FA 2J9UA 2J0WA 1MMDA 3Q7LA 2X51A 3CVPA 4UWLA 4U07A 2R7TA 3MKQA 4BY6A 3JQ1A 2WQ7A 5AENA 3OTNA 3FY4A 4ILGA 2OOEA 2ZXOA 3AG3C 4U0UA 3EDTB 1PD1A 4FU3A 4Q7CA 5LCWC 4Q5SF 4ILHB 3Q47B 3GW4A 2Y4UA 3NZSA 2I6HA 4G23A 2NUPA 3RIBA 1ELRA 4NRHB 5DLJA 3VLFA 4BJ1A 3L22A 3TAXA 2L0TB 4IAOA 4OINF 5DIZA 5FQ8A 3APCA 2WXOA 3RYLA 4F3VA 3FUKA 2HV6A 4U0ZA 4JW1A 5LOZA 4MKTA 1BR4A 4JJFA 3ZFWA 3Q7GA 4OD4A 3JCUQ 3X2QC 4Q4ZF 4LLEA 4FHJA 4PJMA 3LS0A 3LDZA 2LAHA 3KD7A 5FCLA 1SQMA 4YVQC 3UMVA 3FFLA 4JXTA 1PAQA 1TKNA 2LSEA 2EQXA 5DBKA 2C04A 5E3CA 4LLCA 3QJZA 3ASHA 1Z5ZA 3AQCA 3KAEA 3N0TA 1H2UA 4UI9J 3CVYA 4ZLCA 1HU3A 3EFOA 3EGXB 5L3QA 1OCOC 2WXGA 3LXUX 5DVWA 4UQZA 4O6YA 3JQ0A 2PQRA 4GMJA 4EZKA 1IHGA 3T8MA 2KZTB 1SMYF 2Q7FA 4XZ4A 1OCZC 3SZRA 4QDLA 1NZNA 3G2VA 2KJGA 3K9IA 3GODA 3DAGA 5G05C 2AXUA 4I44A 4CSAA 1D1CA 3G2UA 5J90A 4A55A 4I1MA 3FUHA 5BW8C 2GRLA 5F5FA 3L6AA 5KYUB 2Y3GA 5CHEE 3I5QA 1A17A 3TL5A 4JURI 1ELKA 3EIJA 2R17C 3B7SA 3S29A 3B7RL 1E90A 1OCRC 4F4BA 4F53A 2J09A 3PEUB 3CVXA 2I1JA 2CNWD 3ASNC 1D1BA 2HM8A 4ACKA 4A1GA 4YJWA 3CVNA 2FF4A 3PH0C 2OVFA 3FH7A 3R7RA 2ZXRA 4U5EE 2AXVA 3FHDA 4G7HF 4XKBA 3K1HA 2R59A 1TWHA 4X0RA 4GZCA 2H7BA 4WWNA 4DJAA 3FTSA 4QI2A 5HQ8A 3DXJF 4DI4A 2XRHA 3QKYA 4PJNA 4YT2A 2X3MA 1VYKA 4KNWA 1H0AA 4NQ0A 2VSNA 1OUVA 3UGOA 4CT4A 4HFKB 3CSTA 4JHJA 4WNGA 3I5PA 4G25A 2VH3A 4HOUA 2MWQA 4JEUA 5BV1A 5C1DA 2G3VA 2Y4TA 3NZUA 4ATGA 4RVBA 4OYSA 3SI5A 4J8FA 2LNIA 3AS5A 4G24A 4E6HA 2C2LA 4I9CA 3QDNA 4RDAA 4NY3A 1JWFA 3DMDA 4W8KA 4FJZA 2Y3AA 5E33A 2G3KA 4HLEA 3T6BA 4A2NB 4J8EA 2J9WA 2VYIA 2LO6A 2IJGX 4N06A 3RK6A 4RBNA 4I6JA 1S7ZA 3S27A 1V54C 1SZIA 4KZCA 5M72A 2YHEA 3V7OA 3NQPA 3ABLC 1FFHA 1QZXA 2BF0X 1MNDA 1NU9C 4PS7A 2CFZA 2KQ9A 5CMYA 3ABMC 5EGYA 4CEMA 3P2BA 3NYMA 4URKA 3L0IA 2UY1A 4B89A 4RG6A 4GA0A 1TWGA 2P58C 3FTXA 1UN9A 1TWAA 2EIKC 5KYXA 4JC8A 2PM6A 4YVOA 4CS9C 3LESA 3W8IA 2Q9AA 4U0SA 3X1OA 2Q9CA 4U8HA 1FTSA 3MYVA 4GYOA 4JPSA 3TD7A 4DBRA 3LS1A 2WXLA 4EWCA 3C98A 3O4ZA 1EF1C 1Z3XA 1TJCA 1N54A 4LCTA 4ACLA 3CSFA 2IXMA 4TV3A 1TR2A 5HSWA 3B0UX 3HVEA 1N1CA 3CHRA 2C03A 4FJYA 3ABKC 3FTZA 3FUIA 5FQ6A 4U5DE 3S0XA 3ZXSA 1E8WA 4QI0A 1Z23A 3F47A 2J49A 3LY9A 2J9QA 1VK5A 3ZEFA 2C0LA 4L1BA 2UY1B 3S2AA 1MMGA 4EBBA 2QTVA 4N39A 2XGSA 1HXIA 5G04J 2Q3TA 4CIHA 2X6KA 2X6FA 4GAAA 1P5QA 2KCKA 2WXNA 3QARA 3UNGC 4GB9A 3NDBB 2IXPA 4APFA 3APDA 1E8ZA 4FHKA 2AVPA 3UT8A 5CCMA 3K6BA 3HHMA 2KC7A 3BG1B 2P7VA 3Q5MA 3RO3A 5BUZA 3BG0B 2FI7A 3EIQC 4UWGA 4EPZA 4ABNA 4OIOF 4LRZA 3LPZA 2I1KA 5DS6A 3UMHA 4RD9A 1X5BA 4MQ9F 3S28A 5KYUA 3ZHEB 3CSKA 4XWJA 4JCHA 1ZU4A 5JJ7A 3FVYA 1UJKA 2CGEA 4CS8C 4XTKA 5C2YA 3AS4A 4IWBA 1ELWA 3UGPA 5LP0A 3UMIA 4MS6A 2L9JA 2AW6A 3QK0A 2W4MA 2OVBA 3N2ZB 2CHWA 3OWTA 3RRUA 3ZRHA 3CR3A 3W8HA 2H7OA 3EHMA 3CVQA 1S0PA 4GYYA 3QZCA 3EZIA 2BE5F 5BNWA 3ENEA 4Y6CA 1IQUA 3VTYA 4DPRA 1NU7D 4P29A 4PH4B 3LVQE 1BR2A 3CZ6A 5FZRA 4J32B 2ZPAA 1RJ9B 3POVA 3L54A 3GZ2A 3QWVA 2V0PA 3ZC4A 3SNXA 3NF1A 4ANXA 3PZDA 3OXLA 1HF8A 4DVZA 4OIPF 3MKRA 5JJ6A 3N24A 2MYSA 2IOQA 2V3CC 3F46A 4L2YA 4APOA 4Q94A 4PJJA 4U5BE 4L2LA 2XRZA 5G2NA 4CSAC 4Q69A 3G2WA 2WXHA 4BFRA 2XPIA 4NACA 4WNDA 2GRMA 4GPKA 2VASA 2JD3A 2R7OA 3CQGB 4DOZA 4BSXA 2VSOE 3ZN3A 1Z6AA 4W9RA 3PDNA 2A6HF 1OCCC 3ASOC 2FO7A 1YA0A 3L08A 5EDSA 2P6VA 4I1AA 2XL4A 2A4ZA 3B0PA 3ASFA 5AIJA 4BJTA 3D9PA 4XX5A 4YWQA 2NUTA 5DS4A 4YN0B 2IU1A 4YNDA 1EYHA 3DM9B 3Q6NA 4BJ6C 3ML8A 2J7PA 1MMNA 2L0IA 3NG1A 4B6IA 4G7OF 3D9LA 3S7DA 1KT1A 1PY1A 4WNFA 1E7UA 2DIWA 3NRHA 3NKDA 4I2WA 3QWWA 5T1DB 4F1SA 1OWOA 1E96B 2CFUA 5D91A 3TJPA 4J30B 2J45A 2W4BA 2KATA 1WAO1 3TGOA 5LFAA 2V8SE 2YEVA 1UN8A 5D0OD 4UQYA 3L13A 1ZBPA 3RRNB 2XXAA 3CKBA 1G8XA 3G2TA 4GEHA 1OWMA 3HLZA 3JRTA 4FA6A 4KXKB 2EIMC 3VYWA 4A1SA 3EH1A 1QQEA 1IZMA 2LSUA 3UQ3A 3AU4A 2KW3C 3PE3A 4BG0A 4EBAG 3I4UA 3PS6A 4GA2A 1SZAA 3SEOA 2QY7A 3WXXA 5FZQA 3GYZA 1HG5A 2E2EA 4BJ6A 5EKQD 3L17A 3ZVVA 4HFFB 2R7RA 1M57C 3LCAA 1VYIA 4JL0A 4XE0A 2VSXE 3ZW3A 1UW4B 1NA0A 2W9YA 3HTKC 4JHRA 3VAYA 4IJJA 4N3BA 3O6XA 2CHXA 1U3DA 4PFOA 4I2ZA 3UMKA 1LF8A 3ML9A 3QWPA 3EGXA 3EFOB 1NG1A 3L34A 2VTBB 3AG4C 2XGOA 1U3CA 3D9OA 2VGYA 3EH2A 3FTWA 2IFUA 2OCCC 3CQZA 3KL4A 3UR3C 4K0DA 1FCHA 3I4RB 3MX3A 3ULQA 4L7TA 1Z63A 4O7GA 4I6GA 3QOUA 3RU0A 4UI9K 4B94A 1ZHWA 2V26A 3JYSA 2A68F 3FWVA 2Z15A 1O87A 2L6JA 4XIFA 1RJ9A 4J0UA 2FULA 4N5CA 2MOWA 4HFGA 5FZSA 4FWVA 5KCMA 4AM9A 3LYAA 3FUNA 3CV0A 3W2WA 1EPUA 4FP7A 1HO8A 1MHQA 2BTDA 5EX3A 2FFHA 3KMIA 2IOLA 3W2VA 3R9AB 3DBSA 4C3EA 4A3VA 4G7ZF 4GA1A 5E76A 2JLBA 4JZYA 4D10C 1Y8MA 2PL2A 2XSEA 2PFDA 4LERA 4O6MA 3SP1A 4ZLDA 5E2QA 1VMAA 1LS1A 5ARGA 3RRMB 2JEKA 5E3AA 2NXPA 1N52A 4AXHA 1NP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IRU A;  4I1M A;  4I1O B;  4JVS A;  4JW1 A; 
#chains in the Genus database with same CATH topology
 2JAB A;  2YZS A;  3DE9 A;  3D9H A;  4Z9J A;  4ULW A;  3HXD A;  3U4T A;  3R7C A;  1U6H A;  5D0Q D;  4I17 A;  2GW1 A;  2XCB A;  3VLE A;  1IW7 F;  4I43 A;  3ZTZ A;  3MEK A;  3BEH A;  4FAD A;  5DS5 A;  3IQ5 A;  4E18 A;  2XPZ A;  4U5F E;  1PC2 A;  3QVZ A;  2X6I A;  2DGJ A;  4LG6 A;  3JUI A;  2ZIS A;  3AG2 C;  3E9V A;  2WPV A;  3K33 A;  3SBS A;  2VCC A;  4JKV A;  1ZW2 A;  2Y3D A;  2IBF A;  4XEI G;  5BV0 A;  3ONL A;  3UPV A;  3D9I A;  2WXK A;  2GRN B;  3E70 C;  3FAJ A;  4OAV B;  1H19 A;  3ZPJ A;  3G4X A;  4DJ9 A;  3HJC A;  3FU6 A;  5AAR A;  2ICW G;  3NOC D;  3SQV A;  4O6N A;  4GTT A;  5BPP A;  1TN8 A;  1XGW A;  3GM3 A;  4KMO A;  2OV8 A;  3TG5 A;  5FT9 A;  4DX1 A;  4TRQ A;  4CCA A;  1DNP A;  4KZ0 A;  5ANR A;  1ST6 A;  2IYL D;  4WNE A;  4Y6W A;  3Q15 A;  1S64 A;  3JTL O;  3D3M A;  1H7I A;  5DQT A;  2G62 A;  2BC5 A;  3CVL A;  4N2S A;  4CBE A;  3T8K A;  2RSE B;  4BTB A;  1OW6 A;  4IUL A;  1OWL A;  2AVK A;  5B1A E;  3B13 A;  3B7T A;  2AWY A;  4ILI A;  3KEA A;  4V3I A;  1G5Z A;  4L9P A;  1M2V B;  5F5H A;  1QYM A;  2H6F A;  3JT1 A;  3GZS A;  3HXC A;  2DI3 A;  2QE9 A;  4A4A A;  2O9X A;  2AU5 A;  3Q9N C;  4HS2 A;  3ULE G;  3U3W A;  3AG4 E;  3AGT A;  1OT8 A;  5EYP F;  5JHA A;  2FGY A;  5KYN A;  1H9G A;  3FEY A;  4ANU A;  3KKB A;  3AS8 A;  4PDX A;  4U96 D;  4DLQ A;  3RQE A;  1H2T C;  1D0X A;  1SW6 A;  4C0M A;  1E7V A;  5L0D A;  3SXM A;  1YYH A;  2XLE A;  1D1A A;  5FIN A;  2LK4 A;  2KZT A;  1D8D A;  2I2O A;  5AC4 A;  3ZNG A;  4Z9H A;  2H6H A;  3PZ1 A;  5HI7 A;  2LSV A;  4GTM A;  3ESL A;  2ZU6 B;  1WAT A;  4JEH A;  4E85 A;  5KYY B;  2XLV A;  1E86 A;  3DWW A;  4YT8 A;  3MA5 A;  5BUO A;  3T5V A;  4YT4 A;  2WB7 A;  3A9C A;  4YT5 A;  5KYX B;  4G1T A;  3WHN A;  1SZ9 A;  2IXO A;  3V5Y A;  1D0Y A;  3DSS A;  3LEW A;  1MQS A;  3GAN A;  2HR2 A;  3SO8 A;  1SA4 A;  1KU2 A;  1OWN A;  4AEZ C;  4CX9 A;  3SGH A;  5AGF A;  2MHK A;  3ZIB A;  2J4B A;  1JCQ A;  4I6E A;  1MMA A;  4MVR A;  3SD5 A;  4BEJ A;  1Z5S C;  4C0E A;  2WZF A;  3M1C B;  4U04 A;  4HOQ A;  3SNH A;  4PS8 A;  5CCL A;  4IN3 B;  1ORS C;  1VDY A;  5CI9 A;  4LDR A;  4U5C E;  4GCO A;  3MKQ B;  1IYG A;  4J7W A;  1IKN D;  3E33 A;  4JA7 A;  1FR0 A;  4I1O B;  3MGB A;  2P9N G;  3B29 A;  1FPP A;  4MVS A;  3K66 A;  2VCB A;  3KSQ A;  4BT8 A;  3RVZ A;  1IQR A;  5B3S C;  3DEO A;  3QB2 A;  2L81 A;  4F7A A;  3CK8 A;  4XEV A;  5ITZ F;  1NFO A;  1ZHZ A;  3DD7 A;  4LNG A;  1WWP A;  1YMP A;  5A6J A;  4EBK A;  3B0V C;  1FMW A;  1RMV A;  3RO2 A;  2C0M A;  4LDQ A;  3RJV A;  3OEO A;  2WXQ A;  5JS5 A;  2WL8 A;  1IXV A;  1CGM E;  3CHQ A;  3EG9 A;  1ZYR F;  2QY9 A;  4A3T A;  4JE9 A;  2HKV A;  3HNI A;  4H54 A;  3MFN A;  1T5O A;  2YLD A;  4YDW A;  5B1A C;  3U9J A;  2HO1 A;  1K05 A;  1VOM A;  3AG1 C;  2YHS A;  3EHQ A;  1ZU2 A;  4N3A A;  3RQF A;  1LI7 A;  3PNL B;  4AK9 A;  2NG1 A;  4BSZ B;  1HG2 A;  5AQA A;  3ECS A;  5DQZ A;  1FMV A;  2F37 A;  2EPO A;  1NBB A;  3KPH A;  3PZ3 A;  4EEC A;  3DPD A;  1TQG A;  2W45 A;  4HI8 A;  1GGQ A;  2KCL A;  4I3M A;  1BPO A;  4TXP A;  2OEW A;  1A0B A;  4J8S A;  4O6F A;  2CG2 A;  4GU5 A;  4F6R D;  3TXM A;  5IY5 E;  3ABM E;  1M56 C;  3L82 A;  2FEZ A;  2XEH A;  5L3V A;  3DAF A;  3QC1 A;  2H7V C;  2XL6 A;  4WGZ A;  3QMK A;  5HS0 A;  1L7C A;  3OA1 A;  1KZO A;  3PUK A;  1I4Y A;  2EIK E;  3DJN B;  2A5U A;  2JPU A;  3NYJ A;  3LVR E;  3ZKJ A;  1DCE A;  1I5N A;  3S7J A;  5B3I A;  3ULY A;  4BES A;  3I4G A;  2AWI A;  4CDR A;  2F0Y A;  1ZHX A;  2M4E A;  3FUL A;  1JPN A;  3ZVR A;  4GYT A;  4JHK A;  2R02 A;  1OKK D;  2I8B A;  3T6J A;  1MX2 A;  4KI2 A;  2PF4 E;  2Y3H A;  3BEE A;  1EDU A;  1LVK A;  4WWP A;  3T5X A;  1JPJ A;  2Q00 A;  4LNU D;  2XPY A;  2GAQ A;  3QW1 A;  4I9E A;  2QFC A;  3LAY A;  1YYX A;  4KYO B;  2P9S G;  5L0H A;  2WXP A;  3L16 A;  4FC8 A;  4LUN U;  1H2V C;  2LUH A;  1A7D A;  3SHF A;  3ABK E;  1TNZ A;  3EU9 A;  5FTP A;  5AJD A;  2A1D D;  5D2M C;  4O79 A;  3NMI A;  1N0R A;  5F28 E;  2WM9 A;  4DVY P;  2WZG A;  3ONK A;  4R7L A;  4QFV A;  3IEG A;  3ZIM A;  5CI8 A;  4HOT A;  5A7D B;  4C9B B;  4JJG A;  5FQ4 A;  2ION A;  3CHM A;  2P0N A;  4CRW A;  1M2V A;  1HMO A;  3PUJ A;  5A23 A;  2WQH A;  4Z9I A;  3U66 A;  4MRU A;  2F22 A;  1A7V A;  3QNK A;  2X6J A;  2E0I A;  3PZ4 A;  3PRZ A;  2LFF A;  2AP3 A;  3LUT B;  4ANJ A;  3GEE A;  4C7O B;  5JA4 D;  5KYW B;  1T6Q A;  3D9N A;  5KJN A;  1XNF A;  3T6G B;  4LNB A;  2PX3 A;  3FH8 A;  5KJL A;  2R05 A;  4D4X A;  3IEE A;  5HV9 A;  4UWH A;  1BR1 A;  2J07 A;  3NB2 A;  4JB8 P;  1ZHT A;  3B9Q A;  3WG7 C;  2ETA A;  4GZD A;  5ANL A;  1KPS B;  2OJE D;  3TXN A;  5CEA A;  4ULV A;  3PNT B;  5EHH A;  1D8E A;  2FO1 E;  3PCV A;  4KNV A;  4O1O A;  1MX6 A;  4K0R A;  4WWO A;  3ASN E;  4E0I A;  5T3R A;  3FUD A;  4KT6 B;  3LEV A;  4C3D A;  3V79 K;  4N4W A;  3ZYQ A;  5B1B C;  2GFH A;  4GZ5 A;  1JPL A;  3Q4A B;  4MTG A;  4IYP A;  5EX0 A;  4ZHB A;  5BQG A;  4EHP A;  4C7O A;  4GML A;  3G2S A;  4B8C B;  1WAS A;  2ZXP A;  2NSZ A;  1M2O A;  1W2W A;  1JCS A;  3MYI A;  2XHE A;  4ANW A;  2XEV A;  1SA5 A;  4H4K C;  5L0G A;  1HS6 A;  1S05 A;  3S90 A;  2A5E A;  4CS7 A;  1O1T A;  3FXH A;  1HY5 A;  4CT0 A;  1QZ2 A;  4XEK A;  5A6B D;  1FNT c;  3VTX A;  2QNL A;  1CGO A;  4CDY A;  3FH5 A;  2UUH A;  3UKR G;  1U89 A;  5AN8 A;  4E7S A;  5KJK A;  4C3B A;  1T6U A;  1XZQ A;  5AQ7 A;  1WM5 A;  3QAQ A;  5AYW D;  3TWT A;  2ETB A;  4CS9 A;  4WAF A;  2PM7 A;  5A6C A;  3Q79 A;  2J9V A;  3BQO A;  4NIK A;  1QBQ A;  5T4Y A;  1DCQ A;  2EPN A;  4GTP A;  5ENS D;  4HXI A;  4JVS A;  1N0Q A;  1KT0 A;  1B68 A;  1TWC A;  4PK4 A;  3FU3 A;  5ARF A;  3RIP A;  2XCC A;  2XM0 A;  4G26 A;  2J4D A;  1APC A;  1UJJ A;  3U9W A;  3URZ A;  3JZ0 A;  5G05 J;  2DYR C;  1Z3Y A;  2J46 A;  3KH2 A;  4AP2 A;  3D9K A;  4AL1 A;  1QLE C;  3UT7 A;  3FEX A;  3TG4 A;  1JUQ A;  3EUV A;  2PQN A;  1TFO B;  2Y69 C;  3C8Z A;  4XI9 A;  4IB4 A;  1FAP B;  1PCX A;  3SFZ A;  4BX9 A;  4CGW A;  4AE4 B;  1B89 A;  2Y39 A;  3IBE A;  3CIA A;  2X0C A;  1HZ4 A;  2FBN A;  2WZL A;  4WJ0 A;  1D0Z A;  2YQ8 A;  1NLX A;  3ZHE A;  2XRY A;  2IO3 C;  4G0H A;  2HS5 A;  2VQ2 A;  3KS2 A;  3WG7 E;  4NCQ A;  3ZYK A;  3CHS A;  3FP3 A;  1WDY A;  2WVN A;  4HRL A;  4UI9 C;  4FX5 A;  3C5R A;  2Y3B A;  3E34 A;  3TK0 A;  3VF0 A;  1J8Y F;  2VGX B;  1QNF A;  2UWJ G;  1YZA A;  1JWG A;  4HEA J;  2LAI A;  3ZWI A;  5JUA A;  3HNL A;  2KYH A;  3EGD A;  3CVV A;  4MS2 A;  4CJG A;  2J08 A;  3DM5 A;  3HYM B;  3NKE A;  2BUG A;  3LNR A;  4EHM A;  2PP4 A;  2I9C A;  1F1M A;  2ILR A;  3PEV B;  2PZI A;  1SF8 A;  3P1U A;  4H7X A;  4DXW A;  3UM2 A;  3JCK C;  4UQX A;  5JJT A;  3ZYM A;  2KGO A;  1R4T A;  2OND A;  4K5B A;  1OWP A;  3C72 A;  3ESK A;  2ZIR A;  1T6I A;  1YA7 O;  4GTV A;  3J5P A;  1RKC A;  3I3N A;  2Q4F A;  1K1A A;  4U8Y D;  1Z3I X;  1NA3 A;  3EHN A;  4CS8 A;  3MV3 B;  4AIF A;  2MRI A;  1WGW A;  3JSZ A;  3ITF A;  1GW6 A;  2KNH A;  5KYY A;  2CHZ A;  1L5J A;  3DSV A;  4N2Q A;  3ZGQ A;  1E8X A;  1Q0M A;  4P6I C;  3S9O A;  2WQ6 A;  3PDM P;  3PHF 2;  4B93 B;  5JT4 A;  1LM3 B;  3FDQ A;  4JEA A;  1BI7 B;  4Z68 A;  4AY5 A;  3Q49 B;  3APF A;  3RKV A;  2DVW A;  3MJW A;  4TUM A;  4F1P A;  1DOW A;  5TJ5 E;  1OKK A;  2YIN A;  5AC5 A;  1V54 E;  2J0X A;  1E8Y A;  1QKR A;  1HH8 A;  1HE8 A;  3FUJ A;  4IRU A;  2NUT B;  4G2V A;  5CRU A;  4FLB A;  1TFK B;  2DYR E;  5FQ7 A;  2XXA B;  3QVY A;  2TMV P;  2V5Q C;  2D5R B;  3FUM A;  4GYW A;  5FWQ A;  1O1S A;  2B6C A;  3KEZ A;  1HFA A;  2R7S A;  4OIR F;  4ANV A;  3RH3 A;  1TYQ G;  4ER9 A;  3DZA A;  3IV0 A;  3W4Y A;  3CK9 A;  3LKU A;  3SZ7 A;  2OG2 A;  1FVH A;  2Q9B A;  1KZP A;  5CMW A;  5CRV A;  4U5H A;  2LXM A;  3TUL A;  3SY2 A;  3UT4 A;  5D92 A;  1LD8 A;  1OXK A;  5J08 A;  3EJN A;  4NTB A;  2H6G A;  2EIN E;  5ENQ D;  2HV7 A;  3C8G D;  1EA8 A;  3ISM C;  2NUP B;  3HNJ A;  3LY7 A;  3CKC A;  3GZ1 A;  4MND A;  3MLG A;  3ZXP A;  1PD0 A;  4AV7 A;  4DI3 A;  3H2U A;  4DBQ A;  3M15 A;  2M64 A;  1BI8 B;  4B0Z A;  3FTV A;  1H6K A;  4G8L A;  4PAC A;  1SYQ A;  3HKK A;  3LLK A;  3RAU A;  3PVL A;  5KYW A;  2WXJ A;  4KC9 A;  1XWJ A;  4PUC A;  3U64 A;  4KVM A;  2IO2 C;  4N3C A;  1JRA A;  3S7F A;  3VLD A;  4RG9 A;  4MW8 A;  2Y1L E;  2VJ8 A;  3JXI A;  2DBA A;  4JCZ A;  2VB6 A;  4AX2 A;  2R7U A;  4BX8 A;  2P61 A;  3PE4 A;  4HOR A;  2WVO A;  4FLH A;  4XKC A;  4XI0 A;  3E37 A;  3EZH A;  3C63 A;  1DC2 A;  4AOF A;  4BJ5 C;  3LJ3 A;  5T8I A;  2IOS A;  4CDM A;  3LNM B;  2GGF A;  2CNW A;  2VSY A;  4AY6 A;  2HSB A;  4AJW A;  3ZQY A;  5AJL A;  1J8M F;  1Z6T A;  4P9T A;  2EIJ E;  2DCP A;  2OCC E;  3LJN A;  4RLY A;  3ASG A;  4OD5 A;  4BWR A;  2WXI A;  3SFX A;  2GRO B;  2EPM X;  4EKW A;  4NTF A;  1TR4 A;  1TJF A;  1VB5 A;  1H9T A;  2R7Q A;  4MVU A;  4M7C A;  3K1I A;  3Q6M A;  2PX0 A;  1RKE A;  2E87 A;  4MVQ A;  4OIQ F;  3CHP A;  5HRY A;  2FAP B;  2CYD A;  2YNQ A;  4MTO A;  3IHV A;  3O48 A;  3UUX A;  3CVU A;  4YL1 A;  3DJU B;  2HSQ A;  4D4N A;  3D9J A;  4AVX A;  4IAQ A;  2NC9 A;  3J5Q B;  5G55 A;  3TWU A;  3WOD F;  4K1O A;  4LAC B;  2YHC A;  3Q7F A;  1E83 A;  4K03 A;  1MZC A;  3FHE A;  2KM4 A;  4RSY A;  1E84 A;  4XLN F;  2RFA A;  1BZ4 A;  4EZJ A;  4UWK A;  1N11 A;  4LDK A;  2IF4 A;  3V2O A;  3CEQ A;  3LJB A;  4B8A A;  2HE0 A;  2VTB A;  2HYZ A;  3FU0 A;  3AU5 A;  2QLA A;  4ME2 A;  4JRZ A;  1Y6I A;  2ZXW E;  4EZL A;  2KK1 A;  4W8P A;  4GCN A;  3KYI A;  2HMQ A;  5LX8 A;  1TN6 A;  1DVP A;  2WXF A;  1TNU A;  3K7D A;  1EI7 A;  1LKX A;  3EQL F;  3UX4 A;  1ORJ A;  4L23 A;  3BRJ A;  3AQB A;  3PRE A;  1JOG A;  2CG3 A;  3EPV A;  2XLH A;  3T4R A;  5CBO A;  2V4L A;  4GZ6 A;  2R7W A;  1ZHY A;  1NZE A;  3RKO F;  1S70 B;  2X38 A;  3FUF A;  3HXB A;  3LY8 A;  4H7Y A;  3V5Z A;  4Q96 A;  4N6H A;  1BDJ B;  1V4A A;  1UG3 A;  3T9K A;  3MZL B;  1AWC B;  1RZ4 A;  3L9T A;  1FVF A;  3Q9U C;  4OVV A;  5T3W A;  3SF4 A;  4BT9 A;  1YDI A;  3K1I C;  2WXR A;  4AE4 A;  1HX8 A;  1LD7 A;  1YA9 A;  3O10 A;  2L9B A;  4KVO A;  3QTH A;  4JD2 G;  3N71 A;  3JRM O;  4HOS A;  3U5S A;  3GWL A;  3CVW A;  4DK5 A;  4G11 A;  5ENT D;  4MLP A;  2YL1 A;  4CDN A;  5A69 A;  3Q7A A;  1V55 E;  3S7B A;  2XEN A;  2EIJ C;  3CK7 A;  2R5S A;  4BJ5 A;  4JTA B;  3MCX A;  4KBL A;  1WY6 A;  2IQC A;  2CCY A;  256B A;  3LS8 A;  2EIL C;  1V74 B;  2LQG A;  4YDE A;  3HRA A;  4J6I A;  3DPY A;  4TXR A;  5A6B A;  5ENN A;  4K5C A;  1O3U A;  2EIN C;  3ZG1 A;  2RG8 A;  3E4B A;  4GZ3 A;  5LCW J;  1RKE B;  3EG9 B;  3LLI A;  2A6E F;  2XQ0 A;  5FIO A;  2WVQ A;  3L1M A;  4KBQ A;  2CW0 F;  3H2V A;  4P9F A;  3TQO A;  3U8P A;  2GA0 A;  1UG7 A;  4JA9 A;  4YL3 A;  3R7Q A;  1Q0K A;  5T3T A;  3G50 A;  3OAW A;  4PJL A;  3B7U X;  4JTC B;  5BT1 A;  4J7T A;  3V30 A;  2JX0 A;  4K7B A;  5AQ9 A;  3MV2 B;  5G04 C;  2A69 F;  4HE8 D;  1FFT C;  1SR2 A;  2WVI A;  2OJQ A;  1W3B A;  2EIM E;  2D4U A;  1Q2Z A;  4JC7 A;  2YLI A;  3RFY A;  1N4Q A;  1MNE A;  3HIZ A;  1BU9 A;  5COG A;  1OCC E;  2IXN A;  1INZ A;  3DSU A;  1AVO B;  3OXG A;  2J7P D;  3PMR A;  3ZYL A;  1HMD A;  3OXF A;  2GDC A;  3SYN A;  4YDO A;  4OVU A;  4UWF A;  4DRX E;  4JZA A;  1LPE A;  3FTY A;  4CGV A;  4PS3 A;  3SFY A;  5JHB A;  1VTM P;  3RF3 A;  2R7X A;  2R7V A;  4DLO A;  1OCZ E;  3CGH A;  3NYL A;  3FUE A;  5HKP A;  3CHO A;  2WB2 A;  5JP7 A;  2RKK A;  3D9M A;  1NL4 A;  4XLP F;  4YL0 A;  3DKA A;  5FJY A;  2PNO A;  3GM1 A;  5E75 A;  4HRN A;  2B0J A;  3DXM G;  4OAU C;  4FES A;  1TEZ A;  2M63 A;  4M63 A;  3GEH A;  2KCV A;  4FUL A;  2WMO A;  4M3O A;  2P2C P;  3FU5 A;  3CLJ A;  3IKO B;  4EBA A;  2X6H A;  2LD6 A;  1JCR A;  2CDQ A;  4U63 A;  4WUY A;  4PFP A;  2BKK B;  2MHR A;  2R25 A;  1T9K A;  3M4C A;  4BTA A;  1V55 C;  2B0O E;  2HUJ A;  1OR3 A;  3FOO A;  3E32 A;  4LEU A;  3FTU A;  3TWR A;  3CQC B;  1K40 A;  1NSG B;  3C3R A;  3EGD B;  3FDH A;  3ZSU A;  4DX6 D;  3SBT B;  4TUU A;  2DB4 A;  5FZT A;  2OKU A;  4E7Z A;  2VGX A;  3O39 A;  5KJM A;  3HDX A;  2ZXW C;  2RD0 A;  5IY5 C;  2DYS C;  2XGM A;  2WXM A;  1KLX A;  2LCH A;  3DXK G;  1O5H A;  2XS1 A;  2EPK X;  2AXZ A;  3IHY A;  3AAA C;  3HVE B;  4AL0 A;  2DZO A;  3JYH A;  3DI5 A;  5BXU A;  4UDV A;  2ZD9 A;  2QYJ A;  2F8X K;  1MYO A;  5H7P A;  4NUR A;  2WMN A;  4EQF A;  4GTQ A;  4J8D A;  1QPU A;  5ENO D;  1ZU5 A;  4U5G A;  3DWL G;  1YZC A;  3H65 A;  5CED B;  3ASD A;  4HVB A;  2V5F A;  2J9U A;  2J0W A;  4BEM J;  3C62 A;  1MMD A;  3Q7L A;  1T01 A;  2X51 A;  5JLI A;  3CVP A;  4UWL A;  4K5A B;  4U07 A;  2R7T A;  3MKQ A;  4BY6 A;  2BED A;  3JQ1 A;  2WQ7 A;  5AEN A;  3OTN A;  1FT2 A;  3FY4 A;  4ILG A;  2OOE A;  2ZXO A;  3AG3 C;  4U0U A;  1CGN A;  2NSG A;  1PD1 A;  3EDT B;  4CDA A;  4BPM A;  4Q7C A;  4FU3 A;  1OXJ A;  5LCW C;  4Q5S F;  4X8Q A;  4ILH B;  3Q47 B;  3GW4 A;  5CBN A;  4GMR A;  5COM A;  1TNY A;  2Y4U A;  3NZS A;  2I6H A;  3FAP B;  4G23 A;  2NUP A;  3RIB A;  1ELR A;  4NRH B;  5DLJ A;  3VLF A;  2LFD A;  4BJ1 A;  3L22 A;  3TAX A;  3DSW A;  2L0T B;  3C3O A;  4IAO A;  4OIN F;  5DIZ A;  3TWV A;  5FQ8 A;  3APC A;  1GS9 A;  2WXO A;  4WGY A;  3RYL A;  2L6B A;  4MW3 A;  4F3V A;  3FUK A;  1LS4 A;  2HV6 A;  4U0Z A;  1E85 A;  3EHR A;  4JW1 A;  5LOZ A;  4MKT A;  1BR4 A;  4JJF A;  3ZFW A;  3Q7G A;  4GTS A;  2GRQ B;  4OD4 A;  3JCU Q;  3X2Q C;  4Q4Z F;  4LLE A;  4FHJ A;  3HXF A;  3ZQV A;  4PJM A;  3LS0 A;  3QW0 A;  3SXY A;  3LDZ A;  2LAH A;  3KD7 A;  5FCL A;  1SQM A;  4ZFH A;  4YVQ C;  3UMV A;  2OOC A;  3FFL A;  1Y4C A;  2KC3 A;  1HW1 A;  4JXT A;  2UUI A;  1PAQ A;  1OQC A;  1MJ0 A;  3KYJ A;  1TKN A;  2LSE A;  3TWW A;  5EK0 A;  4XQ1 A;  2EQX A;  5DBK A;  3AG2 E;  2C04 A;  4BET A;  1C02 A;  1N94 A;  5E3C A;  4LLC A;  3QJZ A;  3ASH A;  1Z5Z A;  2VGE A;  2LP4 A;  3TOM A;  3AQC A;  1O1R A;  3KAE A;  3N0T A;  4E17 A;  2XLM A;  1H2U A;  4UI9 J;  3CVY A;  4ZLC A;  1HU3 A;  3EFO A;  1QSP A;  3EGX B;  5L3Q A;  1OCO C;  2H6I A;  2WXG A;  2AJA A;  3LXU X;  2J9B A;  3UIP C;  5DVW A;  4UQZ A;  4O6Y A;  5L0F A;  3JQ0 A;  2PQR A;  1QQ3 A;  4GMJ A;  1IHG A;  3T8M A;  4EZK A;  2KZT B;  1SMY F;  1A5E A;  2Q7F A;  3C8G A;  4XZ4 A;  1OCZ C;  3SZR A;  2NYJ A;  4QDL A;  1NZN A;  2R2L A;  3G2V A;  3ZUV B;  2KJG A;  3K9I A;  3GOD A;  3DAG A;  5G05 C;  1N4S A;  1WG0 A;  2L6F A;  2AXU A;  4I44 A;  4CSA A;  4IGG A;  1D1C A;  3G2U A;  5J90 A;  2OEX A;  5EID A;  4A55 A;  4I1M A;  3FUH A;  5BW8 C;  2GRL A;  5F5F A;  3RQG A;  3V5X A;  3L6A A;  5EIL A;  3TWX A;  5KYU B;  2Y3G A;  3IHU A;  2QYU A;  5CHE E;  3C7J A;  3I5Q A;  1A17 A;  3DSX A;  4CJO A;  3TL5 A;  4JUR I;  1ELK A;  3EIJ A;  2R17 C;  1Z7Q c;  3NAW A;  3B7S A;  1MQV A;  1G4W R;  3S29 A;  1JAF A;  3B7R L;  1E90 A;  1RCP A;  1OCR C;  4F4B A;  3UM3 A;  4F53 A;  2J09 A;  3PEU B;  1G4U S;  4EUK B;  3J06 A;  3CVX A;  2I1J A;  1ZW3 A;  3NMK A;  1Q0G A;  1I4Z A;  3W9G A;  2CNW D;  3LEO A;  3UM1 A;  4JEB A;  3ASN C;  1D1B A;  1ZVZ A;  4MTF A;  2HM8 A;  2RFM A;  4DX5 D;  2DYS E;  4ACK A;  2YRF A;  4A1G A;  4YJW A;  3FMS A;  3CVN A;  1L3P A;  4J8Y A;  2FF4 A;  1IHB A;  2OVF A;  3PH0 C;  3FH7 A;  3T9O A;  2ETS A;  3R7R A;  2ZXR A;  4U5E E;  3B7B A;  2XLD A;  2AXV A;  4HQD A;  5AQB A;  1N4R A;  3FHD A;  2XZD G;  4G7H F;  4XKB A;  3K1H A;  2L6H A;  2R59 A;  4ATZ D;  1TWH A;  2NSF A;  4X0R A;  1JMW A;  4GZC A;  2H7B A;  4WWN A;  3O55 A;  4DJA A;  3FTS A;  4QI2 A;  5HQ8 A;  3DXJ F;  4DI4 A;  1ORY A;  2XRH A;  4MBG A;  3AG3 E;  3QKY A;  4PJN A;  4YT2 A;  3M79 A;  2X3M A;  2ZGG A;  1VYK A;  4KNW A;  1H0A A;  1GQA A;  4NQ0 A;  2XLW A;  1WTY A;  2VSN A;  1WOL A;  1OUV A;  3HG0 D;  2I15 A;  1A7E A;  1E2X A;  1YCS B;  1OCO E;  2XM4 A;  3UGO A;  4CT4 A;  4HFK B;  3CST A;  4JHJ A;  4WNG A;  3I5P A;  4N5Q A;  4G25 A;  2VH3 A;  4HOU A;  2MWQ A;  4JEU A;  1QVX A;  5BV1 A;  5C1D A;  4HLL A;  3AGU A;  2G3V A;  2Y4T A;  2J8S D;  4E0H A;  1ZB1 A;  1OR2 A;  3U3B A;  3NZU A;  4ATG A;  4RVB A;  4OYS A;  3SI5 A;  1K04 A;  4J8F A;  3VRC A;  2LNI A;  3AS5 A;  4G24 A;  4E6H A;  2C2L A;  4I9C A;  3QDN A;  4RDA A;  4NY3 A;  1JWF A;  3DMD A;  3X2Q E;  4W8K A;  1TN7 A;  4FJZ A;  1Y6D A;  2Y3A A;  5E33 A;  2G3K A;  3AG1 E;  4HLE A;  3VM6 A;  3T6B A;  4A2N B;  3AJM A;  4J8E A;  2J9W A;  2VYI A;  2HJ3 A;  1X81 A;  2LO6 A;  2IJG X;  4N06 A;  1M6T A;  3RK6 A;  4RBN A;  4I6J A;  1S7Z A;  3S27 A;  3KSL A;  1V54 C;  1SZI A;  4KZC A;  5M72 A;  1BLX B;  2YHE A;  3GM2 A;  3V7O A;  2KXP C;  4JTD B;  3NQP A;  3ABL C;  5BQH A;  1FFH A;  2BF0 X;  1QZX A;  1EQ1 A;  2ASR A;  1MND A;  5L0C A;  2YWA A;  1NU9 C;  4MVZ A;  4HRM B;  4PS7 A;  3UXG A;  5ENP D;  2CFZ A;  2KQ9 A;  5CMY A;  3ABM C;  1KNY A;  5EGY A;  4CEM A;  2OQM A;  3P2B A;  2AWC A;  3NYM A;  4URK A;  4LSZ E;  3L0I A;  5B3S E;  2UY1 A;  3E30 A;  4B89 A;  4RG6 A;  4GA0 A;  1TWG A;  1YYJ A;  2P58 C;  3FTX A;  1UN9 A;  1TWA A;  2A0U A;  2PNN A;  2EIK C;  5KYX A;  4JC8 A;  2PM6 A;  4FAP B;  4YVO A;  4CS9 C;  3LES A;  3W8I A;  3UIO C;  4BEP A;  5D66 A;  2Q9A A;  3BU8 A;  4U0S A;  4DX7 D;  3X1O A;  3JYY A;  2Q9C A;  4U8H A;  1A41 A;  2QC9 A;  4RQI A;  3W9F A;  1FTS A;  3MYV A;  1H6G A;  4GYO A;  3Q75 A;  4JPS A;  3TD7 A;  4DBR A;  3DRA A;  3LS1 A;  1WN0 A;  2WXL A;  5CEC B;  4EWC A;  2BL2 A;  3C98 A;  4MVM A;  4ONS A;  4O1P A;  3O4Z A;  3V31 A;  1OW8 A;  2HMZ A;  1EF1 C;  1K8K G;  1Z3X A;  2A0B A;  1TJC A;  1N54 A;  4LCT A;  4ACL A;  3CSF A;  2IXM A;  4TV3 A;  1TR2 A;  5HSW A;  3B0U X;  3MYF A;  3HVE A;  3L8J A;  1N1C A;  3CHR A;  2C03 A;  4FJY A;  5L0J A;  4R32 A;  4XPW A;  3ABK C;  1OCR E;  3FTZ A;  3FUI A;  4U5D E;  5FQ6 A;  3UIN C;  3S0X A;  2YLG A;  3ZXS A;  1E8W A;  4QI0 A;  1AEP A;  1Z23 A;  4EBJ A;  1O5M A;  2ZGD A;  3F47 A;  4J7Y A;  2J49 A;  3DEP A;  3LY9 A;  2J9Q A;  1VK5 A;  1EKY A;  4U7E B;  3ZEF A;  2DWZ A;  2C0L A;  4L1B A;  2UY1 B;  3S2A A;  1MMG A;  4EBB A;  2QTV A;  4N39 A;  2XGS A;  4XPX A;  1HXI A;  5G04 J;  2Q3T A;  4CIH A;  2X6K A;  3ATP A;  3GWN A;  2X6F A;  4GAA A;  1P5Q A;  2KCK A;  2WXN A;  3QAR A;  3GEI A;  2YKZ A;  3UNG C;  4GB9 A;  3NDB B;  5K0I A;  3TWQ A;  1BBH A;  2OU6 A;  2IXP A;  1U0B B;  4APF A;  3APD A;  1E8Z A;  4FHK A;  4EIY A;  3PZ2 A;  2AVP A;  3ABL E;  3UT8 A;  2F8Y A;  3JXJ A;  5CCM A;  3K6B A;  3HHM A;  2KC7 A;  1KTM A;  3C8G B;  2VC9 A;  3BG1 B;  3IPM O;  2P7V A;  3Q5M A;  3RO3 A;  3SXK A;  5BUZ A;  3BG0 B;  3NBN B;  2FI7 A;  4O60 A;  3EIQ C;  1H6O A;  4GTR A;  4UWG A;  5B1B E;  2P9K G;  4EPZ A;  4ABN A;  4OIO F;  4LRZ A;  2ETC A;  2Y0B G;  3LPZ A;  2I1K A;  5DS6 A;  2EPL X;  3UMH A;  4RD9 A;  4NTA A;  1X5B A;  3ASO E;  4MQ9 F;  3S28 A;  4G8K A;  3EU5 A;  5KYU A;  3ZHE B;  3CSK A;  4XWJ A;  4JCH A;  4QQI A;  1ZU4 A;  5JJ7 A;  3IQ6 A;  3FVY A;  1VLT A;  1Q0D A;  1UJK A;  1ZZP A;  2CGE A;  3RSE G;  4HBD A;  3TJ5 A;  4XTK A;  4CS8 C;  1RW2 A;  5ENR D;  5C2Y A;  4XEF A;  2VCA A;  3AS4 A;  3HXE A;  4IWB A;  2PBE A;  1ELW A;  3UGP A;  3B95 A;  5LP0 A;  3UMI A;  1LI5 A;  2L9J A;  2AW6 A;  3QK0 A;  1OY3 D;  2W4M A;  2YL7 A;  4MS6 A;  2OVB A;  3N2Z B;  2CHW A;  3FOP A;  3OWT A;  1CPR A;  2XLO A;  3RRU A;  3ZRH A;  3CR3 A;  1VLS A;  3UKU G;  2YL0 A;  3W8H A;  4XPY A;  2P9I G;  2H7O A;  3EHM A;  3CVQ A;  1S0P A;  4GYY A;  3QZC A;  1SVX A;  3EZI A;  2BE5 F;  5BNW A;  3IQT A;  3ENE A;  1CPQ A;  4Y6C A;  1IQU A;  3VTY A;  1TNB A;  5KBA A;  4DPR A;  1NU7 D;  4P29 A;  4PH4 B;  3LVQ E;  4DUI A;  4DX2 A;  1BR2 A;  5JVE A;  3CZ6 A;  3NOG D;  4J32 B;  5FZR A;  2ZPA A;  1UOH A;  1RJ9 B;  3POV A;  2QUP A;  3L54 A;  3GZ2 A;  3QWV A;  4U95 D;  2V0P A;  2V4H C;  3ZC4 A;  3DE8 A;  3SNX A;  2EIL E;  1U2V G;  3NF1 A;  4ANX A;  2Y69 E;  3PZD A;  3OXL A;  1HF8 A;  4DVZ A;  2IM8 A;  4OIP F;  1NFI E;  5JSL A;  3U3F A;  3MKR A;  5JJ6 A;  3N24 A;  4U8V D;  4WAB A;  2BKG A;  2MYS A;  2IOQ A;  2V3C C;  3F46 A;  4L2Y A;  4APO A;  2KSF A;  4Q94 A;  3IQC A;  4GQH A;  3AJI A;  4PJJ A;  5KNG A;  4IAR A;  2HFI A;  3JSE O;  1NI1 A;  4U5B E;  1UFB A;  3RVY A;  4L2L A;  2XRZ A;  5G2N A;  3R2P A;  5EIB E;  4CSA C;  4Q69 A;  3G2W A;  3GOR A;  4YDY A;  2WXH A;  3ZTM A;  4BFR A;  2XPI A;  4CIP A;  4NAC A;  1FT1 A;  4WND A;  5L0I A;  2GRM A;  4GPK A;  1YAU O;  2VAS A;  3TOL A;  2JD3 A;  2R7O A;  2H8A A;  4N6C A;  3CQG B;  4DOZ A;  4BSX A;  2VSO E;  3ZN3 A;  1Z6A A;  4W9R A;  4CYM D;  3PDN A;  2A6H F;  1OCC C;  3ASO C;  1GM5 A;  2FO7 A;  1YA0 A;  3L08 A;  5EDS A;  2P6V A;  4I1A A;  2XL4 A;  3U2M A;  2A4Z A;  4C48 B;  3B0P A;  2MYO A;  3ASF A;  5AIJ A;  4BJT A;  2NPU A;  3D9P A;  4XX5 A;  4YWQ A;  2NUT A;  5DS4 A;  4YN0 B;  2IU1 A;  4YND A;  1EYH A;  2XS8 A;  3DM9 B;  4NQF A;  3UI2 A;  3Q6N A;  4BJ6 C;  3DST A;  3ML8 A;  2J7P A;  2J8W A;  1MMN A;  4G78 A;  2L0I A;  3NG1 A;  5EYL A;  4B6I A;  4G7O F;  3D9L A;  2QZA A;  3Q73 A;  3S7D A;  3HNK A;  1HE1 A;  1KT1 A;  1PY1 A;  3R9M A;  4WNF A;  1E7U A;  3L8I A;  2DIW A;  3NRH A;  5GPG B;  3NKD A;  4I2W A;  5BQI A;  5T1D B;  3QWW A;  3S84 A;  4F1S A;  1LE4 A;  2B0H A;  1OWO A;  2HZ8 A;  3US6 A;  5CIV A;  1JR8 A;  1E96 B;  2CFU A;  2GRP B;  3U8V A;  2IY0 C;  5D91 A;  3TJP A;  4J30 B;  2J45 A;  2W4B A;  2KAT A;  1C17 M;  1WAO 1;  3TGO A;  3CEX A;  5LFA A;  2V8S E;  5A6A A;  5EN5 D;  2YEV A;  1G3N B;  3Q78 A;  3CAX A;  1UN8 A;  5D0O D;  4UQY A;  3L13 A;  1ZBP A;  3RRN B;  3U0C A;  3ZU7 B;  2XXA A;  2Q7R A;  3CKB A;  1N4P A;  1PV3 A;  1G8X A;  3G2T A;  3UM0 A;  4UUC A;  4GEH A;  1OWM A;  3HLZ A;  3JRT A;  2XZT G;  3TWS A;  4FA6 A;  3WAQ A;  4KXK B;  2EIM C;  4DRH B;  1N9A A;  3VYW A;  4A1S A;  3EH1 A;  1QQE A;  1IZM A;  2P9P G;  4L6R A;  2LSU A;  3UQ3 A;  4U9E A;  3JUE A;  3AU4 A;  2KW3 C;  1MX4 A;  3PE3 A;  2RD9 A;  1NFN A;  4BG0 A;  4EBA G;  1DOV A;  2GRR B;  3I4U A;  3PS6 A;  4HNA D;  4GA2 A;  1SZA A;  1YAR O;  3SEO A;  2QY7 A;  1R5I D;  3WXX A;  3U2L A;  5FZQ A;  3GYZ A;  4HI9 A;  3SXZ A;  5KNH D;  1HG5 A;  2E2E A;  1C03 A;  2YQY A;  4BJ6 A;  3UTM A;  3RW0 A;  3L17 A;  5EKQ D;  1LE2 A;  3ZVV A;  5JMN D;  3IXE A;  4HFF B;  2R7R A;  4A63 B;  1M57 C;  2P9U G;  3BUA A;  4BER A;  3LCA A;  1VYI A;  4JL0 A;  5A6K A;  4XE0 A;  2VSX E;  3ZW3 A;  1UW4 B;  1YLM A;  1NA0 A;  2W9Y A;  3HTK C;  4PR9 A;  4JHR A;  2KBX A;  4CZ2 D;  2GWW A;  3VAY A;  4IJJ A;  4N3B A;  3O6X A;  1AUE A;  2R03 A;  2CHX A;  1U3D A;  1YVI A;  4PFO A;  4I2Z A;  1Q0F A;  3UMK A;  1LF8 A;  3B71 A;  3ML9 A;  3C18 A;  3QWP A;  3EGX A;  3EFO B;  1NG1 A;  3L34 A;  3MBG A;  2VTB B;  5COF A;  3AG4 C;  4TXQ A;  2XGO A;  1U3C A;  3D9O A;  3G4Z A;  3C3Q A;  2VGY A;  3EH2 A;  3FTW A;  2IFU A;  2OCC C;  3CQZ A;  1H6P A;  3KL4 A;  4U9D A;  3TJ6 A;  2XEE A;  3V2X A;  3UR3 C;  4K0D A;  3U9M A;  1FCH A;  2LXL A;  3I4R B;  5BXO A;  1S63 A;  3MX3 A;  4DRI B;  1HE9 A;  3ULQ A;  4L7T A;  1Z63 A;  2LIG A;  2P1A A;  2DZN A;  1K1B A;  1AP7 A;  4O7G A;  1LTX A;  4I6G A;  3QOU A;  4JIO A;  3RU0 A;  5KWD A;  4UI9 K;  1YJG A;  4B94 A;  1ZHW A;  3F6Q A;  2V26 A;  3JYS A;  4GPM A;  2A68 F;  3FWV A;  2P9L G;  2Z15 A;  4CDV A;  5CER B;  1OW7 A;  1O87 A;  2L6J A;  4XIF A;  4NC3 A;  3AOU A;  1RJ9 A;  1TNO A;  4J0U A;  2FUL A;  3A11 A;  2MOW A;  4N5C A;  4HFG A;  5FZS A;  3NMJ A;  5JRA A;  1K3Z D;  4FWV A;  5KCM A;  1LIH A;  4AM9 A;  3LYA A;  3FUN A;  3CV0 A;  3W2W A;  1EPU A;  4FP7 A;  2YL3 A;  2L6G A;  1HO8 A;  1MHQ A;  2BTD A;  5EX3 A;  2FFH A;  3M4B A;  3KMI A;  2IOL A;  3W2V A;  1D9S A;  4HB5 A;  3R9A B;  3DBS A;  4C3E A;  4A3V A;  1BD8 A;  2OEV A;  4G7Z F;  4GA1 A;  4MVO A;  5E76 A;  4YK5 A;  2JLB A;  2IEJ A;  4JZY A;  4D10 C;  2XL8 A;  2L7A A;  1Y8M A;  2PL2 A;  2HJM A;  2XSE A;  2PFD A;  1OXB A;  4LER A;  4O6M A;  3SP1 A;  4ZLD A;  5E2Q A;  1VMA A;  1N95 A;  3ZDL A;  1LS1 A;  5ARG A;  3RRM B;  4DRJ B;  1HW2 A;  5AAO A;  2JEK A;  5E3A A;  2NXP A;  1N52 A;  1RXQ A;  4AXH A;  2R9R B;  1XZP A;  2YVK A;  4GTO A;  1NP7 A; 
#chains in the Genus database with same CATH homology
 2YZS A;  4ULW A;  3U4T A;  5D0Q D;  4I17 A;  2GW1 A;  2XCB A;  3VLE A;  1IW7 F;  4I43 A;  3MEK A;  4FAD A;  5DS5 A;  2XPZ A;  4U5F E;  1PC2 A;  2X6I A;  2DGJ A;  3JUI A;  3AG2 C;  3E9V A;  2WPV A;  3K33 A;  3SBS A;  2Y3D A;  5BV0 A;  3ONL A;  3UPV A;  3D9I A;  2WXK A;  3E70 C;  3FAJ A;  1H19 A;  3ZPJ A;  3HJC A;  3FU6 A;  4O6N A;  5BPP A;  1XGW A;  4KMO A;  2OV8 A;  3TG5 A;  5FT9 A;  4TRQ A;  4CCA A;  1DNP A;  4KZ0 A;  5ANR A;  1ST6 A;  2IYL D;  4WNE A;  4Y6W A;  3Q15 A;  3D3M A;  5DQT A;  2G62 A;  3CVL A;  4N2S A;  4CBE A;  4BTB A;  4IUL A;  1OWL A;  3B13 A;  3B7T A;  4ILI A;  4V3I A;  1M2V B;  5F5H A;  3JT1 A;  3GZS A;  2O9X A;  4HS2 A;  3U3W A;  5JHA A;  2FGY A;  5KYN A;  3FEY A;  4ANU A;  3KKB A;  3AS8 A;  4PDX A;  4DLQ A;  1H2T C;  1D0X A;  4C0M A;  1E7V A;  1D1A A;  2KZT A;  2I2O A;  5HI7 A;  2LSV A;  3ESL A;  2ZU6 B;  4JEH A;  4E85 A;  5KYY B;  4YT8 A;  3MA5 A;  5BUO A;  3T5V A;  4YT4 A;  2WB7 A;  4YT5 A;  5KYX B;  4G1T A;  1SZ9 A;  2IXO A;  1D0Y A;  3LEW A;  1MQS A;  3GAN A;  2HR2 A;  1KU2 A;  4AEZ C;  1OWN A;  3SGH A;  2MHK A;  3ZIB A;  2J4B A;  4I6E A;  1MMA A;  3SD5 A;  4BEJ A;  4C0E A;  2WZF A;  3M1C B;  4U04 A;  4HOQ A;  3SNH A;  4PS8 A;  5CCL A;  4IN3 B;  1VDY A;  5CI9 A;  4U5C E;  4GCO A;  3MKQ B;  1IYG A;  4JA7 A;  4I1O B;  3MGB A;  3K66 A;  4BT8 A;  1IQR A;  5B3S C;  3QB2 A;  2L81 A;  4F7A A;  3CK8 A;  1ZHZ A;  3DD7 A;  3B0V C;  1FMW A;  3RO2 A;  2C0M A;  3RJV A;  3OEO A;  2WXQ A;  2WL8 A;  3CHQ A;  3EG9 A;  1ZYR F;  2QY9 A;  4A3T A;  5B1A C;  2HO1 A;  3AG1 C;  1VOM A;  2YHS A;  1ZU2 A;  4N3A A;  3PNL B;  4AK9 A;  2NG1 A;  1HG2 A;  3ECS A;  5DQZ A;  1FMV A;  4EEC A;  3DPD A;  2W45 A;  2KCL A;  4I3M A;  1BPO A;  4J8S A;  4O6F A;  2CG2 A;  4GU5 A;  3TXM A;  1M56 C;  2FEZ A;  5L3V A;  3DAF A;  3QC1 A;  2H7V C;  3QMK A;  3OA1 A;  3PUK A;  3DJN B;  2A5U A;  3NYJ A;  3LVR E;  3S7J A;  3I4G A;  2AWI A;  4CDR A;  1ZHX A;  2M4E A;  3FUL A;  1JPN A;  3ZVR A;  4GYT A;  4JHK A;  1OKK D;  2I8B A;  3T6J A;  4KI2 A;  2PF4 E;  3BEE A;  4WWP A;  2Y3H A;  1EDU A;  1LVK A;  3T5X A;  1JPJ A;  2XPY A;  4I9E A;  2QFC A;  3LAY A;  4KYO B;  2WXP A;  3L16 A;  4FC8 A;  4LUN U;  1H2V C;  3SHF A;  5FTP A;  5AJD A;  2A1D D;  4O79 A;  2WM9 A;  3ONK A;  4R7L A;  4DVY P;  2WZG A;  4QFV A;  3IEG A;  3ZIM A;  5CI8 A;  4HOT A;  5A7D B;  4C9B B;  4JJG A;  5FQ4 A;  2ION A;  3CHM A;  4CRW A;  1M2V A;  3PUJ A;  5A23 A;  2WQH A;  3U66 A;  4MRU A;  3QNK A;  2X6J A;  2E0I A;  3PRZ A;  4ANJ A;  4C7O B;  5KYW B;  3D9N A;  5KJN A;  1XNF A;  2PX3 A;  3FH8 A;  5KJL A;  4UWH A;  3IEE A;  1BR1 A;  2J07 A;  1ZHT A;  3B9Q A;  3WG7 C;  4GZD A;  5ANL A;  3TXN A;  3PNT B;  5EHH A;  4KNV A;  4K0R A;  4WWO A;  5T3R A;  3FUD A;  4KT6 B;  3LEV A;  4C3D A;  3ZYQ A;  5B1B C;  2GFH A;  4GZ5 A;  1JPL A;  3Q4A B;  4IYP A;  5EX0 A;  4C7O A;  4GML A;  3G2S A;  4B8C B;  2ZXP A;  2NSZ A;  1M2O A;  1W2W A;  2XHE A;  4ANW A;  2XEV A;  4H4K C;  1HS6 A;  4CS7 A;  4CT0 A;  1QZ2 A;  3VTX A;  3FH5 A;  4E7S A;  5KJK A;  4C3B A;  1WM5 A;  3QAQ A;  5AYW D;  4CS9 A;  4WAF A;  2PM7 A;  5A6C A;  2J9V A;  5T4Y A;  4HXI A;  4JVS A;  1KT0 A;  1TWC A;  4PK4 A;  3FU3 A;  5ARF A;  3RIP A;  2XCC A;  4G26 A;  2J4D A;  1UJJ A;  3U9W A;  3URZ A;  5G05 J;  2DYR C;  1Z3Y A;  2J46 A;  3KH2 A;  4AP2 A;  3D9K A;  1QLE C;  3UT7 A;  3FEX A;  3TG4 A;  1JUQ A;  2PQN A;  2Y69 C;  4XI9 A;  1PCX A;  3SFZ A;  4BX9 A;  4CGW A;  4AE4 B;  1B89 A;  2Y39 A;  3IBE A;  3CIA A;  1HZ4 A;  2FBN A;  2WZL A;  4WJ0 A;  1D0Z A;  2YQ8 A;  3ZHE A;  2XRY A;  4G0H A;  2VQ2 A;  3KS2 A;  3ZYK A;  3CHS A;  3FP3 A;  2WVN A;  4UI9 C;  4FX5 A;  2Y3B A;  1J8Y F;  2VGX B;  1QNF A;  2UWJ G;  1JWG A;  4HEA J;  2LAI A;  3EGD A;  3CVV A;  2J08 A;  3DM5 A;  3HYM B;  3NKE A;  2BUG A;  3LNR A;  2PP4 A;  2I9C A;  2ILR A;  3PEV B;  2PZI A;  1SF8 A;  3P1U A;  4H7X A;  3JCK C;  4UQX A;  5JJT A;  3ZYM A;  2KGO A;  2OND A;  1OWP A;  3ESK A;  3I3N A;  1Z3I X;  1NA3 A;  3EHN A;  4CS8 A;  3MV3 B;  4AIF A;  2MRI A;  1WGW A;  3JSZ A;  3ITF A;  1GW6 A;  2KNH A;  5KYY A;  2CHZ A;  1L5J A;  4N2Q A;  3ZGQ A;  1E8X A;  4P6I C;  2WQ6 A;  3PHF 2;  3FDQ A;  4AY5 A;  3Q49 B;  3APF A;  3RKV A;  3MJW A;  1OKK A;  2YIN A;  2J0X A;  1E8Y A;  1HH8 A;  1HE8 A;  3FUJ A;  4IRU A;  2NUT B;  4G2V A;  4FLB A;  5FQ7 A;  2XXA B;  3FUM A;  2D5R B;  4GYW A;  5FWQ A;  3KEZ A;  1HFA A;  2R7S A;  4OIR F;  4ANV A;  3RH3 A;  3DZA A;  3IV0 A;  3CK9 A;  3LKU A;  3SZ7 A;  2OG2 A;  1FVH A;  2Q9B A;  5CMW A;  4U5H A;  3UT4 A;  5D92 A;  5J08 A;  3EJN A;  2HV7 A;  2NUP B;  3LY7 A;  3CKC A;  3GZ1 A;  4MND A;  3MLG A;  1PD0 A;  4AV7 A;  4DI3 A;  4DBQ A;  4B0Z A;  3FTV A;  1H6K A;  3LLK A;  3PVL A;  5KYW A;  2WXJ A;  4KC9 A;  4PUC A;  3U64 A;  4KVM A;  4N3C A;  3S7F A;  3VLD A;  4RG9 A;  2VJ8 A;  2DBA A;  2R7U A;  2VB6 A;  4AX2 A;  4BX8 A;  3PE4 A;  4HOR A;  2WVO A;  4FLH A;  4XKC A;  4XI0 A;  3EZH A;  4AOF A;  4BJ5 C;  3LJ3 A;  5T8I A;  2IOS A;  4CDM A;  2GGF A;  2CNW A;  2VSY A;  4AY6 A;  4AJW A;  5AJL A;  1J8M F;  1Z6T A;  2DCP A;  3ASG A;  4OD5 A;  4BWR A;  2WXI A;  1TJF A;  2R7Q A;  3Q6M A;  2PX0 A;  2E87 A;  4OIQ F;  3CHP A;  2YNQ A;  3UUX A;  3IHV A;  3O48 A;  3CVU A;  3DJU B;  3D9J A;  4AVX A;  2NC9 A;  5G55 A;  3WOD F;  4LAC B;  2YHC A;  4K03 A;  3FHE A;  2KM4 A;  4RSY A;  4XLN F;  4EZJ A;  4UWK A;  2IF4 A;  3CEQ A;  3LJB A;  4B8A A;  2VTB A;  2HYZ A;  3FU0 A;  3AU5 A;  4ME2 A;  1Y6I A;  4EZL A;  4GCN A;  5LX8 A;  1DVP A;  2WXF A;  3K7D A;  1LKX A;  3EQL F;  3UX4 A;  4L23 A;  3AQB A;  3PRE A;  2CG3 A;  3EPV A;  3T4R A;  2V4L A;  4GZ6 A;  2R7W A;  1ZHY A;  1NZE A;  3RKO F;  2X38 A;  3FUF A;  3LY8 A;  4H7Y A;  4Q96 A;  1UG3 A;  3MZL B;  1FVF A;  4OVV A;  5T3W A;  3SF4 A;  4BT9 A;  3K1I C;  2WXR A;  4AE4 A;  1HX8 A;  2L9B A;  4KVO A;  3N71 A;  4HOS A;  3CVW A;  4DK5 A;  4G11 A;  4MLP A;  4CDN A;  3S7B A;  2EIJ C;  3CK7 A;  2R5S A;  4BJ5 A;  3MCX A;  4KBL A;  1WY6 A;  2IQC A;  3LS8 A;  2EIL C;  4J6I A;  5ENN A;  2EIN C;  3ZG1 A;  2RG8 A;  3E4B A;  4GZ3 A;  5LCW J;  3EG9 B;  3LLI A;  2A6E F;  2XQ0 A;  2WVQ A;  4KBQ A;  2CW0 F;  4JA9 A;  3R7Q A;  5T3T A;  3OAW A;  4PJL A;  3B7U X;  5BT1 A;  4K7B A;  3MV2 B;  5G04 C;  2A69 F;  4HE8 D;  1FFT C;  2WVI A;  1W3B A;  3RFY A;  1MNE A;  3HIZ A;  2IXN A;  1INZ A;  3OXG A;  2J7P D;  3PMR A;  3ZYL A;  3OXF A;  3SYN A;  4OVU A;  4UWF A;  4JZA A;  3FTY A;  4CGV A;  4PS3 A;  5JHB A;  2R7X A;  2R7V A;  4DLO A;  3CGH A;  3NYL A;  3FUE A;  3CHO A;  2WB2 A;  3D9M A;  4XLP F;  5FJY A;  5E75 A;  2B0J A;  4FES A;  1TEZ A;  2M63 A;  4M63 A;  2KCV A;  4FUL A;  2WMO A;  4M3O A;  3FU5 A;  3CLJ A;  3IKO B;  4EBA A;  2X6H A;  2CDQ A;  4U63 A;  4WUY A;  4PFP A;  4BTA A;  1V55 C;  4LEU A;  3FTU A;  3CQC B;  3EGD B;  3FDH A;  3ZSU A;  3SBT B;  4TUU A;  4E7Z A;  2VGX A;  3O39 A;  5KJM A;  3HDX A;  2ZXW C;  2RD0 A;  5IY5 C;  2DYS C;  2XGM A;  2WXM A;  1KLX A;  1O5H A;  3IHY A;  2AXZ A;  3HVE B;  3JYH A;  4NUR A;  2WMN A;  4EQF A;  4J8D A;  1ZU5 A;  4U5G A;  3H65 A;  3ASD A;  4HVB A;  2V5F A;  2J9U A;  2J0W A;  1MMD A;  3Q7L A;  2X51 A;  3CVP A;  4UWL A;  4U07 A;  2R7T A;  3MKQ A;  4BY6 A;  3JQ1 A;  2WQ7 A;  5AEN A;  3OTN A;  3FY4 A;  4ILG A;  2OOE A;  2ZXO A;  3AG3 C;  4U0U A;  3EDT B;  1PD1 A;  4FU3 A;  4Q7C A;  5LCW C;  4Q5S F;  4ILH B;  3Q47 B;  3GW4 A;  2Y4U A;  3NZS A;  2I6H A;  4G23 A;  2NUP A;  3RIB A;  1ELR A;  4NRH B;  5DLJ A;  3VLF A;  4BJ1 A;  3L22 A;  3TAX A;  2L0T B;  4IAO A;  4OIN F;  5DIZ A;  5FQ8 A;  3APC A;  2WXO A;  3RYL A;  4F3V A;  3FUK A;  2HV6 A;  4U0Z A;  4JW1 A;  5LOZ A;  4MKT A;  1BR4 A;  4JJF A;  3ZFW A;  3Q7G A;  4OD4 A;  3JCU Q;  3X2Q C;  4Q4Z F;  4LLE A;  4FHJ A;  4PJM A;  3LS0 A;  3LDZ A;  2LAH A;  3KD7 A;  5FCL A;  1SQM A;  4YVQ C;  3UMV A;  3FFL A;  4JXT A;  1PAQ A;  1TKN A;  2LSE A;  2EQX A;  5DBK A;  2C04 A;  5E3C A;  4LLC A;  3QJZ A;  3ASH A;  1Z5Z A;  3AQC A;  3KAE A;  3N0T A;  1H2U A;  4UI9 J;  3CVY A;  4ZLC A;  1HU3 A;  3EFO A;  3EGX B;  5L3Q A;  1OCO C;  2WXG A;  3LXU X;  5DVW A;  4UQZ A;  4O6Y A;  3JQ0 A;  2PQR A;  4GMJ A;  4EZK A;  1IHG A;  3T8M A;  2KZT B;  1SMY F;  2Q7F A;  4XZ4 A;  1OCZ C;  3SZR A;  4QDL A;  1NZN A;  3G2V A;  2KJG A;  3K9I A;  3GOD A;  3DAG A;  5G05 C;  2AXU A;  4I44 A;  4CSA A;  1D1C A;  3G2U A;  5J90 A;  4A55 A;  4I1M A;  3FUH A;  5BW8 C;  2GRL A;  5F5F A;  3L6A A;  5KYU B;  2Y3G A;  5CHE E;  3I5Q A;  1A17 A;  3TL5 A;  4JUR I;  1ELK A;  3EIJ A;  2R17 C;  3B7S A;  3S29 A;  3B7R L;  1E90 A;  1OCR C;  4F4B A;  4F53 A;  2J09 A;  3PEU B;  3CVX A;  2I1J A;  2CNW D;  3ASN C;  1D1B A;  2HM8 A;  4ACK A;  4A1G A;  4YJW A;  3CVN A;  2FF4 A;  3PH0 C;  2OVF A;  3FH7 A;  3R7R A;  2ZXR A;  4U5E E;  2AXV A;  3FHD A;  4G7H F;  4XKB A;  3K1H A;  2R59 A;  1TWH A;  4X0R A;  4GZC A;  2H7B A;  4WWN A;  4DJA A;  3FTS A;  4QI2 A;  5HQ8 A;  3DXJ F;  4DI4 A;  2XRH A;  3QKY A;  4PJN A;  4YT2 A;  2X3M A;  1VYK A;  4KNW A;  1H0A A;  4NQ0 A;  2VSN A;  1OUV A;  3UGO A;  4CT4 A;  4HFK B;  3CST A;  4JHJ A;  4WNG A;  3I5P A;  4G25 A;  2VH3 A;  4HOU A;  2MWQ A;  4JEU A;  5BV1 A;  5C1D A;  2G3V A;  2Y4T A;  3NZU A;  4ATG A;  4RVB A;  4OYS A;  3SI5 A;  4J8F A;  2LNI A;  3AS5 A;  4G24 A;  4E6H A;  2C2L A;  4I9C A;  3QDN A;  4RDA A;  4NY3 A;  1JWF A;  3DMD A;  4W8K A;  4FJZ A;  2Y3A A;  5E33 A;  2G3K A;  4HLE A;  3T6B A;  4A2N B;  4J8E A;  2J9W A;  2VYI A;  2LO6 A;  2IJG X;  4N06 A;  3RK6 A;  4RBN A;  4I6J A;  1S7Z A;  3S27 A;  1V54 C;  1SZI A;  4KZC A;  5M72 A;  2YHE A;  3V7O A;  3NQP A;  3ABL C;  1FFH A;  1QZX A;  2BF0 X;  1MND A;  1NU9 C;  4PS7 A;  2CFZ A;  2KQ9 A;  5CMY A;  3ABM C;  5EGY A;  4CEM A;  3P2B A;  3NYM A;  4URK A;  3L0I A;  2UY1 A;  4B89 A;  4RG6 A;  4GA0 A;  1TWG A;  2P58 C;  3FTX A;  1UN9 A;  1TWA A;  2EIK C;  5KYX A;  4JC8 A;  2PM6 A;  4YVO A;  4CS9 C;  3LES A;  3W8I A;  2Q9A A;  4U0S A;  3X1O A;  2Q9C A;  4U8H A;  1FTS A;  3MYV A;  4GYO A;  4JPS A;  3TD7 A;  4DBR A;  3LS1 A;  2WXL A;  4EWC A;  3C98 A;  3O4Z A;  1EF1 C;  1Z3X A;  1TJC A;  1N54 A;  4LCT A;  4ACL A;  3CSF A;  2IXM A;  4TV3 A;  1TR2 A;  5HSW A;  3B0U X;  3HVE A;  1N1C A;  3CHR A;  2C03 A;  4FJY A;  3ABK C;  3FTZ A;  3FUI A;  5FQ6 A;  4U5D E;  3S0X A;  3ZXS A;  1E8W A;  4QI0 A;  1Z23 A;  3F47 A;  2J49 A;  3LY9 A;  2J9Q A;  1VK5 A;  3ZEF A;  2C0L A;  4L1B A;  2UY1 B;  3S2A A;  1MMG A;  4EBB A;  2QTV A;  4N39 A;  2XGS A;  1HXI A;  5G04 J;  2Q3T A;  4CIH A;  2X6K A;  2X6F A;  4GAA A;  1P5Q A;  2KCK A;  2WXN A;  3QAR A;  3UNG C;  4GB9 A;  3NDB B;  2IXP A;  4APF A;  3APD A;  1E8Z A;  4FHK A;  2AVP A;  3UT8 A;  5CCM A;  3K6B A;  3HHM A;  2KC7 A;  3BG1 B;  2P7V A;  3Q5M A;  3RO3 A;  5BUZ A;  3BG0 B;  2FI7 A;  3EIQ C;  4UWG A;  4EPZ A;  4ABN A;  4OIO F;  4LRZ A;  3LPZ A;  2I1K A;  5DS6 A;  3UMH A;  4RD9 A;  1X5B A;  4MQ9 F;  3S28 A;  5KYU A;  3ZHE B;  3CSK A;  4XWJ A;  4JCH A;  1ZU4 A;  5JJ7 A;  3FVY A;  1UJK A;  2CGE A;  4CS8 C;  4XTK A;  5C2Y A;  3AS4 A;  4IWB A;  1ELW A;  3UGP A;  5LP0 A;  3UMI A;  4MS6 A;  2L9J A;  2AW6 A;  3QK0 A;  2W4M A;  2OVB A;  3N2Z B;  2CHW A;  3OWT A;  3RRU A;  3ZRH A;  3CR3 A;  3W8H A;  2H7O A;  3EHM A;  3CVQ A;  1S0P A;  4GYY A;  3QZC A;  3EZI A;  2BE5 F;  5BNW A;  3ENE A;  4Y6C A;  1IQU A;  3VTY A;  4DPR A;  1NU7 D;  4P29 A;  4PH4 B;  3LVQ E;  1BR2 A;  3CZ6 A;  5FZR A;  4J32 B;  2ZPA A;  1RJ9 B;  3POV A;  3L54 A;  3GZ2 A;  3QWV A;  2V0P A;  3ZC4 A;  3SNX A;  3NF1 A;  4ANX A;  3PZD A;  3OXL A;  1HF8 A;  4DVZ A;  4OIP F;  3MKR A;  5JJ6 A;  3N24 A;  2MYS A;  2IOQ A;  2V3C C;  3F46 A;  4L2Y A;  4APO A;  4Q94 A;  4PJJ A;  4U5B E;  4L2L A;  2XRZ A;  5G2N A;  4CSA C;  4Q69 A;  3G2W A;  2WXH A;  4BFR A;  2XPI A;  4NAC A;  4WND A;  2GRM A;  4GPK A;  2VAS A;  2JD3 A;  2R7O A;  3CQG B;  4DOZ A;  4BSX A;  2VSO E;  3ZN3 A;  1Z6A A;  4W9R A;  3PDN A;  2A6H F;  1OCC C;  3ASO C;  2FO7 A;  1YA0 A;  3L08 A;  5EDS A;  2P6V A;  4I1A A;  2XL4 A;  2A4Z A;  3B0P A;  3ASF A;  5AIJ A;  4BJT A;  3D9P A;  4XX5 A;  4YWQ A;  2NUT A;  5DS4 A;  4YN0 B;  2IU1 A;  4YND A;  1EYH A;  3DM9 B;  3Q6N A;  4BJ6 C;  3ML8 A;  2J7P A;  1MMN A;  2L0I A;  3NG1 A;  4B6I A;  4G7O F;  3D9L A;  3S7D A;  1KT1 A;  1PY1 A;  4WNF A;  1E7U A;  2DIW A;  3NRH A;  3NKD A;  4I2W A;  3QWW A;  5T1D B;  4F1S A;  1OWO A;  1E96 B;  2CFU A;  5D91 A;  3TJP A;  4J30 B;  2J45 A;  2W4B A;  2KAT A;  1WAO 1;  3TGO A;  5LFA A;  2V8S E;  2YEV A;  1UN8 A;  5D0O D;  4UQY A;  3L13 A;  1ZBP A;  3RRN B;  2XXA A;  3CKB A;  1G8X A;  3G2T A;  4GEH A;  1OWM A;  3HLZ A;  3JRT A;  4FA6 A;  4KXK B;  2EIM C;  3VYW A;  4A1S A;  3EH1 A;  1QQE A;  1IZM A;  2LSU A;  3UQ3 A;  3AU4 A;  2KW3 C;  3PE3 A;  4BG0 A;  4EBA G;  3I4U A;  3PS6 A;  4GA2 A;  1SZA A;  3SEO A;  2QY7 A;  3WXX A;  5FZQ A;  3GYZ A;  1HG5 A;  2E2E A;  4BJ6 A;  5EKQ D;  3L17 A;  3ZVV A;  4HFF B;  2R7R A;  1M57 C;  3LCA A;  1VYI A;  4JL0 A;  4XE0 A;  2VSX E;  3ZW3 A;  1UW4 B;  1NA0 A;  2W9Y A;  3HTK C;  4JHR A;  3VAY A;  4IJJ A;  4N3B A;  3O6X A;  2CHX A;  1U3D A;  4PFO A;  4I2Z A;  3UMK A;  1LF8 A;  3ML9 A;  3QWP A;  3EGX A;  3EFO B;  1NG1 A;  3L34 A;  2VTB B;  3AG4 C;  2XGO A;  1U3C A;  3D9O A;  2VGY A;  3EH2 A;  3FTW A;  2IFU A;  2OCC C;  3CQZ A;  3KL4 A;  3UR3 C;  4K0D A;  1FCH A;  3I4R B;  3MX3 A;  3ULQ A;  4L7T A;  1Z63 A;  4O7G A;  4I6G A;  3QOU A;  3RU0 A;  4UI9 K;  4B94 A;  1ZHW A;  2V26 A;  3JYS A;  2A68 F;  3FWV A;  2Z15 A;  1O87 A;  2L6J A;  4XIF A;  1RJ9 A;  4J0U A;  2FUL A;  4N5C A;  2MOW A;  4HFG A;  5FZS A;  4FWV A;  5KCM A;  4AM9 A;  3LYA A;  3FUN A;  3CV0 A;  3W2W A;  1EPU A;  4FP7 A;  1HO8 A;  1MHQ A;  2BTD A;  5EX3 A;  2FFH A;  3KMI A;  2IOL A;  3W2V A;  3R9A B;  3DBS A;  4C3E A;  4A3V A;  4G7Z F;  4GA1 A;  5E76 A;  2JLB A;  4JZY A;  4D10 C;  1Y8M A;  2PL2 A;  2XSE A;  2PFD A;  4LER A;  4O6M A;  3SP1 A;  4ZLD A;  5E2Q A;  1VMA A;  1LS1 A;  5ARG A;  3RRM B;  2JEK A;  5E3A A;  2NXP A;  1N52 A;  4AXH A;  1NP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...