4I1MA

Crystal structure of the legionella pneumophila gap domain of lepb
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
297
structure length
285
Chain Sequence
SILELKPLTLLMTSSTSFSETINQWADILKTTDMEKFSFDSNPINLLELVKQFNLYVDELAITCEANNVWATPNLFALYDNSGGEAIHGHAFVPYYKESIVLRRLFTVDPNTFNLSRFAAFEGPCQLYCAAHADSAWVKIQTLLTLGNGIINTLKIIKQAQAFGIDEAVTENLKALKEQFIAFQLAEADIKESLKAPSNKESEFFYPIDEKALAKMNGYQLATICLEELNSPKPSPLIERILSNKKFWKRINSAFESGVFKGRTDDPAGKIAKIREWHQLLQISG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mechanism of Rab1b deactivation by the Legionella pneumophila GAP LepB.
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila
molecule tags Hydrolase
molecule keywords LepB
total genus 104
structure length 285
sequence length 297
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18172 LepB_GAP_N LepB GAP domain N-terminal subdomain
A PF18227 LepB_GAP_C LepB GAP domain C-terminal subdomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1700 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4i1mA01
1.25.40.830 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4i1mA02
4I1MA 4IRUA 4JVSA 4I1OB 4JW1A
chains in the Genus database with same CATH superfamily
4JTCB 5FWQA 1Z6AA 5DBKA 3SZ7A 1V74B 1Z7Qc 3KSQA 2NUPB 2XLDA 1H6KA 2I6HA 3R7QA 1TNYA 3AAAC 3D3MA 3DKAA 2NUTA 2X38A 3TWTA 4EZJA 4FLHA 4BTAA 1E7UA 1PAQA 3W2VA 1TN7A 3Q73A 2J08A 4ANVA 4F6RD 4DX2A 5ANLA 4DVZA 4QDLA 4HVBA 2KATA 4LG6A 3GWNA 4K0DA 2KXPC 3FTYA 4YDOA 3NKDA 3ZVRA 2QFCA 3QWVA 3T9OA 3C72A 2R7WA 3SXMA 2OOEA 1WDYA 3AU4A 1N52A 1Q0FA 3L54A 1J8YF 5JUAA 4B89A 1TR2A 2XSEA 3QAQA 4JEAA 1FMWA 3HVEA 2J7PA 3OWTA 3S2AA 3MEKA 4G7HF 3SYNA 4MTOA 1SA5A 3FEYA 3AG4C 3KYJA 4JC8A 4KZCA 1DCQA 3X2QC 3B7UX 3BG1B 3PNLB 4NRHB 2LFDA 2OCCC 3L6AA 3MZLB 4UQZA 5T8IA 5DS4A 2Y4UA 3QNKA 3UX4A 4GTSA 4BETA 4O6MA 4J32B 4CS7A 2AP3A 4U5HA 4EWCA 1H19A 4YDEA 3ITFA 5A6AA 2L7AA 3M15A 5A6KA 1V4AA 4D10C 3Q78A 4D4XA 3UPVA 4GTPA 4AIFA 2NSGA 5JP7A 1QQEA 2W45A 1YVIA 5CMYA 5JJTA 1K3ZD 1R5ID 5HSWA 1DOWA 3E30A 5A6JA 1FCHA 4N6CA 1M57C 2NUTB 2R17C 1V55C 2YQ8A 3C3RA 2XLWA 2MWQA 3UT7A 4E6HA 2CNWD 3I4GA 2Z15A 3ESKA 4IULA 5ENNA 2QE9A 3SD5A 5COGA 4MVSA 3Q6MA 1DVPA 3Q75A 4XPWA 1WN0A 3WG7E 3PDMP 2P9UG 1Z5ZA 4U5FE 4GPMA 1IKND 4NTFA 3U0CA 3C8GA 3J5QB 3W8HA 2ZIRA 2VB6A 1WATA 5B1BE 4YT2A 1BD8A 3TGOA 4G7ZF 4AP2A 4I1OB 4JURI 1G3NB 1FNTc 4G11A 2JPUA 4U07A 3OXFA 1LIHA 1TN8A 1UG3A 3VYWA 1XWJA 2CHWA 3ABME 4A2NB 4Q5SF 3CVVA 3I4UA 2YHSA 2C0LA 5CMWA 2V5QC 1QZ2A 1YA9A 3CHOA 1OCZC 2NYJA 5G2NA 4HORA 2ONDA 4WGYA 2PQRA 4UWLA 4XEVA 1QQ3A 3S28A 2ETAA 5HKPA 3K66A 2ZXRA 3GANA 3EU5A 5AC4A 2DYSC 4MVZA 4E0HA 3ISMC 1I4ZA 3S9OA 1NZEA 3UGOA 1XGWA 2P9NG 4Y6CA 3AG1C 2VJ8A 4G0HA 1EYHA 3FUIA 5CECB 5ENQD 2OV8A 3ZVVA 4UQXA 2HJMA 1ZU2A 3PZ3A 3FTSA 5KYWA 4GCNA 1JPLA 4GYWA 4I1AA 5CI8A 3D9HA 3O10A 3IXEA 2E2EA 3FH7A 1HE9A 1VB5A 4PJLA 1OW7A 2I1KA 1OCOE 3F46A 4YT4A 2CHXA 2Q7FA 3C8GB 3JXIA 4QQIA 3AGUA 4RG9A 2OCCE 1TFOB 3D9LA 2YZSA 4KI2A 4N3AA 3CEQA 4P29A 2WXHA 2NSFA 1HE1A 1OCZE 4EBAA 3CHMA 3ABKC 3ZPJA 3T6JA 4PR9A 3APFA 4RLYA 4F53A 4ME2A 3C63A 5FQ8A 2XM4A 3RF3A 2R2LA 1Y4CA 3TD7A 1PC2A 3ZFWA 3ABMC 2X3MA 2V4HC 2J09A 2E87A 2WXRA 3JUEA 2P61A 2R7TA 3CK9A 2YLGA 4AE4A 3P2BA 2W4BA 4O1PA 4U9EA 2WB7A 3FWVA 1MX2A 3OAWA 4TUUA 1C17M 1G8XA 4CCAA 4FC8A 3V2XA 1BPOA 1D1BA 2MYSA 1Z23A 3OXLA 4FU3A 2B6CA 3O39A 1MMAA 2DVWA 3JCKC 2IXMA 1FVHA 2KC7A 1RXQA 5DIZA 3ESLA 3B0UX 4XQ1A 5CHEE 1IHGA 5EILA 3CHRA 4LACB 4CS9A 4GTTA 2XEHA 5AAOA 2XGMA 4CEMA 3EZIA 3G2TA 4PH4B 1BLXB 3ONKA 2AWCA 4O7GA 4O1OA 1QVXA 2L81A 1H0AA 3E70C 4BJ1A 1QLEC 2ETBA 1CPRA 2ZISA 2EIME 3SEOA 2J45A 2PNNA 2GW1A 2H6FA 3EGXB 2WQ6A 1TNUA 1TKNA 2G3KA 4JEHA 4GCOA 3HXBA 3CSFA 4BT9A 5CI9A 4NY3A 4O6NA 2LSVA 4WAFA 2XRZA 5D0OD 5AN8A 2XL4A 4JJFA 2ZU6B 2XLOA 3ZEFA 4GYTA 3IV0A 5KCMA 4JRZA 3DEPA 3CV0A 3LVRE 3LJBA 1IQUA 1E85A 4HB5A 3ZXSA 4MTFA 3B7RL 3BEHA 4WABA 2IEJA 3ZTMA 4DXWA 4U96D 2WVOA 2WXJA 2I15A 2J8SD 3ZC4A 4IARA 2PM6A 4I1MA 3BQOA 2HM8A 3PEVB 3O6XA 2FBNA 3EG9B 1TEZA 3VRCA 3NOGD 3P1UA 2BE5F 1D9SA 3NMJA 2AVPA 3N2ZB 4F7AA 3ZDLA 3GEIA 3DSWA 3NYJA 2H7OA 4FHKA 4DI3A 1K40A 3T8KA 4G7OF 3QVZA 5B3SE 1TQGA 4BSXA 3FUFA 2WXLA 3TL5A 1LF8A 3D9IA 2XCCA 4JD2G 3MKRA 4FADA 2W4MA 4RG6A 1E84A 1OUVA 4I17A 3TWRA 1A7VA 2R25A 4J7WA 3CKBA 3U66A 2Q9AA 5IY5E 1JCRA 2LUHA 2GRRB 2XHEA 2C04A 1A5EA 2EPLX 1YA7O 4K1OA 5G55A 4OAUC 5GPGB 3FMSA 5LCWJ 3TJ6A 2A68F 3C3OA 5B3IA 3LKUA 3T6GB 3EU9A 5JLIA 3ZIMA 3F6QA 3R9MA 5ARFA 4N06A 4B6IA 1N11A 3GZSA 4FWVA 4JTDB 1UFBA 3N24A 3LY8A 3ASNC 1SMYF 3PRZA 2ZXOA 2UUHA 1S70B 2Q9CA 4BJTA 3PREA 4TXPA 2AWYA 4YVOA 3HRAA 2ETSA 4ZLCA 1MHQA 2PNOA 3NQPA 1NA0A 2QC9A 3PS6A 4BG0A 2J0WA 4HI8A 4MVMA 4APOA 3KAEA 2VQ2A 5BUZA 5BXOA 3V5XA 5G05J 2ZGGA 4J7TA 5KYUB 1OWPA 2IOLA 4U5GA 1A7DA 3RIPA 2GFHA 5DS6A 2YQYA 3U8PA 3ZIBA 2YNQA 2EINC 2H6GA 3APDA 3LUTB 5JVEA 3C98A 2LXLA 2VGYA 4J6IA 2H7VC 4AM9A 1O5HA 3EIJA 3HNKA 4UI9C 3VTXA 5KWDA 3TWSA 4NCQA 2V26A 2OKUA 4TXQA 4JZYA 5AENA 3PUJA 2AU5A 1NP7A 2ZPAA 3FXHA 2V0PA 4HOUA 5AIJA 1ZU4A 3ULQA 4GZ5A 4CGVA 1CGME 1HZ4A 4WJ0A 4I2ZA 3CKCA 5AC5A 3ZYKA 1EPUA 3D9JA 5EK0A 4WWOA 4XI0A 3DSSA 3R2PA 1H9GA 3AQCA 3EHNA 4GPKA 4E17A 1BR4A 1E96B 3NBNB 4PJMA 1LKXA 3IPMO 4CJOA 5CRUA 4GYOA 2D5RB 2ICWG 2OU6A 2CW0F 2RKKA 3B13A 1YYJA 3HNLA 2VSYA 3FTXA 3UXGA 5L0HA 2WXPA 4B8AA 4N3CA 3L0IA 2PF4E 1HW1A 1YCSB 2YKZA 3MYIA 1LI7A 1LD7A 5EDSA 3ZW3A 2LD6A 2FI7A 4IYPA 1OCRC 2VASA 2WXIA 3ZTZA 5HV9A 4NC3A 3L08A 3G2WA 3UINC 1ZW2A 3DJNB 4YJWA 2YEVA 4ER9A 3DBSA 3LY7A 2D4UA 4P9TA 1ZZPA 2OOCA 2IU1A 4E0IA 3CVYA 1M2VA 4BEPA 4IB4A 3I5PA 1FTSA 2IONA 1MMGA 4LDRA 3RW0A 4YL1A 2KC3A 1O5MA 1H2UA 5KYYB 2YLIA 3TWWA 3ZQVA 4A4AA 2NSZA 5M72A 1H6OA 4ULVA 2GDCA 3VM6A 4PS3A 4XEIG 4Q4ZF 4K5AB 3MKQA 5JHBA 4JHRA 4O6YA 4XKBA 4XPYA 2EIKE 4JKVA 3UIOC 4U04A 5KYWB 3IQTA 1H2TC 1O87A 2YLDA 4DPRA 2VGEA 2WB2A 4M3OA 1DCEA 2HO1A 1OW8A 3RKOF 3KMIA 5F5FA 2KGOA 2CYDA 3CQZA 3ZNGA 3Q49B 4QI2A 4OINF 4OAVB 3ASFA 3V7OA 4R7LA 1U3CA 1NSGB 1QZXA 1N0QA 4ZFHA 4U63A 1YARO 1NFIE 2P9LG 3F47A 2I2OA 3NZUA 1PD1A 4J8YA 3L16A 3QARA 1FFHA 3G4XA 4U9DA 4MRUA 4IAQA 256BA 4ANUA 3A9CA 1XZPA 2P2CP 3M4BA 4NIKA 1T01A 2Y3HA 4QI0A 1MMDA 4Z68A 1E2XA 3WXXA 3FUNA 2M64A 3NG1A 3S90A 3EDTB 4WWPA 4W8KA 2VGXB 3GYZA 3C8GD 1JWGA 4Q7CA 2V5FA 3HNJA 3UUXA 4O6FA 3U3FA 3U2MA 2VSOE 1W2WA 3SQVA 2Y69C 3JYYA 4U0SA 1NG1A 3HJCA 2P9SG 3DRAA 1DC2A 5HRYA 1J8MF 3QTHA 5EYLA 4G8KA 4OIPF 4MTGA 4HOQA 2ILRA 3Q9UC 4C0MA 2KQ9A 1UOHA 3WODF 4AX2A 2LAHA 3S29A 4GZCA 4O60A 2H7BA 5FINA 2GROB 2GRLA 3PVLA 4MKTA 3TULA 3CVLA 3PZDA 2WMNA 1Q0DA 3L9TA 1OCOC 3SGHA 4ACLA 5EN5D 3C62A 3DPYA 4JEUA 1NFNA 1O1RA 2EIMC 2XENA 4DRIB 5DQZA 4W8PA 1C02A 2KZTA 3U9WA 4LCTA 2WQHA 4HFKB 3CR3A 3ZHEA 3EHMA 2M63A 2Y4TA 2GGFA 3I3NA 5ENRD 2YWAA 4JIOA 5L0IA 3T5XA 4HFGA 1AEPA 1K1AA 4CJGA 3GEHA 1NZNA 3O55A 4YVQC 3JTLO 4K5BA 3K9IA 4CIHA 3DEOA 3PE3A 4XI9A 2YL0A 3IHVA 4DVYP 1S63A 3H65A 4YWQA 3TOLA 4GZ6A 4G2VA 4L23A 3Q7FA 2X6HA 3RVYA 3ZQYA 2A0UA 2J9WA 5D2MC 5KJMA 3EHQA 2A69F 4EBBA 3ASNE 2EILE 2L6HA 2LIGA 2VCAA 1HMOA 1UW4B 4LLCA 1FFTC 2MOWA 2XRHA 2YL1A 1JAFA 1VK5A 5T4YA 1L5JA 2PFDA 3EG9A 1TYQG 2CG2A 2EILC 5FTPA 4HOSA 1HY5A 1KTMA 2X6KA 1CGOA 3S7JA 1SZIA 1VMAA 1MNEA 2XLMA 4ONSA 1JPNA 2IXPA 4XTKA 4YT8A 1KT0A 3AS4A 3ULEG 2L6GA 1KPSB 2HR2A 3IHYA 3FUMA 2NC9A 3QC1A 4JXTA 1JWFA 2EPNA 2WM9A 4FHJA 5G05C 4XEKA 3U8VA 2B0JA 3FOOA 1FVFA 3B9QA 4KBQA 2C03A 2XL8A 2X6IA 2IFUA 1H2VC 1S0PA 4QFVA 3RU0A 1ZU5A 1S05A 1PCXA 3HXFA 1H6PA 1V55E 2VTBA 5G04C 1G5ZA 2WZFA 1QBQA 5JRAA 5DS5A 2R7RA 5JSLA 3UIPC 2H8AA 3RFYA 3UMHA 2OVBA 3T4RA 3MX3A 4EHPA 1MX6A 1IW7F 5ENTD 4GEHA 3PZ1A 2KYHA 2OEWA 1VLTA 3FU3A 2P58C 1INZA 4A1GA 3EUVA 4BX8A 2AXZA 2HMQA 4GTQA 3L1MA 3NF1A 3CEXA 1WG0A 3APCA 4MBGA 2AXVA 3EQLF 1QKRA 3FTVA 3JYSA 1ELRA 2BKGA 3ATPA 2MYOA 3CHQA 3W9FA 2IOQA 4LLEA 4HNAD 5COFA 1BBHA 3O48A 4OIOF 2WXFA 2EIJC 2IO2C 3VLFA 3E34A 2OJQA 2P9PG 4G8LA 4BX9A 5BXUA 1EA8A 2HUJA 1TFKB 1YYHA 2I9CA 1EDUA 3K1IC 3CZ6A 2Y3AA 3ZSUA 3OXGA 1OT8A 2J8WA 3GWLA 4JJGA 5ENPD 4GZ3A 4PK4A 3SXZA 4KZ0A 1D0YA 3FDQA 4PDXA 4DX7D 2WQ7A 4XPXA 2HV6A 4OIQF 2HKVA 4LERA 5HI7A 5JT4A 2P9KG 4J8EA 2WZLA 3U9MA 5JJ6A 4G23A 2DZNA 1O1TA 2BL2A 4YNDA 2QY9A 2MRIA 1SA4A 4HS2A 3OEOA 3IEEA 2I1JA 5FZSA 3FUKA 4U0UA 1A0BA 4L2LA 1R4TA 1T5OA 2DBAA 4L2YA 1E8WA 4XWJA 3H2UA 1MZCA 3LCAA 3NAWA 1TR4A 1NL4A 3QWPA 5A7DB 4CDNA 3G2UA 3LJ3A 4KYOB 2VH3A 4U0ZA 3RRNB 4HLLA 5FQ7A 1VYIA 5AQ9A 2EIKC 4BPMA 4ILGA 1K04A 2CDQA 2KW3C 1N4QA 1LD8A 1VTMP 3NDBB 3HTKC 2PM7A 3DPDA 4W9RA 2QTVA 3GM2A 5G04J 4WNEA 3QZCA 1OWLA 2Y39A 3AJMA 3IEGA 2YL7A 4HEAJ 2G62A 2VCBA 3C7JA 3NYLA 3ABKE 2Q3TA 4H4KC 3QVYA 5CEDB 1Z5SC 3K7DA 4GMLA 2A6HF 2V8SE 4AL1A 3KS2A 4CDYA 4AY5A 1YJGA 1XNFA 3UMVA 3S7BA 4C48B 4OVVA 2F0YA 4I3MA 1ZYRF 4GTVA 1B89A 5J90A 4IGGA 3Q6NA 1HW2A 4HFFB 1OCRE 4WNFA 2PP4A 4MVOA 4U5DE 4BFRA 4XX5A 3FEXA 4HLEA 3L13A 3EGDA 3TXNA 3UNGC 2BF0X 3PEUB 1SYQA 1WY6A 4LNBA 3VTYA 3AU5A 3B7TA 1ORYA 4NACA 5DQTA 1FPPA 1K05A 3NZSA 2WVQA 4TV3A 2XQ0A 4ILIA 1Q0GA 5L3VA 3TK0A 1HO8A 5AQBA 3FUJA 2IXOA 3RH3A 3QK0A 2JABA 1KZPA 2LFFA 2LSUA 2JEKA 2QZAA 3BU8A 3KEZA 2R7XA 4XLNF 4R32A 4BESA 1LS1A 4XZ4A 2ETCA 4DBRA 4MW8A 1OWMA 3HIZA 4DLOA 5FZTA 2YINA 3B29A 5L0JA 2WZGA 2OEXA 4DRJB 5LCWC 2GA0A 2WXNA 1NFOA 3U4TA 2HJ3A 4DLQA 3Q9NC 4I9EA 3WAQA 2PZIA 3U9JA 4CT0A 1TWHA 3PMRA 1X81A 3FTUA 4M63A 3C8ZA 2IM8A 3G2SA 4NURA 3TAXA 4B0ZA 4F1SA 3PHF2 3C5RA 1UN8A 4N2QA 1RJ9B 2BKKB 1SF8A 4AK9A 5CCMA 3GORA 1Z3IX 2C0MA 3FU6A 5FJYA 3ENEA 3TG4A 2WL8A 2AVKA 4FLBA 5BV1A 4JCHA 3O4ZA 3BEEA 4CX9A 1X5BA 3KL4A 3AG3C 1TNOA 4C3BA 1TWGA 3LEVA 1SZAA 5JMND 1JMWA 1OKKD 1JUQA 1RMVA 4H54A 3J5PA 4H7YA 2YHEA 1TN6A 3ULYA 1S64A 4N5QA 2XGSA 2CFUA 1KNYA 3W4YA 3EFOA 3S0XA 1OCCC 1BI8B 4E18A 4HE8D 3HVEB 4Q96A 3FULA 2CGEA 4XIFA 2R7SA 2J4BA 1I5NA 2WXOA 1VDYA 4DJAA 5A69A 4FJYA 1EQ1A 3JSZA 3EHRA 3SNXA 3KYIA 1ZVZA 1BR2A 2Q9BA 2LCHA 4TUMA 4MVUA 2P7VA 2L0IA 3NOCD 4UUCA 2R5SA 3HDXA 3AOUA 3HNIA 2C2LA 1BI7B 1Y6DA 3VF0A 3JQ0A 3PCVA 3CVWA 4A3VA 3TJPA 3EH2A 4DRXE 3E37A 1EI7A 4JB8P 4OIRF 5AQ7A 3AG4E 3RQGA 4CRWA 3ZRHA 3PH0C 4NQFA 4PJJA 3GODA 3V2OA 3IKOB 1F1MA 4GTMA 3B71A 2Y69E 1RKEA 4C3DA 4AV7A 4C7OA 2KCLA 3LPZA 4FP7A 4U8HA 1N94A 1YYXA 1NU9C 1YLMA 1FT2A 5B3SC 4IRUA 5ENSD 4AEZC 1A41A 4J8FA 5C2YA 3LVQE 5AGFA 2DIWA 1E8ZA 1L3PA 2G3VA 2OG2A 2J46A 5BQGA 3RO3A 4IN3B 1PD0A 3DWLG 4GA0A 3FUEA 3K1HA 4WNDA 1FMVA 4MS2A 4Q94A 2J9UA 3ASDA 3ZKJA 1ORSC 1U89A 2QYJA 4EECA 2IJGX 5DVWA 1HXIA 5KJKA 3V31A 4PFOA 4JHJA 3X1OA 5CBOA 4MQ9F 2XXAB 3CVQA 2L6BA 3D9NA 1VOMA 3ZWIA 4A3TA 4LSZE 4HRMB 2R02A 3DM9B 2ZXPA 3CVPA 1D1CA 3V79K 3TWQA 4K5CA 4HBDA 3TQOA 1KZOA 2V4LA 3OA1A 2ZXWC 3ABLC 1HF8A 1IQRA 2L6JA 4YT5A 3SNHA 5BW8C 3LS1A 4CIPA 4J8DA 2QY7A 2ZD9A 1ZB1A 1DOVA 2WXKA 4XKCA 4G1TA 4H7XA 4LUNU 4RVBA 1JCQA 2PQNA 3KSLA 4BJ5C 3GZ1A 4KMOA 1D8DA 4DX5D 5L3QA 4HOTA 1D1AA 3UR3C 5KYUA 1LE4A 5EHHA 4TRQA 4E7SA 3NMIA 2IBFA 4Q69A 2AXUA 1OCCE 4BSZB 2PX3A 2TMVP 3UT4A 3DI5A 3AG2C 3LAYA 4PFPA 1N95A 1N54A 1RKEB 1G4WR 1E90A 3JZ0A 1TJCA 3RK6A 5BPPA 4EBAG 4EZLA 1WM5A 4KNWA 1Q0MA 5T1DB 4DOZA 1D8EA 5E2QA 4L1BA 4ZHBA 2RG8A 5AYWD 1Z3XA 2IQCA 1SQMA 3SBTB 4AE4B 1RCPA 5A23A 1H9TA 3D9KA 1N1CA 5COMA 1UN9A 3DM5A 4UI9J 2J07A 3SFZA 2FGYA 2LSEA 3NB2A 3UM3A 2A0BA 1AVOB 2XLEA 4U8VD 5EGYA 2PL2A 4EBJA 2I8BA 1E8XA 4EPZA 1N4RA 4YL0A 2F8XK 4UDVA 1TNBA 3LESA 5BUOA 2L9BA 4CYMD 4DBQA 1HG2A 5BQIA 2R7OA 2LK4A 4K0RA 4CS8C 3DE9A 4F3VA 2WPVA 4KVOA 3AS8A 3AQBA 2BTDA 4ACKA 3FOPA 3E4BA 3K33A 3PNTB 2YL3A 2UY1A 1V54C 4WWNA 5EX0A 3JXJA 2ZGDA 1KU2A 2Y3GA 3LEOA 4L7TA 5KYNA 2XLVA 3TWUA 4N4WA 3LXUX 3KD7A 2HSQA 2KCKA 3KPHA 4RD9A 4RDAA 1EKYA 3CK8A 3LS8A 4U5EE 2DWZA 4APFA 1U0BB 5TJ5E 1ELWA 3QMKA 1FR0A 1M56C 5T3RA 4P9FA 1SW6A 4A63B 1FAPB 3TWXA 3DXKG 3FDHA 3FFLA 2HV7A 4OYSA 1WTYA 4GZDA 2X6FA 3ONLA 1Z6TA 3N0TA 4J30B 4F4BA 3GZ2A 2GRMA 1NI1A 3C3QA 3AG1E 1M2VB 5BV0A 2UWJG 4BJ6A 4CDAA 4BEJA 1JCSA 1ZBPA 2PBEA 3SI5A 4EBKA 2IY0C 2NPUA 4EIYA 4DX6D 2DYRE 4E85A 4KVMA 4EQFA 2HMZA 1LI5A 2J9VA 1RZ4A 3JQ1A 3V5ZA 2RSEB 4DRHB 1LPEA 4L6RA 4ANJA 3UI2A 2LAIA 1GQAA 4NTBA 5EIDA 5KJNA 3AG3E 1ZHWA 1MMNA 4GQHA 3ZYQA 1E86A 4HI9A 2J0XA 3HYMB 3Q7GA 1JR8A 1PY1A 3QB2A 2F37A 2GRPB 5L0FA 4JTAB 4U7EB 4XEFA 5E3CA 5FIOA 4WGZA 2KM4A 3T8MA 2NG1A 3SFXA 3EGDB 2VSNA 3DJUB 2P9IG 4B93B 4C0EA 1LVKA 3ML9A 2X51A 1Z3YA 3CSKA 2LNIA 1OY3D 2JLBA 3LY9A 3LEWA 2BC5A 3FHEA 2A6EF 4G24A 2UY1B 5IY5C 3U3BA 4AL0A 5CIVA 2A5EA 5D66A 4FA6A 3RSEG 4KBLA 2O9XA 4LDQA 2YVKA 3BUAA 4CDMA 4PS7A 3TG5A 2DCPA 1ST6A 4ILHB 3HLZA 1AWCB 1GW6A 1OXKA 1LM3B 2LQGA 2RD9A 1EF1C 1UJKA 3FH8A 3RO2A 1LS4A 1RW2A 2J4DA 4C9BB 1AUEA 4AVXA 2AWIA 2F8YA 3DSUA 3IQ6A 1D0ZA 4YK5A 5E33A 2LP4A 3Q4AB 3OTNA 1TJFA 3Q5MA 1Z63A 5AJLA 4CT4A 1MX4A 2XGOA 5E3AA 2UUIA 3IQ5A 4C3EA 1T9KA 1WASA 3DE8A 1HE8A 5AJDA 3UGPA 4CGWA 5KYXA 1MNDA 2GRNB 5FZQA 4DX1A 5EIBE 2EPKX 3BG0B 4IAOA 2IXNA 2E0IA 3SXYA 4YDWA 3E9VA 4P6IC 3X2QE 3L8IA 1APCA 1RKCA 3CVNA 4XLPF 1U6HA 4L9PA 5FT9A 4BT8A 4I9CA 4A55A 3L34A 1OWOA 4N3BA 4B94A 2XZTG 3L22A 4BTBA 4DUIA 4UQYA 4NQ0A 4TXRA 4AOFA 1JOGA 4YN0B 3ASGA 3T6BA 3KEAA 5CERB 3L8JA 2RD0A 2Q00A 4JE9A 2XEVA 5ANRA 1LE2A 1U3DA 3HKKA 4I6EA 3ECSA 1NA3A 5JS5A 2B0HA 2Y3DA 3ZN3A 2NXPA 3H2VA 3SZRA 4KXKB 4GTRA 3DSXA 4BJ6C 2R59A 2DYSE 4CDRA 4I44A 4OVUA 1W3BA 1YAUO 1U2VG 2KJGA 3RRMB 2HFIA 3CSTA 2Q7RA 3FTWA 3G50A 3B0VC 4J8SA 1Y6IA 5B1AE 5B1AC 2DGJA 4YL3A 1C03A 3CAXA 4BJ5A 3FHDA 2J9BA 3D9PA 3KKBA 4K03A 4LEUA 3AGTA 2EQXA 1IYGA 1N9AA 4UWFA 5FCLA 4N2SA 3B95A 1MQSA 3FTZA 1YZCA 1N4SA 4Z9IA 3EIQC 4ATGA 3GEEA 3QWWA 5EKQD 2VCCA 2QNLA 4GYYA 3RRUA 4LRZA 3D9MA 2L9JA 5FQ6A 1GGQA 5B1BC 3ZGQA 4HQDA 2QLAA 4UWKA 3LLKA 1CPQA 1XZQA 1OW6A 3LLIA 2R7UA 4FULA 4WUYA 3DD7A 2EIJE 2OQMA 3S84A 5HS0A 4DK5A 4ATZD 1ELKA 3CGHA 1OR3A 3UTMA 4V3IA 1UG7A 2XEEA 3DZAA 3J06A 5T3TA 3UKRG 5KNHD 3ZHEB 1H7IA 1MQVA 3HHMA 4O79A 3AS5A 1TWAA 1MYOA 1AP7A 2XZDG 3FP3A 2FEZA 1O3UA 2ASRA 3EH1A 4ANWA 4JL0A 1OXJA 1NLXA 5JHAA 2XLHA 3SO8A 3DAFA 4LNGA 5KJLA 3SHFA 1G4US 4IWBA 4KC9A 1YMPA 3RIBA 2LXMA 3JRMO 3LYAA 3SFYA 5BNWA 2GAQA 2VC9A 1L7CA 3JUIA 4GAAA 1QNFA 3CVUA 2WXGA 2WXMA 3DWWA 5KYYA 3ML8A 4K7BA 1QPUA 3VLEA 2R9RB 4C7OB 3Q79A 2EPOA 4U95D 4EKWA 4MW3A 4X0RA 3GM3A 3FY4A 2YRFA 5J08A 3B7BA 2MHKA 3ZXPA 3SXKA 2HZ8A 5D91A 1DNPA 3CIAA 4MLPA 3E32A 2XS1A 3FU5A 2FF4A 4U5BE 2VGXA 3EGXA 3FAPB 1OQCA 2HS5A 4G78A 4CDVA 4JHKA 5CBNA 2KZTB 4MS6A 5KNGA 3MYFA 4I6JA 3U2LA 1H6GA 5KBAA 3US6A 1NU7D 3JRTA 4HXIA 3SP1A 3POVA 3UM1A 1T6UA 3PUKA 4MNDA 2PX0A 3CHSA 5FQ4A 2FULA 2AW6A 2QUPA 1T6IA 3RQEA 3FU0A 3UKUG 4AY6A 5HQ8A 3IBEA 3FUDA 1HH8A 2NUPA 2QYUA 3U5SA 1Q0KA 2HE0A 3ASHA 4I2WA 1I4YA 5LFAA 3WG7C 4GMJA 3UMKA 4ANXA 3U3WA 4CS9C 2FO7A 1WOLA 2XPYA 3AG2E 2XCBA 5F5HA 3Q15A 4X8QA 4EHMA 5FZRA 3RVZA 3QJZA 4FESA 4GMRA 3LJNA 2CCYA 3MV3B 5LX8A 1OKKA 1OR2A 2OVFA 3G4ZA 1GM5A 2FO1E 1T6QA 1VLSA 4JA7A 2J7PD 3VLDA 3CVXA 3FH5A 1RJ9A 4N39A 3FUHA 3MYVA 3M1CB 3JSEO 1IHBA 2IYLD 4HRNA 3IHUA 3LDZA 2KK1A 3QDNA 5BT1A 3URZA 5CEAA 1BDJB 3Q7AA 1S7ZA 4B8CB 2VSXE 1HMDA 4MVRA 4Y6WA 5LP0A 1WGWA 4UWHA 3HXEA 2RFMA 4J0UA 1ZHTA 3MJWA 4GA1A 3EFOB 5JA4D 3A11A 1N4PA 2HYZA 4MVQA 2X0CA 1GS9A 4CZ2D 3FAJA 4LNUD 3RQFA 5ENOD 3EPVA 5A6BD 5F28E 1JRAA 3MBGA 5E75A 4NTAA 4N5CA 4KT6B 4CS8A 2VYIA 2JX0A 2A4ZA 2Q4FA 5H7PA 3MFNA 2X6JA 1OXBA 4EZKA 1TNZA 3HXDA 4RQIA 1M6TA 5L0GA 4GU5A 3AJIA 5C1DA 4ZLDA 2XM0A 3B7SA 1O1SA 1NBBA 2CHZA 5AQAA 1BZ4A 5AARA 3HG0D 5EYPF 2Y0BG 2KNHA 4CBEA 4BERA 5EX3A 3PZ4A 4UWGA 3VAYA 4ABNA 2B0OE 3I5QA 3IQCA 2V3CC 1ORJA 3LS0A 3UM0A 3NRHA 1Y8MA 3NMKA 1BR1A 2P0NA 1HS6A 4XE0A 5BQHA 2HSBA 3D9OA 3W9GA 4Z9JA 4AJWA 5K0IA 1HG5A 2JD3A 1HU3A 4FJZA 2L0TB 2CG3A 4GTOA 4FX5A 1E7VA 4LDKA 1PV3A 4GB9A 1FT1A 1E8YA 2DZOA 3RJVA 1OWNA 1YA0A 1ZHZA 4N6HA 1JPJA 4E7ZA 1YDIA 4GA2A 4Z9HA 1A17A 3L17A 4U8YD 3U64A 1M2OA 1SVXA 5D92A 2DYRC 3TWVA 3ASOC 3DXMG 3UQ3A 3HXCA 3TOMA 4F1PA 4PJNA 1B68A 1ZW3A 1D0XA 3EJNA 2CFZA 3MKQB 4JCZA 5L0CA 2LO6A 3K1IA 3Q47B 1YZAA 1TWCA 2XXAA 5ITZF 1N0RA 2IF4A 2Y3BA 4PUCA 4U5CE 4CSAC 3QW0A 4AXHA 1SR2A 4RSYA 2R03A 3PZ2A 2FAPB 3PE4A 5JJ7A 1WWPA 2L6FA 4HRLA 3L82A 4JPSA 3NYMA 3ZYLA 2W9YA 5T3WA 2R05A 3CQGB 3S7FA 1VYKA 3LNMB 3QW1A 4JW1A 2RFAA 2KSFA 3BRJA 2OJED 3W2WA 1QYMA 2J49A 4JVSA 4ULWA 4A1SA 2P1AA 3QKYA 5L0DA 1IZMA 2DI3A 4EUKB 2BUGA 4YDYA 3SY2A 2J9QA 3ZG1A 5A6BA 3CK7A 3ZYMA 5ARGA 1V54E 3MV2B 4DJ9A 3R9AB 2FFHA 2A5UA 4JZAA 2XL6A 3SBSA 1P5QA 4M7CA 3KH2A 3ZUVB 3LNRA 2KCVA 3Q7LA 2GRQB 3W8IA 2XPIA 5CRVA 2A1DD 3V30A 3PDNA 4BEMJ 4D4NA 3I4RB 1WAO1 5KYXB 3C18A 3DAGA 3DXJF 1IXVA 2P6VA 4RBNA 2WVIA 3E33A 4I6GA 4URKA 5A6CA 3JCUQ 2YHCA 2XRYA 5CCLA 2OEVA 2H6HA 3MLGA 3TXMA 4DI4A 3DSTA 1CGNA 3M4CA 5E76A 1K1BA 1HX8A 3G2VA 4OD5A 4FAPB 2EINE 4BY6A 2IOSA 4OD4A 4UI9K 4PACA 3T5VA 3EZHA 3JYHA 5D0QD 2WVNA 2WXQA 2Y1LE 4IJJA 1KT1A 2WMOA 3S7DA 3R7RA 1E83A 3CHPA 3K6BA 3ASOE 3B0PA 1UJJA 1K8KG 3WHNA 4G25A 3MGBA 3UT8A 4KNVA 4CSAA 1Q2ZA 3N71A 1QSPA 4I43A 3M79A 4JEBA 3DMDA 2XPZA 3QOUA 4JC7A 3CLJA 2H6IA 3V5YA 1SZ9A 3R7CA 4BWRA 3RYLA 2M4EA 4WNGA 1MJ0A 2CNWA 3JT1A 3MCXA 3RAUA 2BEDA 3RKVA 2F22A 3NKEA 1A7EA 4J7YA 3CQCB 3GW4A 2R7QA 3UM2A 2XS8A 3ZU7B 2R7VA 1KLXA 2ZXWE 2DB4A 3ABLE 5DLJA 3MA5A 3UMIA 2EPMX 2KBXA 2GWWA 1ZHXA 3S27A 3TJ5A 1ZHYA 3DSVA 4PS8A 2IO3C 3SF4A 2VTBB 4JA9A 1LTXA 4G26A 3FVYA 3GM1A 2AJAA 1BU9A 2MHRA 3T9KA 1HFAA 5LOZA
chains in the Genus database with same CATH topology
5FWQA 1Z6AA 5DBKA 3SZ7A 2NUPB 2I6HA 1H6KA 3R7QA 3D3MA 2NUTA 2X38A 4EZJA 4FLHA 4BTAA 1E7UA 1PAQA 3W2VA 2J08A 4ANVA 5ANLA 4DVZA 4QDLA 4HVBA 2KATA 4K0DA 3FTYA 3NKDA 3ZVRA 2QFCA 3QWVA 2R7WA 3AU4A 2OOEA 1N52A 3L54A 1J8YF 4B89A 1TR2A 2XSEA 3QAQA 1FMWA 3HVEA 2J7PA 3OWTA 3S2AA 3MEKA 4G7HF 3SYNA 3FEYA 3AG4C 4JC8A 4KZCA 3BG1B 3X2QC 3B7UX 3PNLB 4NRHB 2OCCC 3L6AA 3MZLB 4UQZA 5T8IA 5DS4A 2Y4UA 3QNKA 3UX4A 4O6MA 4J32B 4CS7A 4EWCA 4U5HA 1H19A 3ITFA 4D10C 3UPVA 4AIFA 1QQEA 2W45A 5CMYA 5JJTA 5HSWA 1FCHA 1M57C 2NUTB 2R17C 1V55C 2YQ8A 2MWQA 3UT7A 4E6HA 2CNWD 3I4GA 2Z15A 3ESKA 4IULA 5ENNA 3SD5A 3Q6MA 1DVPA 1Z5ZA 4U5FE 3W8HA 2VB6A 4YT2A 3TGOA 4G7ZF 4AP2A 4I1OB 4JURI 4G11A 4U07A 3OXFA 1UG3A 3VYWA 2CHWA 4A2NB 4Q5SF 3CVVA 3I4UA 2YHSA 2C0LA 5CMWA 1QZ2A 3CHOA 1OCZC 5G2NA 4HORA 2ONDA 2PQRA 4UWLA 3S28A 3K66A 2ZXRA 3GANA 2DYSC 1NZEA 3UGOA 1XGWA 4Y6CA 3AG1C 2VJ8A 4G0HA 1EYHA 3FUIA 2OV8A 3ZVVA 4UQXA 1ZU2A 3FTSA 5KYWA 4GCNA 1JPLA 4GYWA 4I1AA 5CI8A 2E2EA 3FH7A 4PJLA 2I1KA 3F46A 4YT4A 2CHXA 2Q7FA 4RG9A 3D9LA 2YZSA 4KI2A 4N3AA 3CEQA 4P29A 2WXHA 4EBAA 3CHMA 3ABKC 3ZPJA 3T6JA 3APFA 4F53A 4ME2A 5FQ8A 3TD7A 1PC2A 3ZFWA 3ABMC 2X3MA 2J09A 2E87A 2WXRA 2R7TA 3CK9A 4AE4A 3P2BA 2W4BA 2WB7A 3FWVA 3OAWA 4TUUA 4CCAA 1G8XA 4FC8A 1BPOA 1D1BA 2MYSA 1Z23A 3OXLA 4FU3A 3O39A 1MMAA 3JCKC 2IXMA 1FVHA 2KC7A 5DIZA 3ESLA 3B0UX 5CHEE 1IHGA 3CHRA 4LACB 4CS9A 2XGMA 4CEMA 3EZIA 3G2TA 4PH4B 3ONKA 4O7GA 2L81A 1H0AA 3E70C 4BJ1A 1QLEC 3SEOA 2J45A 2GW1A 3EGXB 2WQ6A 1TKNA 2G3KA 4JEHA 4GCOA 3CSFA 4BT9A 5CI9A 4NY3A 4O6NA 2LSVA 4WAFA 2XRZA 5D0OD 2XL4A 4JJFA 2ZU6B 3ZEFA 4GYTA 3IV0A 5KCMA 3CV0A 3LVRE 3LJBA 1IQUA 3ZXSA 3B7RL 2WVOA 2WXJA 3ZC4A 2PM6A 4I1MA 2HM8A 3PEVB 3O6XA 2FBNA 3EG9B 1TEZA 3P1UA 2BE5F 2AVPA 3N2ZB 4F7AA 3NYJA 2H7OA 4FHKA 4DI3A 4G7OF 4BSXA 3FUFA 2WXLA 3TL5A 1LF8A 3D9IA 2XCCA 3MKRA 4FADA 2W4MA 4RG6A 1OUVA 4I17A 3CKBA 3U66A 2Q9AA 2XHEA 2C04A 5G55A 5LCWJ 2A68F 3LKUA 3ZIMA 5ARFA 4N06A 4B6IA 3GZSA 4FWVA 3N24A 3LY8A 3ASNC 1SMYF 3PRZA 2ZXOA 2Q9CA 4BJTA 3PREA 4YVOA 4ZLCA 1MHQA 3NQPA 1NA0A 3PS6A 4BG0A 2J0WA 4APOA 3KAEA 2VQ2A 5BUZA 5G05J 5KYUB 1OWPA 2IOLA 4U5GA 3RIPA 2GFHA 5DS6A 3ZIBA 2YNQA 2EINC 3APDA 3C98A 2VGYA 4J6IA 2H7VC 4AM9A 1O5HA 3EIJA 4UI9C 3VTXA 2V26A 5AENA 4JZYA 3PUJA 1NP7A 2ZPAA 2V0PA 4HOUA 5AIJA 1ZU4A 3ULQA 4GZ5A 4CGVA 1HZ4A 4WJ0A 4I2ZA 3CKCA 3ZYKA 1EPUA 3D9JA 4WWOA 4XI0A 3AQCA 3EHNA 4GPKA 1BR4A 1E96B 4PJMA 1LKXA 4GYOA 2D5RB 2CW0F 3B13A 2VSYA 3FTXA 2WXPA 4B8AA 4N3CA 3L0IA 2PF4E 5EDSA 3ZW3A 2FI7A 4IYPA 1OCRC 2VASA 2WXIA 3L08A 3G2WA 3DJNB 4YJWA 2YEVA 3LY7A 3DBSA 2IU1A 3CVYA 1M2VA 3I5PA 1FTSA 2IONA 1MMGA 1H2UA 5KYYB 2NSZA 5M72A 4PS3A 4Q4ZF 3MKQA 5JHBA 4JHRA 4O6YA 4XKBA 4U04A 5KYWB 1H2TC 1O87A 4DPRA 2WB2A 4M3OA 2HO1A 3RKOF 5F5FA 3KMIA 2KGOA 3CQZA 3Q49B 4QI2A 4OINF 3ASFA 3V7OA 4R7LA 1U3CA 1QZXA 4U63A 3F47A 2I2OA 3NZUA 1PD1A 3L16A 3QARA 1FFHA 4MRUA 4ANUA 2Y3HA 4QI0A 1MMDA 3WXXA 3FUNA 3EDTB 3NG1A 4WWPA 4W8KA 2VGXB 3GYZA 1JWGA 4Q7CA 2V5FA 3UUXA 4O6FA 2VSOE 1W2WA 2Y69C 4U0SA 1NG1A 3HJCA 1J8MF 4OIPF 4HOQA 2ILRA 4C0MA 2KQ9A 3WODF 4AX2A 2LAHA 3S29A 4GZCA 2H7BA 2GRLA 3PVLA 4MKTA 3CVLA 3PZDA 2WMNA 1OCOC 3SGHA 4ACLA 4JEUA 2EIMC 5DQZA 2KZTA 3U9WA 4LCTA 2WQHA 4HFKB 3CR3A 3ZHEA 3EHMA 2M63A 2Y4TA 2GGFA 3I3NA 3T5XA 4HFGA 1NZNA 4YVQC 3K9IA 4CIHA 3PE3A 4XI9A 3IHVA 4DVYP 3H65A 4YWQA 4GZ6A 4G2VA 4L23A 2X6HA 2J9WA 5KJMA 2A69F 4EBBA 4LLCA 1UW4B 1FFTC 2MOWA 2XRHA 1VK5A 5T4YA 1L5JA 2PFDA 3EG9A 2CG2A 2EILC 5FTPA 4HOSA 2X6KA 3S7JA 1SZIA 1VMAA 1MNEA 1JPNA 2IXPA 4XTKA 4YT8A 1KT0A 3AS4A 2HR2A 3IHYA 3FUMA 2NC9A 3QC1A 4JXTA 1JWFA 4FHJA 2WM9A 5G05C 2B0JA 1FVFA 3B9QA 4KBQA 2C03A 2X6IA 2IFUA 1H2VC 1S0PA 4QFVA 3RU0A 1ZU5A 1PCXA 2VTBA 5G04C 2WZFA 5DS5A 2R7RA 3UMHA 3RFYA 2OVBA 3T4RA 3MX3A 1IW7F 4GEHA 3FU3A 2P58C 1INZA 4A1GA 4BX8A 2AXZA 3NF1A 3APCA 2AXVA 3EQLF 3FTVA 3JYSA 1ELRA 3CHQA 2IOQA 4LLEA 3O48A 4OIOF 2WXFA 2EIJC 3VLFA 4BX9A 2I9CA 1EDUA 3K1IC 3CZ6A 2Y3AA 3ZSUA 3OXGA 4JJGA 4GZ3A 4PK4A 4KZ0A 1D0YA 3FDQA 4PDXA 2WQ7A 4OIQF 2HV6A 4LERA 5HI7A 4J8EA 2WZLA 5JJ6A 4G23A 4YNDA 2QY9A 2MRIA 4HS2A 3OEOA 3IEEA 2I1JA 5FZSA 3FUKA 4U0UA 4L2LA 2DBAA 4L2YA 1E8WA 4XWJA 3LCAA 3QWPA 5A7DB 4CDNA 3G2UA 3LJ3A 4KYOB 2VH3A 4U0ZA 3RRNB 5FQ7A 1VYIA 2EIKC 4ILGA 2CDQA 2KW3C 3NDBB 4W9RA 3HTKC 2PM7A 3DPDA 2QTVA 5G04J 4WNEA 3QZCA 2Y39A 1OWLA 3IEGA 4HEAJ 2G62A 3NYLA 2Q3TA 4H4KC 3K7DA 4GMLA 2A6HF 2V8SE 3KS2A 4AY5A 1XNFA 3UMVA 3S7BA 4OVVA 4I3MA 1ZYRF 1B89A 5J90A 3Q6NA 4HFFB 4WNFA 2PP4A 4U5DE 4BFRA 4XX5A 3FEXA 4HLEA 3L13A 3EGDA 3TXNA 3UNGC 2BF0X 3PEUB 1WY6A 3VTYA 3AU5A 3B7TA 4NACA 5DQTA 3NZSA 2WVQA 4TV3A 2XQ0A 4ILIA 5L3VA 1HO8A 3FUJA 2IXOA 3RH3A 3QK0A 2LSUA 2JEKA 3KEZA 2R7XA 4XLNF 1LS1A 4XZ4A 4DBRA 1OWMA 3HIZA 4DLOA 2YINA 2WZGA 5LCWC 2WXNA 3U4TA 4DLQA 4I9EA 2PZIA 4CT0A 1TWHA 3PMRA 3FTUA 4M63A 4NURA 3TAXA 3G2SA 4B0ZA 4F1SA 3PHF2 4N2QA 1UN8A 1RJ9B 1SF8A 4AK9A 5CCMA 1Z3IX 2C0MA 3FU6A 5FJYA 3ENEA 3TG4A 2WL8A 4FLBA 5BV1A 4JCHA 3O4ZA 3BEEA 1X5BA 3KL4A 3AG3C 4C3BA 1TWGA 3LEVA 1SZAA 1OKKD 1JUQA 4H7YA 2YHEA 2XGSA 2CFUA 3EFOA 3S0XA 1OCCC 3HVEB 4HE8D 4Q96A 3FULA 2CGEA 4XIFA 2R7SA 2J4BA 2WXOA 1VDYA 4DJAA 4FJYA 3JSZA 3SNXA 1BR2A 2Q9BA 2P7VA 2L0IA 2R5SA 3HDXA 2C2LA 3JQ0A 3CVWA 4A3VA 3TJPA 3EH2A 4OIRF 4CRWA 3ZRHA 3PH0C 4PJJA 3GODA 3IKOB 4C3DA 4AV7A 4C7OA 2KCLA 3LPZA 4FP7A 4U8HA 1NU9C 5B3SC 4IRUA 4AEZC 4J8FA 5C2YA 3LVQE 2DIWA 1E8ZA 2G3VA 2OG2A 2J46A 3RO3A 4IN3B 1PD0A 4GA0A 3FUEA 3K1HA 4WNDA 1FMVA 4Q94A 2J9UA 3ASDA 4EECA 2IJGX 5DVWA 1HXIA 5KJKA 4PFOA 4JHJA 3X1OA 4MQ9F 2XXAB 3CVQA 3D9NA 1VOMA 4A3TA 3DM9B 2ZXPA 3CVPA 1D1CA 2V4LA 5BW8C 3OA1A 2ZXWC 3ABLC 1HF8A 1IQRA 2L6JA 4YT5A 3SNHA 3LS1A 4J8DA 2QY7A 2WXKA 4XKCA 4G1TA 4H7XA 4LUNU 4RVBA 2PQNA 4BJ5C 3GZ1A 4KMOA 5L3QA 4HOTA 1D1AA 3UR3C 5KYUA 5EHHA 4TRQA 4E7SA 4Q69A 2AXUA 2PX3A 3UT4A 3LAYA 3AG2C 4PFPA 1N54A 1E90A 5BPPA 1TJCA 3RK6A 4EBAG 4EZLA 1WM5A 4KNWA 5T1DB 4DOZA 5E2QA 4L1BA 2RG8A 5AYWD 1Z3XA 2IQCA 1SQMA 3SBTB 4AE4B 5A23A 3D9KA 1N1CA 1UN9A 3DM5A 4UI9J 2J07A 3SFZA 2FGYA 2LSEA 5EGYA 2PL2A 2I8BA 1E8XA 4EPZA 3LESA 5BUOA 2L9BA 4DBQA 1HG2A 2R7OA 4K0RA 4CS8C 4F3VA 4KVOA 2WPVA 3AS8A 3AQBA 2BTDA 4ACKA 3E4BA 3K33A 3PNTB 2UY1A 1V54C 4WWNA 5EX0A 1KU2A 2Y3GA 4L7TA 5KYNA 3LXUX 3KD7A 2KCKA 4RD9A 4RDAA 3CK8A 3LS8A 4U5EE 4APFA 1ELWA 3QMKA 1M56C 5T3RA 3FDHA 3FFLA 2HV7A 4OYSA 4GZDA 2X6FA 3ONLA 1Z6TA 3N0TA 4J30B 4F4BA 3GZ2A 2GRMA 1M2VB 5BV0A 2UWJG 4BJ6A 4BEJA 1ZBPA 3SI5A 4E85A 4KVMA 4EQFA 2J9VA 3JQ1A 4ANJA 2LAIA 5KJNA 1ZHWA 1MMNA 3ZYQA 2J0XA 3HYMB 3Q7GA 1PY1A 3QB2A 5E3CA 2KM4A 3T8MA 2NG1A 3EGDB 2VSNA 3DJUB 4C0EA 1LVKA 3ML9A 2X51A 1Z3YA 3CSKA 2LNIA 2JLBA 3LY9A 3LEWA 3FHEA 2A6EF 4G24A 2UY1B 5IY5C 4FA6A 4KBLA 2O9XA 4CDMA 4PS7A 3TG5A 2DCPA 1ST6A 4ILHB 3HLZA 1GW6A 1EF1C 1UJKA 3FH8A 3RO2A 2J4DA 4C9BB 4AVXA 2AWIA 1D0ZA 5E33A 3Q4AB 3OTNA 1TJFA 3Q5MA 1Z63A 5AJLA 4CT4A 2XGOA 5E3AA 4C3EA 1HE8A 5AJDA 3UGPA 4CGWA 5KYXA 1MNDA 5FZQA 3BG0B 4IAOA 2IXNA 2E0IA 3E9VA 4P6IC 3CVNA 4XLPF 5FT9A 4BT8A 4I9CA 4A55A 3L34A 1OWOA 4N3BA 4B94A 3L22A 4BTBA 4UQYA 4NQ0A 4AOFA 4YN0B 3ASGA 3T6BA 2RD0A 2XEVA 5ANRA 1U3DA 4I6EA 3ECSA 1NA3A 2Y3DA 3ZN3A 2NXPA 3SZRA 4KXKB 4BJ6C 2R59A 4CDRA 4I44A 4OVUA 1W3BA 3RRMB 2KJGA 3CSTA 3FTWA 3B0VC 4J8SA 1Y6IA 5B1AC 2DGJA 4BJ5A 3FHDA 3D9PA 3KKBA 4K03A 4LEUA 2EQXA 1IYGA 4UWFA 5FCLA 4N2SA 1MQSA 3FTZA 3EIQC 4ATGA 3QWWA 5EKQD 4GYYA 3RRUA 4LRZA 3D9MA 2L9JA 5FQ6A 5B1BC 3ZGQA 4UWKA 3LLKA 3LLIA 2R7UA 4FULA 4WUYA 3DD7A 4DK5A 1ELKA 3CGHA 4V3IA 3DZAA 5T3TA 3ZHEB 3HHMA 4O79A 3AS5A 1TWAA 3FP3A 2FEZA 3EH1A 4ANWA 4JL0A 5JHAA 3DAFA 5KJLA 3SHFA 4IWBA 4KC9A 3RIBA 3LYAA 5BNWA 3JUIA 4GAAA 1QNFA 3CVUA 2WXGA 2WXMA 3ML8A 5KYYA 4K7BA 3VLEA 4C7OB 4X0RA 3FY4A 5J08A 2MHKA 5D91A 1DNPA 3CIAA 4MLPA 3FU5A 2FF4A 4U5BE 2VGXA 3EGXA 4JHKA 2KZTB 4MS6A 4I6JA 1NU7D 3JRTA 4HXIA 3SP1A 3POVA 3PUKA 4MNDA 2PX0A 3CHSA 5FQ4A 2FULA 2AW6A 4AY6A 3FU0A 5HQ8A 3IBEA 3FUDA 1HH8A 2NUPA 4I2WA 3ASHA 5LFAA 3WG7C 4GMJA 3UMKA 4ANXA 3U3WA 4CS9C 2FO7A 2XPYA 2XCBA 5F5HA 3Q15A 5FZRA 3QJZA 4FESA 3MV3B 5LX8A 1OKKA 2OVFA 4JA7A 3VLDA 2J7PD 3CVXA 3FH5A 1RJ9A 4N39A 3FUHA 3MYVA 3M1CB 2IYLD 3LDZA 3QDNA 5BT1A 3URZA 1S7ZA 4B8CB 2VSXE 4Y6WA 5LP0A 1WGWA 4UWHA 4J0UA 1ZHTA 3MJWA 4GA1A 3EFOB 2HYZA 3FAJA 3EPVA 5E75A 4N5CA 4KT6B 4CS8A 2VYIA 2A4ZA 2X6JA 4EZKA 4GU5A 5C1DA 4ZLDA 3B7SA 2CHZA 2KNHA 4CBEA 5EX3A 4UWGA 3VAYA 4ABNA 3I5QA 2V3CC 3LS0A 3NRHA 1Y8MA 1BR1A 1HS6A 4XE0A 3D9OA 4AJWA 1HG5A 2JD3A 1HU3A 4FJZA 2L0TB 2CG3A 4FX5A 1E7VA 4GB9A 1E8YA 3RJVA 1OWNA 1YA0A 1ZHZA 1JPJA 4E7ZA 4GA2A 1A17A 3L17A 3U64A 1M2OA 5D92A 2DYRC 3UQ3A 3ASOC 4PJNA 1D0XA 3EJNA 2CFZA 3MKQB 2LO6A 3Q47B 2XXAA 1TWCA 2IF4A 2Y3BA 4PUCA 4U5CE 4CSAC 4AXHA 4RSYA 3PE4A 5JJ7A 4JPSA 3NYMA 3ZYLA 2W9YA 5T3WA 3CQGB 3S7FA 1VYKA 4JW1A 3W2WA 2J49A 4JVSA 4ULWA 4A1SA 3QKYA 1IZMA 2BUGA 2J9QA 3ZG1A 3CK7A 3ZYMA 5ARGA 3MV2B 3R9AB 2FFHA 2A5UA 4JZAA 3SBSA 1P5QA 3KH2A 3LNRA 2KCVA 3Q7LA 3W8IA 2XPIA 2A1DD 3PDNA 3I4RB 1WAO1 5KYXB 3DAGA 3DXJF 2P6VA 4RBNA 2WVIA 4I6GA 4URKA 5A6CA 3JCUQ 2YHCA 2XRYA 5CCLA 3MLGA 3TXMA 4DI4A 5E76A 1HX8A 3G2VA 4OD5A 4BY6A 2IOSA 4OD4A 4UI9K 3T5VA 3EZHA 3JYHA 5D0QD 2WVNA 2WXQA 4IJJA 3S7DA 1KT1A 2WMOA 3R7RA 3CHPA 3K6BA 3B0PA 1UJJA 4G25A 3UT8A 3MGBA 4KNVA 4CSAA 3N71A 4I43A 3DMDA 2XPZA 3QOUA 3CLJA 1SZ9A 4BWRA 3RYLA 2M4EA 4WNGA 2CNWA 3JT1A 3MCXA 3RKVA 3NKEA 3GW4A 3CQCB 2R7QA 2R7VA 1KLXA 5DLJA 3MA5A 3UMIA 1ZHXA 3S27A 1ZHYA 4PS8A 3SF4A 2VTBB 4JA9A 4G26A 3FVYA 1HFAA 5LOZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I1M A;  4IRU A;  4JVS A;  4I1O B;  4JW1 A; 
#chains in the Genus database with same CATH topology
 4JTC B;  5FWQ A;  1Z6A A;  5DBK A;  3SZ7 A;  1V74 B;  1Z7Q c;  3KSQ A;  2NUP B;  2XLD A;  1H6K A;  2I6H A;  3R7Q A;  1TNY A;  3AAA C;  3D3M A;  3DKA A;  2NUT A;  2X38 A;  3TWT A;  4EZJ A;  4FLH A;  4BTA A;  1E7U A;  1PAQ A;  3W2V A;  1TN7 A;  3Q73 A;  2J08 A;  4ANV A;  4F6R D;  4DX2 A;  5ANL A;  4DVZ A;  4QDL A;  4HVB A;  2KAT A;  4LG6 A;  3GWN A;  4K0D A;  2KXP C;  3FTY A;  4YDO A;  3NKD A;  3ZVR A;  2QFC A;  3QWV A;  3T9O A;  3C72 A;  2R7W A;  3SXM A;  2OOE A;  1WDY A;  3AU4 A;  1N52 A;  1Q0F A;  3L54 A;  1J8Y F;  5JUA A;  4B89 A;  1TR2 A;  2XSE A;  3QAQ A;  4JEA A;  1FMW A;  3HVE A;  2J7P A;  3OWT A;  3S2A A;  3MEK A;  4G7H F;  3SYN A;  4MTO A;  1SA5 A;  3FEY A;  3AG4 C;  3KYJ A;  4JC8 A;  4KZC A;  1DCQ A;  3X2Q C;  3B7U X;  3BG1 B;  3PNL B;  4NRH B;  2LFD A;  2OCC C;  3L6A A;  3MZL B;  4UQZ A;  5T8I A;  5DS4 A;  2Y4U A;  3QNK A;  3UX4 A;  4GTS A;  4BET A;  4O6M A;  4J32 B;  4CS7 A;  2AP3 A;  4U5H A;  4EWC A;  1H19 A;  4YDE A;  3ITF A;  5A6A A;  2L7A A;  3M15 A;  5A6K A;  1V4A A;  4D10 C;  3Q78 A;  4D4X A;  3UPV A;  4GTP A;  4AIF A;  2NSG A;  5JP7 A;  1QQE A;  2W45 A;  1YVI A;  5CMY A;  5JJT A;  1K3Z D;  1R5I D;  5HSW A;  1DOW A;  3E30 A;  5A6J A;  1FCH A;  4N6C A;  1M57 C;  2NUT B;  2R17 C;  1V55 C;  2YQ8 A;  3C3R A;  2XLW A;  2MWQ A;  3UT7 A;  4E6H A;  2CNW D;  3I4G A;  2Z15 A;  3ESK A;  4IUL A;  5ENN A;  2QE9 A;  3SD5 A;  5COG A;  4MVS A;  3Q6M A;  1DVP A;  3Q75 A;  4XPW A;  1WN0 A;  3WG7 E;  3PDM P;  2P9U G;  1Z5Z A;  4U5F E;  4GPM A;  1IKN D;  4NTF A;  3U0C A;  3C8G A;  3J5Q B;  3W8H A;  2ZIR A;  2VB6 A;  1WAT A;  5B1B E;  4YT2 A;  1BD8 A;  3TGO A;  4G7Z F;  4AP2 A;  4I1O B;  4JUR I;  1G3N B;  1FNT c;  4G11 A;  2JPU A;  4U07 A;  3OXF A;  1LIH A;  1TN8 A;  1UG3 A;  3VYW A;  1XWJ A;  2CHW A;  3ABM E;  4A2N B;  4Q5S F;  3CVV A;  3I4U A;  2YHS A;  2C0L A;  5CMW A;  2V5Q C;  1QZ2 A;  1YA9 A;  3CHO A;  1OCZ C;  2NYJ A;  5G2N A;  4HOR A;  2OND A;  4WGY A;  2PQR A;  4UWL A;  4XEV A;  1QQ3 A;  3S28 A;  2ETA A;  5HKP A;  3K66 A;  2ZXR A;  3GAN A;  3EU5 A;  5AC4 A;  2DYS C;  4MVZ A;  4E0H A;  3ISM C;  1I4Z A;  3S9O A;  1NZE A;  3UGO A;  1XGW A;  2P9N G;  4Y6C A;  3AG1 C;  2VJ8 A;  4G0H A;  1EYH A;  3FUI A;  5CEC B;  5ENQ D;  2OV8 A;  3ZVV A;  4UQX A;  2HJM A;  1ZU2 A;  3PZ3 A;  3FTS A;  5KYW A;  4GCN A;  1JPL A;  4GYW A;  4I1A A;  5CI8 A;  3D9H A;  3O10 A;  3IXE A;  2E2E A;  3FH7 A;  1HE9 A;  1VB5 A;  4PJL A;  1OW7 A;  2I1K A;  1OCO E;  3F46 A;  4YT4 A;  2CHX A;  2Q7F A;  3C8G B;  3JXI A;  4QQI A;  3AGU A;  4RG9 A;  2OCC E;  1TFO B;  3D9L A;  2YZS A;  4KI2 A;  4N3A A;  3CEQ A;  4P29 A;  2WXH A;  2NSF A;  1HE1 A;  1OCZ E;  4EBA A;  3CHM A;  3ABK C;  3ZPJ A;  3T6J A;  4PR9 A;  3APF A;  4RLY A;  4F53 A;  4ME2 A;  3C63 A;  5FQ8 A;  2XM4 A;  3RF3 A;  2R2L A;  1Y4C A;  3TD7 A;  1PC2 A;  3ZFW A;  3ABM C;  2X3M A;  2V4H C;  2J09 A;  2E87 A;  2WXR A;  3JUE A;  2P61 A;  2R7T A;  3CK9 A;  2YLG A;  4AE4 A;  3P2B A;  2W4B A;  4O1P A;  4U9E A;  2WB7 A;  3FWV A;  1MX2 A;  3OAW A;  4TUU A;  1C17 M;  1G8X A;  4CCA A;  4FC8 A;  3V2X A;  1BPO A;  1D1B A;  2MYS A;  1Z23 A;  3OXL A;  4FU3 A;  2B6C A;  3O39 A;  1MMA A;  2DVW A;  3JCK C;  2IXM A;  1FVH A;  2KC7 A;  1RXQ A;  5DIZ A;  3ESL A;  3B0U X;  4XQ1 A;  5CHE E;  1IHG A;  5EIL A;  3CHR A;  4LAC B;  4CS9 A;  4GTT A;  2XEH A;  5AAO A;  2XGM A;  4CEM A;  3EZI A;  3G2T A;  4PH4 B;  1BLX B;  3ONK A;  2AWC A;  4O7G A;  4O1O A;  1QVX A;  2L81 A;  1H0A A;  3E70 C;  4BJ1 A;  1QLE C;  2ETB A;  1CPR A;  2ZIS A;  2EIM E;  3SEO A;  2J45 A;  2PNN A;  2GW1 A;  2H6F A;  3EGX B;  2WQ6 A;  1TNU A;  1TKN A;  2G3K A;  4JEH A;  4GCO A;  3HXB A;  3CSF A;  4BT9 A;  5CI9 A;  4NY3 A;  4O6N A;  2LSV A;  4WAF A;  2XRZ A;  5D0O D;  5AN8 A;  2XL4 A;  4JJF A;  2ZU6 B;  2XLO A;  3ZEF A;  4GYT A;  3IV0 A;  5KCM A;  4JRZ A;  3DEP A;  3CV0 A;  3LVR E;  3LJB A;  1IQU A;  1E85 A;  4HB5 A;  3ZXS A;  4MTF A;  3B7R L;  3BEH A;  4WAB A;  2IEJ A;  3ZTM A;  4DXW A;  4U96 D;  2WVO A;  2WXJ A;  2I15 A;  2J8S D;  3ZC4 A;  4IAR A;  2PM6 A;  4I1M A;  3BQO A;  2HM8 A;  3PEV B;  3O6X A;  2FBN A;  3EG9 B;  1TEZ A;  3VRC A;  3NOG D;  3P1U A;  2BE5 F;  1D9S A;  3NMJ A;  2AVP A;  3N2Z B;  4F7A A;  3ZDL A;  3GEI A;  3DSW A;  3NYJ A;  2H7O A;  4FHK A;  4DI3 A;  1K40 A;  3T8K A;  4G7O F;  3QVZ A;  5B3S E;  1TQG A;  4BSX A;  3FUF A;  2WXL A;  3TL5 A;  1LF8 A;  3D9I A;  2XCC A;  4JD2 G;  3MKR A;  4FAD A;  2W4M A;  4RG6 A;  1E84 A;  1OUV A;  4I17 A;  3TWR A;  1A7V A;  2R25 A;  4J7W A;  3CKB A;  3U66 A;  2Q9A A;  5IY5 E;  1JCR A;  2LUH A;  2GRR B;  2XHE A;  2C04 A;  1A5E A;  2EPL X;  1YA7 O;  4K1O A;  5G55 A;  4OAU C;  5GPG B;  3FMS A;  5LCW J;  3TJ6 A;  2A68 F;  3C3O A;  5B3I A;  3LKU A;  3T6G B;  3EU9 A;  5JLI A;  3ZIM A;  3F6Q A;  3R9M A;  5ARF A;  4N06 A;  4B6I A;  1N11 A;  3GZS A;  4FWV A;  4JTD B;  1UFB A;  3N24 A;  3LY8 A;  3ASN C;  1SMY F;  3PRZ A;  2ZXO A;  2UUH A;  1S70 B;  2Q9C A;  4BJT A;  3PRE A;  4TXP A;  2AWY A;  4YVO A;  3HRA A;  2ETS A;  4ZLC A;  1MHQ A;  2PNO A;  3NQP A;  1NA0 A;  2QC9 A;  3PS6 A;  4BG0 A;  2J0W A;  4HI8 A;  4MVM A;  4APO A;  3KAE A;  2VQ2 A;  5BUZ A;  5BXO A;  3V5X A;  5G05 J;  2ZGG A;  4J7T A;  5KYU B;  1OWP A;  2IOL A;  4U5G A;  1A7D A;  3RIP A;  2GFH A;  5DS6 A;  2YQY A;  3U8P A;  3ZIB A;  2YNQ A;  2EIN C;  2H6G A;  3APD A;  3LUT B;  5JVE A;  3C98 A;  2LXL A;  2VGY A;  4J6I A;  2H7V C;  4AM9 A;  1O5H A;  3EIJ A;  3HNK A;  4UI9 C;  3VTX A;  5KWD A;  3TWS A;  4NCQ A;  2V26 A;  2OKU A;  4TXQ A;  4JZY A;  5AEN A;  3PUJ A;  2AU5 A;  1NP7 A;  2ZPA A;  3FXH A;  2V0P A;  4HOU A;  5AIJ A;  1ZU4 A;  3ULQ A;  4GZ5 A;  4CGV A;  1CGM E;  1HZ4 A;  4WJ0 A;  4I2Z A;  3CKC A;  5AC5 A;  3ZYK A;  1EPU A;  3D9J A;  5EK0 A;  4WWO A;  4XI0 A;  3DSS A;  3R2P A;  1H9G A;  3AQC A;  3EHN A;  4GPK A;  4E17 A;  1BR4 A;  1E96 B;  3NBN B;  4PJM A;  1LKX A;  3IPM O;  4CJO A;  5CRU A;  4GYO A;  2D5R B;  2ICW G;  2OU6 A;  2CW0 F;  2RKK A;  3B13 A;  1YYJ A;  3HNL A;  2VSY A;  3FTX A;  3UXG A;  5L0H A;  2WXP A;  4B8A A;  4N3C A;  3L0I A;  2PF4 E;  1HW1 A;  1YCS B;  2YKZ A;  3MYI A;  1LI7 A;  1LD7 A;  5EDS A;  3ZW3 A;  2LD6 A;  2FI7 A;  4IYP A;  1OCR C;  2VAS A;  2WXI A;  3ZTZ A;  5HV9 A;  4NC3 A;  3L08 A;  3G2W A;  3UIN C;  1ZW2 A;  3DJN B;  4YJW A;  2YEV A;  4ER9 A;  3DBS A;  3LY7 A;  2D4U A;  4P9T A;  1ZZP A;  2OOC A;  2IU1 A;  4E0I A;  3CVY A;  1M2V A;  4BEP A;  4IB4 A;  3I5P A;  1FTS A;  2ION A;  1MMG A;  4LDR A;  3RW0 A;  4YL1 A;  2KC3 A;  1O5M A;  1H2U A;  5KYY B;  2YLI A;  3TWW A;  3ZQV A;  4A4A A;  2NSZ A;  5M72 A;  1H6O A;  4ULV A;  2GDC A;  3VM6 A;  4PS3 A;  4XEI G;  4Q4Z F;  4K5A B;  3MKQ A;  5JHB A;  4JHR A;  4O6Y A;  4XKB A;  4XPY A;  2EIK E;  4JKV A;  3UIO C;  4U04 A;  5KYW B;  3IQT A;  1H2T C;  1O87 A;  2YLD A;  4DPR A;  2VGE A;  2WB2 A;  4M3O A;  1DCE A;  2HO1 A;  1OW8 A;  3RKO F;  3KMI A;  5F5F A;  2KGO A;  2CYD A;  3CQZ A;  3ZNG A;  3Q49 B;  4QI2 A;  4OIN F;  4OAV B;  3ASF A;  3V7O A;  4R7L A;  1U3C A;  1NSG B;  1QZX A;  1N0Q A;  4ZFH A;  4U63 A;  1YAR O;  1NFI E;  2P9L G;  3F47 A;  2I2O A;  3NZU A;  1PD1 A;  4J8Y A;  3L16 A;  3QAR A;  1FFH A;  3G4X A;  4U9D A;  4MRU A;  4IAQ A;  256B A;  4ANU A;  3A9C A;  1XZP A;  2P2C P;  3M4B A;  4NIK A;  1T01 A;  2Y3H A;  4QI0 A;  1MMD A;  4Z68 A;  1E2X A;  3WXX A;  3FUN A;  2M64 A;  3NG1 A;  3S90 A;  3EDT B;  4WWP A;  4W8K A;  2VGX B;  3GYZ A;  3C8G D;  1JWG A;  4Q7C A;  2V5F A;  3HNJ A;  3UUX A;  4O6F A;  3U3F A;  3U2M A;  2VSO E;  1W2W A;  3SQV A;  2Y69 C;  3JYY A;  4U0S A;  1NG1 A;  3HJC A;  2P9S G;  3DRA A;  1DC2 A;  5HRY A;  1J8M F;  3QTH A;  5EYL A;  4G8K A;  4OIP F;  4MTG A;  4HOQ A;  2ILR A;  3Q9U C;  4C0M A;  2KQ9 A;  1UOH A;  3WOD F;  4AX2 A;  2LAH A;  3S29 A;  4GZC A;  4O60 A;  2H7B A;  5FIN A;  2GRO B;  2GRL A;  3PVL A;  4MKT A;  3TUL A;  3CVL A;  3PZD A;  2WMN A;  1Q0D A;  3L9T A;  1OCO C;  3SGH A;  4ACL A;  5EN5 D;  3C62 A;  3DPY A;  4JEU A;  1NFN A;  1O1R A;  2EIM C;  2XEN A;  4DRI B;  5DQZ A;  4W8P A;  1C02 A;  2KZT A;  3U9W A;  4LCT A;  2WQH A;  4HFK B;  3CR3 A;  3ZHE A;  3EHM A;  2M63 A;  2Y4T A;  2GGF A;  3I3N A;  5ENR D;  2YWA A;  4JIO A;  5L0I A;  3T5X A;  4HFG A;  1AEP A;  1K1A A;  4CJG A;  3GEH A;  1NZN A;  3O55 A;  4YVQ C;  3JTL O;  4K5B A;  3K9I A;  4CIH A;  3DEO A;  3PE3 A;  4XI9 A;  2YL0 A;  3IHV A;  4DVY P;  1S63 A;  3H65 A;  4YWQ A;  3TOL A;  4GZ6 A;  4G2V A;  4L23 A;  3Q7F A;  2X6H A;  3RVY A;  3ZQY A;  2A0U A;  2J9W A;  5D2M C;  5KJM A;  3EHQ A;  2A69 F;  4EBB A;  3ASN E;  2EIL E;  2L6H A;  2LIG A;  2VCA A;  1HMO A;  1UW4 B;  4LLC A;  1FFT C;  2MOW A;  2XRH A;  2YL1 A;  1JAF A;  1VK5 A;  5T4Y A;  1L5J A;  2PFD A;  3EG9 A;  1TYQ G;  2CG2 A;  2EIL C;  5FTP A;  4HOS A;  1HY5 A;  1KTM A;  2X6K A;  1CGO A;  3S7J A;  1SZI A;  1VMA A;  1MNE A;  2XLM A;  4ONS A;  1JPN A;  2IXP A;  4XTK A;  4YT8 A;  1KT0 A;  3AS4 A;  3ULE G;  2L6G A;  1KPS B;  2HR2 A;  3IHY A;  3FUM A;  2NC9 A;  3QC1 A;  4JXT A;  1JWF A;  2EPN A;  2WM9 A;  4FHJ A;  5G05 C;  4XEK A;  3U8V A;  2B0J A;  3FOO A;  1FVF A;  3B9Q A;  4KBQ A;  2C03 A;  2XL8 A;  2X6I A;  2IFU A;  1H2V C;  1S0P A;  4QFV A;  3RU0 A;  1ZU5 A;  1S05 A;  1PCX A;  3HXF A;  1H6P A;  1V55 E;  2VTB A;  5G04 C;  1G5Z A;  2WZF A;  1QBQ A;  5JRA A;  5DS5 A;  2R7R A;  5JSL A;  3UIP C;  2H8A A;  3RFY A;  3UMH A;  2OVB A;  3T4R A;  3MX3 A;  4EHP A;  1MX6 A;  1IW7 F;  5ENT D;  4GEH A;  3PZ1 A;  2KYH A;  2OEW A;  1VLT A;  3FU3 A;  2P58 C;  1INZ A;  4A1G A;  3EUV A;  4BX8 A;  2AXZ A;  2HMQ A;  4GTQ A;  3L1M A;  3NF1 A;  3CEX A;  1WG0 A;  3APC A;  4MBG A;  2AXV A;  3EQL F;  1QKR A;  3FTV A;  3JYS A;  1ELR A;  2BKG A;  3ATP A;  2MYO A;  3CHQ A;  3W9F A;  2IOQ A;  4LLE A;  4HNA D;  5COF A;  1BBH A;  3O48 A;  4OIO F;  2WXF A;  2EIJ C;  2IO2 C;  3VLF A;  3E34 A;  2OJQ A;  2P9P G;  4G8L A;  4BX9 A;  5BXU A;  1EA8 A;  2HUJ A;  1TFK B;  1YYH A;  2I9C A;  1EDU A;  3K1I C;  3CZ6 A;  2Y3A A;  3ZSU A;  3OXG A;  1OT8 A;  2J8W A;  3GWL A;  4JJG A;  5ENP D;  4GZ3 A;  4PK4 A;  3SXZ A;  4KZ0 A;  1D0Y A;  3FDQ A;  4PDX A;  4DX7 D;  2WQ7 A;  4XPX A;  2HV6 A;  4OIQ F;  2HKV A;  4LER A;  5HI7 A;  5JT4 A;  2P9K G;  4J8E A;  2WZL A;  3U9M A;  5JJ6 A;  4G23 A;  2DZN A;  1O1T A;  2BL2 A;  4YND A;  2QY9 A;  2MRI A;  1SA4 A;  4HS2 A;  3OEO A;  3IEE A;  2I1J A;  5FZS A;  3FUK A;  4U0U A;  1A0B A;  4L2L A;  1R4T A;  1T5O A;  2DBA A;  4L2Y A;  1E8W A;  4XWJ A;  3H2U A;  1MZC A;  3LCA A;  3NAW A;  1TR4 A;  1NL4 A;  3QWP A;  5A7D B;  4CDN A;  3G2U A;  3LJ3 A;  4KYO B;  2VH3 A;  4U0Z A;  3RRN B;  4HLL A;  5FQ7 A;  1VYI A;  5AQ9 A;  2EIK C;  4BPM A;  4ILG A;  1K04 A;  2CDQ A;  2KW3 C;  1N4Q A;  1LD8 A;  1VTM P;  3NDB B;  3HTK C;  2PM7 A;  3DPD A;  4W9R A;  2QTV A;  3GM2 A;  5G04 J;  4WNE A;  3QZC A;  1OWL A;  2Y39 A;  3AJM A;  3IEG A;  2YL7 A;  4HEA J;  2G62 A;  2VCB A;  3C7J A;  3NYL A;  3ABK E;  2Q3T A;  4H4K C;  3QVY A;  5CED B;  1Z5S C;  3K7D A;  4GML A;  2A6H F;  2V8S E;  4AL1 A;  3KS2 A;  4CDY A;  4AY5 A;  1YJG A;  1XNF A;  3UMV A;  3S7B A;  4C48 B;  4OVV A;  2F0Y A;  4I3M A;  1ZYR F;  4GTV A;  1B89 A;  5J90 A;  4IGG A;  3Q6N A;  1HW2 A;  4HFF B;  1OCR E;  4WNF A;  2PP4 A;  4MVO A;  4U5D E;  4BFR A;  4XX5 A;  3FEX A;  4HLE A;  3L13 A;  3EGD A;  3TXN A;  3UNG C;  2BF0 X;  3PEU B;  1SYQ A;  1WY6 A;  4LNB A;  3VTY A;  3AU5 A;  3B7T A;  1ORY A;  4NAC A;  5DQT A;  1FPP A;  1K05 A;  3NZS A;  2WVQ A;  4TV3 A;  2XQ0 A;  4ILI A;  1Q0G A;  5L3V A;  3TK0 A;  1HO8 A;  5AQB A;  3FUJ A;  2IXO A;  3RH3 A;  3QK0 A;  2JAB A;  1KZP A;  2LFF A;  2LSU A;  2JEK A;  2QZA A;  3BU8 A;  3KEZ A;  2R7X A;  4XLN F;  4R32 A;  4BES A;  1LS1 A;  4XZ4 A;  2ETC A;  4DBR A;  4MW8 A;  1OWM A;  3HIZ A;  4DLO A;  5FZT A;  2YIN A;  3B29 A;  5L0J A;  2WZG A;  2OEX A;  4DRJ B;  5LCW C;  2GA0 A;  2WXN A;  1NFO A;  3U4T A;  2HJ3 A;  4DLQ A;  3Q9N C;  4I9E A;  3WAQ A;  2PZI A;  3U9J A;  4CT0 A;  1TWH A;  3PMR A;  1X81 A;  3FTU A;  4M63 A;  3C8Z A;  2IM8 A;  3G2S A;  4NUR A;  3TAX A;  4B0Z A;  4F1S A;  3PHF 2;  3C5R A;  1UN8 A;  4N2Q A;  1RJ9 B;  2BKK B;  1SF8 A;  4AK9 A;  5CCM A;  3GOR A;  1Z3I X;  2C0M A;  3FU6 A;  5FJY A;  3ENE A;  3TG4 A;  2WL8 A;  2AVK A;  4FLB A;  5BV1 A;  4JCH A;  3O4Z A;  3BEE A;  4CX9 A;  1X5B A;  3KL4 A;  3AG3 C;  1TNO A;  4C3B A;  1TWG A;  3LEV A;  1SZA A;  5JMN D;  1JMW A;  1OKK D;  1JUQ A;  1RMV A;  4H54 A;  3J5P A;  4H7Y A;  2YHE A;  1TN6 A;  3ULY A;  1S64 A;  4N5Q A;  2XGS A;  2CFU A;  1KNY A;  3W4Y A;  3EFO A;  3S0X A;  1OCC C;  1BI8 B;  4E18 A;  4HE8 D;  3HVE B;  4Q96 A;  3FUL A;  2CGE A;  4XIF A;  2R7S A;  2J4B A;  1I5N A;  2WXO A;  1VDY A;  4DJA A;  5A69 A;  4FJY A;  1EQ1 A;  3JSZ A;  3EHR A;  3SNX A;  3KYI A;  1ZVZ A;  1BR2 A;  2Q9B A;  2LCH A;  4TUM A;  4MVU A;  2P7V A;  2L0I A;  3NOC D;  4UUC A;  2R5S A;  3HDX A;  3AOU A;  3HNI A;  2C2L A;  1BI7 B;  1Y6D A;  3VF0 A;  3JQ0 A;  3PCV A;  3CVW A;  4A3V A;  3TJP A;  3EH2 A;  4DRX E;  3E37 A;  1EI7 A;  4JB8 P;  4OIR F;  5AQ7 A;  3AG4 E;  3RQG A;  4CRW A;  3ZRH A;  3PH0 C;  4NQF A;  4PJJ A;  3GOD A;  3V2O A;  3IKO B;  1F1M A;  4GTM A;  3B71 A;  2Y69 E;  1RKE A;  4C3D A;  4AV7 A;  4C7O A;  2KCL A;  3LPZ A;  4FP7 A;  4U8H A;  1N94 A;  1YYX A;  1NU9 C;  1YLM A;  1FT2 A;  5B3S C;  4IRU A;  5ENS D;  4AEZ C;  1A41 A;  4J8F A;  5C2Y A;  3LVQ E;  5AGF A;  2DIW A;  1E8Z A;  1L3P A;  2G3V A;  2OG2 A;  2J46 A;  5BQG A;  3RO3 A;  4IN3 B;  1PD0 A;  3DWL G;  4GA0 A;  3FUE A;  3K1H A;  4WND A;  1FMV A;  4MS2 A;  4Q94 A;  2J9U A;  3ASD A;  3ZKJ A;  1ORS C;  1U89 A;  2QYJ A;  4EEC A;  2IJG X;  5DVW A;  1HXI A;  5KJK A;  3V31 A;  4PFO A;  4JHJ A;  3X1O A;  5CBO A;  4MQ9 F;  2XXA B;  3CVQ A;  2L6B A;  3D9N A;  1VOM A;  3ZWI A;  4A3T A;  4LSZ E;  4HRM B;  2R02 A;  3DM9 B;  2ZXP A;  3CVP A;  1D1C A;  3V79 K;  3TWQ A;  4K5C A;  4HBD A;  3TQO A;  1KZO A;  2V4L A;  3OA1 A;  2ZXW C;  3ABL C;  1HF8 A;  1IQR A;  2L6J A;  4YT5 A;  3SNH A;  5BW8 C;  3LS1 A;  4CIP A;  4J8D A;  2QY7 A;  2ZD9 A;  1ZB1 A;  1DOV A;  2WXK A;  4XKC A;  4G1T A;  4H7X A;  4LUN U;  4RVB A;  1JCQ A;  2PQN A;  3KSL A;  4BJ5 C;  3GZ1 A;  4KMO A;  1D8D A;  4DX5 D;  5L3Q A;  4HOT A;  1D1A A;  3UR3 C;  5KYU A;  1LE4 A;  5EHH A;  4TRQ A;  4E7S A;  3NMI A;  2IBF A;  4Q69 A;  2AXU A;  1OCC E;  4BSZ B;  2PX3 A;  2TMV P;  3UT4 A;  3DI5 A;  3AG2 C;  3LAY A;  4PFP A;  1N95 A;  1N54 A;  1RKE B;  1G4W R;  1E90 A;  3JZ0 A;  1TJC A;  3RK6 A;  5BPP A;  4EBA G;  4EZL A;  1WM5 A;  4KNW A;  1Q0M A;  5T1D B;  4DOZ A;  1D8E A;  5E2Q A;  4L1B A;  4ZHB A;  2RG8 A;  5AYW D;  1Z3X A;  2IQC A;  1SQM A;  3SBT B;  4AE4 B;  1RCP A;  5A23 A;  1H9T A;  3D9K A;  1N1C A;  5COM A;  1UN9 A;  3DM5 A;  4UI9 J;  2J07 A;  3SFZ A;  2FGY A;  2LSE A;  3NB2 A;  3UM3 A;  2A0B A;  1AVO B;  2XLE A;  4U8V D;  5EGY A;  2PL2 A;  4EBJ A;  2I8B A;  1E8X A;  4EPZ A;  1N4R A;  4YL0 A;  2F8X K;  4UDV A;  1TNB A;  3LES A;  5BUO A;  2L9B A;  4CYM D;  4DBQ A;  1HG2 A;  5BQI A;  2R7O A;  2LK4 A;  4K0R A;  4CS8 C;  3DE9 A;  4F3V A;  2WPV A;  4KVO A;  3AS8 A;  3AQB A;  2BTD A;  4ACK A;  3FOP A;  3E4B A;  3K33 A;  3PNT B;  2YL3 A;  2UY1 A;  1V54 C;  4WWN A;  5EX0 A;  3JXJ A;  2ZGD A;  1KU2 A;  2Y3G A;  3LEO A;  4L7T A;  5KYN A;  2XLV A;  3TWU A;  4N4W A;  3LXU X;  3KD7 A;  2HSQ A;  2KCK A;  3KPH A;  4RD9 A;  4RDA A;  1EKY A;  3CK8 A;  3LS8 A;  4U5E E;  2DWZ A;  4APF A;  1U0B B;  5TJ5 E;  1ELW A;  3QMK A;  1FR0 A;  1M56 C;  5T3R A;  4P9F A;  1SW6 A;  4A63 B;  1FAP B;  3TWX A;  3DXK G;  3FDH A;  3FFL A;  2HV7 A;  4OYS A;  1WTY A;  4GZD A;  2X6F A;  3ONL A;  1Z6T A;  3N0T A;  4J30 B;  4F4B A;  3GZ2 A;  2GRM A;  1NI1 A;  3C3Q A;  3AG1 E;  1M2V B;  5BV0 A;  2UWJ G;  4BJ6 A;  4CDA A;  4BEJ A;  1JCS A;  1ZBP A;  2PBE A;  3SI5 A;  4EBK A;  2IY0 C;  2NPU A;  4EIY A;  4DX6 D;  2DYR E;  4E85 A;  4KVM A;  4EQF A;  2HMZ A;  1LI5 A;  2J9V A;  1RZ4 A;  3JQ1 A;  3V5Z A;  2RSE B;  4DRH B;  1LPE A;  4L6R A;  4ANJ A;  3UI2 A;  2LAI A;  1GQA A;  4NTB A;  5EID A;  5KJN A;  3AG3 E;  1ZHW A;  1MMN A;  4GQH A;  3ZYQ A;  1E86 A;  4HI9 A;  2J0X A;  3HYM B;  3Q7G A;  1JR8 A;  1PY1 A;  3QB2 A;  2F37 A;  2GRP B;  5L0F A;  4JTA B;  4U7E B;  4XEF A;  5E3C A;  5FIO A;  4WGZ A;  2KM4 A;  3T8M A;  2NG1 A;  3SFX A;  3EGD B;  2VSN A;  3DJU B;  2P9I G;  4B93 B;  4C0E A;  1LVK A;  3ML9 A;  2X51 A;  1Z3Y A;  3CSK A;  2LNI A;  1OY3 D;  2JLB A;  3LY9 A;  3LEW A;  2BC5 A;  3FHE A;  2A6E F;  4G24 A;  2UY1 B;  5IY5 C;  3U3B A;  4AL0 A;  5CIV A;  2A5E A;  5D66 A;  4FA6 A;  3RSE G;  4KBL A;  2O9X A;  4LDQ A;  2YVK A;  3BUA A;  4CDM A;  4PS7 A;  3TG5 A;  2DCP A;  1ST6 A;  4ILH B;  3HLZ A;  1AWC B;  1GW6 A;  1OXK A;  1LM3 B;  2LQG A;  2RD9 A;  1EF1 C;  1UJK A;  3FH8 A;  3RO2 A;  1LS4 A;  1RW2 A;  2J4D A;  4C9B B;  1AUE A;  4AVX A;  2AWI A;  2F8Y A;  3DSU A;  3IQ6 A;  1D0Z A;  4YK5 A;  5E33 A;  2LP4 A;  3Q4A B;  3OTN A;  1TJF A;  3Q5M A;  1Z63 A;  5AJL A;  4CT4 A;  1MX4 A;  2XGO A;  5E3A A;  2UUI A;  3IQ5 A;  4C3E A;  1T9K A;  1WAS A;  3DE8 A;  1HE8 A;  5AJD A;  3UGP A;  4CGW A;  5KYX A;  1MND A;  2GRN B;  5FZQ A;  4DX1 A;  5EIB E;  2EPK X;  3BG0 B;  4IAO A;  2IXN A;  2E0I A;  3SXY A;  4YDW A;  3E9V A;  4P6I C;  3X2Q E;  3L8I A;  1APC A;  1RKC A;  3CVN A;  4XLP F;  1U6H A;  4L9P A;  5FT9 A;  4BT8 A;  4I9C A;  4A55 A;  3L34 A;  1OWO A;  4N3B A;  4B94 A;  2XZT G;  3L22 A;  4BTB A;  4DUI A;  4UQY A;  4NQ0 A;  4TXR A;  4AOF A;  1JOG A;  4YN0 B;  3ASG A;  3T6B A;  3KEA A;  5CER B;  3L8J A;  2RD0 A;  2Q00 A;  4JE9 A;  2XEV A;  5ANR A;  1LE2 A;  1U3D A;  3HKK A;  4I6E A;  3ECS A;  1NA3 A;  5JS5 A;  2B0H A;  2Y3D A;  3ZN3 A;  2NXP A;  3H2V A;  3SZR A;  4KXK B;  4GTR A;  3DSX A;  4BJ6 C;  2R59 A;  2DYS E;  4CDR A;  4I44 A;  4OVU A;  1W3B A;  1YAU O;  1U2V G;  2KJG A;  3RRM B;  2HFI A;  3CST A;  2Q7R A;  3FTW A;  3G50 A;  3B0V C;  4J8S A;  1Y6I A;  5B1A E;  5B1A C;  2DGJ A;  4YL3 A;  1C03 A;  3CAX A;  4BJ5 A;  3FHD A;  2J9B A;  3D9P A;  3KKB A;  4K03 A;  4LEU A;  3AGT A;  2EQX A;  1IYG A;  1N9A A;  4UWF A;  5FCL A;  4N2S A;  3B95 A;  1MQS A;  3FTZ A;  1YZC A;  1N4S A;  4Z9I A;  3EIQ C;  4ATG A;  3GEE A;  3QWW A;  5EKQ D;  2VCC A;  2QNL A;  4GYY A;  3RRU A;  4LRZ A;  3D9M A;  2L9J A;  5FQ6 A;  1GGQ A;  5B1B C;  3ZGQ A;  4HQD A;  2QLA A;  4UWK A;  3LLK A;  1CPQ A;  1XZQ A;  1OW6 A;  3LLI A;  2R7U A;  4FUL A;  4WUY A;  3DD7 A;  2EIJ E;  2OQM A;  3S84 A;  5HS0 A;  4DK5 A;  4ATZ D;  1ELK A;  3CGH A;  1OR3 A;  3UTM A;  4V3I A;  1UG7 A;  2XEE A;  3DZA A;  3J06 A;  5T3T A;  3UKR G;  5KNH D;  3ZHE B;  1H7I A;  1MQV A;  3HHM A;  4O79 A;  3AS5 A;  1TWA A;  1MYO A;  1AP7 A;  2XZD G;  3FP3 A;  2FEZ A;  1O3U A;  2ASR A;  3EH1 A;  4ANW A;  4JL0 A;  1OXJ A;  1NLX A;  5JHA A;  2XLH A;  3SO8 A;  3DAF A;  4LNG A;  5KJL A;  3SHF A;  1G4U S;  4IWB A;  4KC9 A;  1YMP A;  3RIB A;  2LXM A;  3JRM O;  3LYA A;  3SFY A;  5BNW A;  2GAQ A;  2VC9 A;  1L7C A;  3JUI A;  4GAA A;  1QNF A;  3CVU A;  2WXG A;  2WXM A;  3DWW A;  5KYY A;  3ML8 A;  4K7B A;  1QPU A;  3VLE A;  2R9R B;  4C7O B;  3Q79 A;  2EPO A;  4U95 D;  4EKW A;  4MW3 A;  4X0R A;  3GM3 A;  3FY4 A;  2YRF A;  5J08 A;  3B7B A;  2MHK A;  3ZXP A;  3SXK A;  2HZ8 A;  5D91 A;  1DNP A;  3CIA A;  4MLP A;  3E32 A;  2XS1 A;  3FU5 A;  2FF4 A;  4U5B E;  2VGX A;  3EGX A;  3FAP B;  1OQC A;  2HS5 A;  4G78 A;  4CDV A;  4JHK A;  5CBN A;  2KZT B;  4MS6 A;  5KNG A;  3MYF A;  4I6J A;  3U2L A;  1H6G A;  5KBA A;  3US6 A;  1NU7 D;  3JRT A;  4HXI A;  3SP1 A;  3POV A;  3UM1 A;  1T6U A;  3PUK A;  4MND A;  2PX0 A;  3CHS A;  5FQ4 A;  2FUL A;  2AW6 A;  2QUP A;  1T6I A;  3RQE A;  3FU0 A;  3UKU G;  4AY6 A;  5HQ8 A;  3IBE A;  3FUD A;  1HH8 A;  2NUP A;  2QYU A;  3U5S A;  1Q0K A;  2HE0 A;  3ASH A;  4I2W A;  1I4Y A;  5LFA A;  3WG7 C;  4GMJ A;  3UMK A;  4ANX A;  3U3W A;  4CS9 C;  2FO7 A;  1WOL A;  2XPY A;  3AG2 E;  2XCB A;  5F5H A;  3Q15 A;  4X8Q A;  4EHM A;  5FZR A;  3RVZ A;  3QJZ A;  4FES A;  4GMR A;  3LJN A;  2CCY A;  3MV3 B;  5LX8 A;  1OKK A;  1OR2 A;  2OVF A;  3G4Z A;  1GM5 A;  2FO1 E;  1T6Q A;  1VLS A;  4JA7 A;  2J7P D;  3VLD A;  3CVX A;  3FH5 A;  1RJ9 A;  4N39 A;  3FUH A;  3MYV A;  3M1C B;  3JSE O;  1IHB A;  2IYL D;  4HRN A;  3IHU A;  3LDZ A;  2KK1 A;  3QDN A;  5BT1 A;  3URZ A;  5CEA A;  1BDJ B;  3Q7A A;  1S7Z A;  4B8C B;  2VSX E;  1HMD A;  4MVR A;  4Y6W A;  5LP0 A;  1WGW A;  4UWH A;  3HXE A;  2RFM A;  4J0U A;  1ZHT A;  3MJW A;  4GA1 A;  3EFO B;  5JA4 D;  3A11 A;  1N4P A;  2HYZ A;  4MVQ A;  2X0C A;  1GS9 A;  4CZ2 D;  3FAJ A;  4LNU D;  3RQF A;  5ENO D;  3EPV A;  5A6B D;  5F28 E;  1JRA A;  3MBG A;  5E75 A;  4NTA A;  4N5C A;  4KT6 B;  4CS8 A;  2VYI A;  2JX0 A;  2A4Z A;  2Q4F A;  5H7P A;  3MFN A;  2X6J A;  1OXB A;  4EZK A;  1TNZ A;  3HXD A;  4RQI A;  1M6T A;  5L0G A;  4GU5 A;  3AJI A;  5C1D A;  4ZLD A;  2XM0 A;  3B7S A;  1O1S A;  1NBB A;  2CHZ A;  5AQA A;  1BZ4 A;  5AAR A;  3HG0 D;  5EYP F;  2Y0B G;  2KNH A;  4CBE A;  4BER A;  5EX3 A;  3PZ4 A;  4UWG A;  3VAY A;  4ABN A;  2B0O E;  3I5Q A;  3IQC A;  2V3C C;  1ORJ A;  3LS0 A;  3UM0 A;  3NRH A;  1Y8M A;  3NMK A;  1BR1 A;  2P0N A;  1HS6 A;  4XE0 A;  5BQH A;  2HSB A;  3D9O A;  3W9G A;  4Z9J A;  4AJW A;  5K0I A;  1HG5 A;  2JD3 A;  1HU3 A;  4FJZ A;  2L0T B;  2CG3 A;  4GTO A;  4FX5 A;  1E7V A;  4LDK A;  1PV3 A;  4GB9 A;  1FT1 A;  1E8Y A;  2DZO A;  3RJV A;  1OWN A;  1YA0 A;  1ZHZ A;  4N6H A;  1JPJ A;  4E7Z A;  1YDI A;  4GA2 A;  4Z9H A;  1A17 A;  3L17 A;  4U8Y D;  3U64 A;  1M2O A;  1SVX A;  5D92 A;  2DYR C;  3TWV A;  3ASO C;  3DXM G;  3UQ3 A;  3HXC A;  3TOM A;  4F1P A;  4PJN A;  1B68 A;  1ZW3 A;  1D0X A;  3EJN A;  2CFZ A;  3MKQ B;  4JCZ A;  5L0C A;  2LO6 A;  3K1I A;  3Q47 B;  1YZA A;  1TWC A;  2XXA A;  5ITZ F;  1N0R A;  2IF4 A;  2Y3B A;  4PUC A;  4U5C E;  4CSA C;  3QW0 A;  4AXH A;  1SR2 A;  4RSY A;  2R03 A;  3PZ2 A;  2FAP B;  3PE4 A;  5JJ7 A;  1WWP A;  2L6F A;  4HRL A;  3L82 A;  4JPS A;  3NYM A;  3ZYL A;  2W9Y A;  5T3W A;  2R05 A;  3CQG B;  3S7F A;  1VYK A;  3LNM B;  3QW1 A;  4JW1 A;  2RFA A;  2KSF A;  3BRJ A;  2OJE D;  3W2W A;  1QYM A;  2J49 A;  4JVS A;  4ULW A;  4A1S A;  2P1A A;  3QKY A;  5L0D A;  1IZM A;  2DI3 A;  4EUK B;  2BUG A;  4YDY A;  3SY2 A;  2J9Q A;  3ZG1 A;  5A6B A;  3CK7 A;  3ZYM A;  5ARG A;  1V54 E;  3MV2 B;  4DJ9 A;  3R9A B;  2FFH A;  2A5U A;  4JZA A;  2XL6 A;  3SBS A;  1P5Q A;  4M7C A;  3KH2 A;  3ZUV B;  3LNR A;  2KCV A;  3Q7L A;  2GRQ B;  3W8I A;  2XPI A;  5CRV A;  2A1D D;  3V30 A;  3PDN A;  4BEM J;  4D4N A;  3I4R B;  1WAO 1;  5KYX B;  3C18 A;  3DAG A;  3DXJ F;  1IXV A;  2P6V A;  4RBN A;  2WVI A;  3E33 A;  4I6G A;  4URK A;  5A6C A;  3JCU Q;  2YHC A;  2XRY A;  5CCL A;  2OEV A;  2H6H A;  3MLG A;  3TXM A;  4DI4 A;  3DST A;  1CGN A;  3M4C A;  5E76 A;  1K1B A;  1HX8 A;  3G2V A;  4OD5 A;  4FAP B;  2EIN E;  4BY6 A;  2IOS A;  4OD4 A;  4UI9 K;  4PAC A;  3T5V A;  3EZH A;  3JYH A;  5D0Q D;  2WVN A;  2WXQ A;  2Y1L E;  4IJJ A;  1KT1 A;  2WMO A;  3S7D A;  3R7R A;  1E83 A;  3CHP A;  3K6B A;  3ASO E;  3B0P A;  1UJJ A;  1K8K G;  3WHN A;  4G25 A;  3MGB A;  3UT8 A;  4KNV A;  4CSA A;  1Q2Z A;  3N71 A;  1QSP A;  4I43 A;  3M79 A;  4JEB A;  3DMD A;  2XPZ A;  3QOU A;  4JC7 A;  3CLJ A;  2H6I A;  3V5Y A;  1SZ9 A;  3R7C A;  4BWR A;  3RYL A;  2M4E A;  4WNG A;  1MJ0 A;  2CNW A;  3JT1 A;  3MCX A;  3RAU A;  2BED A;  3RKV A;  2F22 A;  3NKE A;  1A7E A;  4J7Y A;  3CQC B;  3GW4 A;  2R7Q A;  3UM2 A;  2XS8 A;  3ZU7 B;  2R7V A;  1KLX A;  2ZXW E;  2DB4 A;  3ABL E;  5DLJ A;  3MA5 A;  3UMI A;  2EPM X;  2KBX A;  2GWW A;  1ZHX A;  3S27 A;  3TJ5 A;  1ZHY A;  3DSV A;  4PS8 A;  2IO3 C;  3SF4 A;  2VTB B;  4JA9 A;  1LTX A;  4G26 A;  3FVY A;  3GM1 A;  2AJA A;  1BU9 A;  2MHR A;  3T9K A;  1HFA A;  5LOZ A; 
#chains in the Genus database with same CATH homology
 5FWQ A;  1Z6A A;  5DBK A;  3SZ7 A;  2NUP B;  2I6H A;  1H6K A;  3R7Q A;  3D3M A;  2NUT A;  2X38 A;  4EZJ A;  4FLH A;  4BTA A;  1E7U A;  1PAQ A;  3W2V A;  2J08 A;  4ANV A;  5ANL A;  4DVZ A;  4QDL A;  4HVB A;  2KAT A;  4K0D A;  3FTY A;  3NKD A;  3ZVR A;  2QFC A;  3QWV A;  2R7W A;  3AU4 A;  2OOE A;  1N52 A;  3L54 A;  1J8Y F;  4B89 A;  1TR2 A;  2XSE A;  3QAQ A;  1FMW A;  3HVE A;  2J7P A;  3OWT A;  3S2A A;  3MEK A;  4G7H F;  3SYN A;  3FEY A;  3AG4 C;  4JC8 A;  4KZC A;  3BG1 B;  3X2Q C;  3B7U X;  3PNL B;  4NRH B;  2OCC C;  3L6A A;  3MZL B;  4UQZ A;  5T8I A;  5DS4 A;  2Y4U A;  3QNK A;  3UX4 A;  4O6M A;  4J32 B;  4CS7 A;  4EWC A;  4U5H A;  1H19 A;  3ITF A;  4D10 C;  3UPV A;  4AIF A;  1QQE A;  2W45 A;  5CMY A;  5JJT A;  5HSW A;  1FCH A;  1M57 C;  2NUT B;  2R17 C;  1V55 C;  2YQ8 A;  2MWQ A;  3UT7 A;  4E6H A;  2CNW D;  3I4G A;  2Z15 A;  3ESK A;  4IUL A;  5ENN A;  3SD5 A;  3Q6M A;  1DVP A;  1Z5Z A;  4U5F E;  3W8H A;  2VB6 A;  4YT2 A;  3TGO A;  4G7Z F;  4AP2 A;  4I1O B;  4JUR I;  4G11 A;  4U07 A;  3OXF A;  1UG3 A;  3VYW A;  2CHW A;  4A2N B;  4Q5S F;  3CVV A;  3I4U A;  2YHS A;  2C0L A;  5CMW A;  1QZ2 A;  3CHO A;  1OCZ C;  5G2N A;  4HOR A;  2OND A;  2PQR A;  4UWL A;  3S28 A;  3K66 A;  2ZXR A;  3GAN A;  2DYS C;  1NZE A;  3UGO A;  1XGW A;  4Y6C A;  3AG1 C;  2VJ8 A;  4G0H A;  1EYH A;  3FUI A;  2OV8 A;  3ZVV A;  4UQX A;  1ZU2 A;  3FTS A;  5KYW A;  4GCN A;  1JPL A;  4GYW A;  4I1A A;  5CI8 A;  2E2E A;  3FH7 A;  4PJL A;  2I1K A;  3F46 A;  4YT4 A;  2CHX A;  2Q7F A;  4RG9 A;  3D9L A;  2YZS A;  4KI2 A;  4N3A A;  3CEQ A;  4P29 A;  2WXH A;  4EBA A;  3CHM A;  3ABK C;  3ZPJ A;  3T6J A;  3APF A;  4F53 A;  4ME2 A;  5FQ8 A;  3TD7 A;  1PC2 A;  3ZFW A;  3ABM C;  2X3M A;  2J09 A;  2E87 A;  2WXR A;  2R7T A;  3CK9 A;  4AE4 A;  3P2B A;  2W4B A;  2WB7 A;  3FWV A;  3OAW A;  4TUU A;  4CCA A;  1G8X A;  4FC8 A;  1BPO A;  1D1B A;  2MYS A;  1Z23 A;  3OXL A;  4FU3 A;  3O39 A;  1MMA A;  3JCK C;  2IXM A;  1FVH A;  2KC7 A;  5DIZ A;  3ESL A;  3B0U X;  5CHE E;  1IHG A;  3CHR A;  4LAC B;  4CS9 A;  2XGM A;  4CEM A;  3EZI A;  3G2T A;  4PH4 B;  3ONK A;  4O7G A;  2L81 A;  1H0A A;  3E70 C;  4BJ1 A;  1QLE C;  3SEO A;  2J45 A;  2GW1 A;  3EGX B;  2WQ6 A;  1TKN A;  2G3K A;  4JEH A;  4GCO A;  3CSF A;  4BT9 A;  5CI9 A;  4NY3 A;  4O6N A;  2LSV A;  4WAF A;  2XRZ A;  5D0O D;  2XL4 A;  4JJF A;  2ZU6 B;  3ZEF A;  4GYT A;  3IV0 A;  5KCM A;  3CV0 A;  3LVR E;  3LJB A;  1IQU A;  3ZXS A;  3B7R L;  2WVO A;  2WXJ A;  3ZC4 A;  2PM6 A;  4I1M A;  2HM8 A;  3PEV B;  3O6X A;  2FBN A;  3EG9 B;  1TEZ A;  3P1U A;  2BE5 F;  2AVP A;  3N2Z B;  4F7A A;  3NYJ A;  2H7O A;  4FHK A;  4DI3 A;  4G7O F;  4BSX A;  3FUF A;  2WXL A;  3TL5 A;  1LF8 A;  3D9I A;  2XCC A;  3MKR A;  4FAD A;  2W4M A;  4RG6 A;  1OUV A;  4I17 A;  3CKB A;  3U66 A;  2Q9A A;  2XHE A;  2C04 A;  5G55 A;  5LCW J;  2A68 F;  3LKU A;  3ZIM A;  5ARF A;  4N06 A;  4B6I A;  3GZS A;  4FWV A;  3N24 A;  3LY8 A;  3ASN C;  1SMY F;  3PRZ A;  2ZXO A;  2Q9C A;  4BJT A;  3PRE A;  4YVO A;  4ZLC A;  1MHQ A;  3NQP A;  1NA0 A;  3PS6 A;  4BG0 A;  2J0W A;  4APO A;  3KAE A;  2VQ2 A;  5BUZ A;  5G05 J;  5KYU B;  1OWP A;  2IOL A;  4U5G A;  3RIP A;  2GFH A;  5DS6 A;  3ZIB A;  2YNQ A;  2EIN C;  3APD A;  3C98 A;  2VGY A;  4J6I A;  2H7V C;  4AM9 A;  1O5H A;  3EIJ A;  4UI9 C;  3VTX A;  2V26 A;  5AEN A;  4JZY A;  3PUJ A;  1NP7 A;  2ZPA A;  2V0P A;  4HOU A;  5AIJ A;  1ZU4 A;  3ULQ A;  4GZ5 A;  4CGV A;  1HZ4 A;  4WJ0 A;  4I2Z A;  3CKC A;  3ZYK A;  1EPU A;  3D9J A;  4WWO A;  4XI0 A;  3AQC A;  3EHN A;  4GPK A;  1BR4 A;  1E96 B;  4PJM A;  1LKX A;  4GYO A;  2D5R B;  2CW0 F;  3B13 A;  2VSY A;  3FTX A;  2WXP A;  4B8A A;  4N3C A;  3L0I A;  2PF4 E;  5EDS A;  3ZW3 A;  2FI7 A;  4IYP A;  1OCR C;  2VAS A;  2WXI A;  3L08 A;  3G2W A;  3DJN B;  4YJW A;  2YEV A;  3LY7 A;  3DBS A;  2IU1 A;  3CVY A;  1M2V A;  3I5P A;  1FTS A;  2ION A;  1MMG A;  1H2U A;  5KYY B;  2NSZ A;  5M72 A;  4PS3 A;  4Q4Z F;  3MKQ A;  5JHB A;  4JHR A;  4O6Y A;  4XKB A;  4U04 A;  5KYW B;  1H2T C;  1O87 A;  4DPR A;  2WB2 A;  4M3O A;  2HO1 A;  3RKO F;  5F5F A;  3KMI A;  2KGO A;  3CQZ A;  3Q49 B;  4QI2 A;  4OIN F;  3ASF A;  3V7O A;  4R7L A;  1U3C A;  1QZX A;  4U63 A;  3F47 A;  2I2O A;  3NZU A;  1PD1 A;  3L16 A;  3QAR A;  1FFH A;  4MRU A;  4ANU A;  2Y3H A;  4QI0 A;  1MMD A;  3WXX A;  3FUN A;  3EDT B;  3NG1 A;  4WWP A;  4W8K A;  2VGX B;  3GYZ A;  1JWG A;  4Q7C A;  2V5F A;  3UUX A;  4O6F A;  2VSO E;  1W2W A;  2Y69 C;  4U0S A;  1NG1 A;  3HJC A;  1J8M F;  4OIP F;  4HOQ A;  2ILR A;  4C0M A;  2KQ9 A;  3WOD F;  4AX2 A;  2LAH A;  3S29 A;  4GZC A;  2H7B A;  2GRL A;  3PVL A;  4MKT A;  3CVL A;  3PZD A;  2WMN A;  1OCO C;  3SGH A;  4ACL A;  4JEU A;  2EIM C;  5DQZ A;  2KZT A;  3U9W A;  4LCT A;  2WQH A;  4HFK B;  3CR3 A;  3ZHE A;  3EHM A;  2M63 A;  2Y4T A;  2GGF A;  3I3N A;  3T5X A;  4HFG A;  1NZN A;  4YVQ C;  3K9I A;  4CIH A;  3PE3 A;  4XI9 A;  3IHV A;  4DVY P;  3H65 A;  4YWQ A;  4GZ6 A;  4G2V A;  4L23 A;  2X6H A;  2J9W A;  5KJM A;  2A69 F;  4EBB A;  4LLC A;  1UW4 B;  1FFT C;  2MOW A;  2XRH A;  1VK5 A;  5T4Y A;  1L5J A;  2PFD A;  3EG9 A;  2CG2 A;  2EIL C;  5FTP A;  4HOS A;  2X6K A;  3S7J A;  1SZI A;  1VMA A;  1MNE A;  1JPN A;  2IXP A;  4XTK A;  4YT8 A;  1KT0 A;  3AS4 A;  2HR2 A;  3IHY A;  3FUM A;  2NC9 A;  3QC1 A;  4JXT A;  1JWF A;  4FHJ A;  2WM9 A;  5G05 C;  2B0J A;  1FVF A;  3B9Q A;  4KBQ A;  2C03 A;  2X6I A;  2IFU A;  1H2V C;  1S0P A;  4QFV A;  3RU0 A;  1ZU5 A;  1PCX A;  2VTB A;  5G04 C;  2WZF A;  5DS5 A;  2R7R A;  3UMH A;  3RFY A;  2OVB A;  3T4R A;  3MX3 A;  1IW7 F;  4GEH A;  3FU3 A;  2P58 C;  1INZ A;  4A1G A;  4BX8 A;  2AXZ A;  3NF1 A;  3APC A;  2AXV A;  3EQL F;  3FTV A;  3JYS A;  1ELR A;  3CHQ A;  2IOQ A;  4LLE A;  3O48 A;  4OIO F;  2WXF A;  2EIJ C;  3VLF A;  4BX9 A;  2I9C A;  1EDU A;  3K1I C;  3CZ6 A;  2Y3A A;  3ZSU A;  3OXG A;  4JJG A;  4GZ3 A;  4PK4 A;  4KZ0 A;  1D0Y A;  3FDQ A;  4PDX A;  2WQ7 A;  4OIQ F;  2HV6 A;  4LER A;  5HI7 A;  4J8E A;  2WZL A;  5JJ6 A;  4G23 A;  4YND A;  2QY9 A;  2MRI A;  4HS2 A;  3OEO A;  3IEE A;  2I1J A;  5FZS A;  3FUK A;  4U0U A;  4L2L A;  2DBA A;  4L2Y A;  1E8W A;  4XWJ A;  3LCA A;  3QWP A;  5A7D B;  4CDN A;  3G2U A;  3LJ3 A;  4KYO B;  2VH3 A;  4U0Z A;  3RRN B;  5FQ7 A;  1VYI A;  2EIK C;  4ILG A;  2CDQ A;  2KW3 C;  3NDB B;  4W9R A;  3HTK C;  2PM7 A;  3DPD A;  2QTV A;  5G04 J;  4WNE A;  3QZC A;  2Y39 A;  1OWL A;  3IEG A;  4HEA J;  2G62 A;  3NYL A;  2Q3T A;  4H4K C;  3K7D A;  4GML A;  2A6H F;  2V8S E;  3KS2 A;  4AY5 A;  1XNF A;  3UMV A;  3S7B A;  4OVV A;  4I3M A;  1ZYR F;  1B89 A;  5J90 A;  3Q6N A;  4HFF B;  4WNF A;  2PP4 A;  4U5D E;  4BFR A;  4XX5 A;  3FEX A;  4HLE A;  3L13 A;  3EGD A;  3TXN A;  3UNG C;  2BF0 X;  3PEU B;  1WY6 A;  3VTY A;  3AU5 A;  3B7T A;  4NAC A;  5DQT A;  3NZS A;  2WVQ A;  4TV3 A;  2XQ0 A;  4ILI A;  5L3V A;  1HO8 A;  3FUJ A;  2IXO A;  3RH3 A;  3QK0 A;  2LSU A;  2JEK A;  3KEZ A;  2R7X A;  4XLN F;  1LS1 A;  4XZ4 A;  4DBR A;  1OWM A;  3HIZ A;  4DLO A;  2YIN A;  2WZG A;  5LCW C;  2WXN A;  3U4T A;  4DLQ A;  4I9E A;  2PZI A;  4CT0 A;  1TWH A;  3PMR A;  3FTU A;  4M63 A;  4NUR A;  3TAX A;  3G2S A;  4B0Z A;  4F1S A;  3PHF 2;  4N2Q A;  1UN8 A;  1RJ9 B;  1SF8 A;  4AK9 A;  5CCM A;  1Z3I X;  2C0M A;  3FU6 A;  5FJY A;  3ENE A;  3TG4 A;  2WL8 A;  4FLB A;  5BV1 A;  4JCH A;  3O4Z A;  3BEE A;  1X5B A;  3KL4 A;  3AG3 C;  4C3B A;  1TWG A;  3LEV A;  1SZA A;  1OKK D;  1JUQ A;  4H7Y A;  2YHE A;  2XGS A;  2CFU A;  3EFO A;  3S0X A;  1OCC C;  3HVE B;  4HE8 D;  4Q96 A;  3FUL A;  2CGE A;  4XIF A;  2R7S A;  2J4B A;  2WXO A;  1VDY A;  4DJA A;  4FJY A;  3JSZ A;  3SNX A;  1BR2 A;  2Q9B A;  2P7V A;  2L0I A;  2R5S A;  3HDX A;  2C2L A;  3JQ0 A;  3CVW A;  4A3V A;  3TJP A;  3EH2 A;  4OIR F;  4CRW A;  3ZRH A;  3PH0 C;  4PJJ A;  3GOD A;  3IKO B;  4C3D A;  4AV7 A;  4C7O A;  2KCL A;  3LPZ A;  4FP7 A;  4U8H A;  1NU9 C;  5B3S C;  4IRU A;  4AEZ C;  4J8F A;  5C2Y A;  3LVQ E;  2DIW A;  1E8Z A;  2G3V A;  2OG2 A;  2J46 A;  3RO3 A;  4IN3 B;  1PD0 A;  4GA0 A;  3FUE A;  3K1H A;  4WND A;  1FMV A;  4Q94 A;  2J9U A;  3ASD A;  4EEC A;  2IJG X;  5DVW A;  1HXI A;  5KJK A;  4PFO A;  4JHJ A;  3X1O A;  4MQ9 F;  2XXA B;  3CVQ A;  3D9N A;  1VOM A;  4A3T A;  3DM9 B;  2ZXP A;  3CVP A;  1D1C A;  2V4L A;  5BW8 C;  3OA1 A;  2ZXW C;  3ABL C;  1HF8 A;  1IQR A;  2L6J A;  4YT5 A;  3SNH A;  3LS1 A;  4J8D A;  2QY7 A;  2WXK A;  4XKC A;  4G1T A;  4H7X A;  4LUN U;  4RVB A;  2PQN A;  4BJ5 C;  3GZ1 A;  4KMO A;  5L3Q A;  4HOT A;  1D1A A;  3UR3 C;  5KYU A;  5EHH A;  4TRQ A;  4E7S A;  4Q69 A;  2AXU A;  2PX3 A;  3UT4 A;  3LAY A;  3AG2 C;  4PFP A;  1N54 A;  1E90 A;  5BPP A;  1TJC A;  3RK6 A;  4EBA G;  4EZL A;  1WM5 A;  4KNW A;  5T1D B;  4DOZ A;  5E2Q A;  4L1B A;  2RG8 A;  5AYW D;  1Z3X A;  2IQC A;  1SQM A;  3SBT B;  4AE4 B;  5A23 A;  3D9K A;  1N1C A;  1UN9 A;  3DM5 A;  4UI9 J;  2J07 A;  3SFZ A;  2FGY A;  2LSE A;  5EGY A;  2PL2 A;  2I8B A;  1E8X A;  4EPZ A;  3LES A;  5BUO A;  2L9B A;  4DBQ A;  1HG2 A;  2R7O A;  4K0R A;  4CS8 C;  4F3V A;  4KVO A;  2WPV A;  3AS8 A;  3AQB A;  2BTD A;  4ACK A;  3E4B A;  3K33 A;  3PNT B;  2UY1 A;  1V54 C;  4WWN A;  5EX0 A;  1KU2 A;  2Y3G A;  4L7T A;  5KYN A;  3LXU X;  3KD7 A;  2KCK A;  4RD9 A;  4RDA A;  3CK8 A;  3LS8 A;  4U5E E;  4APF A;  1ELW A;  3QMK A;  1M56 C;  5T3R A;  3FDH A;  3FFL A;  2HV7 A;  4OYS A;  4GZD A;  2X6F A;  3ONL A;  1Z6T A;  3N0T A;  4J30 B;  4F4B A;  3GZ2 A;  2GRM A;  1M2V B;  5BV0 A;  2UWJ G;  4BJ6 A;  4BEJ A;  1ZBP A;  3SI5 A;  4E85 A;  4KVM A;  4EQF A;  2J9V A;  3JQ1 A;  4ANJ A;  2LAI A;  5KJN A;  1ZHW A;  1MMN A;  3ZYQ A;  2J0X A;  3HYM B;  3Q7G A;  1PY1 A;  3QB2 A;  5E3C A;  2KM4 A;  3T8M A;  2NG1 A;  3EGD B;  2VSN A;  3DJU B;  4C0E A;  1LVK A;  3ML9 A;  2X51 A;  1Z3Y A;  3CSK A;  2LNI A;  2JLB A;  3LY9 A;  3LEW A;  3FHE A;  2A6E F;  4G24 A;  2UY1 B;  5IY5 C;  4FA6 A;  4KBL A;  2O9X A;  4CDM A;  4PS7 A;  3TG5 A;  2DCP A;  1ST6 A;  4ILH B;  3HLZ A;  1GW6 A;  1EF1 C;  1UJK A;  3FH8 A;  3RO2 A;  2J4D A;  4C9B B;  4AVX A;  2AWI A;  1D0Z A;  5E33 A;  3Q4A B;  3OTN A;  1TJF A;  3Q5M A;  1Z63 A;  5AJL A;  4CT4 A;  2XGO A;  5E3A A;  4C3E A;  1HE8 A;  5AJD A;  3UGP A;  4CGW A;  5KYX A;  1MND A;  5FZQ A;  3BG0 B;  4IAO A;  2IXN A;  2E0I A;  3E9V A;  4P6I C;  3CVN A;  4XLP F;  5FT9 A;  4BT8 A;  4I9C A;  4A55 A;  3L34 A;  1OWO A;  4N3B A;  4B94 A;  3L22 A;  4BTB A;  4UQY A;  4NQ0 A;  4AOF A;  4YN0 B;  3ASG A;  3T6B A;  2RD0 A;  2XEV A;  5ANR A;  1U3D A;  4I6E A;  3ECS A;  1NA3 A;  2Y3D A;  3ZN3 A;  2NXP A;  3SZR A;  4KXK B;  4BJ6 C;  2R59 A;  4CDR A;  4I44 A;  4OVU A;  1W3B A;  3RRM B;  2KJG A;  3CST A;  3FTW A;  3B0V C;  4J8S A;  1Y6I A;  5B1A C;  2DGJ A;  4BJ5 A;  3FHD A;  3D9P A;  3KKB A;  4K03 A;  4LEU A;  2EQX A;  1IYG A;  4UWF A;  5FCL A;  4N2S A;  1MQS A;  3FTZ A;  3EIQ C;  4ATG A;  3QWW A;  5EKQ D;  4GYY A;  3RRU A;  4LRZ A;  3D9M A;  2L9J A;  5FQ6 A;  5B1B C;  3ZGQ A;  4UWK A;  3LLK A;  3LLI A;  2R7U A;  4FUL A;  4WUY A;  3DD7 A;  4DK5 A;  1ELK A;  3CGH A;  4V3I A;  3DZA A;  5T3T A;  3ZHE B;  3HHM A;  4O79 A;  3AS5 A;  1TWA A;  3FP3 A;  2FEZ A;  3EH1 A;  4ANW A;  4JL0 A;  5JHA A;  3DAF A;  5KJL A;  3SHF A;  4IWB A;  4KC9 A;  3RIB A;  3LYA A;  5BNW A;  3JUI A;  4GAA A;  1QNF A;  3CVU A;  2WXG A;  2WXM A;  3ML8 A;  5KYY A;  4K7B A;  3VLE A;  4C7O B;  4X0R A;  3FY4 A;  5J08 A;  2MHK A;  5D91 A;  1DNP A;  3CIA A;  4MLP A;  3FU5 A;  2FF4 A;  4U5B E;  2VGX A;  3EGX A;  4JHK A;  2KZT B;  4MS6 A;  4I6J A;  1NU7 D;  3JRT A;  4HXI A;  3SP1 A;  3POV A;  3PUK A;  4MND A;  2PX0 A;  3CHS A;  5FQ4 A;  2FUL A;  2AW6 A;  4AY6 A;  3FU0 A;  5HQ8 A;  3IBE A;  3FUD A;  1HH8 A;  2NUP A;  4I2W A;  3ASH A;  5LFA A;  3WG7 C;  4GMJ A;  3UMK A;  4ANX A;  3U3W A;  4CS9 C;  2FO7 A;  2XPY A;  2XCB A;  5F5H A;  3Q15 A;  5FZR A;  3QJZ A;  4FES A;  3MV3 B;  5LX8 A;  1OKK A;  2OVF A;  4JA7 A;  3VLD A;  2J7P D;  3CVX A;  3FH5 A;  1RJ9 A;  4N39 A;  3FUH A;  3MYV A;  3M1C B;  2IYL D;  3LDZ A;  3QDN A;  5BT1 A;  3URZ A;  1S7Z A;  4B8C B;  2VSX E;  4Y6W A;  5LP0 A;  1WGW A;  4UWH A;  4J0U A;  1ZHT A;  3MJW A;  4GA1 A;  3EFO B;  2HYZ A;  3FAJ A;  3EPV A;  5E75 A;  4N5C A;  4KT6 B;  4CS8 A;  2VYI A;  2A4Z A;  2X6J A;  4EZK A;  4GU5 A;  5C1D A;  4ZLD A;  3B7S A;  2CHZ A;  2KNH A;  4CBE A;  5EX3 A;  4UWG A;  3VAY A;  4ABN A;  3I5Q A;  2V3C C;  3LS0 A;  3NRH A;  1Y8M A;  1BR1 A;  1HS6 A;  4XE0 A;  3D9O A;  4AJW A;  1HG5 A;  2JD3 A;  1HU3 A;  4FJZ A;  2L0T B;  2CG3 A;  4FX5 A;  1E7V A;  4GB9 A;  1E8Y A;  3RJV A;  1OWN A;  1YA0 A;  1ZHZ A;  1JPJ A;  4E7Z A;  4GA2 A;  1A17 A;  3L17 A;  3U64 A;  1M2O A;  5D92 A;  2DYR C;  3UQ3 A;  3ASO C;  4PJN A;  1D0X A;  3EJN A;  2CFZ A;  3MKQ B;  2LO6 A;  3Q47 B;  2XXA A;  1TWC A;  2IF4 A;  2Y3B A;  4PUC A;  4U5C E;  4CSA C;  4AXH A;  4RSY A;  3PE4 A;  5JJ7 A;  4JPS A;  3NYM A;  3ZYL A;  2W9Y A;  5T3W A;  3CQG B;  3S7F A;  1VYK A;  4JW1 A;  3W2W A;  2J49 A;  4JVS A;  4ULW A;  4A1S A;  3QKY A;  1IZM A;  2BUG A;  2J9Q A;  3ZG1 A;  3CK7 A;  3ZYM A;  5ARG A;  3MV2 B;  3R9A B;  2FFH A;  2A5U A;  4JZA A;  3SBS A;  1P5Q A;  3KH2 A;  3LNR A;  2KCV A;  3Q7L A;  3W8I A;  2XPI A;  2A1D D;  3PDN A;  3I4R B;  1WAO 1;  5KYX B;  3DAG A;  3DXJ F;  2P6V A;  4RBN A;  2WVI A;  4I6G A;  4URK A;  5A6C A;  3JCU Q;  2YHC A;  2XRY A;  5CCL A;  3MLG A;  3TXM A;  4DI4 A;  5E76 A;  1HX8 A;  3G2V A;  4OD5 A;  4BY6 A;  2IOS A;  4OD4 A;  4UI9 K;  3T5V A;  3EZH A;  3JYH A;  5D0Q D;  2WVN A;  2WXQ A;  4IJJ A;  3S7D A;  1KT1 A;  2WMO A;  3R7R A;  3CHP A;  3K6B A;  3B0P A;  1UJJ A;  4G25 A;  3UT8 A;  3MGB A;  4KNV A;  4CSA A;  3N71 A;  4I43 A;  3DMD A;  2XPZ A;  3QOU A;  3CLJ A;  1SZ9 A;  4BWR A;  3RYL A;  2M4E A;  4WNG A;  2CNW A;  3JT1 A;  3MCX A;  3RKV A;  3NKE A;  3GW4 A;  3CQC B;  2R7Q A;  2R7V A;  1KLX A;  5DLJ A;  3MA5 A;  3UMI A;  1ZHX A;  3S27 A;  1ZHY A;  4PS8 A;  3SF4 A;  2VTB B;  4JA9 A;  4G26 A;  3FVY A;  1HFA A;  5LOZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...