5HV9A

Human ltc4s mutant-s36e
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
143
structure length
143
Chain Sequence
b'VALLAAVTLLGVLLQAYFSLQVISARRAFRVEPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leukotriene C4 synthase
molecule tags Lyase
source organism Homo sapiens
publication title Phosphorylation of Leukotriene C4 Synthase at Serine 36 Impairs Catalytic Activity.
pubmed doi rcsb
total genus 52
structure length 143
sequence length 143
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 5hv9A00
2PNOA 3HKKA 4J7YA 4YL1A 4YK5A 4YL3A 5BQIA 4BPMA 5HV9A 4AL1A 3LEOA 5K0IA 4JRZA 4NTAA 2Q7RA 2UUHA 4JCZA 2UUIA 5BQHA 4YL0A 3PCVA 3DWWA 4NTBA 4AL0A 5BQGA 4JC7A 4J7TA 2H8AA 3B29A 4WABA 4NTFA
chains in the Genus database with same CATH superfamily
2PNOA 5JLIA 1A0BA 3C62A 2YHSA 5JT4A 4LDKA 4LACB 3GEEA 2EILC 4JJGA 1K05A 2A68F 2XS8A 4CJGA 3FHDA 3FMSA 4WJ0A 4OIPF 4CX9A 3RYLA 3Q7GA 3TJ6A 1YVIA 5KYUA 1M57C 4BJTA 2P0NA 2R03A 2G3KA 5COFA 3GANA 4FESA 4U5CE 5L0FA 3JCUQ 2M64A 4NTAA 3TK0A 3TJ5A 4AE4A 3MBGA 1TWCA 4JW1A 3IHUA 4N6CA 2PX3A 4ULVA 2Q3TA 3CZ6A 3OWTA 3RKOF 2ZPAA 1V55C 1TWHA 2GAQA 1RXQA 4I44A 4HE8D 3ZWIA 2Q9AA 1GQAA 2YL0A 3K6BA 3SP1A 3SXYA 1UG7A 3JTLO 3LS0A 4PJLA 3TD7A 5B3IA 1FR0A 3NKDA 5DQZA 1OKKD 4D4NA 4MVRA 3SZRA 3TOLA 5KYUB 1LE2A 2CDQA 2VASA 4H54A 1C02A 1PD0A 2A6EF 2OG2A 5KYXA 1ZYRF 4MVMA 4KC9A 1MNDA 3VF0A 1ORJA 2LFDA 3C7JA 3H2VA 2NG1A 3HNKA 2Q00A 5T3WA 1VOMA 2GWWA 4FAPB 4M63A 1WOLA 5KYYA 4UDVA 3EH1A 2DB4A 2HJMA 2L9JA 2MWQA 3KYJA 1L7CA 1ORSC 2A0UA 4JCZA 3GWLA 3MLGA 3DWWA 3PMRA 4G78A 4NTBA 2LQGA 2BL2A 5CI9A 5BQGA 1J8MF 3RF3A 2Y3GA 1TKNA 2OEXA 3EHNA 4XPXA 1VTMP 4JE9A 2CW0F 5EGYA 1OCRC 2AU5A 2AWCA 3ABMC 2F22A 2FAPB 3GWNA 3ZVRA 4U5GA 1N1CA 2LD6A 4BEMJ 3N24A 2IXPA 1QPUA 3M15A 1NG1A 1M2VA 2H7OA 3JYYA 2IXOA 4JIOA 3U9MA 5FCLA 2OCCC 5B3SC 4DXWA 2NUPA 2PF4E 2IOQA 2YL1A 1YDIA 1Y4CA 4MNDA 4O7GA 1XWJA 3K1IC 3L8JA 4YL1A 3SYNA 2XXAB 3FVYA 1SZIA 4MVZA 1EI7A 1YARO 4JVSA 1U0BB 1TWAA 4BG0A 4DJ9A 4G0HA 5JS5A 2LSEA 3LLIA 2HV6A 3BEHA 2VCBA 1M6TA 1Z5ZA 2ZXOA 4C7OA 1KTMA 4XEKA 3N2ZB 5L0CA 5B1BC 2JX0A 4OIRF 2I8BA 1PCXA 5D92A 2R7WA 1JMWA 2EIKC 1J8YF 2DGJA 2EPNA 1RJ9A 4E7SA 5IY5C 4H4KC 4J7YA 2XXAA 3KKBA 3VM6A 2EPKX 2PBEA 3VAYA 2R7UA 3JRTA 3QZCA 1W2WA 5DLJA 5BQIA 4YL3A 4QDLA 2V3CC 3AQBA 3IQ6A 1JPJA 2W4MA 4NC3A 4NCQA 4AE4B 4EBJA 5L0IA 2V26A 2R7RA 1VYIA 2WZLA 2AP3A 3C8ZA 3EG9A 2L81A 4C7OB 4CDAA 4O6MA 1NBBA 3L0IA 4U9EA 1B68A 3EJNA 5D91A 3S27A 1XZPA 1R5ID 2Q9BA 4YT5A 3SXKA 2FGYA 1Z63A 5BUOA 1BR1A 1ZW2A 3PHF2 3K66A 1Z23A 2LFFA 4XEVA 1DOVA 3T6GB 3K1HA 2XLHA 5KYNA 1ZU5A 1WGWA 2HMQA 2P7VA 1UFBA 2QTVA 3T4RA 1ZU4A 1Q0GA 2HZ8A 3RVZA 3DE9A 4U9DA 3FAJA 2EPLX 2YRFA 4JEBA 2PP4A 2QUPA 3ZQVA 2E87A 3JZ0A 1LIHA 3UGOA 2NPUA 1LM3B 3LEOA 4N6HA 1NLXA 1D0XA 3OA1A 2Q7RA 2UUHA 3ITFA 2VB6A 1F1MA 2XL6A 3QW1A 3RQGA 5BQHA 4G7OF 1Y6DA 3S29A 4CBEA 4FWVA 2Y3HA 3DAGA 1XZQA 4RDAA 1CGME 2KGOA 3G50A 2QNLA 1ZHXA 3AG2C 3GM1A 1FFTC 1SMYF 1Z7Qc 3S28A 3U2LA 3C63A 1M2VB 2O9XA 1APCA 3CQZA 3VYWA 2A0BA 3E9VA 4I3MA 4W8KA 3FXHA 1QZXA 2J9UA 3MYFA 4HFKB 3KH2A 5F28E 3AG1C 1I5NA 5A69A 1SF8A 2L6HA 4IGGA 2YZSA 2OJED 4GQHA 2Y69C 3L8IA 2CYDA 4DVZA 5HV9A 2DYSC 4BJ1A 2XSEA 1YZAA 4MQ9F 4HFFB 4AL1A 3NDBB 4B6IA 5DS6A 3X2QC 3L34A 3U2MA 3ZDLA 2OOCA 2J9BA 3AQCA 2MHRA 4DBQA 2J9WA 3ATPA 5DS4A 2YWAA 3UGPA 1IZMA 1D1CA 3GEIA 3KYIA 2AVKA 2YLGA 2A1DD 4I1MA 4XEFA 3LUTB 3HNLA 3NYJA 2XM0A 3S90A 1KNYA 2RD9A 1E84A 1TFOB 3NYMA 5JVEA 1OCCC 3B29A 1G4WR 3S0XA 2R7QA 5KYWA 2XRHA 1C17M 1NZEA 2G3VA 3HKKA 4CS9A 4D4XA 3PDMP 5E3AA 1MMNA 2VC9A 1JPNA 3NKEA 2HUJA 2KYHA 3Q6MA 5F5HA 4IAQA 3RQFA 3QMKA 2H7VC 1FAPB 1OR3A 2WVOA 1ZHWA 2B0HA 3SXZA 1EKYA 4YT8A 4BJ6A 3AOUA 1T5OA 2J7PA 3ZQYA 4DRHB 5KYXB 3GM3A 2I15A 4MTFA 4KNVA 1TFKB 2CGEA 3MFNA 1VLSA 2P61A 2JPUA 1E2XA 3EGXB 3V5YA 1GS9A 3ZIBA 4LLEA 4NQFA 4U5DE 3U3FA 3QW0A 2OU6A 4CDYA 5KYYB 1OKKA 4BJ6C 5L0JA 5KYWB 3O6XA 2M4EA 5DS5A 1QQ3A 1A41A 2VH3A 2OQMA 1A7EA 3MYIA 2FFHA 1ZHZA 4LLCA 1HW2A 3T6BA 1QVXA 2KW3C 3DJNB 1OW6A 2EIMC 3JT1A 1NFOA 2ETSA 2Y39A 4WGZA 1OR2A 3HTKC 3WAQA 4CIHA 3H65A 1Q0MA 3SEOA 1WTYA 3RIPA 1YA7O 4XLPF 1M2OA 2BC5A 3NMIA 1OXKA 1FTSA 4QI0A 3EH2A 1CGNA 3SXMA 4YT2A 5A6JA 2TMVP 4Q4ZF 4MW8A 2EINC 2UUIA 3DJUB 1WWPA 1OW7A 1YAUO 3NRHA 3JSEO 4K7BA 1RKEA 2D5RB 3K33A 4Z9JA 2GDCA 2Q9CA 1WN0A 3C8GB 3M79A 256BA 2KSFA 1LVKA 4I1OB 2HKVA 4IB4A 2HV7A 5T1DB 4G7ZF 3EFOA 2YVKA 2Y3BA 3KPHA 3LESA 3LLKA 2B0JA 3JYHA 5T3TA 4ANJA 3BRJA 2IM8A 3TQOA 4HEAJ 1PV3A 1Z3IX 2XLDA 3U3BA 2EIJC 3H2UA 3IPMO 4Q7CA 4ULWA 4YN0B 3ZTMA 3U0CA 2YQYA 1G5ZA 3DXJF 4EHPA 4OIQF 2NSGA 3ABLC 1BR2A 1L3PA 1YJGA 2VCAA 3EZHA 3Q7LA 4JJFA 3C18A 2BE5F 5DQTA 2J8WA 1BDJB 3IQCA 5AC4A 4LDQA 5JRAA 3ZSUA 3Q6NA 1C03A 1SR2A 3EGDB 2QY9A 3PCVA 4MS2A 1OCZC 4N06A 3EG9B 1A7DA 3EFOB 4J32B 4MW3A 3U9JA 3AG3C 4E17A 3S84A 3IQ5A 1E83A 4RD9A 4DRIB 4FX5A 2R7OA 3US6A 2KC3A 3W4YA 1ORYA 2A6HF 2WVNA 1FNTc 4U5HA 1MMGA 2QE9A 3DZAA 1HY5A 1LI5A 3W8IA 3LAYA 3WG7C 3O55A 4XQ1A 2IYLD 1G8XA 5F5FA 3DM9B 1RMVA 1MNEA 4O6NA 1I4ZA 2EPOA 3DI5A 1U89A 4OD4A 3W2WA 2ZXPA 3UR3C 2XLEA 3B71A 1WATA 4E18A 4P6IC 2ASRA 3J06A 3EGXA 3AGUA 3FAPB 3V5XA 4JRZA 1ZHTA 1D1BA 3HLZA 3EQLF 4PJNA 2XM4A 4XWJA 3F47A 4PFPA 1D0ZA 3HNIA 5E2QA 4IJJA 2J0WA 2ZXWC 3R2PA 4KI2A 5EK0A 5A6BA 1T01A 2DI3A 4R32A 4QI2A 1LS1A 1NU7D 1T6IA 3DE8A 5E3CA 3B9QA 3DMDA 5COGA 3SNHA 3V5ZA 1JRAA 4MVSA 1OCOC 3NYLA 1Q0DA 2CNWD 2KK1A 4OD5A 3ZG1A 1BZ4A 4L6RA 1ZVZA 3A9CA 3RVYA 2R02A 4EUKB 1MMAA 2VCCA 1Q0KA 2Z15A 3CSKA 5DVWA 4BEJA 1O3UA 4BPMA 1YZCA 1AUEA 4BJ5C 3MX3A 1OXBA 3B0UX 2PX0A 3RH3A 5B1AC 4LDRA 3M1CB 3GM2A 2ICWG 3CEXA 3S9OA 3LNMB 3DD7A 3UMHA 3QTHA 2XS1A 4CSAA 4PJMA 2XLWA 1JR8A 1H9TA 1CPQA 3ASNC 2MYSA 2YL7A 5CIVA 1MQVA 3EPVA 3CAXA 5E33A 4EKWA 2HS5A 2R25A 1M56C 1LPEA 1JOGA 4NTFA 1H6GA 4K1OA 4JTAB 1NU9C 1QKRA 2D4UA 1AEPA 1YYJA 2HSQA 2OKUA 4PFOA 2R7VA 2NUTA 2P6VA 3IQTA 3AG4C 2LCHA 1CGOA 1AVOB 4Z9IA 3X1OA 5COMA 5EHHA 1LE4A 3FOPA 4ZLDA 1Z6AA 1HE1A 4BJ5A 1PD1A 5JSLA 4XLNF 1NSGB 3B0VC 1TR2A 2W45A 3UMIA 1T6QA 1V4AA 3W2VA 4K0DA 5GPGB 3U5SA 3HJCA 1IW7F 1U6HA 4AL0A 2WZGA 3C8GD 2HJ3A 4CSAC 1HE9A 2QLAA 3NG1A 4IWBA 1JAFA 4PR9A 4J7TA 3OEOA 3JRMO 4U5FE 3EHMA 1O5HA 5L3VA 1RJ9B 2YLIA 1GGQA 2H8AA 1I4YA 2NUTB 1V74B 5AGFA 3E70C 2X51A 4DOZA 5JUAA 3KL4A 1EA8A 4NY3A 2XL4A 3HNJA 2YL3A 3RQEA 1FMWA 2KJGA 3M4CA 4CS8C 2LIGA 3FDQA 1VB5A 4PACA 1OQCA 1LKXA 3AGTA 2WVQA 2L6GA 3POVA 4EWCA 4GYTA 3LNRA 1D0YA 5K0IA 1VMAA 4PK4A 3ZTZA 4EIYA 1ZHYA 4YJWA 2H7BA 4IARA 5JP7A 3R7CA 1LI7A 5L3QA 4IAOA 2RSEB 4U5BE 4GEHA 1VLTA 3I5PA 4JTDB 2HFIA 1T9KA 5L0GA 4G7HF 4ZLCA 1TWGA 1H9GA 3I5QA 4IRUA 1EQ1A 3LEVA 1RKEB 4A2NB 4JEAA 4OINF 4W8PA 4CJOA 3C8GA 1OW8A 2NUPB 4JZAA 4JC7A 2OEVA 3EZIA 3G4ZA 3G4XA 3KMIA 5HSWA 4DRJB 4DVYP 2JD3A 1S7ZA 4JKVA 2LK4A 1R4TA 2C03A 2J9VA 4DBRA 2EPMX 4C3DA 4CIPA 3RW0A 1MMDA 1K40A 2C04A 2LP4A 3GODA 4X0RA 4YK5A 1T6UA 2R9RB 2ZXRA 3M4BA 1O87A 3GORA 4N4WA 4O79A 3V7OA 4AX2A 2W9YA 1SYQA 2R7SA 5L0DA 1G4US 3FOOA 3O10A 1LS4A 2HSBA 2CNWA 4JTCB 1YLMA 2G62A 3ABKC 2XLVA 4LERA 1E85A 3ASOC 2L7AA 3F46A 3I4UA 2NSFA 5CI8A 1HMDA 4XPWA 2X0CA 1BBHA 1DOWA 2J7PD 1VYKA 3EGDA 3WODF 3U8VA 4CS7A 3ZC4A 4E7ZA 5L0HA 1ST6A 1CPRA 2WB7A 1A7VA 4PJJA 5A6KA 1GM5A 3L1MA 2R7TA 2HMZA 2J46A 1VK5A 5A6BD 3QVYA 4O6YA 1V54C 2PFDA 2IXNA 2AWYA 3W8HA 2J0XA 1FMVA 4JCHA 1K04A 1NFNA 3O39A 4C3BA 1QSPA 3IEEA 2CCYA 2YEVA 3N0TA 3LJBA 3A11A 4XPYA 4F4BA 4J30B 4Q5SF 4OIOF 4E0IA 4KBLA 1Q0FA 4ER9A 1E86A 1FFHA 1D1AA 4MTGA 4ONSA 1H7IA 1ZZPA 4AK9A 5AC5A 2KNHA 1ZW3A 3NMJA 4WGYA 4CS8A 1KU2A 2IBFA 3TOMA 3TULA 3QVZA 4CDVA 4E0HA 4MVUA 2DYRC 2WZFA 3VRCA 1YYXA 5A6AA 4EBBA 2L6FA 4WABA 5TJ5E 1TQGA 2YLDA 4P9TA 2Y3DA 4U5EE 3DAFA 2IXMA 3K1IA 1QLEC 1BR4A 1YA9A 2XLOA 1WASA 4EBKA 2R05A 3T9OA 3B0PA 3ECSA 1RKCA 3T6JA 4MVOA 3K7DA 4RBNA 5FZTA 1HW1A 3DM5A 4P9FA 4YWQA 3GEHA 2XL8A 3WHNA 3DKAA 2WL8A 2J45A 3LS1A 4MVQA 2OJQA 2XLMA 4JURI 4YL0A 2R7XA 1RCPA 2A69F 2ZD9A 2GA0A 1S05A 3UMKA 1HMOA 2KQ9A 4MTOA 4KNWA 4C3EA 3NMKA 2Q4FA 4XTKA 4Z9HA 3U8PA 3UNGC 4A4AA 4CS9C 2P1AA 4YT4A 2GFHA 2YKZA 3JSZA 3RFYA 2W4BA 3AJMA
chains in the Genus database with same CATH topology
2PNOA 3HKKA 4J7YA 4YL1A 4YK5A 4YL3A 5BQIA 4BPMA 5HV9A 4AL1A 3LEOA 5K0IA 4JRZA 4NTAA 2Q7RA 2UUHA 4JCZA 2UUIA 5BQHA 4YL0A 3PCVA 3DWWA 4NTBA 4AL0A 5BQGA 4JC7A 4J7TA 2H8AA 3B29A 4WABA 4NTFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PNO A;  3HKK A;  4J7Y A;  4YL1 A;  4YK5 A;  4YL3 A;  5BQI A;  4BPM A;  5HV9 A;  4AL1 A;  3LEO A;  5K0I A;  4JRZ A;  4NTA A;  2Q7R A;  2UUH A;  4JCZ A;  2UUI A;  5BQH A;  4YL0 A;  3PCV A;  3DWW A;  4NTB A;  4AL0 A;  5BQG A;  4JC7 A;  4J7T A;  2H8A A;  3B29 A;  4WAB A;  4NTF A; 
#chains in the Genus database with same CATH topology
 2PNO A;  5JLI A;  1A0B A;  3C62 A;  2YHS A;  5JT4 A;  4LDK A;  4LAC B;  3GEE A;  2EIL C;  4JJG A;  1K05 A;  2A68 F;  2XS8 A;  4CJG A;  3FHD A;  3FMS A;  4WJ0 A;  4OIP F;  4CX9 A;  3RYL A;  3Q7G A;  3TJ6 A;  1YVI A;  5KYU A;  1M57 C;  4BJT A;  2P0N A;  2R03 A;  2G3K A;  5COF A;  3GAN A;  4FES A;  4U5C E;  5L0F A;  3JCU Q;  2M64 A;  4NTA A;  3TK0 A;  3TJ5 A;  4AE4 A;  3MBG A;  1TWC A;  4JW1 A;  3IHU A;  4N6C A;  2PX3 A;  4ULV A;  2Q3T A;  3CZ6 A;  3OWT A;  3RKO F;  2ZPA A;  1V55 C;  1TWH A;  2GAQ A;  1RXQ A;  4I44 A;  4HE8 D;  3ZWI A;  2Q9A A;  1GQA A;  2YL0 A;  3K6B A;  3SP1 A;  3SXY A;  1UG7 A;  3JTL O;  3LS0 A;  4PJL A;  3TD7 A;  5B3I A;  1FR0 A;  3NKD A;  5DQZ A;  1OKK D;  4D4N A;  4MVR A;  3SZR A;  3TOL A;  5KYU B;  1LE2 A;  2CDQ A;  2VAS A;  4H54 A;  1C02 A;  1PD0 A;  2A6E F;  2OG2 A;  5KYX A;  1ZYR F;  4MVM A;  4KC9 A;  1MND A;  3VF0 A;  1ORJ A;  2LFD A;  3C7J A;  3H2V A;  2NG1 A;  3HNK A;  2Q00 A;  5T3W A;  1VOM A;  2GWW A;  4FAP B;  4M63 A;  1WOL A;  5KYY A;  4UDV A;  3EH1 A;  2DB4 A;  2HJM A;  2L9J A;  2MWQ A;  3KYJ A;  1L7C A;  1ORS C;  2A0U A;  4JCZ A;  3GWL A;  3MLG A;  3DWW A;  3PMR A;  4G78 A;  4NTB A;  2LQG A;  2BL2 A;  5CI9 A;  5BQG A;  1J8M F;  3RF3 A;  2Y3G A;  1TKN A;  2OEX A;  3EHN A;  4XPX A;  1VTM P;  4JE9 A;  2CW0 F;  5EGY A;  1OCR C;  2AU5 A;  2AWC A;  3ABM C;  2F22 A;  2FAP B;  3GWN A;  3ZVR A;  4U5G A;  1N1C A;  2LD6 A;  4BEM J;  3N24 A;  2IXP A;  1QPU A;  3M15 A;  1NG1 A;  1M2V A;  2H7O A;  3JYY A;  2IXO A;  4JIO A;  3U9M A;  5FCL A;  2OCC C;  5B3S C;  4DXW A;  2NUP A;  2PF4 E;  2IOQ A;  2YL1 A;  1YDI A;  1Y4C A;  4MND A;  4O7G A;  1XWJ A;  3K1I C;  3L8J A;  4YL1 A;  3SYN A;  2XXA B;  3FVY A;  1SZI A;  4MVZ A;  1EI7 A;  1YAR O;  4JVS A;  1U0B B;  1TWA A;  4BG0 A;  4DJ9 A;  4G0H A;  5JS5 A;  2LSE A;  3LLI A;  2HV6 A;  3BEH A;  2VCB A;  1M6T A;  1Z5Z A;  2ZXO A;  4C7O A;  1KTM A;  4XEK A;  3N2Z B;  5L0C A;  5B1B C;  2JX0 A;  4OIR F;  2I8B A;  1PCX A;  5D92 A;  2R7W A;  1JMW A;  2EIK C;  1J8Y F;  2DGJ A;  2EPN A;  1RJ9 A;  4E7S A;  5IY5 C;  4H4K C;  4J7Y A;  2XXA A;  3KKB A;  3VM6 A;  2EPK X;  2PBE A;  3VAY A;  2R7U A;  3JRT A;  3QZC A;  1W2W A;  5DLJ A;  5BQI A;  4YL3 A;  4QDL A;  2V3C C;  3AQB A;  3IQ6 A;  1JPJ A;  2W4M A;  4NC3 A;  4NCQ A;  4AE4 B;  4EBJ A;  5L0I A;  2V26 A;  2R7R A;  1VYI A;  2WZL A;  2AP3 A;  3C8Z A;  3EG9 A;  2L81 A;  4C7O B;  4CDA A;  4O6M A;  1NBB A;  3L0I A;  4U9E A;  1B68 A;  3EJN A;  5D91 A;  3S27 A;  1XZP A;  1R5I D;  2Q9B A;  4YT5 A;  3SXK A;  2FGY A;  1Z63 A;  5BUO A;  1BR1 A;  1ZW2 A;  3PHF 2;  3K66 A;  1Z23 A;  2LFF A;  4XEV A;  1DOV A;  3T6G B;  3K1H A;  2XLH A;  5KYN A;  1ZU5 A;  1WGW A;  2HMQ A;  2P7V A;  1UFB A;  2QTV A;  3T4R A;  1ZU4 A;  1Q0G A;  2HZ8 A;  3RVZ A;  3DE9 A;  4U9D A;  3FAJ A;  2EPL X;  2YRF A;  4JEB A;  2PP4 A;  2QUP A;  3ZQV A;  2E87 A;  3JZ0 A;  1LIH A;  3UGO A;  2NPU A;  1LM3 B;  3LEO A;  4N6H A;  1NLX A;  1D0X A;  3OA1 A;  2Q7R A;  2UUH A;  3ITF A;  2VB6 A;  1F1M A;  2XL6 A;  3QW1 A;  3RQG A;  5BQH A;  4G7O F;  1Y6D A;  3S29 A;  4CBE A;  4FWV A;  2Y3H A;  3DAG A;  1XZQ A;  4RDA A;  1CGM E;  2KGO A;  3G50 A;  2QNL A;  1ZHX A;  3AG2 C;  3GM1 A;  1FFT C;  1SMY F;  1Z7Q c;  3S28 A;  3U2L A;  3C63 A;  1M2V B;  2O9X A;  1APC A;  3CQZ A;  3VYW A;  2A0B A;  3E9V A;  4I3M A;  4W8K A;  3FXH A;  1QZX A;  2J9U A;  3MYF A;  4HFK B;  3KH2 A;  5F28 E;  3AG1 C;  1I5N A;  5A69 A;  1SF8 A;  2L6H A;  4IGG A;  2YZS A;  2OJE D;  4GQH A;  2Y69 C;  3L8I A;  2CYD A;  4DVZ A;  5HV9 A;  2DYS C;  4BJ1 A;  2XSE A;  1YZA A;  4MQ9 F;  4HFF B;  4AL1 A;  3NDB B;  4B6I A;  5DS6 A;  3X2Q C;  3L34 A;  3U2M A;  3ZDL A;  2OOC A;  2J9B A;  3AQC A;  2MHR A;  4DBQ A;  2J9W A;  3ATP A;  5DS4 A;  2YWA A;  3UGP A;  1IZM A;  1D1C A;  3GEI A;  3KYI A;  2AVK A;  2YLG A;  2A1D D;  4I1M A;  4XEF A;  3LUT B;  3HNL A;  3NYJ A;  2XM0 A;  3S90 A;  1KNY A;  2RD9 A;  1E84 A;  1TFO B;  3NYM A;  5JVE A;  1OCC C;  3B29 A;  1G4W R;  3S0X A;  2R7Q A;  5KYW A;  2XRH A;  1C17 M;  1NZE A;  2G3V A;  3HKK A;  4CS9 A;  4D4X A;  3PDM P;  5E3A A;  1MMN A;  2VC9 A;  1JPN A;  3NKE A;  2HUJ A;  2KYH A;  3Q6M A;  5F5H A;  4IAQ A;  3RQF A;  3QMK A;  2H7V C;  1FAP B;  1OR3 A;  2WVO A;  1ZHW A;  2B0H A;  3SXZ A;  1EKY A;  4YT8 A;  4BJ6 A;  3AOU A;  1T5O A;  2J7P A;  3ZQY A;  4DRH B;  5KYX B;  3GM3 A;  2I15 A;  4MTF A;  4KNV A;  1TFK B;  2CGE A;  3MFN A;  1VLS A;  2P61 A;  2JPU A;  1E2X A;  3EGX B;  3V5Y A;  1GS9 A;  3ZIB A;  4LLE A;  4NQF A;  4U5D E;  3U3F A;  3QW0 A;  2OU6 A;  4CDY A;  5KYY B;  1OKK A;  4BJ6 C;  5L0J A;  5KYW B;  3O6X A;  2M4E A;  5DS5 A;  1QQ3 A;  1A41 A;  2VH3 A;  2OQM A;  1A7E A;  3MYI A;  2FFH A;  1ZHZ A;  4LLC A;  1HW2 A;  3T6B A;  1QVX A;  2KW3 C;  3DJN B;  1OW6 A;  2EIM C;  3JT1 A;  1NFO A;  2ETS A;  2Y39 A;  4WGZ A;  1OR2 A;  3HTK C;  3WAQ A;  4CIH A;  3H65 A;  1Q0M A;  3SEO A;  1WTY A;  3RIP A;  1YA7 O;  4XLP F;  1M2O A;  2BC5 A;  3NMI A;  1OXK A;  1FTS A;  4QI0 A;  3EH2 A;  1CGN A;  3SXM A;  4YT2 A;  5A6J A;  2TMV P;  4Q4Z F;  4MW8 A;  2EIN C;  2UUI A;  3DJU B;  1WWP A;  1OW7 A;  1YAU O;  3NRH A;  3JSE O;  4K7B A;  1RKE A;  2D5R B;  3K33 A;  4Z9J A;  2GDC A;  2Q9C A;  1WN0 A;  3C8G B;  3M79 A;  256B A;  2KSF A;  1LVK A;  4I1O B;  2HKV A;  4IB4 A;  2HV7 A;  5T1D B;  4G7Z F;  3EFO A;  2YVK A;  2Y3B A;  3KPH A;  3LES A;  3LLK A;  2B0J A;  3JYH A;  5T3T A;  4ANJ A;  3BRJ A;  2IM8 A;  3TQO A;  4HEA J;  1PV3 A;  1Z3I X;  2XLD A;  3U3B A;  2EIJ C;  3H2U A;  3IPM O;  4Q7C A;  4ULW A;  4YN0 B;  3ZTM A;  3U0C A;  2YQY A;  1G5Z A;  3DXJ F;  4EHP A;  4OIQ F;  2NSG A;  3ABL C;  1BR2 A;  1L3P A;  1YJG A;  2VCA A;  3EZH A;  3Q7L A;  4JJF A;  3C18 A;  2BE5 F;  5DQT A;  2J8W A;  1BDJ B;  3IQC A;  5AC4 A;  4LDQ A;  5JRA A;  3ZSU A;  3Q6N A;  1C03 A;  1SR2 A;  3EGD B;  2QY9 A;  3PCV A;  4MS2 A;  1OCZ C;  4N06 A;  3EG9 B;  1A7D A;  3EFO B;  4J32 B;  4MW3 A;  3U9J A;  3AG3 C;  4E17 A;  3S84 A;  3IQ5 A;  1E83 A;  4RD9 A;  4DRI B;  4FX5 A;  2R7O A;  3US6 A;  2KC3 A;  3W4Y A;  1ORY A;  2A6H F;  2WVN A;  1FNT c;  4U5H A;  1MMG A;  2QE9 A;  3DZA A;  1HY5 A;  1LI5 A;  3W8I A;  3LAY A;  3WG7 C;  3O55 A;  4XQ1 A;  2IYL D;  1G8X A;  5F5F A;  3DM9 B;  1RMV A;  1MNE A;  4O6N A;  1I4Z A;  2EPO A;  3DI5 A;  1U89 A;  4OD4 A;  3W2W A;  2ZXP A;  3UR3 C;  2XLE A;  3B71 A;  1WAT A;  4E18 A;  4P6I C;  2ASR A;  3J06 A;  3EGX A;  3AGU A;  3FAP B;  3V5X A;  4JRZ A;  1ZHT A;  1D1B A;  3HLZ A;  3EQL F;  4PJN A;  2XM4 A;  4XWJ A;  3F47 A;  4PFP A;  1D0Z A;  3HNI A;  5E2Q A;  4IJJ A;  2J0W A;  2ZXW C;  3R2P A;  4KI2 A;  5EK0 A;  5A6B A;  1T01 A;  2DI3 A;  4R32 A;  4QI2 A;  1LS1 A;  1NU7 D;  1T6I A;  3DE8 A;  5E3C A;  3B9Q A;  3DMD A;  5COG A;  3SNH A;  3V5Z A;  1JRA A;  4MVS A;  1OCO C;  3NYL A;  1Q0D A;  2CNW D;  2KK1 A;  4OD5 A;  3ZG1 A;  1BZ4 A;  4L6R A;  1ZVZ A;  3A9C A;  3RVY A;  2R02 A;  4EUK B;  1MMA A;  2VCC A;  1Q0K A;  2Z15 A;  3CSK A;  5DVW A;  4BEJ A;  1O3U A;  4BPM A;  1YZC A;  1AUE A;  4BJ5 C;  3MX3 A;  1OXB A;  3B0U X;  2PX0 A;  3RH3 A;  5B1A C;  4LDR A;  3M1C B;  3GM2 A;  2ICW G;  3CEX A;  3S9O A;  3LNM B;  3DD7 A;  3UMH A;  3QTH A;  2XS1 A;  4CSA A;  4PJM A;  2XLW A;  1JR8 A;  1H9T A;  1CPQ A;  3ASN C;  2MYS A;  2YL7 A;  5CIV A;  1MQV A;  3EPV A;  3CAX A;  5E33 A;  4EKW A;  2HS5 A;  2R25 A;  1M56 C;  1LPE A;  1JOG A;  4NTF A;  1H6G A;  4K1O A;  4JTA B;  1NU9 C;  1QKR A;  2D4U A;  1AEP A;  1YYJ A;  2HSQ A;  2OKU A;  4PFO A;  2R7V A;  2NUT A;  2P6V A;  3IQT A;  3AG4 C;  2LCH A;  1CGO A;  1AVO B;  4Z9I A;  3X1O A;  5COM A;  5EHH A;  1LE4 A;  3FOP A;  4ZLD A;  1Z6A A;  1HE1 A;  4BJ5 A;  1PD1 A;  5JSL A;  4XLN F;  1NSG B;  3B0V C;  1TR2 A;  2W45 A;  3UMI A;  1T6Q A;  1V4A A;  3W2V A;  4K0D A;  5GPG B;  3U5S A;  3HJC A;  1IW7 F;  1U6H A;  4AL0 A;  2WZG A;  3C8G D;  2HJ3 A;  4CSA C;  1HE9 A;  2QLA A;  3NG1 A;  4IWB A;  1JAF A;  4PR9 A;  4J7T A;  3OEO A;  3JRM O;  4U5F E;  3EHM A;  1O5H A;  5L3V A;  1RJ9 B;  2YLI A;  1GGQ A;  2H8A A;  1I4Y A;  2NUT B;  1V74 B;  5AGF A;  3E70 C;  2X51 A;  4DOZ A;  5JUA A;  3KL4 A;  1EA8 A;  4NY3 A;  2XL4 A;  3HNJ A;  2YL3 A;  3RQE A;  1FMW A;  2KJG A;  3M4C A;  4CS8 C;  2LIG A;  3FDQ A;  1VB5 A;  4PAC A;  1OQC A;  1LKX A;  3AGT A;  2WVQ A;  2L6G A;  3POV A;  4EWC A;  4GYT A;  3LNR A;  1D0Y A;  5K0I A;  1VMA A;  4PK4 A;  3ZTZ A;  4EIY A;  1ZHY A;  4YJW A;  2H7B A;  4IAR A;  5JP7 A;  3R7C A;  1LI7 A;  5L3Q A;  4IAO A;  2RSE B;  4U5B E;  4GEH A;  1VLT A;  3I5P A;  4JTD B;  2HFI A;  1T9K A;  5L0G A;  4G7H F;  4ZLC A;  1TWG A;  1H9G A;  3I5Q A;  4IRU A;  1EQ1 A;  3LEV A;  1RKE B;  4A2N B;  4JEA A;  4OIN F;  4W8P A;  4CJO A;  3C8G A;  1OW8 A;  2NUP B;  4JZA A;  4JC7 A;  2OEV A;  3EZI A;  3G4Z A;  3G4X A;  3KMI A;  5HSW A;  4DRJ B;  4DVY P;  2JD3 A;  1S7Z A;  4JKV A;  2LK4 A;  1R4T A;  2C03 A;  2J9V A;  4DBR A;  2EPM X;  4C3D A;  4CIP A;  3RW0 A;  1MMD A;  1K40 A;  2C04 A;  2LP4 A;  3GOD A;  4X0R A;  4YK5 A;  1T6U A;  2R9R B;  2ZXR A;  3M4B A;  1O87 A;  3GOR A;  4N4W A;  4O79 A;  3V7O A;  4AX2 A;  2W9Y A;  1SYQ A;  2R7S A;  5L0D A;  1G4U S;  3FOO A;  3O10 A;  1LS4 A;  2HSB A;  2CNW A;  4JTC B;  1YLM A;  2G62 A;  3ABK C;  2XLV A;  4LER A;  1E85 A;  3ASO C;  2L7A A;  3F46 A;  3I4U A;  2NSF A;  5CI8 A;  1HMD A;  4XPW A;  2X0C A;  1BBH A;  1DOW A;  2J7P D;  1VYK A;  3EGD A;  3WOD F;  3U8V A;  4CS7 A;  3ZC4 A;  4E7Z A;  5L0H A;  1ST6 A;  1CPR A;  2WB7 A;  1A7V A;  4PJJ A;  5A6K A;  1GM5 A;  3L1M A;  2R7T A;  2HMZ A;  2J46 A;  1VK5 A;  5A6B D;  3QVY A;  4O6Y A;  1V54 C;  2PFD A;  2IXN A;  2AWY A;  3W8H A;  2J0X A;  1FMV A;  4JCH A;  1K04 A;  1NFN A;  3O39 A;  4C3B A;  1QSP A;  3IEE A;  2CCY A;  2YEV A;  3N0T A;  3LJB A;  3A11 A;  4XPY A;  4F4B A;  4J30 B;  4Q5S F;  4OIO F;  4E0I A;  4KBL A;  1Q0F A;  4ER9 A;  1E86 A;  1FFH A;  1D1A A;  4MTG A;  4ONS A;  1H7I A;  1ZZP A;  4AK9 A;  5AC5 A;  2KNH A;  1ZW3 A;  3NMJ A;  4WGY A;  4CS8 A;  1KU2 A;  2IBF A;  3TOM A;  3TUL A;  3QVZ A;  4CDV A;  4E0H A;  4MVU A;  2DYR C;  2WZF A;  3VRC A;  1YYX A;  5A6A A;  4EBB A;  2L6F A;  4WAB A;  5TJ5 E;  1TQG A;  2YLD A;  4P9T A;  2Y3D A;  4U5E E;  3DAF A;  2IXM A;  3K1I A;  1QLE C;  1BR4 A;  1YA9 A;  2XLO A;  1WAS A;  4EBK A;  2R05 A;  3T9O A;  3B0P A;  3ECS A;  1RKC A;  3T6J A;  4MVO A;  3K7D A;  4RBN A;  5FZT A;  1HW1 A;  3DM5 A;  4P9F A;  4YWQ A;  3GEH A;  2XL8 A;  3WHN A;  3DKA A;  2WL8 A;  2J45 A;  3LS1 A;  4MVQ A;  2OJQ A;  2XLM A;  4JUR I;  4YL0 A;  2R7X A;  1RCP A;  2A69 F;  2ZD9 A;  2GA0 A;  1S05 A;  3UMK A;  1HMO A;  2KQ9 A;  4MTO A;  4KNW A;  4C3E A;  3NMK A;  2Q4F A;  4XTK A;  4Z9H A;  3U8P A;  3UNG C;  4A4A A;  4CS9 C;  2P1A A;  4YT4 A;  2GFH A;  2YKZ A;  3JSZ A;  3RFY A;  2W4B A;  3AJM A; 
#chains in the Genus database with same CATH homology
 2PNO A;  3HKK A;  4J7Y A;  4YL1 A;  4YK5 A;  4YL3 A;  5BQI A;  4BPM A;  5HV9 A;  4AL1 A;  3LEO A;  5K0I A;  4JRZ A;  4NTA A;  2Q7R A;  2UUH A;  4JCZ A;  2UUI A;  5BQH A;  4YL0 A;  3PCV A;  3DWW A;  4NTB A;  4AL0 A;  5BQG A;  4JC7 A;  4J7T A;  2H8A A;  3B29 A;  4WAB A;  4NTF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...