5HV9A

Human ltc4s mutant-s36e
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
143
structure length
143
Chain Sequence
VALLAAVTLLGVLLQAYFSLQVISARRAFRVEPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leukotriene C4 synthase
publication title Phosphorylation of Leukotriene C4 Synthase at Serine 36 Impairs Catalytic Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 52
structure length 143
sequence length 143
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 5hv9A00
4J7YA 5HV9A 3HKKA 5BQGA 3B29A 4NTBA 3LEOA 4NTAA 2Q7RA 5BQHA 4JCZA 4JRZA 4BPMA 4YL1A 2PNOA 2UUIA 4J7TA 4WABA 2UUHA 2H8AA 4YL3A 5K0IA 3DWWA 4JC7A 4YK5A 5BQIA 3PCVA 4NTFA 4YL0A 4AL1A 4AL0A
chains in the Genus database with same CATH superfamily
2YLDA 3M15A 3M4BA 3DE9A 1VK5A 4XEKA 4YT8A 3GEHA 3RVYA 3IQ6A 2V26A 4JEBA 3VF0A 4EBKA 2R7VA 2G3KA 3U2LA 1K04A 1TFKB 3B29A 1EKYA 1KTMA 3A9CA 1A7DA 4FAPB 2KYHA 2XLWA 3WG7C 3C8GD 1FTSA 4MVUA 4U5FE 1TR2A 2XS8A 3CQZA 1TWCA 3CAXA 2AWYA 4RD9A 4WABA 4I3MA 4EKWA 3L34A 5L0FA 2VB6A 3DMDA 1Z5ZA 2AU5A 3EH2A 4Q7CA 3JYHA 3WHNA 4PR9A 4JC7A 1L3PA 2F22A 4PFPA 2M64A 2G3VA 2QUPA 3K1IC 2YQYA 4CIPA 2DB4A 3HNKA 1JR8A 3GODA 4D4NA 5TJ5E 2GAQA 3WODF 5HV9A 1WOLA 4C3EA 1WTYA 3CZ6A 2GWWA 4JTCB 1WGWA 3EJNA 4CS8A 1G8XA 4PJMA 2H7OA 1Q0KA 3I5PA 4IGGA 3EH1A 1E2XA 2GA0A 3GM1A 2YWAA 4XPXA 5L0JA 2LFFA 4MS2A 1D1AA 1OW7A 2J9WA 3S29A 2G62A 1OW6A 3I5QA 3SXKA 3ASNC 3PMRA 4KNWA 4ONSA 4YL1A 3UGOA 2JX0A 3ABLC 3KKBA 5EGYA 5KYYA 1PD1A 4XTKA 2Q9AA 3ABMC 2NSGA 5JUAA 3LS0A 4UDVA 4DXWA 2P0NA 1YVIA 3EG9A 1MMGA 3PCVA 1Q0MA 1T9KA 2XLMA 3AQBA 2IXOA 3JRTA 5KYUB 4YL0A 4N4WA 1V4AA 4XPWA 4MVQA 5L0IA 1YZCA 2OJED 3DM9B 3KYIA 5HSWA 5A6AA 1ST6A 3FAPB 4JW1A 3DJNB 1Z63A 1N1CA 1WWPA 3K66A 2YHSA 2QE9A 4NC3A 3LESA 1WATA 1ZHWA 3LEVA 2Q00A 1G4US 2VH3A 3ECSA 2VCBA 4JEAA 5COGA 1HMOA 1MQVA 3CSKA 2Y3DA 5E33A 4YT5A 2YL7A 4CSAC 4EHPA 4A2NB 2KJGA 4N06A 1JAFA 2XLEA 2CGEA 4C3BA 2HMZA 4G7HF 2YRFA 4OD4A 1NLXA 3RQFA 2J9BA 4GEHA 3U8PA 3U9JA 2HS5A 4ULWA 1LS1A 3IHUA 1QZXA 2XS1A 4JTDB 3ZC4A 2ZXRA 2Q9BA 2ETSA 2L6GA 1FMVA 3O6XA 3LNMB 2XSEA 4I44A 2WVQA 4JTAB 4K0DA 5E3AA 4EBJA 4DBRA 5BQIA 1HE1A 3JSEO 3DKAA 4OD5A 3SEOA 4BJ5A 4XLPF 3B0UX 2J9UA 2HSBA 3DD7A 3L1MA 4M63A 1UFBA 4XEVA 2X0CA 3TJ5A 4YT2A 1A0BA 3JYYA 3ABKC 5A6KA 3W2VA 3EFOA 2J9VA 1FR0A 1DOVA 3DE8A 3AG2C 3RW0A 4RDAA 4XWJA 4BJ6C 2HKVA 1I5NA 3SZRA 2XL6A 1GGQA 1D0YA 4IWBA 4YT4A 3T4RA 4E7ZA 1EQ1A 2DYSC 4JRZA 2L6FA 4LLCA 4NCQA 1EI7A 1LS4A 1R4TA 3MFNA 4O6MA 1S05A 4KC9A 1MMDA 1TWGA 2R7WA 1M2OA 3S90A 5K0IA 1PD0A 256BA 4JE9A 2XRHA 4CJGA 1ZYRF 4LDQA 4J30B 4U9EA 5CI9A 1M2VA 4PJNA 2J0XA 1QSPA 1E84A 4OIOF 3T9OA 4MVZA 4CS9C 1L7CA 3LLIA 3RF3A 4MTOA 1J8MF 1APCA 1Z6AA 2DI3A 3LUTB 2JD3A 1FFHA 1M2VB 3EQLF 2XXAA 1KNYA 2XL8A 4LLEA 3S9OA 1AVOB 4RBNA 4JCHA 1O87A 1H7IA 1M6TA 3RKOF 1W2WA 1MNEA 4KNVA 1FAPB 1J8YF 3KPHA 4JCZA 1ZU5A 4LDRA 3JCUQ 5B1AC 1FFTC 2XXAB 2C03A 3LS1A 3DM5A 3K7DA 1T5OA 4BEMJ 3RQEA 3ITFA 3RH3A 1HY5A 3T6GB 4BJTA 3C8GA 3JZ0A 5B3IA 4H54A 5JLIA 5KYXA 4ZLDA 3V7OA 1RKEB 1A7VA 4DRJB 3V5ZA 3EGDA 3GEEA 4G0HA 1D0XA 4YK5A 2FFHA 2J8WA 3KYJA 4O6NA 1VLSA 4E7SA 3MX3A 3C8GB 1O3UA 4XEFA 2W9YA 5DVWA 4MQ9F 5KYXB 1Z7Qc 3AGUA 1ZU4A 3EGDB 3H65A 5DS4A 4JURI 5L0GA 4I1OB 2ASRA 4IARA 2E87A 4W8PA 4OIPF 5BUOA 2EPNA 4KI2A 3U0CA 3POVA 4CS7A 2L6HA 4G78A 4NTBA 5L0CA 1BZ4A 1YA7O 1I4ZA 2EPMX 2PP4A 3H2VA 3IPMO 4DJ9A 5A69A 2R7TA 4LACB 2PF4E 5T1DB 3MYIA 4MW8A 4CIHA 1ORSC 4XPYA 2H8AA 4YWQA 2KSFA 3NG1A 5AC4A 3IEEA 3C62A 2EIMC 1PCXA 2LSEA 5AGFA 4PJLA 1NU7D 2VASA 3AQCA 2XM0A 4K1OA 3B9QA 4E18A 3SXYA 1RJ9B 2CDQA 1V55C 2CNWD 1Z3IX 3GM2A 3PHF2 3HKKA 2OQMA 3HNJA 4E0HA 3TULA 2PFDA 5JT4A 4JJGA 1ZHTA 2CCYA 3QW0A 1LI5A 1YARO 2XLDA 5IY5C 1Q0GA 4J32B 1NZEA 1G5ZA 1B68A 3G4XA 3NYLA 3ZDLA 4CDVA 3G4ZA 2YL0A 1OXBA 3NYJA 4L6RA 3E9VA 2XLOA 1LM3B 2HUJA 1R5ID 2IXNA 5KYUA 3NYMA 1OKKD 3GWLA 2EPLX 3HLZA 4NTFA 5DS5A 3Q7LA 2WZFA 3SYNA 1NFOA 3ZG1A 1MNDA 1G4WR 1U6HA 1YLMA 4PK4A 2HV7A 5JP7A 1SR2A 5F28E 3ZWIA 1S7ZA 1AUEA 2FAPB 2R7QA 1UG7A 3BRJA 3DZAA 1H9GA 1OCZC 1SZIA 3ASOC 4MNDA 5FZTA 2LP4A 4B6IA 5A6BD 5JRAA 1LE2A 3W2WA 3KL4A 4CBEA 4MW3A 1AEPA 4P9FA 2A1DD 3VRCA 1JPNA 3UMIA 2AWCA 1U89A 1LKXA 3UNGC 4A4AA 2QY9A 3US6A 1A41A 3N0TA 1YZAA 1EA8A 2J7PD 3NKDA 1CGNA 1ZHZA 2XM4A 5L0HA 4NY3A 1BR4A 3IQTA 4U5DE 5L0DA 1VYKA 3NMIA 4P6IC 1U0BB 2D4UA 2W45A 3GORA 2EPOA 1V54C 1RCPA 4DOZA 2LFDA 5A6JA 2R7UA 2R7XA 3LNRA 2PBEA 5KYWA 3NMKA 3HNLA 4BJ5C 4I1MA 3B0VC 3FHDA 3FOPA 3ATPA 3MYFA 2QTVA 1OCOC 1ORYA 3JTLO 2PX3A 4IJJA 5KYWB 1H9TA 3DJUB 5BQHA 2WZGA 1SF8A 1CGOA 1RXQA 3RIPA 3TQOA 3ZIBA 2D5RB 4O6YA 1XZQA 4K7BA 4X0RA 3S28A 3C18A 1QVXA 2NSFA 2R25A 3S84A 3HNIA 2B0JA 3DWWA 1SYQA 4CX9A 1T6QA 4U9DA 3T6JA 2LQGA 3GM3A 4PJJA 3VAYA 4Z9HA 1C03A 2EPKX 2J46A 3KMIA 2WB7A 2HJMA 2CYDA 1E86A 3L8IA 5EK0A 4BJ6A 1M57C 4CDAA 2BL2A 4CDYA 2QNLA 4MVMA 3LJBA 3T6BA 3U2MA 5L3VA 3AG3C 2OCCC 3B0PA 3F46A 4YN0B 3WAQA 5FCLA 3DI5A 5JVEA 5L3QA 2V3CC 1I4YA 1Z23A 1TWAA 3V5YA 4DVZA 2OEXA 5DQTA 2QLAA 3U8VA 3MLGA 3OA1A 2Y3GA 1IW7F 2ZPAA 2OG2A 2NUTB 1Q0FA 1YJGA 3JRMO 2R9RB 2W4MA 4OIQF 1RKEA 3W8IA 4FESA 2PNOA 2A6EF 3Q7GA 2MHRA 2UUIA 3A11A 3N2ZB 4CS9A 3B71A 3FMSA 3JSZA 1OW8A 3L0IA 4U5HA 3W4YA 3TOLA 2AVKA 2R7OA 2IOQA 3OEOA 4AE4A 2A68F 2J45A 3QZCA 4OIRF 2P6VA 4BEJA 2M4EA 3ZQVA 4ER9A 1RKCA 1BR2A 1D1CA 1BR1A 2IM8A 2YLGA 1K05A 2LK4A 2PX0A 4AE4B 1CPQA 1NG1A 5COFA 3ZTMA 4U5EE 3QVZA 1CPRA 4Z9IA 3AJMA 5GPGB 2WL8A 4MVRA 2R7SA 1TQGA 3LEOA 3CEXA 4R32A 4C3DA 2HFIA 3QW1A 1LIHA 1ZW3A 1LVKA 3DXJF 2NG1A 1V74B 3UMKA 2DYRC 1GQAA 4U5BE 2R02A 1VOMA 1C02A 4BG0A 1RJ9A 1SMYF 1T6IA 1PV3A 4JVSA 4XQ1A 3U3FA 2BE5F 4EBBA 1YDIA 2VCCA 3OWTA 3RYLA 1JOGA 1KU2A 2C04A 4OINF 2NUPA 1LE4A 1OKKA 2A0BA 3AG1C 3R7CA 3C8ZA 4CJOA 1NBBA 1YYXA 2IYLD 5JSLA 2DGJA 4PFOA 2OEVA 5T3WA 3U3BA 4ULVA 5CIVA 4IRUA 2LCHA 2H7VC 1E83A 3PDMP 1CGME 1HW2A 2XLHA 1D1BA 1VB5A 2NUPB 2WZLA 3LAYA 4EIYA 4EWCA 1QPUA 3E70C 1NU9C 2EINC 2MYSA 3M79A 4LERA 3K1HA 4ANJA 4CS8C 4HFFB 1C17M 2I15A 5COMA 1ZZPA 3FAJA 1T6UA 1HW1A 2Y3HA 3GEIA 3QMKA 4WJ0A 5A6BA 4C7OA 1HE9A 1VMAA 1VTMP 5KYNA 1ZW2A 2ZD9A 4J7TA 4E17A 2X51A 3K1IA 5F5HA 4W8KA 1ZVZA 2VCAA 4P9TA 1TFOB 4C7OB 4G7ZF 2Q3TA 3S27A 4IAOA 2Y3BA 2EIKC 2J7PA 2LIGA 4DBQA 1E85A 3I4UA 5DS6A 1Q0DA 2W4BA 2NPUA 3BEHA 4XLNF 2R05A 3SXMA 3VYWA 2L7AA 2L9JA 2R7RA 2HJ3A 3KH2A 2BC5A 3X2QC 1IZMA 4EUKB 3S0XA 3TOMA 4DVYP 2KC3A 2KW3C 2GDCA 4NTAA 4DRHB 3UGPA 4D4XA 2IXMA 4BPMA 2Y39A 2Y69C 3IQ5A 3TD7A 1JPJA 2KQ9A 4IB4A 4DRIB 1OCCC 1F1MA 5D92A 2O9XA 3W8HA 3M4CA 4U5GA 3O55A 2FGYA 3Q6NA 5KYYB 3U9MA 4GQHA 3X1OA 3UR3C 3LLKA 4HFKB 3DAGA 4AL1A 2YZSA 2ZXWC 1QQ3A 4J7YA 4O7GA 3Q6MA 3EG9B 3J06A 2WVNA 2HZ8A 1OR3A 1VLTA 2Q9CA 2ZXPA 3ZTZA 4CSAA 2KGOA 2OOCA 3GWNA 1A7EA 3L8JA 4JZAA 5AC5A 4WGYA 3NDBB 1JMWA 3UMHA 4E0IA 3GANA 1H6GA 3TJ6A 3ZVRA 2J0WA 1FMWA 2CW0F 1DOWA 2R03A 3H2UA 3G50A 2HV6A 4YL3A 4MVSA 1ZHXA 4Z9JA 5JS5A 2EILC 1OR2A 3O10A 3O39A 2XLVA 5B1BC 1NSGB 2EIJC 2OU6A 3AGTA 3EZHA 3SXZA 3C7JA 4U5CE 3RVZA 3EPVA 3EZIA 1Y6DA 1Y4CA 1ZHYA 1BDJB 2L81A 2OKUA 2RSEB 2XL4A 2Q4FA 3QTHA 2HMQA 4AL0A 4FWVA 3TK0A 2YL1A 4F4BA 5T3TA 1QLEC 3V5XA 3NRHA 3FDQA 3F47A 2NUTA 4G7OF 2Z15A 4BJ1A 2GFHA 1YYJA 1K40A 1T01A 2OJQA 5BQGA 2TMVP 1YA9A 1WASA 1LPEA 2ICWG 2RD9A 3R2PA 2LD6A 3EFOB 3U5SA 1RMVA 1QKRA 3FVYA 1XZPA 3VM6A 3N24A 2YKZA 2P61A 1GM5A 3SP1A 1NFNA 4ZLCA 3FOOA 5EHHA 2YVKA 4HE8D 1LI7A 1XWJA 4GYTA 2YL3A 3EHMA 2YEVA 3QVYA 1VYIA 2I8BA 3AG4C 1YAUO 2KK1A 3IQCA 4JJFA 3K33A 4KBLA 4MVOA 4O79A 4AX2A 4QI2A 2MWQA 4QI0A 3RQGA 4NQFA 4PACA 3FXHA 1TWHA 1MMAA 3EHNA 1OXKA 3AOUA 5E2QA 4AK9A 1O5HA 2AP3A 2P7VA 2A6HF 3HJCA 4LDKA 1ORJA 1OCRC 2YLIA 3NKEA 3MBGA 3C63A 4MTGA 2B0HA 1JRAA 3DAFA 2CNWA 4HEAJ 5B3SC 3K6BA 5DQZA 2H7BA 2VC9A 5E3CA 3M1CB 2HSQA 1D0ZA 4IAQA 3ZSUA 5F5FA 2Q7RA 3EGXA 4MTFA 4Q5SF 4Q4ZF 3RFYA 4N6HA 4QDLA 1MMNA 2A69F 1TKNA 3NMJA 5D91A 3ZQYA 1WN0A 3JT1A 1HMDA 2IBFA 2P1AA 2WVOA 4WGZA 2UUHA 1FNTc 5DLJA 4YJWA 3SNHA 3EGXB 3HTKC 1M56C 4H4KC 2A0UA 1BBHA 4FX5A 4JKVA 4JIOA 5CI8A 2KNHA 1OQCA 1GS9A 2JPUA 2ZXOA 4N6CA 2IXPA
chains in the Genus database with same CATH topology
4J7YA 5HV9A 3HKKA 5BQGA 3B29A 4NTBA 3LEOA 4NTAA 2Q7RA 5BQHA 4JCZA 4JRZA 4BPMA 4YL1A 2PNOA 2UUIA 4J7TA 4WABA 2UUHA 2H8AA 4YL3A 5K0IA 3DWWA 4JC7A 4YK5A 5BQIA 3PCVA 4NTFA 4YL0A 4AL1A 4AL0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J7Y A;  5HV9 A;  3HKK A;  5BQG A;  3B29 A;  4NTB A;  3LEO A;  4NTA A;  2Q7R A;  5BQH A;  4JCZ A;  4JRZ A;  4BPM A;  4YL1 A;  2PNO A;  2UUI A;  4J7T A;  4WAB A;  2UUH A;  2H8A A;  4YL3 A;  5K0I A;  3DWW A;  4JC7 A;  4YK5 A;  5BQI A;  3PCV A;  4NTF A;  4YL0 A;  4AL1 A;  4AL0 A; 
#chains in the Genus database with same CATH topology
 2YLD A;  3M15 A;  3M4B A;  3DE9 A;  1VK5 A;  4XEK A;  4YT8 A;  3GEH A;  3RVY A;  3IQ6 A;  2V26 A;  4JEB A;  3VF0 A;  4EBK A;  2R7V A;  2G3K A;  3U2L A;  1K04 A;  1TFK B;  3B29 A;  1EKY A;  1KTM A;  3A9C A;  1A7D A;  4FAP B;  2KYH A;  2XLW A;  3WG7 C;  3C8G D;  1FTS A;  4MVU A;  4U5F E;  1TR2 A;  2XS8 A;  3CQZ A;  1TWC A;  3CAX A;  2AWY A;  4RD9 A;  4WAB A;  4I3M A;  4EKW A;  3L34 A;  5L0F A;  2VB6 A;  3DMD A;  1Z5Z A;  2AU5 A;  3EH2 A;  4Q7C A;  3JYH A;  3WHN A;  4PR9 A;  4JC7 A;  1L3P A;  2F22 A;  4PFP A;  2M64 A;  2G3V A;  2QUP A;  3K1I C;  2YQY A;  4CIP A;  2DB4 A;  3HNK A;  1JR8 A;  3GOD A;  4D4N A;  5TJ5 E;  2GAQ A;  3WOD F;  5HV9 A;  1WOL A;  4C3E A;  1WTY A;  3CZ6 A;  2GWW A;  4JTC B;  1WGW A;  3EJN A;  4CS8 A;  1G8X A;  4PJM A;  2H7O A;  1Q0K A;  3I5P A;  4IGG A;  3EH1 A;  1E2X A;  2GA0 A;  3GM1 A;  2YWA A;  4XPX A;  5L0J A;  2LFF A;  4MS2 A;  1D1A A;  1OW7 A;  2J9W A;  3S29 A;  2G62 A;  1OW6 A;  3I5Q A;  3SXK A;  3ASN C;  3PMR A;  4KNW A;  4ONS A;  4YL1 A;  3UGO A;  2JX0 A;  3ABL C;  3KKB A;  5EGY A;  5KYY A;  1PD1 A;  4XTK A;  2Q9A A;  3ABM C;  2NSG A;  5JUA A;  3LS0 A;  4UDV A;  4DXW A;  2P0N A;  1YVI A;  3EG9 A;  1MMG A;  3PCV A;  1Q0M A;  1T9K A;  2XLM A;  3AQB A;  2IXO A;  3JRT A;  5KYU B;  4YL0 A;  4N4W A;  1V4A A;  4XPW A;  4MVQ A;  5L0I A;  1YZC A;  2OJE D;  3DM9 B;  3KYI A;  5HSW A;  5A6A A;  1ST6 A;  3FAP B;  4JW1 A;  3DJN B;  1Z63 A;  1N1C A;  1WWP A;  3K66 A;  2YHS A;  2QE9 A;  4NC3 A;  3LES A;  1WAT A;  1ZHW A;  3LEV A;  2Q00 A;  1G4U S;  2VH3 A;  3ECS A;  2VCB A;  4JEA A;  5COG A;  1HMO A;  1MQV A;  3CSK A;  2Y3D A;  5E33 A;  4YT5 A;  2YL7 A;  4CSA C;  4EHP A;  4A2N B;  2KJG A;  4N06 A;  1JAF A;  2XLE A;  2CGE A;  4C3B A;  2HMZ A;  4G7H F;  2YRF A;  4OD4 A;  1NLX A;  3RQF A;  2J9B A;  4GEH A;  3U8P A;  3U9J A;  2HS5 A;  4ULW A;  1LS1 A;  3IHU A;  1QZX A;  2XS1 A;  4JTD B;  3ZC4 A;  2ZXR A;  2Q9B A;  2ETS A;  2L6G A;  1FMV A;  3O6X A;  3LNM B;  2XSE A;  4I44 A;  2WVQ A;  4JTA B;  4K0D A;  5E3A A;  4EBJ A;  4DBR A;  5BQI A;  1HE1 A;  3JSE O;  3DKA A;  4OD5 A;  3SEO A;  4BJ5 A;  4XLP F;  3B0U X;  2J9U A;  2HSB A;  3DD7 A;  3L1M A;  4M63 A;  1UFB A;  4XEV A;  2X0C A;  3TJ5 A;  4YT2 A;  1A0B A;  3JYY A;  3ABK C;  5A6K A;  3W2V A;  3EFO A;  2J9V A;  1FR0 A;  1DOV A;  3DE8 A;  3AG2 C;  3RW0 A;  4RDA A;  4XWJ A;  4BJ6 C;  2HKV A;  1I5N A;  3SZR A;  2XL6 A;  1GGQ A;  1D0Y A;  4IWB A;  4YT4 A;  3T4R A;  4E7Z A;  1EQ1 A;  2DYS C;  4JRZ A;  2L6F A;  4LLC A;  4NCQ A;  1EI7 A;  1LS4 A;  1R4T A;  3MFN A;  4O6M A;  1S05 A;  4KC9 A;  1MMD A;  1TWG A;  2R7W A;  1M2O A;  3S90 A;  5K0I A;  1PD0 A;  256B A;  4JE9 A;  2XRH A;  4CJG A;  1ZYR F;  4LDQ A;  4J30 B;  4U9E A;  5CI9 A;  1M2V A;  4PJN A;  2J0X A;  1QSP A;  1E84 A;  4OIO F;  3T9O A;  4MVZ A;  4CS9 C;  1L7C A;  3LLI A;  3RF3 A;  4MTO A;  1J8M F;  1APC A;  1Z6A A;  2DI3 A;  3LUT B;  2JD3 A;  1FFH A;  1M2V B;  3EQL F;  2XXA A;  1KNY A;  2XL8 A;  4LLE A;  3S9O A;  1AVO B;  4RBN A;  4JCH A;  1O87 A;  1H7I A;  1M6T A;  3RKO F;  1W2W A;  1MNE A;  4KNV A;  1FAP B;  1J8Y F;  3KPH A;  4JCZ A;  1ZU5 A;  4LDR A;  3JCU Q;  5B1A C;  1FFT C;  2XXA B;  2C03 A;  3LS1 A;  3DM5 A;  3K7D A;  1T5O A;  4BEM J;  3RQE A;  3ITF A;  3RH3 A;  1HY5 A;  3T6G B;  4BJT A;  3C8G A;  3JZ0 A;  5B3I A;  4H54 A;  5JLI A;  5KYX A;  4ZLD A;  3V7O A;  1RKE B;  1A7V A;  4DRJ B;  3V5Z A;  3EGD A;  3GEE A;  4G0H A;  1D0X A;  4YK5 A;  2FFH A;  2J8W A;  3KYJ A;  4O6N A;  1VLS A;  4E7S A;  3MX3 A;  3C8G B;  1O3U A;  4XEF A;  2W9Y A;  5DVW A;  4MQ9 F;  5KYX B;  1Z7Q c;  3AGU A;  1ZU4 A;  3EGD B;  3H65 A;  5DS4 A;  4JUR I;  5L0G A;  4I1O B;  2ASR A;  4IAR A;  2E87 A;  4W8P A;  4OIP F;  5BUO A;  2EPN A;  4KI2 A;  3U0C A;  3POV A;  4CS7 A;  2L6H A;  4G78 A;  4NTB A;  5L0C A;  1BZ4 A;  1YA7 O;  1I4Z A;  2EPM X;  2PP4 A;  3H2V A;  3IPM O;  4DJ9 A;  5A69 A;  2R7T A;  4LAC B;  2PF4 E;  5T1D B;  3MYI A;  4MW8 A;  4CIH A;  1ORS C;  4XPY A;  2H8A A;  4YWQ A;  2KSF A;  3NG1 A;  5AC4 A;  3IEE A;  3C62 A;  2EIM C;  1PCX A;  2LSE A;  5AGF A;  4PJL A;  1NU7 D;  2VAS A;  3AQC A;  2XM0 A;  4K1O A;  3B9Q A;  4E18 A;  3SXY A;  1RJ9 B;  2CDQ A;  1V55 C;  2CNW D;  1Z3I X;  3GM2 A;  3PHF 2;  3HKK A;  2OQM A;  3HNJ A;  4E0H A;  3TUL A;  2PFD A;  5JT4 A;  4JJG A;  1ZHT A;  2CCY A;  3QW0 A;  1LI5 A;  1YAR O;  2XLD A;  5IY5 C;  1Q0G A;  4J32 B;  1NZE A;  1G5Z A;  1B68 A;  3G4X A;  3NYL A;  3ZDL A;  4CDV A;  3G4Z A;  2YL0 A;  1OXB A;  3NYJ A;  4L6R A;  3E9V A;  2XLO A;  1LM3 B;  2HUJ A;  1R5I D;  2IXN A;  5KYU A;  3NYM A;  1OKK D;  3GWL A;  2EPL X;  3HLZ A;  4NTF A;  5DS5 A;  3Q7L A;  2WZF A;  3SYN A;  1NFO A;  3ZG1 A;  1MND A;  1G4W R;  1U6H A;  1YLM A;  4PK4 A;  2HV7 A;  5JP7 A;  1SR2 A;  5F28 E;  3ZWI A;  1S7Z A;  1AUE A;  2FAP B;  2R7Q A;  1UG7 A;  3BRJ A;  3DZA A;  1H9G A;  1OCZ C;  1SZI A;  3ASO C;  4MND A;  5FZT A;  2LP4 A;  4B6I A;  5A6B D;  5JRA A;  1LE2 A;  3W2W A;  3KL4 A;  4CBE A;  4MW3 A;  1AEP A;  4P9F A;  2A1D D;  3VRC A;  1JPN A;  3UMI A;  2AWC A;  1U89 A;  1LKX A;  3UNG C;  4A4A A;  2QY9 A;  3US6 A;  1A41 A;  3N0T A;  1YZA A;  1EA8 A;  2J7P D;  3NKD A;  1CGN A;  1ZHZ A;  2XM4 A;  5L0H A;  4NY3 A;  1BR4 A;  3IQT A;  4U5D E;  5L0D A;  1VYK A;  3NMI A;  4P6I C;  1U0B B;  2D4U A;  2W45 A;  3GOR A;  2EPO A;  1V54 C;  1RCP A;  4DOZ A;  2LFD A;  5A6J A;  2R7U A;  2R7X A;  3LNR A;  2PBE A;  5KYW A;  3NMK A;  3HNL A;  4BJ5 C;  4I1M A;  3B0V C;  3FHD A;  3FOP A;  3ATP A;  3MYF A;  2QTV A;  1OCO C;  1ORY A;  3JTL O;  2PX3 A;  4IJJ A;  5KYW B;  1H9T A;  3DJU B;  5BQH A;  2WZG A;  1SF8 A;  1CGO A;  1RXQ A;  3RIP A;  3TQO A;  3ZIB A;  2D5R B;  4O6Y A;  1XZQ A;  4K7B A;  4X0R A;  3S28 A;  3C18 A;  1QVX A;  2NSF A;  2R25 A;  3S84 A;  3HNI A;  2B0J A;  3DWW A;  1SYQ A;  4CX9 A;  1T6Q A;  4U9D A;  3T6J A;  2LQG A;  3GM3 A;  4PJJ A;  3VAY A;  4Z9H A;  1C03 A;  2EPK X;  2J46 A;  3KMI A;  2WB7 A;  2HJM A;  2CYD A;  1E86 A;  3L8I A;  5EK0 A;  4BJ6 A;  1M57 C;  4CDA A;  2BL2 A;  4CDY A;  2QNL A;  4MVM A;  3LJB A;  3T6B A;  3U2M A;  5L3V A;  3AG3 C;  2OCC C;  3B0P A;  3F46 A;  4YN0 B;  3WAQ A;  5FCL A;  3DI5 A;  5JVE A;  5L3Q A;  2V3C C;  1I4Y A;  1Z23 A;  1TWA A;  3V5Y A;  4DVZ A;  2OEX A;  5DQT A;  2QLA A;  3U8V A;  3MLG A;  3OA1 A;  2Y3G A;  1IW7 F;  2ZPA A;  2OG2 A;  2NUT B;  1Q0F A;  1YJG A;  3JRM O;  2R9R B;  2W4M A;  4OIQ F;  1RKE A;  3W8I A;  4FES A;  2PNO A;  2A6E F;  3Q7G A;  2MHR A;  2UUI A;  3A11 A;  3N2Z B;  4CS9 A;  3B71 A;  3FMS A;  3JSZ A;  1OW8 A;  3L0I A;  4U5H A;  3W4Y A;  3TOL A;  2AVK A;  2R7O A;  2IOQ A;  3OEO A;  4AE4 A;  2A68 F;  2J45 A;  3QZC A;  4OIR F;  2P6V A;  4BEJ A;  2M4E A;  3ZQV A;  4ER9 A;  1RKC A;  1BR2 A;  1D1C A;  1BR1 A;  2IM8 A;  2YLG A;  1K05 A;  2LK4 A;  2PX0 A;  4AE4 B;  1CPQ A;  1NG1 A;  5COF A;  3ZTM A;  4U5E E;  3QVZ A;  1CPR A;  4Z9I A;  3AJM A;  5GPG B;  2WL8 A;  4MVR A;  2R7S A;  1TQG A;  3LEO A;  3CEX A;  4R32 A;  4C3D A;  2HFI A;  3QW1 A;  1LIH A;  1ZW3 A;  1LVK A;  3DXJ F;  2NG1 A;  1V74 B;  3UMK A;  2DYR C;  1GQA A;  4U5B E;  2R02 A;  1VOM A;  1C02 A;  4BG0 A;  1RJ9 A;  1SMY F;  1T6I A;  1PV3 A;  4JVS A;  4XQ1 A;  3U3F A;  2BE5 F;  4EBB A;  1YDI A;  2VCC A;  3OWT A;  3RYL A;  1JOG A;  1KU2 A;  2C04 A;  4OIN F;  2NUP A;  1LE4 A;  1OKK A;  2A0B A;  3AG1 C;  3R7C A;  3C8Z A;  4CJO A;  1NBB A;  1YYX A;  2IYL D;  5JSL A;  2DGJ A;  4PFO A;  2OEV A;  5T3W A;  3U3B A;  4ULV A;  5CIV A;  4IRU A;  2LCH A;  2H7V C;  1E83 A;  3PDM P;  1CGM E;  1HW2 A;  2XLH A;  1D1B A;  1VB5 A;  2NUP B;  2WZL A;  3LAY A;  4EIY A;  4EWC A;  1QPU A;  3E70 C;  1NU9 C;  2EIN C;  2MYS A;  3M79 A;  4LER A;  3K1H A;  4ANJ A;  4CS8 C;  4HFF B;  1C17 M;  2I15 A;  5COM A;  1ZZP A;  3FAJ A;  1T6U A;  1HW1 A;  2Y3H A;  3GEI A;  3QMK A;  4WJ0 A;  5A6B A;  4C7O A;  1HE9 A;  1VMA A;  1VTM P;  5KYN A;  1ZW2 A;  2ZD9 A;  4J7T A;  4E17 A;  2X51 A;  3K1I A;  5F5H A;  4W8K A;  1ZVZ A;  2VCA A;  4P9T A;  1TFO B;  4C7O B;  4G7Z F;  2Q3T A;  3S27 A;  4IAO A;  2Y3B A;  2EIK C;  2J7P A;  2LIG A;  4DBQ A;  1E85 A;  3I4U A;  5DS6 A;  1Q0D A;  2W4B A;  2NPU A;  3BEH A;  4XLN F;  2R05 A;  3SXM A;  3VYW A;  2L7A A;  2L9J A;  2R7R A;  2HJ3 A;  3KH2 A;  2BC5 A;  3X2Q C;  1IZM A;  4EUK B;  3S0X A;  3TOM A;  4DVY P;  2KC3 A;  2KW3 C;  2GDC A;  4NTA A;  4DRH B;  3UGP A;  4D4X A;  2IXM A;  4BPM A;  2Y39 A;  2Y69 C;  3IQ5 A;  3TD7 A;  1JPJ A;  2KQ9 A;  4IB4 A;  4DRI B;  1OCC C;  1F1M A;  5D92 A;  2O9X A;  3W8H A;  3M4C A;  4U5G A;  3O55 A;  2FGY A;  3Q6N A;  5KYY B;  3U9M A;  4GQH A;  3X1O A;  3UR3 C;  3LLK A;  4HFK B;  3DAG A;  4AL1 A;  2YZS A;  2ZXW C;  1QQ3 A;  4J7Y A;  4O7G A;  3Q6M A;  3EG9 B;  3J06 A;  2WVN A;  2HZ8 A;  1OR3 A;  1VLT A;  2Q9C A;  2ZXP A;  3ZTZ A;  4CSA A;  2KGO A;  2OOC A;  3GWN A;  1A7E A;  3L8J A;  4JZA A;  5AC5 A;  4WGY A;  3NDB B;  1JMW A;  3UMH A;  4E0I A;  3GAN A;  1H6G A;  3TJ6 A;  3ZVR A;  2J0W A;  1FMW A;  2CW0 F;  1DOW A;  2R03 A;  3H2U A;  3G50 A;  2HV6 A;  4YL3 A;  4MVS A;  1ZHX A;  4Z9J A;  5JS5 A;  2EIL C;  1OR2 A;  3O10 A;  3O39 A;  2XLV A;  5B1B C;  1NSG B;  2EIJ C;  2OU6 A;  3AGT A;  3EZH A;  3SXZ A;  3C7J A;  4U5C E;  3RVZ A;  3EPV A;  3EZI A;  1Y6D A;  1Y4C A;  1ZHY A;  1BDJ B;  2L81 A;  2OKU A;  2RSE B;  2XL4 A;  2Q4F A;  3QTH A;  2HMQ A;  4AL0 A;  4FWV A;  3TK0 A;  2YL1 A;  4F4B A;  5T3T A;  1QLE C;  3V5X A;  3NRH A;  3FDQ A;  3F47 A;  2NUT A;  4G7O F;  2Z15 A;  4BJ1 A;  2GFH A;  1YYJ A;  1K40 A;  1T01 A;  2OJQ A;  5BQG A;  2TMV P;  1YA9 A;  1WAS A;  1LPE A;  2ICW G;  2RD9 A;  3R2P A;  2LD6 A;  3EFO B;  3U5S A;  1RMV A;  1QKR A;  3FVY A;  1XZP A;  3VM6 A;  3N24 A;  2YKZ A;  2P61 A;  1GM5 A;  3SP1 A;  1NFN A;  4ZLC A;  3FOO A;  5EHH A;  2YVK A;  4HE8 D;  1LI7 A;  1XWJ A;  4GYT A;  2YL3 A;  3EHM A;  2YEV A;  3QVY A;  1VYI A;  2I8B A;  3AG4 C;  1YAU O;  2KK1 A;  3IQC A;  4JJF A;  3K33 A;  4KBL A;  4MVO A;  4O79 A;  4AX2 A;  4QI2 A;  2MWQ A;  4QI0 A;  3RQG A;  4NQF A;  4PAC A;  3FXH A;  1TWH A;  1MMA A;  3EHN A;  1OXK A;  3AOU A;  5E2Q A;  4AK9 A;  1O5H A;  2AP3 A;  2P7V A;  2A6H F;  3HJC A;  4LDK A;  1ORJ A;  1OCR C;  2YLI A;  3NKE A;  3MBG A;  3C63 A;  4MTG A;  2B0H A;  1JRA A;  3DAF A;  2CNW A;  4HEA J;  5B3S C;  3K6B A;  5DQZ A;  2H7B A;  2VC9 A;  5E3C A;  3M1C B;  2HSQ A;  1D0Z A;  4IAQ A;  3ZSU A;  5F5F A;  2Q7R A;  3EGX A;  4MTF A;  4Q5S F;  4Q4Z F;  3RFY A;  4N6H A;  4QDL A;  1MMN A;  2A69 F;  1TKN A;  3NMJ A;  5D91 A;  3ZQY A;  1WN0 A;  3JT1 A;  1HMD A;  2IBF A;  2P1A A;  2WVO A;  4WGZ A;  2UUH A;  1FNT c;  5DLJ A;  4YJW A;  3SNH A;  3EGX B;  3HTK C;  1M56 C;  4H4K C;  2A0U A;  1BBH A;  4FX5 A;  4JKV A;  4JIO A;  5CI8 A;  2KNH A;  1OQC A;  1GS9 A;  2JPU A;  2ZXO A;  4N6C A;  2IXP A; 
#chains in the Genus database with same CATH homology
 4J7Y A;  5HV9 A;  3HKK A;  5BQG A;  3B29 A;  4NTB A;  3LEO A;  4NTA A;  2Q7R A;  5BQH A;  4JCZ A;  4JRZ A;  4BPM A;  4YL1 A;  2PNO A;  2UUI A;  4J7T A;  4WAB A;  2UUH A;  2H8A A;  4YL3 A;  5K0I A;  3DWW A;  4JC7 A;  4YK5 A;  5BQI A;  3PCV A;  4NTF A;  4YL0 A;  4AL1 A;  4AL0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...