5HV9A

Human ltc4s mutant-s36e
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
143
structure length
143
Chain Sequence
VALLAAVTLLGVLLQAYFSLQVISARRAFRVEPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leukotriene C4 synthase
publication title Phosphorylation of Leukotriene C4 Synthase at Serine 36 Impairs Catalytic Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 52
structure length 143
sequence length 143
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 5hv9A00
4JRZA 4J7TA 4YL3A 4YK5A 3HKKA 4JCZA 3LEOA 4NTBA 5K0IA 4YL0A 5BQIA 3B29A 2UUHA 2UUIA 2H8AA 3DWWA 3PCVA 2PNOA 2Q7RA 5BQHA 4J7YA 4NTAA 4YL1A 4BPMA 4AL1A 4NTFA 5HV9A 4WABA 4JC7A 5BQGA 4AL0A
chains in the Genus database with same CATH superfamily
5CI8A 4Q7CA 2C03A 2EIJC 3NYLA 4G0HA 3JT1A 4I1MA 3IHUA 1CGME 2A68F 2AWCA 4YWQA 3N0TA 1BBHA 3X2QC 3UR3C 2XL8A 3B71A 4NTBA 1VLTA 3HLZA 3C63A 3EG9A 1T5OA 3GORA 2B0JA 3OA1A 4RD9A 4XTKA 1Q0FA 1XZPA 1TR2A 3ZTZA 4IRUA 4BJ6C 3ZTMA 2OCCC 1IW7F 3B29A 4A2NB 4BJ5C 2UUIA 3U3FA 1YZAA 4EBJA 1U0BB 4JKVA 2A6EF 4PFOA 3Q6NA 1NFOA 1VOMA 3AGTA 3W8IA 2QE9A 1K05A 2PF4E 5JS5A 4G7OF 2D4UA 2XXAA 1ORJA 3ABKC 1DOVA 1YARO 2HUJA 2XSEA 1Z63A 5BUOA 4ER9A 5KYYA 1KTMA 1LI7A 1HMDA 3ZWIA 3ITFA 4E0HA 1FFHA 1MMAA 4EHPA 1WN0A 3FOOA 3SYNA 3NMKA 4CDVA 2L6FA 1YZCA 1D1AA 3GM3A 4YK5A 3MX3A 1OQCA 1TWAA 3EGXB 3QZCA 2OU6A 2EPNA 2XL4A 1RKCA 3H65A 3LEVA 3JZ0A 3LEOA 4MTOA 4WGZA 4JIOA 3LLKA 3LJBA 3M4CA 2BL2A 1MNDA 5JRAA 3PMRA 2XS1A 2Q9AA 4LLEA 2XRHA 1F1MA 3EGXA 1EA8A 3MFNA 3NKEA 5DVWA 1GM5A 2P6VA 4BG0A 2WZGA 3QW0A 3KYJA 2BE5F 4CSAC 2A0UA 5DS6A 4AE4B 2Q3TA 5EGYA 1WASA 3IEEA 3C7JA 2YWAA 3JRTA 1J8MF 1LIHA 2YL0A 1LVKA 2J0WA 1H9TA 2OEXA 5L0DA 3KYIA 3WAQA 5KYNA 4NTFA 2EIMC 5L3VA 4CIHA 3DKAA 1OCCC 5T1DB 5A6JA 1V54C 2MHRA 4W8KA 2D5RB 2KSFA 3C8GA 1VB5A 4IJJA 4JRZA 3JSEO 4FWVA 4PJMA 2JX0A 4J7TA 1JRAA 4Z9IA 1D0ZA 5TJ5E 2VB6A 1D1CA 5KYUB 4OIOF 1ZHWA 2VCBA 3AOUA 4N6HA 4OINF 4CJGA 3BEHA 1LE4A 1QVXA 3GANA 2OQMA 1VK5A 4W8PA 2V26A 3CAXA 2P0NA 3UMIA 1OCOC 4J32B 1HMOA 1VMAA 1R4TA 4O7GA 1OW7A 2HSQA 4DBQA 5JLIA 3E70C 2DYRC 1TKNA 4KNWA 2R7UA 3POVA 1ORSC 1Q0KA 2BC5A 2YLGA 4JVSA 4ANJA 4CS8C 1S7ZA 3RVZA 2WB7A 2HKVA 2DB4A 1OW8A 1YJGA 3GWNA 3RYLA 1FMWA 1KU2A 2NG1A 1LS1A 3S29A 1Q0GA 5A6BD 2YKZA 3JSZA 1BZ4A 2YEVA 3QMKA 4GEHA 2HSBA 1NZEA 4OD5A 1HW2A 3PDMP 2YHSA 2IOQA 4OIRF 1ZU4A 2QNLA 3R7CA 3QTHA 4DJ9A 4KBLA 3OWTA 3K66A 3NKDA 3V5XA 3MYFA 3H2VA 1FNTc 1ZHZA 5COFA 4LDRA 3SXKA 1QQ3A 1NLXA 1MMGA 5JP7A 1GQAA 2XS8A 3AG3C 4I44A 3RFYA 2ZPAA 2I15A 1Y6DA 3AGUA 4EIYA 4IB4A 1ZW2A 2YQYA 5HV9A 1J8YF 2WVOA 4PFPA 4IGGA 1JR8A 3DWWA 1E83A 2XL6A 3K33A 1W2WA 4XQ1A 5D92A 2Q9BA 3E9VA 3T9OA 1A7VA 4PACA 2LCHA 2W9YA 3IQTA 2QY9A 4U5BE 1OCZC 3KMIA 1G8XA 3S0XA 4JW1A 4C3DA 4MTGA 4AL1A 4E7SA 1ZYRF 2J9UA 4PR9A 5DLJA 2OEVA 3G4XA 4IARA 4U5HA 2R9RB 4AX2A 4O6YA 4D4NA 2DGJA 2QUPA 4H54A 3RW0A 4UDVA 1QKRA 1MMDA 5L0CA 1SR2A 2HV7A 1O5HA 1T6QA 1FTSA 2A0BA 3LUTB 4N4WA 5BQIA 4CS8A 5FZTA 3IQ6A 3ZSUA 3SXZA 3GEEA 3IQ5A 3SEOA 3AG2C 1CPQA 1H6GA 1D1BA 3ZQYA 4G7ZF 4ZLCA 2LP4A 4E7ZA 3LESA 3LS1A 1RJ9B 3N2ZB 2Z15A 1SMYF 3VRCA 4EKWA 1MMNA 5E3AA 2XLDA 4J7YA 4YL1A 3C8GD 3K1IC 4Z9HA 1M2VB 1MNEA 2B0HA 3EH2A 4LERA 2QTVA 2XLHA 2XLEA 2HMQA 1RJ9A 2FFHA 3VM6A 4N6CA 4YN0B 4BJTA 1OR2A 4JJGA 1AVOB 3V7OA 1K04A 3W2VA 3O10A 4K0DA 2J7PA 3EHMA 2RD9A 3QVZA 5B1BC 3AQCA 1Q0DA 2VCAA 1UFBA 2R7SA 2NUTB 2HMZA 2TMVP 3JYHA 4YL0A 4K7BA 3UMHA 5B3SC 4I3MA 4F4BA 5AC5A 4C3BA 3K6BA 1O3UA 2X0CA 3W2WA 4DRJB 4DXWA 2YZSA 1HY5A 3U2MA 2NUTA 2Y39A 1D0XA 1I4ZA 1WATA 3L0IA 3SZRA 1O87A 4JEBA 1ORYA 3C18A 2ZXPA 5KYWB 4QI2A 1KNYA 1JOGA 1TWHA 3FOPA 1YYXA 3HJCA 1N1CA 4LDQA 2IXPA 3U8VA 1Z6AA 5KYXB 4PJJA 4ULVA 3ZDLA 2R7RA 4OIQF 1U89A 2Q9CA 4AL0A 5A69A 2ETSA 2ZXOA 4C3EA 3L1MA 3SXMA 1CGNA 3KH2A 4KC9A 1NU9C 2ASRA 2HJMA 1ZVZA 2CW0F 1E85A 4DRIB 5T3TA 3G4ZA 3DE9A 1ZU5A 3CEXA 4NC3A 3F47A 4WGYA 2GWWA 4EBKA 4BEJA 5L0GA 1HW1A 2R7OA 4FAPB 1OR3A 1C03A 3UMKA 4EBBA 5DS4A 3DAFA 5GPGB 3TOLA 5AGFA 5L3QA 2PNOA 2YLDA 5B1AC 1VLSA 3ZIBA 1RMVA 4H4KC 2YL1A 1PCXA 1QPUA 3PHF2 2V3CC 1OKKA 1TFKB 2IYLD 2LK4A 2OG2A 3LLIA 3HNLA 3O55A 4JJFA 1V55C 2KYHA 1YVIA 4XEKA 4AE4A 4E17A 4U5GA 1GS9A 3WODF 4I1OB 1XWJA 4DOZA 1E2XA 2NSGA 1G5ZA 4JTAB 1WGWA 2HS5A 3NMIA 2AP3A 2J8WA 3F46A 4JCZA 4YJWA 3K7DA 2J9VA 2J9WA 2Y3GA 4X0RA 3TQOA 4BJ6A 3NRHA 3ZQVA 4BJ5A 1A7EA 2QLAA 2ZXRA 4MW3A 4EUKB 4OIPF 1FAPB 5E2QA 2G3VA 3EHNA 2M64A 3O39A 3VYWA 4CS9C 3TK0A 5KYUA 3UNGC 4XWJA 5DQZA 5T3WA 1RKEB 3DMDA 3FXHA 3VAYA 1AEPA 4JTCB 1JAFA 2EINC 2R05A 2Q4FA 3I4UA 1K40A 2KGOA 2GDCA 1PD0A 1HE1A 4MNDA 5A6KA 3U0CA 3UGOA 1ZZPA 2J46A 1YDIA 3QVYA 4NCQA 4R32A 3JRMO 4FESA 5JSLA 3RF3A 2J7PD 2KK1A 2WZFA 3RQEA 3VF0A 5JUAA 2L81A 1BR1A 2W4BA 3ASNC 1PD1A 4YT5A 4NY3A 3B0PA 3DD7A 1WWPA 4LLCA 3SXYA 3V5YA 1D0YA 1RXQA 3M79A 4QDLA 2MWQA 4LDKA 3EQLF 1ZHTA 4GYTA 2J9BA 3AG1C 2ICWG 3KL4A 1I4YA 1H9GA 4CSAA 2Y3HA 3MYIA 1DOWA 3B0UX 4PJNA 4CX9A 3I5PA 1NU7D 3L8JA 2JPUA 2CCYA 3EGDB 256BA 1WTYA 5EHHA 4O6NA 3GEHA 2W45A 2RSEB 2NPUA 2Y3BA 1M56C 3A9CA 5CI9A 3RIPA 4DRHB 2FGYA 2Q7RA 1T6UA 1ZHYA 4GQHA 4MQ9F 4U5FE 5IY5C 1FR0A 1GGQA 5COMA 2OJQA 1TFOB 1QLEC 2KJGA 3GWLA 2A1DD 2J0XA 2VCCA 4U9EA 4WABA 2MYSA 2WZLA 3U8PA 2PX3A 1BDJB 2L7AA 3IPMO 4XLNF 4E0IA 1LE2A 2LSEA 3Q6MA 2YVKA 4DVZA 4E18A 3DJNB 4HFFB 2DI3A 3A11A 3G50A 4D4XA 3C8ZA 5L0JA 2XLVA 2R7VA 3EZIA 2LQGA 3QW1A 1AUEA 3S9OA 2XM4A 3AG4C 4CBEA 5DS5A 3NG1A 5CIVA 2YL3A 3NMJA 3DXJF 3U9JA 2M4EA 4HEAJ 1VYIA 5B3IA 1T9KA 3DJUB 4MW8A 1OKKD 1YA7O 4XPWA 4MVZA 4RBNA 1OXKA 2R02A 3TD7A 3Q7LA 1T6IA 3M15A 4P9TA 1M57C 3DM5A 2PFDA 2Q00A 1UG7A 1TWGA 2OJED 2L6HA 4XLPF 3ASOC 4P6IC 4JTDB 2F22A 1YLMA 2P1AA 3RQGA 1OW6A 3M1CB 3S28A 2CGEA 1TQGA 1M2VA 2IBFA 3HKKA 4IWBA 3TJ6A 3TOMA 2IM8A 2XLMA 3DI5A 4M63A 5COGA 4YT4A 3ABMC 3HNJA 1L3PA 3ZG1A 1APCA 3U3BA 2R7WA 2ZD9A 3HNIA 3LNMB 4U5CE 4CS7A 4NQFA 1ST6A 3GEIA 3I5QA 4U5DE 3RH3A 3T6GB 1YYJA 3T6BA 3L34A 4ONSA 2XLOA 2VC9A 2R7XA 2NUPB 2LIGA 1QSPA 4MVOA 4P9FA 1NG1A 3C62A 1Q0MA 1B68A 2A6HF 4N06A 4NTAA 3Q7GA 4BPMA 3FVYA 2G62A 3LNRA 3NYMA 5F28E 2EPLX 1CPRA 2NUPA 3HTKC 1I5NA 4MS2A 1Z3IX 4HFKB 3ZC4A 2LFFA 3HNKA 3L8IA 5A6BA 2AVKA 5KYWA 4AK9A 1OXBA 2ZXWC 3ECSA 1G4US 1NBBA 5JVEA 1SYQA 3GODA 1SZIA 5KYXA 2DYSC 4CIPA 3FMSA 3MLGA 1T01A 4MVSA 3W4YA 2JD3A 3M4BA 4C7OB 2GA0A 4J30B 1JPNA 2XXAB 4FX5A 2R25A 4LACB 1EI7A 2EPOA 2XLWA 5KYYB 3S84A 2IXNA 3K1IA 4C7OA 4MVRA 2C04A 3R2PA 4CJOA 1L7CA 4IAOA 4XEVA 2AWYA 4XPYA 3U9MA 2WVNA 4MVUA 4G7HF 4JE9A 3ATPA 2YL7A 1YA9A 2HFIA 1LI5A 3JYYA 2CNWA 1NFNA 2H7BA 3X1OA 3W8HA 3RVYA 4A4AA 4PK4A 4Z9JA 5E33A 2X51A 4U9DA 4O79A 1EQ1A 3T6JA 5FCLA 1LM3B 4DBRA 1M6TA 4G78A 1NSGB 2WVQA 2R7TA 5L0IA 2HV6A 3K1HA 1HE9A 5L0FA 2KNHA 3C8GB 3LAYA 1A0BA 1WOLA 1YAUO 4JEAA 2EPMX 1C17M 3UGPA 2PX0A 5JT4A 2AU5A 1RKEA 2H7OA 1JMWA 3N24A 1TWCA 1ZHXA 2YLIA 1PV3A 3CZ6A 3DZAA 1BR4A 1V74B 1U6HA 2CYDA 1A41A 3FAJA 5L0HA 3TULA 3SNHA 3KKBA 4DVYP 5K0IA 2EILC 3J06A 4WJ0A 2HJ3A 1Z5ZA 3ABLC 3FAPB 1Z7Qc 3DM9B 1H7IA 3FHDA 3FDQA 4K1OA 2KW3C 2UUHA 2G3KA 3H2UA 1C02A 4JCHA 3OEOA 3O6XA 2I8BA 3U5SA 2Y3DA 5BQHA 3KPHA 3GM1A 2KC3A 3IQCA 5E3CA 3B9QA 3US6A 5AC4A 3EGDA 4OD4A 1M2OA 2EPKX 3NYJA 4JURI 3TJ5A 1EKYA 4XPXA 1FFTC 3RKOF 1VYKA 4ULWA 2E87A 5F5HA 1JPJA 4MTFA 2R7QA 4BJ1A 2J45A 2EIKC 2GFHA 3JCUQ 4QI0A 4JZAA 2YRFA 1IZMA 3CSKA 4U5EE 4CS9A 4KNVA 2GAQA 3EH1A 4Q4ZF 1LKXA 1V4AA 2W4MA 2A69F 1LS4A 1LPEA 5A6AA 3B0VC 3WHNA 1VTMP 4MVMA 2H8AA 1G4WR 2R03A 3PCVA 1E86A 5EK0A 4IAQA 3RQFA 4EWCA 1RCPA 2CNWD 1QZXA 2WL8A 4O6MA 4CDAA 2KQ9A 4XEFA 3SP1A 2HZ8A 3T4RA 2OOCA 5F5FA 2Y69C 2L9JA 4JC7A 3S27A 4CDYA 1MQVA 5BQGA 5HSWA 2O9XA 2CDQA 1A7DA 2IXOA 3LS0A 3EFOB 4Q5SF 2PP4A 3DAGA 4YT8A 1E84A 2LFDA 4RDAA 4YL3A 1Y4CA 4HE8D 1BR2A 1Z23A 3GM2A 3MBGA 4ZLDA 3EZHA 1ZW3A 3CQZA 2FAPB 2XM0A 2PBEA 1FMVA 2VH3A 3DE8A 2IXMA 3AQBA 3EFOA 2OKUA 2VASA 4YT2A 4L6RA 1SF8A 1R5ID 2NSFA 2P61A 3BRJA 4PJLA 3V5ZA 3ZVRA 3NDBB 3S90A 4KI2A 3JTLO 3AJMA 2L6GA 4MVQA 4B6IA 1OCRC 4BEMJ 5D91A 1CGOA 1XZQA 1S05A 2H7VC 3WG7C 2P7VA 3EJNA 3U2LA 3EPVA 2LD6A 3EG9B 5DQTA
chains in the Genus database with same CATH topology
4JRZA 4J7TA 4YL3A 4YK5A 3HKKA 4JCZA 3LEOA 4NTBA 5K0IA 4YL0A 5BQIA 3B29A 2UUHA 2UUIA 2H8AA 3DWWA 3PCVA 2PNOA 2Q7RA 5BQHA 4J7YA 4NTAA 4YL1A 4BPMA 4AL1A 4NTFA 5HV9A 4WABA 4JC7A 5BQGA 4AL0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JRZ A;  4J7T A;  4YL3 A;  4YK5 A;  3HKK A;  4JCZ A;  3LEO A;  4NTB A;  5K0I A;  4YL0 A;  5BQI A;  3B29 A;  2UUH A;  2UUI A;  2H8A A;  3DWW A;  3PCV A;  2PNO A;  2Q7R A;  5BQH A;  4J7Y A;  4NTA A;  4YL1 A;  4BPM A;  4AL1 A;  4NTF A;  5HV9 A;  4WAB A;  4JC7 A;  5BQG A;  4AL0 A; 
#chains in the Genus database with same CATH topology
 5CI8 A;  4Q7C A;  2C03 A;  2EIJ C;  3NYL A;  4G0H A;  3JT1 A;  4I1M A;  3IHU A;  1CGM E;  2A68 F;  2AWC A;  4YWQ A;  3N0T A;  1BBH A;  3X2Q C;  3UR3 C;  2XL8 A;  3B71 A;  4NTB A;  1VLT A;  3HLZ A;  3C63 A;  3EG9 A;  1T5O A;  3GOR A;  2B0J A;  3OA1 A;  4RD9 A;  4XTK A;  1Q0F A;  1XZP A;  1TR2 A;  3ZTZ A;  4IRU A;  4BJ6 C;  3ZTM A;  2OCC C;  1IW7 F;  3B29 A;  4A2N B;  4BJ5 C;  2UUI A;  3U3F A;  1YZA A;  4EBJ A;  1U0B B;  4JKV A;  2A6E F;  4PFO A;  3Q6N A;  1NFO A;  1VOM A;  3AGT A;  3W8I A;  2QE9 A;  1K05 A;  2PF4 E;  5JS5 A;  4G7O F;  2D4U A;  2XXA A;  1ORJ A;  3ABK C;  1DOV A;  1YAR O;  2HUJ A;  2XSE A;  1Z63 A;  5BUO A;  4ER9 A;  5KYY A;  1KTM A;  1LI7 A;  1HMD A;  3ZWI A;  3ITF A;  4E0H A;  1FFH A;  1MMA A;  4EHP A;  1WN0 A;  3FOO A;  3SYN A;  3NMK A;  4CDV A;  2L6F A;  1YZC A;  1D1A A;  3GM3 A;  4YK5 A;  3MX3 A;  1OQC A;  1TWA A;  3EGX B;  3QZC A;  2OU6 A;  2EPN A;  2XL4 A;  1RKC A;  3H65 A;  3LEV A;  3JZ0 A;  3LEO A;  4MTO A;  4WGZ A;  4JIO A;  3LLK A;  3LJB A;  3M4C A;  2BL2 A;  1MND A;  5JRA A;  3PMR A;  2XS1 A;  2Q9A A;  4LLE A;  2XRH A;  1F1M A;  3EGX A;  1EA8 A;  3MFN A;  3NKE A;  5DVW A;  1GM5 A;  2P6V A;  4BG0 A;  2WZG A;  3QW0 A;  3KYJ A;  2BE5 F;  4CSA C;  2A0U A;  5DS6 A;  4AE4 B;  2Q3T A;  5EGY A;  1WAS A;  3IEE A;  3C7J A;  2YWA A;  3JRT A;  1J8M F;  1LIH A;  2YL0 A;  1LVK A;  2J0W A;  1H9T A;  2OEX A;  5L0D A;  3KYI A;  3WAQ A;  5KYN A;  4NTF A;  2EIM C;  5L3V A;  4CIH A;  3DKA A;  1OCC C;  5T1D B;  5A6J A;  1V54 C;  2MHR A;  4W8K A;  2D5R B;  2KSF A;  3C8G A;  1VB5 A;  4IJJ A;  4JRZ A;  3JSE O;  4FWV A;  4PJM A;  2JX0 A;  4J7T A;  1JRA A;  4Z9I A;  1D0Z A;  5TJ5 E;  2VB6 A;  1D1C A;  5KYU B;  4OIO F;  1ZHW A;  2VCB A;  3AOU A;  4N6H A;  4OIN F;  4CJG A;  3BEH A;  1LE4 A;  1QVX A;  3GAN A;  2OQM A;  1VK5 A;  4W8P A;  2V26 A;  3CAX A;  2P0N A;  3UMI A;  1OCO C;  4J32 B;  1HMO A;  1VMA A;  1R4T A;  4O7G A;  1OW7 A;  2HSQ A;  4DBQ A;  5JLI A;  3E70 C;  2DYR C;  1TKN A;  4KNW A;  2R7U A;  3POV A;  1ORS C;  1Q0K A;  2BC5 A;  2YLG A;  4JVS A;  4ANJ A;  4CS8 C;  1S7Z A;  3RVZ A;  2WB7 A;  2HKV A;  2DB4 A;  1OW8 A;  1YJG A;  3GWN A;  3RYL A;  1FMW A;  1KU2 A;  2NG1 A;  1LS1 A;  3S29 A;  1Q0G A;  5A6B D;  2YKZ A;  3JSZ A;  1BZ4 A;  2YEV A;  3QMK A;  4GEH A;  2HSB A;  1NZE A;  4OD5 A;  1HW2 A;  3PDM P;  2YHS A;  2IOQ A;  4OIR F;  1ZU4 A;  2QNL A;  3R7C A;  3QTH A;  4DJ9 A;  4KBL A;  3OWT A;  3K66 A;  3NKD A;  3V5X A;  3MYF A;  3H2V A;  1FNT c;  1ZHZ A;  5COF A;  4LDR A;  3SXK A;  1QQ3 A;  1NLX A;  1MMG A;  5JP7 A;  1GQA A;  2XS8 A;  3AG3 C;  4I44 A;  3RFY A;  2ZPA A;  2I15 A;  1Y6D A;  3AGU A;  4EIY A;  4IB4 A;  1ZW2 A;  2YQY A;  5HV9 A;  1J8Y F;  2WVO A;  4PFP A;  4IGG A;  1JR8 A;  3DWW A;  1E83 A;  2XL6 A;  3K33 A;  1W2W A;  4XQ1 A;  5D92 A;  2Q9B A;  3E9V A;  3T9O A;  1A7V A;  4PAC A;  2LCH A;  2W9Y A;  3IQT A;  2QY9 A;  4U5B E;  1OCZ C;  3KMI A;  1G8X A;  3S0X A;  4JW1 A;  4C3D A;  4MTG A;  4AL1 A;  4E7S A;  1ZYR F;  2J9U A;  4PR9 A;  5DLJ A;  2OEV A;  3G4X A;  4IAR A;  4U5H A;  2R9R B;  4AX2 A;  4O6Y A;  4D4N A;  2DGJ A;  2QUP A;  4H54 A;  3RW0 A;  4UDV A;  1QKR A;  1MMD A;  5L0C A;  1SR2 A;  2HV7 A;  1O5H A;  1T6Q A;  1FTS A;  2A0B A;  3LUT B;  4N4W A;  5BQI A;  4CS8 A;  5FZT A;  3IQ6 A;  3ZSU A;  3SXZ A;  3GEE A;  3IQ5 A;  3SEO A;  3AG2 C;  1CPQ A;  1H6G A;  1D1B A;  3ZQY A;  4G7Z F;  4ZLC A;  2LP4 A;  4E7Z A;  3LES A;  3LS1 A;  1RJ9 B;  3N2Z B;  2Z15 A;  1SMY F;  3VRC A;  4EKW A;  1MMN A;  5E3A A;  2XLD A;  4J7Y A;  4YL1 A;  3C8G D;  3K1I C;  4Z9H A;  1M2V B;  1MNE A;  2B0H A;  3EH2 A;  4LER A;  2QTV A;  2XLH A;  2XLE A;  2HMQ A;  1RJ9 A;  2FFH A;  3VM6 A;  4N6C A;  4YN0 B;  4BJT A;  1OR2 A;  4JJG A;  1AVO B;  3V7O A;  1K04 A;  3W2V A;  3O10 A;  4K0D A;  2J7P A;  3EHM A;  2RD9 A;  3QVZ A;  5B1B C;  3AQC A;  1Q0D A;  2VCA A;  1UFB A;  2R7S A;  2NUT B;  2HMZ A;  2TMV P;  3JYH A;  4YL0 A;  4K7B A;  3UMH A;  5B3S C;  4I3M A;  4F4B A;  5AC5 A;  4C3B A;  3K6B A;  1O3U A;  2X0C A;  3W2W A;  4DRJ B;  4DXW A;  2YZS A;  1HY5 A;  3U2M A;  2NUT A;  2Y39 A;  1D0X A;  1I4Z A;  1WAT A;  3L0I A;  3SZR A;  1O87 A;  4JEB A;  1ORY A;  3C18 A;  2ZXP A;  5KYW B;  4QI2 A;  1KNY A;  1JOG A;  1TWH A;  3FOP A;  1YYX A;  3HJC A;  1N1C A;  4LDQ A;  2IXP A;  3U8V A;  1Z6A A;  5KYX B;  4PJJ A;  4ULV A;  3ZDL A;  2R7R A;  4OIQ F;  1U89 A;  2Q9C A;  4AL0 A;  5A69 A;  2ETS A;  2ZXO A;  4C3E A;  3L1M A;  3SXM A;  1CGN A;  3KH2 A;  4KC9 A;  1NU9 C;  2ASR A;  2HJM A;  1ZVZ A;  2CW0 F;  1E85 A;  4DRI B;  5T3T A;  3G4Z A;  3DE9 A;  1ZU5 A;  3CEX A;  4NC3 A;  3F47 A;  4WGY A;  2GWW A;  4EBK A;  4BEJ A;  5L0G A;  1HW1 A;  2R7O A;  4FAP B;  1OR3 A;  1C03 A;  3UMK A;  4EBB A;  5DS4 A;  3DAF A;  5GPG B;  3TOL A;  5AGF A;  5L3Q A;  2PNO A;  2YLD A;  5B1A C;  1VLS A;  3ZIB A;  1RMV A;  4H4K C;  2YL1 A;  1PCX A;  1QPU A;  3PHF 2;  2V3C C;  1OKK A;  1TFK B;  2IYL D;  2LK4 A;  2OG2 A;  3LLI A;  3HNL A;  3O55 A;  4JJF A;  1V55 C;  2KYH A;  1YVI A;  4XEK A;  4AE4 A;  4E17 A;  4U5G A;  1GS9 A;  3WOD F;  4I1O B;  1XWJ A;  4DOZ A;  1E2X A;  2NSG A;  1G5Z A;  4JTA B;  1WGW A;  2HS5 A;  3NMI A;  2AP3 A;  2J8W A;  3F46 A;  4JCZ A;  4YJW A;  3K7D A;  2J9V A;  2J9W A;  2Y3G A;  4X0R A;  3TQO A;  4BJ6 A;  3NRH A;  3ZQV A;  4BJ5 A;  1A7E A;  2QLA A;  2ZXR A;  4MW3 A;  4EUK B;  4OIP F;  1FAP B;  5E2Q A;  2G3V A;  3EHN A;  2M64 A;  3O39 A;  3VYW A;  4CS9 C;  3TK0 A;  5KYU A;  3UNG C;  4XWJ A;  5DQZ A;  5T3W A;  1RKE B;  3DMD A;  3FXH A;  3VAY A;  1AEP A;  4JTC B;  1JAF A;  2EIN C;  2R05 A;  2Q4F A;  3I4U A;  1K40 A;  2KGO A;  2GDC A;  1PD0 A;  1HE1 A;  4MND A;  5A6K A;  3U0C A;  3UGO A;  1ZZP A;  2J46 A;  1YDI A;  3QVY A;  4NCQ A;  4R32 A;  3JRM O;  4FES A;  5JSL A;  3RF3 A;  2J7P D;  2KK1 A;  2WZF A;  3RQE A;  3VF0 A;  5JUA A;  2L81 A;  1BR1 A;  2W4B A;  3ASN C;  1PD1 A;  4YT5 A;  4NY3 A;  3B0P A;  3DD7 A;  1WWP A;  4LLC A;  3SXY A;  3V5Y A;  1D0Y A;  1RXQ A;  3M79 A;  4QDL A;  2MWQ A;  4LDK A;  3EQL F;  1ZHT A;  4GYT A;  2J9B A;  3AG1 C;  2ICW G;  3KL4 A;  1I4Y A;  1H9G A;  4CSA A;  2Y3H A;  3MYI A;  1DOW A;  3B0U X;  4PJN A;  4CX9 A;  3I5P A;  1NU7 D;  3L8J A;  2JPU A;  2CCY A;  3EGD B;  256B A;  1WTY A;  5EHH A;  4O6N A;  3GEH A;  2W45 A;  2RSE B;  2NPU A;  2Y3B A;  1M56 C;  3A9C A;  5CI9 A;  3RIP A;  4DRH B;  2FGY A;  2Q7R A;  1T6U A;  1ZHY A;  4GQH A;  4MQ9 F;  4U5F E;  5IY5 C;  1FR0 A;  1GGQ A;  5COM A;  2OJQ A;  1TFO B;  1QLE C;  2KJG A;  3GWL A;  2A1D D;  2J0X A;  2VCC A;  4U9E A;  4WAB A;  2MYS A;  2WZL A;  3U8P A;  2PX3 A;  1BDJ B;  2L7A A;  3IPM O;  4XLN F;  4E0I A;  1LE2 A;  2LSE A;  3Q6M A;  2YVK A;  4DVZ A;  4E18 A;  3DJN B;  4HFF B;  2DI3 A;  3A11 A;  3G50 A;  4D4X A;  3C8Z A;  5L0J A;  2XLV A;  2R7V A;  3EZI A;  2LQG A;  3QW1 A;  1AUE A;  3S9O A;  2XM4 A;  3AG4 C;  4CBE A;  5DS5 A;  3NG1 A;  5CIV A;  2YL3 A;  3NMJ A;  3DXJ F;  3U9J A;  2M4E A;  4HEA J;  1VYI A;  5B3I A;  1T9K A;  3DJU B;  4MW8 A;  1OKK D;  1YA7 O;  4XPW A;  4MVZ A;  4RBN A;  1OXK A;  2R02 A;  3TD7 A;  3Q7L A;  1T6I A;  3M15 A;  4P9T A;  1M57 C;  3DM5 A;  2PFD A;  2Q00 A;  1UG7 A;  1TWG A;  2OJE D;  2L6H A;  4XLP F;  3ASO C;  4P6I C;  4JTD B;  2F22 A;  1YLM A;  2P1A A;  3RQG A;  1OW6 A;  3M1C B;  3S28 A;  2CGE A;  1TQG A;  1M2V A;  2IBF A;  3HKK A;  4IWB A;  3TJ6 A;  3TOM A;  2IM8 A;  2XLM A;  3DI5 A;  4M63 A;  5COG A;  4YT4 A;  3ABM C;  3HNJ A;  1L3P A;  3ZG1 A;  1APC A;  3U3B A;  2R7W A;  2ZD9 A;  3HNI A;  3LNM B;  4U5C E;  4CS7 A;  4NQF A;  1ST6 A;  3GEI A;  3I5Q A;  4U5D E;  3RH3 A;  3T6G B;  1YYJ A;  3T6B A;  3L34 A;  4ONS A;  2XLO A;  2VC9 A;  2R7X A;  2NUP B;  2LIG A;  1QSP A;  4MVO A;  4P9F A;  1NG1 A;  3C62 A;  1Q0M A;  1B68 A;  2A6H F;  4N06 A;  4NTA A;  3Q7G A;  4BPM A;  3FVY A;  2G62 A;  3LNR A;  3NYM A;  5F28 E;  2EPL X;  1CPR A;  2NUP A;  3HTK C;  1I5N A;  4MS2 A;  1Z3I X;  4HFK B;  3ZC4 A;  2LFF A;  3HNK A;  3L8I A;  5A6B A;  2AVK A;  5KYW A;  4AK9 A;  1OXB A;  2ZXW C;  3ECS A;  1G4U S;  1NBB A;  5JVE A;  1SYQ A;  3GOD A;  1SZI A;  5KYX A;  2DYS C;  4CIP A;  3FMS A;  3MLG A;  1T01 A;  4MVS A;  3W4Y A;  2JD3 A;  3M4B A;  4C7O B;  2GA0 A;  4J30 B;  1JPN A;  2XXA B;  4FX5 A;  2R25 A;  4LAC B;  1EI7 A;  2EPO A;  2XLW A;  5KYY B;  3S84 A;  2IXN A;  3K1I A;  4C7O A;  4MVR A;  2C04 A;  3R2P A;  4CJO A;  1L7C A;  4IAO A;  4XEV A;  2AWY A;  4XPY A;  3U9M A;  2WVN A;  4MVU A;  4G7H F;  4JE9 A;  3ATP A;  2YL7 A;  1YA9 A;  2HFI A;  1LI5 A;  3JYY A;  2CNW A;  1NFN A;  2H7B A;  3X1O A;  3W8H A;  3RVY A;  4A4A A;  4PK4 A;  4Z9J A;  5E33 A;  2X51 A;  4U9D A;  4O79 A;  1EQ1 A;  3T6J A;  5FCL A;  1LM3 B;  4DBR A;  1M6T A;  4G78 A;  1NSG B;  2WVQ A;  2R7T A;  5L0I A;  2HV6 A;  3K1H A;  1HE9 A;  5L0F A;  2KNH A;  3C8G B;  3LAY A;  1A0B A;  1WOL A;  1YAU O;  4JEA A;  2EPM X;  1C17 M;  3UGP A;  2PX0 A;  5JT4 A;  2AU5 A;  1RKE A;  2H7O A;  1JMW A;  3N24 A;  1TWC A;  1ZHX A;  2YLI A;  1PV3 A;  3CZ6 A;  3DZA A;  1BR4 A;  1V74 B;  1U6H A;  2CYD A;  1A41 A;  3FAJ A;  5L0H A;  3TUL A;  3SNH A;  3KKB A;  4DVY P;  5K0I A;  2EIL C;  3J06 A;  4WJ0 A;  2HJ3 A;  1Z5Z A;  3ABL C;  3FAP B;  1Z7Q c;  3DM9 B;  1H7I A;  3FHD A;  3FDQ A;  4K1O A;  2KW3 C;  2UUH A;  2G3K A;  3H2U A;  1C02 A;  4JCH A;  3OEO A;  3O6X A;  2I8B A;  3U5S A;  2Y3D A;  5BQH A;  3KPH A;  3GM1 A;  2KC3 A;  3IQC A;  5E3C A;  3B9Q A;  3US6 A;  5AC4 A;  3EGD A;  4OD4 A;  1M2O A;  2EPK X;  3NYJ A;  4JUR I;  3TJ5 A;  1EKY A;  4XPX A;  1FFT C;  3RKO F;  1VYK A;  4ULW A;  2E87 A;  5F5H A;  1JPJ A;  4MTF A;  2R7Q A;  4BJ1 A;  2J45 A;  2EIK C;  2GFH A;  3JCU Q;  4QI0 A;  4JZA A;  2YRF A;  1IZM A;  3CSK A;  4U5E E;  4CS9 A;  4KNV A;  2GAQ A;  3EH1 A;  4Q4Z F;  1LKX A;  1V4A A;  2W4M A;  2A69 F;  1LS4 A;  1LPE A;  5A6A A;  3B0V C;  3WHN A;  1VTM P;  4MVM A;  2H8A A;  1G4W R;  2R03 A;  3PCV A;  1E86 A;  5EK0 A;  4IAQ A;  3RQF A;  4EWC A;  1RCP A;  2CNW D;  1QZX A;  2WL8 A;  4O6M A;  4CDA A;  2KQ9 A;  4XEF A;  3SP1 A;  2HZ8 A;  3T4R A;  2OOC A;  5F5F A;  2Y69 C;  2L9J A;  4JC7 A;  3S27 A;  4CDY A;  1MQV A;  5BQG A;  5HSW A;  2O9X A;  2CDQ A;  1A7D A;  2IXO A;  3LS0 A;  3EFO B;  4Q5S F;  2PP4 A;  3DAG A;  4YT8 A;  1E84 A;  2LFD A;  4RDA A;  4YL3 A;  1Y4C A;  4HE8 D;  1BR2 A;  1Z23 A;  3GM2 A;  3MBG A;  4ZLD A;  3EZH A;  1ZW3 A;  3CQZ A;  2FAP B;  2XM0 A;  2PBE A;  1FMV A;  2VH3 A;  3DE8 A;  2IXM A;  3AQB A;  3EFO A;  2OKU A;  2VAS A;  4YT2 A;  4L6R A;  1SF8 A;  1R5I D;  2NSF A;  2P61 A;  3BRJ A;  4PJL A;  3V5Z A;  3ZVR A;  3NDB B;  3S90 A;  4KI2 A;  3JTL O;  3AJM A;  2L6G A;  4MVQ A;  4B6I A;  1OCR C;  4BEM J;  5D91 A;  1CGO A;  1XZQ A;  1S05 A;  2H7V C;  3WG7 C;  2P7V A;  3EJN A;  3U2L A;  3EPV A;  2LD6 A;  3EG9 B;  5DQT A; 
#chains in the Genus database with same CATH homology
 4JRZ A;  4J7T A;  4YL3 A;  4YK5 A;  3HKK A;  4JCZ A;  3LEO A;  4NTB A;  5K0I A;  4YL0 A;  5BQI A;  3B29 A;  2UUH A;  2UUI A;  2H8A A;  3DWW A;  3PCV A;  2PNO A;  2Q7R A;  5BQH A;  4J7Y A;  4NTA A;  4YL1 A;  4BPM A;  4AL1 A;  4NTF A;  5HV9 A;  4WAB A;  4JC7 A;  5BQG A;  4AL0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...