5HV9A

Human ltc4s mutant-s36e
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
143
structure length
143
Chain Sequence
VALLAAVTLLGVLLQAYFSLQVISARRAFRVEPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Leukotriene C4 synthase
publication title Phosphorylation of Leukotriene C4 Synthase at Serine 36 Impairs Catalytic Activity.
pubmed doi rcsb
source organism Homo sapiens
total genus 52
structure length 143
sequence length 143
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 5hv9A00
4YL3A 5HV9A 4BPMA 4YL0A 4J7TA 4JC7A 4AL0A 3LEOA 4NTBA 2H8AA 5BQGA 5BQHA 4YK5A 4JCZA 3HKKA 3PCVA 4AL1A 4J7YA 4YL1A 2PNOA 3DWWA 3B29A 4NTFA 2UUHA 4JRZA 2UUIA 2Q7RA 5K0IA 5BQIA 4WABA 4NTAA
chains in the Genus database with same CATH superfamily
4XEVA 1ZHWA 4DRHB 3X2QC 4A4AA 1IW7F 1EA8A 3C8GD 4YJWA 1JR8A 3H2VA 3HNKA 3U8PA 5DLJA 1V4AA 4C7OA 4R32A 3JT1A 1A7EA 4PFOA 1I4YA 5JUAA 2YRFA 1K04A 1VOMA 2B0HA 2IXOA 3HKKA 4E7SA 1T6IA 2FFHA 3U2LA 1YZAA 1YYXA 2HZ8A 3GWLA 2KQ9A 1RKCA 4WJ0A 4FAPB 3F46A 1V55C 2ZXPA 3L34A 1ZHXA 2R7OA 3QW0A 1FTSA 3S84A 1C02A 3RVZA 3X1OA 1RMVA 2R7WA 2AWCA 2GWWA 3JSEO 1ZZPA 2BC5A 3O10A 2VH3A 3ABKC 2L81A 4O6MA 1OW7A 2R25A 2YL1A 1NZEA 1TQGA 4DVZA 4FESA 1AUEA 4NTAA 3FOPA 4Q4ZF 1YAUO 1FAPB 4MVRA 3G50A 1WWPA 2PBEA 2IXMA 1ZVZA 4JC7A 1RCPA 5L0IA 3AG3C 3ZTZA 5AC4A 3NYMA 5JSLA 3FAPB 4KI2A 3UR3C 2J7PA 3JYYA 1H6GA 5L3QA 3O55A 4YL1A 1Q0MA 4ANJA 5B3SC 1EI7A 4FX5A 1NFOA 3KYIA 3R2PA 5TJ5E 5JRAA 3KH2A 2W4MA 2EPKX 2WZFA 3ZQYA 4UDVA 5CIVA 1HMDA 4JTDB 4ONSA 3BRJA 3DM5A 3OWTA 3HNIA 3LAYA 3Q7GA 2ZD9A 4CDVA 4DXWA 2ZPAA 3SEOA 1D0XA 2D4UA 2W9YA 1YA7O 2QUPA 1WASA 3W2VA 3U0CA 4K7BA 3RVYA 2Q9BA 1LIHA 2YLGA 3B9QA 4CDYA 5E2QA 3ZVRA 3VAYA 2G3KA 3F47A 4XEFA 2J9UA 3C62A 1H9TA 3LNMB 4D4NA 3QVZA 3S90A 1Z23A 1VK5A 2VCAA 3DD7A 3K1IC 1O3UA 4PJNA 1XZQA 3EHMA 3N0TA 2GFHA 3DKAA 1T5OA 1HW2A 3JYHA 5COMA 3FVYA 2J0XA 1HE9A 2P6VA 2XM0A 4JVSA 5D92A 4DRJB 1XZPA 2H7VC 5L3VA 2Y3HA 3S29A 3OA1A 2ASRA 3ZSUA 3WHNA 4BJTA 1G8XA 1TR2A 3MX3A 3QTHA 4WGYA 3S27A 5KYWB 2Q9AA 1HMOA 1ORJA 2R05A 5EK0A 1ZW2A 1FR0A 3PMRA 2NG1A 3AG1C 4PACA 2KGOA 3RW0A 3EFOA 3EPVA 5FCLA 3NMJA 1JRAA 4YL0A 2W4BA 2NUTB 3QVYA 2V3CC 4EIYA 1U6HA 3TULA 3U9JA 2XLMA 2XLWA 3IQCA 5JVEA 5L0FA 5A6AA 2OOCA 1OW6A 3DZAA 5BUOA 1GQAA 5KYNA 3KPHA 4U9DA 5DQZA 2AU5A 3C63A 5A6JA 2L6FA 5KYYA 1CGME 2CDQA 4LLCA 2Z15A 3GEIA 1QQ3A 5T3WA 2HKVA 3AJMA 4JIOA 2LP4A 1BR2A 3S9OA 3GWNA 3U9MA 2J8WA 2YL3A 3IQ6A 5KYYB 1OQCA 3O6XA 2XLEA 2YVKA 5T1DB 4IJJA 1R4TA 3K1HA 3E9VA 1FFTC 1E2XA 3NDBB 5BQGA 2QTVA 2A6EF 4MW3A 3TOMA 5COGA 1PCXA 3KKBA 1AEPA 4MTGA 4EKWA 4E18A 1EQ1A 4FWVA 1A41A 2EIJC 1C17M 1TFKB 2HMQA 4DRIB 5DVWA 4XLPF 4I44A 2IOQA 2NUPA 2R03A 4AE4A 3AGTA 1TFOB 3DWWA 2GAQA 2G62A 2OU6A 2R7UA 4CS8C 2WVOA 1Z5ZA 2C04A 5L0JA 3QW1A 5HSWA 4E0IA 2XSEA 4MW8A 1YYJA 2Q7RA 3N24A 3A9CA 1OKKD 1NSGB 3DI5A 3L0IA 4MVQA 5A6BD 4N6HA 3UMHA 3CEXA 4OINF 2LK4A 3W4YA 3AQCA 1WGWA 3G4ZA 4X0RA 5HV9A 1Q0KA 4LLEA 3TK0A 4IAQA 3B0PA 1T01A 2AVKA 3FDQA 5L0GA 4PJMA 5A6KA 2IXNA 4DOZA 4DJ9A 3EGXA 5BQHA 5COFA 1Y4CA 4YWQA 4JCZA 2OQMA 3RYLA 3L8JA 1Z7Qc 4BJ5C 4U5GA 1BR1A 2PF4E 1A7VA 3ATPA 1OCRC 3NYJA 3EGXB 2LCHA 2NPUA 2QY9A 4D4XA 2KYHA 4C7OB 1G4WR 3LEVA 3LUTB 3N2ZB 4XWJA 1M6TA 4IWBA 4NCQA 2VB6A 2KNHA 3C8GA 4CJGA 1ZU4A 2XL4A 1D0YA 2UUHA 2YWAA 3DE9A 4HEAJ 3DAFA 1A7DA 3T6JA 3K33A 1V54C 1E86A 2QE9A 1A0BA 2QNLA 3EHNA 4Z9HA 2XLOA 2CCYA 4KC9A 1ORSC 3PDMP 2ZXWC 1CPRA 1WOLA 3OEOA 3T6GB 1M2OA 4Q5SF 2A1DD 3I5PA 4CIPA 2YLIA 3ZQVA 2M4EA 3V7OA 4OIRF 4J7TA 4PJJA 3U8VA 4BJ6C 3A11A 5JLIA 2D5RB 4O79A 4HFKB 2Q9CA 4OIQF 5L0CA 2J9BA 3K1IA 4WGZA 3JSZA 1LE2A 1QKRA 1GS9A 3MBGA 4N4WA 1OXBA 3DJNB 1BBHA 2VCCA 1YVIA 4K1OA 2A0UA 2J9VA 5IY5C 3MYIA 4DVYP 2A6HF 3K6BA 4DBQA 5JS5A 5F5FA 5F5HA 2UUIA 3ITFA 1SMYF 3SXKA 1LI7A 2R7VA 3CQZA 4BEMJ 4KNWA 1LPEA 1ORYA 3ZG1A 3LESA 5E33A 2L7AA 1TWGA 2IYLD 1O5HA 4ULVA 3ASOC 3ZC4A 2CNWD 5B1AC 4OD5A 4MQ9F 3UGOA 3TJ6A 4JJFA 2OEXA 4NTBA 2YL0A 3NMKA 2E87A 2FAPB 3EG9A 4XPWA 1T6QA 3QMKA 5FZTA 1N1CA 3W8IA 2CW0F 1TWHA 4QDLA 1C03A 4NQFA 3T9OA 1RJ9A 2A68F 2YZSA 1OR3A 4U5DE 2PNOA 4H4KC 1YJGA 1APCA 1ZHYA 2J46A 2P1AA 2XL6A 4NTFA 2OCCC 2KW3C 1CGOA 1VTMP 1RJ9B 4CS9A 1W2WA 1JOGA 4Z9IA 1I5NA 4PJLA 4JTAB 1Q0DA 1T6UA 3FOOA 4C3BA 4C3DA 2LIGA 4KBLA 3U5SA 5JP7A 3WG7C 1F1MA 4OIOF 2F22A 4EBJA 3RIPA 3W8HA 2GDCA 1MQVA 3L1MA 4CSAC 2DGJA 1L3PA 1DOVA 1OXKA 1NBBA 4J32B 3KYJA 5L0DA 1EKYA 1FMVA 2EPNA 1MMAA 1JPJA 2AWYA 3SXZA 2WVNA 3EFOB 4HE8D 3B0VC 2Y69C 3LS1A 2DYRC 2XS8A 3VYWA 3GODA 1L7CA 2Y3DA 3RH3A 4MVOA 2G3VA 4ULWA 4Q7CA 3W2WA 2R7XA 1MMDA 2WL8A 1VLTA 4JRZA 2NSFA 4MVMA 3RQGA 3ZWIA 1TWAA 4EHPA 4MNDA 2TMVP 1G5ZA 4G0HA 3Q6NA 1ZU5A 1MNEA 4L6RA 5KYUA 3RQFA 1MMGA 3VRCA 4MVZA 3M4CA 3TD7A 5BQIA 1T9KA 5KYXA 1YZCA 2JX0A 4MVSA 3POVA 3ABLC 3AGUA 3T4RA 2R7SA 1FNTc 1CGNA 4CDAA 2PP4A 2YHSA 3E70C 3M1CB 3M79A 1LM3B 2J0WA 4O6YA 3WODF 1NU7D 2IXPA 4BJ5A 4I3MA 4I1MA 2Q3TA 2V26A 3GM1A 2XLVA 3UNGC 3QZCA 3JRMO 2GA0A 3KMIA 3EGDA 3DXJF 1QPUA 2PX0A 3GEHA 3C18A 4EWCA 3SNHA 3B29A 2QLAA 2X0CA 3LNRA 3MFNA 1OCOC 2OG2A 1J8YF 4IARA 4YT8A 1M2VA 2HFIA 3SXMA 4IGGA 2NUPB 1VLSA 1YLMA 3CSKA 1QSPA 2KK1A 4AE4B 2BL2A 5K0IA 1Q0FA 3NMIA 3EH2A 4U5FE 1E85A 4P9FA 2KSFA 2HMZA 2EPOA 4GYTA 1M2VB 1TKNA 2Q00A 3SXYA 1SF8A 3IQTA 1S7ZA 3GANA 3I4UA 4BPMA 3CZ6A 4LDRA 3GM2A 3H65A 3ZTMA 3LEOA 4JZAA 5AGFA 1D1AA 2J45A 2AP3A 4RDAA 2MYSA 4B6IA 1HY5A 2Q4FA 3NRHA 3EZIA 1D1BA 3U3FA 2WZLA 3EH1A 2OEVA 4JE9A 1I4ZA 2Y3GA 4ZLDA 4J7YA 1OKKA 2EIKC 3H2UA 4MTOA 1M56C 1B68A 1NFNA 4BJ1A 3S28A 1YDIA 2LSEA 3V5ZA 2VC9A 2WVQA 3UGPA 1XWJA 2R7QA 3LLIA 1PD1A 2YKZA 3WAQA 1D0ZA 1NLXA 2HSQA 1BDJB 3NG1A 4W8PA 2Y39A 2HV7A 4J30B 1MMNA 2LQGA 4W8KA 1DOWA 1JPNA 4ZLCA 2L6GA 2O9XA 3C8GB 1E84A 1ST6A 2ETSA 3V5XA 1U0BB 3B0UX 2I8BA 1YA9A 4XEKA 256BA 4YT2A 4C3EA 3K7DA 2XL8A 2KJGA 3AG4C 2YLDA 3EJNA 3GORA 1Q0GA 1K05A 1U89A 2BE5F 2M64A 4LDKA 4YK5A 1OW8A 4BG0A 1VB5A 3AQBA 3NKDA 4RD9A 4EUKB 1LKXA 5DS5A 4CX9A 2EPMX 5JT4A 4G7ZF 5CI9A 2HSBA 5EHHA 4EBKA 2I15A 1LVKA 4BEJA 1NU9C 5L0HA 5B1BC 2FGYA 3DAGA 1S05A 1RKEA 2ICWG 4YT4A 4GQHA 4NC3A 2J7PD 2NSGA 3ASNC 4LDQA 2R7TA 3US6A 4CS7A 1GGQA 4ER9A 3KL4A 4PR9A 1RKEB 1V74B 4DBRA 2L9JA 4NY3A 4CBEA 4YL3A 2W45A 3IQ5A 5DQTA 4JURI 4CSAA 3ECSA 3EZHA 2CGEA 5B3IA 4RBNA 4HFFB 3ZIBA 1WN0A 4CIHA 1SYQA 3L8IA 1G4US 3HNLA 2VCBA 4LERA 3IHUA 3M4BA 2XRHA 3PCVA 3NYLA 2A0BA 5E3AA 3R7CA 3V5YA 1GM5A 5AC5A 3HLZA 2YL7A 4G7OF 3EG9B 2H7BA 3FAJA 3Q6MA 1OR2A 1PD0A 3T6BA 4U5EE 3U2MA 1M57C 1YARO 2EINC 2P61A 3DMDA 4LACB 2CNWA 1PV3A 3K66A 4N06A 2R7RA 3DM9B 2JPUA 3HNJA 1HE1A 3MLGA 5F28E 1Z6AA 1WTYA 1SR2A 4XPYA 5GPGB 3S0XA 2YQYA 3SP1A 2R9RB 3ZDLA 1JAFA 3RFYA 2PFDA 1LE4A 3LJBA 2VASA 4E0HA 4IAOA 3DE8A 4MVUA 1QVXA 3GM3A 1UFBA 5EGYA 1KNYA 3AOUA 4IB4A 4AK9A 1MNDA 4U5HA 4N6CA 1K40A 1JMWA 4JEBA 1H9GA 1TWCA 3M15A 4U9EA 1WATA 2WZGA 1LS1A 2DI3A 2XLDA 3JZ0A 4JEAA 5CI8A 4XLNF 3TOLA 2Y3BA 1SZIA 2P0NA 2XS1A 3LS0A 4GEHA 1O87A 3RKOF 3JRTA 4CJOA 5KYWA 2A69F 2LD6A 3FXHA 5D91A 1E83A 2EIMC 4U5CE 1BZ4A 3UMIA 1VYIA 4CS8A 4AX2A 3C7JA 4QI0A 4E17A 4IRUA 3B71A 1FMWA 5T3TA 2MHRA 3NKEA 2EILC 2L6HA 2NUTA 5DS6A 1RXQA 1LI5A 4G7HF 4WABA 2HJ3A 5DS4A 2YEVA 1Z3IX 3BEHA 1Y6DA 4KNVA 1CPQA 4XTKA 1HW1A 2OJED 2RSEB 2DB4A 3HTKC 3UMKA 1LS4A 4K0DA 4AL0A 3PHF2 2H8AA 5KYUB 1R5ID 3VF0A 2R02A 2DYSC 5KYXB 4PK4A 4JW1A 4Z9JA 4O7GA 1VMAA 2ZXRA 1ZW3A 3AG2C 3DJUB 4E7ZA 3ABMC 2LFFA 4OIPF 2ZXOA 4I1OB 3EQLF 4U5BE 2PX3A 2IBFA 3I5QA 4P9TA 2HUJA 1VYKA 3TJ5A 4QI2A 4CS9C 1IZMA 4P6IC 1KU2A 3RF3A 3IEEA 1ZHZA 1J8MF 3CAXA 3EGDB 4YN0B 3IPMO 2OJQA 2B0JA 3U3BA 1KTMA 2EPLX 2LFDA 1OCZC 2P7VA 1BR4A 4OD4A 4A2NB 2XXAA 4JJGA 1ZHTA 4F4BA 2J9WA 1FFHA 2X51A 4O6NA 3SZRA 4BJ6A 1OCCC 4JTCB 1D1CA 2KC3A 2JD3A 3G4XA 2XXAB 2OKUA 4MTFA 2HJMA 3GEEA 2C03A 2RD9A 2XLHA 4XPXA 3SYNA 4AL1A 4H54A 2HS5A 5A69A 1UG7A 3HJCA 2MWQA 4JKVA 1H7IA 4MS2A 3FMSA 3JTLO 1NG1A 5A6BA 4JCHA 2HV6A 5E3CA 3VM6A 4XQ1A 2H7OA 2WB7A 4M63A 4PFPA 2XM4A 3MYFA 4G78A 3RQEA 3TQOA 3J06A 3O39A 1ZYRF 2CYDA 3LLKA 3FHDA 3Q7LA 1AVOB 3JCUQ 4YT5A 2IM8A 3C8ZA 4EBBA 1Z63A 1QLEC 1QZXA
chains in the Genus database with same CATH topology
4YL3A 5HV9A 4BPMA 4YL0A 4J7TA 4JC7A 4AL0A 3LEOA 4NTBA 2H8AA 5BQGA 5BQHA 4YK5A 4JCZA 3HKKA 3PCVA 4AL1A 4J7YA 4YL1A 2PNOA 3DWWA 3B29A 4NTFA 2UUHA 4JRZA 2UUIA 2Q7RA 5K0IA 5BQIA 4WABA 4NTAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YL3 A;  5HV9 A;  4BPM A;  4YL0 A;  4J7T A;  4JC7 A;  4AL0 A;  3LEO A;  4NTB A;  2H8A A;  5BQG A;  5BQH A;  4YK5 A;  4JCZ A;  3HKK A;  3PCV A;  4AL1 A;  4J7Y A;  4YL1 A;  2PNO A;  3DWW A;  3B29 A;  4NTF A;  2UUH A;  4JRZ A;  2UUI A;  2Q7R A;  5K0I A;  5BQI A;  4WAB A;  4NTA A; 
#chains in the Genus database with same CATH topology
 4XEV A;  1ZHW A;  4DRH B;  3X2Q C;  4A4A A;  1IW7 F;  1EA8 A;  3C8G D;  4YJW A;  1JR8 A;  3H2V A;  3HNK A;  3U8P A;  5DLJ A;  1V4A A;  4C7O A;  4R32 A;  3JT1 A;  1A7E A;  4PFO A;  1I4Y A;  5JUA A;  2YRF A;  1K04 A;  1VOM A;  2B0H A;  2IXO A;  3HKK A;  4E7S A;  1T6I A;  2FFH A;  3U2L A;  1YZA A;  1YYX A;  2HZ8 A;  3GWL A;  2KQ9 A;  1RKC A;  4WJ0 A;  4FAP B;  3F46 A;  1V55 C;  2ZXP A;  3L34 A;  1ZHX A;  2R7O A;  3QW0 A;  1FTS A;  3S84 A;  1C02 A;  3RVZ A;  3X1O A;  1RMV A;  2R7W A;  2AWC A;  2GWW A;  3JSE O;  1ZZP A;  2BC5 A;  3O10 A;  2VH3 A;  3ABK C;  2L81 A;  4O6M A;  1OW7 A;  2R25 A;  2YL1 A;  1NZE A;  1TQG A;  4DVZ A;  4FES A;  1AUE A;  4NTA A;  3FOP A;  4Q4Z F;  1YAU O;  1FAP B;  4MVR A;  3G50 A;  1WWP A;  2PBE A;  2IXM A;  1ZVZ A;  4JC7 A;  1RCP A;  5L0I A;  3AG3 C;  3ZTZ A;  5AC4 A;  3NYM A;  5JSL A;  3FAP B;  4KI2 A;  3UR3 C;  2J7P A;  3JYY A;  1H6G A;  5L3Q A;  3O55 A;  4YL1 A;  1Q0M A;  4ANJ A;  5B3S C;  1EI7 A;  4FX5 A;  1NFO A;  3KYI A;  3R2P A;  5TJ5 E;  5JRA A;  3KH2 A;  2W4M A;  2EPK X;  2WZF A;  3ZQY A;  4UDV A;  5CIV A;  1HMD A;  4JTD B;  4ONS A;  3BRJ A;  3DM5 A;  3OWT A;  3HNI A;  3LAY A;  3Q7G A;  2ZD9 A;  4CDV A;  4DXW A;  2ZPA A;  3SEO A;  1D0X A;  2D4U A;  2W9Y A;  1YA7 O;  2QUP A;  1WAS A;  3W2V A;  3U0C A;  4K7B A;  3RVY A;  2Q9B A;  1LIH A;  2YLG A;  3B9Q A;  4CDY A;  5E2Q A;  3ZVR A;  3VAY A;  2G3K A;  3F47 A;  4XEF A;  2J9U A;  3C62 A;  1H9T A;  3LNM B;  4D4N A;  3QVZ A;  3S90 A;  1Z23 A;  1VK5 A;  2VCA A;  3DD7 A;  3K1I C;  1O3U A;  4PJN A;  1XZQ A;  3EHM A;  3N0T A;  2GFH A;  3DKA A;  1T5O A;  1HW2 A;  3JYH A;  5COM A;  3FVY A;  2J0X A;  1HE9 A;  2P6V A;  2XM0 A;  4JVS A;  5D92 A;  4DRJ B;  1XZP A;  2H7V C;  5L3V A;  2Y3H A;  3S29 A;  3OA1 A;  2ASR A;  3ZSU A;  3WHN A;  4BJT A;  1G8X A;  1TR2 A;  3MX3 A;  3QTH A;  4WGY A;  3S27 A;  5KYW B;  2Q9A A;  1HMO A;  1ORJ A;  2R05 A;  5EK0 A;  1ZW2 A;  1FR0 A;  3PMR A;  2NG1 A;  3AG1 C;  4PAC A;  2KGO A;  3RW0 A;  3EFO A;  3EPV A;  5FCL A;  3NMJ A;  1JRA A;  4YL0 A;  2W4B A;  2NUT B;  3QVY A;  2V3C C;  4EIY A;  1U6H A;  3TUL A;  3U9J A;  2XLM A;  2XLW A;  3IQC A;  5JVE A;  5L0F A;  5A6A A;  2OOC A;  1OW6 A;  3DZA A;  5BUO A;  1GQA A;  5KYN A;  3KPH A;  4U9D A;  5DQZ A;  2AU5 A;  3C63 A;  5A6J A;  2L6F A;  5KYY A;  1CGM E;  2CDQ A;  4LLC A;  2Z15 A;  3GEI A;  1QQ3 A;  5T3W A;  2HKV A;  3AJM A;  4JIO A;  2LP4 A;  1BR2 A;  3S9O A;  3GWN A;  3U9M A;  2J8W A;  2YL3 A;  3IQ6 A;  5KYY B;  1OQC A;  3O6X A;  2XLE A;  2YVK A;  5T1D B;  4IJJ A;  1R4T A;  3K1H A;  3E9V A;  1FFT C;  1E2X A;  3NDB B;  5BQG A;  2QTV A;  2A6E F;  4MW3 A;  3TOM A;  5COG A;  1PCX A;  3KKB A;  1AEP A;  4MTG A;  4EKW A;  4E18 A;  1EQ1 A;  4FWV A;  1A41 A;  2EIJ C;  1C17 M;  1TFK B;  2HMQ A;  4DRI B;  5DVW A;  4XLP F;  4I44 A;  2IOQ A;  2NUP A;  2R03 A;  4AE4 A;  3AGT A;  1TFO B;  3DWW A;  2GAQ A;  2G62 A;  2OU6 A;  2R7U A;  4CS8 C;  2WVO A;  1Z5Z A;  2C04 A;  5L0J A;  3QW1 A;  5HSW A;  4E0I A;  2XSE A;  4MW8 A;  1YYJ A;  2Q7R A;  3N24 A;  3A9C A;  1OKK D;  1NSG B;  3DI5 A;  3L0I A;  4MVQ A;  5A6B D;  4N6H A;  3UMH A;  3CEX A;  4OIN F;  2LK4 A;  3W4Y A;  3AQC A;  1WGW A;  3G4Z A;  4X0R A;  5HV9 A;  1Q0K A;  4LLE A;  3TK0 A;  4IAQ A;  3B0P A;  1T01 A;  2AVK A;  3FDQ A;  5L0G A;  4PJM A;  5A6K A;  2IXN A;  4DOZ A;  4DJ9 A;  3EGX A;  5BQH A;  5COF A;  1Y4C A;  4YWQ A;  4JCZ A;  2OQM A;  3RYL A;  3L8J A;  1Z7Q c;  4BJ5 C;  4U5G A;  1BR1 A;  2PF4 E;  1A7V A;  3ATP A;  1OCR C;  3NYJ A;  3EGX B;  2LCH A;  2NPU A;  2QY9 A;  4D4X A;  2KYH A;  4C7O B;  1G4W R;  3LEV A;  3LUT B;  3N2Z B;  4XWJ A;  1M6T A;  4IWB A;  4NCQ A;  2VB6 A;  2KNH A;  3C8G A;  4CJG A;  1ZU4 A;  2XL4 A;  1D0Y A;  2UUH A;  2YWA A;  3DE9 A;  4HEA J;  3DAF A;  1A7D A;  3T6J A;  3K33 A;  1V54 C;  1E86 A;  2QE9 A;  1A0B A;  2QNL A;  3EHN A;  4Z9H A;  2XLO A;  2CCY A;  4KC9 A;  1ORS C;  3PDM P;  2ZXW C;  1CPR A;  1WOL A;  3OEO A;  3T6G B;  1M2O A;  4Q5S F;  2A1D D;  3I5P A;  4CIP A;  2YLI A;  3ZQV A;  2M4E A;  3V7O A;  4OIR F;  4J7T A;  4PJJ A;  3U8V A;  4BJ6 C;  3A11 A;  5JLI A;  2D5R B;  4O79 A;  4HFK B;  2Q9C A;  4OIQ F;  5L0C A;  2J9B A;  3K1I A;  4WGZ A;  3JSZ A;  1LE2 A;  1QKR A;  1GS9 A;  3MBG A;  4N4W A;  1OXB A;  3DJN B;  1BBH A;  2VCC A;  1YVI A;  4K1O A;  2A0U A;  2J9V A;  5IY5 C;  3MYI A;  4DVY P;  2A6H F;  3K6B A;  4DBQ A;  5JS5 A;  5F5F A;  5F5H A;  2UUI A;  3ITF A;  1SMY F;  3SXK A;  1LI7 A;  2R7V A;  3CQZ A;  4BEM J;  4KNW A;  1LPE A;  1ORY A;  3ZG1 A;  3LES A;  5E33 A;  2L7A A;  1TWG A;  2IYL D;  1O5H A;  4ULV A;  3ASO C;  3ZC4 A;  2CNW D;  5B1A C;  4OD5 A;  4MQ9 F;  3UGO A;  3TJ6 A;  4JJF A;  2OEX A;  4NTB A;  2YL0 A;  3NMK A;  2E87 A;  2FAP B;  3EG9 A;  4XPW A;  1T6Q A;  3QMK A;  5FZT A;  1N1C A;  3W8I A;  2CW0 F;  1TWH A;  4QDL A;  1C03 A;  4NQF A;  3T9O A;  1RJ9 A;  2A68 F;  2YZS A;  1OR3 A;  4U5D E;  2PNO A;  4H4K C;  1YJG A;  1APC A;  1ZHY A;  2J46 A;  2P1A A;  2XL6 A;  4NTF A;  2OCC C;  2KW3 C;  1CGO A;  1VTM P;  1RJ9 B;  4CS9 A;  1W2W A;  1JOG A;  4Z9I A;  1I5N A;  4PJL A;  4JTA B;  1Q0D A;  1T6U A;  3FOO A;  4C3B A;  4C3D A;  2LIG A;  4KBL A;  3U5S A;  5JP7 A;  3WG7 C;  1F1M A;  4OIO F;  2F22 A;  4EBJ A;  3RIP A;  3W8H A;  2GDC A;  1MQV A;  3L1M A;  4CSA C;  2DGJ A;  1L3P A;  1DOV A;  1OXK A;  1NBB A;  4J32 B;  3KYJ A;  5L0D A;  1EKY A;  1FMV A;  2EPN A;  1MMA A;  1JPJ A;  2AWY A;  3SXZ A;  2WVN A;  3EFO B;  4HE8 D;  3B0V C;  2Y69 C;  3LS1 A;  2DYR C;  2XS8 A;  3VYW A;  3GOD A;  1L7C A;  2Y3D A;  3RH3 A;  4MVO A;  2G3V A;  4ULW A;  4Q7C A;  3W2W A;  2R7X A;  1MMD A;  2WL8 A;  1VLT A;  4JRZ A;  2NSF A;  4MVM A;  3RQG A;  3ZWI A;  1TWA A;  4EHP A;  4MND A;  2TMV P;  1G5Z A;  4G0H A;  3Q6N A;  1ZU5 A;  1MNE A;  4L6R A;  5KYU A;  3RQF A;  1MMG A;  3VRC A;  4MVZ A;  3M4C A;  3TD7 A;  5BQI A;  1T9K A;  5KYX A;  1YZC A;  2JX0 A;  4MVS A;  3POV A;  3ABL C;  3AGU A;  3T4R A;  2R7S A;  1FNT c;  1CGN A;  4CDA A;  2PP4 A;  2YHS A;  3E70 C;  3M1C B;  3M79 A;  1LM3 B;  2J0W A;  4O6Y A;  3WOD F;  1NU7 D;  2IXP A;  4BJ5 A;  4I3M A;  4I1M A;  2Q3T A;  2V26 A;  3GM1 A;  2XLV A;  3UNG C;  3QZC A;  3JRM O;  2GA0 A;  3KMI A;  3EGD A;  3DXJ F;  1QPU A;  2PX0 A;  3GEH A;  3C18 A;  4EWC A;  3SNH A;  3B29 A;  2QLA A;  2X0C A;  3LNR A;  3MFN A;  1OCO C;  2OG2 A;  1J8Y F;  4IAR A;  4YT8 A;  1M2V A;  2HFI A;  3SXM A;  4IGG A;  2NUP B;  1VLS A;  1YLM A;  3CSK A;  1QSP A;  2KK1 A;  4AE4 B;  2BL2 A;  5K0I A;  1Q0F A;  3NMI A;  3EH2 A;  4U5F E;  1E85 A;  4P9F A;  2KSF A;  2HMZ A;  2EPO A;  4GYT A;  1M2V B;  1TKN A;  2Q00 A;  3SXY A;  1SF8 A;  3IQT A;  1S7Z A;  3GAN A;  3I4U A;  4BPM A;  3CZ6 A;  4LDR A;  3GM2 A;  3H65 A;  3ZTM A;  3LEO A;  4JZA A;  5AGF A;  1D1A A;  2J45 A;  2AP3 A;  4RDA A;  2MYS A;  4B6I A;  1HY5 A;  2Q4F A;  3NRH A;  3EZI A;  1D1B A;  3U3F A;  2WZL A;  3EH1 A;  2OEV A;  4JE9 A;  1I4Z A;  2Y3G A;  4ZLD A;  4J7Y A;  1OKK A;  2EIK C;  3H2U A;  4MTO A;  1M56 C;  1B68 A;  1NFN A;  4BJ1 A;  3S28 A;  1YDI A;  2LSE A;  3V5Z A;  2VC9 A;  2WVQ A;  3UGP A;  1XWJ A;  2R7Q A;  3LLI A;  1PD1 A;  2YKZ A;  3WAQ A;  1D0Z A;  1NLX A;  2HSQ A;  1BDJ B;  3NG1 A;  4W8P A;  2Y39 A;  2HV7 A;  4J30 B;  1MMN A;  2LQG A;  4W8K A;  1DOW A;  1JPN A;  4ZLC A;  2L6G A;  2O9X A;  3C8G B;  1E84 A;  1ST6 A;  2ETS A;  3V5X A;  1U0B B;  3B0U X;  2I8B A;  1YA9 A;  4XEK A;  256B A;  4YT2 A;  4C3E A;  3K7D A;  2XL8 A;  2KJG A;  3AG4 C;  2YLD A;  3EJN A;  3GOR A;  1Q0G A;  1K05 A;  1U89 A;  2BE5 F;  2M64 A;  4LDK A;  4YK5 A;  1OW8 A;  4BG0 A;  1VB5 A;  3AQB A;  3NKD A;  4RD9 A;  4EUK B;  1LKX A;  5DS5 A;  4CX9 A;  2EPM X;  5JT4 A;  4G7Z F;  5CI9 A;  2HSB A;  5EHH A;  4EBK A;  2I15 A;  1LVK A;  4BEJ A;  1NU9 C;  5L0H A;  5B1B C;  2FGY A;  3DAG A;  1S05 A;  1RKE A;  2ICW G;  4YT4 A;  4GQH A;  4NC3 A;  2J7P D;  2NSG A;  3ASN C;  4LDQ A;  2R7T A;  3US6 A;  4CS7 A;  1GGQ A;  4ER9 A;  3KL4 A;  4PR9 A;  1RKE B;  1V74 B;  4DBR A;  2L9J A;  4NY3 A;  4CBE A;  4YL3 A;  2W45 A;  3IQ5 A;  5DQT A;  4JUR I;  4CSA A;  3ECS A;  3EZH A;  2CGE A;  5B3I A;  4RBN A;  4HFF B;  3ZIB A;  1WN0 A;  4CIH A;  1SYQ A;  3L8I A;  1G4U S;  3HNL A;  2VCB A;  4LER A;  3IHU A;  3M4B A;  2XRH A;  3PCV A;  3NYL A;  2A0B A;  5E3A A;  3R7C A;  3V5Y A;  1GM5 A;  5AC5 A;  3HLZ A;  2YL7 A;  4G7O F;  3EG9 B;  2H7B A;  3FAJ A;  3Q6M A;  1OR2 A;  1PD0 A;  3T6B A;  4U5E E;  3U2M A;  1M57 C;  1YAR O;  2EIN C;  2P61 A;  3DMD A;  4LAC B;  2CNW A;  1PV3 A;  3K66 A;  4N06 A;  2R7R A;  3DM9 B;  2JPU A;  3HNJ A;  1HE1 A;  3MLG A;  5F28 E;  1Z6A A;  1WTY A;  1SR2 A;  4XPY A;  5GPG B;  3S0X A;  2YQY A;  3SP1 A;  2R9R B;  3ZDL A;  1JAF A;  3RFY A;  2PFD A;  1LE4 A;  3LJB A;  2VAS A;  4E0H A;  4IAO A;  3DE8 A;  4MVU A;  1QVX A;  3GM3 A;  1UFB A;  5EGY A;  1KNY A;  3AOU A;  4IB4 A;  4AK9 A;  1MND A;  4U5H A;  4N6C A;  1K40 A;  1JMW A;  4JEB A;  1H9G A;  1TWC A;  3M15 A;  4U9E A;  1WAT A;  2WZG A;  1LS1 A;  2DI3 A;  2XLD A;  3JZ0 A;  4JEA A;  5CI8 A;  4XLN F;  3TOL A;  2Y3B A;  1SZI A;  2P0N A;  2XS1 A;  3LS0 A;  4GEH A;  1O87 A;  3RKO F;  3JRT A;  4CJO A;  5KYW A;  2A69 F;  2LD6 A;  3FXH A;  5D91 A;  1E83 A;  2EIM C;  4U5C E;  1BZ4 A;  3UMI A;  1VYI A;  4CS8 A;  4AX2 A;  3C7J A;  4QI0 A;  4E17 A;  4IRU A;  3B71 A;  1FMW A;  5T3T A;  2MHR A;  3NKE A;  2EIL C;  2L6H A;  2NUT A;  5DS6 A;  1RXQ A;  1LI5 A;  4G7H F;  4WAB A;  2HJ3 A;  5DS4 A;  2YEV A;  1Z3I X;  3BEH A;  1Y6D A;  4KNV A;  1CPQ A;  4XTK A;  1HW1 A;  2OJE D;  2RSE B;  2DB4 A;  3HTK C;  3UMK A;  1LS4 A;  4K0D A;  4AL0 A;  3PHF 2;  2H8A A;  5KYU B;  1R5I D;  3VF0 A;  2R02 A;  2DYS C;  5KYX B;  4PK4 A;  4JW1 A;  4Z9J A;  4O7G A;  1VMA A;  2ZXR A;  1ZW3 A;  3AG2 C;  3DJU B;  4E7Z A;  3ABM C;  2LFF A;  4OIP F;  2ZXO A;  4I1O B;  3EQL F;  4U5B E;  2PX3 A;  2IBF A;  3I5Q A;  4P9T A;  2HUJ A;  1VYK A;  3TJ5 A;  4QI2 A;  4CS9 C;  1IZM A;  4P6I C;  1KU2 A;  3RF3 A;  3IEE A;  1ZHZ A;  1J8M F;  3CAX A;  3EGD B;  4YN0 B;  3IPM O;  2OJQ A;  2B0J A;  3U3B A;  1KTM A;  2EPL X;  2LFD A;  1OCZ C;  2P7V A;  1BR4 A;  4OD4 A;  4A2N B;  2XXA A;  4JJG A;  1ZHT A;  4F4B A;  2J9W A;  1FFH A;  2X51 A;  4O6N A;  3SZR A;  4BJ6 A;  1OCC C;  4JTC B;  1D1C A;  2KC3 A;  2JD3 A;  3G4X A;  2XXA B;  2OKU A;  4MTF A;  2HJM A;  3GEE A;  2C03 A;  2RD9 A;  2XLH A;  4XPX A;  3SYN A;  4AL1 A;  4H54 A;  2HS5 A;  5A69 A;  1UG7 A;  3HJC A;  2MWQ A;  4JKV A;  1H7I A;  4MS2 A;  3FMS A;  3JTL O;  1NG1 A;  5A6B A;  4JCH A;  2HV6 A;  5E3C A;  3VM6 A;  4XQ1 A;  2H7O A;  2WB7 A;  4M63 A;  4PFP A;  2XM4 A;  3MYF A;  4G78 A;  3RQE A;  3TQO A;  3J06 A;  3O39 A;  1ZYR F;  2CYD A;  3LLK A;  3FHD A;  3Q7L A;  1AVO B;  3JCU Q;  4YT5 A;  2IM8 A;  3C8Z A;  4EBB A;  1Z63 A;  1QLE C;  1QZX A; 
#chains in the Genus database with same CATH homology
 4YL3 A;  5HV9 A;  4BPM A;  4YL0 A;  4J7T A;  4JC7 A;  4AL0 A;  3LEO A;  4NTB A;  2H8A A;  5BQG A;  5BQH A;  4YK5 A;  4JCZ A;  3HKK A;  3PCV A;  4AL1 A;  4J7Y A;  4YL1 A;  2PNO A;  3DWW A;  3B29 A;  4NTF A;  2UUH A;  4JRZ A;  2UUI A;  2Q7R A;  5K0I A;  5BQI A;  4WAB A;  4NTA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...