1RKEA

Human vinculin head (1-258) in complex with human vinculin tail (879-1066)
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
262
structure length
262
Chain Sequence
HHHHMPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinculin
publication title Vinculin activation by talin through helical bundle conversion
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion, structural protein
total genus 110
structure length 262
sequence length 262
ec nomenclature
pdb deposition date 2003-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1rkeA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1rkeA01
1DOWA 3H2VA 1T01A 4E18A 2LQGA 3TJ5A 5L0DA 4PR9A 5FZTA 2GWWA 5L0JA 5L0FA 4EHPA 5L0CA 4ONSA 1ZVZA 4K1OA 2X0CA 1ST6A 1ZW2A 1U6HA 3VF0A 1RKEB 1SYQA 2HSQA 3H2UA 1TR2A 1ZW3A 4IGGA 3RF3A 3TJ6A 2B0HA 5L0IA 3T6GB 2L7AA 4P9TA 3S90A 5L0HA 1XWJA 1DOVA 2GDCA 4DJ9A 4E17A 5L0GA 1RKEA 1U89A 3MYIA 1QKRA 1H6GA 2IBFA 1L7CA 1RKCA 3ZDLA 1YDIA 4W8PA
chains in the Genus database with same CATH superfamily
3JT1A 4W8KA 2GFHA 2X51A 2XLMA 3EFOB 4EBKA 5L3QA 1QZXA 3UGPA 3NKDA 1QVXA 3EGXA 2YL1A 3TD7A 3SXKA 1OCRC 2NUTA 3MFNA 4C7OB 4PFOA 5A69A 4OIOF 3U9JA 3MBGA 3O55A 5JP7A 2KC3A 3SXYA 4WABA 3AQBA 2XL6A 3NMIA 5DS4A 4J7YA 2XXAA 3GM3A 3Q7GA 1Q0DA 3ZQYA 3QW1A 2Q9BA 3LLIA 2RSEB 2J45A 4BJ6C 3Q6NA 1NFOA 2E87A 3BEHA 3IQTA 4MVMA 3MYFA 4N6CA 3DI5A 1GS9A 3KH2A 2HV7A 3LS1A 3B0UX 2G62A 4E0HA 1K04A 2R7QA 4DBRA 1JPJA 2IBFA 3CQZA 3QVZA 4CS9A 5B3SC 4U5GA 5JLIA 4JTDB 4W8PA 3EJNA 3F47A 4CIHA 2Q9AA 4BEJA 3RVZA 3UGOA 3AG3C 3GM1A 3LNRA 5BQIA 4G7ZF 3W2WA 2LP4A 4MVUA 4K1OA 2OKUA 3CSKA 3KKBA 4XPXA 2L9JA 2NPUA 2Y3HA 2HMQA 1LS4A 3O39A 3LEVA 2ZD9A 3Q7LA 1D0XA 1AVOB 4LDKA 3G4ZA 4MTGA 3SYNA 2HUJA 2R7SA 4LDQA 3RW0A 4JJGA 4XLPF 2QLAA 4FESA 4BJ1A 1FFTC 4I3MA 5T3WA 4CDAA 1ORSC 2OCCC 3CEXA 3DZAA 4RD9A 5JRAA 1RKEA 3FDQA 3ITFA 2Z15A 3FHDA 1FTSA 4PJLA 1IZMA 3FMSA 1SF8A 2CCYA 1NSGB 2FGYA 3UMKA 1WTYA 2JX0A 3GM2A 4AE4A 4UDVA 3NYJA 1B68A 2OQMA 1LVKA 1GM5A 2G3VA 4MS2A 5A6JA 4XTKA 3HTKC 1T9KA 3TQOA 4E7ZA 2DB4A 3UR3C 1YVIA 2I15A 1I5NA 4JVSA 2W9YA 3U3FA 2GWWA 1Q0MA 4PK4A 1YARO 2J9UA 5L0CA 1NG1A 2L6FA 1HE1A 1VMAA 3LJBA 2X0CA 1ZHTA 3VF0A 1LI5A 1SYQA 2Y3DA 4NQFA 1TR2A 4IGGA 2NG1A 3KPHA 5EGYA 3N24A 3S9OA 2KSFA 2YL3A 5KYWB 4A2NB 1RJ9A 2R7VA 1JPNA 3RQFA 3GODA 3L8JA 5KYUB 4BJ6A 2BC5A 3VM6A 4DVZA 1JR8A 2WVNA 4RDAA 3DKAA 3AOUA 2VCAA 1QLEC 2XLWA 1O87A 3C8GD 3L34A 3L8IA 4OIPF 3HNLA 5KYWA 2CGEA 1CPQA 2YVKA 4MVZA 1EKYA 5KYUA 4BG0A 5AC4A 1Y6DA 3CAXA 5KYXA 4RBNA 2KQ9A 4PJMA 4YT4A 5L3VA 2LQGA 3RIPA 2OJED 1OCCC 1C02A 4QI0A 3HNIA 3OA1A 4JCHA 3WAQA 2KW3C 2IYLD 1NBBA 1TFOB 4C3EA 2YLDA 1VLTA 1S7ZA 1ZHXA 3ZIBA 2YEVA 4OINF 1M2VA 5B1AC 3RH3A 4YL1A 4XWJA 1MNEA 2YQYA 3ZVRA 3I4UA 1D1CA 4NTFA 2QUPA 4OD5A 1BR2A 3SEOA 1E85A 3T9OA 2YKZA 4Q4ZF 1A7VA 2M64A 2KGOA 3QVYA 4OD4A 4JURI 3NYMA 3ZDLA 1LIHA 2C04A 3RF3A 4ULVA 3NYLA 2B0JA 1V54C 2ZXRA 1DOWA 3DM5A 4LLCA 4E0IA 4EWCA 1RCPA 1OKKD 3EHNA 1MNDA 4IRUA 1T5OA 4PR9A 3O6XA 4CJOA 2VC9A 1LPEA 4EBJA 1ZVZA 5L0FA 3NDBB 1SZIA 2YWAA 3TJ6A 1SR2A 1ZZPA 4CJGA 2AWCA 4CBEA 1V4AA 1G8XA 5DS5A 2EPKX 1SMYF 2EPMX 2P1AA 3ABLC 3S90A 2R7XA 1HE9A 4L6RA 3M4BA 1J8MF 4GYTA 5F5FA 3AG1C 1ZYRF 3US6A 3U2LA 1O3UA 2KJGA 4MTFA 3W4YA 5BUOA 2CYDA 3HJCA 1FFHA 4JTCB 1RKCA 1YZCA 3JZ0A 1YDIA 2KNHA 3IEEA 4JW1A 3NMJA 1UG7A 2AU5A 3C63A 3S0XA 1I4YA 1MMDA 2PFDA 1A0BA 3M15A 4BPMA 4G78A 5AC5A 5KYYA 3GEEA 2EPLX 2IXOA 2UUHA 3EH2A 4LLEA 1OR2A 1ZW3A 2ZXWC 1LE2A 2NUPB 4JIOA 4N06A 3T6JA 4YL0A 4XQ1A 3T6BA 2VCBA 1M57C 1VK5A 1ZHYA 2JD3A 3EFOA 3TK0A 1OW6A 2PNOA 2XM4A 3M79A 1C17M 2A68F 3Q6MA 5E3AA 5EK0A 3KYIA 4LACB 3S84A 4C7OA 1BR1A 1Y4CA 2HSBA 2NUPA 3DAFA 3POVA 1FAPB 1PV3A 4U5FE 4C3BA 3GANA 5D91A 4U5BE 2EPNA 1FMWA 2A0UA 4D4NA 4M63A 2WZGA 1VOMA 2ETSA 1T01A 3G50A 4K0DA 2HMZA 4Z9JA 2KYHA 3T4RA 2R7UA 1I4ZA 2R9RB 2IXNA 4U5HA 5L0JA 2DYRC 1QPUA 2H7OA 3V5YA 4OIQF 2V26A 4MQ9F 1Z23A 4KBLA 5AGFA 2VASA 3KL4A 1Z63A 2ICWG 1KTMA 4DOZA 2DYSC 2P61A 4CIPA 3J06A 5F5HA 3TULA 1YZAA 1VB5A 4PACA 4JZAA 4D4XA 2AWYA 2O9XA 5DLJA 4BJ5C 5JUAA 4EIYA 2XL8A 2WL8A 4MVOA 1UFBA 5CI8A 5HV9A 2XRHA 1Q0GA 2MWQA 3NG1A 4IB4A 2XLDA 2I8BA 3PCVA 3VYWA 4YT8A 5JS5A 3HLZA 4MVRA 4PFPA 4YK5A 1TWAA 1L7CA 1HW2A 2JPUA 2L6HA 1YA7O 2A6EF 4WJ0A 3RKOF 4NC3A 2LK4A 1M2OA 2LFDA 3O10A 4I1OB 2R03A 5JVEA 5BQGA 1GQAA 3ZSUA 4JTAB 1RMVA 1T6QA 3R7CA 4CX9A 1BZ4A 1ST6A 3LEOA 4J32B 4N6HA 3TOMA 3PHF2 2NSFA 3NMKA 2C03A 3IQCA 2EINC 2XLHA 4LERA 1LE4A 3ZWIA 2IXPA 1NFNA 3DMDA 3U2MA 2YZSA 2A6HF 3VAYA 4F4BA 1APCA 1ORJA 4U9DA 4J7TA 2XL4A 4DRIB 4IARA 3K6BA 3R2PA 2Y69C 3NKEA 1TFKB 3DE9A 1Q0FA 3KMIA 4MW3A 2L81A 1H6GA 3H65A 5B1BC 3ZTZA 2W4MA 4NTBA 2WVQA 3I5QA 4EUKB 3FXHA 4A4AA 1D0ZA 4G7OF 5GPGB 3GEHA 1OCZC 1OR3A 1CGNA 1XZQA 2Q3TA 2WB7A 4C3DA 4E18A 5B3IA 2AVKA 3W8IA 3I5PA 5FZTA 1LS1A 1AUEA 3AG4C 2EIKC 2R7RA 2YLGA 2A1DD 1ZW2A 1JOGA 1U6HA 1WN0A 2HSQA 4XPWA 1Z7Qc 4G0HA 4IAQA 4O6YA 1A7EA 1W2WA 5E2QA 4CDYA 3ECSA 3F46A 3M4CA 3T6GB 3V7OA 3EGDB 5DS6A 2LIGA 4Z9HA 2LD6A 1VTMP 4BEMJ 2UUIA 2TMVP 2R7WA 2Y3GA 1WOLA 3UMHA 4U5DE 3DJUB 1U0BB 2HZ8A 2OG2A 1Q0KA 3W2VA 2OJQA 4BJ5A 4P9FA 5L0GA 2IXMA 3MYIA 1QKRA 3X1OA 2MYSA 2XLVA 4H54A 1JRAA 1ZHWA 2EPOA 2Q7RA 3LUTB 4AL0A 1K05A 2CDQA 2AP3A 3CZ6A 5E33A 1FR0A 3ZG1A 1BDJB 2L6GA 2FFHA 2LSEA 3H2VA 2LFFA 3X2QC 4Q7CA 3FAJA 2IM8A 1ORYA 4J30B 4DRJB 1RXQA 5A6AA 5FCLA 1PCXA 4U9EA 1HY5A 2J0XA 3K66A 3QZCA 2P6VA 4FWVA 1TKNA 3C7JA 3VRCA 1D0YA 2R02A 4ANJA 3ATPA 2DGJA 2VCCA 2ZXOA 1PD0A 5T1DB 4AX2A 1LKXA 3EHMA 3E9VA 1TWHA 3RVYA 5HSWA 2Q4FA 2KK1A 1JMWA 5TJ5E 3EPVA 2Q00A 3L0IA 2W45A 4P6IC 4I44A 4AK9A 1U89A 5A6BA 3WHNA 1EQ1A 4JEBA 2A0BA 1LM3B 2IOQA 2Y3BA 5A6BD 1BBHA 1FMVA 2D4UA 1YJGA 3K1IC 1G4WR 3S27A 4DVYP 1EA8A 5L0DA 1R5ID 2ASRA 3B0PA 2PX0A 1NLXA 4XEFA 1XZPA 4ER9A 1YA9A 3MX3A 3S29A 4KNVA 1BR4A 1H9GA 1WWPA 3IQ5A 4PJNA 3V5ZA 2R7OA 3FOOA 5CIVA 5K0IA 2V3CC 2J0WA 2H7VC 4O79A 2HV6A 4WGYA 3TOLA 3LAYA 4ZLCA 3ZC4A 1ZHZA 3AJMA 4JC7A 1HMOA 2A69F 256BA 2QY9A 3AQCA 4JJFA 3PDMP 4Q5SF 4EKWA 3EGXB 3B0VC 4U5EE 2J7PA 2NUTB 3LNMB 4HFFB 2HS5A 4Z9IA 2PBEA 1E84A 1NU7D 1WGWA 4MVSA 4CS7A 2XXAB 2J7PD 3QW0A 4KC9A 3GWNA 4I1MA 3WG7C 1D1BA 4LDRA 4XEVA 2Y39A 1VYKA 3B9QA 4ZLDA 4CDVA 4U5CE 2ZPAA 3W8HA 3WODF 4PJJA 1Z6AA 4JKVA 4MTOA 4H4KC 4EHPA 2EIMC 3JSZA 4ONSA 1G5ZA 4ULWA 1LI7A 2OOCA 3C62A 2HKVA 4YT2A 2EILC 4R32A 5L0IA 1OXKA 2H8AA 2QNLA 3ABMC 4O6NA 3IQ6A 2OEXA 2QE9A 2XS1A 3JRTA 1VYIA 3FAPB 5F28E 3JYHA 1EI7A 2J9VA 1L3PA 3BRJA 4JE9A 1YLMA 2BE5F 4YN0B 4QI2A 1Z3IX 1V74B 2R05A 5D92A 3S28A 1NZEA 3RQGA 3K33A 1N1CA 2YL7A 3C18A 5COMA 3SXZA 3U0CA 3DM9B 2G3KA 2LCHA 1C03A 3U8PA 5E3CA 3EZHA 2D5RB 3LESA 1HW1A 3K1IA 5DQTA 1OW7A 4NY3A 3HNJA 3ASNC 3SNHA 1QSPA 3KYJA 3K1HA 2J9BA 4YL3A 1IW7F 1YYXA 1MMNA 3SP1A 1RKEB 2GA0A 3EQLF 3AGUA 1G4US 1GGQA 2BL2A 3ASOC 3DE8A 3G4XA 4AE4B 4P9TA 3RFYA 4GQHA 1T6IA 1XWJA 5CI9A 4EBBA 2GDCA 4IWBA 4MW8A 2R25A 1Z5ZA 3B71A 1CPRA 4XLNF 3HNKA 3L1MA 1VLSA 3EG9B 3OWTA 3C8ZA 3N2ZB 4N4WA 2F22A 2PP4A 1MQVA 3E70C 3JCUQ 1OW8A 3DXJF 3JSEO 1H9TA 1QQ3A 4QDLA 1H7IA 2YL0A 1JAFA 4CSAC 4YT5A 3U5SA 5DQZA 1RJ9B 4CS8C 2NSGA 3TJ5A 3ZQVA 3A11A 3V5XA 3EG9A 3C8GB 1E86A 1YAUO 2DI3A 3DJNB 2M4EA 2R7TA 4JEAA 2PX3A 4OIRF 4DBQA 4DRHB 5JT4A 2W4BA 1CGOA 2L7AA 3FVYA 2J46A 4JCZA 1V55C 2P7VA 5IY5C 1DOVA 2XLOA 2WVOA 4IJJA 3C8GA 3SXMA 1TWCA 5KYXB 1KNYA 2HJ3A 3QTHA 4DJ9A 3A9CA 4E17A 2P0NA 1WASA 2MHRA 4K7BA 4G7HF 3U9MA 2H7BA 3LLKA 1S05A 2Q9CA 2WZFA 1A7DA 4JRZA 3EGDA 5COGA 3NRHA 4NTAA 1OXBA 1WATA 2EIJC 4IAOA 4YJWA 3EZIA 4FAPB 1M6TA 1NU9C 4AL1A 3DD7A 5BQHA 1E83A 3JRMO 2FAPB 2HJMA 1PD1A 3FOPA 4NCQA 2VH3A 1M2VB 2CW0F 2XM0A 4HE8D 3QMKA 2CNWA 1HMDA 3K7DA 2QTVA 3JTLO 3ZTMA 1J8YF 3MLGA 2XS8A 4E7SA 2B0HA 2CNWD 3OEOA 4MNDA 2XSEA 3U3BA 4MVQA 1ZU4A 3B29A 2J9WA 2RD9A 3ABKC 2OU6A 1R4TA 3AGTA 5A6KA 3EH1A 1TWGA 1MMAA 2J8WA 3RQEA 2PF4E 5KYNA 1T6UA 4HEAJ 2GAQA 4CS9C 5JSLA 3IHUA 2HFIA 4GEHA 3SZRA 1D1AA 1AEPA 1OKKA 3DAGA 1E2XA 3JYYA 2YHSA 1YYJA 3UMIA 4DXWA 5EHHA 1TQGA 3GWLA 3GORA 4O7GA 4CSAA 4O6MA 4CS8A 3GEIA 3PMRA 5T3TA 5DVWA 3RYLA 4YWQA 3H2UA 3UNGC 1OQCA 4X0RA 2YLIA 1MMGA 3HKKA 1KU2A 1M56C 3U8VA 1F1MA 2VB6A 5L0HA 4WGZA 1OCOC 5COFA 3M1CB 4BJTA 2ZXPA 1FNTc 2XLEA 4B6IA 1K40A 1CGME 2YRFA 4XPYA 3DWWA 2OEVA 3AG2C 3N0TA 4XEKA 5KYYB 4KI2A 4HFKB 1ZU5A 1O5HA 2WZLA 3IPMO 3LS0A 4FX5A 4KNWA 1A41A
chains in the Genus database with same CATH topology
1DOWA 3H2VA 1T01A 4E18A 2LQGA 3TJ5A 5L0DA 4PR9A 5FZTA 2GWWA 5L0JA 5L0FA 4EHPA 5L0CA 4ONSA 1ZVZA 4K1OA 2X0CA 1ST6A 1ZW2A 1U6HA 3VF0A 1RKEB 1SYQA 2HSQA 3H2UA 1TR2A 1ZW3A 4IGGA 3RF3A 3TJ6A 2B0HA 5L0IA 3T6GB 2L7AA 4P9TA 3S90A 5L0HA 1XWJA 1DOVA 2GDCA 4DJ9A 4E17A 5L0GA 1RKEA 1U89A 3MYIA 1QKRA 1H6GA 2IBFA 1L7CA 1RKCA 3ZDLA 1YDIA 4W8PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DOW A;  3H2V A;  1T01 A;  4E18 A;  2LQG A;  3TJ5 A;  5L0D A;  4PR9 A;  5FZT A;  2GWW A;  5L0J A;  5L0F A;  4EHP A;  5L0C A;  4ONS A;  1ZVZ A;  4K1O A;  2X0C A;  1ST6 A;  1ZW2 A;  1U6H A;  3VF0 A;  1RKE B;  1SYQ A;  2HSQ A;  3H2U A;  1TR2 A;  1ZW3 A;  4IGG A;  3RF3 A;  3TJ6 A;  2B0H A;  5L0I A;  3T6G B;  2L7A A;  4P9T A;  3S90 A;  5L0H A;  1XWJ A;  1DOV A;  2GDC A;  4DJ9 A;  4E17 A;  5L0G A;  1RKE A;  1U89 A;  3MYI A;  1QKR A;  1H6G A;  2IBF A;  1L7C A;  1RKC A;  3ZDL A;  1YDI A;  4W8P A; 
#chains in the Genus database with same CATH topology
 3JT1 A;  4W8K A;  2GFH A;  2X51 A;  2XLM A;  3EFO B;  4EBK A;  5L3Q A;  1QZX A;  3UGP A;  3NKD A;  1QVX A;  3EGX A;  2YL1 A;  3TD7 A;  3SXK A;  1OCR C;  2NUT A;  3MFN A;  4C7O B;  4PFO A;  5A69 A;  4OIO F;  3U9J A;  3MBG A;  3O55 A;  5JP7 A;  2KC3 A;  3SXY A;  4WAB A;  3AQB A;  2XL6 A;  3NMI A;  5DS4 A;  4J7Y A;  2XXA A;  3GM3 A;  3Q7G A;  1Q0D A;  3ZQY A;  3QW1 A;  2Q9B A;  3LLI A;  2RSE B;  2J45 A;  4BJ6 C;  3Q6N A;  1NFO A;  2E87 A;  3BEH A;  3IQT A;  4MVM A;  3MYF A;  4N6C A;  3DI5 A;  1GS9 A;  3KH2 A;  2HV7 A;  3LS1 A;  3B0U X;  2G62 A;  4E0H A;  1K04 A;  2R7Q A;  4DBR A;  1JPJ A;  2IBF A;  3CQZ A;  3QVZ A;  4CS9 A;  5B3S C;  4U5G A;  5JLI A;  4JTD B;  4W8P A;  3EJN A;  3F47 A;  4CIH A;  2Q9A A;  4BEJ A;  3RVZ A;  3UGO A;  3AG3 C;  3GM1 A;  3LNR A;  5BQI A;  4G7Z F;  3W2W A;  2LP4 A;  4MVU A;  4K1O A;  2OKU A;  3CSK A;  3KKB A;  4XPX A;  2L9J A;  2NPU A;  2Y3H A;  2HMQ A;  1LS4 A;  3O39 A;  3LEV A;  2ZD9 A;  3Q7L A;  1D0X A;  1AVO B;  4LDK A;  3G4Z A;  4MTG A;  3SYN A;  2HUJ A;  2R7S A;  4LDQ A;  3RW0 A;  4JJG A;  4XLP F;  2QLA A;  4FES A;  4BJ1 A;  1FFT C;  4I3M A;  5T3W A;  4CDA A;  1ORS C;  2OCC C;  3CEX A;  3DZA A;  4RD9 A;  5JRA A;  1RKE A;  3FDQ A;  3ITF A;  2Z15 A;  3FHD A;  1FTS A;  4PJL A;  1IZM A;  3FMS A;  1SF8 A;  2CCY A;  1NSG B;  2FGY A;  3UMK A;  1WTY A;  2JX0 A;  3GM2 A;  4AE4 A;  4UDV A;  3NYJ A;  1B68 A;  2OQM A;  1LVK A;  1GM5 A;  2G3V A;  4MS2 A;  5A6J A;  4XTK A;  3HTK C;  1T9K A;  3TQO A;  4E7Z A;  2DB4 A;  3UR3 C;  1YVI A;  2I15 A;  1I5N A;  4JVS A;  2W9Y A;  3U3F A;  2GWW A;  1Q0M A;  4PK4 A;  1YAR O;  2J9U A;  5L0C A;  1NG1 A;  2L6F A;  1HE1 A;  1VMA A;  3LJB A;  2X0C A;  1ZHT A;  3VF0 A;  1LI5 A;  1SYQ A;  2Y3D A;  4NQF A;  1TR2 A;  4IGG A;  2NG1 A;  3KPH A;  5EGY A;  3N24 A;  3S9O A;  2KSF A;  2YL3 A;  5KYW B;  4A2N B;  1RJ9 A;  2R7V A;  1JPN A;  3RQF A;  3GOD A;  3L8J A;  5KYU B;  4BJ6 A;  2BC5 A;  3VM6 A;  4DVZ A;  1JR8 A;  2WVN A;  4RDA A;  3DKA A;  3AOU A;  2VCA A;  1QLE C;  2XLW A;  1O87 A;  3C8G D;  3L34 A;  3L8I A;  4OIP F;  3HNL A;  5KYW A;  2CGE A;  1CPQ A;  2YVK A;  4MVZ A;  1EKY A;  5KYU A;  4BG0 A;  5AC4 A;  1Y6D A;  3CAX A;  5KYX A;  4RBN A;  2KQ9 A;  4PJM A;  4YT4 A;  5L3V A;  2LQG A;  3RIP A;  2OJE D;  1OCC C;  1C02 A;  4QI0 A;  3HNI A;  3OA1 A;  4JCH A;  3WAQ A;  2KW3 C;  2IYL D;  1NBB A;  1TFO B;  4C3E A;  2YLD A;  1VLT A;  1S7Z A;  1ZHX A;  3ZIB A;  2YEV A;  4OIN F;  1M2V A;  5B1A C;  3RH3 A;  4YL1 A;  4XWJ A;  1MNE A;  2YQY A;  3ZVR A;  3I4U A;  1D1C A;  4NTF A;  2QUP A;  4OD5 A;  1BR2 A;  3SEO A;  1E85 A;  3T9O A;  2YKZ A;  4Q4Z F;  1A7V A;  2M64 A;  2KGO A;  3QVY A;  4OD4 A;  4JUR I;  3NYM A;  3ZDL A;  1LIH A;  2C04 A;  3RF3 A;  4ULV A;  3NYL A;  2B0J A;  1V54 C;  2ZXR A;  1DOW A;  3DM5 A;  4LLC A;  4E0I A;  4EWC A;  1RCP A;  1OKK D;  3EHN A;  1MND A;  4IRU A;  1T5O A;  4PR9 A;  3O6X A;  4CJO A;  2VC9 A;  1LPE A;  4EBJ A;  1ZVZ A;  5L0F A;  3NDB B;  1SZI A;  2YWA A;  3TJ6 A;  1SR2 A;  1ZZP A;  4CJG A;  2AWC A;  4CBE A;  1V4A A;  1G8X A;  5DS5 A;  2EPK X;  1SMY F;  2EPM X;  2P1A A;  3ABL C;  3S90 A;  2R7X A;  1HE9 A;  4L6R A;  3M4B A;  1J8M F;  4GYT A;  5F5F A;  3AG1 C;  1ZYR F;  3US6 A;  3U2L A;  1O3U A;  2KJG A;  4MTF A;  3W4Y A;  5BUO A;  2CYD A;  3HJC A;  1FFH A;  4JTC B;  1RKC A;  1YZC A;  3JZ0 A;  1YDI A;  2KNH A;  3IEE A;  4JW1 A;  3NMJ A;  1UG7 A;  2AU5 A;  3C63 A;  3S0X A;  1I4Y A;  1MMD A;  2PFD A;  1A0B A;  3M15 A;  4BPM A;  4G78 A;  5AC5 A;  5KYY A;  3GEE A;  2EPL X;  2IXO A;  2UUH A;  3EH2 A;  4LLE A;  1OR2 A;  1ZW3 A;  2ZXW C;  1LE2 A;  2NUP B;  4JIO A;  4N06 A;  3T6J A;  4YL0 A;  4XQ1 A;  3T6B A;  2VCB A;  1M57 C;  1VK5 A;  1ZHY A;  2JD3 A;  3EFO A;  3TK0 A;  1OW6 A;  2PNO A;  2XM4 A;  3M79 A;  1C17 M;  2A68 F;  3Q6M A;  5E3A A;  5EK0 A;  3KYI A;  4LAC B;  3S84 A;  4C7O A;  1BR1 A;  1Y4C A;  2HSB A;  2NUP A;  3DAF A;  3POV A;  1FAP B;  1PV3 A;  4U5F E;  4C3B A;  3GAN A;  5D91 A;  4U5B E;  2EPN A;  1FMW A;  2A0U A;  4D4N A;  4M63 A;  2WZG A;  1VOM A;  2ETS A;  1T01 A;  3G50 A;  4K0D A;  2HMZ A;  4Z9J A;  2KYH A;  3T4R A;  2R7U A;  1I4Z A;  2R9R B;  2IXN A;  4U5H A;  5L0J A;  2DYR C;  1QPU A;  2H7O A;  3V5Y A;  4OIQ F;  2V26 A;  4MQ9 F;  1Z23 A;  4KBL A;  5AGF A;  2VAS A;  3KL4 A;  1Z63 A;  2ICW G;  1KTM A;  4DOZ A;  2DYS C;  2P61 A;  4CIP A;  3J06 A;  5F5H A;  3TUL A;  1YZA A;  1VB5 A;  4PAC A;  4JZA A;  4D4X A;  2AWY A;  2O9X A;  5DLJ A;  4BJ5 C;  5JUA A;  4EIY A;  2XL8 A;  2WL8 A;  4MVO A;  1UFB A;  5CI8 A;  5HV9 A;  2XRH A;  1Q0G A;  2MWQ A;  3NG1 A;  4IB4 A;  2XLD A;  2I8B A;  3PCV A;  3VYW A;  4YT8 A;  5JS5 A;  3HLZ A;  4MVR A;  4PFP A;  4YK5 A;  1TWA A;  1L7C A;  1HW2 A;  2JPU A;  2L6H A;  1YA7 O;  2A6E F;  4WJ0 A;  3RKO F;  4NC3 A;  2LK4 A;  1M2O A;  2LFD A;  3O10 A;  4I1O B;  2R03 A;  5JVE A;  5BQG A;  1GQA A;  3ZSU A;  4JTA B;  1RMV A;  1T6Q A;  3R7C A;  4CX9 A;  1BZ4 A;  1ST6 A;  3LEO A;  4J32 B;  4N6H A;  3TOM A;  3PHF 2;  2NSF A;  3NMK A;  2C03 A;  3IQC A;  2EIN C;  2XLH A;  4LER A;  1LE4 A;  3ZWI A;  2IXP A;  1NFN A;  3DMD A;  3U2M A;  2YZS A;  2A6H F;  3VAY A;  4F4B A;  1APC A;  1ORJ A;  4U9D A;  4J7T A;  2XL4 A;  4DRI B;  4IAR A;  3K6B A;  3R2P A;  2Y69 C;  3NKE A;  1TFK B;  3DE9 A;  1Q0F A;  3KMI A;  4MW3 A;  2L81 A;  1H6G A;  3H65 A;  5B1B C;  3ZTZ A;  2W4M A;  4NTB A;  2WVQ A;  3I5Q A;  4EUK B;  3FXH A;  4A4A A;  1D0Z A;  4G7O F;  5GPG B;  3GEH A;  1OCZ C;  1OR3 A;  1CGN A;  1XZQ A;  2Q3T A;  2WB7 A;  4C3D A;  4E18 A;  5B3I A;  2AVK A;  3W8I A;  3I5P A;  5FZT A;  1LS1 A;  1AUE A;  3AG4 C;  2EIK C;  2R7R A;  2YLG A;  2A1D D;  1ZW2 A;  1JOG A;  1U6H A;  1WN0 A;  2HSQ A;  4XPW A;  1Z7Q c;  4G0H A;  4IAQ A;  4O6Y A;  1A7E A;  1W2W A;  5E2Q A;  4CDY A;  3ECS A;  3F46 A;  3M4C A;  3T6G B;  3V7O A;  3EGD B;  5DS6 A;  2LIG A;  4Z9H A;  2LD6 A;  1VTM P;  4BEM J;  2UUI A;  2TMV P;  2R7W A;  2Y3G A;  1WOL A;  3UMH A;  4U5D E;  3DJU B;  1U0B B;  2HZ8 A;  2OG2 A;  1Q0K A;  3W2V A;  2OJQ A;  4BJ5 A;  4P9F A;  5L0G A;  2IXM A;  3MYI A;  1QKR A;  3X1O A;  2MYS A;  2XLV A;  4H54 A;  1JRA A;  1ZHW A;  2EPO A;  2Q7R A;  3LUT B;  4AL0 A;  1K05 A;  2CDQ A;  2AP3 A;  3CZ6 A;  5E33 A;  1FR0 A;  3ZG1 A;  1BDJ B;  2L6G A;  2FFH A;  2LSE A;  3H2V A;  2LFF A;  3X2Q C;  4Q7C A;  3FAJ A;  2IM8 A;  1ORY A;  4J30 B;  4DRJ B;  1RXQ A;  5A6A A;  5FCL A;  1PCX A;  4U9E A;  1HY5 A;  2J0X A;  3K66 A;  3QZC A;  2P6V A;  4FWV A;  1TKN A;  3C7J A;  3VRC A;  1D0Y A;  2R02 A;  4ANJ A;  3ATP A;  2DGJ A;  2VCC A;  2ZXO A;  1PD0 A;  5T1D B;  4AX2 A;  1LKX A;  3EHM A;  3E9V A;  1TWH A;  3RVY A;  5HSW A;  2Q4F A;  2KK1 A;  1JMW A;  5TJ5 E;  3EPV A;  2Q00 A;  3L0I A;  2W45 A;  4P6I C;  4I44 A;  4AK9 A;  1U89 A;  5A6B A;  3WHN A;  1EQ1 A;  4JEB A;  2A0B A;  1LM3 B;  2IOQ A;  2Y3B A;  5A6B D;  1BBH A;  1FMV A;  2D4U A;  1YJG A;  3K1I C;  1G4W R;  3S27 A;  4DVY P;  1EA8 A;  5L0D A;  1R5I D;  2ASR A;  3B0P A;  2PX0 A;  1NLX A;  4XEF A;  1XZP A;  4ER9 A;  1YA9 A;  3MX3 A;  3S29 A;  4KNV A;  1BR4 A;  1H9G A;  1WWP A;  3IQ5 A;  4PJN A;  3V5Z A;  2R7O A;  3FOO A;  5CIV A;  5K0I A;  2V3C C;  2J0W A;  2H7V C;  4O79 A;  2HV6 A;  4WGY A;  3TOL A;  3LAY A;  4ZLC A;  3ZC4 A;  1ZHZ A;  3AJM A;  4JC7 A;  1HMO A;  2A69 F;  256B A;  2QY9 A;  3AQC A;  4JJF A;  3PDM P;  4Q5S F;  4EKW A;  3EGX B;  3B0V C;  4U5E E;  2J7P A;  2NUT B;  3LNM B;  4HFF B;  2HS5 A;  4Z9I A;  2PBE A;  1E84 A;  1NU7 D;  1WGW A;  4MVS A;  4CS7 A;  2XXA B;  2J7P D;  3QW0 A;  4KC9 A;  3GWN A;  4I1M A;  3WG7 C;  1D1B A;  4LDR A;  4XEV A;  2Y39 A;  1VYK A;  3B9Q A;  4ZLD A;  4CDV A;  4U5C E;  2ZPA A;  3W8H A;  3WOD F;  4PJJ A;  1Z6A A;  4JKV A;  4MTO A;  4H4K C;  4EHP A;  2EIM C;  3JSZ A;  4ONS A;  1G5Z A;  4ULW A;  1LI7 A;  2OOC A;  3C62 A;  2HKV A;  4YT2 A;  2EIL C;  4R32 A;  5L0I A;  1OXK A;  2H8A A;  2QNL A;  3ABM C;  4O6N A;  3IQ6 A;  2OEX A;  2QE9 A;  2XS1 A;  3JRT A;  1VYI A;  3FAP B;  5F28 E;  3JYH A;  1EI7 A;  2J9V A;  1L3P A;  3BRJ A;  4JE9 A;  1YLM A;  2BE5 F;  4YN0 B;  4QI2 A;  1Z3I X;  1V74 B;  2R05 A;  5D92 A;  3S28 A;  1NZE A;  3RQG A;  3K33 A;  1N1C A;  2YL7 A;  3C18 A;  5COM A;  3SXZ A;  3U0C A;  3DM9 B;  2G3K A;  2LCH A;  1C03 A;  3U8P A;  5E3C A;  3EZH A;  2D5R B;  3LES A;  1HW1 A;  3K1I A;  5DQT A;  1OW7 A;  4NY3 A;  3HNJ A;  3ASN C;  3SNH A;  1QSP A;  3KYJ A;  3K1H A;  2J9B A;  4YL3 A;  1IW7 F;  1YYX A;  1MMN A;  3SP1 A;  1RKE B;  2GA0 A;  3EQL F;  3AGU A;  1G4U S;  1GGQ A;  2BL2 A;  3ASO C;  3DE8 A;  3G4X A;  4AE4 B;  4P9T A;  3RFY A;  4GQH A;  1T6I A;  1XWJ A;  5CI9 A;  4EBB A;  2GDC A;  4IWB A;  4MW8 A;  2R25 A;  1Z5Z A;  3B71 A;  1CPR A;  4XLN F;  3HNK A;  3L1M A;  1VLS A;  3EG9 B;  3OWT A;  3C8Z A;  3N2Z B;  4N4W A;  2F22 A;  2PP4 A;  1MQV A;  3E70 C;  3JCU Q;  1OW8 A;  3DXJ F;  3JSE O;  1H9T A;  1QQ3 A;  4QDL A;  1H7I A;  2YL0 A;  1JAF A;  4CSA C;  4YT5 A;  3U5S A;  5DQZ A;  1RJ9 B;  4CS8 C;  2NSG A;  3TJ5 A;  3ZQV A;  3A11 A;  3V5X A;  3EG9 A;  3C8G B;  1E86 A;  1YAU O;  2DI3 A;  3DJN B;  2M4E A;  2R7T A;  4JEA A;  2PX3 A;  4OIR F;  4DBQ A;  4DRH B;  5JT4 A;  2W4B A;  1CGO A;  2L7A A;  3FVY A;  2J46 A;  4JCZ A;  1V55 C;  2P7V A;  5IY5 C;  1DOV A;  2XLO A;  2WVO A;  4IJJ A;  3C8G A;  3SXM A;  1TWC A;  5KYX B;  1KNY A;  2HJ3 A;  3QTH A;  4DJ9 A;  3A9C A;  4E17 A;  2P0N A;  1WAS A;  2MHR A;  4K7B A;  4G7H F;  3U9M A;  2H7B A;  3LLK A;  1S05 A;  2Q9C A;  2WZF A;  1A7D A;  4JRZ A;  3EGD A;  5COG A;  3NRH A;  4NTA A;  1OXB A;  1WAT A;  2EIJ C;  4IAO A;  4YJW A;  3EZI A;  4FAP B;  1M6T A;  1NU9 C;  4AL1 A;  3DD7 A;  5BQH A;  1E83 A;  3JRM O;  2FAP B;  2HJM A;  1PD1 A;  3FOP A;  4NCQ A;  2VH3 A;  1M2V B;  2CW0 F;  2XM0 A;  4HE8 D;  3QMK A;  2CNW A;  1HMD A;  3K7D A;  2QTV A;  3JTL O;  3ZTM A;  1J8Y F;  3MLG A;  2XS8 A;  4E7S A;  2B0H A;  2CNW D;  3OEO A;  4MND A;  2XSE A;  3U3B A;  4MVQ A;  1ZU4 A;  3B29 A;  2J9W A;  2RD9 A;  3ABK C;  2OU6 A;  1R4T A;  3AGT A;  5A6K A;  3EH1 A;  1TWG A;  1MMA A;  2J8W A;  3RQE A;  2PF4 E;  5KYN A;  1T6U A;  4HEA J;  2GAQ A;  4CS9 C;  5JSL A;  3IHU A;  2HFI A;  4GEH A;  3SZR A;  1D1A A;  1AEP A;  1OKK A;  3DAG A;  1E2X A;  3JYY A;  2YHS A;  1YYJ A;  3UMI A;  4DXW A;  5EHH A;  1TQG A;  3GWL A;  3GOR A;  4O7G A;  4CSA A;  4O6M A;  4CS8 A;  3GEI A;  3PMR A;  5T3T A;  5DVW A;  3RYL A;  4YWQ A;  3H2U A;  3UNG C;  1OQC A;  4X0R A;  2YLI A;  1MMG A;  3HKK A;  1KU2 A;  1M56 C;  3U8V A;  1F1M A;  2VB6 A;  5L0H A;  4WGZ A;  1OCO C;  5COF A;  3M1C B;  4BJT A;  2ZXP A;  1FNT c;  2XLE A;  4B6I A;  1K40 A;  1CGM E;  2YRF A;  4XPY A;  3DWW A;  2OEV A;  3AG2 C;  3N0T A;  4XEK A;  5KYY B;  4KI2 A;  4HFK B;  1ZU5 A;  1O5H A;  2WZL A;  3IPM O;  3LS0 A;  4FX5 A;  4KNW A;  1A41 A; 
#chains in the Genus database with same CATH homology
 1DOW A;  3H2V A;  1T01 A;  4E18 A;  2LQG A;  3TJ5 A;  5L0D A;  4PR9 A;  5FZT A;  2GWW A;  5L0J A;  5L0F A;  4EHP A;  5L0C A;  4ONS A;  1ZVZ A;  4K1O A;  2X0C A;  1ST6 A;  1ZW2 A;  1U6H A;  3VF0 A;  1RKE B;  1SYQ A;  2HSQ A;  3H2U A;  1TR2 A;  1ZW3 A;  4IGG A;  3RF3 A;  3TJ6 A;  2B0H A;  5L0I A;  3T6G B;  2L7A A;  4P9T A;  3S90 A;  5L0H A;  1XWJ A;  1DOV A;  2GDC A;  4DJ9 A;  4E17 A;  5L0G A;  1RKE A;  1U89 A;  3MYI A;  1QKR A;  1H6G A;  2IBF A;  1L7C A;  1RKC A;  3ZDL A;  1YDI A;  4W8P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...