1RKEA

Human vinculin head (1-258) in complex with human vinculin tail (879-1066)
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
262
structure length
262
Chain Sequence
HHHHMPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Vinculin activation by talin through helical bundle conversion
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion, structural protein
molecule keywords Vinculin
total genus 110
structure length 262
sequence length 262
ec nomenclature
pdb deposition date 2003-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1rkeA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1rkeA01
3VF0A 3ZDLA 3MYIA 1T01A 5FZTA 3T6GB 2HSQA 5L0IA 4ONSA 3H2VA 1XWJA 2X0CA 1H6GA 1ST6A 3RF3A 5L0HA 1U6HA 1ZW3A 5L0JA 5L0DA 2GDCA 4P9TA 3TJ5A 1RKEA 3H2UA 4E17A 1QKRA 2L7AA 4W8PA 5L0CA 1SYQA 5L0FA 2LQGA 4IGGA 1U89A 1ZVZA 3TJ6A 4E18A 4PR9A 5L0GA 4K1OA 4DJ9A 4EHPA 1DOVA 2IBFA 2GWWA 1RKEB 1YDIA 1TR2A 1RKCA 1L7CA 3S90A 2B0HA 1DOWA 1ZW2A
chains in the Genus database with same CATH superfamily
3EHMA 3K1IA 5FZTA 1QQ3A 3V5ZA 5JRAA 1VLTA 2P0NA 1FR0A 3DE9A 1S7ZA 4MNDA 2EIJC 1FFTC 5D92A 2KGOA 4E0HA 4IB4A 2TMVP 1ORJA 1LI7A 4Z9IA 3RF3A 3POVA 2GA0A 2LCHA 3DWWA 4LDQA 3V5XA 1YLMA 1ZZPA 2IXMA 4DVZA 1C03A 2I15A 4DOZA 5JT4A 5AC4A 2YKZA 3H65A 1OXKA 4RBNA 1U89A 1VB5A 1ZVZA 2LK4A 1D0YA 4NQFA 1U0BB 1JPJA 3UMIA 3WG7C 2LD6A 3NYMA 1JPNA 3O6XA 2R7RA 3B0PA 1DOVA 3MX3A 2GWWA 5B1BC 1SF8A 3M4CA 1O3UA 2Q9BA 3N2ZB 3HNIA 2PFDA 3AQCA 3LS0A 4MS2A 3IQ6A 4XEFA 1J8MF 3R7CA 4C3EA 2Q3TA 4JRZA 4C7OB 1ZU4A 2UUHA 4XWJA 1MMGA 2PBEA 2AWCA 2VB6A 2YVKA 1NBBA 3LJBA 4ONSA 3W8IA 5COMA 2X0CA 2YRFA 4ZLCA 2HMQA 3HTKC 3ZTMA 5DQTA 2XL6A 1C17M 3NYLA 3DJUB 2A69F 4PJMA 3EH2A 4E17A 5L0CA 2EIMC 1UFBA 2XL8A 1HMOA 2ZXRA 4I3MA 3EFOB 4IWBA 3TD7A 1RJ9B 3JSEO 4HFFB 1LE4A 2EPLX 2NUTB 4BJTA 4PR9A 1ZHWA 2IM8A 3CZ6A 3S0XA 1NSGB 3RH3A 4CSAC 4AL0A 5BQIA 3B9QA 3SXZA 4NTBA 1YYJA 2IYLD 2C04A 1RKEB 5GPGB 4CBEA 3M4BA 1VYKA 1OCRC 5KYWA 3EG9A 4IJJA 4U5CE 4ULWA 4DRJB 3K7DA 1ZW2A 2EIKC 3I5PA 2G3KA 3VM6A 3W8HA 4AE4A 2EPOA 4PFOA 1T5OA 1ZU5A 1PD1A 2YLDA 3RW0A 2NUPB 4MQ9F 2W4MA 3B0VC 3NKDA 2YZSA 3EGDA 3C7JA 4O6MA 4CS8C 4IAQA 2R7WA 5DLJA 4DBQA 2R7TA 4HEAJ 1PCXA 4YT8A 3I4UA 3HKKA 1ZHYA 3OWTA 3EZHA 2CCYA 2OJED 4U5DE 3LS1A 3O55A 1MMAA 2YLGA 3FDQA 3DE8A 2VC9A 3DM5A 2J9VA 4I44A 4J7TA 4JIOA 4CDYA 5T3TA 3GM3A 3RKOF 2WL8A 3K1IC 4KBLA 1XZQA 2LFFA 3K6BA 3ZQYA 4G78A 2M64A 4YT5A 1XWJA 4MVQA 3KYJA 3KKBA 3JYHA 4LDKA 5JSLA 3S84A 3TJ5A 4D4NA 3H2UA 1QLEC 1LPEA 2J9UA 5E33A 1B68A 1ZHZA 4O6YA 2J8WA 2QLAA 3G50A 2R7VA 3Q7GA 2EINC 2YL7A 2VH3A 3NMKA 2XLHA 2G3VA 3CAXA 3L8IA 5F28E 3UMKA 5D91A 4Z9JA 3C8GD 1QPUA 2A6EF 2DGJA 1L7CA 2R7OA 4Q5SF 2B0HA 5TJ5E 1CPRA 1KNYA 2KSFA 3F47A 2JX0A 4NC3A 2PX3A 1NLXA 2HUJA 5F5HA 1CPQA 1GQAA 4A4AA 4FX5A 1H6GA 1OW7A 2WVNA 4H54A 4PK4A 4MVOA 2H7OA 2HJMA 1TFKB 3GEIA 3U9JA 4XQ1A 1NFNA 3K66A 4IRUA 1Q0FA 2OG2A 1LI5A 2KW3C 4ER9A 2OJQA 3OA1A 2PP4A 2XLOA 3C8ZA 1WOLA 1LIHA 1BR1A 2YL3A 3ECSA 1MNEA 2DYRC 4CSAA 4C3DA 4JTCB 5KYYA 4G7HF 5CI8A 4E0IA 4KI2A 1TR2A 2AWYA 5AGFA 2HSBA 1FTSA 2OOCA 2XS8A 2J45A 4U9EA 1Q0KA 3EJNA 1GM5A 4C7OA 5KYXA 5AC5A 4U5FE 2BE5F 3CQZA 3H2VA 1EA8A 3G4XA 1JR8A 4GEHA 1H9TA 1K05A 3RYLA 2RD9A 5EHHA 2ICWG 4M63A 2LSEA 3A11A 5EGYA 1WWPA 2J9WA 4OINF 5KYUA 4CS7A 2BC5A 4WABA 3C62A 3LNRA 4MVUA 2J7PD 4EBKA 1HMDA 1I4ZA 1T9KA 4E7ZA 1KU2A 5CIVA 1KTMA 4G0HA 2YQYA 1FMWA 4GYTA 4YN0B 1Z3IX 2FGYA 3AGUA 3LUTB 2R02A 2IOQA 1G4WR 2KK1A 1O87A 1YARO 3VAYA 4OIPF 5E3CA 2MWQA 3AG3C 2XXAA 2V26A 3ZDLA 4MW8A 1T01A 3GANA 1BR2A 1Y4CA 2VASA 2W45A 1IW7F 3MYFA 3Q6MA 3A9CA 3N0TA 1JMWA 3IEEA 3QZCA 4QI0A 3ZVRA 5IY5C 5L3VA 1CGME 1GGQA 1YA7O 2CGEA 2WZLA 2NUPA 5DQZA 1LM3B 4PJLA 3NKEA 3FMSA 2ZXPA 1QKRA 4MW3A 5HV9A 1LE2A 1M6TA 4P6IC 2LFDA 2J7PA 3C63A 3DJNB 1TQGA 3EG9B 3FOPA 2VCBA 1ORYA 2AU5A 2XSEA 3EH1A 4EUKB 2KC3A 4K1OA 1FMVA 3QTHA 4ULVA 3QMKA 4XTKA 1C02A 2IBFA 3U2MA 2IXOA 4U5BE 3W2WA 5JLIA 2OKUA 3L0IA 3MYIA 4YK5A 1CGOA 3DZAA 4IAOA 2L9JA 1YJGA 3JCUQ 4BJ1A 4LDRA 3PDMP 3DXJF 4DVYP 4U5HA 2X51A 2J0XA 1FNTc 2DI3A 3X2QC 1MMDA 1D0ZA 2HS5A 2A0BA 4KNVA 4H4KC 4BEMJ 3EZIA 3JZ0A 2OQMA 2QTVA 4CX9A 3RQFA 1D0XA 3T9OA 1UG7A 2Y3GA 4MTGA 4XPXA 3DI5A 4CIHA 2ZD9A 2YWAA 2LQGA 2DYSC 3QW0A 1Z23A 4JVSA 2YL1A 4Z9HA 3TOLA 1A41A 1N1CA 3U8VA 2XLMA 3EHNA 4Q4ZF 1VMAA 4OD5A 4QI2A 4JKVA 5A6BA 2IXPA 256BA 5DS4A 3C8GA 2J0WA 5A6BD 1M56C 4J7YA 1D1BA 4JEAA 4R32A 1S05A 1R5ID 3LAYA 4CIPA 3C18A 3ASNC 3JRTA 2DB4A 3E9VA 3JRMO 2XLWA 1WASA 4RD9A 2XM4A 4YT2A 3GWLA 3UMHA 2M4EA 1Z6AA 3DAGA 1EKYA 2P61A 3GEHA 3IQTA 3SP1A 1W2WA 5B3SC 1U6HA 5JP7A 5L0DA 3HNLA 4JEBA 3RQEA 3WHNA 4CJOA 3QW1A 2WZGA 3CSKA 3NYJA 3SEOA 1VTMP 4X0RA 1MMNA 1AEPA 2B0JA 4WGYA 5L0FA 1ZHTA 3NMJA 4IGGA 3QVYA 4W8KA 4BG0A 4DRIB 3NMIA 1E86A 2XLDA 2KJGA 5T1DB 5L0GA 4G7ZF 1A0BA 3MBGA 3NRHA 3FHDA 3HJCA 2HKVA 3U5SA 3LESA 4QDLA 1OR2A 1IZMA 4IARA 1YYXA 2YHSA 4NY3A 3EPVA 4EIYA 4OIRF 2A0UA 3ASOC 3W2VA 3J06A 3AQBA 2G62A 3KH2A 4YL1A 1YAUO 5B1AC 2IXNA 4YT4A 5L0IA 1M2VA 1OR3A 1TWAA 2EPMX 5JVEA 2XRHA 4J30B 4O79A 4J32B 2Q00A 2QNLA 1AUEA 2Q9CA 3FOOA 1OW8A 3TULA 4LACB 3U8PA 2Y39A 3AJMA 2L6FA 5JUAA 4NTFA 1E85A 2EPKX 3ABMC 5A6JA 3U0CA 1J8YF 3C8GB 1SYQA 3BRJA 2L6GA 4MTFA 1V4AA 4EKWA 1E2XA 3GORA 2Q7RA 2P7VA 1HE9A 2YLIA 1HY5A 2XLVA 3O39A 5KYXB 3RVZA 4YWQA 1MNDA 1TFOB 3DAFA 3GWNA 4U5EE 3UR3C 4N6HA 2R7UA 4WJ0A 3AG2C 3V7OA 2BL2A 2XLEA 1Z7Qc 3VRCA 1DOWA 3MFNA 1LVKA 2W9YA 1AVOB 3RQGA 2YL0A 3DKAA 1BR4A 3GEEA 1VYIA 3B29A 3V5YA 2Y3BA 4OIOF 2NSGA 1WGWA 1RCPA 4L6RA 2QUPA 3ABLC 2VCCA 1EI7A 3BEHA 3M1CB 4I1MA 5HSWA 4XLPF 1OKKD 1I5NA 2Z15A 4JTAB 5BUOA 1HW1A 1BBHA 2KYHA 5KYNA 1WTYA 3ZQVA 4AL1A 1OKKA 1ZHXA 4OD4A 1WATA 4EBBA 3TK0A 2J9BA 3S27A 4CS9A 2R9RB 3MLGA 3KPHA 4JZAA 4BJ5C 4E18A 3IQCA 4JW1A 1TWHA 2H7VC 2WVOA 3SNHA 1PD0A 2LP4A 2J46A 3FAJA 2I8BA 1HE1A 1K40A 3Q7LA 4JE9A 3ZTZA 3S90A 1QSPA 5F5FA 1TKNA 5K0IA 4NCQA 3LEOA 2R7SA 1H7IA 2ZXWC 3AG4C 1SZIA 3T6GB 3U3FA 1HW2A 1M57C 5KYYB 1OW6A 2LIGA 3LLIA 2V3CC 4A2NB 1JOGA 4MVZA 4JTDB 2P1AA 3EGXB 1RMVA 2QE9A 4XLNF 1YVIA 1RKEA 3SYNA 1FFHA 1R4TA 4W8PA 3U2LA 1TWGA 2CNWA 2Q9AA 3HLZA 4AK9A 4C3BA 1Y6DA 4YJWA 4KNWA 2PX0A 1VLSA 4U5GA 1G5ZA 2A68F 2ASRA 1EQ1A 2AVKA 2L81A 1M2OA 4DJ9A 3T6JA 3NG1A 4RDAA 4LLCA 1LKXA 3L34A 5CI9A 3WODF 3SXMA 1T6QA 2NSFA 2R25A 1D1CA 3US6A 3B71A 4XPWA 4I1OB 3TOMA 2P6VA 1Q0DA 1LS1A 3DM9B 2ZPAA 3LNMB 5JS5A 3RVYA 1BDJB 4BPMA 4PJJA 1VOMA 1RXQA 3S28A 2MHRA 4OIQF 1ZYRF 4WGZA 4B6IA 4ZLDA 2W4BA 1OXBA 5FCLA 3IPMO 2WB7A 3U3BA 2HMZA 1ZW3A 4FWVA 2GDCA 3W4YA 5E2QA 2RSEB 1JRAA 4YL0A 4XEVA 3UGOA 2R05A 4BEJA 1K04A 3WAQA 2XS1A 2OCCC 3R2PA 2C03A 3ITFA 3KL4A 3G4ZA 2NG1A 5A6AA 1NZEA 1F1MA 4EHPA 3ZG1A 1APCA 4BJ6A 3AGTA 3Q6NA 2R7XA 1T6UA 3M15A 2HJ3A 3EGXA 3OEOA 2CNWD 2NUTA 3ZIBA 3GM2A 1ORSC 1E83A 3O10A 3VF0A 3SXKA 2GFHA 4DBRA 3L1MA 1M2VB 4MVSA 4CDAA 4GQHA 3K1HA 4MTOA 3PMRA 2QY9A 1NFOA 1A7DA 3HNKA 2WZFA 4JJGA 5T3WA 4AE4B 5L0HA 3LLKA 1JAFA 2GAQA 4XEKA 4DRHB 1QVXA 1FAPB 2H8AA 4XPYA 1CGNA 1H9GA 4KC9A 1GS9A 2L6HA 3DMDA 1YZCA 4PFPA 5DVWA 2A6HF 1SR2A 2CW0F 2WVQA 2D5RB 4PJNA 2R03A 3EFOA 4CS9C 3SZRA 4F4BA 3PCVA 1TWCA 3KMIA 4O7GA 4BJ5A 2R7QA 4YL3A 3FXHA 4P9FA 2H7BA 5DS5A 4UDVA 3IHUA 3T4RA 1D1AA 1VK5A 2KNHA 3TQOA 3I5QA 1A7EA 2VCAA 1Z63A 4N4WA 5COGA 5KYWB 3NDBB 2YEVA 3KYIA 4E7SA 2A1DD 3RIPA 1SMYF 5A69A 1OCZC 2MYSA 2HV7A 2ZXOA 3M79A 3AOUA 3K33A 2OEXA 2Y69C 2KQ9A 3VYWA 1BZ4A 2FAPB 4K7BA 4PACA 1ST6A 5KYUB 1RJ9A 3F46A 5BQHA 4CDVA 4D4XA 1O5HA 3ZWIA 3N24A 1Q0GA 5L0JA 4P9TA 3AG1C 3EGDB 3JYYA 2L7AA 4ANJA 3GM1A 3T6BA 1XZPA 4DXWA 1YA9A 1LS4A 3S29A 3ZC4A 3TJ6A 2FFHA 1YZAA 3FVYA 3HNJA 2EPNA 3CEXA 3L8JA 2HFIA 4HE8D 4LERA 3UNGC 1G4US 4FAPB 1E84A 1Q0MA 2CYDA 3QVZA 4AX2A 1PV3A 3ABKC 4U9DA 5EK0A 1I4YA 1A7VA 1RKCA 3RFYA 4JJFA 2XM0A 3UGPA 3PHF2 1NU9C 4NTAA 2JPUA 3ATPA 2ETSA 5COFA 1OCCC 2AP3A 1G8XA 2HSQA 2PF4E 4CJGA 5L3QA 2F22A 2PNOA 3EQLF 5E3AA 1T6IA 4JCZA 2Y3HA 3SXYA 5B3IA 1NG1A 4MVMA 2XL4A 3U9MA 3GODA 4K0DA 3JT1A 4G7OF 5DS6A 2O9XA 1OQCA 1NU7D 3X1OA 4CS8A 1V54C 3E70C 3ZSUA 1MQVA 2OU6A 5A6KA 4HFKB 4O6NA 4N06A 1V74B 4FESA 2D4UA 5BQGA 4JC7A 2JD3A 3S9OA 2XXAB 2HV6A 2OEVA 2E87A 2Y3DA 4EWCA 3FAPB 2Q4FA 2NPUA 3JTLO 3JSZA 2UUIA 4N6CA 3IQ5A 4JURI 4BJ6C 2EILC 1WN0A 1YDIA 1Z5ZA 1QZXA 1V55C 1OCOC 4JCHA 4LLEA 2HZ8A 1L3PA 3DD7A 3LEVA 4Q7CA 3B0UX 4EBJA 2CDQA 4MVRA
chains in the Genus database with same CATH topology
3VF0A 3ZDLA 3MYIA 1T01A 5FZTA 3T6GB 2HSQA 5L0IA 4ONSA 3H2VA 1XWJA 2X0CA 1H6GA 1ST6A 3RF3A 5L0HA 1U6HA 1ZW3A 5L0JA 5L0DA 2GDCA 4P9TA 3TJ5A 1RKEA 3H2UA 4E17A 1QKRA 2L7AA 4W8PA 5L0CA 1SYQA 5L0FA 2LQGA 4IGGA 1U89A 1ZVZA 3TJ6A 4E18A 4PR9A 5L0GA 4K1OA 4DJ9A 4EHPA 1DOVA 2IBFA 2GWWA 1RKEB 1YDIA 1TR2A 1RKCA 1L7CA 3S90A 2B0HA 1DOWA 1ZW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VF0 A;  3ZDL A;  3MYI A;  1T01 A;  5FZT A;  3T6G B;  2HSQ A;  5L0I A;  4ONS A;  3H2V A;  1XWJ A;  2X0C A;  1H6G A;  1ST6 A;  3RF3 A;  5L0H A;  1U6H A;  1ZW3 A;  5L0J A;  5L0D A;  2GDC A;  4P9T A;  3TJ5 A;  1RKE A;  3H2U A;  4E17 A;  1QKR A;  2L7A A;  4W8P A;  5L0C A;  1SYQ A;  5L0F A;  2LQG A;  4IGG A;  1U89 A;  1ZVZ A;  3TJ6 A;  4E18 A;  4PR9 A;  5L0G A;  4K1O A;  4DJ9 A;  4EHP A;  1DOV A;  2IBF A;  2GWW A;  1RKE B;  1YDI A;  1TR2 A;  1RKC A;  1L7C A;  3S90 A;  2B0H A;  1DOW A;  1ZW2 A; 
#chains in the Genus database with same CATH topology
 3EHM A;  3K1I A;  5FZT A;  1QQ3 A;  3V5Z A;  5JRA A;  1VLT A;  2P0N A;  1FR0 A;  3DE9 A;  1S7Z A;  4MND A;  2EIJ C;  1FFT C;  5D92 A;  2KGO A;  4E0H A;  4IB4 A;  2TMV P;  1ORJ A;  1LI7 A;  4Z9I A;  3RF3 A;  3POV A;  2GA0 A;  2LCH A;  3DWW A;  4LDQ A;  3V5X A;  1YLM A;  1ZZP A;  2IXM A;  4DVZ A;  1C03 A;  2I15 A;  4DOZ A;  5JT4 A;  5AC4 A;  2YKZ A;  3H65 A;  1OXK A;  4RBN A;  1U89 A;  1VB5 A;  1ZVZ A;  2LK4 A;  1D0Y A;  4NQF A;  1U0B B;  1JPJ A;  3UMI A;  3WG7 C;  2LD6 A;  3NYM A;  1JPN A;  3O6X A;  2R7R A;  3B0P A;  1DOV A;  3MX3 A;  2GWW A;  5B1B C;  1SF8 A;  3M4C A;  1O3U A;  2Q9B A;  3N2Z B;  3HNI A;  2PFD A;  3AQC A;  3LS0 A;  4MS2 A;  3IQ6 A;  4XEF A;  1J8M F;  3R7C A;  4C3E A;  2Q3T A;  4JRZ A;  4C7O B;  1ZU4 A;  2UUH A;  4XWJ A;  1MMG A;  2PBE A;  2AWC A;  2VB6 A;  2YVK A;  1NBB A;  3LJB A;  4ONS A;  3W8I A;  5COM A;  2X0C A;  2YRF A;  4ZLC A;  2HMQ A;  3HTK C;  3ZTM A;  5DQT A;  2XL6 A;  1C17 M;  3NYL A;  3DJU B;  2A69 F;  4PJM A;  3EH2 A;  4E17 A;  5L0C A;  2EIM C;  1UFB A;  2XL8 A;  1HMO A;  2ZXR A;  4I3M A;  3EFO B;  4IWB A;  3TD7 A;  1RJ9 B;  3JSE O;  4HFF B;  1LE4 A;  2EPL X;  2NUT B;  4BJT A;  4PR9 A;  1ZHW A;  2IM8 A;  3CZ6 A;  3S0X A;  1NSG B;  3RH3 A;  4CSA C;  4AL0 A;  5BQI A;  3B9Q A;  3SXZ A;  4NTB A;  1YYJ A;  2IYL D;  2C04 A;  1RKE B;  5GPG B;  4CBE A;  3M4B A;  1VYK A;  1OCR C;  5KYW A;  3EG9 A;  4IJJ A;  4U5C E;  4ULW A;  4DRJ B;  3K7D A;  1ZW2 A;  2EIK C;  3I5P A;  2G3K A;  3VM6 A;  3W8H A;  4AE4 A;  2EPO A;  4PFO A;  1T5O A;  1ZU5 A;  1PD1 A;  2YLD A;  3RW0 A;  2NUP B;  4MQ9 F;  2W4M A;  3B0V C;  3NKD A;  2YZS A;  3EGD A;  3C7J A;  4O6M A;  4CS8 C;  4IAQ A;  2R7W A;  5DLJ A;  4DBQ A;  2R7T A;  4HEA J;  1PCX A;  4YT8 A;  3I4U A;  3HKK A;  1ZHY A;  3OWT A;  3EZH A;  2CCY A;  2OJE D;  4U5D E;  3LS1 A;  3O55 A;  1MMA A;  2YLG A;  3FDQ A;  3DE8 A;  2VC9 A;  3DM5 A;  2J9V A;  4I44 A;  4J7T A;  4JIO A;  4CDY A;  5T3T A;  3GM3 A;  3RKO F;  2WL8 A;  3K1I C;  4KBL A;  1XZQ A;  2LFF A;  3K6B A;  3ZQY A;  4G78 A;  2M64 A;  4YT5 A;  1XWJ A;  4MVQ A;  3KYJ A;  3KKB A;  3JYH A;  4LDK A;  5JSL A;  3S84 A;  3TJ5 A;  4D4N A;  3H2U A;  1QLE C;  1LPE A;  2J9U A;  5E33 A;  1B68 A;  1ZHZ A;  4O6Y A;  2J8W A;  2QLA A;  3G50 A;  2R7V A;  3Q7G A;  2EIN C;  2YL7 A;  2VH3 A;  3NMK A;  2XLH A;  2G3V A;  3CAX A;  3L8I A;  5F28 E;  3UMK A;  5D91 A;  4Z9J A;  3C8G D;  1QPU A;  2A6E F;  2DGJ A;  1L7C A;  2R7O A;  4Q5S F;  2B0H A;  5TJ5 E;  1CPR A;  1KNY A;  2KSF A;  3F47 A;  2JX0 A;  4NC3 A;  2PX3 A;  1NLX A;  2HUJ A;  5F5H A;  1CPQ A;  1GQA A;  4A4A A;  4FX5 A;  1H6G A;  1OW7 A;  2WVN A;  4H54 A;  4PK4 A;  4MVO A;  2H7O A;  2HJM A;  1TFK B;  3GEI A;  3U9J A;  4XQ1 A;  1NFN A;  3K66 A;  4IRU A;  1Q0F A;  2OG2 A;  1LI5 A;  2KW3 C;  4ER9 A;  2OJQ A;  3OA1 A;  2PP4 A;  2XLO A;  3C8Z A;  1WOL A;  1LIH A;  1BR1 A;  2YL3 A;  3ECS A;  1MNE A;  2DYR C;  4CSA A;  4C3D A;  4JTC B;  5KYY A;  4G7H F;  5CI8 A;  4E0I A;  4KI2 A;  1TR2 A;  2AWY A;  5AGF A;  2HSB A;  1FTS A;  2OOC A;  2XS8 A;  2J45 A;  4U9E A;  1Q0K A;  3EJN A;  1GM5 A;  4C7O A;  5KYX A;  5AC5 A;  4U5F E;  2BE5 F;  3CQZ A;  3H2V A;  1EA8 A;  3G4X A;  1JR8 A;  4GEH A;  1H9T A;  1K05 A;  3RYL A;  2RD9 A;  5EHH A;  2ICW G;  4M63 A;  2LSE A;  3A11 A;  5EGY A;  1WWP A;  2J9W A;  4OIN F;  5KYU A;  4CS7 A;  2BC5 A;  4WAB A;  3C62 A;  3LNR A;  4MVU A;  2J7P D;  4EBK A;  1HMD A;  1I4Z A;  1T9K A;  4E7Z A;  1KU2 A;  5CIV A;  1KTM A;  4G0H A;  2YQY A;  1FMW A;  4GYT A;  4YN0 B;  1Z3I X;  2FGY A;  3AGU A;  3LUT B;  2R02 A;  2IOQ A;  1G4W R;  2KK1 A;  1O87 A;  1YAR O;  3VAY A;  4OIP F;  5E3C A;  2MWQ A;  3AG3 C;  2XXA A;  2V26 A;  3ZDL A;  4MW8 A;  1T01 A;  3GAN A;  1BR2 A;  1Y4C A;  2VAS A;  2W45 A;  1IW7 F;  3MYF A;  3Q6M A;  3A9C A;  3N0T A;  1JMW A;  3IEE A;  3QZC A;  4QI0 A;  3ZVR A;  5IY5 C;  5L3V A;  1CGM E;  1GGQ A;  1YA7 O;  2CGE A;  2WZL A;  2NUP A;  5DQZ A;  1LM3 B;  4PJL A;  3NKE A;  3FMS A;  2ZXP A;  1QKR A;  4MW3 A;  5HV9 A;  1LE2 A;  1M6T A;  4P6I C;  2LFD A;  2J7P A;  3C63 A;  3DJN B;  1TQG A;  3EG9 B;  3FOP A;  2VCB A;  1ORY A;  2AU5 A;  2XSE A;  3EH1 A;  4EUK B;  2KC3 A;  4K1O A;  1FMV A;  3QTH A;  4ULV A;  3QMK A;  4XTK A;  1C02 A;  2IBF A;  3U2M A;  2IXO A;  4U5B E;  3W2W A;  5JLI A;  2OKU A;  3L0I A;  3MYI A;  4YK5 A;  1CGO A;  3DZA A;  4IAO A;  2L9J A;  1YJG A;  3JCU Q;  4BJ1 A;  4LDR A;  3PDM P;  3DXJ F;  4DVY P;  4U5H A;  2X51 A;  2J0X A;  1FNT c;  2DI3 A;  3X2Q C;  1MMD A;  1D0Z A;  2HS5 A;  2A0B A;  4KNV A;  4H4K C;  4BEM J;  3EZI A;  3JZ0 A;  2OQM A;  2QTV A;  4CX9 A;  3RQF A;  1D0X A;  3T9O A;  1UG7 A;  2Y3G A;  4MTG A;  4XPX A;  3DI5 A;  4CIH A;  2ZD9 A;  2YWA A;  2LQG A;  2DYS C;  3QW0 A;  1Z23 A;  4JVS A;  2YL1 A;  4Z9H A;  3TOL A;  1A41 A;  1N1C A;  3U8V A;  2XLM A;  3EHN A;  4Q4Z F;  1VMA A;  4OD5 A;  4QI2 A;  4JKV A;  5A6B A;  2IXP A;  256B A;  5DS4 A;  3C8G A;  2J0W A;  5A6B D;  1M56 C;  4J7Y A;  1D1B A;  4JEA A;  4R32 A;  1S05 A;  1R5I D;  3LAY A;  4CIP A;  3C18 A;  3ASN C;  3JRT A;  2DB4 A;  3E9V A;  3JRM O;  2XLW A;  1WAS A;  4RD9 A;  2XM4 A;  4YT2 A;  3GWL A;  3UMH A;  2M4E A;  1Z6A A;  3DAG A;  1EKY A;  2P61 A;  3GEH A;  3IQT A;  3SP1 A;  1W2W A;  5B3S C;  1U6H A;  5JP7 A;  5L0D A;  3HNL A;  4JEB A;  3RQE A;  3WHN A;  4CJO A;  3QW1 A;  2WZG A;  3CSK A;  3NYJ A;  3SEO A;  1VTM P;  4X0R A;  1MMN A;  1AEP A;  2B0J A;  4WGY A;  5L0F A;  1ZHT A;  3NMJ A;  4IGG A;  3QVY A;  4W8K A;  4BG0 A;  4DRI B;  3NMI A;  1E86 A;  2XLD A;  2KJG A;  5T1D B;  5L0G A;  4G7Z F;  1A0B A;  3MBG A;  3NRH A;  3FHD A;  3HJC A;  2HKV A;  3U5S A;  3LES A;  4QDL A;  1OR2 A;  1IZM A;  4IAR A;  1YYX A;  2YHS A;  4NY3 A;  3EPV A;  4EIY A;  4OIR F;  2A0U A;  3ASO C;  3W2V A;  3J06 A;  3AQB A;  2G62 A;  3KH2 A;  4YL1 A;  1YAU O;  5B1A C;  2IXN A;  4YT4 A;  5L0I A;  1M2V A;  1OR3 A;  1TWA A;  2EPM X;  5JVE A;  2XRH A;  4J30 B;  4O79 A;  4J32 B;  2Q00 A;  2QNL A;  1AUE A;  2Q9C A;  3FOO A;  1OW8 A;  3TUL A;  4LAC B;  3U8P A;  2Y39 A;  3AJM A;  2L6F A;  5JUA A;  4NTF A;  1E85 A;  2EPK X;  3ABM C;  5A6J A;  3U0C A;  1J8Y F;  3C8G B;  1SYQ A;  3BRJ A;  2L6G A;  4MTF A;  1V4A A;  4EKW A;  1E2X A;  3GOR A;  2Q7R A;  2P7V A;  1HE9 A;  2YLI A;  1HY5 A;  2XLV A;  3O39 A;  5KYX B;  3RVZ A;  4YWQ A;  1MND A;  1TFO B;  3DAF A;  3GWN A;  4U5E E;  3UR3 C;  4N6H A;  2R7U A;  4WJ0 A;  3AG2 C;  3V7O A;  2BL2 A;  2XLE A;  1Z7Q c;  3VRC A;  1DOW A;  3MFN A;  1LVK A;  2W9Y A;  1AVO B;  3RQG A;  2YL0 A;  3DKA A;  1BR4 A;  3GEE A;  1VYI A;  3B29 A;  3V5Y A;  2Y3B A;  4OIO F;  2NSG A;  1WGW A;  1RCP A;  4L6R A;  2QUP A;  3ABL C;  2VCC A;  1EI7 A;  3BEH A;  3M1C B;  4I1M A;  5HSW A;  4XLP F;  1OKK D;  1I5N A;  2Z15 A;  4JTA B;  5BUO A;  1HW1 A;  1BBH A;  2KYH A;  5KYN A;  1WTY A;  3ZQV A;  4AL1 A;  1OKK A;  1ZHX A;  4OD4 A;  1WAT A;  4EBB A;  3TK0 A;  2J9B A;  3S27 A;  4CS9 A;  2R9R B;  3MLG A;  3KPH A;  4JZA A;  4BJ5 C;  4E18 A;  3IQC A;  4JW1 A;  1TWH A;  2H7V C;  2WVO A;  3SNH A;  1PD0 A;  2LP4 A;  2J46 A;  3FAJ A;  2I8B A;  1HE1 A;  1K40 A;  3Q7L A;  4JE9 A;  3ZTZ A;  3S90 A;  1QSP A;  5F5F A;  1TKN A;  5K0I A;  4NCQ A;  3LEO A;  2R7S A;  1H7I A;  2ZXW C;  3AG4 C;  1SZI A;  3T6G B;  3U3F A;  1HW2 A;  1M57 C;  5KYY B;  1OW6 A;  2LIG A;  3LLI A;  2V3C C;  4A2N B;  1JOG A;  4MVZ A;  4JTD B;  2P1A A;  3EGX B;  1RMV A;  2QE9 A;  4XLN F;  1YVI A;  1RKE A;  3SYN A;  1FFH A;  1R4T A;  4W8P A;  3U2L A;  1TWG A;  2CNW A;  2Q9A A;  3HLZ A;  4AK9 A;  4C3B A;  1Y6D A;  4YJW A;  4KNW A;  2PX0 A;  1VLS A;  4U5G A;  1G5Z A;  2A68 F;  2ASR A;  1EQ1 A;  2AVK A;  2L81 A;  1M2O A;  4DJ9 A;  3T6J A;  3NG1 A;  4RDA A;  4LLC A;  1LKX A;  3L34 A;  5CI9 A;  3WOD F;  3SXM A;  1T6Q A;  2NSF A;  2R25 A;  1D1C A;  3US6 A;  3B71 A;  4XPW A;  4I1O B;  3TOM A;  2P6V A;  1Q0D A;  1LS1 A;  3DM9 B;  2ZPA A;  3LNM B;  5JS5 A;  3RVY A;  1BDJ B;  4BPM A;  4PJJ A;  1VOM A;  1RXQ A;  3S28 A;  2MHR A;  4OIQ F;  1ZYR F;  4WGZ A;  4B6I A;  4ZLD A;  2W4B A;  1OXB A;  5FCL A;  3IPM O;  2WB7 A;  3U3B A;  2HMZ A;  1ZW3 A;  4FWV A;  2GDC A;  3W4Y A;  5E2Q A;  2RSE B;  1JRA A;  4YL0 A;  4XEV A;  3UGO A;  2R05 A;  4BEJ A;  1K04 A;  3WAQ A;  2XS1 A;  2OCC C;  3R2P A;  2C03 A;  3ITF A;  3KL4 A;  3G4Z A;  2NG1 A;  5A6A A;  1NZE A;  1F1M A;  4EHP A;  3ZG1 A;  1APC A;  4BJ6 A;  3AGT A;  3Q6N A;  2R7X A;  1T6U A;  3M15 A;  2HJ3 A;  3EGX A;  3OEO A;  2CNW D;  2NUT A;  3ZIB A;  3GM2 A;  1ORS C;  1E83 A;  3O10 A;  3VF0 A;  3SXK A;  2GFH A;  4DBR A;  3L1M A;  1M2V B;  4MVS A;  4CDA A;  4GQH A;  3K1H A;  4MTO A;  3PMR A;  2QY9 A;  1NFO A;  1A7D A;  3HNK A;  2WZF A;  4JJG A;  5T3W A;  4AE4 B;  5L0H A;  3LLK A;  1JAF A;  2GAQ A;  4XEK A;  4DRH B;  1QVX A;  1FAP B;  2H8A A;  4XPY A;  1CGN A;  1H9G A;  4KC9 A;  1GS9 A;  2L6H A;  3DMD A;  1YZC A;  4PFP A;  5DVW A;  2A6H F;  1SR2 A;  2CW0 F;  2WVQ A;  2D5R B;  4PJN A;  2R03 A;  3EFO A;  4CS9 C;  3SZR A;  4F4B A;  3PCV A;  1TWC A;  3KMI A;  4O7G A;  4BJ5 A;  2R7Q A;  4YL3 A;  3FXH A;  4P9F A;  2H7B A;  5DS5 A;  4UDV A;  3IHU A;  3T4R A;  1D1A A;  1VK5 A;  2KNH A;  3TQO A;  3I5Q A;  1A7E A;  2VCA A;  1Z63 A;  4N4W A;  5COG A;  5KYW B;  3NDB B;  2YEV A;  3KYI A;  4E7S A;  2A1D D;  3RIP A;  1SMY F;  5A69 A;  1OCZ C;  2MYS A;  2HV7 A;  2ZXO A;  3M79 A;  3AOU A;  3K33 A;  2OEX A;  2Y69 C;  2KQ9 A;  3VYW A;  1BZ4 A;  2FAP B;  4K7B A;  4PAC A;  1ST6 A;  5KYU B;  1RJ9 A;  3F46 A;  5BQH A;  4CDV A;  4D4X A;  1O5H A;  3ZWI A;  3N24 A;  1Q0G A;  5L0J A;  4P9T A;  3AG1 C;  3EGD B;  3JYY A;  2L7A A;  4ANJ A;  3GM1 A;  3T6B A;  1XZP A;  4DXW A;  1YA9 A;  1LS4 A;  3S29 A;  3ZC4 A;  3TJ6 A;  2FFH A;  1YZA A;  3FVY A;  3HNJ A;  2EPN A;  3CEX A;  3L8J A;  2HFI A;  4HE8 D;  4LER A;  3UNG C;  1G4U S;  4FAP B;  1E84 A;  1Q0M A;  2CYD A;  3QVZ A;  4AX2 A;  1PV3 A;  3ABK C;  4U9D A;  5EK0 A;  1I4Y A;  1A7V A;  1RKC A;  3RFY A;  4JJF A;  2XM0 A;  3UGP A;  3PHF 2;  1NU9 C;  4NTA A;  2JPU A;  3ATP A;  2ETS A;  5COF A;  1OCC C;  2AP3 A;  1G8X A;  2HSQ A;  2PF4 E;  4CJG A;  5L3Q A;  2F22 A;  2PNO A;  3EQL F;  5E3A A;  1T6I A;  4JCZ A;  2Y3H A;  3SXY A;  5B3I A;  1NG1 A;  4MVM A;  2XL4 A;  3U9M A;  3GOD A;  4K0D A;  3JT1 A;  4G7O F;  5DS6 A;  2O9X A;  1OQC A;  1NU7 D;  3X1O A;  4CS8 A;  1V54 C;  3E70 C;  3ZSU A;  1MQV A;  2OU6 A;  5A6K A;  4HFK B;  4O6N A;  4N06 A;  1V74 B;  4FES A;  2D4U A;  5BQG A;  4JC7 A;  2JD3 A;  3S9O A;  2XXA B;  2HV6 A;  2OEV A;  2E87 A;  2Y3D A;  4EWC A;  3FAP B;  2Q4F A;  2NPU A;  3JTL O;  3JSZ A;  2UUI A;  4N6C A;  3IQ5 A;  4JUR I;  4BJ6 C;  2EIL C;  1WN0 A;  1YDI A;  1Z5Z A;  1QZX A;  1V55 C;  1OCO C;  4JCH A;  4LLE A;  2HZ8 A;  1L3P A;  3DD7 A;  3LEV A;  4Q7C A;  3B0U X;  4EBJ A;  2CDQ A;  4MVR A; 
#chains in the Genus database with same CATH homology
 3VF0 A;  3ZDL A;  3MYI A;  1T01 A;  5FZT A;  3T6G B;  2HSQ A;  5L0I A;  4ONS A;  3H2V A;  1XWJ A;  2X0C A;  1H6G A;  1ST6 A;  3RF3 A;  5L0H A;  1U6H A;  1ZW3 A;  5L0J A;  5L0D A;  2GDC A;  4P9T A;  3TJ5 A;  1RKE A;  3H2U A;  4E17 A;  1QKR A;  2L7A A;  4W8P A;  5L0C A;  1SYQ A;  5L0F A;  2LQG A;  4IGG A;  1U89 A;  1ZVZ A;  3TJ6 A;  4E18 A;  4PR9 A;  5L0G A;  4K1O A;  4DJ9 A;  4EHP A;  1DOV A;  2IBF A;  2GWW A;  1RKE B;  1YDI A;  1TR2 A;  1RKC A;  1L7C A;  3S90 A;  2B0H A;  1DOW A;  1ZW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...