1RKEA

Human vinculin head (1-258) in complex with human vinculin tail (879-1066)
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
262
structure length
262
Chain Sequence
HHHHMPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Vinculin activation by talin through helical bundle conversion
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion, structural protein
molecule keywords Vinculin
total genus 110
structure length 262
sequence length 262
ec nomenclature
pdb deposition date 2003-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1rkeA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1rkeA01
3H2VA 4ONSA 1DOVA 2IBFA 3MYIA 1SYQA 1TR2A 2GWWA 5L0IA 1DOWA 3T6GB 4IGGA 4P9TA 1U89A 1ST6A 1L7CA 1RKEA 4E18A 3ZDLA 1XWJA 2GDCA 2L7AA 4E17A 1T01A 2HSQA 4W8PA 5FZTA 5L0CA 1YDIA 4K1OA 1RKEB 3RF3A 3TJ5A 1QKRA 4DJ9A 1ZW2A 3VF0A 5L0GA 2B0HA 4EHPA 5L0FA 1ZVZA 1RKCA 1U6HA 1ZW3A 2LQGA 2X0CA 5L0HA 5L0JA 4PR9A 3H2UA 3TJ6A 3S90A 1H6GA 5L0DA
chains in the Genus database with same CATH superfamily
1ORYA 1LS1A 4D4XA 2H8AA 2IBFA 2XM0A 4OD4A 3VM6A 1E2XA 1QPUA 2KK1A 2OQMA 2D4UA 2VCCA 4C3EA 1XZQA 2LK4A 1C03A 3KL4A 4IJJA 3TOLA 1QSPA 4CSAC 3OA1A 1KNYA 4CS9A 4Q4ZF 3RH3A 4GYTA 3SXMA 4H54A 1FMWA 1VYIA 2LIGA 1YYJA 1A41A 3B71A 3B29A 3TJ5A 4DVYP 1OW8A 3LNMB 2J0WA 4HE8D 2J7PA 1LVKA 2UUIA 2Y3DA 3LUTB 1PCXA 3JYYA 3F47A 5CIVA 3ITFA 3DM5A 1CPQA 4HEAJ 4PFOA 5L3VA 1BR2A 4X0RA 1FFTC 4YN0B 1E83A 1QQ3A 3DAGA 4A4AA 3U5SA 5A6AA 3FXHA 3AGUA 4I3MA 3US6A 2YLDA 2Q3TA 1EI7A 3UMHA 3U2LA 4W8KA 3KKBA 1WWPA 3C8ZA 1NZEA 3K7DA 1Y4CA 5DS4A 1S05A 4C3DA 2KW3C 3K1IA 2JX0A 5TJ5E 3PMRA 3M4CA 2YZSA 4E17A 1HE9A 3Q7LA 4WGZA 1AEPA 5FZTA 4JIOA 1T5OA 4DBRA 3U3FA 2VASA 3RQEA 1ZW2A 2YLGA 2DI3A 4RD9A 1G8XA 3EGDB 2B0HA 4LLEA 4LLCA 3O6XA 1A7DA 2YHSA 1ZHYA 2J9VA 2R7QA 4MS2A 2DB4A 3L1MA 3LLIA 4CS8A 1LM3B 4C7OB 2J9WA 1BR1A 1MMNA 2ICWG 3ABKC 3N2ZB 4JTAB 1MMAA 5L0DA 3EGDA 4CBEA 3SXKA 3K33A 3BRJA 4JVSA 1ZHTA 4BEMJ 1SZIA 1PV3A 1D1CA 3G50A 1IW7F 2G62A 3EFOA 4D4NA 1OXKA 1RKEA 4EUKB 1OR3A 4YL0A 1XWJA 3DI5A 3QW0A 4L6RA 3MX3A 5JS5A 2L6HA 2AWCA 4XEFA 2HV7A 1VLTA 2XL8A 4DVZA 1OW6A 4IRUA 2EPMX 5IY5C 1EKYA 5FCLA 3L0IA 5KYXB 4BJ1A 2JPUA 3ZG1A 2WB7A 1ZHZA 2LQGA 2OCCC 3U8PA 2PX3A 2HSBA 1NG1A 1G4US 1H6GA 3ASNC 3JRTA 3AQBA 3M15A 4G0HA 3R7CA 2CNWD 1JPJA 3FOOA 2XS8A 2O9XA 3K1IC 3S29A 4A2NB 1GM5A 4CDAA 2PP4A 4IGGA 3ZQYA 4E0HA 3CQZA 2HJ3A 2YKZA 1JR8A 2GDCA 2JD3A 2QTVA 2VCAA 1QLEC 3HNLA 3CAXA 3GWLA 3NMJA 3QTHA 1Z23A 3LLKA 1T01A 1S7ZA 4JTDB 5E33A 3ZQVA 1H9TA 1LIHA 1OW7A 1RXQA 2RSEB 1E86A 3VYWA 3GODA 5JLIA 3EG9B 2Y39A 4K0DA 1J8MF 5KYUA 3PHF2 1D0ZA 2XL6A 3B0VC 4NY3A 1AUEA 2BC5A 4ZLCA 2L9JA 4GQHA 2P0NA 4BJTA 4JZAA 3W2VA 4J32B 3NDBB 4FWVA 1N1CA 3IQCA 1LE2A 1JPNA 4O6MA 1DOVA 3V5ZA 1W2WA 2KC3A 2ZPAA 4PJJA 3JZ0A 4OIOF 5CI9A 2Y3GA 3EHNA 3VAYA 3IHUA 5EGYA 1BR4A 2CDQA 3ABMC 3T9OA 2ETSA 2EPOA 2HUJA 2IXOA 4IARA 2EINC 2M4EA 2YLIA 4MW8A 2L7AA 3AGTA 3AG1C 3C8GA 3TK0A 2OEXA 2KNHA 2R7XA 4U5HA 3DD7A 2KQ9A 3PCVA 2WZFA 2YL0A 3DE9A 1YARO 2OOCA 2EIJC 4YWQA 3DXJF 4WABA 2VCBA 3RW0A 4OIQF 1HW2A 5KYYB 2L6FA 3TOMA 2CW0F 5L0FA 1ZU4A 4U5FE 3VRCA 4MVZA 2IXNA 2AU5A 3RQFA 4BG0A 2HMQA 5KYUB 1T9KA 3S90A 3B9QA 1D0YA 1L3PA 4OIRF 5KYYA 2R7TA 3KH2A 2RD9A 5KYXA 3GM2A 2A69F 2J46A 3DE8A 2R7UA 2NUTB 2QNLA 5B3IA 2DYRC 4KNWA 3T6GB 1SF8A 4OINF 1BDJB 2XL4A 1K40A 4NC3A 3KPHA 4U5EE 2WVOA 2R9RB 2PNOA 3GEIA 4JW1A 4BPMA 4YT4A 2PBEA 3AG3C 5AC4A 3C63A 1FMVA 3M4BA 5JSLA 3K1HA 2VB6A 1M2OA 2HSQA 4JRZA 2Z15A 2ZXWC 4EBKA 3LAYA 1ZHXA 2R7OA 4M63A 256BA 1RKEB 5A6KA 1CPRA 1MMGA 2H7VC 4DJ9A 1T6QA 2YVKA 3MLGA 1Z63A 4YL1A 4O6YA 4CJGA 3PDMP 5T1DB 1VTMP 1WOLA 2NUTA 2NSFA 2R7RA 4I1MA 2GAQA 3AJMA 4JJGA 1V4AA 2DYSC 2HFIA 3EHMA 3FAPB 3GORA 4I44A 4PR9A 4XEVA 3NMIA 3W8IA 5DQTA 4HFFB 5L3QA 4Q5SF 1E84A 2ZXRA 1AVOB 3JSZA 1SMYF 1WASA 2YQYA 3HJCA 3UNGC 3X1OA 4MTGA 1VOMA 1OKKA 1YJGA 2J0XA 3EJNA 1JAFA 3FMSA 1V54C 2DGJA 1NBBA 2OJED 3DJUB 2A6EF 2MYSA 3EGXB 3QVZA 3QW1A 4LERA 4XEKA 1Z7Qc 3RKOF 3H65A 4AX2A 2YRFA 1YDIA 5F5FA 1A7EA 4JJFA 2CYDA 5KYNA 2R7WA 4C7OA 1Z5ZA 3I4UA 5DQZA 4BJ6A 2PF4E 4MVOA 4MVMA 3J06A 2KSFA 2HS5A 3ECSA 5L0JA 3HNIA 1HMDA 4O7GA 3A11A 3DWWA 4PJNA 1EA8A 3SP1A 3H2VA 3R2PA 4CS7A 5JVEA 2W4MA 1QZXA 3ZTMA 3L8JA 1V55C 3W8HA 3E9VA 4F4BA 1LKXA 2W9YA 2R05A 2H7OA 3ABLC 3HLZA 1MNDA 4N6CA 2EPLX 4XLNF 2W4BA 4CSAA 1YA7O 4MVRA 2XXAB 4WJ0A 3FAJA 1NLXA 1D1AA 1OCOC 2QUPA 1LS4A 3KMIA 3UMKA 4QI2A 4FAPB 1IZMA 2WZGA 2R03A 3MFNA 5KYWA 3ATPA 2A68F 2G3VA 5E3CA 2BL2A 4YK5A 5T3TA 4MW3A 4JEBA 4K7BA 4G7ZF 2R7SA 3DMDA 3HNKA 1LPEA 4XWJA 2P61A 5E3AA 5CI8A 2HJMA 3S27A 3F46A 4LACB 1ZHWA 3T6JA 3L34A 3DM9B 1YA9A 2WVQA 4XPWA 1MNEA 3L8IA 3JYHA 1TR2A 1TQGA 5E2QA 2LSEA 4P9FA 2NUPB 2NPUA 2OKUA 1UFBA 3G4XA 4PJMA 4XTKA 3U9MA 1YAUO 4AE4B 1RMVA 4Z9JA 4JCZA 4KC9A 3NG1A 3NKDA 4RDAA 1T6IA 1A0BA 2LCHA 2CCYA 2NUPA 2Y3HA 3EZHA 3I5PA 4W8PA 2R02A 4N4WA 3S9OA 3ZSUA 3DJNB 1TFOB 1NFNA 5B1BC 5JP7A 1RCPA 3NYLA 2KGOA 4RBNA 1QKRA 2J9UA 1YYXA 2UUHA 1TWGA 3AG2C 4I1OB 4JURI 3RIPA 3SYNA 3EQLF 3LEVA 2IM8A 1JMWA 3O55A 4CS8C 1I5NA 1FFHA 1PD0A 1TFKB 3ZC4A 2D5RB 3CEXA 1TWCA 3FVYA 3UMIA 3SNHA 3QVYA 3TJ6A 1KU2A 5K0IA 1FTSA 3QZCA 4ZLDA 2TMVP 1A7VA 1VLSA 2CGEA 3OWTA 1OKKD 4MVQA 2HZ8A 4BJ5C 1C02A 1LI5A 2C03A 2EILC 4PFPA 5JRAA 1GGQA 4P9TA 2Q9CA 4N06A 4BEJA 1E85A 3DZAA 3JCUQ 1M56C 3NYJA 1OCRC 2L81A 4YT8A 1TWHA 2HKVA 3EFOB 4CDVA 1ZYRF 3NMKA 4JCHA 2LP4A 3U0CA 5A6JA 4E7SA 5JT4A 2QY9A 1NU7D 1XZPA 2EIKC 3DAFA 4Z9IA 5HV9A 3UGOA 4E7ZA 1OR2A 4CJOA 1VYKA 5EK0A 1G4WR 3C18A 4IWBA 3H2UA 3ZTZA 4DXWA 4XQ1A 3S0XA 1MQVA 2C04A 5COMA 3MYIA 1CGME 4CDYA 2IXMA 3POVA 4XPXA 1M6TA 3NYMA 5KYWB 4LDRA 4IB4A 1O3UA 2XLOA 1L7CA 1Z3IX 3IEEA 4NQFA 3GEHA 1OCZC 2P7VA 5BQIA 3TULA 1Q0KA 4ANJA 5DVWA 3CSKA 2YL7A 4EKWA 3JT1A 1TKNA 3KYJA 3ZIBA 1D1BA 3WHNA 2ZXPA 4XPYA 5B1AC 4EWCA 4KNVA 2ZD9A 4NTAA 4EBBA 2E87A 4JKVA 5F28E 4MNDA 2VH3A 1ZVZA 3KYIA 2CNWA 3GWNA 3DKAA 3O10A 4G78A 4IAOA 2WZLA 4WGYA 3IQ6A 2F22A 2A1DD 3NKEA 4KI2A 4J7YA 2XLWA 2MWQA 2Q9BA 3C8GD 3O39A 4AK9A 3RYLA 3SZRA 2XS1A 3AG4C 1DOWA 1NFOA 4O6NA 4LDQA 4DRHB 4U5DE 3UR3C 4AL0A 3EGXA 1R4TA 3N24A 4E0IA 5A6BA 5EHHA 5COFA 3JTLO 1GQAA 3LEOA 3BEHA 5COGA 1HMOA 1NSGB 3LS0A 4PK4A 2XM4A 3GM1A 4PACA 2XLEA 2OJQA 4U9EA 1YZCA 1M2VA 3GEEA 2LFFA 4K1OA 5L0CA 4DBQA 2XXAA 2J7PD 5BQHA 3GM3A 3LNRA 2EPKX 4DRIB 5A6BD 4OIPF 2QE9A 4QI0A 4Z9HA 2A0BA 1VK5A 2PX0A 5T3WA 2V3CC 3RVZA 1HY5A 1RKCA 4P6IC 1ZW3A 4EBJA 3HKKA 4MTFA 2OEVA 2WL8A 4ER9A 1JOGA 3M79A 5F5HA 4E18A 4O79A 4ONSA 4ULWA 2GFHA 3TQOA 5D92A 3G4ZA 3TD7A 2OU6A 2G3KA 2EIMC 4G7HF 1Q0FA 3AQCA 1OXBA 2XLDA 5DLJA 2AP3A 2ASRA 3AOUA 1FNTc 2IOQA 1BZ4A 5B3SC 2Y3BA 1I4ZA 4YT2A 5AC5A 2A0UA 3WAQA 3T6BA 1WGWA 4CIHA 1ZU5A 3WG7C 4J30B 1EQ1A 5BQGA 2W45A 2XLVA 2GA0A 4QDLA 5BUOA 1LI7A 3IQ5A 4HFKB 3CZ6A 1U6HA 2YL1A 3C62A 1H9GA 1RJ9B 4IAQA 4NTFA 1FR0A 1Z6AA 1B68A 4DOZA 4U5BE 3FOPA 2ZXOA 4JEAA 4R32A 3IQTA 1O87A 4CS9C 1SYQA 2GWWA 4PJLA 1F1MA 4YL3A 4U5CE 3W4YA 1KTMA 3LJBA 1G5ZA 2XSEA 3C8GB 4U9DA 2M64A 1R5ID 1U89A 1ST6A 3T4RA 1ORSC 2L6GA 3A9CA 2QLAA 2Y69C 1OQCA 2FFHA 3B0PA 1HW1A 3I5QA 1VB5A 1YLMA 2Q00A 4Q7CA 4JTCB 2AVKA 1OCCC 3EH1A 3V5XA 3SXYA 1CGOA 1I4YA 2PFDA 1K05A 1J8YF 3EH2A 3MBGA 4MVUA 3SXZA 3X2QC 5DS5A 2VC9A 1VMAA 2MHRA 5D91A 3S84A 3C7JA 3ZWIA 1NU9C 4LDKA 2HV6A 3Q6NA 2FAPB 2HMZA 3VF0A 3HNJA 2IXPA 2XLHA 4U5GA 3RQGA 2XLMA 4BJ6C 4DRJB 5HSWA 1BBHA 3IPMO 4N6HA 4J7TA 1GS9A 1D0XA 5L0HA 2LD6A 2P1AA 5GPGB 3WODF 2LFDA 2NG1A 2J45A 3U2MA 1RJ9A 4NTBA 4XLPF 1Q0GA 1U0BB 4FESA 3ZVRA 3NRHA 1T6UA 2AWYA 2I8BA 3Q6MA 4NCQA 4ULVA 3ZDLA 3JRMO 4AL1A 5JUAA 1O5HA 1WATA 5AGFA 5DS6A 2H7BA 1WTYA 3FDQA 4YJWA 1MMDA 4FX5A 1TWAA 4JE9A 1K04A 3W2WA 2J9BA 3RF3A 2KJGA 4BJ5A 4CIPA 3UGPA 5A69A 1WN0A 3RFYA 2OG2A 2YEVA 5L0GA 2KYHA 3M1CB 1LE4A 1JRAA 3EG9A 3U9JA 2NSGA 1Y6DA 2EPNA 3U8VA 2X51A 3V7OA 1YZAA 2FGYA 2Q9AA 3EZIA 4EIYA 1Q0MA 4MQ9F 2Q7RA 2R7VA 3E70C 1YVIA 3OEOA 1PD1A 3LESA 2V26A 3Q7GA 1APCA 3K66A 5L0IA 3U3BA 2WVNA 1Q0DA 2B0JA 2P6VA 3EPVA 3QMKA 4MTOA 3S28A 1M57C 2YL3A 4C3BA 3B0UX 1ORJA 3FHDA 4H4KC 1M2VB 2Q4FA 1FAPB 3JSEO 1C17M 2R25A 3MYFA 4YT5A 4B6IA 2XRHA 2A6HF 4AE4A 3N0TA 4OD5A 3RVYA 3HTKC 3GANA 1SR2A 2BE5F 2IYLD 4EHPA 3SEOA 1CGNA 1H7IA 1QVXA 2I15A 2J8WA 3ASOC 3LS1A 1V74B 4CX9A 1UG7A 4MVSA 3V5YA 4UDVA 3K6BA 2YWAA 4KBLA 1ZZPA 2X0CA 4JC7A 4GEHA 1HE1A 4G7OF
chains in the Genus database with same CATH topology
3H2VA 4ONSA 1DOVA 2IBFA 3MYIA 1SYQA 1TR2A 2GWWA 5L0IA 1DOWA 3T6GB 4IGGA 4P9TA 1U89A 1ST6A 1L7CA 1RKEA 4E18A 3ZDLA 1XWJA 2GDCA 2L7AA 4E17A 1T01A 2HSQA 4W8PA 5FZTA 5L0CA 1YDIA 4K1OA 1RKEB 3RF3A 3TJ5A 1QKRA 4DJ9A 1ZW2A 3VF0A 5L0GA 2B0HA 4EHPA 5L0FA 1ZVZA 1RKCA 1U6HA 1ZW3A 2LQGA 2X0CA 5L0HA 5L0JA 4PR9A 3H2UA 3TJ6A 3S90A 1H6GA 5L0DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H2V A;  4ONS A;  1DOV A;  2IBF A;  3MYI A;  1SYQ A;  1TR2 A;  2GWW A;  5L0I A;  1DOW A;  3T6G B;  4IGG A;  4P9T A;  1U89 A;  1ST6 A;  1L7C A;  1RKE A;  4E18 A;  3ZDL A;  1XWJ A;  2GDC A;  2L7A A;  4E17 A;  1T01 A;  2HSQ A;  4W8P A;  5FZT A;  5L0C A;  1YDI A;  4K1O A;  1RKE B;  3RF3 A;  3TJ5 A;  1QKR A;  4DJ9 A;  1ZW2 A;  3VF0 A;  5L0G A;  2B0H A;  4EHP A;  5L0F A;  1ZVZ A;  1RKC A;  1U6H A;  1ZW3 A;  2LQG A;  2X0C A;  5L0H A;  5L0J A;  4PR9 A;  3H2U A;  3TJ6 A;  3S90 A;  1H6G A;  5L0D A; 
#chains in the Genus database with same CATH topology
 1ORY A;  1LS1 A;  4D4X A;  2H8A A;  2IBF A;  2XM0 A;  4OD4 A;  3VM6 A;  1E2X A;  1QPU A;  2KK1 A;  2OQM A;  2D4U A;  2VCC A;  4C3E A;  1XZQ A;  2LK4 A;  1C03 A;  3KL4 A;  4IJJ A;  3TOL A;  1QSP A;  4CSA C;  3OA1 A;  1KNY A;  4CS9 A;  4Q4Z F;  3RH3 A;  4GYT A;  3SXM A;  4H54 A;  1FMW A;  1VYI A;  2LIG A;  1YYJ A;  1A41 A;  3B71 A;  3B29 A;  3TJ5 A;  4DVY P;  1OW8 A;  3LNM B;  2J0W A;  4HE8 D;  2J7P A;  1LVK A;  2UUI A;  2Y3D A;  3LUT B;  1PCX A;  3JYY A;  3F47 A;  5CIV A;  3ITF A;  3DM5 A;  1CPQ A;  4HEA J;  4PFO A;  5L3V A;  1BR2 A;  4X0R A;  1FFT C;  4YN0 B;  1E83 A;  1QQ3 A;  3DAG A;  4A4A A;  3U5S A;  5A6A A;  3FXH A;  3AGU A;  4I3M A;  3US6 A;  2YLD A;  2Q3T A;  1EI7 A;  3UMH A;  3U2L A;  4W8K A;  3KKB A;  1WWP A;  3C8Z A;  1NZE A;  3K7D A;  1Y4C A;  5DS4 A;  1S05 A;  4C3D A;  2KW3 C;  3K1I A;  2JX0 A;  5TJ5 E;  3PMR A;  3M4C A;  2YZS A;  4E17 A;  1HE9 A;  3Q7L A;  4WGZ A;  1AEP A;  5FZT A;  4JIO A;  1T5O A;  4DBR A;  3U3F A;  2VAS A;  3RQE A;  1ZW2 A;  2YLG A;  2DI3 A;  4RD9 A;  1G8X A;  3EGD B;  2B0H A;  4LLE A;  4LLC A;  3O6X A;  1A7D A;  2YHS A;  1ZHY A;  2J9V A;  2R7Q A;  4MS2 A;  2DB4 A;  3L1M A;  3LLI A;  4CS8 A;  1LM3 B;  4C7O B;  2J9W A;  1BR1 A;  1MMN A;  2ICW G;  3ABK C;  3N2Z B;  4JTA B;  1MMA A;  5L0D A;  3EGD A;  4CBE A;  3SXK A;  3K33 A;  3BRJ A;  4JVS A;  1ZHT A;  4BEM J;  1SZI A;  1PV3 A;  1D1C A;  3G50 A;  1IW7 F;  2G62 A;  3EFO A;  4D4N A;  1OXK A;  1RKE A;  4EUK B;  1OR3 A;  4YL0 A;  1XWJ A;  3DI5 A;  3QW0 A;  4L6R A;  3MX3 A;  5JS5 A;  2L6H A;  2AWC A;  4XEF A;  2HV7 A;  1VLT A;  2XL8 A;  4DVZ A;  1OW6 A;  4IRU A;  2EPM X;  5IY5 C;  1EKY A;  5FCL A;  3L0I A;  5KYX B;  4BJ1 A;  2JPU A;  3ZG1 A;  2WB7 A;  1ZHZ A;  2LQG A;  2OCC C;  3U8P A;  2PX3 A;  2HSB A;  1NG1 A;  1G4U S;  1H6G A;  3ASN C;  3JRT A;  3AQB A;  3M15 A;  4G0H A;  3R7C A;  2CNW D;  1JPJ A;  3FOO A;  2XS8 A;  2O9X A;  3K1I C;  3S29 A;  4A2N B;  1GM5 A;  4CDA A;  2PP4 A;  4IGG A;  3ZQY A;  4E0H A;  3CQZ A;  2HJ3 A;  2YKZ A;  1JR8 A;  2GDC A;  2JD3 A;  2QTV A;  2VCA A;  1QLE C;  3HNL A;  3CAX A;  3GWL A;  3NMJ A;  3QTH A;  1Z23 A;  3LLK A;  1T01 A;  1S7Z A;  4JTD B;  5E33 A;  3ZQV A;  1H9T A;  1LIH A;  1OW7 A;  1RXQ A;  2RSE B;  1E86 A;  3VYW A;  3GOD A;  5JLI A;  3EG9 B;  2Y39 A;  4K0D A;  1J8M F;  5KYU A;  3PHF 2;  1D0Z A;  2XL6 A;  3B0V C;  4NY3 A;  1AUE A;  2BC5 A;  4ZLC A;  2L9J A;  4GQH A;  2P0N A;  4BJT A;  4JZA A;  3W2V A;  4J32 B;  3NDB B;  4FWV A;  1N1C A;  3IQC A;  1LE2 A;  1JPN A;  4O6M A;  1DOV A;  3V5Z A;  1W2W A;  2KC3 A;  2ZPA A;  4PJJ A;  3JZ0 A;  4OIO F;  5CI9 A;  2Y3G A;  3EHN A;  3VAY A;  3IHU A;  5EGY A;  1BR4 A;  2CDQ A;  3ABM C;  3T9O A;  2ETS A;  2EPO A;  2HUJ A;  2IXO A;  4IAR A;  2EIN C;  2M4E A;  2YLI A;  4MW8 A;  2L7A A;  3AGT A;  3AG1 C;  3C8G A;  3TK0 A;  2OEX A;  2KNH A;  2R7X A;  4U5H A;  3DD7 A;  2KQ9 A;  3PCV A;  2WZF A;  2YL0 A;  3DE9 A;  1YAR O;  2OOC A;  2EIJ C;  4YWQ A;  3DXJ F;  4WAB A;  2VCB A;  3RW0 A;  4OIQ F;  1HW2 A;  5KYY B;  2L6F A;  3TOM A;  2CW0 F;  5L0F A;  1ZU4 A;  4U5F E;  3VRC A;  4MVZ A;  2IXN A;  2AU5 A;  3RQF A;  4BG0 A;  2HMQ A;  5KYU B;  1T9K A;  3S90 A;  3B9Q A;  1D0Y A;  1L3P A;  4OIR F;  5KYY A;  2R7T A;  3KH2 A;  2RD9 A;  5KYX A;  3GM2 A;  2A69 F;  2J46 A;  3DE8 A;  2R7U A;  2NUT B;  2QNL A;  5B3I A;  2DYR C;  4KNW A;  3T6G B;  1SF8 A;  4OIN F;  1BDJ B;  2XL4 A;  1K40 A;  4NC3 A;  3KPH A;  4U5E E;  2WVO A;  2R9R B;  2PNO A;  3GEI A;  4JW1 A;  4BPM A;  4YT4 A;  2PBE A;  3AG3 C;  5AC4 A;  3C63 A;  1FMV A;  3M4B A;  5JSL A;  3K1H A;  2VB6 A;  1M2O A;  2HSQ A;  4JRZ A;  2Z15 A;  2ZXW C;  4EBK A;  3LAY A;  1ZHX A;  2R7O A;  4M63 A;  256B A;  1RKE B;  5A6K A;  1CPR A;  1MMG A;  2H7V C;  4DJ9 A;  1T6Q A;  2YVK A;  3MLG A;  1Z63 A;  4YL1 A;  4O6Y A;  4CJG A;  3PDM P;  5T1D B;  1VTM P;  1WOL A;  2NUT A;  2NSF A;  2R7R A;  4I1M A;  2GAQ A;  3AJM A;  4JJG A;  1V4A A;  2DYS C;  2HFI A;  3EHM A;  3FAP B;  3GOR A;  4I44 A;  4PR9 A;  4XEV A;  3NMI A;  3W8I A;  5DQT A;  4HFF B;  5L3Q A;  4Q5S F;  1E84 A;  2ZXR A;  1AVO B;  3JSZ A;  1SMY F;  1WAS A;  2YQY A;  3HJC A;  3UNG C;  3X1O A;  4MTG A;  1VOM A;  1OKK A;  1YJG A;  2J0X A;  3EJN A;  1JAF A;  3FMS A;  1V54 C;  2DGJ A;  1NBB A;  2OJE D;  3DJU B;  2A6E F;  2MYS A;  3EGX B;  3QVZ A;  3QW1 A;  4LER A;  4XEK A;  1Z7Q c;  3RKO F;  3H65 A;  4AX2 A;  2YRF A;  1YDI A;  5F5F A;  1A7E A;  4JJF A;  2CYD A;  5KYN A;  2R7W A;  4C7O A;  1Z5Z A;  3I4U A;  5DQZ A;  4BJ6 A;  2PF4 E;  4MVO A;  4MVM A;  3J06 A;  2KSF A;  2HS5 A;  3ECS A;  5L0J A;  3HNI A;  1HMD A;  4O7G A;  3A11 A;  3DWW A;  4PJN A;  1EA8 A;  3SP1 A;  3H2V A;  3R2P A;  4CS7 A;  5JVE A;  2W4M A;  1QZX A;  3ZTM A;  3L8J A;  1V55 C;  3W8H A;  3E9V A;  4F4B A;  1LKX A;  2W9Y A;  2R05 A;  2H7O A;  3ABL C;  3HLZ A;  1MND A;  4N6C A;  2EPL X;  4XLN F;  2W4B A;  4CSA A;  1YA7 O;  4MVR A;  2XXA B;  4WJ0 A;  3FAJ A;  1NLX A;  1D1A A;  1OCO C;  2QUP A;  1LS4 A;  3KMI A;  3UMK A;  4QI2 A;  4FAP B;  1IZM A;  2WZG A;  2R03 A;  3MFN A;  5KYW A;  3ATP A;  2A68 F;  2G3V A;  5E3C A;  2BL2 A;  4YK5 A;  5T3T A;  4MW3 A;  4JEB A;  4K7B A;  4G7Z F;  2R7S A;  3DMD A;  3HNK A;  1LPE A;  4XWJ A;  2P61 A;  5E3A A;  5CI8 A;  2HJM A;  3S27 A;  3F46 A;  4LAC B;  1ZHW A;  3T6J A;  3L34 A;  3DM9 B;  1YA9 A;  2WVQ A;  4XPW A;  1MNE A;  3L8I A;  3JYH A;  1TR2 A;  1TQG A;  5E2Q A;  2LSE A;  4P9F A;  2NUP B;  2NPU A;  2OKU A;  1UFB A;  3G4X A;  4PJM A;  4XTK A;  3U9M A;  1YAU O;  4AE4 B;  1RMV A;  4Z9J A;  4JCZ A;  4KC9 A;  3NG1 A;  3NKD A;  4RDA A;  1T6I A;  1A0B A;  2LCH A;  2CCY A;  2NUP A;  2Y3H A;  3EZH A;  3I5P A;  4W8P A;  2R02 A;  4N4W A;  3S9O A;  3ZSU A;  3DJN B;  1TFO B;  1NFN A;  5B1B C;  5JP7 A;  1RCP A;  3NYL A;  2KGO A;  4RBN A;  1QKR A;  2J9U A;  1YYX A;  2UUH A;  1TWG A;  3AG2 C;  4I1O B;  4JUR I;  3RIP A;  3SYN A;  3EQL F;  3LEV A;  2IM8 A;  1JMW A;  3O55 A;  4CS8 C;  1I5N A;  1FFH A;  1PD0 A;  1TFK B;  3ZC4 A;  2D5R B;  3CEX A;  1TWC A;  3FVY A;  3UMI A;  3SNH A;  3QVY A;  3TJ6 A;  1KU2 A;  5K0I A;  1FTS A;  3QZC A;  4ZLD A;  2TMV P;  1A7V A;  1VLS A;  2CGE A;  3OWT A;  1OKK D;  4MVQ A;  2HZ8 A;  4BJ5 C;  1C02 A;  1LI5 A;  2C03 A;  2EIL C;  4PFP A;  5JRA A;  1GGQ A;  4P9T A;  2Q9C A;  4N06 A;  4BEJ A;  1E85 A;  3DZA A;  3JCU Q;  1M56 C;  3NYJ A;  1OCR C;  2L81 A;  4YT8 A;  1TWH A;  2HKV A;  3EFO B;  4CDV A;  1ZYR F;  3NMK A;  4JCH A;  2LP4 A;  3U0C A;  5A6J A;  4E7S A;  5JT4 A;  2QY9 A;  1NU7 D;  1XZP A;  2EIK C;  3DAF A;  4Z9I A;  5HV9 A;  3UGO A;  4E7Z A;  1OR2 A;  4CJO A;  1VYK A;  5EK0 A;  1G4W R;  3C18 A;  4IWB A;  3H2U A;  3ZTZ A;  4DXW A;  4XQ1 A;  3S0X A;  1MQV A;  2C04 A;  5COM A;  3MYI A;  1CGM E;  4CDY A;  2IXM A;  3POV A;  4XPX A;  1M6T A;  3NYM A;  5KYW B;  4LDR A;  4IB4 A;  1O3U A;  2XLO A;  1L7C A;  1Z3I X;  3IEE A;  4NQF A;  3GEH A;  1OCZ C;  2P7V A;  5BQI A;  3TUL A;  1Q0K A;  4ANJ A;  5DVW A;  3CSK A;  2YL7 A;  4EKW A;  3JT1 A;  1TKN A;  3KYJ A;  3ZIB A;  1D1B A;  3WHN A;  2ZXP A;  4XPY A;  5B1A C;  4EWC A;  4KNV A;  2ZD9 A;  4NTA A;  4EBB A;  2E87 A;  4JKV A;  5F28 E;  4MND A;  2VH3 A;  1ZVZ A;  3KYI A;  2CNW A;  3GWN A;  3DKA A;  3O10 A;  4G78 A;  4IAO A;  2WZL A;  4WGY A;  3IQ6 A;  2F22 A;  2A1D D;  3NKE A;  4KI2 A;  4J7Y A;  2XLW A;  2MWQ A;  2Q9B A;  3C8G D;  3O39 A;  4AK9 A;  3RYL A;  3SZR A;  2XS1 A;  3AG4 C;  1DOW A;  1NFO A;  4O6N A;  4LDQ A;  4DRH B;  4U5D E;  3UR3 C;  4AL0 A;  3EGX A;  1R4T A;  3N24 A;  4E0I A;  5A6B A;  5EHH A;  5COF A;  3JTL O;  1GQA A;  3LEO A;  3BEH A;  5COG A;  1HMO A;  1NSG B;  3LS0 A;  4PK4 A;  2XM4 A;  3GM1 A;  4PAC A;  2XLE A;  2OJQ A;  4U9E A;  1YZC A;  1M2V A;  3GEE A;  2LFF A;  4K1O A;  5L0C A;  4DBQ A;  2XXA A;  2J7P D;  5BQH A;  3GM3 A;  3LNR A;  2EPK X;  4DRI B;  5A6B D;  4OIP F;  2QE9 A;  4QI0 A;  4Z9H A;  2A0B A;  1VK5 A;  2PX0 A;  5T3W A;  2V3C C;  3RVZ A;  1HY5 A;  1RKC A;  4P6I C;  1ZW3 A;  4EBJ A;  3HKK A;  4MTF A;  2OEV A;  2WL8 A;  4ER9 A;  1JOG A;  3M79 A;  5F5H A;  4E18 A;  4O79 A;  4ONS A;  4ULW A;  2GFH A;  3TQO A;  5D92 A;  3G4Z A;  3TD7 A;  2OU6 A;  2G3K A;  2EIM C;  4G7H F;  1Q0F A;  3AQC A;  1OXB A;  2XLD A;  5DLJ A;  2AP3 A;  2ASR A;  3AOU A;  1FNT c;  2IOQ A;  1BZ4 A;  5B3S C;  2Y3B A;  1I4Z A;  4YT2 A;  5AC5 A;  2A0U A;  3WAQ A;  3T6B A;  1WGW A;  4CIH A;  1ZU5 A;  3WG7 C;  4J30 B;  1EQ1 A;  5BQG A;  2W45 A;  2XLV A;  2GA0 A;  4QDL A;  5BUO A;  1LI7 A;  3IQ5 A;  4HFK B;  3CZ6 A;  1U6H A;  2YL1 A;  3C62 A;  1H9G A;  1RJ9 B;  4IAQ A;  4NTF A;  1FR0 A;  1Z6A A;  1B68 A;  4DOZ A;  4U5B E;  3FOP A;  2ZXO A;  4JEA A;  4R32 A;  3IQT A;  1O87 A;  4CS9 C;  1SYQ A;  2GWW A;  4PJL A;  1F1M A;  4YL3 A;  4U5C E;  3W4Y A;  1KTM A;  3LJB A;  1G5Z A;  2XSE A;  3C8G B;  4U9D A;  2M64 A;  1R5I D;  1U89 A;  1ST6 A;  3T4R A;  1ORS C;  2L6G A;  3A9C A;  2QLA A;  2Y69 C;  1OQC A;  2FFH A;  3B0P A;  1HW1 A;  3I5Q A;  1VB5 A;  1YLM A;  2Q00 A;  4Q7C A;  4JTC B;  2AVK A;  1OCC C;  3EH1 A;  3V5X A;  3SXY A;  1CGO A;  1I4Y A;  2PFD A;  1K05 A;  1J8Y F;  3EH2 A;  3MBG A;  4MVU A;  3SXZ A;  3X2Q C;  5DS5 A;  2VC9 A;  1VMA A;  2MHR A;  5D91 A;  3S84 A;  3C7J A;  3ZWI A;  1NU9 C;  4LDK A;  2HV6 A;  3Q6N A;  2FAP B;  2HMZ A;  3VF0 A;  3HNJ A;  2IXP A;  2XLH A;  4U5G A;  3RQG A;  2XLM A;  4BJ6 C;  4DRJ B;  5HSW A;  1BBH A;  3IPM O;  4N6H A;  4J7T A;  1GS9 A;  1D0X A;  5L0H A;  2LD6 A;  2P1A A;  5GPG B;  3WOD F;  2LFD A;  2NG1 A;  2J45 A;  3U2M A;  1RJ9 A;  4NTB A;  4XLP F;  1Q0G A;  1U0B B;  4FES A;  3ZVR A;  3NRH A;  1T6U A;  2AWY A;  2I8B A;  3Q6M A;  4NCQ A;  4ULV A;  3ZDL A;  3JRM O;  4AL1 A;  5JUA A;  1O5H A;  1WAT A;  5AGF A;  5DS6 A;  2H7B A;  1WTY A;  3FDQ A;  4YJW A;  1MMD A;  4FX5 A;  1TWA A;  4JE9 A;  1K04 A;  3W2W A;  2J9B A;  3RF3 A;  2KJG A;  4BJ5 A;  4CIP A;  3UGP A;  5A69 A;  1WN0 A;  3RFY A;  2OG2 A;  2YEV A;  5L0G A;  2KYH A;  3M1C B;  1LE4 A;  1JRA A;  3EG9 A;  3U9J A;  2NSG A;  1Y6D A;  2EPN A;  3U8V A;  2X51 A;  3V7O A;  1YZA A;  2FGY A;  2Q9A A;  3EZI A;  4EIY A;  1Q0M A;  4MQ9 F;  2Q7R A;  2R7V A;  3E70 C;  1YVI A;  3OEO A;  1PD1 A;  3LES A;  2V26 A;  3Q7G A;  1APC A;  3K66 A;  5L0I A;  3U3B A;  2WVN A;  1Q0D A;  2B0J A;  2P6V A;  3EPV A;  3QMK A;  4MTO A;  3S28 A;  1M57 C;  2YL3 A;  4C3B A;  3B0U X;  1ORJ A;  3FHD A;  4H4K C;  1M2V B;  2Q4F A;  1FAP B;  3JSE O;  1C17 M;  2R25 A;  3MYF A;  4YT5 A;  4B6I A;  2XRH A;  2A6H F;  4AE4 A;  3N0T A;  4OD5 A;  3RVY A;  3HTK C;  3GAN A;  1SR2 A;  2BE5 F;  2IYL D;  4EHP A;  3SEO A;  1CGN A;  1H7I A;  1QVX A;  2I15 A;  2J8W A;  3ASO C;  3LS1 A;  1V74 B;  4CX9 A;  1UG7 A;  4MVS A;  3V5Y A;  4UDV A;  3K6B A;  2YWA A;  4KBL A;  1ZZP A;  2X0C A;  4JC7 A;  4GEH A;  1HE1 A;  4G7O F; 
#chains in the Genus database with same CATH homology
 3H2V A;  4ONS A;  1DOV A;  2IBF A;  3MYI A;  1SYQ A;  1TR2 A;  2GWW A;  5L0I A;  1DOW A;  3T6G B;  4IGG A;  4P9T A;  1U89 A;  1ST6 A;  1L7C A;  1RKE A;  4E18 A;  3ZDL A;  1XWJ A;  2GDC A;  2L7A A;  4E17 A;  1T01 A;  2HSQ A;  4W8P A;  5FZT A;  5L0C A;  1YDI A;  4K1O A;  1RKE B;  3RF3 A;  3TJ5 A;  1QKR A;  4DJ9 A;  1ZW2 A;  3VF0 A;  5L0G A;  2B0H A;  4EHP A;  5L0F A;  1ZVZ A;  1RKC A;  1U6H A;  1ZW3 A;  2LQG A;  2X0C A;  5L0H A;  5L0J A;  4PR9 A;  3H2U A;  3TJ6 A;  3S90 A;  1H6G A;  5L0D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...