1RKEA

Human vinculin head (1-258) in complex with human vinculin tail (879-1066)
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
262
structure length
262
Chain Sequence
b'HHHHMPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinculin
publication title Vinculin activation by talin through helical bundle conversion
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion, structural protein
total genus 110
structure length 262
sequence length 262
ec nomenclature
pdb deposition date 2003-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1rkeA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1rkeA01
1TR2A 5L0JA 4W8PA 4DJ9A 5L0IA 4K1OA 1ST6A 2LQGA 5L0HA 1QKRA 4ONSA 5FZTA 5L0GA 3H2VA 3TJ5A 3ZDLA 1DOVA 4PR9A 1ZW2A 1T01A 1RKCA 1ZW3A 2GDCA 4IGGA 2B0HA 1L7CA 4E17A 1H6GA 2GWWA 2HSQA 3MYIA 5L0FA 3T6GB 1DOWA 1RKEB 1U89A 1XWJA 1U6HA 1YDIA 2X0CA 4E18A 5L0DA 3RF3A 4EHPA 2IBFA 3TJ6A 5L0CA 3S90A 2L7AA 3VF0A 4P9TA 1SYQA 3H2UA 1RKEA 1ZVZA
chains in the Genus database with same CATH superfamily
1D1AA 3F46A 5JVEA 2LIGA 1VOMA 1ORYA 2OOCA 2Q00A 2YHSA 4MNDA 2W9YA 4XQ1A 1QKRA 1O5HA 1H7IA 3H2VA 3ITFA 2MYSA 2AWCA 2XXAB 3O6XA 2A68F 4GYTA 3K1IC 1O3UA 3KH2A 4IGGA 2W4MA 2YZSA 2ZXOA 5TJ5E 2DYSC 4O6MA 5DVWA 2FFHA 1KNYA 4ANJA 3B0UX 4HE8D 1SMYF 1VB5A 3L8IA 1Z3IX 2OU6A 3T6GB 1W2WA 2LSEA 4MVZA 1LE4A 1D1CA 3QTHA 3MYFA 4E0IA 4G0HA 4YT5A 3DZAA 2M4EA 3HTKC 3TQOA 1V54C 2R7SA 5T3TA 1OW6A 1Z5ZA 3ZTZA 4NQFA 2GAQA 2ZPAA 3JRMO 1MMAA 5D92A 1A7VA 2AVKA 2XM0A 4JKVA 2VCBA 4U5HA 1SZIA 3ZSUA 3GORA 2Q7RA 1UFBA 3GM1A 3AQCA 3IQ5A 1MMNA 1Z23A 1MMGA 3UGOA 4BJ6C 4ULVA 4MVOA 4WJ0A 2NUPA 1JPJA 2Y3GA 4KNWA 3V5YA 4N6CA 4U9DA 3L1MA 5L3QA 1WASA 4RDAA 3RQFA 1M2OA 4YL0A 5A6BA 1V55C 2ZXRA 2HFIA 2IXNA 1D0YA 3B29A 1FMVA 2HJMA 2LP4A 3EGDA 5AC5A 4DXWA 2X0CA 3T6JA 2J7PD 2P0NA 1A0BA 2OEXA 5T3WA 4MVSA 3FAPB 2HJ3A 4K7BA 4PJJA 4JJFA 4BJ1A 4P9TA 3QMKA 2ICWG 2A6HF 3E9VA 3RH3A 2ASRA 2R7OA 3DE8A 3FXHA 4EWCA 1ZVZA 1CGOA 1T9KA 2FGYA 3W8IA 2ZXPA 2CGEA 3KYIA 3Q6NA 4CX9A 1QPUA 3S9OA 4YWQA 4AK9A 4U5BE 1Q0DA 5JSLA 1SF8A 1Y4CA 1YZAA 1LVKA 3JSZA 4R32A 3V7OA 1HMOA 1O87A 2XS8A 3I5PA 5FZTA 2WVNA 4BPMA 2YL1A 3W4YA 4CS8A 3AG1C 5B3IA 2G3VA 2CNWD 3L8JA 5JLIA 3SNHA 1OCOC 3LS0A 1H6GA 4LERA 4U5CE 1LPEA 1A7DA 2VC9A 1TWAA 4G78A 4EUKB 2PFDA 3AJMA 2YWAA 2MWQA 4EBBA 1Y6DA 2B0JA 1UG7A 5GPGB 1FNTc 3Q7LA 3MX3A 3EPVA 2WVOA 3C8GD 3GWNA 4NTBA 3DJNB 4DRJB 2AWYA 2RSEB 1M2VA 1MMDA 1VLSA 3PMRA 1T5OA 2UUHA 5A6BD 2J0WA 3GEEA 3S0XA 5E2QA 1JOGA 4H4KC 4DJ9A 3EZIA 3SYNA 3VAYA 5F28E 4CS8C 5L0IA 2R7UA 1NSGB 4JW1A 5DQTA 1QZXA 1RMVA 3ZG1A 3EGXB 1LE2A 4JIOA 4J7YA 3DMDA 2M64A 3T6BA 4PK4A 5FCLA 5KYNA 1RKCA 1ZW3A 3JCUQ 2L6GA 1NBBA 1YYXA 1J8MF 2WB7A 3QW0A 2EPLX 3B71A 4WGYA 2YLIA 3WODF 3UR3C 1YA9A 4M63A 1OW7A 3MLGA 1Z6AA 1ZHYA 4IWBA 2C04A 4AL1A 5KYUB 2JD3A 1K04A 4O79A 2XLMA 2TMVP 2H7OA 3LNMB 1M56C 5KYXB 3EHMA 1SR2A 3IHUA 3NKDA 4MVUA 1LI5A 4GEHA 4Z9JA 2EIJC 1YARO 2HSBA 4ZLCA 5L0JA 1H9TA 5A6KA 2J0XA 1D1BA 3EG9B 1LI7A 3EH1A 4I3MA 4K1OA 4LLCA 4PFOA 3UNGC 4AL0A 3LNRA 2O9XA 3TJ5A 4MTFA 3VYWA 1T01A 3UMKA 3FDQA 1LS4A 3ABMC 3HNLA 2CCYA 3RW0A 2CDQA 1NU7D 2LK4A 5L0FA 3JSEO 3JYHA 3U3BA 2I8BA 3K1IA 3SXYA 3X2QC 3S84A 2KSFA 4ZLDA 3NYJA 2XRHA 3RQEA 3JT1A 4HFFB 1TFKB 3TJ6A 4XEVA 3T4RA 3SEOA 1I5NA 2IYLD 2P6VA 2HMZA 3AQBA 1WN0A 3HJCA 4PFPA 1RJ9B 5E3CA 3LS1A 4IARA 4GQHA 3GANA 1NG1A 2EPMX 3FOPA 2J45A 3LEVA 3Q6MA 4W8PA 5DS4A 2KJGA 2R7QA 2IXOA 3GM2A 4BG0A 1ZZPA 1KU2A 4XPYA 1JRAA 4ER9A 4JVSA 4G7OF 2EPNA 5CI8A 1TQGA 1T6UA 2P7VA 4QI2A 3PDMP 4CSAA 3J06A 3W8HA 2VH3A 2XL8A 2XM4A 5DS6A 4XLNF 3WAQA 5DS5A 2WL8A 2Q9CA 3S29A 4BJ6A 2WZFA 3TULA 4LDRA 1DOWA 3CAXA 1I4ZA 1OR2A 1ZU5A 3C18A 2HV7A 4I44A 3M4BA 4CJOA 4NTAA 3UGPA 2ZD9A 1FFTC 2KYHA 4FAPB 1WWPA 2DB4A 4H54A 2NUTB 1TR2A 1QVXA 2GA0A 2Q4FA 3C8GB 2YLGA 4U5GA 1N1CA 2OKUA 3IQCA 4K0DA 3IEEA 3BEHA 3CSKA 5BQIA 3OEOA 4Z9IA 4CSAC 1YYJA 1WGWA 3IQTA 4NC3A 4I1MA 3RQGA 3ZTMA 1CPQA 1ZHTA 4WGZA 3W2VA 1VMAA 1I4YA 4N4WA 3T9OA 4CS7A 4HEAJ 2XL4A 3RVZA 3N0TA 5HV9A 3DXJF 3LAYA 3WG7C 2XSEA 3NG1A 2HSQA 3MYIA 3UMHA 2XXAA 3GODA 1YAUO 3HNKA 3S27A 3POVA 2PBEA 4ULWA 3RF3A 2KGOA 1GGQA 2IBFA 5COMA 3KPHA 1APCA 1PV3A 2QY9A 3K33A 3IPMO 4FWVA 3ASNC 3M79A 4YT8A 1AEPA 1SYQA 3LUTB 3WHNA 3FHDA 3RFYA 4IAQA 4C3DA 3DKAA 2L81A 2J46A 4JTCB 1HMDA 3K66A 1FFHA 1A41A 4DVYP 2IXMA 2OJQA 2PNOA 2PX3A 2V26A 2WZGA 3QVZA 4B6IA 2KC3A 5L0HA 5BUOA 1FMWA 2EINC 3DD7A 3ZDLA 4IAOA 3NMJA 2R7TA 1NLXA 4JJGA 1YJGA 2B0HA 2QE9A 1LIHA 2J9BA 2Q9AA 1WATA 3DAFA 4O7GA 5T1DB 3DAGA 3NKEA 4YK5A 2Y3BA 2XLOA 2MHRA 2LCHA 3HNIA 1HW2A 5BQHA 4XTKA 1GM5A 1AUEA 1HE1A 5CIVA 2OG2A 1R5ID 2H8AA 3O39A 3H2UA 3I4UA 1MNEA 4J7TA 1RKEA 4N6HA 4OD4A 2CW0F 3QW1A 4AE4B 4DVZA 4OIQF 3U8VA 2NPUA 3TK0A 5A6JA 4JRZA 3V5ZA 1TWHA 2HKVA 4JTDB 4EBKA 2YQYA 2QNLA 2LQGA 4ONSA 2R7VA 3AGTA 3EH2A 3R2PA 1NFOA 2OJED 4IRUA 1ZHZA 4PR9A 4E0HA 4MQ9F 2GDCA 3M15A 4NY3A 3M1CB 1EA8A 2R25A 1ZHXA 4C3EA 4J30B 4YT4A 3G4XA 3K6BA 2J9VA 5EK0A 4O6NA 4O6YA 2L6FA 4DBQA 2P61A 3KMIA 1QSPA 2ZXWC 4PJLA 4XWJA 4CBEA 3BRJA 1CPRA 2A0BA 5AGFA 4C7OB 4U5FE 2YVKA 4OIOF 1FR0A 4A4AA 4JCHA 2KNHA 1YLMA 4X0RA 1U0BB 2LFFA 5B3SC 2L9JA 1NU9C 1F1MA 3A9CA 2F22A 1OR3A 1ST6A 1LKXA 1OXKA 1ZU4A 2EIKC 2VASA 1JR8A 3DI5A 1TFOB 5L0GA 5A6AA 2QUPA 3SXKA 4OINF 5JUAA 1EKYA 1BR1A 1ZW2A 5KYYB 2A1DD 2L6HA 1PD1A 3TOLA 4CJGA 5COFA 1J8YF 3VM6A 1QQ3A 3ECSA 3U8PA 1RXQA 2GFHA 3AG3C 3EGXA 4LLEA 2KW3C 2OEVA 3Q7GA 1YDIA 1E84A 1U6HA 2P1AA 3DE9A 5KYWB 1EI7A 3E70C 4DRHB 4LDKA 2L7AA 3ABLC 2JX0A 3CEXA 1Q0GA 1V4AA 1E86A 2EILC 1L7CA 5KYUA 2I15A 2H7BA 2C03A 1VK5A 2J9UA 2J9WA 2A69F 3GEHA 5IY5C 1LS1A 4JEBA 5KYXA 1LM3B 5CI9A 2E87A 5DLJA 1TKNA 4MVMA 2V3CC 1EQ1A 3VRCA 2XLVA 4P6IC 1M57C 3IQ6A 3MFNA 1ZYRF 1C02A 1MNDA 3L0IA 5JRAA 1OW8A 2H7VC 2NSGA 3A11A 3GM3A 4MVQA 4QDLA 3EJNA 5DQZA 4JZAA 4CIHA 4XLPF 2CYDA 1G4WR 4WABA 2IM8A 4KC9A 4E18A 1TWCA 2DI3A 5JS5A 2HS5A 4XEKA 4L6RA 4MS2A 5L0CA 1OKKA 3EFOA 1E2XA 1E83A 1KTMA 5E3AA 1WOLA 1G8XA 3U0CA 1E85A 5E33A 3ZQVA 2RD9A 3JYYA 4MVRA 1B68A 2YL7A 2J7PA 2NUPB 3OWTA 1ZHWA 1RJ9A 1A7EA 4CDAA 3JTLO 2DYRC 5EGYA 1NFNA 3NMIA 5B1BC 1VLTA 3EGDB 2A0UA 3NYLA 1G5ZA 3NMKA 2BE5F 1HY5A 2XLDA 4JTAB 1V74B 4BEMJ 2HZ8A 1FTSA 4XPXA 2PF4E 4Q5SF 5F5FA 2HUJA 4JCZA 1Q0MA 2W4BA 4KBLA 2GWWA 3GEIA 1WTYA 3NDBB 3DJUB 1U89A 4E7ZA 1BDJB 1K40A 1D0XA 256BA 3JRTA 4OIRF 3HKKA 4MTOA 3PHF2 3C7JA 2QLAA 3S90A 4RBNA 2LFDA 2CNWA 2D5RB 4U5DE 1FAPB 2XL6A 1BZ4A 2Z15A 2DGJA 1CGNA 2PP4A 2X51A 2YL0A 1T6QA 1JMWA 3EQLF 1S7ZA 4BJTA 3SXZA 4D4NA 1M6TA 1R4TA 2R03A 2AU5A 5L3VA 5BQGA 5EHHA 3AG2C 2NUTA 3C8GA 3H65A 1OKKD 4Z9HA 1HE9A 3HLZA 2EPKX 1QLEC 5AC4A 3LLKA 4A2NB 1OXBA 2YKZA 3U2MA 3MBGA 4E17A 2W45A 3GWLA 4YT2A 4G7HF 2A6EF 3LEOA 4YN0B 2PX0A 2R9RB 2NSFA 3N24A 3O10A 1RKEB 1XWJA 1L3PA 1K05A 1Q0KA 2VB6A 2Y39A 3B0PA 3ZQYA 5L0DA 1M2VB 4CDVA 4EHPA 1C17M 2AP3A 3FAJA 3V5XA 4HFKB 4DRIB 4LDQA 4DBRA 3L34A 4I1OB 3G50A 2BL2A 3SZRA 5D91A 5JT4A 2J8WA 3CZ6A 2R7XA 1XZQA 1CGME 2IXPA 2VCCA 3AGUA 4YL3A 5B1AC 3SP1A 3C62A 1YZCA 2XLHA 3C63A 3G4ZA 4XPWA 5JP7A 3LESA 3FOOA 3QZCA 2LD6A 3KKBA 4U5EE 5F5HA 3X1OA 5K0IA 4KNVA 4EIYA 2R7RA 5HSWA 1DOVA 3RKOF 4PJNA 3AG4C 4P9FA 2BC5A 3DWWA 1G4US 1MQVA 2NG1A 4JEAA 3TD7A 4DOZA 2OCCC 3RVYA 1BBHA 3K7DA 3ZIBA 1PCXA 2ETSA 1ORSC 3N2ZB 3U3FA 4UDVA 3DM9B 3JZ0A 3U5SA 3U9JA 2KQ9A 3I5QA 1Q0FA 4PJMA 2R05A 4Q7CA 3UMIA 3C8ZA 2XLWA 3FVYA 3EHNA 4C3BA 2EIMC 2WVQA 1BR4A 3CQZA 3ATPA 3O55A 4U9EA 3RIPA 3LLIA 4EKWA 1S05A 1ORJA 3F47A 3EZHA 3QVYA 4F4BA 4NCQA 1D0ZA 5COGA 3ZVRA 3S28A 2OQMA 4FX5A 4MW3A 4BJ5A 1C03A 2HV6A 2QTVA 4OD5A 1T6IA 2VCAA 1BR2A 1JAFA 4AE4A 1TWGA 1AVOB 4EBJA 1PD0A 2YL3A 4CS9A 4QI0A 1VTMP 3B9QA 3OA1A 4FESA 1NZEA 1GS9A 2HMQA 3RYLA 4CDYA 3ABKC 3DM5A 3U2LA 4E7SA 3TOMA 3NRHA 1IZMA 2YRFA 4PACA 2KK1A 4XEFA 4AX2A 4JURI 2YLDA 2R02A 4BEJA 4D4XA 3AOUA 4OIPF 4IB4A 3W2WA 1HW1A 2D4UA 3VF0A 4YL1A 4G7ZF 3ZC4A 4N06A 3FMSA 2WZLA 3HNJA 2IOQA 3ZWIA 4BJ5C 1XZPA 4J32B 1OCRC 2JPUA 2XS1A 3LJBA 2R7WA 4JE9A 3ASOC 4C7OA 2YEVA 2FAPB 4NTFA 3NYMA 4CS9C 1GQAA 1VYKA 2G62A 1YA7O 2UUIA 1H9GA 2Y3HA 2Y3DA 1Z7Qc 4JC7A 3US6A 2Q3TA 1OCZC 5A69A 2Y69C 3SXMA 3EG9A 3EFOB 4MTGA 1VYIA 4MW8A 4IJJA 1OQCA 2EPOA 3KYJA 3M4CA 4YJWA 3K1HA 5KYYA 1IW7F 4Q4ZF 3B0VC 2G3KA 2Q9BA 4W8KA 1OCCC 2XLEA 1YVIA 3U9MA 4LACB 4KI2A 1JPNA 1RCPA 3KL4A 1Z63A 3PCVA 3R7CA 4CIPA 4RD9A 5KYWA
chains in the Genus database with same CATH topology
1TR2A 5L0JA 4W8PA 4DJ9A 5L0IA 4K1OA 1ST6A 2LQGA 5L0HA 1QKRA 4ONSA 5FZTA 5L0GA 3H2VA 3TJ5A 3ZDLA 1DOVA 4PR9A 1ZW2A 1T01A 1RKCA 1ZW3A 2GDCA 4IGGA 2B0HA 1L7CA 4E17A 1H6GA 2GWWA 2HSQA 3MYIA 5L0FA 3T6GB 1DOWA 1RKEB 1U89A 1XWJA 1U6HA 1YDIA 2X0CA 4E18A 5L0DA 3RF3A 4EHPA 2IBFA 3TJ6A 5L0CA 3S90A 2L7AA 3VF0A 4P9TA 1SYQA 3H2UA 1RKEA 1ZVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TR2 A;  5L0J A;  4W8P A;  4DJ9 A;  5L0I A;  4K1O A;  1ST6 A;  2LQG A;  5L0H A;  1QKR A;  4ONS A;  5FZT A;  5L0G A;  3H2V A;  3TJ5 A;  3ZDL A;  1DOV A;  4PR9 A;  1ZW2 A;  1T01 A;  1RKC A;  1ZW3 A;  2GDC A;  4IGG A;  2B0H A;  1L7C A;  4E17 A;  1H6G A;  2GWW A;  2HSQ A;  3MYI A;  5L0F A;  3T6G B;  1DOW A;  1RKE B;  1U89 A;  1XWJ A;  1U6H A;  1YDI A;  2X0C A;  4E18 A;  5L0D A;  3RF3 A;  4EHP A;  2IBF A;  3TJ6 A;  5L0C A;  3S90 A;  2L7A A;  3VF0 A;  4P9T A;  1SYQ A;  3H2U A;  1RKE A;  1ZVZ A; 
#chains in the Genus database with same CATH topology
 1D1A A;  3F46 A;  5JVE A;  2LIG A;  1VOM A;  1ORY A;  2OOC A;  2Q00 A;  2YHS A;  4MND A;  2W9Y A;  4XQ1 A;  1QKR A;  1O5H A;  1H7I A;  3H2V A;  3ITF A;  2MYS A;  2AWC A;  2XXA B;  3O6X A;  2A68 F;  4GYT A;  3K1I C;  1O3U A;  3KH2 A;  4IGG A;  2W4M A;  2YZS A;  2ZXO A;  5TJ5 E;  2DYS C;  4O6M A;  5DVW A;  2FFH A;  1KNY A;  4ANJ A;  3B0U X;  4HE8 D;  1SMY F;  1VB5 A;  3L8I A;  1Z3I X;  2OU6 A;  3T6G B;  1W2W A;  2LSE A;  4MVZ A;  1LE4 A;  1D1C A;  3QTH A;  3MYF A;  4E0I A;  4G0H A;  4YT5 A;  3DZA A;  2M4E A;  3HTK C;  3TQO A;  1V54 C;  2R7S A;  5T3T A;  1OW6 A;  1Z5Z A;  3ZTZ A;  4NQF A;  2GAQ A;  2ZPA A;  3JRM O;  1MMA A;  5D92 A;  1A7V A;  2AVK A;  2XM0 A;  4JKV A;  2VCB A;  4U5H A;  1SZI A;  3ZSU A;  3GOR A;  2Q7R A;  1UFB A;  3GM1 A;  3AQC A;  3IQ5 A;  1MMN A;  1Z23 A;  1MMG A;  3UGO A;  4BJ6 C;  4ULV A;  4MVO A;  4WJ0 A;  2NUP A;  1JPJ A;  2Y3G A;  4KNW A;  3V5Y A;  4N6C A;  4U9D A;  3L1M A;  5L3Q A;  1WAS A;  4RDA A;  3RQF A;  1M2O A;  4YL0 A;  5A6B A;  1V55 C;  2ZXR A;  2HFI A;  2IXN A;  1D0Y A;  3B29 A;  1FMV A;  2HJM A;  2LP4 A;  3EGD A;  5AC5 A;  4DXW A;  2X0C A;  3T6J A;  2J7P D;  2P0N A;  1A0B A;  2OEX A;  5T3W A;  4MVS A;  3FAP B;  2HJ3 A;  4K7B A;  4PJJ A;  4JJF A;  4BJ1 A;  4P9T A;  3QMK A;  2ICW G;  2A6H F;  3E9V A;  3RH3 A;  2ASR A;  2R7O A;  3DE8 A;  3FXH A;  4EWC A;  1ZVZ A;  1CGO A;  1T9K A;  2FGY A;  3W8I A;  2ZXP A;  2CGE A;  3KYI A;  3Q6N A;  4CX9 A;  1QPU A;  3S9O A;  4YWQ A;  4AK9 A;  4U5B E;  1Q0D A;  5JSL A;  1SF8 A;  1Y4C A;  1YZA A;  1LVK A;  3JSZ A;  4R32 A;  3V7O A;  1HMO A;  1O87 A;  2XS8 A;  3I5P A;  5FZT A;  2WVN A;  4BPM A;  2YL1 A;  3W4Y A;  4CS8 A;  3AG1 C;  5B3I A;  2G3V A;  2CNW D;  3L8J A;  5JLI A;  3SNH A;  1OCO C;  3LS0 A;  1H6G A;  4LER A;  4U5C E;  1LPE A;  1A7D A;  2VC9 A;  1TWA A;  4G78 A;  4EUK B;  2PFD A;  3AJM A;  2YWA A;  2MWQ A;  4EBB A;  1Y6D A;  2B0J A;  1UG7 A;  5GPG B;  1FNT c;  3Q7L A;  3MX3 A;  3EPV A;  2WVO A;  3C8G D;  3GWN A;  4NTB A;  3DJN B;  4DRJ B;  2AWY A;  2RSE B;  1M2V A;  1MMD A;  1VLS A;  3PMR A;  1T5O A;  2UUH A;  5A6B D;  2J0W A;  3GEE A;  3S0X A;  5E2Q A;  1JOG A;  4H4K C;  4DJ9 A;  3EZI A;  3SYN A;  3VAY A;  5F28 E;  4CS8 C;  5L0I A;  2R7U A;  1NSG B;  4JW1 A;  5DQT A;  1QZX A;  1RMV A;  3ZG1 A;  3EGX B;  1LE2 A;  4JIO A;  4J7Y A;  3DMD A;  2M64 A;  3T6B A;  4PK4 A;  5FCL A;  5KYN A;  1RKC A;  1ZW3 A;  3JCU Q;  2L6G A;  1NBB A;  1YYX A;  1J8M F;  2WB7 A;  3QW0 A;  2EPL X;  3B71 A;  4WGY A;  2YLI A;  3WOD F;  3UR3 C;  1YA9 A;  4M63 A;  1OW7 A;  3MLG A;  1Z6A A;  1ZHY A;  4IWB A;  2C04 A;  4AL1 A;  5KYU B;  2JD3 A;  1K04 A;  4O79 A;  2XLM A;  2TMV P;  2H7O A;  3LNM B;  1M56 C;  5KYX B;  3EHM A;  1SR2 A;  3IHU A;  3NKD A;  4MVU A;  1LI5 A;  4GEH A;  4Z9J A;  2EIJ C;  1YAR O;  2HSB A;  4ZLC A;  5L0J A;  1H9T A;  5A6K A;  2J0X A;  1D1B A;  3EG9 B;  1LI7 A;  3EH1 A;  4I3M A;  4K1O A;  4LLC A;  4PFO A;  3UNG C;  4AL0 A;  3LNR A;  2O9X A;  3TJ5 A;  4MTF A;  3VYW A;  1T01 A;  3UMK A;  3FDQ A;  1LS4 A;  3ABM C;  3HNL A;  2CCY A;  3RW0 A;  2CDQ A;  1NU7 D;  2LK4 A;  5L0F A;  3JSE O;  3JYH A;  3U3B A;  2I8B A;  3K1I A;  3SXY A;  3X2Q C;  3S84 A;  2KSF A;  4ZLD A;  3NYJ A;  2XRH A;  3RQE A;  3JT1 A;  4HFF B;  1TFK B;  3TJ6 A;  4XEV A;  3T4R A;  3SEO A;  1I5N A;  2IYL D;  2P6V A;  2HMZ A;  3AQB A;  1WN0 A;  3HJC A;  4PFP A;  1RJ9 B;  5E3C A;  3LS1 A;  4IAR A;  4GQH A;  3GAN A;  1NG1 A;  2EPM X;  3FOP A;  2J45 A;  3LEV A;  3Q6M A;  4W8P A;  5DS4 A;  2KJG A;  2R7Q A;  2IXO A;  3GM2 A;  4BG0 A;  1ZZP A;  1KU2 A;  4XPY A;  1JRA A;  4ER9 A;  4JVS A;  4G7O F;  2EPN A;  5CI8 A;  1TQG A;  1T6U A;  2P7V A;  4QI2 A;  3PDM P;  4CSA A;  3J06 A;  3W8H A;  2VH3 A;  2XL8 A;  2XM4 A;  5DS6 A;  4XLN F;  3WAQ A;  5DS5 A;  2WL8 A;  2Q9C A;  3S29 A;  4BJ6 A;  2WZF A;  3TUL A;  4LDR A;  1DOW A;  3CAX A;  1I4Z A;  1OR2 A;  1ZU5 A;  3C18 A;  2HV7 A;  4I44 A;  3M4B A;  4CJO A;  4NTA A;  3UGP A;  2ZD9 A;  1FFT C;  2KYH A;  4FAP B;  1WWP A;  2DB4 A;  4H54 A;  2NUT B;  1TR2 A;  1QVX A;  2GA0 A;  2Q4F A;  3C8G B;  2YLG A;  4U5G A;  1N1C A;  2OKU A;  3IQC A;  4K0D A;  3IEE A;  3BEH A;  3CSK A;  5BQI A;  3OEO A;  4Z9I A;  4CSA C;  1YYJ A;  1WGW A;  3IQT A;  4NC3 A;  4I1M A;  3RQG A;  3ZTM A;  1CPQ A;  1ZHT A;  4WGZ A;  3W2V A;  1VMA A;  1I4Y A;  4N4W A;  3T9O A;  4CS7 A;  4HEA J;  2XL4 A;  3RVZ A;  3N0T A;  5HV9 A;  3DXJ F;  3LAY A;  3WG7 C;  2XSE A;  3NG1 A;  2HSQ A;  3MYI A;  3UMH A;  2XXA A;  3GOD A;  1YAU O;  3HNK A;  3S27 A;  3POV A;  2PBE A;  4ULW A;  3RF3 A;  2KGO A;  1GGQ A;  2IBF A;  5COM A;  3KPH A;  1APC A;  1PV3 A;  2QY9 A;  3K33 A;  3IPM O;  4FWV A;  3ASN C;  3M79 A;  4YT8 A;  1AEP A;  1SYQ A;  3LUT B;  3WHN A;  3FHD A;  3RFY A;  4IAQ A;  4C3D A;  3DKA A;  2L81 A;  2J46 A;  4JTC B;  1HMD A;  3K66 A;  1FFH A;  1A41 A;  4DVY P;  2IXM A;  2OJQ A;  2PNO A;  2PX3 A;  2V26 A;  2WZG A;  3QVZ A;  4B6I A;  2KC3 A;  5L0H A;  5BUO A;  1FMW A;  2EIN C;  3DD7 A;  3ZDL A;  4IAO A;  3NMJ A;  2R7T A;  1NLX A;  4JJG A;  1YJG A;  2B0H A;  2QE9 A;  1LIH A;  2J9B A;  2Q9A A;  1WAT A;  3DAF A;  4O7G A;  5T1D B;  3DAG A;  3NKE A;  4YK5 A;  2Y3B A;  2XLO A;  2MHR A;  2LCH A;  3HNI A;  1HW2 A;  5BQH A;  4XTK A;  1GM5 A;  1AUE A;  1HE1 A;  5CIV A;  2OG2 A;  1R5I D;  2H8A A;  3O39 A;  3H2U A;  3I4U A;  1MNE A;  4J7T A;  1RKE A;  4N6H A;  4OD4 A;  2CW0 F;  3QW1 A;  4AE4 B;  4DVZ A;  4OIQ F;  3U8V A;  2NPU A;  3TK0 A;  5A6J A;  4JRZ A;  3V5Z A;  1TWH A;  2HKV A;  4JTD B;  4EBK A;  2YQY A;  2QNL A;  2LQG A;  4ONS A;  2R7V A;  3AGT A;  3EH2 A;  3R2P A;  1NFO A;  2OJE D;  4IRU A;  1ZHZ A;  4PR9 A;  4E0H A;  4MQ9 F;  2GDC A;  3M15 A;  4NY3 A;  3M1C B;  1EA8 A;  2R25 A;  1ZHX A;  4C3E A;  4J30 B;  4YT4 A;  3G4X A;  3K6B A;  2J9V A;  5EK0 A;  4O6N A;  4O6Y A;  2L6F A;  4DBQ A;  2P61 A;  3KMI A;  1QSP A;  2ZXW C;  4PJL A;  4XWJ A;  4CBE A;  3BRJ A;  1CPR A;  2A0B A;  5AGF A;  4C7O B;  4U5F E;  2YVK A;  4OIO F;  1FR0 A;  4A4A A;  4JCH A;  2KNH A;  1YLM A;  4X0R A;  1U0B B;  2LFF A;  5B3S C;  2L9J A;  1NU9 C;  1F1M A;  3A9C A;  2F22 A;  1OR3 A;  1ST6 A;  1LKX A;  1OXK A;  1ZU4 A;  2EIK C;  2VAS A;  1JR8 A;  3DI5 A;  1TFO B;  5L0G A;  5A6A A;  2QUP A;  3SXK A;  4OIN F;  5JUA A;  1EKY A;  1BR1 A;  1ZW2 A;  5KYY B;  2A1D D;  2L6H A;  1PD1 A;  3TOL A;  4CJG A;  5COF A;  1J8Y F;  3VM6 A;  1QQ3 A;  3ECS A;  3U8P A;  1RXQ A;  2GFH A;  3AG3 C;  3EGX A;  4LLE A;  2KW3 C;  2OEV A;  3Q7G A;  1YDI A;  1E84 A;  1U6H A;  2P1A A;  3DE9 A;  5KYW B;  1EI7 A;  3E70 C;  4DRH B;  4LDK A;  2L7A A;  3ABL C;  2JX0 A;  3CEX A;  1Q0G A;  1V4A A;  1E86 A;  2EIL C;  1L7C A;  5KYU A;  2I15 A;  2H7B A;  2C03 A;  1VK5 A;  2J9U A;  2J9W A;  2A69 F;  3GEH A;  5IY5 C;  1LS1 A;  4JEB A;  5KYX A;  1LM3 B;  5CI9 A;  2E87 A;  5DLJ A;  1TKN A;  4MVM A;  2V3C C;  1EQ1 A;  3VRC A;  2XLV A;  4P6I C;  1M57 C;  3IQ6 A;  3MFN A;  1ZYR F;  1C02 A;  1MND A;  3L0I A;  5JRA A;  1OW8 A;  2H7V C;  2NSG A;  3A11 A;  3GM3 A;  4MVQ A;  4QDL A;  3EJN A;  5DQZ A;  4JZA A;  4CIH A;  4XLP F;  2CYD A;  1G4W R;  4WAB A;  2IM8 A;  4KC9 A;  4E18 A;  1TWC A;  2DI3 A;  5JS5 A;  2HS5 A;  4XEK A;  4L6R A;  4MS2 A;  5L0C A;  1OKK A;  3EFO A;  1E2X A;  1E83 A;  1KTM A;  5E3A A;  1WOL A;  1G8X A;  3U0C A;  1E85 A;  5E33 A;  3ZQV A;  2RD9 A;  3JYY A;  4MVR A;  1B68 A;  2YL7 A;  2J7P A;  2NUP B;  3OWT A;  1ZHW A;  1RJ9 A;  1A7E A;  4CDA A;  3JTL O;  2DYR C;  5EGY A;  1NFN A;  3NMI A;  5B1B C;  1VLT A;  3EGD B;  2A0U A;  3NYL A;  1G5Z A;  3NMK A;  2BE5 F;  1HY5 A;  2XLD A;  4JTA B;  1V74 B;  4BEM J;  2HZ8 A;  1FTS A;  4XPX A;  2PF4 E;  4Q5S F;  5F5F A;  2HUJ A;  4JCZ A;  1Q0M A;  2W4B A;  4KBL A;  2GWW A;  3GEI A;  1WTY A;  3NDB B;  3DJU B;  1U89 A;  4E7Z A;  1BDJ B;  1K40 A;  1D0X A;  256B A;  3JRT A;  4OIR F;  3HKK A;  4MTO A;  3PHF 2;  3C7J A;  2QLA A;  3S90 A;  4RBN A;  2LFD A;  2CNW A;  2D5R B;  4U5D E;  1FAP B;  2XL6 A;  1BZ4 A;  2Z15 A;  2DGJ A;  1CGN A;  2PP4 A;  2X51 A;  2YL0 A;  1T6Q A;  1JMW A;  3EQL F;  1S7Z A;  4BJT A;  3SXZ A;  4D4N A;  1M6T A;  1R4T A;  2R03 A;  2AU5 A;  5L3V A;  5BQG A;  5EHH A;  3AG2 C;  2NUT A;  3C8G A;  3H65 A;  1OKK D;  4Z9H A;  1HE9 A;  3HLZ A;  2EPK X;  1QLE C;  5AC4 A;  3LLK A;  4A2N B;  1OXB A;  2YKZ A;  3U2M A;  3MBG A;  4E17 A;  2W45 A;  3GWL A;  4YT2 A;  4G7H F;  2A6E F;  3LEO A;  4YN0 B;  2PX0 A;  2R9R B;  2NSF A;  3N24 A;  3O10 A;  1RKE B;  1XWJ A;  1L3P A;  1K05 A;  1Q0K A;  2VB6 A;  2Y39 A;  3B0P A;  3ZQY A;  5L0D A;  1M2V B;  4CDV A;  4EHP A;  1C17 M;  2AP3 A;  3FAJ A;  3V5X A;  4HFK B;  4DRI B;  4LDQ A;  4DBR A;  3L34 A;  4I1O B;  3G50 A;  2BL2 A;  3SZR A;  5D91 A;  5JT4 A;  2J8W A;  3CZ6 A;  2R7X A;  1XZQ A;  1CGM E;  2IXP A;  2VCC A;  3AGU A;  4YL3 A;  5B1A C;  3SP1 A;  3C62 A;  1YZC A;  2XLH A;  3C63 A;  3G4Z A;  4XPW A;  5JP7 A;  3LES A;  3FOO A;  3QZC A;  2LD6 A;  3KKB A;  4U5E E;  5F5H A;  3X1O A;  5K0I A;  4KNV A;  4EIY A;  2R7R A;  5HSW A;  1DOV A;  3RKO F;  4PJN A;  3AG4 C;  4P9F A;  2BC5 A;  3DWW A;  1G4U S;  1MQV A;  2NG1 A;  4JEA A;  3TD7 A;  4DOZ A;  2OCC C;  3RVY A;  1BBH A;  3K7D A;  3ZIB A;  1PCX A;  2ETS A;  1ORS C;  3N2Z B;  3U3F A;  4UDV A;  3DM9 B;  3JZ0 A;  3U5S A;  3U9J A;  2KQ9 A;  3I5Q A;  1Q0F A;  4PJM A;  2R05 A;  4Q7C A;  3UMI A;  3C8Z A;  2XLW A;  3FVY A;  3EHN A;  4C3B A;  2EIM C;  2WVQ A;  1BR4 A;  3CQZ A;  3ATP A;  3O55 A;  4U9E A;  3RIP A;  3LLI A;  4EKW A;  1S05 A;  1ORJ A;  3F47 A;  3EZH A;  3QVY A;  4F4B A;  4NCQ A;  1D0Z A;  5COG A;  3ZVR A;  3S28 A;  2OQM A;  4FX5 A;  4MW3 A;  4BJ5 A;  1C03 A;  2HV6 A;  2QTV A;  4OD5 A;  1T6I A;  2VCA A;  1BR2 A;  1JAF A;  4AE4 A;  1TWG A;  1AVO B;  4EBJ A;  1PD0 A;  2YL3 A;  4CS9 A;  4QI0 A;  1VTM P;  3B9Q A;  3OA1 A;  4FES A;  1NZE A;  1GS9 A;  2HMQ A;  3RYL A;  4CDY A;  3ABK C;  3DM5 A;  3U2L A;  4E7S A;  3TOM A;  3NRH A;  1IZM A;  2YRF A;  4PAC A;  2KK1 A;  4XEF A;  4AX2 A;  4JUR I;  2YLD A;  2R02 A;  4BEJ A;  4D4X A;  3AOU A;  4OIP F;  4IB4 A;  3W2W A;  1HW1 A;  2D4U A;  3VF0 A;  4YL1 A;  4G7Z F;  3ZC4 A;  4N06 A;  3FMS A;  2WZL A;  3HNJ A;  2IOQ A;  3ZWI A;  4BJ5 C;  1XZP A;  4J32 B;  1OCR C;  2JPU A;  2XS1 A;  3LJB A;  2R7W A;  4JE9 A;  3ASO C;  4C7O A;  2YEV A;  2FAP B;  4NTF A;  3NYM A;  4CS9 C;  1GQA A;  1VYK A;  2G62 A;  1YA7 O;  2UUI A;  1H9G A;  2Y3H A;  2Y3D A;  1Z7Q c;  4JC7 A;  3US6 A;  2Q3T A;  1OCZ C;  5A69 A;  2Y69 C;  3SXM A;  3EG9 A;  3EFO B;  4MTG A;  1VYI A;  4MW8 A;  4IJJ A;  1OQC A;  2EPO A;  3KYJ A;  3M4C A;  4YJW A;  3K1H A;  5KYY A;  1IW7 F;  4Q4Z F;  3B0V C;  2G3K A;  2Q9B A;  4W8K A;  1OCC C;  2XLE A;  1YVI A;  3U9M A;  4LAC B;  4KI2 A;  1JPN A;  1RCP A;  3KL4 A;  1Z63 A;  3PCV A;  3R7C A;  4CIP A;  4RD9 A;  5KYW A; 
#chains in the Genus database with same CATH homology
 1TR2 A;  5L0J A;  4W8P A;  4DJ9 A;  5L0I A;  4K1O A;  1ST6 A;  2LQG A;  5L0H A;  1QKR A;  4ONS A;  5FZT A;  5L0G A;  3H2V A;  3TJ5 A;  3ZDL A;  1DOV A;  4PR9 A;  1ZW2 A;  1T01 A;  1RKC A;  1ZW3 A;  2GDC A;  4IGG A;  2B0H A;  1L7C A;  4E17 A;  1H6G A;  2GWW A;  2HSQ A;  3MYI A;  5L0F A;  3T6G B;  1DOW A;  1RKE B;  1U89 A;  1XWJ A;  1U6H A;  1YDI A;  2X0C A;  4E18 A;  5L0D A;  3RF3 A;  4EHP A;  2IBF A;  3TJ6 A;  5L0C A;  3S90 A;  2L7A A;  3VF0 A;  4P9T A;  1SYQ A;  3H2U A;  1RKE A;  1ZVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...