1RKEA

Human vinculin head (1-258) in complex with human vinculin tail (879-1066)
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
262
structure length
262
Chain Sequence
b'HHHHMPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinculin
molecule tags Cell adhesion, structural protein
source organism Homo sapiens
publication title Vinculin activation by talin through helical bundle conversion
pubmed doi rcsb
total genus 110
structure length 262
sequence length 262
ec nomenclature
pdb deposition date 2003-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1rkeA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1rkeA01
4E18A 1TR2A 4K1OA 2X0CA 1YDIA 3RF3A 3TJ5A 1T01A 1RKEB 1U6HA 5L0GA 1RKEA 3T6GB 5L0CA 4P9TA 1ZW2A 3H2VA 4IGGA 2GDCA 1U89A 2IBFA 1XWJA 5L0FA 1H6GA 2LQGA 4ONSA 2HSQA 1ZVZA 1DOWA 4DJ9A 5FZTA 5L0IA 3S90A 3ZDLA 4W8PA 5L0HA 2GWWA 5L0JA 1DOVA 1L7CA 1SYQA 3VF0A 1RKCA 2B0HA 4E17A 1ZW3A 3MYIA 3TJ6A 2L7AA 4PR9A 5L0DA 4EHPA 1QKRA 1ST6A 3H2UA
chains in the Genus database with same CATH superfamily
4GEHA 2R7XA 2WZGA 4GYTA 2LSEA 2L6HA 3LJBA 1APCA 4CDAA 2XXAB 3QW0A 1FMWA 1AEPA 3N0TA 3IQ6A 3NRHA 3ZWIA 3S0XA 1VLTA 4LACB 4MVSA 4ULWA 4BEMJ 4ER9A 5EGYA 2DYRC 2G3VA 4IB4A 1EQ1A 4MTFA 2LP4A 1LM3B 3GODA 4DJ9A 4MW3A 2ICWG 1CGNA 4U9EA 4KNVA 3K1HA 4IAOA 1K04A 4LLCA 1S05A 2IYLD 2M64A 4CSAA 3MYIA 5F5HA 2IXPA 2F22A 2L7AA 2QLAA 2HUJA 4JTDB 1MNEA 3ASNC 1LKXA 4EHPA 1TQGA 3U8PA 4L6RA 4LDKA 5JUAA 3ZTZA 1JRAA 1YAUO 1M2VA 1I5NA 2EILC 5DS4A 1ZZPA 4DRIB 5KYNA 3AG2C 5DS6A 2ZXRA 2Y39A 2GAQA 1Q0GA 2V26A 4NC3A 5L0FA 2Y3HA 1H6GA 2HSQA 2HJ3A 2VC9A 1ZVZA 2Y3BA 3BEHA 5CIVA 1YJGA 2J9BA 3OA1A 2KQ9A 3G50A 1RCPA 4HFKB 4YWQA 5KYWB 1B68A 1SMYF 1A0BA 3US6A 1QPUA 2CCYA 2ETSA 2A0UA 3PCVA 1WASA 4CJGA 2NUTA 2Q4FA 3R7CA 4I3MA 3EHMA 3GM2A 4JJGA 3SXMA 1H9TA 3RW0A 4CJOA 2P61A 4MQ9F 3K1IA 1GGQA 3LNRA 3EH1A 1ZHYA 1LVKA 1LS1A 1D1CA 1YYJA 4R32A 1QLEC 4A4AA 1T01A 3EGDB 2DYSC 3O39A 2XM0A 4JEAA 4O6MA 4YL3A 4FESA 4U5DE 3VM6A 3DAGA 4JC7A 1Q0MA 4KNWA 2AWCA 4AX2A 3IQ5A 1E86A 4MVOA 3CZ6A 2YL7A 2LD6A 4PFOA 4OD5A 2XS1A 2HKVA 1LPEA 4W8PA 1M2VB 3M4CA 3UR3C 2ZD9A 2Q00A 3LUTB 2P6VA 2A6EF 2EPLX 2P1AA 1QQ3A 5BQIA 1EI7A 5AC4A 1T5OA 1YA9A 4ANJA 1TR2A 3FVYA 4K1OA 2XLHA 5IY5C 1YDIA 3DXJF 3LLIA 4X0RA 5A6AA 1FMVA 3NDBB 3RH3A 1OCCC 3EGDA 4G78A 1NU9C 3DKAA 1E2XA 3Q7LA 4O79A 4RD9A 4AL0A 5KYUB 1MMDA 3QZCA 2FAPB 1ORJA 3WHNA 2KYHA 3JT1A 1T6QA 3U2LA 3WG7C 3C8ZA 1BBHA 4XLNF 1LE2A 3ZC4A 4E7ZA 1PV3A 4XQ1A 3VF0A 2EPNA 4EKWA 2XM4A 3K6BA 4JIOA 4Z9IA 3TOMA 1G4US 2AWYA 1VYIA 2ASRA 2B0JA 2WVNA 2CW0F 2Y3GA 2YWAA 2OU6A 3ASOC 4N06A 4NTBA 3K7DA 4C3DA 1CPRA 4C7OB 2QE9A 2M4EA 2DB4A 2OJED 5BQHA 2R25A 2Y3DA 3X1OA 1PD0A 4OIOF 1NFOA 2C04A 2IOQA 2J9WA 1VMAA 5FCLA 3TJ5A 1U6HA 3ZTMA 2KK1A 2MWQA 1ZYRF 2Q7RA 1KTMA 1SZIA 4WABA 2YL3A 4I1OB 1PCXA 1R4TA 2J46A 5KYUA 1U89A 2JX0A 3JSZA 2E87A 2HMZA 4NTFA 3B29A 4O7GA 4J7YA 2YVKA 3CEXA 4F4BA 2QY9A 3ZDLA 3DE9A 3LEVA 4K0DA 3W8IA 3EZHA 4MVMA 3ZG1A 1G5ZA 2FFHA 3FAJA 3GWLA 1ZW3A 3ABLC 3ZVRA 1CPQA 1L3PA 2WZLA 2PX0A 3E9VA 4CIPA 3VAYA 1VTMP 4G7ZF 1HE9A 3WAQA 2XSEA 2IXNA 2W9YA 4J7TA 2GA0A 4H4KC 1HW1A 1OR3A 2UUHA 3V5ZA 1TWCA 2YKZA 3KPHA 3LESA 1XZPA 5F28E 3S27A 3U8VA 3UMIA 4MTOA 1OQCA 1V74B 4XPYA 1NFNA 4W8KA 3VYWA 4IWBA 5DQZA 5L0GA 1H7IA 1Q0KA 1WTYA 2YEVA 1HY5A 4JEBA 4XLPF 1PD1A 5BQGA 4IGGA 2AU5A 4AK9A 1LI5A 2LQGA 1S7ZA 4EBKA 1OW8A 4CS8C 1HMOA 3FHDA 1OCRC 2H7VC 1WATA 5T3TA 3V7OA 5COGA 5KYYB 4C7OA 4CS7A 1YYXA 2W4BA 2YL0A 3ZSUA 4JCHA 4NQFA 4YT2A 1C02A 1K40A 4JRZA 3RVZA 1JPNA 1FTSA 5KYXA 1RJ9B 2KW3C 1MMAA 3QW1A 1N1CA 2KSFA 1A7EA 4XPXA 3W4YA 1JPJA 5HV9A 2NUPA 3FXHA 3U3BA 2XLVA 3EPVA 2OEVA 2ZPAA 1HMDA 3I5QA 3KYJA 2C03A 2CNWD 4JVSA 1CGOA 3W2VA 3TK0A 1RXQA 3GEHA 1D0XA 1TFKB 3GWNA 3NYMA 2LCHA 1Q0FA 3RKOF 4RBNA 2IBFA 3RQEA 4CX9A 4ZLDA 2IXOA 5E3AA 2LFFA 2LK4A 3N24A 1DOWA 3ATPA 4BJ5C 1FR0A 3FMSA 5KYYA 3Q6MA 1D0YA 2YLGA 3SXKA 3G4ZA 3KMIA 4D4NA 1FFTC 1XZQA 2BC5A 2L6GA 3Q6NA 5JS5A 4XPWA 4XEFA 3V5YA 2WB7A 4FWVA 1WGWA 3MYFA 1A7VA 3I5PA 3C7JA 4OIRF 4AE4A 4D4XA 4EBBA 5JLIA 3O6XA 1H9GA 1KNYA 3DI5A 3DZAA 3GEIA 2MYSA 3SZRA 5AC5A 2TMVP 3IQCA 4JTCB 4MVUA 4CIHA 1O87A 5A69A 5JRAA 5A6BA 4Q4ZF 2XXAA 3RFYA 1YARO 3UGOA 2QTVA 2KC3A 4OIQF 3W8HA 3H2VA 2VB6A 2W45A 4EIYA 3VRCA 4O6NA 4G7HF 1JMWA 1M6TA 1OXKA 3HTKC 1HW2A 3DWWA 2UUIA 2NUPB 1A7DA 5D92A 5B1BC 1TWHA 2KJGA 3T4RA 2VCBA 3B9QA 3K66A 1ORYA 5JSLA 2PP4A 3TD7A 4C3BA 1NZEA 2L6FA 2NUTB 5T3WA 1FAPB 3RIPA 4YJWA 5KYXB 4U5GA 3DM9B 3IQTA 2R9RB 4E0IA 2EPMX 4PR9A 3DD7A 3U9JA 2Q3TA 1UFBA 3U2MA 4JTAB 3T6JA 3EFOB 3IEEA 2YLDA 2WVOA 1IW7F 1F1MA 3ABMC 3EG9B 3M79A 4PJMA 4WGZA 1VLSA 2NPUA 3SEOA 4ZLCA 3K1IC 4MW8A 2WL8A 4Z9JA 4IJJA 4XEVA 4CDVA 1YLMA 4YT8A 4C3EA 1W2WA 1V4AA 3E70C 3FAPB 3JRTA 1G4WR 5EK0A 2DI3A 5JP7A 2I8BA 3AGUA 3L8JA 1A41A 2OOCA 3EJNA 1VB5A 1ZHZA 1TKNA 3SP1A 5JT4A 5COMA 1NU7D 5L0JA 4EBJA 1VK5A 2EIKC 3CQZA 1NBBA 3LAYA 1T9KA 2B0HA 1KU2A 4LDRA 1GQAA 4YL1A 4BJ6A 1Z23A 3PMRA 3RQGA 4N6CA 2R7RA 2ZXOA 3NMKA 3SYNA 3H2UA 4A2NB 4J32B 4DVYP 3PDMP 4B6IA 3N2ZB 1G8XA 1M56C 4DVZA 1D1AA 256BA 3HNJA 1R5ID 3RF3A 2XL4A 2R02A 3L34A 2X0CA 5A6KA 1AUEA 4U5BE 2H8AA 3JYHA 4PK4A 1SR2A 1XWJA 4IARA 3GORA 1V55C 5B3IA 4G7OF 2L9JA 1AVOB 4KC9A 3AG3C 4N6HA 1GM5A 4YL0A 5EHHA 3NG1A 3QVZA 2HZ8A 1M2OA 2D5RB 3C18A 3C8GD 3HNLA 4NCQA 3LNMB 3JCUQ 2J0WA 2J8WA 2XLDA 1SYQA 3G4XA 2LIGA 2NSFA 4I1MA 3UGPA 1YVIA 3S9OA 1RJ9A 2NG1A 2Z15A 4JW1A 1BR2A 1SF8A 4UDVA 5E3CA 3FOOA 5K0IA 1JAFA 3H65A 2G3KA 3U0CA 3JYYA 1NSGB 5E2QA 3LS1A 1FNTc 1Q0DA 5KYWA 3C8GA 1VYKA 2CNWA 1OW7A 2OKUA 3T6BA 4KI2A 4RDAA 2Q9AA 3K33A 1WWPA 2R7OA 5E33A 3FDQA 4JCZA 4JE9A 3ZIBA 5D91A 3S29A 3S28A 1JOGA 2PBEA 1QZXA 4EUKB 3KKBA 4YN0B 1QVXA 3R2PA 2Q9BA 3KH2A 3EQLF 2R7SA 1C03A 2P0NA 3GM1A 3SNHA 2GWWA 3U3FA 2PF4E 1TWAA 2A0BA 2JPUA 5DS5A 3WODF 1LI7A 5TJ5E 1M57C 1JR8A 4FX5A 2R7QA 3TJ6A 3GM3A 1I4ZA 3M4BA 4H54A 3GEEA 1EA8A 1OXBA 2VCCA 2J0XA 3TULA 2H7OA 1OKKA 2R7UA 2H7BA 1T6IA 1J8MF 3AGTA 4U5CE 2XLWA 2YRFA 4E0HA 4Z9HA 2G62A 2XS8A 1J8YF 2RSEB 2XLMA 1Z7Qc 1NLXA 4DOZA 4FAPB 4DBQA 3ZQYA 4CS9C 1TWGA 1Z3IX 3O55A 3T6GB 3DJUB 4DRHB 4E7SA 3B0UX 4MVZA 3RYLA 3Q7GA 4QDLA 3J06A 2YZSA 3NMJA 1OKKD 4OINF 4KBLA 3UMHA 2W4MA 4BEJA 2YHSA 4DXWA 5CI8A 4J30B 2EPOA 4XEKA 2J7PA 1ORSC 3NMIA 1K05A 2XLEA 3JRMO 2RD9A 2OQMA 1V54C 2EINC 4OIPF 3B0PA 3C8GB 1VOMA 1L7CA 3C63A 5DLJA 3NKDA 1BDJB 1RKCA 3B71A 4MTGA 3X2QC 5L0DA 3L8IA 2OJQA 4WGYA 4P6IC 1D1BA 4IAQA 4G0HA 3W2WA 2L81A 4IRUA 1QKRA 4BJ6C 4BJ5A 5DQTA 4AE4B 1Z63A 1CGME 1BR1A 5AGFA 3A11A 3I4UA 2ZXWC 3DE8A 4BPMA 3V5XA 1RMVA 4PJJA 4GQHA 2AP3A 5JVEA 5T1DB 2YL1A 1NG1A 1RKEB 3AJMA 3EGXA 3EH2A 4LDQA 4XTKA 1ZU4A 1ZW2A 4Q5SF 5BUOA 2VCAA 1D0ZA 2GDCA 5HSWA 3JZ0A 2X51A 1ZHWA 4ONSA 2A69F 2PX3A 3JSEO 3L0IA 4JZAA 3KYIA 3B0VC 3QVYA 4JJFA 2J9UA 2DGJA 5COFA 2HMQA 5FZTA 3F47A 5L0IA 1E84A 1E85A 3S90A 3RQFA 1MMNA 3DAFA 4QI0A 4AL1A 3RVYA 3PHF2 2Q9CA 4PFPA 5GPGB 2J9VA 2YLIA 4U5EE 3UNGC 3EHNA 2WZFA 2QNLA 2XLOA 3A9CA 3AG1C 2HV7A 3HNKA 3TQOA 2J45A 2EPKX 2I15A 2MHRA 4CBEA 1C17M 4XWJA 1EKYA 2KGOA 1ZU5A 3HKKA 1YZCA 3EG9A 3AOUA 1UG7A 2J7PD 1GS9A 3MFNA 3OEOA 3U9MA 3TOLA 4EWCA 2EIMC 4DBRA 1Z5ZA 3HJCA 1RKEA 3EGXB 1Y6DA 3M15A 4P9TA 2LFDA 2WVQA 4P9FA 3MX3A 4DRJB 2NSGA 4JKVA 4MVQA 2O9XA 5B1AC 2EIJC 3FOPA 4CS9A 3DJNB 3POVA 1OW6A 2R05A 2FGYA 3JTLO 1Y4CA 1HE1A 1MNDA 2OG2A 5L0HA 2HS5A 2HFIA 2YQYA 3UMKA 1Z6AA 2A6HF 3ITFA 5A6JA 4Q7CA 5B3SC 4MS2A 3EZIA 2R7VA 4BJTA 2A68F 4BJ1A 3KL4A 3NYLA 4E18A 3CAXA 2HSBA 4YK5A 2R7TA 3AG4C 2V3CC 1WN0A 3LEOA 4K7BA 1MMGA 2PNOA 3U5SA 4LLEA 2OEXA 4U9DA 2Y69C 4I44A 3ZQVA 1U0BB 3QMKA 1OCZC 3L1MA 1MQVA 3T9OA 5CI9A 3O10A 2P7VA 3ABKC 3S84A 3SXYA 2IXMA 3ECSA 1LE4A 4MNDA 4YT4A 4BG0A 1WOLA 1YZAA 3C62A 3CSKA 3LS0A 2QUPA 2D4UA 2XL8A 4O6YA 3DMDA 5L3QA 2CDQA 4U5FE 3AQCA 3M1CB 1DOVA 2IM8A 4MVRA 3F46A 3IHUA 2PFDA 3IPMO 4PJNA 4E17A 2CGEA 2HJMA 4NTAA 5DVWA 3SXZA 3MBGA 1TFOB 2BL2A 1ST6A 2VASA 4PACA 2OCCC 3NYJA 1ZHTA 3EFOA 1OCOC 1O3UA 4LERA 1FFHA 2R03A 4N4WA 4QI2A 1O5HA 2XL6A 2ZXPA 2BE5F 4PJLA 4CDYA 5A6BD 3QTHA 1I4YA 4JURI 2VH3A 2A1DD 3BRJA 4CS8A 1BR4A 1YA7O 5L0CA 2CYDA 2GFHA 1IZMA 2XRHA 4OD4A 2HV6A 3NKEA 1E83A 1LIHA 4HEAJ 2KNHA 2AVKA 3AQBA 3HNIA 3HLZA 4YT5A 5L3VA 4ULVA 4WJ0A 1BZ4A 1QSPA 1LS4A 3OWTA 3DM5A 3LLKA 4HFFB 4CSAC 1OR2A 4M63A 3MLGA 3GANA 2JD3A 4HE8D 4U5HA 2R7WA 5F5FA 4NY3A 1T6UA 1ZHXA
chains in the Genus database with same CATH topology
4E18A 1TR2A 4K1OA 2X0CA 1YDIA 3RF3A 3TJ5A 1T01A 1RKEB 1U6HA 5L0GA 1RKEA 3T6GB 5L0CA 4P9TA 1ZW2A 3H2VA 4IGGA 2GDCA 1U89A 2IBFA 1XWJA 5L0FA 1H6GA 2LQGA 4ONSA 2HSQA 1ZVZA 1DOWA 4DJ9A 5FZTA 5L0IA 3S90A 3ZDLA 4W8PA 5L0HA 2GWWA 5L0JA 1DOVA 1L7CA 1SYQA 3VF0A 1RKCA 2B0HA 4E17A 1ZW3A 3MYIA 3TJ6A 2L7AA 4PR9A 5L0DA 4EHPA 1QKRA 1ST6A 3H2UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E18 A;  1TR2 A;  4K1O A;  2X0C A;  1YDI A;  3RF3 A;  3TJ5 A;  1T01 A;  1RKE B;  1U6H A;  5L0G A;  1RKE A;  3T6G B;  5L0C A;  4P9T A;  1ZW2 A;  3H2V A;  4IGG A;  2GDC A;  1U89 A;  2IBF A;  1XWJ A;  5L0F A;  1H6G A;  2LQG A;  4ONS A;  2HSQ A;  1ZVZ A;  1DOW A;  4DJ9 A;  5FZT A;  5L0I A;  3S90 A;  3ZDL A;  4W8P A;  5L0H A;  2GWW A;  5L0J A;  1DOV A;  1L7C A;  1SYQ A;  3VF0 A;  1RKC A;  2B0H A;  4E17 A;  1ZW3 A;  3MYI A;  3TJ6 A;  2L7A A;  4PR9 A;  5L0D A;  4EHP A;  1QKR A;  1ST6 A;  3H2U A; 
#chains in the Genus database with same CATH topology
 4GEH A;  2R7X A;  2WZG A;  4GYT A;  2LSE A;  2L6H A;  3LJB A;  1APC A;  4CDA A;  2XXA B;  3QW0 A;  1FMW A;  1AEP A;  3N0T A;  3IQ6 A;  3NRH A;  3ZWI A;  3S0X A;  1VLT A;  4LAC B;  4MVS A;  4ULW A;  4BEM J;  4ER9 A;  5EGY A;  2DYR C;  2G3V A;  4IB4 A;  1EQ1 A;  4MTF A;  2LP4 A;  1LM3 B;  3GOD A;  4DJ9 A;  4MW3 A;  2ICW G;  1CGN A;  4U9E A;  4KNV A;  3K1H A;  4IAO A;  1K04 A;  4LLC A;  1S05 A;  2IYL D;  2M64 A;  4CSA A;  3MYI A;  5F5H A;  2IXP A;  2F22 A;  2L7A A;  2QLA A;  2HUJ A;  4JTD B;  1MNE A;  3ASN C;  1LKX A;  4EHP A;  1TQG A;  3U8P A;  4L6R A;  4LDK A;  5JUA A;  3ZTZ A;  1JRA A;  1YAU O;  1M2V A;  1I5N A;  2EIL C;  5DS4 A;  1ZZP A;  4DRI B;  5KYN A;  3AG2 C;  5DS6 A;  2ZXR A;  2Y39 A;  2GAQ A;  1Q0G A;  2V26 A;  4NC3 A;  5L0F A;  2Y3H A;  1H6G A;  2HSQ A;  2HJ3 A;  2VC9 A;  1ZVZ A;  2Y3B A;  3BEH A;  5CIV A;  1YJG A;  2J9B A;  3OA1 A;  2KQ9 A;  3G50 A;  1RCP A;  4HFK B;  4YWQ A;  5KYW B;  1B68 A;  1SMY F;  1A0B A;  3US6 A;  1QPU A;  2CCY A;  2ETS A;  2A0U A;  3PCV A;  1WAS A;  4CJG A;  2NUT A;  2Q4F A;  3R7C A;  4I3M A;  3EHM A;  3GM2 A;  4JJG A;  3SXM A;  1H9T A;  3RW0 A;  4CJO A;  2P61 A;  4MQ9 F;  3K1I A;  1GGQ A;  3LNR A;  3EH1 A;  1ZHY A;  1LVK A;  1LS1 A;  1D1C A;  1YYJ A;  4R32 A;  1QLE C;  4A4A A;  1T01 A;  3EGD B;  2DYS C;  3O39 A;  2XM0 A;  4JEA A;  4O6M A;  4YL3 A;  4FES A;  4U5D E;  3VM6 A;  3DAG A;  4JC7 A;  1Q0M A;  4KNW A;  2AWC A;  4AX2 A;  3IQ5 A;  1E86 A;  4MVO A;  3CZ6 A;  2YL7 A;  2LD6 A;  4PFO A;  4OD5 A;  2XS1 A;  2HKV A;  1LPE A;  4W8P A;  1M2V B;  3M4C A;  3UR3 C;  2ZD9 A;  2Q00 A;  3LUT B;  2P6V A;  2A6E F;  2EPL X;  2P1A A;  1QQ3 A;  5BQI A;  1EI7 A;  5AC4 A;  1T5O A;  1YA9 A;  4ANJ A;  1TR2 A;  3FVY A;  4K1O A;  2XLH A;  5IY5 C;  1YDI A;  3DXJ F;  3LLI A;  4X0R A;  5A6A A;  1FMV A;  3NDB B;  3RH3 A;  1OCC C;  3EGD A;  4G78 A;  1NU9 C;  3DKA A;  1E2X A;  3Q7L A;  4O79 A;  4RD9 A;  4AL0 A;  5KYU B;  1MMD A;  3QZC A;  2FAP B;  1ORJ A;  3WHN A;  2KYH A;  3JT1 A;  1T6Q A;  3U2L A;  3WG7 C;  3C8Z A;  1BBH A;  4XLN F;  1LE2 A;  3ZC4 A;  4E7Z A;  1PV3 A;  4XQ1 A;  3VF0 A;  2EPN A;  4EKW A;  2XM4 A;  3K6B A;  4JIO A;  4Z9I A;  3TOM A;  1G4U S;  2AWY A;  1VYI A;  2ASR A;  2B0J A;  2WVN A;  2CW0 F;  2Y3G A;  2YWA A;  2OU6 A;  3ASO C;  4N06 A;  4NTB A;  3K7D A;  4C3D A;  1CPR A;  4C7O B;  2QE9 A;  2M4E A;  2DB4 A;  2OJE D;  5BQH A;  2R25 A;  2Y3D A;  3X1O A;  1PD0 A;  4OIO F;  1NFO A;  2C04 A;  2IOQ A;  2J9W A;  1VMA A;  5FCL A;  3TJ5 A;  1U6H A;  3ZTM A;  2KK1 A;  2MWQ A;  1ZYR F;  2Q7R A;  1KTM A;  1SZI A;  4WAB A;  2YL3 A;  4I1O B;  1PCX A;  1R4T A;  2J46 A;  5KYU A;  1U89 A;  2JX0 A;  3JSZ A;  2E87 A;  2HMZ A;  4NTF A;  3B29 A;  4O7G A;  4J7Y A;  2YVK A;  3CEX A;  4F4B A;  2QY9 A;  3ZDL A;  3DE9 A;  3LEV A;  4K0D A;  3W8I A;  3EZH A;  4MVM A;  3ZG1 A;  1G5Z A;  2FFH A;  3FAJ A;  3GWL A;  1ZW3 A;  3ABL C;  3ZVR A;  1CPQ A;  1L3P A;  2WZL A;  2PX0 A;  3E9V A;  4CIP A;  3VAY A;  1VTM P;  4G7Z F;  1HE9 A;  3WAQ A;  2XSE A;  2IXN A;  2W9Y A;  4J7T A;  2GA0 A;  4H4K C;  1HW1 A;  1OR3 A;  2UUH A;  3V5Z A;  1TWC A;  2YKZ A;  3KPH A;  3LES A;  1XZP A;  5F28 E;  3S27 A;  3U8V A;  3UMI A;  4MTO A;  1OQC A;  1V74 B;  4XPY A;  1NFN A;  4W8K A;  3VYW A;  4IWB A;  5DQZ A;  5L0G A;  1H7I A;  1Q0K A;  1WTY A;  2YEV A;  1HY5 A;  4JEB A;  4XLP F;  1PD1 A;  5BQG A;  4IGG A;  2AU5 A;  4AK9 A;  1LI5 A;  2LQG A;  1S7Z A;  4EBK A;  1OW8 A;  4CS8 C;  1HMO A;  3FHD A;  1OCR C;  2H7V C;  1WAT A;  5T3T A;  3V7O A;  5COG A;  5KYY B;  4C7O A;  4CS7 A;  1YYX A;  2W4B A;  2YL0 A;  3ZSU A;  4JCH A;  4NQF A;  4YT2 A;  1C02 A;  1K40 A;  4JRZ A;  3RVZ A;  1JPN A;  1FTS A;  5KYX A;  1RJ9 B;  2KW3 C;  1MMA A;  3QW1 A;  1N1C A;  2KSF A;  1A7E A;  4XPX A;  3W4Y A;  1JPJ A;  5HV9 A;  2NUP A;  3FXH A;  3U3B A;  2XLV A;  3EPV A;  2OEV A;  2ZPA A;  1HMD A;  3I5Q A;  3KYJ A;  2C03 A;  2CNW D;  4JVS A;  1CGO A;  3W2V A;  3TK0 A;  1RXQ A;  3GEH A;  1D0X A;  1TFK B;  3GWN A;  3NYM A;  2LCH A;  1Q0F A;  3RKO F;  4RBN A;  2IBF A;  3RQE A;  4CX9 A;  4ZLD A;  2IXO A;  5E3A A;  2LFF A;  2LK4 A;  3N24 A;  1DOW A;  3ATP A;  4BJ5 C;  1FR0 A;  3FMS A;  5KYY A;  3Q6M A;  1D0Y A;  2YLG A;  3SXK A;  3G4Z A;  3KMI A;  4D4N A;  1FFT C;  1XZQ A;  2BC5 A;  2L6G A;  3Q6N A;  5JS5 A;  4XPW A;  4XEF A;  3V5Y A;  2WB7 A;  4FWV A;  1WGW A;  3MYF A;  1A7V A;  3I5P A;  3C7J A;  4OIR F;  4AE4 A;  4D4X A;  4EBB A;  5JLI A;  3O6X A;  1H9G A;  1KNY A;  3DI5 A;  3DZA A;  3GEI A;  2MYS A;  3SZR A;  5AC5 A;  2TMV P;  3IQC A;  4JTC B;  4MVU A;  4CIH A;  1O87 A;  5A69 A;  5JRA A;  5A6B A;  4Q4Z F;  2XXA A;  3RFY A;  1YAR O;  3UGO A;  2QTV A;  2KC3 A;  4OIQ F;  3W8H A;  3H2V A;  2VB6 A;  2W45 A;  4EIY A;  3VRC A;  4O6N A;  4G7H F;  1JMW A;  1M6T A;  1OXK A;  3HTK C;  1HW2 A;  3DWW A;  2UUI A;  2NUP B;  1A7D A;  5D92 A;  5B1B C;  1TWH A;  2KJG A;  3T4R A;  2VCB A;  3B9Q A;  3K66 A;  1ORY A;  5JSL A;  2PP4 A;  3TD7 A;  4C3B A;  1NZE A;  2L6F A;  2NUT B;  5T3W A;  1FAP B;  3RIP A;  4YJW A;  5KYX B;  4U5G A;  3DM9 B;  3IQT A;  2R9R B;  4E0I A;  2EPM X;  4PR9 A;  3DD7 A;  3U9J A;  2Q3T A;  1UFB A;  3U2M A;  4JTA B;  3T6J A;  3EFO B;  3IEE A;  2YLD A;  2WVO A;  1IW7 F;  1F1M A;  3ABM C;  3EG9 B;  3M79 A;  4PJM A;  4WGZ A;  1VLS A;  2NPU A;  3SEO A;  4ZLC A;  3K1I C;  4MW8 A;  2WL8 A;  4Z9J A;  4IJJ A;  4XEV A;  4CDV A;  1YLM A;  4YT8 A;  4C3E A;  1W2W A;  1V4A A;  3E70 C;  3FAP B;  3JRT A;  1G4W R;  5EK0 A;  2DI3 A;  5JP7 A;  2I8B A;  3AGU A;  3L8J A;  1A41 A;  2OOC A;  3EJN A;  1VB5 A;  1ZHZ A;  1TKN A;  3SP1 A;  5JT4 A;  5COM A;  1NU7 D;  5L0J A;  4EBJ A;  1VK5 A;  2EIK C;  3CQZ A;  1NBB A;  3LAY A;  1T9K A;  2B0H A;  1KU2 A;  4LDR A;  1GQA A;  4YL1 A;  4BJ6 A;  1Z23 A;  3PMR A;  3RQG A;  4N6C A;  2R7R A;  2ZXO A;  3NMK A;  3SYN A;  3H2U A;  4A2N B;  4J32 B;  4DVY P;  3PDM P;  4B6I A;  3N2Z B;  1G8X A;  1M56 C;  4DVZ A;  1D1A A;  256B A;  3HNJ A;  1R5I D;  3RF3 A;  2XL4 A;  2R02 A;  3L34 A;  2X0C A;  5A6K A;  1AUE A;  4U5B E;  2H8A A;  3JYH A;  4PK4 A;  1SR2 A;  1XWJ A;  4IAR A;  3GOR A;  1V55 C;  5B3I A;  4G7O F;  2L9J A;  1AVO B;  4KC9 A;  3AG3 C;  4N6H A;  1GM5 A;  4YL0 A;  5EHH A;  3NG1 A;  3QVZ A;  2HZ8 A;  1M2O A;  2D5R B;  3C18 A;  3C8G D;  3HNL A;  4NCQ A;  3LNM B;  3JCU Q;  2J0W A;  2J8W A;  2XLD A;  1SYQ A;  3G4X A;  2LIG A;  2NSF A;  4I1M A;  3UGP A;  1YVI A;  3S9O A;  1RJ9 A;  2NG1 A;  2Z15 A;  4JW1 A;  1BR2 A;  1SF8 A;  4UDV A;  5E3C A;  3FOO A;  5K0I A;  1JAF A;  3H65 A;  2G3K A;  3U0C A;  3JYY A;  1NSG B;  5E2Q A;  3LS1 A;  1FNT c;  1Q0D A;  5KYW A;  3C8G A;  1VYK A;  2CNW A;  1OW7 A;  2OKU A;  3T6B A;  4KI2 A;  4RDA A;  2Q9A A;  3K33 A;  1WWP A;  2R7O A;  5E33 A;  3FDQ A;  4JCZ A;  4JE9 A;  3ZIB A;  5D91 A;  3S29 A;  3S28 A;  1JOG A;  2PBE A;  1QZX A;  4EUK B;  3KKB A;  4YN0 B;  1QVX A;  3R2P A;  2Q9B A;  3KH2 A;  3EQL F;  2R7S A;  1C03 A;  2P0N A;  3GM1 A;  3SNH A;  2GWW A;  3U3F A;  2PF4 E;  1TWA A;  2A0B A;  2JPU A;  5DS5 A;  3WOD F;  1LI7 A;  5TJ5 E;  1M57 C;  1JR8 A;  4FX5 A;  2R7Q A;  3TJ6 A;  3GM3 A;  1I4Z A;  3M4B A;  4H54 A;  3GEE A;  1EA8 A;  1OXB A;  2VCC A;  2J0X A;  3TUL A;  2H7O A;  1OKK A;  2R7U A;  2H7B A;  1T6I A;  1J8M F;  3AGT A;  4U5C E;  2XLW A;  2YRF A;  4E0H A;  4Z9H A;  2G62 A;  2XS8 A;  1J8Y F;  2RSE B;  2XLM A;  1Z7Q c;  1NLX A;  4DOZ A;  4FAP B;  4DBQ A;  3ZQY A;  4CS9 C;  1TWG A;  1Z3I X;  3O55 A;  3T6G B;  3DJU B;  4DRH B;  4E7S A;  3B0U X;  4MVZ A;  3RYL A;  3Q7G A;  4QDL A;  3J06 A;  2YZS A;  3NMJ A;  1OKK D;  4OIN F;  4KBL A;  3UMH A;  2W4M A;  4BEJ A;  2YHS A;  4DXW A;  5CI8 A;  4J30 B;  2EPO A;  4XEK A;  2J7P A;  1ORS C;  3NMI A;  1K05 A;  2XLE A;  3JRM O;  2RD9 A;  2OQM A;  1V54 C;  2EIN C;  4OIP F;  3B0P A;  3C8G B;  1VOM A;  1L7C A;  3C63 A;  5DLJ A;  3NKD A;  1BDJ B;  1RKC A;  3B71 A;  4MTG A;  3X2Q C;  5L0D A;  3L8I A;  2OJQ A;  4WGY A;  4P6I C;  1D1B A;  4IAQ A;  4G0H A;  3W2W A;  2L81 A;  4IRU A;  1QKR A;  4BJ6 C;  4BJ5 A;  5DQT A;  4AE4 B;  1Z63 A;  1CGM E;  1BR1 A;  5AGF A;  3A11 A;  3I4U A;  2ZXW C;  3DE8 A;  4BPM A;  3V5X A;  1RMV A;  4PJJ A;  4GQH A;  2AP3 A;  5JVE A;  5T1D B;  2YL1 A;  1NG1 A;  1RKE B;  3AJM A;  3EGX A;  3EH2 A;  4LDQ A;  4XTK A;  1ZU4 A;  1ZW2 A;  4Q5S F;  5BUO A;  2VCA A;  1D0Z A;  2GDC A;  5HSW A;  3JZ0 A;  2X51 A;  1ZHW A;  4ONS A;  2A69 F;  2PX3 A;  3JSE O;  3L0I A;  4JZA A;  3KYI A;  3B0V C;  3QVY A;  4JJF A;  2J9U A;  2DGJ A;  5COF A;  2HMQ A;  5FZT A;  3F47 A;  5L0I A;  1E84 A;  1E85 A;  3S90 A;  3RQF A;  1MMN A;  3DAF A;  4QI0 A;  4AL1 A;  3RVY A;  3PHF 2;  2Q9C A;  4PFP A;  5GPG B;  2J9V A;  2YLI A;  4U5E E;  3UNG C;  3EHN A;  2WZF A;  2QNL A;  2XLO A;  3A9C A;  3AG1 C;  2HV7 A;  3HNK A;  3TQO A;  2J45 A;  2EPK X;  2I15 A;  2MHR A;  4CBE A;  1C17 M;  4XWJ A;  1EKY A;  2KGO A;  1ZU5 A;  3HKK A;  1YZC A;  3EG9 A;  3AOU A;  1UG7 A;  2J7P D;  1GS9 A;  3MFN A;  3OEO A;  3U9M A;  3TOL A;  4EWC A;  2EIM C;  4DBR A;  1Z5Z A;  3HJC A;  1RKE A;  3EGX B;  1Y6D A;  3M15 A;  4P9T A;  2LFD A;  2WVQ A;  4P9F A;  3MX3 A;  4DRJ B;  2NSG A;  4JKV A;  4MVQ A;  2O9X A;  5B1A C;  2EIJ C;  3FOP A;  4CS9 A;  3DJN B;  3POV A;  1OW6 A;  2R05 A;  2FGY A;  3JTL O;  1Y4C A;  1HE1 A;  1MND A;  2OG2 A;  5L0H A;  2HS5 A;  2HFI A;  2YQY A;  3UMK A;  1Z6A A;  2A6H F;  3ITF A;  5A6J A;  4Q7C A;  5B3S C;  4MS2 A;  3EZI A;  2R7V A;  4BJT A;  2A68 F;  4BJ1 A;  3KL4 A;  3NYL A;  4E18 A;  3CAX A;  2HSB A;  4YK5 A;  2R7T A;  3AG4 C;  2V3C C;  1WN0 A;  3LEO A;  4K7B A;  1MMG A;  2PNO A;  3U5S A;  4LLE A;  2OEX A;  4U9D A;  2Y69 C;  4I44 A;  3ZQV A;  1U0B B;  3QMK A;  1OCZ C;  3L1M A;  1MQV A;  3T9O A;  5CI9 A;  3O10 A;  2P7V A;  3ABK C;  3S84 A;  3SXY A;  2IXM A;  3ECS A;  1LE4 A;  4MND A;  4YT4 A;  4BG0 A;  1WOL A;  1YZA A;  3C62 A;  3CSK A;  3LS0 A;  2QUP A;  2D4U A;  2XL8 A;  4O6Y A;  3DMD A;  5L3Q A;  2CDQ A;  4U5F E;  3AQC A;  3M1C B;  1DOV A;  2IM8 A;  4MVR A;  3F46 A;  3IHU A;  2PFD A;  3IPM O;  4PJN A;  4E17 A;  2CGE A;  2HJM A;  4NTA A;  5DVW A;  3SXZ A;  3MBG A;  1TFO B;  2BL2 A;  1ST6 A;  2VAS A;  4PAC A;  2OCC C;  3NYJ A;  1ZHT A;  3EFO A;  1OCO C;  1O3U A;  4LER A;  1FFH A;  2R03 A;  4N4W A;  4QI2 A;  1O5H A;  2XL6 A;  2ZXP A;  2BE5 F;  4PJL A;  4CDY A;  5A6B D;  3QTH A;  1I4Y A;  4JUR I;  2VH3 A;  2A1D D;  3BRJ A;  4CS8 A;  1BR4 A;  1YA7 O;  5L0C A;  2CYD A;  2GFH A;  1IZM A;  2XRH A;  4OD4 A;  2HV6 A;  3NKE A;  1E83 A;  1LIH A;  4HEA J;  2KNH A;  2AVK A;  3AQB A;  3HNI A;  3HLZ A;  4YT5 A;  5L3V A;  4ULV A;  4WJ0 A;  1BZ4 A;  1QSP A;  1LS4 A;  3OWT A;  3DM5 A;  3LLK A;  4HFF B;  4CSA C;  1OR2 A;  4M63 A;  3MLG A;  3GAN A;  2JD3 A;  4HE8 D;  4U5H A;  2R7W A;  5F5F A;  4NY3 A;  1T6U A;  1ZHX A; 
#chains in the Genus database with same CATH homology
 4E18 A;  1TR2 A;  4K1O A;  2X0C A;  1YDI A;  3RF3 A;  3TJ5 A;  1T01 A;  1RKE B;  1U6H A;  5L0G A;  1RKE A;  3T6G B;  5L0C A;  4P9T A;  1ZW2 A;  3H2V A;  4IGG A;  2GDC A;  1U89 A;  2IBF A;  1XWJ A;  5L0F A;  1H6G A;  2LQG A;  4ONS A;  2HSQ A;  1ZVZ A;  1DOW A;  4DJ9 A;  5FZT A;  5L0I A;  3S90 A;  3ZDL A;  4W8P A;  5L0H A;  2GWW A;  5L0J A;  1DOV A;  1L7C A;  1SYQ A;  3VF0 A;  1RKC A;  2B0H A;  4E17 A;  1ZW3 A;  3MYI A;  3TJ6 A;  2L7A A;  4PR9 A;  5L0D A;  4EHP A;  1QKR A;  1ST6 A;  3H2U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...