1RKEA

Human vinculin head (1-258) in complex with human vinculin tail (879-1066)
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
262
structure length
262
Chain Sequence
HHHHMPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion, structural protein
molecule keywords Vinculin
publication title Vinculin activation by talin through helical bundle conversion
pubmed doi rcsb
source organism Homo sapiens
total genus 110
structure length 262
sequence length 262
ec nomenclature
pdb deposition date 2003-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1rkeA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1rkeA01
3H2VA 1L7CA 3T6GB 1H6GA 1RKCA 2LQGA 5L0JA 1RKEB 3H2UA 2HSQA 4P9TA 1U6HA 2GDCA 1ST6A 3TJ5A 5L0CA 5L0DA 2X0CA 3S90A 3ZDLA 4DJ9A 5L0GA 3TJ6A 1RKEA 1T01A 4ONSA 3MYIA 1U89A 5L0FA 1ZW3A 1ZW2A 1QKRA 1ZVZA 3VF0A 1DOVA 2GWWA 2IBFA 5L0IA 1YDIA 4E18A 4W8PA 3RF3A 5FZTA 1DOWA 2B0HA 2L7AA 4K1OA 4E17A 1SYQA 1TR2A 4IGGA 1XWJA 5L0HA 4PR9A 4EHPA
chains in the Genus database with same CATH superfamily
2KC3A 2OU6A 4JURI 2PNOA 3K1IA 1OQCA 1WATA 3GWNA 2R7VA 2LQGA 4QI0A 3SYNA 4EWCA 1A7EA 5EK0A 4LDQA 3SEOA 1U6HA 5F5HA 3ZG1A 3QVYA 1Z7Qc 3RQGA 2KYHA 3WAQA 3ZDLA 2ZXOA 4CBEA 3BEHA 4O79A 1OR3A 4ULWA 2P7VA 3N24A 4MTGA 3F46A 1FMWA 3LS1A 3EGDA 1ZHTA 4W8KA 1HMOA 4PJMA 5JSLA 5BQIA 3A9CA 3DJUB 3LNMB 3NMIA 1QQ3A 4IB4A 1S7ZA 4XEKA 3RKOF 4EBKA 4X0RA 3ZSUA 1CPQA 1U0BB 3M4BA 4BEJA 3L34A 2YWAA 3FAJA 4PR9A 2H7BA 1C03A 2R7WA 3VAYA 3X1OA 1J8YF 3IHUA 2R05A 4DRHB 3C8GB 2PFDA 2YLIA 3EG9A 1RKCA 3PMRA 1PD1A 1IZMA 1SZIA 3U9JA 1O87A 3FXHA 3I5PA 4P9FA 2GDCA 3GM1A 2XL6A 4XPYA 3HNKA 1T01A 2M4EA 1UG7A 2YLGA 2EPNA 3S84A 3J06A 3AGTA 3UMHA 3NYLA 4BG0A 5FCLA 4U5FE 1C02A 1N1CA 1ZW3A 1ZW2A 2C04A 3JYYA 5CI9A 5KYWB 2Q3TA 1FAPB 1SF8A 1YARO 3C62A 4KI2A 3C63A 1LM3B 2NUTB 3JSEO 1DOWA 1HE9A 4NTAA 3FDQA 1GM5A 4J32B 3NYJA 1T6UA 1TWHA 2XM4A 1OKKD 3AG4C 1TR2A 1WTYA 4O7GA 1ZZPA 4AK9A 4Q4ZF 3DKAA 2CW0F 4GYTA 4MVRA 4JIOA 4XEFA 1AUEA 2R7RA 2L6FA 3QZCA 2D5RB 2XL4A 3DAGA 4JVSA 3U9MA 4AX2A 4YT8A 1LE2A 2X51A 4G78A 4RDAA 1ZU5A 5JLIA 3MYFA 1ZU4A 3TK0A 2YQYA 2YZSA 3ABMC 4Z9IA 3NKDA 2XLEA 2WZGA 4DJ9A 5KYYB 3HTKC 4C3BA 1RKEA 4N4WA 1YYXA 2LP4A 5EGYA 3EH2A 1EQ1A 2GA0A 2ZPAA 2YHSA 3HNLA 3L1MA 2IBFA 3NG1A 5BQHA 1UFBA 2OKUA 2UUHA 2QNLA 2XLDA 4Q5SF 1CGNA 3L8JA 1JR8A 2OEXA 3IQ6A 3AQCA 1HW1A 2EPOA 2WVOA 2OOCA 3FOPA 2CNWA 2XLVA 2Y3DA 3QTHA 3QVZA 3EGXA 3QW1A 4XPWA 2E87A 4E7ZA 4ZLDA 3H2VA 2EPLX 3LESA 3Q7GA 2QLAA 3GODA 4JJFA 2LD6A 4U5BE 2R7SA 3ABLC 2Q4FA 1FNTc 2IYLD 2Q00A 3QMKA 2LFDA 1K05A 3S9OA 2OQMA 1G8XA 3ZIBA 1YZCA 5E3CA 2HJMA 4FX5A 5KYNA 4G7ZF 2J7PA 1Z5ZA 4NY3A 3B0VC 1PV3A 3TD7A 2NPUA 3DD7A 1NLXA 1APCA 5KYYA 3V5YA 5JS5A 5L0FA 1VOMA 4JRZA 1JRAA 3T9OA 2A1DD 3UMKA 1S05A 5E2QA 4WGZA 4AL0A 3DJNB 2GAQA 5IY5C 3O55A 1RCPA 1W2WA 2L81A 3SXYA 3S0XA 2Q9AA 3FMSA 5KYXB 5JP7A 1YZAA 5B3IA 1E86A 4OIOF 1Y4CA 1Q0KA 4BJTA 4WJ0A 1TWCA 1LKXA 3V5ZA 4H54A 1I5NA 1YAUO 3T6GB 2NSGA 2J0WA 4IJJA 3DXJF 1VK5A 1LI5A 3E70C 3EJNA 3M79A 3CEXA 4JZAA 4YK5A 3TJ5A 5EHHA 1FR0A 4EBBA 3PHF2 2A6HF 3ZTMA 2LFFA 1MMAA 4DRIB 4CS7A 5KYUA 1V54C 4H4KC 3EPVA 4MW3A 3DE8A 4U5DE 2J8WA 2J9BA 4JE9A 4EKWA 4CS8C 2W45A 3W2VA 4C3DA 3GM2A 3B9QA 4MVQA 4LLCA 1H9TA 1M2OA 1VLTA 2I15A 4NTFA 3UGPA 1OR2A 1BZ4A 5F5FA 4YWQA 2A6EF 4BJ5C 5A69A 3MX3A 5KYXA 4U5GA 3TOMA 4KNWA 2O9XA 2F22A 2ZD9A 4CX9A 2KNHA 4MVSA 2TMVP 5BUOA 5A6BD 2MHRA 1ORSC 2VCAA 3H2UA 3NRHA 4IARA 4J7YA 3LJBA 1ST6A 1R5ID 3LEOA 4JTCB 5CIVA 2Z15A 3S90A 4YL1A 1M6TA 1M2VB 3UNGC 4IAOA 1HW2A 1SMYF 1WOLA 4P6IC 3OWTA 2XLMA 4WABA 3DWWA 3LUTB 3EH1A 4JJGA 2FFHA 4GEHA 1VB5A 4ANJA 2A0BA 3I5QA 2WVNA 1D0YA 4RBNA 1RJ9B 1RMVA 3G50A 1R4TA 1ZHYA 3LS0A 4XQ1A 5FZTA 3SP1A 3U2MA 4C3EA 1KTMA 5BQGA 4CDYA 1WGWA 1KU2A 2HS5A 2J9WA 2R7XA 2WB7A 2JPUA 1VTMP 3LAYA 3RFYA 2WL8A 4LLEA 4XWJA 3S28A 3CSKA 2VB6A 3KL4A 1CGME 2JD3A 2HFIA 2H8AA 2KQ9A 5COFA 3PDMP 5L0DA 4CS8A 5JVEA 3C8ZA 1G5ZA 1GQAA 3KH2A 2HV7A 4YL3A 3VRCA 1CGOA 1M2VA 2HV6A 1VMAA 4L6RA 1NG1A 1JPNA 1PD0A 2ZXWC 1T6QA 4BJ5A 2XXAB 3VF0A 2OCCC 2GWWA 3K6BA 4BEMJ 1YDIA 3V7OA 1H9GA 3ASOC 2Y3GA 1YA9A 2XLOA 2Y39A 3U5SA 1RJ9A 4E7SA 3V5XA 4BJ1A 4YJWA 3RQFA 5L0HA 1E85A 2LK4A 3IPMO 2Y3BA 4D4NA 3M1CB 3U3BA 2EPKX 1JAFA 1ORJA 3O6XA 2HUJA 5L0JA 1Q0FA 2KK1A 1MMGA 4P9TA 1L3PA 5A6KA 1HMDA 5L0CA 1ZYRF 4XLPF 3C8GA 2L6GA 256BA 3QW0A 1VLSA 2ASRA 2A0UA 1YVIA 2VCBA 3N2ZB 1KNYA 1A41A 3NMKA 3TQOA 5E33A 3W8IA 5HSWA 2CYDA 4FESA 4GQHA 3NDBB 1G4WR 4HFKB 2GFHA 4CJGA 2EIJC 2YLDA 2KJGA 1LVKA 3K66A 2PX3A 3L0IA 2OG2A 3RF3A 3UR3C 5KYWA 3R2PA 3HNIA 4C7OB 1OW6A 1YJGA 3HNJA 1F1MA 4LDRA 4CJOA 1OW7A 4DVZA 2NUTA 1LIHA 2XL8A 5GPGB 2VH3A 1LI7A 1BR2A 1K40A 3RIPA 3VYWA 4KBLA 4OD5A 5AGFA 4O6YA 3U0CA 1Z3IX 1I4ZA 2BC5A 3AGUA 2NG1A 3JYHA 1FTSA 4DXWA 2J9UA 2EILC 4U9EA 4E0IA 3RVYA 1I4YA 4JW1A 1IW7F 4LDKA 1M56C 4YT5A 2DYRC 4KNVA 2DI3A 5DS6A 1YLMA 1CPRA 3JCUQ 4ONSA 3ZQYA 1E83A 2XLWA 4JEAA 4N6CA 1JMWA 3B29A 3WHNA 4MS2A 3SXKA 4N6HA 3JZ0A 4OD4A 2M64A 4EUKB 2PX0A 3ITFA 2XS8A 2DGJA 3S29A 4DBRA 4UDVA 5DS4A 4K0DA 1E2XA 4W8PA 1YA7O 3TULA 4YT2A 5L3VA 2W9YA 1T5OA 2L6HA 1Z63A 2V3CC 2PBEA 4MQ9F 4Z9HA 3K1HA 1NU7D 3FHDA 2LCHA 2CNWD 3SXMA 1XWJA 3T6JA 2MYSA 1Q0GA 4I3MA 4ULVA 5AC5A 3RW0A 2CCYA 5T3WA 4DRJB 1E84A 3W8HA 3AQBA 2R7QA 2KW3C 1TWAA 2XS1A 2EPMX 4O6MA 3EFOB 2EINC 2J7PD 4JCHA 4JEBA 2W4BA 3FVYA 5TJ5E 3DM9B 4CSAC 4K7BA 2HMZA 1FFHA 1U89A 3GWLA 3RH3A 1ZHZA 4G0HA 5CI8A 1TFKB 1BDJB 4CIHA 3BRJA 3AG1C 3UMIA 2OEVA 3K33A 4DBQA 1AVOB 2W4MA 3HJCA 2IXPA 4XTKA 3GEHA 3O10A 2L7AA 2NUPB 4BJ6C 1OCOC 2XLHA 3DE9A 1TFOB 1D1CA 1MMNA 3LEVA 4IRUA 3KYJA 1OCCC 5F28E 1BBHA 1LS4A 2FAPB 3LLKA 5B1AC 3E9VA 3U8VA 2BE5F 3MBGA 1EKYA 1OCZC 1QVXA 2R03A 1ORYA 4M63A 1H6GA 2R9RB 1V74B 4MTOA 2YL0A 2AWCA 2L9JA 3NKEA 4YL0A 3CZ6A 2ETSA 4NC3A 1XZPA 3ZVRA 3U3FA 4N06A 4JC7A 1LPEA 3N0TA 5COGA 2X0CA 2AP3A 3VM6A 1OXKA 4CS9C 4XEVA 5D92A 4MNDA 2P1AA 3LLIA 4BPMA 3AG3C 5T3TA 1VYIA 3T6BA 1DOVA 2XM0A 3CAXA 2A68F 5L0IA 1NFNA 2VC9A 1RXQA 4E18A 2G3VA 4KC9A 4K1OA 4MVUA 1AEPA 1GS9A 3PCVA 1MNDA 3FOOA 4R32A 3POVA 4YT4A 3EG9B 3MLGA 3SNHA 3TOLA 1NU9C 5DQZA 1NFOA 4QI2A 3B71A 3W4YA 2VCCA 4CSAA 3ASNC 1NBBA 5DS5A 1OXBA 4OINF 2Q9CA 2EIKC 2NSFA 5HV9A 4LERA 3OEOA 1WASA 2G62A 5DLJA 3TJ6A 3IEEA 3H65A 3IQCA 4EIYA 5K0IA 4BJ6A 4JKVA 3KYIA 1OCRC 2Q7RA 2A69F 2R7OA 3G4ZA 3ZWIA 1OW8A 2AVKA 2HZ8A 1ZVZA 1HE1A 5DVWA 2QTVA 2YVKA 3FAPB 3I4UA 4G7HF 1LE4A 3ZTZA 2H7OA 2YKZA 4U5HA 4OIQF 2JX0A 2MWQA 2WVQA 3IQTA 3DM5A 1OKKA 4IGGA 3RQEA 3U8PA 1JOGA 5L3QA 4CS9A 4MVOA 5E3AA 4PACA 4Z9JA 1Z23A 2J45A 3C18A 3A11A 3KKBA 2Q9BA 3T4RA 1RKEB 1O3UA 2J0XA 4FWVA 2HSQA 1YYJA 3AJMA 1GGQA 1Y6DA 1NSGB 4FAPB 2Y3HA 3G4XA 4HE8D 2ZXPA 3ATPA 1HY5A 4HFFB 3X2QC 3IQ5A 4O6NA 4YN0B 3S27A 3MFNA 3JRMO 1T9KA 3GORA 4DVYP 1QKRA 2CGEA 3DAFA 2R7TA 2DYSC 4HEAJ 3R7CA 1ZHXA 2EIMC 3EGXB 2B0HA 2C03A 1D1BA 3EQLF 5JRAA 2XXAA 2I8BA 4J30B 4OIPF 4A4AA 4MVMA 1NZEA 2WZFA 4I1MA 1VYKA 2R25A 4WGYA 1MNEA 3GM3A 5JUAA 1T6IA 3CQZA 2Y69C 5T1DB 2ZXRA 1D1AA 1L7CA 2RD9A 2LSEA 2WZLA 4LACB 3B0PA 4J7TA 4PFPA 1D0XA 4RD9A 4IWBA 3U2LA 3C8GD 2XSEA 5L0GA 1BR4A 3L8IA 2IXMA 2V26A 1TWGA 2H7VC 1WWPA 3SZRA 4OIRF 2QUPA 2HJ3A 5B1BC 2YRFA 2YL7A 4NTBA 4G7OF 2KGOA 3GEEA 3NMJA 4MTFA 2J9VA 5D91A 4CDAA 3HLZA 2PP4A 4XPXA 1K04A 4AE4B 3WODF 2HSBA 1QSPA 1O5HA 4XLNF 3EHMA 2B0JA 5A6JA 4MW8A 3EHNA 3HKKA 3JT1A 1Q0DA 4PK4A 4DOZA 2AU5A 1MMDA 1C17M 3ABKC 1V4AA 3AOUA 3W2WA 2D4UA 3EZIA 3O39A 1QLEC 3RYLA 1PCXA 3C7JA 4AL1A 4C7OA 2RSEB 3DI5A 3ECSA 3GEIA 4JCZA 3WG7C 4B6IA 4CDVA 2FGYA 3SXZA 2R02A 4F4BA 2YEVA 4IAQA 5KYUB 1H7IA 2BL2A 4ER9A 2AWYA 1A0BA 2OJQA 3Q6NA 4ZLCA 3JSZA 3K1IC 2IM8A 3MYIA 4U5EE 2R7UA 1J8MF 1D0ZA 2G3KA 3DZAA 4PFOA 2CDQA 1EA8A 4NCQA 1ZHWA 2IXOA 2PF4E 3EZHA 1FMVA 1WN0A 3RVZA 3F47A 3DMDA 4E0HA 1QZXA 4JTDB 4E17A 1G4US 5A6AA 3KMIA 4QDLA 4AE4A 2LIGA 4PJNA 4U5CE 4D4XA 2P6VA 3KPHA 1SYQA 3GANA 5AC4A 1V55C 1XZQA 1TKNA 1TQGA 3OA1A 2ICWG 4EHPA 4CIPA 3B0UX 1JPJA 2HKVA 2QY9A 3M4CA 4EBJA 3M15A 3UGOA 4NQFA 1SR2A 4MVZA 5A6BA 1M57C 1BR1A 3US6A 2UUIA 4A2NB 1A7DA 2P0NA 2XRHA 4Q7CA 3EGDB 3AG2C 5B3SC 1B68A 3Q6MA 1A7VA 4I44A 1FFTC 3EFOA 3LNRA 1EI7A 3JTLO 5COMA 2KSFA 3JRTA 1LS1A 2P61A 4I1OB 1QPUA 3Q7LA 4PJJA 5JT4A 2YL1A 3ZQVA 5DQTA 1Z6AA 2VASA 4JTAB 1MQVA 1Q0MA 2HMQA 2J46A 2OJED 2DB4A 3K7DA 3NYMA 2YL3A 4U9DA 4PJLA 2IXNA 2IOQA 3ZC4A 2NUPA 2QE9A
chains in the Genus database with same CATH topology
3H2VA 1L7CA 3T6GB 1H6GA 1RKCA 2LQGA 5L0JA 1RKEB 3H2UA 2HSQA 4P9TA 1U6HA 2GDCA 1ST6A 3TJ5A 5L0CA 5L0DA 2X0CA 3S90A 3ZDLA 4DJ9A 5L0GA 3TJ6A 1RKEA 1T01A 4ONSA 3MYIA 1U89A 5L0FA 1ZW3A 1ZW2A 1QKRA 1ZVZA 3VF0A 1DOVA 2GWWA 2IBFA 5L0IA 1YDIA 4E18A 4W8PA 3RF3A 5FZTA 1DOWA 2B0HA 2L7AA 4K1OA 4E17A 1SYQA 1TR2A 4IGGA 1XWJA 5L0HA 4PR9A 4EHPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H2V A;  1L7C A;  3T6G B;  1H6G A;  1RKC A;  2LQG A;  5L0J A;  1RKE B;  3H2U A;  2HSQ A;  4P9T A;  1U6H A;  2GDC A;  1ST6 A;  3TJ5 A;  5L0C A;  5L0D A;  2X0C A;  3S90 A;  3ZDL A;  4DJ9 A;  5L0G A;  3TJ6 A;  1RKE A;  1T01 A;  4ONS A;  3MYI A;  1U89 A;  5L0F A;  1ZW3 A;  1ZW2 A;  1QKR A;  1ZVZ A;  3VF0 A;  1DOV A;  2GWW A;  2IBF A;  5L0I A;  1YDI A;  4E18 A;  4W8P A;  3RF3 A;  5FZT A;  1DOW A;  2B0H A;  2L7A A;  4K1O A;  4E17 A;  1SYQ A;  1TR2 A;  4IGG A;  1XWJ A;  5L0H A;  4PR9 A;  4EHP A; 
#chains in the Genus database with same CATH topology
 2KC3 A;  2OU6 A;  4JUR I;  2PNO A;  3K1I A;  1OQC A;  1WAT A;  3GWN A;  2R7V A;  2LQG A;  4QI0 A;  3SYN A;  4EWC A;  1A7E A;  5EK0 A;  4LDQ A;  3SEO A;  1U6H A;  5F5H A;  3ZG1 A;  3QVY A;  1Z7Q c;  3RQG A;  2KYH A;  3WAQ A;  3ZDL A;  2ZXO A;  4CBE A;  3BEH A;  4O79 A;  1OR3 A;  4ULW A;  2P7V A;  3N24 A;  4MTG A;  3F46 A;  1FMW A;  3LS1 A;  3EGD A;  1ZHT A;  4W8K A;  1HMO A;  4PJM A;  5JSL A;  5BQI A;  3A9C A;  3DJU B;  3LNM B;  3NMI A;  1QQ3 A;  4IB4 A;  1S7Z A;  4XEK A;  3RKO F;  4EBK A;  4X0R A;  3ZSU A;  1CPQ A;  1U0B B;  3M4B A;  4BEJ A;  3L34 A;  2YWA A;  3FAJ A;  4PR9 A;  2H7B A;  1C03 A;  2R7W A;  3VAY A;  3X1O A;  1J8Y F;  3IHU A;  2R05 A;  4DRH B;  3C8G B;  2PFD A;  2YLI A;  3EG9 A;  1RKC A;  3PMR A;  1PD1 A;  1IZM A;  1SZI A;  3U9J A;  1O87 A;  3FXH A;  3I5P A;  4P9F A;  2GDC A;  3GM1 A;  2XL6 A;  4XPY A;  3HNK A;  1T01 A;  2M4E A;  1UG7 A;  2YLG A;  2EPN A;  3S84 A;  3J06 A;  3AGT A;  3UMH A;  3NYL A;  4BG0 A;  5FCL A;  4U5F E;  1C02 A;  1N1C A;  1ZW3 A;  1ZW2 A;  2C04 A;  3JYY A;  5CI9 A;  5KYW B;  2Q3T A;  1FAP B;  1SF8 A;  1YAR O;  3C62 A;  4KI2 A;  3C63 A;  1LM3 B;  2NUT B;  3JSE O;  1DOW A;  1HE9 A;  4NTA A;  3FDQ A;  1GM5 A;  4J32 B;  3NYJ A;  1T6U A;  1TWH A;  2XM4 A;  1OKK D;  3AG4 C;  1TR2 A;  1WTY A;  4O7G A;  1ZZP A;  4AK9 A;  4Q4Z F;  3DKA A;  2CW0 F;  4GYT A;  4MVR A;  4JIO A;  4XEF A;  1AUE A;  2R7R A;  2L6F A;  3QZC A;  2D5R B;  2XL4 A;  3DAG A;  4JVS A;  3U9M A;  4AX2 A;  4YT8 A;  1LE2 A;  2X51 A;  4G78 A;  4RDA A;  1ZU5 A;  5JLI A;  3MYF A;  1ZU4 A;  3TK0 A;  2YQY A;  2YZS A;  3ABM C;  4Z9I A;  3NKD A;  2XLE A;  2WZG A;  4DJ9 A;  5KYY B;  3HTK C;  4C3B A;  1RKE A;  4N4W A;  1YYX A;  2LP4 A;  5EGY A;  3EH2 A;  1EQ1 A;  2GA0 A;  2ZPA A;  2YHS A;  3HNL A;  3L1M A;  2IBF A;  3NG1 A;  5BQH A;  1UFB A;  2OKU A;  2UUH A;  2QNL A;  2XLD A;  4Q5S F;  1CGN A;  3L8J A;  1JR8 A;  2OEX A;  3IQ6 A;  3AQC A;  1HW1 A;  2EPO A;  2WVO A;  2OOC A;  3FOP A;  2CNW A;  2XLV A;  2Y3D A;  3QTH A;  3QVZ A;  3EGX A;  3QW1 A;  4XPW A;  2E87 A;  4E7Z A;  4ZLD A;  3H2V A;  2EPL X;  3LES A;  3Q7G A;  2QLA A;  3GOD A;  4JJF A;  2LD6 A;  4U5B E;  2R7S A;  3ABL C;  2Q4F A;  1FNT c;  2IYL D;  2Q00 A;  3QMK A;  2LFD A;  1K05 A;  3S9O A;  2OQM A;  1G8X A;  3ZIB A;  1YZC A;  5E3C A;  2HJM A;  4FX5 A;  5KYN A;  4G7Z F;  2J7P A;  1Z5Z A;  4NY3 A;  3B0V C;  1PV3 A;  3TD7 A;  2NPU A;  3DD7 A;  1NLX A;  1APC A;  5KYY A;  3V5Y A;  5JS5 A;  5L0F A;  1VOM A;  4JRZ A;  1JRA A;  3T9O A;  2A1D D;  3UMK A;  1S05 A;  5E2Q A;  4WGZ A;  4AL0 A;  3DJN B;  2GAQ A;  5IY5 C;  3O55 A;  1RCP A;  1W2W A;  2L81 A;  3SXY A;  3S0X A;  2Q9A A;  3FMS A;  5KYX B;  5JP7 A;  1YZA A;  5B3I A;  1E86 A;  4OIO F;  1Y4C A;  1Q0K A;  4BJT A;  4WJ0 A;  1TWC A;  1LKX A;  3V5Z A;  4H54 A;  1I5N A;  1YAU O;  3T6G B;  2NSG A;  2J0W A;  4IJJ A;  3DXJ F;  1VK5 A;  1LI5 A;  3E70 C;  3EJN A;  3M79 A;  3CEX A;  4JZA A;  4YK5 A;  3TJ5 A;  5EHH A;  1FR0 A;  4EBB A;  3PHF 2;  2A6H F;  3ZTM A;  2LFF A;  1MMA A;  4DRI B;  4CS7 A;  5KYU A;  1V54 C;  4H4K C;  3EPV A;  4MW3 A;  3DE8 A;  4U5D E;  2J8W A;  2J9B A;  4JE9 A;  4EKW A;  4CS8 C;  2W45 A;  3W2V A;  4C3D A;  3GM2 A;  3B9Q A;  4MVQ A;  4LLC A;  1H9T A;  1M2O A;  1VLT A;  2I15 A;  4NTF A;  3UGP A;  1OR2 A;  1BZ4 A;  5F5F A;  4YWQ A;  2A6E F;  4BJ5 C;  5A69 A;  3MX3 A;  5KYX A;  4U5G A;  3TOM A;  4KNW A;  2O9X A;  2F22 A;  2ZD9 A;  4CX9 A;  2KNH A;  4MVS A;  2TMV P;  5BUO A;  5A6B D;  2MHR A;  1ORS C;  2VCA A;  3H2U A;  3NRH A;  4IAR A;  4J7Y A;  3LJB A;  1ST6 A;  1R5I D;  3LEO A;  4JTC B;  5CIV A;  2Z15 A;  3S90 A;  4YL1 A;  1M6T A;  1M2V B;  3UNG C;  4IAO A;  1HW2 A;  1SMY F;  1WOL A;  4P6I C;  3OWT A;  2XLM A;  4WAB A;  3DWW A;  3LUT B;  3EH1 A;  4JJG A;  2FFH A;  4GEH A;  1VB5 A;  4ANJ A;  2A0B A;  3I5Q A;  2WVN A;  1D0Y A;  4RBN A;  1RJ9 B;  1RMV A;  3G50 A;  1R4T A;  1ZHY A;  3LS0 A;  4XQ1 A;  5FZT A;  3SP1 A;  3U2M A;  4C3E A;  1KTM A;  5BQG A;  4CDY A;  1WGW A;  1KU2 A;  2HS5 A;  2J9W A;  2R7X A;  2WB7 A;  2JPU A;  1VTM P;  3LAY A;  3RFY A;  2WL8 A;  4LLE A;  4XWJ A;  3S28 A;  3CSK A;  2VB6 A;  3KL4 A;  1CGM E;  2JD3 A;  2HFI A;  2H8A A;  2KQ9 A;  5COF A;  3PDM P;  5L0D A;  4CS8 A;  5JVE A;  3C8Z A;  1G5Z A;  1GQA A;  3KH2 A;  2HV7 A;  4YL3 A;  3VRC A;  1CGO A;  1M2V A;  2HV6 A;  1VMA A;  4L6R A;  1NG1 A;  1JPN A;  1PD0 A;  2ZXW C;  1T6Q A;  4BJ5 A;  2XXA B;  3VF0 A;  2OCC C;  2GWW A;  3K6B A;  4BEM J;  1YDI A;  3V7O A;  1H9G A;  3ASO C;  2Y3G A;  1YA9 A;  2XLO A;  2Y39 A;  3U5S A;  1RJ9 A;  4E7S A;  3V5X A;  4BJ1 A;  4YJW A;  3RQF A;  5L0H A;  1E85 A;  2LK4 A;  3IPM O;  2Y3B A;  4D4N A;  3M1C B;  3U3B A;  2EPK X;  1JAF A;  1ORJ A;  3O6X A;  2HUJ A;  5L0J A;  1Q0F A;  2KK1 A;  1MMG A;  4P9T A;  1L3P A;  5A6K A;  1HMD A;  5L0C A;  1ZYR F;  4XLP F;  3C8G A;  2L6G A;  256B A;  3QW0 A;  1VLS A;  2ASR A;  2A0U A;  1YVI A;  2VCB A;  3N2Z B;  1KNY A;  1A41 A;  3NMK A;  3TQO A;  5E33 A;  3W8I A;  5HSW A;  2CYD A;  4FES A;  4GQH A;  3NDB B;  1G4W R;  4HFK B;  2GFH A;  4CJG A;  2EIJ C;  2YLD A;  2KJG A;  1LVK A;  3K66 A;  2PX3 A;  3L0I A;  2OG2 A;  3RF3 A;  3UR3 C;  5KYW A;  3R2P A;  3HNI A;  4C7O B;  1OW6 A;  1YJG A;  3HNJ A;  1F1M A;  4LDR A;  4CJO A;  1OW7 A;  4DVZ A;  2NUT A;  1LIH A;  2XL8 A;  5GPG B;  2VH3 A;  1LI7 A;  1BR2 A;  1K40 A;  3RIP A;  3VYW A;  4KBL A;  4OD5 A;  5AGF A;  4O6Y A;  3U0C A;  1Z3I X;  1I4Z A;  2BC5 A;  3AGU A;  2NG1 A;  3JYH A;  1FTS A;  4DXW A;  2J9U A;  2EIL C;  4U9E A;  4E0I A;  3RVY A;  1I4Y A;  4JW1 A;  1IW7 F;  4LDK A;  1M56 C;  4YT5 A;  2DYR C;  4KNV A;  2DI3 A;  5DS6 A;  1YLM A;  1CPR A;  3JCU Q;  4ONS A;  3ZQY A;  1E83 A;  2XLW A;  4JEA A;  4N6C A;  1JMW A;  3B29 A;  3WHN A;  4MS2 A;  3SXK A;  4N6H A;  3JZ0 A;  4OD4 A;  2M64 A;  4EUK B;  2PX0 A;  3ITF A;  2XS8 A;  2DGJ A;  3S29 A;  4DBR A;  4UDV A;  5DS4 A;  4K0D A;  1E2X A;  4W8P A;  1YA7 O;  3TUL A;  4YT2 A;  5L3V A;  2W9Y A;  1T5O A;  2L6H A;  1Z63 A;  2V3C C;  2PBE A;  4MQ9 F;  4Z9H A;  3K1H A;  1NU7 D;  3FHD A;  2LCH A;  2CNW D;  3SXM A;  1XWJ A;  3T6J A;  2MYS A;  1Q0G A;  4I3M A;  4ULV A;  5AC5 A;  3RW0 A;  2CCY A;  5T3W A;  4DRJ B;  1E84 A;  3W8H A;  3AQB A;  2R7Q A;  2KW3 C;  1TWA A;  2XS1 A;  2EPM X;  4O6M A;  3EFO B;  2EIN C;  2J7P D;  4JCH A;  4JEB A;  2W4B A;  3FVY A;  5TJ5 E;  3DM9 B;  4CSA C;  4K7B A;  2HMZ A;  1FFH A;  1U89 A;  3GWL A;  3RH3 A;  1ZHZ A;  4G0H A;  5CI8 A;  1TFK B;  1BDJ B;  4CIH A;  3BRJ A;  3AG1 C;  3UMI A;  2OEV A;  3K33 A;  4DBQ A;  1AVO B;  2W4M A;  3HJC A;  2IXP A;  4XTK A;  3GEH A;  3O10 A;  2L7A A;  2NUP B;  4BJ6 C;  1OCO C;  2XLH A;  3DE9 A;  1TFO B;  1D1C A;  1MMN A;  3LEV A;  4IRU A;  3KYJ A;  1OCC C;  5F28 E;  1BBH A;  1LS4 A;  2FAP B;  3LLK A;  5B1A C;  3E9V A;  3U8V A;  2BE5 F;  3MBG A;  1EKY A;  1OCZ C;  1QVX A;  2R03 A;  1ORY A;  4M63 A;  1H6G A;  2R9R B;  1V74 B;  4MTO A;  2YL0 A;  2AWC A;  2L9J A;  3NKE A;  4YL0 A;  3CZ6 A;  2ETS A;  4NC3 A;  1XZP A;  3ZVR A;  3U3F A;  4N06 A;  4JC7 A;  1LPE A;  3N0T A;  5COG A;  2X0C A;  2AP3 A;  3VM6 A;  1OXK A;  4CS9 C;  4XEV A;  5D92 A;  4MND A;  2P1A A;  3LLI A;  4BPM A;  3AG3 C;  5T3T A;  1VYI A;  3T6B A;  1DOV A;  2XM0 A;  3CAX A;  2A68 F;  5L0I A;  1NFN A;  2VC9 A;  1RXQ A;  4E18 A;  2G3V A;  4KC9 A;  4K1O A;  4MVU A;  1AEP A;  1GS9 A;  3PCV A;  1MND A;  3FOO A;  4R32 A;  3POV A;  4YT4 A;  3EG9 B;  3MLG A;  3SNH A;  3TOL A;  1NU9 C;  5DQZ A;  1NFO A;  4QI2 A;  3B71 A;  3W4Y A;  2VCC A;  4CSA A;  3ASN C;  1NBB A;  5DS5 A;  1OXB A;  4OIN F;  2Q9C A;  2EIK C;  2NSF A;  5HV9 A;  4LER A;  3OEO A;  1WAS A;  2G62 A;  5DLJ A;  3TJ6 A;  3IEE A;  3H65 A;  3IQC A;  4EIY A;  5K0I A;  4BJ6 A;  4JKV A;  3KYI A;  1OCR C;  2Q7R A;  2A69 F;  2R7O A;  3G4Z A;  3ZWI A;  1OW8 A;  2AVK A;  2HZ8 A;  1ZVZ A;  1HE1 A;  5DVW A;  2QTV A;  2YVK A;  3FAP B;  3I4U A;  4G7H F;  1LE4 A;  3ZTZ A;  2H7O A;  2YKZ A;  4U5H A;  4OIQ F;  2JX0 A;  2MWQ A;  2WVQ A;  3IQT A;  3DM5 A;  1OKK A;  4IGG A;  3RQE A;  3U8P A;  1JOG A;  5L3Q A;  4CS9 A;  4MVO A;  5E3A A;  4PAC A;  4Z9J A;  1Z23 A;  2J45 A;  3C18 A;  3A11 A;  3KKB A;  2Q9B A;  3T4R A;  1RKE B;  1O3U A;  2J0X A;  4FWV A;  2HSQ A;  1YYJ A;  3AJM A;  1GGQ A;  1Y6D A;  1NSG B;  4FAP B;  2Y3H A;  3G4X A;  4HE8 D;  2ZXP A;  3ATP A;  1HY5 A;  4HFF B;  3X2Q C;  3IQ5 A;  4O6N A;  4YN0 B;  3S27 A;  3MFN A;  3JRM O;  1T9K A;  3GOR A;  4DVY P;  1QKR A;  2CGE A;  3DAF A;  2R7T A;  2DYS C;  4HEA J;  3R7C A;  1ZHX A;  2EIM C;  3EGX B;  2B0H A;  2C03 A;  1D1B A;  3EQL F;  5JRA A;  2XXA A;  2I8B A;  4J30 B;  4OIP F;  4A4A A;  4MVM A;  1NZE A;  2WZF A;  4I1M A;  1VYK A;  2R25 A;  4WGY A;  1MNE A;  3GM3 A;  5JUA A;  1T6I A;  3CQZ A;  2Y69 C;  5T1D B;  2ZXR A;  1D1A A;  1L7C A;  2RD9 A;  2LSE A;  2WZL A;  4LAC B;  3B0P A;  4J7T A;  4PFP A;  1D0X A;  4RD9 A;  4IWB A;  3U2L A;  3C8G D;  2XSE A;  5L0G A;  1BR4 A;  3L8I A;  2IXM A;  2V26 A;  1TWG A;  2H7V C;  1WWP A;  3SZR A;  4OIR F;  2QUP A;  2HJ3 A;  5B1B C;  2YRF A;  2YL7 A;  4NTB A;  4G7O F;  2KGO A;  3GEE A;  3NMJ A;  4MTF A;  2J9V A;  5D91 A;  4CDA A;  3HLZ A;  2PP4 A;  4XPX A;  1K04 A;  4AE4 B;  3WOD F;  2HSB A;  1QSP A;  1O5H A;  4XLN F;  3EHM A;  2B0J A;  5A6J A;  4MW8 A;  3EHN A;  3HKK A;  3JT1 A;  1Q0D A;  4PK4 A;  4DOZ A;  2AU5 A;  1MMD A;  1C17 M;  3ABK C;  1V4A A;  3AOU A;  3W2W A;  2D4U A;  3EZI A;  3O39 A;  1QLE C;  3RYL A;  1PCX A;  3C7J A;  4AL1 A;  4C7O A;  2RSE B;  3DI5 A;  3ECS A;  3GEI A;  4JCZ A;  3WG7 C;  4B6I A;  4CDV A;  2FGY A;  3SXZ A;  2R02 A;  4F4B A;  2YEV A;  4IAQ A;  5KYU B;  1H7I A;  2BL2 A;  4ER9 A;  2AWY A;  1A0B A;  2OJQ A;  3Q6N A;  4ZLC A;  3JSZ A;  3K1I C;  2IM8 A;  3MYI A;  4U5E E;  2R7U A;  1J8M F;  1D0Z A;  2G3K A;  3DZA A;  4PFO A;  2CDQ A;  1EA8 A;  4NCQ A;  1ZHW A;  2IXO A;  2PF4 E;  3EZH A;  1FMV A;  1WN0 A;  3RVZ A;  3F47 A;  3DMD A;  4E0H A;  1QZX A;  4JTD B;  4E17 A;  1G4U S;  5A6A A;  3KMI A;  4QDL A;  4AE4 A;  2LIG A;  4PJN A;  4U5C E;  4D4X A;  2P6V A;  3KPH A;  1SYQ A;  3GAN A;  5AC4 A;  1V55 C;  1XZQ A;  1TKN A;  1TQG A;  3OA1 A;  2ICW G;  4EHP A;  4CIP A;  3B0U X;  1JPJ A;  2HKV A;  2QY9 A;  3M4C A;  4EBJ A;  3M15 A;  3UGO A;  4NQF A;  1SR2 A;  4MVZ A;  5A6B A;  1M57 C;  1BR1 A;  3US6 A;  2UUI A;  4A2N B;  1A7D A;  2P0N A;  2XRH A;  4Q7C A;  3EGD B;  3AG2 C;  5B3S C;  1B68 A;  3Q6M A;  1A7V A;  4I44 A;  1FFT C;  3EFO A;  3LNR A;  1EI7 A;  3JTL O;  5COM A;  2KSF A;  3JRT A;  1LS1 A;  2P61 A;  4I1O B;  1QPU A;  3Q7L A;  4PJJ A;  5JT4 A;  2YL1 A;  3ZQV A;  5DQT A;  1Z6A A;  2VAS A;  4JTA B;  1MQV A;  1Q0M A;  2HMQ A;  2J46 A;  2OJE D;  2DB4 A;  3K7D A;  3NYM A;  2YL3 A;  4U9D A;  4PJL A;  2IXN A;  2IOQ A;  3ZC4 A;  2NUP A;  2QE9 A; 
#chains in the Genus database with same CATH homology
 3H2V A;  1L7C A;  3T6G B;  1H6G A;  1RKC A;  2LQG A;  5L0J A;  1RKE B;  3H2U A;  2HSQ A;  4P9T A;  1U6H A;  2GDC A;  1ST6 A;  3TJ5 A;  5L0C A;  5L0D A;  2X0C A;  3S90 A;  3ZDL A;  4DJ9 A;  5L0G A;  3TJ6 A;  1RKE A;  1T01 A;  4ONS A;  3MYI A;  1U89 A;  5L0F A;  1ZW3 A;  1ZW2 A;  1QKR A;  1ZVZ A;  3VF0 A;  1DOV A;  2GWW A;  2IBF A;  5L0I A;  1YDI A;  4E18 A;  4W8P A;  3RF3 A;  5FZT A;  1DOW A;  2B0H A;  2L7A A;  4K1O A;  4E17 A;  1SYQ A;  1TR2 A;  4IGG A;  1XWJ A;  5L0H A;  4PR9 A;  4EHP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...