2J9WA

Structural insight into the escrt-i-ii link and its role in mvb trafficking
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
101
structure length
101
Chain Sequence
HHMGNLNRCIADIVSLFITVMDKLRLEIRAMDEIQPDLRELMETMNRMSHLPPDFEGREKVSQWLQKLSSMSASDELDDSQVRQMLFDLESAYNAFNRFLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VPS28-PROV PROTEIN
publication title Structural Insight Into the Escrt-I/-II Link and its Role in Mvb Trafficking.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Protein transport
total genus 44
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1130 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2j9wA00
2J9UA 2J9WA 2G3KA 2J9VA
chains in the Genus database with same CATH superfamily
2HV6A 3WHNA 2Q9CA 3ECSA 3AOUA 1A41A 4PR9A 4XPXA 1E86A 4OD5A 4YJWA 2EIJC 2M64A 4FWVA 3SXZA 3BRJA 3U2MA 1HY5A 3PMRA 4NTAA 3BEHA 2H7BA 4IAQA 2HMQA 5GPGB 5JT4A 3ZG1A 4EHPA 2Q7RA 4OIPF 2Q9AA 1OCRC 2F22A 4IARA 1YZCA 1TQGA 2L6GA 1U0BB 3SYNA 2XLWA 2EILC 1NFOA 2EIKC 4JJGA 3VM6A 4AE4B 4E0HA 5JUAA 4CS8A 3AQBA 2G3VA 4C7OB 4MVQA 4LLEA 1YDIA 3DE9A 2GFHA 3LJBA 4OD4A 2P1AA 4K7BA 3K6BA 4JEBA 3X1OA 3J06A 2P61A 2Y3BA 2W9YA 3ATPA 3RVZA 2Q9BA 4DRHB 3A9CA 3VYWA 3TJ6A 3UMHA 2UUHA 4FX5A 3U9MA 1CGME 2ETSA 1JAFA 1Q0MA 2J0WA 4N4WA 4IB4A 2VC9A 4ULWA 1ST6A 3O39A 4DBQA 4EWCA 4NQFA 4LLCA 2NUTB 4MVSA 4JCZA 1M2VA 2VCCA 1OCOC 2YLDA 4J32B 4BJ6C 3F47A 3AG3C 4E17A 5HV9A 3GM3A 1T01A 1RXQA 2P7VA 2ZXWC 3ITFA 4XPWA 2D5RB 4R32A 4MTOA 1FMWA 2NUPA 1XWJA 2IOQA 4J7TA 1KNYA 2MHRA 3LNMB 1Z5ZA 4CBEA 1D1BA 1N1CA 1QKRA 1SF8A 3L8IA 4MQ9F 3UMKA 4BG0A 4DJ9A 1G4WR 3JRTA 4DOZA 3QMKA 3VF0A 2HS5A 1YZAA 3Q7GA 3W4YA 3HNJA 1ZVZA 2H7VC 2KSFA 1ZHWA 2Y69C 3DMDA 4P6IC 2X51A 1Z7Qc 2Q3TA 4E0IA 3DJUB 3K1IC 2MYSA 1R5ID 3DXJF 3GEEA 4MW8A 4E7SA 2YQYA 4G0HA 3C18A 3ASNC 2LQGA 3FVYA 3H2VA 4EBJA 4YT8A 1APCA 5DVWA 3C8ZA 5JLIA 4G7OF 2B0HA 3E9VA 1LS4A 4ZLDA 1ORJA 3JT1A 3O10A 4MVRA 5T3WA 2IXPA 3VRCA 4MS2A 1JRAA 4JRZA 2OJQA 3C8GA 4GEHA 1BBHA 4BEJA 3NYJA 1TR2A 5T3TA 2E87A 1YJGA 3N0TA 3V5XA 3NDBB 5T1DB 4PJNA 2XRHA 1ZZPA 5A69A 4O6MA 1RKEA 3CZ6A 3KL4A 4HFKB 1HE1A 3EPVA 2CDQA 2LCHA 2EPNA 1ZHZA 3CSKA 3SXYA 3FMSA 3NKEA 1I5NA 5DS6A 3SNHA 4CIPA 3WAQA 2XL4A 1M2VB 1O3UA 2GAQA 3X2QC 2H7OA 3DKAA 5B3IA 2R7XA 1NFNA 2YL1A 2XS8A 1V74B 2WZLA 2XLDA 4EBKA 3SZRA 5CIVA 5L0DA 5L3VA 5KYXA 1LI7A 3PHF2 1XZQA 2NUPB 4DRJB 4JURI 2WVQA 2A0BA 3DAGA 3EZIA 4NCQA 4H54A 1OQCA 1L3PA 4C7OA 4HE8D 1K40A 2XLEA 3DD7A 1VLSA 1A7VA 2NSGA 1BR2A 3ZVRA 1PV3A 1EA8A 1SZIA 2IXMA 2J46A 2Y3GA 3K66A 3U3FA 5FCLA 1VMAA 1FAPB 2XL8A 1U89A 2VASA 1Q0KA 3NYMA 1ZW3A 1T9KA 2L6FA 2JPUA 5E33A 256BA 2HJMA 2J8WA 5D91A 4BJ1A 4CJOA 2GDCA 4K1OA 1T6IA 1ZYRF 2L9JA 2M4EA 2CGEA 3HTKC 2EPLX 3RYLA 5COMA 2A0UA 2PX3A 1Y6DA 4PJMA 2DYSC 1I4ZA 2YHSA 4D4NA 1VB5A 1GM5A 3O55A 2L81A 3EHNA 1MNEA 3EQLF 5B3SC 2QY9A 4GQHA 2R7QA 1OCCC 4MVOA 2C03A 1WN0A 3KH2A 5L0JA 1YYXA 4Q5SF 3OEOA 4ER9A 1H6GA 4ANJA 3N24A 3T9OA 3TK0A 2PBEA 3KKBA 3HLZA 4JE9A 3SXKA 4MTFA 1KU2A 1OR2A 1LM3B 1RKEB 3DZAA 4FAPB 2WL8A 2A1DD 3FOPA 1TFOB 3IQ5A 2FAPB 1D1AA 3FHDA 4EIYA 3U0CA 4EUKB 2EINC 4CSAC 2L6HA 2LK4A 3LEOA 4KC9A 1FMVA 3V5YA 3UMIA 1EKYA 1NG1A 2VCBA 3QVZA 2GA0A 4G7ZF 4C3BA 5KYXB 2OG2A 3RQFA 2OKUA 2HKVA 4YT4A 2LFFA 1O5HA 1ZU4A 4M63A 3RKOF 1GQAA 3UGOA 4I44A 4WGZA 1DOVA 4YK5A 4E18A 1ZHXA 3DAFA 2D4UA 4IWBA 1ORSC 1HW2A 3GM1A 4XWJA 3B29A 2EPOA 3NG1A 3EHMA 3QTHA 4I1OB 4DVYP 5E3AA 2WVNA 2XM4A 2HSBA 2KJGA 5A6BA 5KYUB 5L0CA 1PD1A 3POVA 2R25A 4F4BA 4PFOA 4KI2A 2DI3A 2Y39A 4KNWA 3S0XA 1VTMP 2WZFA 1XZPA 1Z6AA 4A4AA 1HE9A 3K33A 3JYHA 3RF3A 1OXBA 4AK9A 1PCXA 2R7WA 1NZEA 3C8GD 2OEVA 1K04A 4DRIB 1ZW2A 2IXNA 2VB6A 1AUEA 1OW8A 4YL0A 1LI5A 1MNDA 2Q4FA 4PK4A 5A6AA 4EBBA 3E70C 1D0YA 2KNHA 2OCCC 3G4XA 3JRMO 1JOGA 3EG9B 3U5SA 1TWAA 2GWWA 3HNKA 4U5BE 3RIPA 1H9GA 4U5HA 3TJ5A 4QDLA 4ZLCA 4G7HF 3SP1A 1AVOB 3EGXB 2R7UA 2XSEA 2XLHA 1J8YF 3FAPB 5E3CA 4BJ5C 2CNWA 3RFYA 3PDMP 1RKCA 2V3CC 4JC7A 2QNLA 2QUPA 3EH2A 2PX0A 3FXHA 3L8JA 4N6HA 4NY3A 5IY5C 3JYYA 2LSEA 3IQCA 3N2ZB 3JSEO 1MMNA 1OCZC 2L7AA 3DE8A 1WASA 4U5CE 4JVSA 3T6BA 5DLJA 5TJ5E 1LKXA 1BZ4A 3QVYA 5DS4A 2HMZA 2NSFA 2X0CA 3VAYA 2UUIA 3W8HA 5BUOA 3ZTMA 3U3BA 1WTYA 5CI9A 3TOLA 2RD9A 3HKKA 3RQEA 4PJJA 3GWNA 2KK1A 2WB7A 3LLKA 1NU9C 1RCPA 3KMIA 4JIOA 1MMAA 2OEXA 4WABA 4BJ6A 5BQIA 1V54C 3M4CA 1LVKA 3EGDA 1T5OA 5E2QA 5F28E 1MQVA 2A69F 3ASOC 3GODA 2KW3C 1UG7A 3CEXA 4BJ5A 2ZPAA 4HFFB 2I8BA 3S90A 3AJMA 3OA1A 5FZTA 3WG7C 3ABLC 1E84A 3I5PA 4NTBA 1E83A 4PFPA 1C17M 3ZDLA 1QPUA 3EZHA 3S28A 4YT2A 2IM8A 4MTGA 1ZU5A 4QI0A 1SMYF 2R9RB 4CS9C 2P0NA 3I5QA 3LNRA 1Q0FA 3S84A 4CIHA 2R7VA 3K1IA 4U5DE 2Y3HA 1G4US 2YVKA 3LAYA 3NMIA 1S05A 2J45A 4XQ1A 1A7DA 2ICWG 3OWTA 4LDRA 3EH1A 3TULA 1M6TA 5BQGA 4K0DA 1OW7A 3HNLA 3FAJA 2HFIA 2ASRA 1CGOA 2Y3DA 2EPKX 3GANA 1EQ1A 5CI8A 2ZXRA 4JW1A 1NLXA 1YARO 3L1MA 5KYUA 3W8IA 5DQTA 1RJ9A 4JEAA 1M56C 2J9BA 5DS5A 2TMVP 1T6UA 3FOOA 1TKNA 1WOLA 2P6VA 2PF4E 3IEEA 3T6GB 1FTSA 4NC3A 2AVKA 4W8KA 4CDAA 2XLOA 5KYWA 3KYIA 2ZD9A 2W4BA 3Q6MA 5F5FA 3V5ZA 5EHHA 1OR3A 2CW0F 4IAOA 2JX0A 2OU6A 4MW3A 1YA7O 3JCUQ 1NU7D 2Q00A 2PNOA 3IPMO 3NMKA 4CDVA 1LPEA 2W4MA 3EG9A 3QW0A 3L0IA 1V55C 3EGDB 2ZXOA 4CS9A 3MYFA 4J7YA 3EGXA 2OJED 2HUJA 3IHUA 5B1AC 4YWQA 4JTAB 3W2WA 5KYNA 3AGUA 2NPUA 1M2OA 1C02A 2YL7A 2YLGA 1VYIA 3LESA 1HW1A 1YYJA 3C63A 4C3DA 4G78A 1LE4A 3I4UA 1CPRA 3K1HA 1ORYA 3T4RA 5L0HA 2CNWD 3Q6NA 3LLIA 3DM9B 1M57C 2C04A 3LUTB 2LP4A 4J30B 4PJLA 2EPMX 4P9TA 4CS8C 3DJNB 1TWCA 4CS7A 2HZ8A 3EJNA 4B6IA 2O9XA 1WGWA 2BL2A 4H4KC 1T6QA 3NYLA 3GORA 2HV7A 3SEOA 3ZC4A 4Q7CA 1B68A 3L34A 5F5HA 2CYDA 2IYLD 1E2XA 3IQ6A 2AWYA 4OIQF 3B0VC 5JVEA 2FGYA 4JZAA 1RJ9B 3T6JA 1UFBA 3U8PA 1WWPA 1FFTC 4U5FE 1OXKA 3DI5A 3H2UA 2J9UA 1FR0A 4U5GA 5KYWB 3NRHA 5EK0A 1ZHYA 3B9QA 4BPMA 3HNIA 1SYQA 2PFDA 3C62A 3FDQA 1D1CA 1VLTA 1JMWA 2XXAA 5K0IA 3KYJA 4I3MA 5KYYA 3EFOA 4CSAA 2OOCA 3GEHA 2DB4A 3K7DA 1RMVA 3M15A 1AEPA 4IJJA 3ABMC 2B0JA 1H7IA 3TQOA 4DBRA 4IRUA 2XLVA 2VCAA 4BJTA 2H8AA 3AG1C 4JJFA 1YA9A 1GS9A 1OKKA 1Y4CA 1NBBA 2YEVA 3GM2A 3PCVA 4LACB 1I4YA 5D92A 1QVXA 2WVOA 3ZTZA 5DQZA 4LERA 2J0XA 4DVZA 3S27A 1Z23A 4Q4ZF 4ONSA 4Z9IA 3V7OA 2XL6A 4MVZA 1IW7F 2G3KA 4LDKA 1LS1A 2EIMC 1TFKB 2R7OA 2YL0A 2IXOA 3A11A 3LEVA 3NMJA 3QW1A 4RD9A 4U5EE 1OW6A 3HJCA 4GYTA 2DYRC 2J7PA 3GWLA 4OINF 4L6RA 1LIHA 3B71A 3F46A 4AX2A 2KC3A 2PP4A 4FESA 1YAUO 1V4AA 2QE9A 4QI2A 3R2PA 5L0IA 4P9FA 3WODF 4E7ZA 3RW0A 2QLAA 1MMGA 2R03A 1U6HA 3TD7A 2J9WA 4XEVA 1LE2A 3US6A 2KGOA 5COFA 3ZIBA 2YZSA 3ABKC 2QTVA 1TWGA 3AGTA 2A6EF 3M4BA 3MFNA 2A68F 2W45A 2CCYA 3B0PA 1IZMA 4IGGA 3M1CB 4OIOF 2FFHA 3KPHA 3UNGC 5BQHA 2RSEB 3U2LA 2WZGA 5JRAA 2AU5A 4WJ0A 1BR4A 1K05A 4YL3A 3UR3C 2R7TA 3JTLO 2AWCA 1QQ3A 2HJ3A 3NKDA 3ZSUA 3MLGA 5L0FA 4JCHA 4BEMJ 4AL0A 1WATA 3ZQYA 2HSQA 5L0GA 4AL1A 2XXAB 2KYHA 3LS1A 4XEKA 4U9EA 4XTKA 1JR8A 1DOWA 3EFOB 5KYYB 1EI7A 2G62A 3AG2C 4KBLA 4DXWA 3GEIA 3RQGA 2MWQA 2I15A 2OQMA 1BDJB 1JPNA 1S7ZA 2LFDA 4U9DA 1QZXA 2XM0A 3Q7LA 2Z15A 4I1MA 1CPQA 2A6HF 3S29A 4A2NB 1Z3IX 3MYIA 1FFHA 1J8MF 1TWHA 2R05A 1VK5A 4CX9A 2VH3A 5AC4A 3B0UX 4Z9JA 1KTMA 1O87A 3JZ0A 2JD3A 5A6KA 2R7RA 1QSPA 1Z63A 2BE5F 1GGQA 1A0BA 5HSWA 4KNVA 1L7CA 2BC5A 1FNTc 3G50A 4NTFA 2YRFA 4UDVA 3O6XA 3QZCA 1E85A 1A7EA 3LS0A 4C3EA 4YT5A 1C03A 5JSLA 4PACA 2V26A 5EGYA 5A6BD 4O6YA 3ZWIA 4ULVA 2YL3A 3G4ZA 3CQZA 1G5ZA 5JP7A 1H9TA 3DM5A 5B1BC 3TOMA 1HMDA 5L3QA 1YLMA 3JSZA 1ZHTA 2IBFA 1PD0A 4RDAA 4JTCB 4X0RA 4MNDA 5AGFA 3U9JA 1G8XA 3ZQVA 1HMOA 4AE4A 4O79A 3RH3A 5COGA 4XLPF 2R7SA 4O7GA 1CGNA 4O6NA 4RBNA 2R02A 2AP3A 3AQCA 1MMDA 3W2VA 3C7JA 2J9VA 1SR2A 2LD6A 4MVUA 4N6CA 4Z9HA 3U8VA 4OIRF 3CAXA 1YVIA 2YLIA 1JPJA 3S9OA 3SXMA 4W8PA 5AC5A 4HEAJ 1OKKD 5A6JA 4XPYA 3DWWA 2XLMA 3MX3A 3R7CA 4CDYA 2YKZA 1F1MA 2NUTA 4CJGA 2LIGA 1QLEC 4N06A 1Q0DA 1Q0GA 4LDQA 4YN0B 1W2WA 4YL1A 3RVYA 2KQ9A 4D4XA 3C8GB 2J7PD 2DGJA 3IQTA 4EKWA 5JS5A 4MVMA 3AG4C 1VYKA 2NG1A 3H65A 3UGPA 1VOMA 1D0XA 2ZXPA 2YWAA 4XEFA 1NSGB 2XS1A 3M79A 1BR1A 1R4TA 4JTDB 4WGYA 4XLNF 1D0ZA 3MBGA 4JKVA
chains in the Genus database with same CATH topology
2HV6A 2Q9CA 3ECSA 4OD5A 4YJWA 2EIJC 4FWVA 3ZVRA 3PMRA 2H7BA 3ZG1A 4OIPF 2Q9AA 1OCRC 3SYNA 4JJGA 2EILC 2EIKC 4AE4B 4CS8A 3AQBA 2G3VA 4C7OB 4LLEA 2GFHA 3LJBA 4OD4A 4K7BA 3X1OA 3K6BA 2Y3BA 2W9YA 2Q9BA 3VYWA 3UMHA 4FX5A 2J0WA 4ULWA 4DBQA 1ST6A 3O39A 4EWCA 4LLCA 2NUTB 1M2VA 1OCOC 4J32B 4BJ6C 3F47A 3AG3C 2P7VA 3ITFA 2ZXWC 2D5RB 1FMWA 2NUPA 2IOQA 1Z5ZA 4CBEA 1D1BA 1N1CA 1SF8A 4MQ9F 3UMKA 4BG0A 3JRTA 4DOZA 3QMKA 3Q7GA 2H7VC 2Y69C 1ZHWA 3DMDA 4P6IC 2X51A 2Q3TA 3DJUB 3K1IC 2MYSA 3DXJF 4E7SA 4G0HA 3ASNC 3FVYA 4YT8A 4G7OF 5DVWA 3E9VA 4ZLDA 3JT1A 5T3WA 2IXPA 4GEHA 4BEJA 3NYJA 1TR2A 5T3TA 2E87A 3N0TA 3NDBB 5T1DB 4PJNA 2XRHA 4O6MA 3CZ6A 3KL4A 4HFKB 3EPVA 2CDQA 3CSKA 1ZHZA 3NKEA 5DS6A 3SNHA 3X2QC 2XL4A 1M2VB 2H7OA 2R7XA 2WZLA 5L3VA 3SZRA 5KYXA 3PHF2 2NUPB 4JURI 2WVQA 3DAGA 3EZIA 4C7OA 4HE8D 3DD7A 1BR2A 2IXMA 1SZIA 2J46A 2Y3GA 3K66A 5FCLA 1VMAA 3NYMA 2VASA 5E33A 5D91A 4BJ1A 2L9JA 1ZYRF 2M4EA 2CGEA 3HTKC 3RYLA 2PX3A 4PJMA 2DYSC 2YHSA 2L81A 3EHNA 1MNEA 3EQLF 5B3SC 2QY9A 2R7QA 1OCCC 2C03A 3KH2A 4Q5SF 3OEOA 4ANJA 3N24A 3KKBA 3HLZA 1KU2A 3DZAA 2WL8A 2A1DD 1D1AA 3FHDA 2EINC 4CSAC 4KC9A 1FMVA 3UMIA 1NG1A 4G7ZF 4C3BA 5KYXB 2OG2A 4YT4A 1O5HA 1ZU4A 4M63A 3RKOF 3UGOA 4I44A 1ZHXA 3DAFA 4IWBA 4XWJA 3NG1A 3EHMA 4I1OB 4DVYP 5E3AA 2WVNA 2KJGA 4KI2A 5KYUB 3POVA 1PD1A 4F4BA 4PFOA 2Y39A 4KNWA 3S0XA 2WZFA 1Z6AA 3K33A 3JYHA 4AK9A 1PCXA 2R7WA 1NZEA 2VB6A 2IXNA 1MNDA 4PK4A 4EBBA 3E70C 1D0YA 2KNHA 2OCCC 3EG9B 1TWAA 4U5BE 3RIPA 4ZLCA 4U5HA 4QDLA 4G7HF 3SP1A 3EGXB 2R7UA 2XSEA 1J8YF 4BJ5C 5E3CA 2CNWA 3RFYA 2V3CC 3EH2A 2PX0A 4NY3A 5IY5C 3N2ZB 2LSEA 1MMNA 1OCZC 4U5CE 4JVSA 3T6BA 5DLJA 1LKXA 5DS4A 3VAYA 3W8HA 5BUOA 5CI9A 4PJJA 2WB7A 3LLKA 1NU9C 3KMIA 4BJ6A 1MMAA 1V54C 1LVKA 3EGDA 5E2QA 2A69F 3ASOC 3GODA 2KW3C 4BJ5A 2ZPAA 4HFFB 2I8BA 3OA1A 3WG7C 3ABLC 3I5PA 4PFPA 3EZHA 3S28A 4YT2A 1ZU5A 4QI0A 1SMYF 4CS9C 3I5QA 3LNRA 2R7VA 4CIHA 4U5DE 2Y3HA 3LAYA 2J45A 3OWTA 3EH1A 4K0DA 3FAJA 2Y3DA 3GANA 5CI8A 2ZXRA 4JW1A 5DQTA 5KYUA 3W8IA 1RJ9A 1M56C 5DS5A 1TKNA 2P6VA 3IEEA 2PF4E 1FTSA 4W8KA 5KYWA 3Q6MA 2W4BA 5F5FA 5EHHA 2CW0F 4IAOA 3JCUQ 1NU7D 2W4MA 3EG9A 3L0IA 1V55C 3EGDB 2ZXOA 4CS9A 3EGXA 5B1AC 4YWQA 3W2WA 5KYNA 1M2OA 1VYIA 3LESA 4C3DA 3I4UA 3K1HA 3T4RA 2CNWD 3Q6NA 3LLIA 3DM9B 1M57C 2C04A 4J30B 4PJLA 4CS8C 3DJNB 1TWCA 4CS7A 3EJNA 4B6IA 2O9XA 1WGWA 4H4KC 3NYLA 2HV7A 3SEOA 3ZC4A 4Q7CA 3L34A 5F5HA 2IYLD 4OIQF 3B0VC 2FGYA 4JZAA 1RJ9B 3T6JA 1FFTC 4U5FE 2J9UA 4U5GA 5KYWB 3NRHA 1ZHYA 3B9QA 3FDQA 2PFDA 1D1CA 2XXAA 4I3MA 5KYYA 3EFOA 4CSAA 3K7DA 4IJJA 3ABMC 2B0JA 4DBRA 4IRUA 4BJTA 3AG1C 4JJFA 1OKKA 4LACB 5D92A 2YEVA 5DQZA 4DVZA 2WVOA 4Q4ZF 4LERA 2J0XA 3S27A 1Z23A 3V7OA 1IW7F 2G3KA 1LS1A 2EIMC 2R7OA 2IXOA 4U5EE 3LEVA 4RD9A 3HJCA 4GYTA 2DYRC 2J7PA 4AX2A 4OINF 3F46A 2PP4A 4FESA 4QI2A 3WODF 4E7ZA 1MMGA 3TD7A 2J9WA 2KGOA 3ZIBA 2YZSA 3ABKC 2QTVA 1TWGA 2A6EF 2A68F 2W45A 3B0PA 1IZMA 3M1CB 4OIOF 2FFHA 3UNGC 2WZGA 4WJ0A 1BR4A 3UR3C 2R7TA 3NKDA 3ZSUA 3MLGA 4JCHA 2XXAB 3LS1A 4XTKA 5KYYB 3EFOB 2G62A 3AG2C 4KBLA 2MWQA 1JPNA 1S7ZA 1QZXA 4I1MA 3Q7LA 2Z15A 4A2NB 2A6HF 3S29A 1Z3IX 1FFHA 1J8MF 1TWHA 3B0UX 1VK5A 2VH3A 1O87A 2JD3A 2R7RA 1Z63A 2BE5F 5HSWA 4KNVA 3O6XA 3QZCA 3LS0A 4C3EA 4YT5A 2V26A 5EGYA 4O6YA 3CQZA 3DM5A 5B1BC 5L3QA 3JSZA 1ZHTA 4X0RA 1PD0A 4RDAA 4AE4A 4MNDA 1G8XA 4O79A 3RH3A 4XLPF 2R7SA 4O7GA 4RBNA 4O6NA 3W2VA 3AQCA 1MMDA 2J9VA 4OIRF 1JPJA 4HEAJ 1OKKD 3MX3A 2NUTA 1QLEC 4N06A 4YN0B 1W2WA 2KQ9A 2J7PD 2DGJA 3AG4C 1VYKA 2NG1A 3H65A 3UGPA 1VOMA 1D0XA 2ZXPA 1BR1A 4XLNF 1D0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J9U A;  2J9W A;  2G3K A;  2J9V A; 
#chains in the Genus database with same CATH topology
 2HV6 A;  3WHN A;  2Q9C A;  3ECS A;  3AOU A;  1A41 A;  4PR9 A;  4XPX A;  1E86 A;  4OD5 A;  4YJW A;  2EIJ C;  2M64 A;  4FWV A;  3SXZ A;  3BRJ A;  3U2M A;  1HY5 A;  3PMR A;  4NTA A;  3BEH A;  2H7B A;  4IAQ A;  2HMQ A;  5GPG B;  5JT4 A;  3ZG1 A;  4EHP A;  2Q7R A;  4OIP F;  2Q9A A;  1OCR C;  2F22 A;  4IAR A;  1YZC A;  1TQG A;  2L6G A;  1U0B B;  3SYN A;  2XLW A;  2EIL C;  1NFO A;  2EIK C;  4JJG A;  3VM6 A;  4AE4 B;  4E0H A;  5JUA A;  4CS8 A;  3AQB A;  2G3V A;  4C7O B;  4MVQ A;  4LLE A;  1YDI A;  3DE9 A;  2GFH A;  3LJB A;  4OD4 A;  2P1A A;  4K7B A;  3K6B A;  4JEB A;  3X1O A;  3J06 A;  2P61 A;  2Y3B A;  2W9Y A;  3ATP A;  3RVZ A;  2Q9B A;  4DRH B;  3A9C A;  3VYW A;  3TJ6 A;  3UMH A;  2UUH A;  4FX5 A;  3U9M A;  1CGM E;  2ETS A;  1JAF A;  1Q0M A;  2J0W A;  4N4W A;  4IB4 A;  2VC9 A;  4ULW A;  1ST6 A;  3O39 A;  4DBQ A;  4EWC A;  4NQF A;  4LLC A;  2NUT B;  4MVS A;  4JCZ A;  1M2V A;  2VCC A;  1OCO C;  2YLD A;  4J32 B;  4BJ6 C;  3F47 A;  3AG3 C;  4E17 A;  5HV9 A;  3GM3 A;  1T01 A;  1RXQ A;  2P7V A;  2ZXW C;  3ITF A;  4XPW A;  2D5R B;  4R32 A;  4MTO A;  1FMW A;  2NUP A;  1XWJ A;  2IOQ A;  4J7T A;  1KNY A;  2MHR A;  3LNM B;  1Z5Z A;  4CBE A;  1D1B A;  1N1C A;  1QKR A;  1SF8 A;  3L8I A;  4MQ9 F;  3UMK A;  4BG0 A;  4DJ9 A;  1G4W R;  3JRT A;  4DOZ A;  3QMK A;  3VF0 A;  2HS5 A;  1YZA A;  3Q7G A;  3W4Y A;  3HNJ A;  1ZVZ A;  2H7V C;  2KSF A;  1ZHW A;  2Y69 C;  3DMD A;  4P6I C;  2X51 A;  1Z7Q c;  2Q3T A;  4E0I A;  3DJU B;  3K1I C;  2MYS A;  1R5I D;  3DXJ F;  3GEE A;  4MW8 A;  4E7S A;  2YQY A;  4G0H A;  3C18 A;  3ASN C;  2LQG A;  3FVY A;  3H2V A;  4EBJ A;  4YT8 A;  1APC A;  5DVW A;  3C8Z A;  5JLI A;  4G7O F;  2B0H A;  3E9V A;  1LS4 A;  4ZLD A;  1ORJ A;  3JT1 A;  3O10 A;  4MVR A;  5T3W A;  2IXP A;  3VRC A;  4MS2 A;  1JRA A;  4JRZ A;  2OJQ A;  3C8G A;  4GEH A;  1BBH A;  4BEJ A;  3NYJ A;  1TR2 A;  5T3T A;  2E87 A;  1YJG A;  3N0T A;  3V5X A;  3NDB B;  5T1D B;  4PJN A;  2XRH A;  1ZZP A;  5A69 A;  4O6M A;  1RKE A;  3CZ6 A;  3KL4 A;  4HFK B;  1HE1 A;  3EPV A;  2CDQ A;  2LCH A;  2EPN A;  1ZHZ A;  3CSK A;  3SXY A;  3FMS A;  3NKE A;  1I5N A;  5DS6 A;  3SNH A;  4CIP A;  3WAQ A;  2XL4 A;  1M2V B;  1O3U A;  2GAQ A;  3X2Q C;  2H7O A;  3DKA A;  5B3I A;  2R7X A;  1NFN A;  2YL1 A;  2XS8 A;  1V74 B;  2WZL A;  2XLD A;  4EBK A;  3SZR A;  5CIV A;  5L0D A;  5L3V A;  5KYX A;  1LI7 A;  3PHF 2;  1XZQ A;  2NUP B;  4DRJ B;  4JUR I;  2WVQ A;  2A0B A;  3DAG A;  3EZI A;  4NCQ A;  4H54 A;  1OQC A;  1L3P A;  4C7O A;  4HE8 D;  1K40 A;  2XLE A;  3DD7 A;  1VLS A;  1A7V A;  2NSG A;  1BR2 A;  3ZVR A;  1PV3 A;  1EA8 A;  1SZI A;  2IXM A;  2J46 A;  2Y3G A;  3K66 A;  3U3F A;  5FCL A;  1VMA A;  1FAP B;  2XL8 A;  1U89 A;  2VAS A;  1Q0K A;  3NYM A;  1ZW3 A;  1T9K A;  2L6F A;  2JPU A;  5E33 A;  256B A;  2HJM A;  2J8W A;  5D91 A;  4BJ1 A;  4CJO A;  2GDC A;  4K1O A;  1T6I A;  1ZYR F;  2L9J A;  2M4E A;  2CGE A;  3HTK C;  2EPL X;  3RYL A;  5COM A;  2A0U A;  2PX3 A;  1Y6D A;  4PJM A;  2DYS C;  1I4Z A;  2YHS A;  4D4N A;  1VB5 A;  1GM5 A;  3O55 A;  2L81 A;  3EHN A;  1MNE A;  3EQL F;  5B3S C;  2QY9 A;  4GQH A;  2R7Q A;  1OCC C;  4MVO A;  2C03 A;  1WN0 A;  3KH2 A;  5L0J A;  1YYX A;  4Q5S F;  3OEO A;  4ER9 A;  1H6G A;  4ANJ A;  3N24 A;  3T9O A;  3TK0 A;  2PBE A;  3KKB A;  3HLZ A;  4JE9 A;  3SXK A;  4MTF A;  1KU2 A;  1OR2 A;  1LM3 B;  1RKE B;  3DZA A;  4FAP B;  2WL8 A;  2A1D D;  3FOP A;  1TFO B;  3IQ5 A;  2FAP B;  1D1A A;  3FHD A;  4EIY A;  3U0C A;  4EUK B;  2EIN C;  4CSA C;  2L6H A;  2LK4 A;  3LEO A;  4KC9 A;  1FMV A;  3V5Y A;  3UMI A;  1EKY A;  1NG1 A;  2VCB A;  3QVZ A;  2GA0 A;  4G7Z F;  4C3B A;  5KYX B;  2OG2 A;  3RQF A;  2OKU A;  2HKV A;  4YT4 A;  2LFF A;  1O5H A;  1ZU4 A;  4M63 A;  3RKO F;  1GQA A;  3UGO A;  4I44 A;  4WGZ A;  1DOV A;  4YK5 A;  4E18 A;  1ZHX A;  3DAF A;  2D4U A;  4IWB A;  1ORS C;  1HW2 A;  3GM1 A;  4XWJ A;  3B29 A;  2EPO A;  3NG1 A;  3EHM A;  3QTH A;  4I1O B;  4DVY P;  5E3A A;  2WVN A;  2XM4 A;  2HSB A;  2KJG A;  5A6B A;  5KYU B;  5L0C A;  1PD1 A;  3POV A;  2R25 A;  4F4B A;  4PFO A;  4KI2 A;  2DI3 A;  2Y39 A;  4KNW A;  3S0X A;  1VTM P;  2WZF A;  1XZP A;  1Z6A A;  4A4A A;  1HE9 A;  3K33 A;  3JYH A;  3RF3 A;  1OXB A;  4AK9 A;  1PCX A;  2R7W A;  1NZE A;  3C8G D;  2OEV A;  1K04 A;  4DRI B;  1ZW2 A;  2IXN A;  2VB6 A;  1AUE A;  1OW8 A;  4YL0 A;  1LI5 A;  1MND A;  2Q4F A;  4PK4 A;  5A6A A;  4EBB A;  3E70 C;  1D0Y A;  2KNH A;  2OCC C;  3G4X A;  3JRM O;  1JOG A;  3EG9 B;  3U5S A;  1TWA A;  2GWW A;  3HNK A;  4U5B E;  3RIP A;  1H9G A;  4U5H A;  3TJ5 A;  4QDL A;  4ZLC A;  4G7H F;  3SP1 A;  1AVO B;  3EGX B;  2R7U A;  2XSE A;  2XLH A;  1J8Y F;  3FAP B;  5E3C A;  4BJ5 C;  2CNW A;  3RFY A;  3PDM P;  1RKC A;  2V3C C;  4JC7 A;  2QNL A;  2QUP A;  3EH2 A;  2PX0 A;  3FXH A;  3L8J A;  4N6H A;  4NY3 A;  5IY5 C;  3JYY A;  2LSE A;  3IQC A;  3N2Z B;  3JSE O;  1MMN A;  1OCZ C;  2L7A A;  3DE8 A;  1WAS A;  4U5C E;  4JVS A;  3T6B A;  5DLJ A;  5TJ5 E;  1LKX A;  1BZ4 A;  3QVY A;  5DS4 A;  2HMZ A;  2NSF A;  2X0C A;  3VAY A;  2UUI A;  3W8H A;  5BUO A;  3ZTM A;  3U3B A;  1WTY A;  5CI9 A;  3TOL A;  2RD9 A;  3HKK A;  3RQE A;  4PJJ A;  3GWN A;  2KK1 A;  2WB7 A;  3LLK A;  1NU9 C;  1RCP A;  3KMI A;  4JIO A;  1MMA A;  2OEX A;  4WAB A;  4BJ6 A;  5BQI A;  1V54 C;  3M4C A;  1LVK A;  3EGD A;  1T5O A;  5E2Q A;  5F28 E;  1MQV A;  2A69 F;  3ASO C;  3GOD A;  2KW3 C;  1UG7 A;  3CEX A;  4BJ5 A;  2ZPA A;  4HFF B;  2I8B A;  3S90 A;  3AJM A;  3OA1 A;  5FZT A;  3WG7 C;  3ABL C;  1E84 A;  3I5P A;  4NTB A;  1E83 A;  4PFP A;  1C17 M;  3ZDL A;  1QPU A;  3EZH A;  3S28 A;  4YT2 A;  2IM8 A;  4MTG A;  1ZU5 A;  4QI0 A;  1SMY F;  2R9R B;  4CS9 C;  2P0N A;  3I5Q A;  3LNR A;  1Q0F A;  3S84 A;  4CIH A;  2R7V A;  3K1I A;  4U5D E;  2Y3H A;  1G4U S;  2YVK A;  3LAY A;  3NMI A;  1S05 A;  2J45 A;  4XQ1 A;  1A7D A;  2ICW G;  3OWT A;  4LDR A;  3EH1 A;  3TUL A;  1M6T A;  5BQG A;  4K0D A;  1OW7 A;  3HNL A;  3FAJ A;  2HFI A;  2ASR A;  1CGO A;  2Y3D A;  2EPK X;  3GAN A;  1EQ1 A;  5CI8 A;  2ZXR A;  4JW1 A;  1NLX A;  1YAR O;  3L1M A;  5KYU A;  3W8I A;  5DQT A;  1RJ9 A;  4JEA A;  1M56 C;  2J9B A;  5DS5 A;  2TMV P;  1T6U A;  3FOO A;  1TKN A;  1WOL A;  2P6V A;  2PF4 E;  3IEE A;  3T6G B;  1FTS A;  4NC3 A;  2AVK A;  4W8K A;  4CDA A;  2XLO A;  5KYW A;  3KYI A;  2ZD9 A;  2W4B A;  3Q6M A;  5F5F A;  3V5Z A;  5EHH A;  1OR3 A;  2CW0 F;  4IAO A;  2JX0 A;  2OU6 A;  4MW3 A;  1YA7 O;  3JCU Q;  1NU7 D;  2Q00 A;  2PNO A;  3IPM O;  3NMK A;  4CDV A;  1LPE A;  2W4M A;  3EG9 A;  3QW0 A;  3L0I A;  1V55 C;  3EGD B;  2ZXO A;  4CS9 A;  3MYF A;  4J7Y A;  3EGX A;  2OJE D;  2HUJ A;  3IHU A;  5B1A C;  4YWQ A;  4JTA B;  3W2W A;  5KYN A;  3AGU A;  2NPU A;  1M2O A;  1C02 A;  2YL7 A;  2YLG A;  1VYI A;  3LES A;  1HW1 A;  1YYJ A;  3C63 A;  4C3D A;  4G78 A;  1LE4 A;  3I4U A;  1CPR A;  3K1H A;  1ORY A;  3T4R A;  5L0H A;  2CNW D;  3Q6N A;  3LLI A;  3DM9 B;  1M57 C;  2C04 A;  3LUT B;  2LP4 A;  4J30 B;  4PJL A;  2EPM X;  4P9T A;  4CS8 C;  3DJN B;  1TWC A;  4CS7 A;  2HZ8 A;  3EJN A;  4B6I A;  2O9X A;  1WGW A;  2BL2 A;  4H4K C;  1T6Q A;  3NYL A;  3GOR A;  2HV7 A;  3SEO A;  3ZC4 A;  4Q7C A;  1B68 A;  3L34 A;  5F5H A;  2CYD A;  2IYL D;  1E2X A;  3IQ6 A;  2AWY A;  4OIQ F;  3B0V C;  5JVE A;  2FGY A;  4JZA A;  1RJ9 B;  3T6J A;  1UFB A;  3U8P A;  1WWP A;  1FFT C;  4U5F E;  1OXK A;  3DI5 A;  3H2U A;  2J9U A;  1FR0 A;  4U5G A;  5KYW B;  3NRH A;  5EK0 A;  1ZHY A;  3B9Q A;  4BPM A;  3HNI A;  1SYQ A;  2PFD A;  3C62 A;  3FDQ A;  1D1C A;  1VLT A;  1JMW A;  2XXA A;  5K0I A;  3KYJ A;  4I3M A;  5KYY A;  3EFO A;  4CSA A;  2OOC A;  3GEH A;  2DB4 A;  3K7D A;  1RMV A;  3M15 A;  1AEP A;  4IJJ A;  3ABM C;  2B0J A;  1H7I A;  3TQO A;  4DBR A;  4IRU A;  2XLV A;  2VCA A;  4BJT A;  2H8A A;  3AG1 C;  4JJF A;  1YA9 A;  1GS9 A;  1OKK A;  1Y4C A;  1NBB A;  2YEV A;  3GM2 A;  3PCV A;  4LAC B;  1I4Y A;  5D92 A;  1QVX A;  2WVO A;  3ZTZ A;  5DQZ A;  4LER A;  2J0X A;  4DVZ A;  3S27 A;  1Z23 A;  4Q4Z F;  4ONS A;  4Z9I A;  3V7O A;  2XL6 A;  4MVZ A;  1IW7 F;  2G3K A;  4LDK A;  1LS1 A;  2EIM C;  1TFK B;  2R7O A;  2YL0 A;  2IXO A;  3A11 A;  3LEV A;  3NMJ A;  3QW1 A;  4RD9 A;  4U5E E;  1OW6 A;  3HJC A;  4GYT A;  2DYR C;  2J7P A;  3GWL A;  4OIN F;  4L6R A;  1LIH A;  3B71 A;  3F46 A;  4AX2 A;  2KC3 A;  2PP4 A;  4FES A;  1YAU O;  1V4A A;  2QE9 A;  4QI2 A;  3R2P A;  5L0I A;  4P9F A;  3WOD F;  4E7Z A;  3RW0 A;  2QLA A;  1MMG A;  2R03 A;  1U6H A;  3TD7 A;  2J9W A;  4XEV A;  1LE2 A;  3US6 A;  2KGO A;  5COF A;  3ZIB A;  2YZS A;  3ABK C;  2QTV A;  1TWG A;  3AGT A;  2A6E F;  3M4B A;  3MFN A;  2A68 F;  2W45 A;  2CCY A;  3B0P A;  1IZM A;  4IGG A;  3M1C B;  4OIO F;  2FFH A;  3KPH A;  3UNG C;  5BQH A;  2RSE B;  3U2L A;  2WZG A;  5JRA A;  2AU5 A;  4WJ0 A;  1BR4 A;  1K05 A;  4YL3 A;  3UR3 C;  2R7T A;  3JTL O;  2AWC A;  1QQ3 A;  2HJ3 A;  3NKD A;  3ZSU A;  3MLG A;  5L0F A;  4JCH A;  4BEM J;  4AL0 A;  1WAT A;  3ZQY A;  2HSQ A;  5L0G A;  4AL1 A;  2XXA B;  2KYH A;  3LS1 A;  4XEK A;  4U9E A;  4XTK A;  1JR8 A;  1DOW A;  3EFO B;  5KYY B;  1EI7 A;  2G62 A;  3AG2 C;  4KBL A;  4DXW A;  3GEI A;  3RQG A;  2MWQ A;  2I15 A;  2OQM A;  1BDJ B;  1JPN A;  1S7Z A;  2LFD A;  4U9D A;  1QZX A;  2XM0 A;  3Q7L A;  2Z15 A;  4I1M A;  1CPQ A;  2A6H F;  3S29 A;  4A2N B;  1Z3I X;  3MYI A;  1FFH A;  1J8M F;  1TWH A;  2R05 A;  1VK5 A;  4CX9 A;  2VH3 A;  5AC4 A;  3B0U X;  4Z9J A;  1KTM A;  1O87 A;  3JZ0 A;  2JD3 A;  5A6K A;  2R7R A;  1QSP A;  1Z63 A;  2BE5 F;  1GGQ A;  1A0B A;  5HSW A;  4KNV A;  1L7C A;  2BC5 A;  1FNT c;  3G50 A;  4NTF A;  2YRF A;  4UDV A;  3O6X A;  3QZC A;  1E85 A;  1A7E A;  3LS0 A;  4C3E A;  4YT5 A;  1C03 A;  5JSL A;  4PAC A;  2V26 A;  5EGY A;  5A6B D;  4O6Y A;  3ZWI A;  4ULV A;  2YL3 A;  3G4Z A;  3CQZ A;  1G5Z A;  5JP7 A;  1H9T A;  3DM5 A;  5B1B C;  3TOM A;  1HMD A;  5L3Q A;  1YLM A;  3JSZ A;  1ZHT A;  2IBF A;  1PD0 A;  4RDA A;  4JTC B;  4X0R A;  4MND A;  5AGF A;  3U9J A;  1G8X A;  3ZQV A;  1HMO A;  4AE4 A;  4O79 A;  3RH3 A;  5COG A;  4XLP F;  2R7S A;  4O7G A;  1CGN A;  4O6N A;  4RBN A;  2R02 A;  2AP3 A;  3AQC A;  1MMD A;  3W2V A;  3C7J A;  2J9V A;  1SR2 A;  2LD6 A;  4MVU A;  4N6C A;  4Z9H A;  3U8V A;  4OIR F;  3CAX A;  1YVI A;  2YLI A;  1JPJ A;  3S9O A;  3SXM A;  4W8P A;  5AC5 A;  4HEA J;  1OKK D;  5A6J A;  4XPY A;  3DWW A;  2XLM A;  3MX3 A;  3R7C A;  4CDY A;  2YKZ A;  1F1M A;  2NUT A;  4CJG A;  2LIG A;  1QLE C;  4N06 A;  1Q0D A;  1Q0G A;  4LDQ A;  4YN0 B;  1W2W A;  4YL1 A;  3RVY A;  2KQ9 A;  4D4X A;  3C8G B;  2J7P D;  2DGJ A;  3IQT A;  4EKW A;  5JS5 A;  4MVM A;  3AG4 C;  1VYK A;  2NG1 A;  3H65 A;  3UGP A;  1VOM A;  1D0X A;  2ZXP A;  2YWA A;  4XEF A;  1NSG B;  2XS1 A;  3M79 A;  1BR1 A;  1R4T A;  4JTD B;  4WGY A;  4XLN F;  1D0Z A;  3MBG A;  4JKV A; 
#chains in the Genus database with same CATH homology
 2HV6 A;  2Q9C A;  3ECS A;  4OD5 A;  4YJW A;  2EIJ C;  4FWV A;  3ZVR A;  3PMR A;  2H7B A;  3ZG1 A;  4OIP F;  2Q9A A;  1OCR C;  3SYN A;  4JJG A;  2EIL C;  2EIK C;  4AE4 B;  4CS8 A;  3AQB A;  2G3V A;  4C7O B;  4LLE A;  2GFH A;  3LJB A;  4OD4 A;  4K7B A;  3X1O A;  3K6B A;  2Y3B A;  2W9Y A;  2Q9B A;  3VYW A;  3UMH A;  4FX5 A;  2J0W A;  4ULW A;  4DBQ A;  1ST6 A;  3O39 A;  4EWC A;  4LLC A;  2NUT B;  1M2V A;  1OCO C;  4J32 B;  4BJ6 C;  3F47 A;  3AG3 C;  2P7V A;  3ITF A;  2ZXW C;  2D5R B;  1FMW A;  2NUP A;  2IOQ A;  1Z5Z A;  4CBE A;  1D1B A;  1N1C A;  1SF8 A;  4MQ9 F;  3UMK A;  4BG0 A;  3JRT A;  4DOZ A;  3QMK A;  3Q7G A;  2H7V C;  2Y69 C;  1ZHW A;  3DMD A;  4P6I C;  2X51 A;  2Q3T A;  3DJU B;  3K1I C;  2MYS A;  3DXJ F;  4E7S A;  4G0H A;  3ASN C;  3FVY A;  4YT8 A;  4G7O F;  5DVW A;  3E9V A;  4ZLD A;  3JT1 A;  5T3W A;  2IXP A;  4GEH A;  4BEJ A;  3NYJ A;  1TR2 A;  5T3T A;  2E87 A;  3N0T A;  3NDB B;  5T1D B;  4PJN A;  2XRH A;  4O6M A;  3CZ6 A;  3KL4 A;  4HFK B;  3EPV A;  2CDQ A;  3CSK A;  1ZHZ A;  3NKE A;  5DS6 A;  3SNH A;  3X2Q C;  2XL4 A;  1M2V B;  2H7O A;  2R7X A;  2WZL A;  5L3V A;  3SZR A;  5KYX A;  3PHF 2;  2NUP B;  4JUR I;  2WVQ A;  3DAG A;  3EZI A;  4C7O A;  4HE8 D;  3DD7 A;  1BR2 A;  2IXM A;  1SZI A;  2J46 A;  2Y3G A;  3K66 A;  5FCL A;  1VMA A;  3NYM A;  2VAS A;  5E33 A;  5D91 A;  4BJ1 A;  2L9J A;  1ZYR F;  2M4E A;  2CGE A;  3HTK C;  3RYL A;  2PX3 A;  4PJM A;  2DYS C;  2YHS A;  2L81 A;  3EHN A;  1MNE A;  3EQL F;  5B3S C;  2QY9 A;  2R7Q A;  1OCC C;  2C03 A;  3KH2 A;  4Q5S F;  3OEO A;  4ANJ A;  3N24 A;  3KKB A;  3HLZ A;  1KU2 A;  3DZA A;  2WL8 A;  2A1D D;  1D1A A;  3FHD A;  2EIN C;  4CSA C;  4KC9 A;  1FMV A;  3UMI A;  1NG1 A;  4G7Z F;  4C3B A;  5KYX B;  2OG2 A;  4YT4 A;  1O5H A;  1ZU4 A;  4M63 A;  3RKO F;  3UGO A;  4I44 A;  1ZHX A;  3DAF A;  4IWB A;  4XWJ A;  3NG1 A;  3EHM A;  4I1O B;  4DVY P;  5E3A A;  2WVN A;  2KJG A;  4KI2 A;  5KYU B;  3POV A;  1PD1 A;  4F4B A;  4PFO A;  2Y39 A;  4KNW A;  3S0X A;  2WZF A;  1Z6A A;  3K33 A;  3JYH A;  4AK9 A;  1PCX A;  2R7W A;  1NZE A;  2VB6 A;  2IXN A;  1MND A;  4PK4 A;  4EBB A;  3E70 C;  1D0Y A;  2KNH A;  2OCC C;  3EG9 B;  1TWA A;  4U5B E;  3RIP A;  4ZLC A;  4U5H A;  4QDL A;  4G7H F;  3SP1 A;  3EGX B;  2R7U A;  2XSE A;  1J8Y F;  4BJ5 C;  5E3C A;  2CNW A;  3RFY A;  2V3C C;  3EH2 A;  2PX0 A;  4NY3 A;  5IY5 C;  3N2Z B;  2LSE A;  1MMN A;  1OCZ C;  4U5C E;  4JVS A;  3T6B A;  5DLJ A;  1LKX A;  5DS4 A;  3VAY A;  3W8H A;  5BUO A;  5CI9 A;  4PJJ A;  2WB7 A;  3LLK A;  1NU9 C;  3KMI A;  4BJ6 A;  1MMA A;  1V54 C;  1LVK A;  3EGD A;  5E2Q A;  2A69 F;  3ASO C;  3GOD A;  2KW3 C;  4BJ5 A;  2ZPA A;  4HFF B;  2I8B A;  3OA1 A;  3WG7 C;  3ABL C;  3I5P A;  4PFP A;  3EZH A;  3S28 A;  4YT2 A;  1ZU5 A;  4QI0 A;  1SMY F;  4CS9 C;  3I5Q A;  3LNR A;  2R7V A;  4CIH A;  4U5D E;  2Y3H A;  3LAY A;  2J45 A;  3OWT A;  3EH1 A;  4K0D A;  3FAJ A;  2Y3D A;  3GAN A;  5CI8 A;  2ZXR A;  4JW1 A;  5DQT A;  5KYU A;  3W8I A;  1RJ9 A;  1M56 C;  5DS5 A;  1TKN A;  2P6V A;  3IEE A;  2PF4 E;  1FTS A;  4W8K A;  5KYW A;  3Q6M A;  2W4B A;  5F5F A;  5EHH A;  2CW0 F;  4IAO A;  3JCU Q;  1NU7 D;  2W4M A;  3EG9 A;  3L0I A;  1V55 C;  3EGD B;  2ZXO A;  4CS9 A;  3EGX A;  5B1A C;  4YWQ A;  3W2W A;  5KYN A;  1M2O A;  1VYI A;  3LES A;  4C3D A;  3I4U A;  3K1H A;  3T4R A;  2CNW D;  3Q6N A;  3LLI A;  3DM9 B;  1M57 C;  2C04 A;  4J30 B;  4PJL A;  4CS8 C;  3DJN B;  1TWC A;  4CS7 A;  3EJN A;  4B6I A;  2O9X A;  1WGW A;  4H4K C;  3NYL A;  2HV7 A;  3SEO A;  3ZC4 A;  4Q7C A;  3L34 A;  5F5H A;  2IYL D;  4OIQ F;  3B0V C;  2FGY A;  4JZA A;  1RJ9 B;  3T6J A;  1FFT C;  4U5F E;  2J9U A;  4U5G A;  5KYW B;  3NRH A;  1ZHY A;  3B9Q A;  3FDQ A;  2PFD A;  1D1C A;  2XXA A;  4I3M A;  5KYY A;  3EFO A;  4CSA A;  3K7D A;  4IJJ A;  3ABM C;  2B0J A;  4DBR A;  4IRU A;  4BJT A;  3AG1 C;  4JJF A;  1OKK A;  4LAC B;  5D92 A;  2YEV A;  5DQZ A;  4DVZ A;  2WVO A;  4Q4Z F;  4LER A;  2J0X A;  3S27 A;  1Z23 A;  3V7O A;  1IW7 F;  2G3K A;  1LS1 A;  2EIM C;  2R7O A;  2IXO A;  4U5E E;  3LEV A;  4RD9 A;  3HJC A;  4GYT A;  2DYR C;  2J7P A;  4AX2 A;  4OIN F;  3F46 A;  2PP4 A;  4FES A;  4QI2 A;  3WOD F;  4E7Z A;  1MMG A;  3TD7 A;  2J9W A;  2KGO A;  3ZIB A;  2YZS A;  3ABK C;  2QTV A;  1TWG A;  2A6E F;  2A68 F;  2W45 A;  3B0P A;  1IZM A;  3M1C B;  4OIO F;  2FFH A;  3UNG C;  2WZG A;  4WJ0 A;  1BR4 A;  3UR3 C;  2R7T A;  3NKD A;  3ZSU A;  3MLG A;  4JCH A;  2XXA B;  3LS1 A;  4XTK A;  5KYY B;  3EFO B;  2G62 A;  3AG2 C;  4KBL A;  2MWQ A;  1JPN A;  1S7Z A;  1QZX A;  4I1M A;  3Q7L A;  2Z15 A;  4A2N B;  2A6H F;  3S29 A;  1Z3I X;  1FFH A;  1J8M F;  1TWH A;  3B0U X;  1VK5 A;  2VH3 A;  1O87 A;  2JD3 A;  2R7R A;  1Z63 A;  2BE5 F;  5HSW A;  4KNV A;  3O6X A;  3QZC A;  3LS0 A;  4C3E A;  4YT5 A;  2V26 A;  5EGY A;  4O6Y A;  3CQZ A;  3DM5 A;  5B1B C;  5L3Q A;  3JSZ A;  1ZHT A;  4X0R A;  1PD0 A;  4RDA A;  4AE4 A;  4MND A;  1G8X A;  4O79 A;  3RH3 A;  4XLP F;  2R7S A;  4O7G A;  4RBN A;  4O6N A;  3W2V A;  3AQC A;  1MMD A;  2J9V A;  4OIR F;  1JPJ A;  4HEA J;  1OKK D;  3MX3 A;  2NUT A;  1QLE C;  4N06 A;  4YN0 B;  1W2W A;  2KQ9 A;  2J7P D;  2DGJ A;  3AG4 C;  1VYK A;  2NG1 A;  3H65 A;  3UGP A;  1VOM A;  1D0X A;  2ZXP A;  1BR1 A;  4XLN F;  1D0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...