2J9WA

Structural insight into the escrt-i-ii link and its role in mvb trafficking
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
101
structure length
101
Chain Sequence
HHMGNLNRCIADIVSLFITVMDKLRLEIRAMDEIQPDLRELMETMNRMSHLPPDFEGREKVSQWLQKLSSMSASDELDDSQVRQMLFDLESAYNAFNRFLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords VPS28-PROV PROTEIN
publication title Structural Insight Into the Escrt-I/-II Link and its Role in Mvb Trafficking.
pubmed doi rcsb
source organism Xenopus laevis
total genus 44
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1130 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2j9wA00
2J9WA 2J9UA 2J9VA 2G3KA
chains in the Genus database with same CATH superfamily
2HSQA 2ZD9A 3ABLC 2WVOA 1GS9A 2YEVA 2A6HF 3U2LA 3ZC4A 3PCVA 4G7OF 5A6JA 1YZAA 4MVOA 3EPVA 3MBGA 3SP1A 2IBFA 1Z6AA 3Q6MA 2JPUA 4ONSA 2AWCA 4M63A 4LERA 4OD4A 4BG0A 4BJTA 1PD0A 3KH2A 4JVSA 2P7VA 1VOMA 4HEAJ 5E33A 4BEMJ 2J9VA 5JVEA 4CIHA 1GGQA 4P9FA 5BUOA 5L3QA 3O39A 1TWAA 3T9OA 4MVUA 3F47A 1CPRA 1AEPA 1Y4CA 3W8IA 4BJ6A 4DBQA 1YA7O 3S28A 2GAQA 3SXZA 2PBEA 1YYJA 3L1MA 3M4CA 3NYMA 2HMZA 5T3WA 4YT4A 5KYYB 3VF0A 1R5ID 1MMNA 2NPUA 3MLGA 5EK0A 3FAJA 4JCHA 3O55A 3TULA 2J8WA 2WB7A 4XPWA 5B1BC 5DLJA 1MQVA 2CDQA 3MYIA 2NSGA 3EJNA 5B1AC 3GODA 4AE4A 4C3BA 2NUTA 2KNHA 1HW1A 2J9BA 4XPXA 2IXNA 3KKBA 2OJED 1SYQA 2JX0A 4JC7A 4IJJA 3U5SA 5JSLA 1EI7A 4EHPA 4ZLCA 2ICWG 3U0CA 4LDRA 4DRJB 3NKDA 1T6UA 4DOZA 1C17M 3E70C 3B0VC 4YJWA 4XPYA 3EH2A 4DBRA 2R7OA 1R4TA 2YRFA 3C18A 4U5HA 3GANA 4CSAC 2LCHA 5A6KA 3L8IA 3NMKA 5A69A 3POVA 1E85A 3IQCA 3M4BA 2J46A 2XXAA 1F1MA 2IXPA 3ZTMA 3LJBA 3HKKA 1C03A 3S9OA 4AX2A 5JLIA 1ORSC 2Z15A 3TQOA 2IXMA 1BZ4A 2LIGA 2YL3A 3ITFA 2ASRA 3DAFA 4KNWA 1M56C 3UMKA 4BJ1A 4EIYA 2R7QA 1TWHA 1M57C 1JPNA 5COFA 2R7RA 4MVZA 2MWQA 2ETSA 3EH1A 4U5DE 3L8JA 3LNMB 4PJLA 5IY5C 2KGOA 1VYKA 3JTLO 1YA9A 1RKEA 2IYLD 3NYLA 3EZIA 4OINF 5E3CA 2OKUA 2VB6A 2D4UA 2CGEA 3ZQYA 4KBLA 4I1MA 4G0HA 5T3TA 4E0HA 3FVYA 2D5RB 5AGFA 1H6GA 3H2VA 3FMSA 1U89A 2R05A 2R7TA 2WZGA 1NSGB 2HZ8A 4MVQA 3S84A 4A2NB 1OCCC 2M4EA 4AL1A 1TQGA 3N0TA 4DVZA 5JS5A 1I5NA 2CNWD 3R7CA 3JSEO 3UMHA 3GORA 4JCZA 4PFOA 5A6AA 1M2VA 3SNHA 4AE4B 3LAYA 4K7BA 1EKYA 4G7HF 4NQFA 1TFOB 1YZCA 1K05A 2KSFA 3CAXA 3DE9A 3AJMA 3IEEA 3KYIA 1MMDA 3NKEA 3DM9B 2HSBA 2J0WA 1Z63A 1Z5ZA 3JYHA 4HE8D 2WZLA 1JMWA 3U3BA 3KPHA 3FDQA 4QI0A 5L0IA 3PMRA 1OW6A 2YVKA 3AG3C 4KC9A 1AUEA 1WOLA 3K1IC 1BBHA 2X0CA 1NG1A 2Y3HA 3ZQVA 3PHF2 3NDBB 1QPUA 1QSPA 4G7ZF 1E83A 5BQGA 2YL1A 3JCUQ 4IARA 3WG7C 1QVXA 3DXJF 3Q7LA 4DXWA 3KYJA 2J45A 2AWYA 2Q9BA 1JR8A 4LACB 4AL0A 2QNLA 4MS2A 3JRTA 4JEAA 3AG2C 2R7WA 3IQ5A 1BR1A 2VASA 2WZFA 1XZQA 2YZSA 1J8YF 2F22A 3M15A 1ZHWA 3W2VA 1LS4A 1J8MF 2Q4FA 3ZWIA 4E17A 2A69F 2XL8A 2M64A 3SXKA 5DQTA 1OW7A 4K1OA 1LE2A 1M2OA 1BR2A 1T5OA 1ST6A 3ZVRA 3JT1A 3G4ZA 2XLEA 1RKEB 4RBNA 2YHSA 4QI2A 2FGYA 1OQCA 4JTCB 4U5CE 3US6A 4XEFA 4C3DA 2R9RB 4O79A 4CS8A 1HMDA 2Y3DA 2IXOA 2YLDA 3VYWA 5JUAA 1RJ9B 4JJGA 3MYFA 4D4NA 4N4WA 5L0FA 1LIHA 4OIRF 1W2WA 2PF4E 3TOLA 3DJUB 1HMOA 3O10A 1NLXA 1QKRA 4LLEA 4RD9A 4CS9A 1NZEA 3EQLF 2QLAA 4DRIB 5COGA 2V26A 3M1CB 1ZYRF 5KYUA 2TMVP 4YN0B 3C8GA 1M2VB 1TFKB 4PR9A 1OXKA 4FESA 3RIPA 3RW0A 3T6GB 3W2WA 1APCA 4X0RA 4J7YA 1B68A 3ZSUA 5EHHA 3AGUA 1I4YA 5CI9A 1LI5A 4JE9A 2KW3C 256BA 2OU6A 2PX0A 1OKKA 1E84A 5KYXB 1CPQA 2HV6A 3ABMC 3NYJA 3SXMA 3RQFA 2DGJA 2ZXOA 3B9QA 4BJ5C 2QY9A 4CDVA 2V3CC 1MNDA 1G4WR 4E18A 1YLMA 4FWVA 4WABA 3BRJA 4G78A 1HE9A 2DB4A 3CSKA 1RXQA 2I15A 3EHNA 3G4XA 3LEVA 4EBBA 1E86A 3FOOA 1FNTc 1YVIA 2EPLX 4HFKB 1H9TA 2XRHA 2Q9AA 3V5XA 4IGGA 3H65A 2YL7A 3EG9A 3DAGA 4OIPF 4E0IA 1LE4A 3H2UA 4YWQA 4J7TA 4MVMA 4XLPF 3HTKC 3PDMP 4A4AA 2AVKA 3VAYA 1KNYA 3K33A 3C8ZA 3S90A 3HNIA 3A11A 1EA8A 4Z9HA 2P1AA 3UR3C 1WN0A 4DJ9A 3ZG1A 1Y6DA 2RD9A 4NTFA 4XQ1A 1LKXA 2PX3A 1E2XA 5DS5A 3QVZA 1VTMP 4U5FE 2HS5A 3S29A 5DQZA 1KTMA 4F4BA 3GM2A 3UNGC 1CGNA 2H7OA 3ASNC 1YDIA 3NMIA 2P0NA 2W45A 4L6RA 2XS1A 1V4AA 3EGDA 1DOWA 4XWJA 4B6IA 2GA0A 3K6BA 5AC4A 2NUPA 1T6IA 5HV9A 2VCBA 5CI8A 1Z23A 4ANJA 1NU7D 3C8GD 2J7PD 4O6YA 3ZDLA 3I5PA 1UG7A 3IQ6A 3QVYA 2LQGA 1BR4A 3KL4A 5KYUB 1M6TA 3C8GB 2KC3A 2KYHA 1PD1A 3FAPB 3DM5A 3LEOA 4GQHA 1S7ZA 3UMIA 2IM8A 2L9JA 3MX3A 3U9MA 4KI2A 4PFPA 4BEJA 2MHRA 1IW7F 2XL4A 2XLHA 3QW0A 2HKVA 5L0CA 3DKAA 4PJJA 3VM6A 2DYSC 2EILC 3HJCA 3I5QA 1JRAA 2W4MA 4MQ9F 3LS0A 4YL3A 3EGXA 1O87A 3QMKA 3RH3A 3U9JA 1VYIA 1G4US 2XSEA 2XLVA 4N6HA 2X51A 5TJ5E 3TK0A 4C7OB 2R7SA 2W4BA 3V5YA 1OR3A 2KJGA 2R7XA 2NSFA 3AG1C 4CX9A 3AGTA 4YL0A 3HNKA 1Z7Qc 3RKOF 4CS7A 5FCLA 1D0ZA 4MNDA 3EG9B 4P9TA 3B29A 3UGPA 4EWCA 2OQMA 4WJ0A 3X1OA 4JZAA 1V55C 1Q0MA 3V7OA 1OXBA 2CYDA 3QTHA 1GQAA 1WGWA 1U0BB 2NUTB 1Q0DA 3ECSA 2L81A 2NG1A 4JRZA 4O7GA 2ZXPA 3ZTZA 4CDAA 2JD3A 2HJMA 1V74B 2EIJC 1VK5A 1NBBA 1Q0KA 4IWBA 2C03A 3FHDA 4XEKA 4DVYP 4FX5A 1QQ3A 4D4XA 5B3IA 3J06A 2DI3A 1FTSA 4CSAA 3EGDB 5HSWA 3RVZA 3T6BA 1VLTA 2NUPB 5L0DA 2XXAB 1OW8A 4P6IC 3C7JA 1JOGA 4U9EA 1MMAA 3E9VA 4CBEA 1U6HA 1QZXA 5DS4A 5AC5A 2W9YA 3X2QC 1IZMA 3BEHA 2L6HA 3AG4C 2B0JA 1ZU4A 4LDQA 2GWWA 1S05A 4Z9JA 3JYYA 1NU9C 4PJNA 4Q5SF 1HY5A 3GEHA 3KMIA 1JPJA 4JEBA 3EZHA 5JP7A 3L0IA 4Z9IA 3EGXB 3JSZA 4ER9A 3IHUA 2HFIA 4CIPA 3T6JA 2QE9A 4BPMA 1TWCA 2L6GA 4MTGA 2YL0A 4OD5A 3QZCA 4KNVA 4RDAA 1SF8A 5KYWA 1WWPA 4NY3A 4BJ6C 1CGOA 2C04A 2J0XA 3M79A 4C7OA 4EUKB 3OWTA 4OIOF 5KYYA 1A41A 1EQ1A 2ZPAA 2LP4A 1ORJA 3QW1A 1GM5A 4C3EA 1OR2A 2AP3A 4NCQA 4YK5A 1FMVA 3K7DA 2QTVA 1Q0GA 3VRCA 4FAPB 3ASOC 4EKWA 2KK1A 1ZZPA 2Y39A 3GM1A 3B0PA 4IAOA 2XS8A 2P61A 5E2QA 4N06A 4NTAA 2XLWA 5D92A 4DRHB 5K0IA 2PP4A 1O3UA 1CGME 3K1IA 1ZHTA 2PFDA 1T9KA 2J9WA 4I3MA 3DD7A 2OEXA 3GEIA 2R7UA 2L6FA 4MVSA 1KU2A 3K66A 4UDVA 3S0XA 3TOMA 1MMGA 2YQYA 3RF3A 3SXYA 5L0GA 4IRUA 4J30B 2E87A 2BE5F 3JZ0A 2I8BA 3HNJA 2QUPA 2OCCC 1SZIA 5F5FA 4EBJA 2EPMX 1VMAA 2Y3GA 3GWNA 3N2ZB 1VLSA 2WL8A 3RQGA 1ZHZA 4EBKA 2XLDA 3CZ6A 1G8XA 3I4UA 4ULWA 3LS1A 4O6MA 1LVKA 1RCPA 3FXHA 2VC9A 3LUTB 1FR0A 3TJ5A 3FOPA 2PNOA 3GEEA 2XM4A 2H8AA 3EFOA 5FZTA 3RYLA 1XWJA 4Q4ZF 3ZIBA 2BC5A 3DWWA 4OIQF 2EIKC 5JT4A 4MW8A 1OCRC 2L7AA 2RSEB 4YL1A 3RVYA 1SMYF 2A68F 2A6EF 2FAPB 2XLOA 3O6XA 2R03A 3DMDA 4U5GA 1UFBA 3SZRA 5F5HA 5EGYA 1YARO 5L0JA 3L34A 2DYRC 2CNWA 4H54A 4JJFA 1NFNA 3DI5A 4YT8A 3V5ZA 4CJGA 1K04A 1PV3A 2HMQA 3G50A 1O5HA 1OKKD 5L0HA 4U9DA 1A7EA 4J32B 2KQ9A 2ZXRA 2Y3BA 1ZHXA 2LK4A 1K40A 2OJQA 3OEOA 1YAUO 1A7VA 1RKCA 2CW0F 4BJ5A 3LLKA 5F28E 1TR2A 5BQIA 4JW1A 1ZW2A 2EINC 3LESA 1ZW3A 4H4KC 1T01A 3WODF 3JRMO 3WAQA 5B3SC 2O9XA 2XLMA 1AVOB 2WVQA 3C63A 4N6CA 3OA1A 2EPOA 1QLEC 2VCAA 2Q7RA 2J9UA 3TD7A 4GEHA 2Q00A 2XM0A 4WGZA 4YT2A 1FMWA 4IB4A 2B0HA 5COMA 4I1OB 1Q0FA 4CJOA 1WTYA 5CIVA 3B71A 2G3KA 3Q7GA 5GPGB 2OOCA 3U8VA 1FFTC 2G3VA 2R02A 4E7SA 5KYNA 4QDLA 3HNLA 3TJ6A 4Q7CA 2EPKX 4JKVA 4CS8C 4ZLDA 3ABKC 3EFOB 4JIOA 1BDJB 1RJ9A 1LPEA 4NC3A 5DVWA 3Q6NA 2BL2A 1TWGA 2MYSA 1A0BA 4MW3A 1Z3IX 2H7VC 3DE8A 3DZAA 3CQZA 5E3AA 1SR2A 4IAQA 4LLCA 4PK4A 2YLGA 4CS9C 5A6BA 1ZHYA 1L7CA 1HE1A 3NRHA 4PACA 1LM3B 3GWLA 4JTAB 4U5BE 3RQEA 1ORYA 4MTFA 1A7DA 1L3PA 3A9CA 3ATPA 1G5ZA 2HV7A 1H7IA 3C62A 4YT5A 3W4YA 4O6NA 5JRAA 1D1BA 2LD6A 3AOUA 3N24A 4WGYA 3DJNB 4XEVA 5KYXA 1JAFA 4ULVA 1D0XA 3GM3A 5L3VA 3U8PA 3SEOA 1ZVZA 1WATA 2OG2A 4K0DA 1VB5A 4XLNF 2YWAA 2LFDA 1D0YA 2AU5A 2XL6A 1C02A 1PCXA 3IQTA 1MNEA 5T1DB 4W8PA 1T6QA 2FFHA 2GDCA 3AQBA 4R32A 1YYXA 1LS1A 3B0UX 2Q3TA 3K1HA 2P6VA 2R25A 1V54C 3RFYA 3LLIA 4E7ZA 4GYTA 1YJGA 1FFHA 4JURI 1I4ZA 3HLZA 3CEXA 2VH3A 3W8HA 2YKZA 2EPNA 4W8KA 3S27A 3SYNA 1FAPB 3T4RA 4CDYA 2ZXWC 1RMVA 3NG1A 3NMJA 4MVRA 2LFFA 2GFHA 2LSEA 3WHNA 2OEVA 1HW2A 2CCYA 4U5EE 3AQCA 2A0UA 4I44A 1TKNA 4AK9A 2UUIA 2H7BA 3IPMO 3UGOA 2Q9CA 2HUJA 4MTOA 2G62A 2YLIA 3U2MA 2UUHA 2Y69C 5BQHA 1LI7A 2A0BA 1OCZC 4LDKA 5D91A 4HFFB 5A6BD 5DS6A 2WVNA 4PJMA 2IOQA 1WASA 2VCCA 3R2PA 2R7VA 1H9GA 1ZU5A 1XZPA 3EHMA 1D1CA 2HJ3A 3MFNA 3F46A 1D1AA 1NFOA 2A1DD 4XTKA 2EIMC 3LNRA 3U3FA 1DOVA 2J7PA 1N1CA 4JTDB 5KYWB 1OCOC 4NTBA
chains in the Genus database with same CATH topology
3ABLC 2WVOA 2YEVA 2A6HF 3ZC4A 4G7OF 3EPVA 3SP1A 1Z6AA 3Q6MA 4M63A 4OD4A 4LERA 4BJTA 4BG0A 1PD0A 3KH2A 4JVSA 2P7VA 1VOMA 4HEAJ 5E33A 2J9VA 4CIHA 5BUOA 5L3QA 3O39A 1TWAA 3F47A 4DBQA 3W8IA 5KYWB 4BJ6A 3S28A 3NYMA 4YT4A 5T3WA 5KYYB 1MMNA 3MLGA 3FAJA 4JCHA 2WB7A 5B1BC 5DLJA 2CDQA 5B1AC 3EJNA 4AE4A 3GODA 4C3BA 2NUTA 2KNHA 2IXNA 3KKBA 4IJJA 4ZLCA 3B0VC 3NKDA 4DOZA 3E70C 4YJWA 3EH2A 4DBRA 2R7OA 4U5HA 3GANA 4CSAC 3POVA 2J46A 2XXAA 2IXPA 3LJBA 4AX2A 2Z15A 2IXMA 3ITFA 3DAFA 3UMKA 4KNWA 1M56C 4BJ1A 2R7QA 1TWHA 1M57C 1JPNA 2R7RA 2MWQA 3EH1A 4U5DE 4PJLA 5IY5C 2KGOA 1VYKA 2IYLD 3NYLA 3EZIA 4OINF 5E3CA 2VB6A 2CGEA 4KBLA 4I1MA 4G0HA 5T3TA 3FVYA 2D5RB 2R7TA 2WZGA 4A2NB 1OCCC 2M4EA 3N0TA 4DVZA 2CNWD 3UMHA 4PFOA 1M2VA 3SNHA 4AE4B 3LAYA 4K7BA 4G7HF 3IEEA 1MMDA 3NKEA 3DM9B 1Z63A 2J0WA 1Z5ZA 3JYHA 4HE8D 2WZLA 3FDQA 4QI0A 3PMRA 3AG3C 4KC9A 3K1IC 1NG1A 2Y3HA 3NDBB 3PHF2 4G7ZF 3JCUQ 3WG7C 3DXJF 3Q7LA 2J45A 2Q9BA 4LACB 3JRTA 2R7WA 3AG2C 2VASA 1BR1A 2YZSA 2WZFA 1J8YF 1ZHWA 3W2VA 1J8MF 2A69F 5DQTA 1M2OA 1BR2A 1ST6A 3ZVRA 3JT1A 4RBNA 2YHSA 4QI2A 2FGYA 4U5CE 4C3DA 4CS8A 4O79A 3VYWA 2Y3DA 2IXOA 1RJ9B 4JJGA 4OIRF 1W2WA 2PF4E 3DJUB 4CS9A 4LLEA 4RD9A 1NZEA 3EQLF 2V26A 3M1CB 1ZYRF 5KYUA 4YN0B 1M2VB 4FESA 3RIPA 3W2WA 5EHHA 4X0RA 3ZSUA 5CI9A 2KW3C 2PX0A 1OKKA 5KYXB 2HV6A 3ABMC 3NYJA 2DGJA 2ZXOA 3B9QA 4BJ5C 2QY9A 2V3CC 1MNDA 4FWVA 3CSKA 3EHNA 3LEVA 4EBBA 4HFKB 2XRHA 2Q9AA 3H65A 3EG9A 3DAGA 4OIPF 4XLPF 3HTKC 3VAYA 3K33A 3UR3C 3ZG1A 1LKXA 2PX3A 5DS5A 4U5FE 3S29A 5DQZA 4F4BA 3UNGC 2H7OA 3ASNC 2W45A 3EGDA 4XWJA 4B6IA 3K6BA 2NUPA 5CI8A 1Z23A 4ANJA 1NU7D 2J7PD 4O6YA 3I5PA 3KL4A 1BR4A 5KYUB 1PD1A 3DM5A 1S7ZA 3UMIA 2L9JA 3MX3A 4KI2A 4PFPA 4BEJA 1IW7F 2XL4A 4PJJA 2DYSC 2EILC 3HJCA 3I5QA 4MQ9F 2W4MA 3LS0A 3EGXA 1O87A 3QMKA 3RH3A 1VYIA 2XSEA 2X51A 2R7SA 2W4BA 2KJGA 2R7XA 3AG1C 3RKOF 4CS7A 5FCLA 1D0ZA 4MNDA 3EG9B 3UGPA 4EWCA 4WJ0A 3X1OA 4JZAA 1V55C 3V7OA 1WGWA 2NUTB 3ECSA 4YWQA 2L81A 2NG1A 5HSWA 4O7GA 2ZXPA 2JD3A 2EIJC 1VK5A 4IWBA 2C03A 3FHDA 4DVYP 4FX5A 1FTSA 4CSAA 3EGDB 3T6BA 2NUPB 2XXAB 4P6IC 1MMAA 3E9VA 4CBEA 1QZXA 5DS4A 2W9YA 3X2QC 1IZMA 3AG4C 2B0JA 1ZU4A 1NU9C 4PJNA 4Q5SF 3KMIA 1JPJA 3EZHA 3L0IA 3EGXB 3JSZA 3T6JA 1TWCA 4OD5A 3QZCA 4KNVA 4RDAA 1SF8A 5KYWA 4NY3A 4BJ6C 2C04A 2J0XA 4C7OA 3OWTA 4OIOF 5KYYA 2ZPAA 4C3EA 1FMVA 3K7DA 2QTVA 3ASOC 2Y39A 3B0PA 4IAOA 5E2QA 4N06A 5D92A 2PP4A 4I3MA 1ZHTA 2PFDA 2J9WA 3DD7A 2R7UA 1KU2A 3K66A 3S0XA 1MMGA 4IRUA 4J30B 2E87A 2BE5F 2I8BA 2OCCC 1SZIA 5F5FA 1VMAA 2Y3GA 3N2ZB 2WL8A 1ZHZA 3CZ6A 1G8XA 3I4UA 4ULWA 3LS1A 4O6MA 1LVKA 3EFOA 3RYLA 4Q4ZF 3ZIBA 4OIQF 2EIKC 1OCRC 1SMYF 2A68F 2A6EF 3O6XA 4U5GA 3SZRA 5EGYA 3DMDA 5F5HA 4C7OB 3L34A 2DYRC 2CNWA 4JJFA 4YT8A 1O5HA 1OKKD 4J32B 2KQ9A 2ZXRA 2Y3BA 1ZHXA 3OEOA 4BJ5A 2CW0F 3LLKA 1TR2A 4JW1A 2EINC 3LESA 4H4KC 3WODF 5B3SC 2O9XA 2WVQA 3OA1A 1QLEC 2J9UA 3TD7A 4GEHA 4YT2A 1FMWA 4I1OB 2G3KA 3Q7GA 1FFTC 2G3VA 4E7SA 5KYNA 4QDLA 4Q7CA 4ZLDA 4CS8C 3ABKC 3EFOB 1RJ9A 5DVWA 3Q6NA 1TWGA 2MYSA 5E3AA 1Z3IX 2H7VC 3DZAA 3CQZA 4PK4A 4LLCA 4CS9C 1ZHYA 3NRHA 4U5BE 2HV7A 4YT5A 4O6NA 1D1BA 3N24A 5KYXA 3DJNB 1D0XA 5L3VA 3SEOA 4K0DA 2OG2A 4XLNF 1D0YA 1PCXA 1MNEA 5T1DB 2FFHA 3AQBA 1LS1A 3B0UX 2Q3TA 3K1HA 2P6VA 1V54C 3RFYA 3LLIA 4E7ZA 4GYTA 1FFHA 4JURI 3HLZA 2VH3A 3W8HA 4W8KA 3SYNA 3T4RA 3S27A 2ZXWC 3NG1A 2GFHA 2LSEA 4U5EE 3AQCA 4I44A 1TKNA 4AK9A 2H7BA 3UGOA 2Q9CA 2G62A 2Y69C 1OCZC 5D91A 4HFFB 5DS6A 2WVNA 4PJMA 2IOQA 2R7VA 1ZU5A 3EHMA 1D1CA 3F46A 1D1AA 2A1DD 4XTKA 2EIMC 3LNRA 2J7PA 1N1CA 1OCOC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J9W A;  2J9U A;  2J9V A;  2G3K A; 
#chains in the Genus database with same CATH topology
 2HSQ A;  2ZD9 A;  3ABL C;  2WVO A;  1GS9 A;  2YEV A;  2A6H F;  3U2L A;  3ZC4 A;  3PCV A;  4G7O F;  5A6J A;  1YZA A;  4MVO A;  3EPV A;  3MBG A;  3SP1 A;  2IBF A;  1Z6A A;  3Q6M A;  2JPU A;  4ONS A;  2AWC A;  4M63 A;  4LER A;  4OD4 A;  4BG0 A;  4BJT A;  1PD0 A;  3KH2 A;  4JVS A;  2P7V A;  1VOM A;  4HEA J;  5E33 A;  4BEM J;  2J9V A;  5JVE A;  4CIH A;  1GGQ A;  4P9F A;  5BUO A;  5L3Q A;  3O39 A;  1TWA A;  3T9O A;  4MVU A;  3F47 A;  1CPR A;  1AEP A;  1Y4C A;  3W8I A;  4BJ6 A;  4DBQ A;  1YA7 O;  3S28 A;  2GAQ A;  3SXZ A;  2PBE A;  1YYJ A;  3L1M A;  3M4C A;  3NYM A;  2HMZ A;  5T3W A;  4YT4 A;  5KYY B;  3VF0 A;  1R5I D;  1MMN A;  2NPU A;  3MLG A;  5EK0 A;  3FAJ A;  4JCH A;  3O55 A;  3TUL A;  2J8W A;  2WB7 A;  4XPW A;  5B1B C;  5DLJ A;  1MQV A;  2CDQ A;  3MYI A;  2NSG A;  3EJN A;  5B1A C;  3GOD A;  4AE4 A;  4C3B A;  2NUT A;  2KNH A;  1HW1 A;  2J9B A;  4XPX A;  2IXN A;  3KKB A;  2OJE D;  1SYQ A;  2JX0 A;  4JC7 A;  4IJJ A;  3U5S A;  5JSL A;  1EI7 A;  4EHP A;  4ZLC A;  2ICW G;  3U0C A;  4LDR A;  4DRJ B;  3NKD A;  1T6U A;  4DOZ A;  1C17 M;  3E70 C;  3B0V C;  4YJW A;  4XPY A;  3EH2 A;  4DBR A;  2R7O A;  1R4T A;  2YRF A;  3C18 A;  4U5H A;  3GAN A;  4CSA C;  2LCH A;  5A6K A;  3L8I A;  3NMK A;  5A69 A;  3POV A;  1E85 A;  3IQC A;  3M4B A;  2J46 A;  2XXA A;  1F1M A;  2IXP A;  3ZTM A;  3LJB A;  3HKK A;  1C03 A;  3S9O A;  4AX2 A;  5JLI A;  1ORS C;  2Z15 A;  3TQO A;  2IXM A;  1BZ4 A;  2LIG A;  2YL3 A;  3ITF A;  2ASR A;  3DAF A;  4KNW A;  1M56 C;  3UMK A;  4BJ1 A;  4EIY A;  2R7Q A;  1TWH A;  1M57 C;  1JPN A;  5COF A;  2R7R A;  4MVZ A;  2MWQ A;  2ETS A;  3EH1 A;  4U5D E;  3L8J A;  3LNM B;  4PJL A;  5IY5 C;  2KGO A;  1VYK A;  3JTL O;  1YA9 A;  1RKE A;  2IYL D;  3NYL A;  3EZI A;  4OIN F;  5E3C A;  2OKU A;  2VB6 A;  2D4U A;  2CGE A;  3ZQY A;  4KBL A;  4I1M A;  4G0H A;  5T3T A;  4E0H A;  3FVY A;  2D5R B;  5AGF A;  1H6G A;  3H2V A;  3FMS A;  1U89 A;  2R05 A;  2R7T A;  2WZG A;  1NSG B;  2HZ8 A;  4MVQ A;  3S84 A;  4A2N B;  1OCC C;  2M4E A;  4AL1 A;  1TQG A;  3N0T A;  4DVZ A;  5JS5 A;  1I5N A;  2CNW D;  3R7C A;  3JSE O;  3UMH A;  3GOR A;  4JCZ A;  4PFO A;  5A6A A;  1M2V A;  3SNH A;  4AE4 B;  3LAY A;  4K7B A;  1EKY A;  4G7H F;  4NQF A;  1TFO B;  1YZC A;  1K05 A;  2KSF A;  3CAX A;  3DE9 A;  3AJM A;  3IEE A;  3KYI A;  1MMD A;  3NKE A;  3DM9 B;  2HSB A;  2J0W A;  1Z63 A;  1Z5Z A;  3JYH A;  4HE8 D;  2WZL A;  1JMW A;  3U3B A;  3KPH A;  3FDQ A;  4QI0 A;  5L0I A;  3PMR A;  1OW6 A;  2YVK A;  3AG3 C;  4KC9 A;  1AUE A;  1WOL A;  3K1I C;  1BBH A;  2X0C A;  1NG1 A;  2Y3H A;  3ZQV A;  3PHF 2;  3NDB B;  1QPU A;  1QSP A;  4G7Z F;  1E83 A;  5BQG A;  2YL1 A;  3JCU Q;  4IAR A;  3WG7 C;  1QVX A;  3DXJ F;  3Q7L A;  4DXW A;  3KYJ A;  2J45 A;  2AWY A;  2Q9B A;  1JR8 A;  4LAC B;  4AL0 A;  2QNL A;  4MS2 A;  3JRT A;  4JEA A;  3AG2 C;  2R7W A;  3IQ5 A;  1BR1 A;  2VAS A;  2WZF A;  1XZQ A;  2YZS A;  1J8Y F;  2F22 A;  3M15 A;  1ZHW A;  3W2V A;  1LS4 A;  1J8M F;  2Q4F A;  3ZWI A;  4E17 A;  2A69 F;  2XL8 A;  2M64 A;  3SXK A;  5DQT A;  1OW7 A;  4K1O A;  1LE2 A;  1M2O A;  1BR2 A;  1T5O A;  1ST6 A;  3ZVR A;  3JT1 A;  3G4Z A;  2XLE A;  1RKE B;  4RBN A;  2YHS A;  4QI2 A;  2FGY A;  1OQC A;  4JTC B;  4U5C E;  3US6 A;  4XEF A;  4C3D A;  2R9R B;  4O79 A;  4CS8 A;  1HMD A;  2Y3D A;  2IXO A;  2YLD A;  3VYW A;  5JUA A;  1RJ9 B;  4JJG A;  3MYF A;  4D4N A;  4N4W A;  5L0F A;  1LIH A;  4OIR F;  1W2W A;  2PF4 E;  3TOL A;  3DJU B;  1HMO A;  3O10 A;  1NLX A;  1QKR A;  4LLE A;  4RD9 A;  4CS9 A;  1NZE A;  3EQL F;  2QLA A;  4DRI B;  5COG A;  2V26 A;  3M1C B;  1ZYR F;  5KYU A;  2TMV P;  4YN0 B;  3C8G A;  1M2V B;  1TFK B;  4PR9 A;  1OXK A;  4FES A;  3RIP A;  3RW0 A;  3T6G B;  3W2W A;  1APC A;  4X0R A;  4J7Y A;  1B68 A;  3ZSU A;  5EHH A;  3AGU A;  1I4Y A;  5CI9 A;  1LI5 A;  4JE9 A;  2KW3 C;  256B A;  2OU6 A;  2PX0 A;  1OKK A;  1E84 A;  5KYX B;  1CPQ A;  2HV6 A;  3ABM C;  3NYJ A;  3SXM A;  3RQF A;  2DGJ A;  2ZXO A;  3B9Q A;  4BJ5 C;  2QY9 A;  4CDV A;  2V3C C;  1MND A;  1G4W R;  4E18 A;  1YLM A;  4FWV A;  4WAB A;  3BRJ A;  4G78 A;  1HE9 A;  2DB4 A;  3CSK A;  1RXQ A;  2I15 A;  3EHN A;  3G4X A;  3LEV A;  4EBB A;  1E86 A;  3FOO A;  1FNT c;  1YVI A;  2EPL X;  4HFK B;  1H9T A;  2XRH A;  2Q9A A;  3V5X A;  4IGG A;  3H65 A;  2YL7 A;  3EG9 A;  3DAG A;  4OIP F;  4E0I A;  1LE4 A;  3H2U A;  4YWQ A;  4J7T A;  4MVM A;  4XLP F;  3HTK C;  3PDM P;  4A4A A;  2AVK A;  3VAY A;  1KNY A;  3K33 A;  3C8Z A;  3S90 A;  3HNI A;  3A11 A;  1EA8 A;  4Z9H A;  2P1A A;  3UR3 C;  1WN0 A;  4DJ9 A;  3ZG1 A;  1Y6D A;  2RD9 A;  4NTF A;  4XQ1 A;  1LKX A;  2PX3 A;  1E2X A;  5DS5 A;  3QVZ A;  1VTM P;  4U5F E;  2HS5 A;  3S29 A;  5DQZ A;  1KTM A;  4F4B A;  3GM2 A;  3UNG C;  1CGN A;  2H7O A;  3ASN C;  1YDI A;  3NMI A;  2P0N A;  2W45 A;  4L6R A;  2XS1 A;  1V4A A;  3EGD A;  1DOW A;  4XWJ A;  4B6I A;  2GA0 A;  3K6B A;  5AC4 A;  2NUP A;  1T6I A;  5HV9 A;  2VCB A;  5CI8 A;  1Z23 A;  4ANJ A;  1NU7 D;  3C8G D;  2J7P D;  4O6Y A;  3ZDL A;  3I5P A;  1UG7 A;  3IQ6 A;  3QVY A;  2LQG A;  1BR4 A;  3KL4 A;  5KYU B;  1M6T A;  3C8G B;  2KC3 A;  2KYH A;  1PD1 A;  3FAP B;  3DM5 A;  3LEO A;  4GQH A;  1S7Z A;  3UMI A;  2IM8 A;  2L9J A;  3MX3 A;  3U9M A;  4KI2 A;  4PFP A;  4BEJ A;  2MHR A;  1IW7 F;  2XL4 A;  2XLH A;  3QW0 A;  2HKV A;  5L0C A;  3DKA A;  4PJJ A;  3VM6 A;  2DYS C;  2EIL C;  3HJC A;  3I5Q A;  1JRA A;  2W4M A;  4MQ9 F;  3LS0 A;  4YL3 A;  3EGX A;  1O87 A;  3QMK A;  3RH3 A;  3U9J A;  1VYI A;  1G4U S;  2XSE A;  2XLV A;  4N6H A;  2X51 A;  5TJ5 E;  3TK0 A;  4C7O B;  2R7S A;  2W4B A;  3V5Y A;  1OR3 A;  2KJG A;  2R7X A;  2NSF A;  3AG1 C;  4CX9 A;  3AGT A;  4YL0 A;  3HNK A;  1Z7Q c;  3RKO F;  4CS7 A;  5FCL A;  1D0Z A;  4MND A;  3EG9 B;  4P9T A;  3B29 A;  3UGP A;  4EWC A;  2OQM A;  4WJ0 A;  3X1O A;  4JZA A;  1V55 C;  1Q0M A;  3V7O A;  1OXB A;  2CYD A;  3QTH A;  1GQA A;  1WGW A;  1U0B B;  2NUT B;  1Q0D A;  3ECS A;  2L81 A;  2NG1 A;  4JRZ A;  4O7G A;  2ZXP A;  3ZTZ A;  4CDA A;  2JD3 A;  2HJM A;  1V74 B;  2EIJ C;  1VK5 A;  1NBB A;  1Q0K A;  4IWB A;  2C03 A;  3FHD A;  4XEK A;  4DVY P;  4FX5 A;  1QQ3 A;  4D4X A;  5B3I A;  3J06 A;  2DI3 A;  1FTS A;  4CSA A;  3EGD B;  5HSW A;  3RVZ A;  3T6B A;  1VLT A;  2NUP B;  5L0D A;  2XXA B;  1OW8 A;  4P6I C;  3C7J A;  1JOG A;  4U9E A;  1MMA A;  3E9V A;  4CBE A;  1U6H A;  1QZX A;  5DS4 A;  5AC5 A;  2W9Y A;  3X2Q C;  1IZM A;  3BEH A;  2L6H A;  3AG4 C;  2B0J A;  1ZU4 A;  4LDQ A;  2GWW A;  1S05 A;  4Z9J A;  3JYY A;  1NU9 C;  4PJN A;  4Q5S F;  1HY5 A;  3GEH A;  3KMI A;  1JPJ A;  4JEB A;  3EZH A;  5JP7 A;  3L0I A;  4Z9I A;  3EGX B;  3JSZ A;  4ER9 A;  3IHU A;  2HFI A;  4CIP A;  3T6J A;  2QE9 A;  4BPM A;  1TWC A;  2L6G A;  4MTG A;  2YL0 A;  4OD5 A;  3QZC A;  4KNV A;  4RDA A;  1SF8 A;  5KYW A;  1WWP A;  4NY3 A;  4BJ6 C;  1CGO A;  2C04 A;  2J0X A;  3M79 A;  4C7O A;  4EUK B;  3OWT A;  4OIO F;  5KYY A;  1A41 A;  1EQ1 A;  2ZPA A;  2LP4 A;  1ORJ A;  3QW1 A;  1GM5 A;  4C3E A;  1OR2 A;  2AP3 A;  4NCQ A;  4YK5 A;  1FMV A;  3K7D A;  2QTV A;  1Q0G A;  3VRC A;  4FAP B;  3ASO C;  4EKW A;  2KK1 A;  1ZZP A;  2Y39 A;  3GM1 A;  3B0P A;  4IAO A;  2XS8 A;  2P61 A;  5E2Q A;  4N06 A;  4NTA A;  2XLW A;  5D92 A;  4DRH B;  5K0I A;  2PP4 A;  1O3U A;  1CGM E;  3K1I A;  1ZHT A;  2PFD A;  1T9K A;  2J9W A;  4I3M A;  3DD7 A;  2OEX A;  3GEI A;  2R7U A;  2L6F A;  4MVS A;  1KU2 A;  3K66 A;  4UDV A;  3S0X A;  3TOM A;  1MMG A;  2YQY A;  3RF3 A;  3SXY A;  5L0G A;  4IRU A;  4J30 B;  2E87 A;  2BE5 F;  3JZ0 A;  2I8B A;  3HNJ A;  2QUP A;  2OCC C;  1SZI A;  5F5F A;  4EBJ A;  2EPM X;  1VMA A;  2Y3G A;  3GWN A;  3N2Z B;  1VLS A;  2WL8 A;  3RQG A;  1ZHZ A;  4EBK A;  2XLD A;  3CZ6 A;  1G8X A;  3I4U A;  4ULW A;  3LS1 A;  4O6M A;  1LVK A;  1RCP A;  3FXH A;  2VC9 A;  3LUT B;  1FR0 A;  3TJ5 A;  3FOP A;  2PNO A;  3GEE A;  2XM4 A;  2H8A A;  3EFO A;  5FZT A;  3RYL A;  1XWJ A;  4Q4Z F;  3ZIB A;  2BC5 A;  3DWW A;  4OIQ F;  2EIK C;  5JT4 A;  4MW8 A;  1OCR C;  2L7A A;  2RSE B;  4YL1 A;  3RVY A;  1SMY F;  2A68 F;  2A6E F;  2FAP B;  2XLO A;  3O6X A;  2R03 A;  3DMD A;  4U5G A;  1UFB A;  3SZR A;  5F5H A;  5EGY A;  1YAR O;  5L0J A;  3L34 A;  2DYR C;  2CNW A;  4H54 A;  4JJF A;  1NFN A;  3DI5 A;  4YT8 A;  3V5Z A;  4CJG A;  1K04 A;  1PV3 A;  2HMQ A;  3G50 A;  1O5H A;  1OKK D;  5L0H A;  4U9D A;  1A7E A;  4J32 B;  2KQ9 A;  2ZXR A;  2Y3B A;  1ZHX A;  2LK4 A;  1K40 A;  2OJQ A;  3OEO A;  1YAU O;  1A7V A;  1RKC A;  2CW0 F;  4BJ5 A;  3LLK A;  5F28 E;  1TR2 A;  5BQI A;  4JW1 A;  1ZW2 A;  2EIN C;  3LES A;  1ZW3 A;  4H4K C;  1T01 A;  3WOD F;  3JRM O;  3WAQ A;  5B3S C;  2O9X A;  2XLM A;  1AVO B;  2WVQ A;  3C63 A;  4N6C A;  3OA1 A;  2EPO A;  1QLE C;  2VCA A;  2Q7R A;  2J9U A;  3TD7 A;  4GEH A;  2Q00 A;  2XM0 A;  4WGZ A;  4YT2 A;  1FMW A;  4IB4 A;  2B0H A;  5COM A;  4I1O B;  1Q0F A;  4CJO A;  1WTY A;  5CIV A;  3B71 A;  2G3K A;  3Q7G A;  5GPG B;  2OOC A;  3U8V A;  1FFT C;  2G3V A;  2R02 A;  4E7S A;  5KYN A;  4QDL A;  3HNL A;  3TJ6 A;  4Q7C A;  2EPK X;  4JKV A;  4CS8 C;  4ZLD A;  3ABK C;  3EFO B;  4JIO A;  1BDJ B;  1RJ9 A;  1LPE A;  4NC3 A;  5DVW A;  3Q6N A;  2BL2 A;  1TWG A;  2MYS A;  1A0B A;  4MW3 A;  1Z3I X;  2H7V C;  3DE8 A;  3DZA A;  3CQZ A;  5E3A A;  1SR2 A;  4IAQ A;  4LLC A;  4PK4 A;  2YLG A;  4CS9 C;  5A6B A;  1ZHY A;  1L7C A;  1HE1 A;  3NRH A;  4PAC A;  1LM3 B;  3GWL A;  4JTA B;  4U5B E;  3RQE A;  1ORY A;  4MTF A;  1A7D A;  1L3P A;  3A9C A;  3ATP A;  1G5Z A;  2HV7 A;  1H7I A;  3C62 A;  4YT5 A;  3W4Y A;  4O6N A;  5JRA A;  1D1B A;  2LD6 A;  3AOU A;  3N24 A;  4WGY A;  3DJN B;  4XEV A;  5KYX A;  1JAF A;  4ULV A;  1D0X A;  3GM3 A;  5L3V A;  3U8P A;  3SEO A;  1ZVZ A;  1WAT A;  2OG2 A;  4K0D A;  1VB5 A;  4XLN F;  2YWA A;  2LFD A;  1D0Y A;  2AU5 A;  2XL6 A;  1C02 A;  1PCX A;  3IQT A;  1MNE A;  5T1D B;  4W8P A;  1T6Q A;  2FFH A;  2GDC A;  3AQB A;  4R32 A;  1YYX A;  1LS1 A;  3B0U X;  2Q3T A;  3K1H A;  2P6V A;  2R25 A;  1V54 C;  3RFY A;  3LLI A;  4E7Z A;  4GYT A;  1YJG A;  1FFH A;  4JUR I;  1I4Z A;  3HLZ A;  3CEX A;  2VH3 A;  3W8H A;  2YKZ A;  2EPN A;  4W8K A;  3S27 A;  3SYN A;  1FAP B;  3T4R A;  4CDY A;  2ZXW C;  1RMV A;  3NG1 A;  3NMJ A;  4MVR A;  2LFF A;  2GFH A;  2LSE A;  3WHN A;  2OEV A;  1HW2 A;  2CCY A;  4U5E E;  3AQC A;  2A0U A;  4I44 A;  1TKN A;  4AK9 A;  2UUI A;  2H7B A;  3IPM O;  3UGO A;  2Q9C A;  2HUJ A;  4MTO A;  2G62 A;  2YLI A;  3U2M A;  2UUH A;  2Y69 C;  5BQH A;  1LI7 A;  2A0B A;  1OCZ C;  4LDK A;  5D91 A;  4HFF B;  5A6B D;  5DS6 A;  2WVN A;  4PJM A;  2IOQ A;  1WAS A;  2VCC A;  3R2P A;  2R7V A;  1H9G A;  1ZU5 A;  1XZP A;  3EHM A;  1D1C A;  2HJ3 A;  3MFN A;  3F46 A;  1D1A A;  1NFO A;  2A1D D;  4XTK A;  2EIM C;  3LNR A;  3U3F A;  1DOV A;  2J7P A;  1N1C A;  4JTD B;  5KYW B;  1OCO C;  4NTB A; 
#chains in the Genus database with same CATH homology
 3ABL C;  2WVO A;  2YEV A;  2A6H F;  3ZC4 A;  4G7O F;  3EPV A;  3SP1 A;  1Z6A A;  3Q6M A;  4M63 A;  4OD4 A;  4LER A;  4BJT A;  4BG0 A;  1PD0 A;  3KH2 A;  4JVS A;  2P7V A;  1VOM A;  4HEA J;  5E33 A;  2J9V A;  4CIH A;  5BUO A;  5L3Q A;  3O39 A;  1TWA A;  3F47 A;  4DBQ A;  3W8I A;  5KYW B;  4BJ6 A;  3S28 A;  3NYM A;  4YT4 A;  5T3W A;  5KYY B;  1MMN A;  3MLG A;  3FAJ A;  4JCH A;  2WB7 A;  5B1B C;  5DLJ A;  2CDQ A;  5B1A C;  3EJN A;  4AE4 A;  3GOD A;  4C3B A;  2NUT A;  2KNH A;  2IXN A;  3KKB A;  4IJJ A;  4ZLC A;  3B0V C;  3NKD A;  4DOZ A;  3E70 C;  4YJW A;  3EH2 A;  4DBR A;  2R7O A;  4U5H A;  3GAN A;  4CSA C;  3POV A;  2J46 A;  2XXA A;  2IXP A;  3LJB A;  4AX2 A;  2Z15 A;  2IXM A;  3ITF A;  3DAF A;  3UMK A;  4KNW A;  1M56 C;  4BJ1 A;  2R7Q A;  1TWH A;  1M57 C;  1JPN A;  2R7R A;  2MWQ A;  3EH1 A;  4U5D E;  4PJL A;  5IY5 C;  2KGO A;  1VYK A;  2IYL D;  3NYL A;  3EZI A;  4OIN F;  5E3C A;  2VB6 A;  2CGE A;  4KBL A;  4I1M A;  4G0H A;  5T3T A;  3FVY A;  2D5R B;  2R7T A;  2WZG A;  4A2N B;  1OCC C;  2M4E A;  3N0T A;  4DVZ A;  2CNW D;  3UMH A;  4PFO A;  1M2V A;  3SNH A;  4AE4 B;  3LAY A;  4K7B A;  4G7H F;  3IEE A;  1MMD A;  3NKE A;  3DM9 B;  1Z63 A;  2J0W A;  1Z5Z A;  3JYH A;  4HE8 D;  2WZL A;  3FDQ A;  4QI0 A;  3PMR A;  3AG3 C;  4KC9 A;  3K1I C;  1NG1 A;  2Y3H A;  3NDB B;  3PHF 2;  4G7Z F;  3JCU Q;  3WG7 C;  3DXJ F;  3Q7L A;  2J45 A;  2Q9B A;  4LAC B;  3JRT A;  2R7W A;  3AG2 C;  2VAS A;  1BR1 A;  2YZS A;  2WZF A;  1J8Y F;  1ZHW A;  3W2V A;  1J8M F;  2A69 F;  5DQT A;  1M2O A;  1BR2 A;  1ST6 A;  3ZVR A;  3JT1 A;  4RBN A;  2YHS A;  4QI2 A;  2FGY A;  4U5C E;  4C3D A;  4CS8 A;  4O79 A;  3VYW A;  2Y3D A;  2IXO A;  1RJ9 B;  4JJG A;  4OIR F;  1W2W A;  2PF4 E;  3DJU B;  4CS9 A;  4LLE A;  4RD9 A;  1NZE A;  3EQL F;  2V26 A;  3M1C B;  1ZYR F;  5KYU A;  4YN0 B;  1M2V B;  4FES A;  3RIP A;  3W2W A;  5EHH A;  4X0R A;  3ZSU A;  5CI9 A;  2KW3 C;  2PX0 A;  1OKK A;  5KYX B;  2HV6 A;  3ABM C;  3NYJ A;  2DGJ A;  2ZXO A;  3B9Q A;  4BJ5 C;  2QY9 A;  2V3C C;  1MND A;  4FWV A;  3CSK A;  3EHN A;  3LEV A;  4EBB A;  4HFK B;  2XRH A;  2Q9A A;  3H65 A;  3EG9 A;  3DAG A;  4OIP F;  4XLP F;  3HTK C;  3VAY A;  3K33 A;  3UR3 C;  3ZG1 A;  1LKX A;  2PX3 A;  5DS5 A;  4U5F E;  3S29 A;  5DQZ A;  4F4B A;  3UNG C;  2H7O A;  3ASN C;  2W45 A;  3EGD A;  4XWJ A;  4B6I A;  3K6B A;  2NUP A;  5CI8 A;  1Z23 A;  4ANJ A;  1NU7 D;  2J7P D;  4O6Y A;  3I5P A;  3KL4 A;  1BR4 A;  5KYU B;  1PD1 A;  3DM5 A;  1S7Z A;  3UMI A;  2L9J A;  3MX3 A;  4KI2 A;  4PFP A;  4BEJ A;  1IW7 F;  2XL4 A;  4PJJ A;  2DYS C;  2EIL C;  3HJC A;  3I5Q A;  4MQ9 F;  2W4M A;  3LS0 A;  3EGX A;  1O87 A;  3QMK A;  3RH3 A;  1VYI A;  2XSE A;  2X51 A;  2R7S A;  2W4B A;  2KJG A;  2R7X A;  3AG1 C;  3RKO F;  4CS7 A;  5FCL A;  1D0Z A;  4MND A;  3EG9 B;  3UGP A;  4EWC A;  4WJ0 A;  3X1O A;  4JZA A;  1V55 C;  3V7O A;  1WGW A;  2NUT B;  3ECS A;  4YWQ A;  2L81 A;  2NG1 A;  5HSW A;  4O7G A;  2ZXP A;  2JD3 A;  2EIJ C;  1VK5 A;  4IWB A;  2C03 A;  3FHD A;  4DVY P;  4FX5 A;  1FTS A;  4CSA A;  3EGD B;  3T6B A;  2NUP B;  2XXA B;  4P6I C;  1MMA A;  3E9V A;  4CBE A;  1QZX A;  5DS4 A;  2W9Y A;  3X2Q C;  1IZM A;  3AG4 C;  2B0J A;  1ZU4 A;  1NU9 C;  4PJN A;  4Q5S F;  3KMI A;  1JPJ A;  3EZH A;  3L0I A;  3EGX B;  3JSZ A;  3T6J A;  1TWC A;  4OD5 A;  3QZC A;  4KNV A;  4RDA A;  1SF8 A;  5KYW A;  4NY3 A;  4BJ6 C;  2C04 A;  2J0X A;  4C7O A;  3OWT A;  4OIO F;  5KYY A;  2ZPA A;  4C3E A;  1FMV A;  3K7D A;  2QTV A;  3ASO C;  2Y39 A;  3B0P A;  4IAO A;  5E2Q A;  4N06 A;  5D92 A;  2PP4 A;  4I3M A;  1ZHT A;  2PFD A;  2J9W A;  3DD7 A;  2R7U A;  1KU2 A;  3K66 A;  3S0X A;  1MMG A;  4IRU A;  4J30 B;  2E87 A;  2BE5 F;  2I8B A;  2OCC C;  1SZI A;  5F5F A;  1VMA A;  2Y3G A;  3N2Z B;  2WL8 A;  1ZHZ A;  3CZ6 A;  1G8X A;  3I4U A;  4ULW A;  3LS1 A;  4O6M A;  1LVK A;  3EFO A;  3RYL A;  4Q4Z F;  3ZIB A;  4OIQ F;  2EIK C;  1OCR C;  1SMY F;  2A68 F;  2A6E F;  3O6X A;  4U5G A;  3SZR A;  5EGY A;  3DMD A;  5F5H A;  4C7O B;  3L34 A;  2DYR C;  2CNW A;  4JJF A;  4YT8 A;  1O5H A;  1OKK D;  4J32 B;  2KQ9 A;  2ZXR A;  2Y3B A;  1ZHX A;  3OEO A;  4BJ5 A;  2CW0 F;  3LLK A;  1TR2 A;  4JW1 A;  2EIN C;  3LES A;  4H4K C;  3WOD F;  5B3S C;  2O9X A;  2WVQ A;  3OA1 A;  1QLE C;  2J9U A;  3TD7 A;  4GEH A;  4YT2 A;  1FMW A;  4I1O B;  2G3K A;  3Q7G A;  1FFT C;  2G3V A;  4E7S A;  5KYN A;  4QDL A;  4Q7C A;  4ZLD A;  4CS8 C;  3ABK C;  3EFO B;  1RJ9 A;  5DVW A;  3Q6N A;  1TWG A;  2MYS A;  5E3A A;  1Z3I X;  2H7V C;  3DZA A;  3CQZ A;  4PK4 A;  4LLC A;  4CS9 C;  1ZHY A;  3NRH A;  4U5B E;  2HV7 A;  4YT5 A;  4O6N A;  1D1B A;  3N24 A;  5KYX A;  3DJN B;  1D0X A;  5L3V A;  3SEO A;  4K0D A;  2OG2 A;  4XLN F;  1D0Y A;  1PCX A;  1MNE A;  5T1D B;  2FFH A;  3AQB A;  1LS1 A;  3B0U X;  2Q3T A;  3K1H A;  2P6V A;  1V54 C;  3RFY A;  3LLI A;  4E7Z A;  4GYT A;  1FFH A;  4JUR I;  3HLZ A;  2VH3 A;  3W8H A;  4W8K A;  3SYN A;  3T4R A;  3S27 A;  2ZXW C;  3NG1 A;  2GFH A;  2LSE A;  4U5E E;  3AQC A;  4I44 A;  1TKN A;  4AK9 A;  2H7B A;  3UGO A;  2Q9C A;  2G62 A;  2Y69 C;  1OCZ C;  5D91 A;  4HFF B;  5DS6 A;  2WVN A;  4PJM A;  2IOQ A;  2R7V A;  1ZU5 A;  3EHM A;  1D1C A;  3F46 A;  1D1A A;  2A1D D;  4XTK A;  2EIM C;  3LNR A;  2J7P A;  1N1C A;  1OCO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...