1M56C

Structure of cytochrome c oxidase from rhodobactor sphaeroides (wild type)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
265
structure length
265
Chain Sequence
AHAKNHDYHILPPSIWPFMASVGAFVMLFGAVLWMHGSGPWMGLIGLVVVLYTMFGWWSDVVTESLEGDHTPVVRLGLRWGFILFIMSEVMFFSAWFWSFFKHALYPMGPESPIIDGIFPPEGIITFDPWHLPLINTLILLCSGCAATWAHHALVHENNRRDVAWGLALAIALGALFTVFQAYEYSHAAFGFAGNIYGANFFMATGFHGFHVIVGTIFLLVCLIRVQRGHFTPEKHVGFEAAIWYWHFVDVVWLFLFASIYIWGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords CYTOCHROME C OXIDASE
publication title The X-ray crystal structures of wild-type and EQ(I-286) mutant cytochrome c oxidases from Rhodobacter sphaeroides.
pubmed doi rcsb
total genus 101
structure length 265
sequence length 265
chains with identical sequence I
ec nomenclature
pdb deposition date 2002-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00510 COX3 Cytochrome c oxidase subunit III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1m56C01
1.20.120.80 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1m56C02
1OCRC 3LDDA 3LUTB 4PDMA 4RO2A 3ZRSA 4HYOA 2EIMC 1V54C 4PA6A 3VOUA 3F7VC 3T4ZA 2X6BA 3SJQC 2K1EA 5BZBA 1R3JC 3AG1C 3JYCA 2Q69A 3OUSA 4R6ZA 4MSWC 1LNQA 3SYQA 4CBCA 2A9HA 3AG3C 1G4YB 3SYCA 1QLEC 2EIKC 4LCUC 3FB8C 2WLLB 2ITCC 4TWKA 4XDJA 3OR7C 4LBEC 4GX5A 3STLC 4I9WA 3OR6C 2WLLA 4G28B 4LP8A 4MVRA 3AG4C 3E8HA 4XDLA 4ZBMA 4MVSA 1R3KC 2QTOA 4P2ZA 1XL4A 3E89A 4WFFA 4MTOA 5E1AC 2DYRC 1K4CC 2WLMA 2WLJA 2BOCC 4GX1A 3LDCA 3ABLC 4JTCB 4MVQA 3SYPA 3ASOC 1ORQC 1R3LC 4X88A 3SPIA 1K4DC 3T4DA 3X2QC 4F4LA 3ABKC 2Y69C 2A0LA 4MW8A 2IH3C 5IY5C 4RUFA 1OCOC 3E8FA 3OUFA 3E8GA 1M57C 4QE7A 3KG2A 5EC2C 4PA4A 2DWEC 3R65A 3ASNC 4R50A 2AHZA 3ABMC 3RBZA 1P7BA 2Q67A 2OCCC 4WFGA 2DYSC 2KB1A 4JTDB 2W0FC 5B1BC 4P9OA 5B3SC 4GX2A 2HVKC 2P7TC 4EKWA 2QKSA 2ZXWC 4PA7A 3K08A 4H37A 2H8PC 2WLHA 3K06A 3RVZA 4PDRA 1R3IC 2ATKC 3FB7C 2EILC 3SPGA 3FB6C 3UKMA 5EK0A 3BEHA 3K0GA 3RVYA 4QE9A 5EBMC 3LNMB 2BOBC 2ZD9A 1J95A 1FFTC 4MVMA 1OCZC 4PDVA 5J9PC 2ITDC 2HG5C 4KFMA 3ZJZA 3SYOA 4MS2A 1KKDA 5EC1C 3E83A 3FB5C 3SPJA 4R8CA 2YEVA 4MW3A 2WLKA 2NLJC 3TCUA 4MVZA 4JTAB 4PA3A 4QNHB 3RW0A 3T1CA 5KUKA 3TETA 2HJFC 2JK5C 2EIJC 3AG2C 5EBWC 2AHYA 3K04A 4GX0A 4MTFA 3STZC 4WFHA 4DXWA 3IGAC 2HVJC 4P9PA 4OXSA 4WFEA 1XL6A 2Q68A 1OCCC 1S5HC 3IFXA 3K03A 4J9YB 2X6CA 4R7CA 3SPHA 2Q6AA 2R9RB 2A79B 3K0DA 2IH1C 4MTGA 4P30A 3GB7C 3LDEA 2HFEC 4H33A 3UM7A 5CBHA 4X8AA 5EBLC 4MVUA 1JVMA 2WLIB 2X6AA 3EFFK 3E86A 3F7YC 4RAIA 2EINC 3OGCC 4XDKA 5CBGA 4BW5A 1M56C 2WLIA 4MVOA 4PDLA 5CBFA 4PA9A 2DWDC 3WG7C 4UUJC 3SYAA 3PJSK 4X89A 3T2MA 4G27B 5B1AC 3F5WC 5KUMA 1ZWIC 1V55C 4RUEA 4HZ3A 2WLNA 3HPLC 3E8BA 3SPCA 4J9ZB 1BL8A
chains in the Genus database with same CATH superfamily
1BE3H 3E22B 4JV5O 4YL0A 5L3GA 1CPYA 2VH3A 3C8GA 3JASA 1FXKA 3I4UA 3NDBB 1MSDA 3O65A 3OUSA 1I5NA 2Y3DA 2M64A 4NXMB 1VEWA 4N6CA 1VP7A 1FXHA 2CTPA 2JRIA 1VARA 3DJNB 1FFXA 2YS8A 1WPBA 1L3PA 1YTFD 4KP4A 4TV8A 1F23A 4X1KA 4BR6A 4DVZA 4XEKA 3TJTA 3D36C 4PJNA 4YY3O 2E74B 1B3QA 4R32A 1X59A 3SYPA 2Y0PA 1FMWA 1HY5A 3ABKC 1NFNA 4K0KO 3ZC4A 4FLYA 1HW1A 4LNUA 2ZCEA 1Q6HA 4PJMA 4PD4F 4ZI7B 3EHBB 1VMGA 3S29A 1IBKB 3ICXA 5B66Z 5L3FA 2F43G 2ZT9B 1P7BA 1BT8A 1R73A 1Q0DA 4F6EA 2HZ8A 3ASNB 2XS1A 1PNLA 5B1BC 3OD4A 3G4ZA 2XUMA 3MFNA 4DV6O 3K08A 3FAVA 3BCCH 4X9QA 2UXBB 3ABTA 4YN0B 5DS4A 3ZQYA 2EILC 5KYYA 1D1AA 4DUZB 1WB7A 2ZR2A 1G1XB 2YWAA 4U5CE 4MVMA 3G6EV 3NYLA 2UUBB 2P06A 4JI8B 4XLPF 1D0ZA 1Z23A 4O6MA 1PV0A 4KFMA 3SYOA 2LFDA 2CE4A 3KKBA 1GKFA 5EC1C 1RJ9B 5KLVH 3GODA 3AJMA 1XMOO 3EG9B 2QWNB 1BR2A 3BAAA 2E5LO 3RW0A 1NZEA 3EH2A 3CEIA 4PI0A 2R7UA 2CCYA 4WFHA 2WB7A 4OIRF 2HVJC 4ONSA 1Y6XA 3K7DA 2HKVA 1GRJA 3S3WA 4BG0A 4GCZA 2JS3A 5CMUA 4DV0O 2LO1A 2E76B 1K04A 4U7NA 5HSWA 5DECA 2YI9A 3EFFK 1F7YA 3OGCC 4BEJA 2ILMA 1ZHTA 5JT4A 3RH3A 4PDLA 5BR8O 5CA3A 2EINB 5A69A 1NQTA 1RM1B 3KH2A 2IJKA 3NKDA 2F95B 1K40A 4JIOA 1V55C 2CTQA 4CS9A 1UJWB 1BS3A 1RPRA 1XWJA 2EIMC 1JR8A 5H2FZ 2H3OA 3AOUA 2K1EA 5BZBA 1AR5A 4X65B 3CD6V 2JJ1G 1I5XA 1CEZA 1OW6A 4PFPA 2GV9A 3SJCC 2DOSA 3BABA 4K8ZA 3B71A 5IWAO 4JYBA 4ZI7A 4DR7O 1U0BB 5JWPA 4LP8A 3W7TA 2EZPA 1S72V 3OA1A 3OE7G 4I1MA 4CH6A 1J5EO 3Q7GA 3CXCU 5IJ0B 4GX1A 1MZFA 1U96A 3H1KH 4I5SA 3CCSV 3MLGA 3MX3A 1ZTEA 4K8XA 2XLEA 4NTAA 4NY3A 1YLMA 1P49A 1XMQB 4PFOA 3HKBB 4JI5B 1K97A 2OIEA 5H9CA 3DMDA 4E7SA 1I0HA 3QO5A 3ETEA 3E8GA 2YICA 5JJNB 3EXAA 3ABMC 4IHJA 4NVPA 5LL6Y 1M57B 3S27A 3ZWIA 4MTXA 1RJ9A 4JYCA 3C62A 2Z3YA 2OEVA 4PK4A 3EG9A 2OJQA 1AI4A 1OHHG 2R9AA 1CP9A 3B77A 4I50A 1T9KA 4NTBA 3KKYA 5FPRA 2DGJA 2WLHA 3UMHA 3CRMA 4X1YB 3FOPA 3I56V 3CMEV 4LACB 1J95A 2A3QA 5EYPA 3APOA 3W8IA 5COMA 1OV9A 1ZHZA 4IARA 1QQCA 2QSAA 3SPJA 3IHUA 1GQAA 2RQ6A 1N0JA 4U9DA 4O4LB 3VYWA 2N05A 4U9EA 3PMRA 4JZ2A 3STZC 1GGQA 4AL1A 4DXWA 4H4KC 1YDXA 3NYMA 5L3DA 2ASRA 4K1OA 3T6GB 3IFXA 2G62A 2K9PA 1FKAO 4DUYO 3W7WA 4ULWA 2KQ9A 3K58A 1LIHA 3POVA 2Q4PA 4TSFG 3QVZA 1HNXB 4DV5O 3A2FA 5CBGA 2GTAA 4MQ9F 5L0IA 3B8NA 3HLZA 3ZRVA 1XQ8A 3ZHRA 2LP4A 5JRAA 4JI2O 1TKNA 2Y3BA 2DB4A 4UB6Z 2ZIMA 4UVCA 5IJ0A 3R66A 5B1NA 4XTKA 3ZHVA 4ZKIA 4I7ZB 4JI3B 2ICWG 1OKKD 1GN3A 3JATA 4JZGA 1NS1A 1F1MA 2A69F 1R3JC 1FAPB 2M7WA 4JYYA 5KYNA 1FFHA 1PV3A 3HKBA 4ZLCA 3CB2A 3AK1A 3DSQA 2IW5A 4LR3A 2HS5A 1QLEB 5IT9N 4PJJA 1VQNV 1H2KA 3E35A 2XL8A 4ZBMA 2XHBA 3M8AA 3JALB 3AG4B 3B40A 4DR4B 5LA6B 4NKGB 1GH6A 3NRHA 3N2GB 3ZBHA 1WN7A 3U0ZA 3L34A 3SJBC 4X1YA 1YZAA 3OMIB 2C2AA 2A1DD 3EFOA 2BC5A 4CZZA 3NMKA 3E8FA 5EC2C 2YDEA 3U2LA 3RBZA 4FLUA 2Q67A 2UXDO 5CB4A 2Y4UA 4FLXA 4CIHA 4DOZA 2XLMA 4G78A 4X1IA 5F5FA 2IXPA 2BE5F 2KG7B 2YIBD 5LGNA 2XLVA 4OIPF 1BHAA 3JD0A 2CGEA 2UUAO 3SPGA 3FB6C 3HB3B 5JH7A 3O9OA 2YL7A 1O5HA 5EBMC 1LE2A 1I4YA 1GN4A 2DN9A 2J9UA 4OPHA 2YL3A 3PDMP 1P84F 2XM4A 3UQ8A 2HG5C 3I5QA 3ZRWB 1X4TA 3HKKA 3HKCB 1GS9A 2XAFA 1W59A 1XOUA 2ZR3A 3DAFA 4UCTA 3AGUA 3OM3B 2JEUA 2VC9A 4CBEA 2AZ0A 3AG2B 1JMKC 1K7DA 2Y4TA 4R7CA 2ZDIA 2UUCO 2A79B 4BIZA 4EWCA 4YIOA 3C63A 4BJ6C 2R7RA 3T1HB 1MSWD 5KA5A 4MVUA 1EI7A 1Q86W 2G3KA 3IQ6A 4XDKA 2GTSA 3JARB 2NNUA 3HJCA 3FAJA 4N21A 4PA9A 3DI5A 3IQTA 3ZS8C 3ZN0A 3G6BA 3JALA 4B08A 1CGOA 3CS5A 5B1AB 2ZM6O 4MNDA 3ZRSA 2QTSA 4CC5A 4JI7B 1AI7A 2QTVA 3ECSA 5FPOA 1VQMV 5JCOA 1MOFA 2VS0A 2V26A 5CI9A 5F5HA 4LF9B 3GM3A 3EJNA 3H2UA 3QO8A 3FVYA 2KYHA 2KNHA 3FB8C 5IYZB 1GM7A 2ZXRA 4FJCC 4HE8D 3STLC 4DR1O 3G4XA 4G28B 2D5RB 1JOYA 1VB5A 2QTOA 1I08A 3H1IH 4WFFA 3IPMO 1QLNA 4LFAB 3KL4A 3WODF 1XNQO 3N2ZB 3N24A 2LP7A 1K4CC 2XAGA 1T6UA 4DRXA 4XWJA 2PGGA 3UCSC 4P9FA 3NR7A 4TQDA 3ITFA 2NUPA 2VRZA 3LLKA 4A4AA 1VLSA 3JYYA 4B7EA 1NVPB 2W4MA 5E3CA 4W4KA 1W0KG 1YARO 1QBZA 4YT2A 1NU1H 5F2VO 4X66B 3T1YB 4FWVA 4Z1MG 3ZRWA 2EBOA 4FLZA 4W4LA 2Q4FA 4B7KA 2VASA 1V74B 2QKSA 4PA7A 5B3SB 1YI2V 1E83A 4ZLDA 4AE4B 4I4TB 1VQ4V 4FM0A 1PD1A 2MK3A 4CS8A 1K3EA 1FTSA 4J7KA 5GONA 1WJZA 5IYDO 4LDQA 4YWQA 4UV9A 3CCJV 3DXRB 5J9PC 3OTOB 2DW4A 1O3UA 1FFTB 1XNRB 1V4AA 3GWOA 5KHIA 3TXSA 4E7ZA 3L8IA 1AR1B 2QNLA 3CC2V 4WJ0A 4ZHQA 2F66C 4GX0A 1ZW3A 1J8YF 1OW8A 2HV6A 2LW7A 4B3SB 2IXNA 2Q5ZA 4B3RB 2Q68A 4J9YB 2KK1A 2X0LA 5CA0B 3C3TA 3FYIB 4ZOLB 1SZTA 2Q0OC 2W9YA 5H6RA 3K1IC 1ST6A 2WWWA 1QCEA 1E86A 5EGYA 1SZIA 2JEXA 2ETNA 4LFCO 2WLIA 3O39A 1JJOA 3VQWA 1M4UA 4XPWA 4B3TO 5KYWB 2OT5A 5LP6C 3DM9B 4YJ2A 1KNYA 2J7PA 3OMNB 1AJPA 1HR0O 1Z5ZA 2BSKA 3LDDA 1GN6A 2P6JA 3DD7A 2BCCH 2JDIG 1TR2A 4O4IB 5BMVB 1SQFA 2AGAA 2F23A 4WBNB 3AG1C 1EN5A 2R72A 1EM1A 1LNQA 4QPKA 4CH4A 1BHBA 4DR2O 4YT4A 1NTMH 5A6BA 1NU9C 2ITCC 4TWKA 4EFBA 2R7OA 2AZ2A 3OR7C 4LBEC 1WGWA 2L6HA 3L8JA 4DR5O 3O55A 2ZINA 2XXAA 2CTWA 2P4KA 2I15A 5BXZA 4JCZA 1Q82W 2OTLV 1YAUO 2RJZA 4JI4B 4LF8B 4DRJB 1AILA 2WLJA 4X64B 4JURI 3AEIA 5A6JA 3H1HH 3SZRA 2PX3A 3C8GD 2ADPA 3KZIZ 3N2KA 4TUYA 4AE4A 1M90W 3ABLB 2R7QA 4I4TA 2OWOA 3X2QC 4QI2A 2L6GA 2OKUA 2PTMA 4I9QA 1CXZB 4DR6B 4CS7A 4GKKO 4J7TA 3VBBA 4FFBB 4IYIA 4G2KA 4DJ9A 1TFOB 3U2MA 3DXRA 3UGOA 2LFSA 3EGXB 1QQ3A 5K0IA 2R25A 1K5SA 3JSEO 3LJBA 4JJGA 1N33B 2LIGA 1EKYA 3UR3C 1A7DA 1MA1A 1WNSA 4ASUG 3GM2A 2HV7A 5C8YA 4W8KA 1Z63A 1MNEA 5CA0A 3RVYA 1QR9A 4QE9A 5DM6V 5L0GA 4TV9A 3B0PA 3JD4A 4FLTA 5IJ9B 1H7IA 1XEQA 1D5NA 2I8BA 3ZDLA 2WA3A 4RQFA 1SA0B 2P22C 2BTQA 2WLKA 3RYIA 1K5QA 2XT9A 1H2GA 3Q4HB 4PV1B 5DEDA 3THOA 1H2LA 5LBQA 2VQFO 1GN2A 2GFHA 5FLXN 1N8RW 3RYFB 4NXNO 1PD0A 4LF6O 2P61A 5FL7G 1Y6DA 4DV3B 4KHPB 5IYCO 4NB5A 1HNWO 3EHMA 3NKEA 4AL0A 4WBNA 3F5TA 4C3EA 3RT3C 1SESA 1Z6AA 1D1CA 4RAIA 3E86A 3K59A 3R7CA 4BAYA 5L0FA 2J9WA 3AQBA 2AW9A 4GKJO 1ZAUA 2QE7G 3UT5B 3SXYA 3SNHA 4DV2O 5GTHZ 3E9VA 4DV1B 3ETDA 2ZNJA 5A6AA 2DI3A 1M2VA 1NLXA 2YXHA 1V54C 2EPMX 2JS5A 1BQ0A 3SXKA 1YZBA 2YXLA 3OFNG 4JASA 4MSWC 3FHDA 3M79A 2V3CC 1CPQA 2EPNA 4U3FH 1T5OA 1Y74A 2MWQA 4FFBA 1M93A 1LM3B 4MVRA 1SQBH 5GW7A 1EN4A 4HAMA 2Q9BA 3C7JA 4JI0O 4PELA 2XAHA 1Z2GA 2UU9O 3U10A 1DOWA 3L72H 1QZXA 2L9JA 2DYRB 2JPUA 3AQCA 4N4WA 2EJ7A 2JX0A 1JCHA 1MABG 3V5XA 2PYLA 1QVFU 4LFBB 2LSEA 2AVKA 4QPJA 1ZVZA 2RN9A 1DF5A 2TMVP 3HNKA 4N06A 1R4TA 2R70A 2NR5A 4RQEA 1OCOC 3N27A 2Y69B 3K5NA 1N32B 5AC5A 1PL4A 2DWEC 4CS4A 3ATPA 2OG2A 5KMGA 2OCCC 4LWSB 3B0VC 5CA1B 1IBMB 1SA0A 2YL1A 3ZG1A 5LHIA 4B3MB 5T1DB 4H37A 1VF6A 2XNDG 3FYEB 2ZXWB 3RYFA 4YHHO 5FCLA 5KAFZ 1Q0MA 1MMMA 3DTUB 3UMIA 1NBBA 1Q0KA 4JZAA 1WA8B 1HNZO 1RSOA 1WPXA 3K9AA 3IQ5A 1H2MA 1F51A 2ITDC 2O57A 3CCUV 1BCCH 2QWQB 1M6TA 4NXMO 2PNOA 2NPUA 2YLDA 1EZJA 4MS2A 2B0HA 3L74H 4DW0A 1QVGU 2P6VA 5EHHA 1YCIA 1XI1A 2EIJC 2GSMB 2CGNA 3IQCA 4P9PA 5H6QA 4OXSA 3K3WA 1VOMA 1OCCC 5LYJB 4EB6B 2R9RB 4CS3A 3T9OA 3LDEA 2E87A 2JGUA 3RYCB 2QE9A 5K1PA 4DV7B 1YXBA 3WU2Z 4BW5A 2E5LB 2J46A 3FFQA 5LMNB 3U8PA 4UCSA 3CCEV 3WG7C 1IBKO 1YTFB 1BQZA 5CI8A 3SYAA 2OU6A 4EEQA 2O9XA 4G27B 3TK0A 2YVKA 1AROP 1XHZA 2R03A 1OCZC 1BZKA 3CC7V 1OW7A 4I3MA 4HNAB 3LUTB 5L3QA 4C3DA 3VOUA 2H7VC 3E22A 4WABA 3SGIA 2HR3A 3GEHA 2CH7B 2EJRA 2FAPB 5LHHA 1YJNV 2R02A 4OPAA 2PBEA 4I44A 4DUZO 3T4RA 2X51A 2DQ3A 4D7SA 3K33A 2WLLB 3J80N 2XM0A 4H13B 2QWRB 3CSXA 2Q7EA 1I7FA 1TWHA 1NBMG 4JI8O 2QEXV 2UXCB 5COGA 2YIDA 3CEXA 1Z5WA 3E89A 5CA1A 3IJ4A 2HHHB 1ORJA 4MTOA 3ETGA 2PFDA 1HE9A 4JC7A 1U97A 1OR3A 4JTCB 4MVQA 4IIJB 3G50A 3A11A 4PR9A 4RWUA 3P30A 1I94B 3FDQA 1WWPA 4CJOA 1R3LC 1VQ6V 3W8HA 1C02A 4DR7B 2PYJA 3GM1A 5IY5C 4RUFA 3ABKB 2XLDA 2PY5A 2LJ2A 1RFYA 4QDLA 4UDVA 4CSAC 3GEEA 1IZ3A 1TWCA 1EQ1A 2GAQA 4G7HF 4EKWA 1JRAA 1VQ8V 4EBJA 3M99B 5B1BB 2DJVA 2PI4A 4FZ0A 2XL6A 3QW0A 4J80A 3LESA 1TWGA 1RKEB 3D3IA 4Z9HA 2ZXOA 1N0NA 1F4MA 2EILB 3LNMB 2BOBC 2YIAA 3NMJA 4O7GA 2G38A 4DR3B 2F22A 3TOLA 5KHHA 3S0XA 2CTRA 1AJNA 5JVDB 1TWAA 1EA8A 1JOGA 4TOIA 3HNLA 1TUEB 5D91A 3K5LA 2ZDIC 2JD3A 2HP8A 2JK5C 2AHYA 1AJQA 2EPKX 1XL6A 4HNAA 4BWAA 1ZZPA 3A0BZ 3GB7C 4IB4A 4XEFA 1LPEA 3W4YA 5K1XA 4Z1VA 1XMQO 1JFFB 2ODMA 4JI5O 1G4WR 5LGUA 2CNWA 5J2TB 5A9GA 4OINF 1H9GA 1K05A 1B06A 5JJEB 1A7EA 2XAQA 1OJHA 3ZRXA 2DWDC 4NR1A 5KX5B 4NYKA 4LF7B 3CQZA 5D5PA 3RQFA 4LF5O 3ZMUA 1V55B 2H8AA 4AQYB 1NZ6A 3PCVA 4IIJA 5T3WA 4YT8A 3D36A 3SJQC 2EIMB 1JPJA 2P1AA 1S5JA 4R6ZA 3CWBH 2UXNA 2A9HA 3QTCA 1G4YB 4Q4ZF 4EBBA 2EIKC 4LCUC 5IY5B 3JD3A 4BJ5C 3B8MA 4E0HA 2HMQA 4E0IA 4OX9B 1MQVA 1L0LH 3CRRA 3MDSA 3WFVA 1OZ0A 4J30B 2GUZB 1KMIZ 1MNGA 1K9MW 1H6GA 2BOCC 3GANA 4FX5A 3TOMA 1TUBB 3LDCA 2Y48A 1WP8A 4RBNA 3ZMZA 3ASOC 1ORQC 3UNGC 1HP8A 3QTHA 4MW8A 4U5EE 1VQLV 1GMGA 5B1OA 3ZMSA 1K33A 1K92A 4L87A 3W7SA 1XBLA 5L3BA 3SXMA 4JAVA 1RKCA 4WFGA 2DYSC 3JSNA 5GTIZ 1A0BA 3ABMB 1WLEA 1KC8W 1Q0FA 2HJMA 3VM6A 2HVKC 2P7TC 3ZIAG 1HWYA 1US6A 3A8TA 4CIPA 2VQEB 4CS8C 1R6TA 3K06A 3ML0A 1R6KA 1KQSU 4K3AA 5EK0A 4JI3O 3GORA 1LUWA 3K66A 1MZEA 4XLNF 2B5UA 2QKCA 3W2WA 2UXDB 2YC0A 2MHRA 3K57A 3LEVA 5J2TA 2C03A 2Q7GA 2YKZA 2GHYA 5JP7A 1YVIA 5KX5A 4IRUA 3ZVRA 3TCUA 3NG1A 4PA3A 3CCQV 1CGNA 4DV4B 1ZSPA 3K04A 1AVMA 5FNVB 4O4LA 3Q7LA 2PP4A 3UGPA 2VWJA 2ZE6A 3DE8A 5DQZA 4D4NA 4CC6A 1TAEA 4HFFB 4FFKA 4JI1O 2LQGA 2H7BA 2KW3C 3W7UA 2Z0AA 2QM4A 5LMUB 3FD9A 2WVOA 1Q3EA 2P4VA 4UV8A 3LNNA 4CS2A 4CH3A 3T2MA 4FM2A 1M9NA 1ZWIC 3WB1A 5JJJB 3SYNA 2WLNA 2GUZA 1APCA 2D2CB 1R6NA 5LOVB 1OCRC 4RO2A 2VCBA 2JGDB 3CCVV 1TUBA 3EH1A 3E2EA 1P7GA 1B6QA 1PNMA 3QF7A 1O87A 3OEEG 3M15A 2Q3TA 3AG3C 1FD9A 1LS1A 1E1RG 1IXBA 3FMSA 2QWOB 1TQGA 3ZQVA 4FMTA 4GYTA 1IDSA 4N6HA 3WAQA 1GAXA 4JI6O 3L9DA 2ZQMA 3GWNA 2LD6A 5E1AC 3K9SA 4KUMA 1OXBA 4DRIB 1N36B 1EFRG 5LA6A 3ZEDA 2RMKB 3N2GA 3U11A 4I0XB 4LF4B 3EGDB 3DE9A 4DBQA 4GYCB 1IXMA 1K73W 3EQLF 3DC6A 2A0LA 4BJ1A 1SQPH 4DR1B 1Q5OA 5A6BD 3T1HO 4F6RB 2VCCA 4K0DA 4R50A 2AHZA 3QZCA 1PL0A 3LEOA 4MT8A 4X62B 4CX9A 1PD3A 3H1LH 1WAZA 3U3FA 1A32A 5LGTA 4DBRA 1N4CA 1OKKA 4U7OA 2KG7A 1XILA 3ZMTA 1KP3A 4JI7O 4WGZA 5IE9A 3JAKB 4GLXA 1SQXH 4IAOA 3CRCA 1Q43A 2EZOA 1TA8A 2Q7HA 4NTWA 4PDVA 1L7CA 1QNMA 1AP5A 2NSFA 3B9QA 2HSBA 1DF4A 1Y67A 2CGOA 4O4JB 4LLCA 2J0XA 3ABUA 2FL4A 4JTAB 3HKCA 1SS3A 2ZXPA 1CGME 4LFAO 5CIVA 2W6IG 5LOVA 1I5YA 3S28A 3A0RA 4O4HB 3K0DA 1JPXA 1T01A 4JYAB 2HLDG 1WTYA 5L0JA 4H33A 4U3JB 1EZVH 3KYIA 3PN1A 1PP9H 3OEHG 3J06A 1M56C 2NUTB 2PX0A 3K5MA 2RDCA 1MG1A 5BQHA 4UUJC 2GDCA 1MMDA 3MBGA 3JARA 4PACA 3PJSK 3AK2A 4PHZA 4X89A 4X66O 2F4VB 4GQHA 1PKXA 3LSUA 1KP2A 3LLIA 3T1CA 3E8BA 2YIBA 4JPRA 5HV9A 1FJGB 2OTJV 3TXQA 2CYDA 1YA7O 4KNVA 5T3TA 3KCXA 2A6EF 2QLAA 4LC1A 1H2NA 2IJJA 2NN4A 3EGDA 3ZTZA 2AWCA 4JAUA 2Q69A 2AXTZ 5D5QA 2HMZA 3JYHA 4LH6A 3HR0A 2Q73A 3F47A 1MMNA 3DZAA 4F6RA 5IYZA 3OTOO 3AGTA 3CYOA 5LXTB 1XNRO 4NQFA 1YVWA 5KHGA 2IJIA 3C8ZA 4H54A 3RYHB 2G3VA 1FXKC 2J8WA 3U0CA 4DK0A 1YJWV 1BGYH 1BMFG 2YUAA 1BZ4A 3JCUQ 1C17M 4B3SO 4B3RO 3TQOA 4JW1A 3EPVA 5KYXB 3L71H 3JZ0A 1T6IA 2OJED 3LS0A 4G0HA 4L8JA 1AVOB 2ZNIA 2YLIA 1G4US 5L3VA 5JQGB 3H01A 1W2WA 5GPGB 1VF6C 3S84A 3APQA 4ANJA 5BY1A 4E18A 1WP7A 3BHPA 1Y4MA 4NTXA 5E79Z 4GUNA 1YYJA 4TQFA 5KYUB 2QA4V 3UKMA 2FTKA 2Z15A 1AB3A 1SF8A 2F93B 2MW2B 1GM9A 2BL2A 4BJ6A 2UUIA 2BE3A 1FNTc 3QG5A 1TVKB 2OQMA 2NUTA 4UFZA 2YQYA 3NMIA 1JR9A 3MD0A 3H9VA 4QNHB 4HFKB 4AX2A 3TD7A 3IEEA 1AI6A 3LNRA 3DM5A 4P6IC 4K7BA 2LFFA 1DOVA 4JI4O 3CCMV 4LF8O 4PI2A 2IXMA 3K03A 3QO7A 1NTKH 4I55B 1HMOA 3I5DA 2OYQA 3UMKA 2R9IA 3W2VA 1ENVA 1ROPA 1IX9A 4ZOLA 4J10A 3ZHTA 1LI5A 2X6AA 2L81A 3JCZA 5KA6A 4DR6O 1BSMA 2Q9LA 1KU9A 4BJTA 4MVOA 2VQFB 5IDJA 4WFBV 1G8XA 2Y0IA 3F46A 2MYSA 4U5FE 2EPOA 1CPRA 3FKSG 1KKCA 5J2UB 1QKRA 4XBFA 2CUGA 5LXTA 1PCXA 1AP6A 4RUEA 1C03A 1N34O 5KYWA 3SPCA 2WL8A 2OIGA 1FS0G 3C8GB 5LP6B 1N33O 2WPDG 4NTFA 4UVBA 3K5OA 4KI2A 4UVAA 1O9HA 4CJGA 4PJ0Z 3CXHF 3G4SV 4OIQF 1VQ9V 4O4IA 1LS4A 5BMVA 4IWBA 4CBCA 3AG1B 1DK1A 2R7SA 1YF2A 2B9ZA 1BBHA 3O6XA 1FFXB 4XDJA 3C90A 5L0HA 4I9WA 1R1BA 4XEVA 4EBKA 3IC7A 3JD2A 1L8DA 4MVSA 2LGWA 4CS9C 4X1KB 2EULA 2JVDA 4DK1A 3JT1A 4O2AB 4QI0A 1QR8A 4L6RA 1YJGA 4X88A 4LNUB 4DV3O 1ZX3A 4ZIBA 2W0XA 4KHPO 1NG1A 1KTMA 3X2QB 4O6YA 1YITV 2HSQA 2QM8A 3P3NA 2KJGA 1IBLB 4GEHA 2UUHA 3ASNC 3O10A 2QGNA 2RSEB 3U8VA 2QM7A 2KB1A 2W0FC 3EGXA 3QNEA 4JV5B 1THZA 3MAQA 1I4ZA 1SZXA 4DYLA 5C93A 1YZCA 3OWTA 4DV1O 2NSGA 3U5SA 3ZX6A 4PDRA 5KHKA 4ICGA 2DE0X 1IURA 5DVWA 3U9MA 3DKAA 1B04A 1MNDA 3ZHSA 2XRHA 1IW7F 3V5ZA 5IJ9A 3RGBA 3HNJA 4X20B 3ZJZA 1KKDA 2FYUH 2Q00A 3FB5C 1TFKB 3FXHA 5J2UA 2D4UA 4YY3B 1ZHWA 5AG2A 1VYKA 3Q4HA 2ZE8A 3IGAC 1GTOA 4FESA 4E2LA 3TJ6A 5DLJA 4G7ZF 5LP6A 1HNZB 2X6CA 4K0KB 3BRJA 1LKXA 1W2BU 4YL1A 2QDOA 2WVNA 2HFEC 5E33A 4LFBO 3US6A 3A9CA 2KQXA 2M6YA 5AGFA 1YEWA 2EINC 1AUEA 1RM1C 2FGYA 2Y3HA 2XL4A 5CBFA 1O9GA 2P5OA 1N32O 1AEPA 1URFA 4KBLA 4DRHB 4UB8Z 4DV6B 3UT5A 4FVMA 1Y4CA 3KYJA 3EZIA 2GBOA 1T6QA 3M1CB 3SP1A 3GEIA 4HZ3A 1IBMO 5A6KA 3CHXA 2LW1A 1VK5A 2UXXA 2J9VA 4B3MO 4C3BA 2V7QG 2DMXA 4O2AA 2X6BA 3G80A 4YXWG 2YHSA 1V54B 4H0LB 3SYQA 2XLOA 5BQGA 5JVEA 3I55V 2CNWD 3ZHUA 1XMOB 3A0HZ 4U5BE 3FOOA 3DWWA 4TT3G 4JAAA 1H8HG 1R3KC 5E3AA 4P9TA 4H44B 3G67A 2EPLX 1WN0A 2R7VA 2LCHA 4LERA 4DV0B 2HJDA 1KB9F 1FR0A 1MMAA 3FX7A 4OD4A 1K4DC 5B5EZ 4F4LA 2UXBO 3QMKA 3OMAB 4YL3A 1VMAA 2LK4A 4RDAA 5BR8B 1Y76B 1LI7A 4FK5C 4IHJB 1JQ0A 1M57C 2B1GA 3JSLA 3Q6NA 2PF4E 1OCOB 2L6LA 4NCQA 1R5ID 4X20A 4DV7O 2UUBO 3TULA 1M2OA 4LWSA 2OCCB 4QIWF 5LMNO 4I50B 5JLIA 4BEMJ 2A0BA 1ZHYA 1GO3F 2B1IA 3VQYA 4KXRA 3OEOA 1NR1A 1XDCA 1YHQV 2L6FA 5EYPB 3CMAV 4UCUA 5CN0A 2ZD9A 1KD1W 4X0RA 4CDVA 3BVOA 5IWAB 1GM8A 3J81N 1WA8A 1H2SB 4YJ3B 3OW2U 1VQ5V 3LS1A 2A06H 3VQXA 1YYXA 5D92A 1FXVA 3JRTA 3V7OA 4OGQB 3ETQA 1B68A 3RF3A 1J5EB 1Q6IA 4MW3A 2UXCO 3B09A 4RD9A 5DS5A 4J42A 5DN6G 1D2DA 4MTFA 2HHHO 3BA8A 3RFYA 1NR7A 2EIJB 2IJHA 2FKXA 3UO2A 4BIOA 1FAFA 1D0YA 1VF7A 1F4NA 4MTGA 1DTOA 1OCCB 5LYJA 4EB6A 1I94O 4EUKB 1QU7A 3UM7A 5HFMA 1SMYF 4Q20A 4X65O 1YIJV 3S90A 3JD1A 2PZSA 3RYCA 3MYFA 2W45A 1RMVA 1GK9A 1IVSA 1OQCA 2ZE5A 3WG7B 5KUMA 3JATB 1OCZB 2X7RB 3CCRV 1L0NH 1IZMA 1ORSC 1Q81W 2RNBA 3L75H 2XLWA 1G8MA 3K1HA 2CH7A 3CCLV 3S3XA 2WA4A 3CAXA 1QLEC 1Y76A 4DR3O 4UCOA 3ZTMA 4GX5A 4UXNA 2YXYA 2Q7RA 2WLLA 4BPMA 3AG4C 1P4RA 4O79A 2NG1A 4LF5B 2KC3A 1J8MF 2XASA 2WVQA 3DXJF 1SETA 3DC5A 3U3BA 3JAMN 4XQ1A 4Z9IA 2YL0A 5JCOC 4DUYB 4A5UB 1KUQA 3PHF2 1U89A 1BR1A 3EFOB 1VQ7V 3CRQA 3T4DA 4DV5B 2E3CA 4N23A 3B29A 1Z5VA 1SQVH 4YJ3A 1JJ2U 4JF3A 1NT2B 2LGQA 5CB4B 4JI2B 4X1IB 5BQIA 3E70C 1LE4A 3RWRD 4LF7O 2ARHA 2KSFA 1Z7Qc 2KGOA 2Q0AA 3W7XA 1NU7D 4ULVA 2H8PC 4B6IA 2QJ1A 5B3IA 5JH7B 2IU3A 4D6TH 1VIBA 4LDKA 1D1BA 5BUOA 2OOCA 3UO3A 1NSGB 1RKEA 4C7OB 3AG7A 4AQYO 1VQKV 3U9JA 4AILC 1Q8IA 4J7JA 3KMIA 2HJ3A 5IYBO 3WB0A 5JVDA 3L70H 1NI8A 5A2QN 1HNXO 3DJUB 2B0JA 1E2XA 4OX9O 2HFIA 3TK1A 3VQVA 4GT1A 4WF9V 2F1MA 2HJFC 3AG2C 1BR4A 3QW1A 1G6UA 3M4BA 3X1OA 4D7TA 2R05A 2A0UA 3EHNA 4P30A 2BTOA 2WSSG 1D0XA 1SQQH 1XHXA 3S9OA 3IC9A 4X8AA 5EBLC 4FM1A 3HNIA 4KL1A 1E79G 4J32B 3HKDB 2FFHA 1VQPV 1JFFA 2WZGA 1FPOA 1WASA 1S05A 5B1AC 2E75B 2UUAB 4PDMA 2WZLA 4JI1B 2AWYA 2YLGA 4JCHA 4WCEV 3F7VC 4DR4O 4XPXA 2XSEA 4IGGA 1LUVA 2VQEO 3CC4V 3JYCA 4Z2WA 5L0DA 1Q7YW 2XTAA 2CW0F 2R7XA 1UFIA 3T6BA 5DQTA 1ZU4A 2Y39A 3CP1A 5L0CA 1EN6A 3NXSA 2EIKB 4JE9A 3I5PA 1XL4A 2YSUB 2JJ2G 3AK3A 2A6HF 4A2NB 4K35A 4E17A 4DRXB 1QHTA 4W8PA 2WLMA 4U5DE 4CSAA 1SRYA 3C18A 2UUCB 4D4XA 1S77D 4JRZA 4DV4O 1QVXA 2M4EA 2NUPB 1HE1A 1ZL8B 1SR2A 1D5AA 3FAPB 3BFRA 3H1JH 4FLVA 3SPIA 3H65A 3BPZA 3ASOB 3JCUZ 3LSQA 4C7OA 3VAYA 2QKAA 3ZN1A 4C7UA 2ETSA 1ZUQA 3OUFA 2VWKA 5HFLA 4FPPA 3KG2A 4JI6B 2ZIOA 3R65A 4YJWA 1H38A 3JAWB 2IBZH 5TISZ 3CZ6A 5LMUO 1PPJH 4JTDB 2ADQB 1HDJA 2ZM6B 5B3SC 5L3EA 4GX2A 5E2QA 2DYSB 3WB2A 2J7PD 3RQEA 4J7ZA 4NC3A 1FYJA 2XLHA 3FB7C 2H7OA 2EX3A 1G5ZA 5GONB 1BDJB 4Q5SF 3K0GA 1S76D 256BA 1YA9A 4Q6GA 2W4BA 3H2VA 3ZIBA 1FFTC 3QVNA 1XZQA 2HKOA 4O2BB 4O6NA 1Q0GA 2KSDA 3HKDA 1NVPD 1S0VA 4ABMA 3P32A 1XNQB 4ZHQB 2A7WA 4R8CA 4LH7A 1DGSA 2FMLA 2QUPA 1COWG 4YIPA 4Z9JA 1E85A 3LSSA 4QJFB 4HBNA 4FLWA 1SYQA 5H5NA 4CDAA 4CH5A 4UCRA 1XUQA 1S7ZA 3JRMO 1H9TA 2RCVA 3KCYA 1NTZH 4WFEA 4EIYA 5FNVA 1OXKA 4FAPB 2P90A 1N36O 4IYHA 4U5GA 2HUJA 1AI5A 1JAFA 4LF4O 2IYLD 4IJJA 2Y3GA 2WLIB 1M5IA 3T6JA 4LF9O 3OTFA 2JIZG 4XPYA 4BJ5A 4YJ2B 4J7YA 2P67A 4JJFA 3F5WC 2BSKB 4JKVA 4X62O 1JX9A 1NH2D 4AI8A 4J9ZB 1KU2A 2FB5A 4EHPA 1OCRB 3RQGA 2JGDA 1K8AW 2LQTA 1SQGA 4IL6Z 1S5LZ 1ZL8A 1PM9A 2N04A 4FZ1A 3SYCA 5JUAA 2IXOA 2XXAB 3AG3B 1HMDA 1XREA 2PUSA 2HEPA 5AC4A 1KECA 2IBFA 4LDRA 3OR6C 3JAWA 3HTKC 4CDYA 2QWPB 3TJ5A 3L0IA 3T1YO 2KKWA 4TUYB 3N2KB 1K34A 1SKVA 3ABLC 1ZHXA 2VCAA 1ZW2A 1WB8A 3B2EE 2N74A 4HEAJ 2L7AA 3DAGA 4YK5A 2D3OW 1KYOF 1ORYA 5F28E 4I0XA 1TGOA 1UG7A 4JGSA 3B4SA 3CRAA 2CDYA 5EZYB 4LFCB 2RD9A 2AP3A 4JYAO 4AHCA 3OAAG 1VTMP 4B3TB 4O2BA 2YZSA 4ER9A 2YI8A 3JTLO 3L1MA 3CE2A 1NH2B 1HR0B 1OR2A 2R7WA 1SERA 2ZKOA 4YT5A 5EIBC 1UFBA 2CDQA 4BW9A 1ZLZA 2F4VO 2IOQA 4DW1A 3OT7A 5C8YB 3RYLA 2DQ0A 2IU0A 1FJGO 2P7VA 2GA0A 3K79A 4TV9B 3TGUH 4DR2B 1HW7A 3BEHA 3D8CA 2XAJA 1ZU5A 3CJHB 4OD5A 3MYIA 4IAQA 2P0NA 2XS8A 4JVSA 2OEXA 1U6HA 2IM9A 3JAKA 3VRCA 4DR5B 1M1KW 4OIOF 2Q8VA 4UCVA 2BTQB 3RYIB 3D3QA 4M63A 3E83A 2J9BA 3EZHA 1WATA 1SC5B 2NLJC 3HKEB 4MVZA 5KUKA 3VF0A 1SF9A 2XOKG 2CAZC 4O4JA 3NYJA 5ITZB 5EBWC 1YJ9V 4KNWA 3JSZA 3K6BA 3B0UX 3M4CA 3ZHQA 3SPHA 2W6JG 5EIBD 1V9PA 5JS5A 5L3CA 4GKKB 3WHNA 3GWLA 1HW2A 4DO2A 4O4HA 4J11A 5CBHA 4F4BA 1JVMA 4U3JA 1EBOA 2AU5A 4JEAA 2R7TA 3CSKA 3MHSC 4AK9A 2QR4A 1S3JA 2YEVB 5JSLA 1M56B 2GWWA 1AR4A 3RKOF 1M2VB 2ZE7A 1YDIA 3KPHA 1E1QG 2OCHA 1A41A 1ZYRF 3ZMVA 3HPLC 1BL8A 5TJ5E 2WAMA 1Q6UA 4HYOA 4PA6A 3MHHC 4E4EA 2YRFA 3T4ZA 4X64O 1JPNA 3BA9A 1UPGA 3BY6A 2A68F 2CK3G 1NKDA 2J0WA 5DS6A 5KAIZ 1Y74B 5KHJA 4LLEA 5EZYA 1NFOA 3SEOA 1DLBA 2L35A 1PNKA 3BRCA 4WFAV 1N34B 2QY9A 3E8HA 4XDLA 4P2ZA 3SR2C 4IT5A 3R2PA 3GVMA 4NXNB 2DYRC 1FMVA 4LF6B 4JEBA 1E84A 1VF5B 3CPWU 1QPUA 1HNWB 3RYHA 3JASB 5FZTA 5LHGA 1FXKB 1RCPA 4BIUA 1A7VA 2Y69C 2IH3C 3CJHA 4DVYP 3DGEA 1VQOV 2V1DA 4GKJB 1LR1A 1JA8A 4QE7A 5KMGB 5KYXA 2LFRA 4PA4A 4DV2B 3LAYA 1MMGA 4WGYA 3P3PA 1XZPA 3SXZA 4TV8B 3EVKA 4P9OA 5JQGA 3HKEA 2ZXWC 4FIPC 5ITZA 1W0JG 4NTYA 2V4DA 3RVZA 2H94A 2IM8A 1R3IC 2ATKC 1Z3IX 5KYUA 1RSOB 4Q7CA 2Z5UA 2PI5A 3QVYA 2J45A 1JMWA 1KBHA 4EFEA 2C04A 3SJAC 3RN4A 3ZSUA 4GZRB 1RPOA 1H8EG 4JI0B 3L73H 3Q6MA 1Y66A 2YEVA 2UU9B 1Q90D 1TVKA 3M7MX 3J7AU 2WZFA 3N0TA 3RFRA 3RIPA 3TETA 3FAVB 2X0CA 1L1FA 4I1OB 2VB6A 4KC9A 3C3SA 5KYYB 1S5HC 4G7OF 3OGIB 2Q6AA 4QGPA 2IH1C 2ZPAA 1RP3B 1YSCA 4I55A 1LVKA 3V5YA 3CX5F 1N1CA 2Q9CA 1NJIW 3F7YC 1RXQA 3ZCCA 4PJLA 1WOLA 1QSPA 1VLTA 3GWKC 1IBLO 1GM5A 3K1IA 3SDLA 3IAYA 4U5HA 5COFA 2GDSA 2Q9AA 4YHHB 1VYIA 4J41A 1T5EA 3G71V
chains in the Genus database with same CATH topology
5L3GA 1CPYA 2VH3A 1FXKA 3I4UA 3NDBB 3OUSA 2Y3DA 1FXHA 3DJNB 1YTFD 4KP4A 1F23A 4DVZA 4PJNA 3SYPA 1FMWA 3ABKC 3ZC4A 4PJMA 3EHBB 3S29A 5L3FA 2F43G 1P7BA 1R73A 3ASNB 1PNLA 5B1BC 3K08A 3ABTA 4YN0B 5DS4A 2EILC 5KYYA 1D1AA 2ZR2A 4U5CE 4MVMA 3G6EV 3NYLA 4XLPF 1D0ZA 1Z23A 4O6MA 4KFMA 3SYOA 3KKBA 1GKFA 5EC1C 1RJ9B 3GODA 3EG9B 1BR2A 3RW0A 1NZEA 3EH2A 2R7UA 2WB7A 4WFHA 4OIRF 2HVJC 3K7DA 4BG0A 4GCZA 5CMUA 4U7NA 5HSWA 3EFFK 4BEJA 3OGCC 1ZHTA 3RH3A 4PDLA 5CA3A 2EINB 1NQTA 1RM1B 3KH2A 2IJKA 3NKDA 1V55C 4CS9A 1UJWB 1RPRA 2EIMC 2K1EA 5BZBA 3CD6V 2JJ1G 1I5XA 1CEZA 4PFPA 4JYBA 4LP8A 3W7TA 2EZPA 1S72V 3OA1A 3OE7G 4I1MA 3Q7GA 3CXCU 4GX1A 4I5SA 3CCSV 3MLGA 3MX3A 4NY3A 4PFOA 1K97A 5H9CA 3DMDA 4E7SA 3QO5A 3ETEA 3E8GA 3ABMC 3S27A 1M57B 4MTXA 1RJ9A 4JYCA 2Z3YA 4PK4A 3EG9A 1AI4A 1OHHG 1CP9A 3B77A 2DGJA 2WLHA 3UMHA 3I56V 3CMEV 4LACB 1J95A 3W8IA 1ZHZA 3SPJA 3VYWA 3PMRA 3STZC 4DXWA 4H4KC 3NYMA 5L3DA 3IFXA 2G62A 4ULWA 3W7WA 2KQ9A 3POVA 4TSFG 5CBGA 4MQ9F 3B8NA 3HLZA 3ZRVA 1TKNA 2Y3BA 4UVCA 5B1NA 4XTKA 4ZKIA 1OKKD 2A69F 1R3JC 2M7WA 5KYNA 1FFHA 4ZLCA 2IW5A 1QLEB 4PJJA 1VQNV 3E35A 4ZBMA 3AG4B 3NRHA 3L34A 3OMIB 2C2AA 2A1DD 3EFOA 4CZZA 3E8FA 5EC2C 3RBZA 2Q67A 4CIHA 4DOZA 5F5FA 2IXPA 2BE5F 5LGNA 4OIPF 1BHAA 3JD0A 2CGEA 3SPGA 3FB6C 3HB3B 1O5HA 5EBMC 2J9UA 2HG5C 3I5QA 3ZRWB 2XAFA 2ZR3A 3DAFA 3OM3B 2JEUA 4CBEA 3AG2B 1K7DA 4R7CA 2ZDIA 2A79B 4BIZA 4EWCA 4BJ6C 2R7RA 1MSWD 5KA5A 4MVUA 1Q86W 2G3KA 4XDKA 3HJCA 2NNUA 3FAJA 4N21A 4PA9A 3ZN0A 5B1AB 4MNDA 3ZRSA 1AI7A 2QTVA 3ECSA 1VQMV 5CI9A 1MOFA 5F5HA 2V26A 3EJNA 3QO8A 3FVYA 2KNHA 3FB8C 1GM7A 2ZXRA 4FJCC 4HE8D 3STLC 4G28B 2D5RB 1JOYA 2QTOA 4WFFA 3WODF 3KL4A 1QLNA 3N2ZB 3N24A 2LP7A 1K4CC 2XAGA 4XWJA 3ITFA 2NUPA 3LLKA 1NVPB 5E3CA 2W4MA 1W0KG 1QBZA 4YT2A 4FWVA 4Z1MG 3ZRWA 2EBOA 2VASA 2QKSA 4PA7A 5B3SB 1YI2V 4ZLDA 4AE4B 1VQ4V 1PD1A 2MK3A 4CS8A 1K3EA 1FTSA 5IYDO 4YWQA 4UV9A 3CCJV 5J9PC 2DW4A 1FFTB 3GWOA 4E7ZA 1AR1B 3CC2V 4WJ0A 4GX0A 1J8YF 2HV6A 2IXNA 2Q68A 4J9YB 2X0LA 3FYIB 1SZTA 2W9YA 5H6RA 3K1IC 1ST6A 2WWWA 1QCEA 5EGYA 1SZIA 2JEXA 3O39A 2WLIA 5KYWB 2OT5A 3DM9B 2J7PA 3OMNB 1AJPA 1Z5ZA 3DD7A 3LDDA 2P6JA 2JDIG 1TR2A 3AG1C 1LNQA 4QPKA 1BHBA 4YT4A 1NU9C 2ITCC 4TWKA 2R7OA 3OR7C 4LBEC 1WGWA 2XXAA 1Q82W 2OTLV 2WLJA 4JURI 3AEIA 3SZRA 2PX3A 4AE4A 1M90W 3ABLB 2R7QA 3X2QC 4QI2A 4CS7A 3VBBA 4G2KA 3UGOA 2LFSA 3EGXB 1K5SA 3LJBA 4JJGA 3UR3C 4ASUG 2HV7A 4W8KA 1Z63A 1MNEA 3RVYA 1QR9A 4QE9A 5DM6V 3B0PA 3JD4A 2I8BA 4RQFA 2WLKA 1K5QA 5LBQA 1H2GA 2GFHA 1N8RW 1PD0A 5FL7G 5IYCO 3EHMA 3NKEA 4C3EA 1SESA 1Z6AA 1D1CA 4RAIA 3E86A 4BAYA 2J9WA 3AQBA 2QE7G 3SNHA 3E9VA 3ETDA 1M2VA 1V54C 3OFNG 4JASA 4MSWC 3FHDA 2V3CC 2MWQA 4MVRA 5GW7A 4HAMA 2Q9BA 4PELA 2XAHA 1QZXA 2L9JA 2DYRB 3AQCA 1JCHA 1MABG 1QVFU 2LSEA 4QPJA 1DF5A 4N06A 4RQEA 1OCOC 2Y69B 2DWEC 2OG2A 2OCCC 3B0VC 3ZG1A 5LHIA 5T1DB 4H37A 2XNDG 3FYEB 2ZXWB 5FCLA 3DTUB 3UMIA 4JZAA 1WPXA 3K9AA 1F51A 2ITDC 3CCUV 1EZJA 4MS2A 1QVGU 2P6VA 5EHHA 2EIJC 2GSMB 4P9PA 5H6QA 4OXSA 3K3WA 1VOMA 1OCCC 2R9RB 3LDEA 2E87A 4BW5A 2J46A 3CCEV 1YTFB 3WG7C 5CI8A 3SYAA 2O9XA 4G27B 1AROP 1OCZC 3CC7V 4I3MA 3LUTB 5L3QA 4C3DA 3VOUA 2H7VC 2HR3A 2EJRA 5LHHA 1YJNV 4I44A 3T4RA 2X51A 2DQ3A 3K33A 2WLLB 1TWHA 1NBMG 2QEXV 3E89A 4MTOA 3ETGA 2PFDA 4JTCB 4MVQA 3FDQA 3P30A 1R3LC 1VQ6V 3W8HA 5IY5C 4RUFA 3ABKB 4QDLA 4CSAC 1TWCA 4G7HF 4EKWA 1VQ8V 3M99B 5B1BB 2PI4A 3LESA 1TWGA 3D3IA 2ZXOA 1F4MA 2EILB 3LNMB 2BOBC 4O7GA 3S0XA 1AJNA 1TWAA 1TUEB 5D91A 2ZDIC 2JD3A 2JK5C 2AHYA 1AJQA 1XL6A 3GB7C 4OINF 2CNWA 5LGUA 2XAQA 3ZRXA 2DWDC 3CQZA 3ZMUA 1V55B 4YT8A 5T3WA 3D36A 3SJQC 2EIMB 1JPJA 4R6ZA 2UXNA 2A9HA 1G4YB 4Q4ZF 4EBBA 2EIKC 4LCUC 5IY5B 3JD3A 4BJ5C 3B8MA 3WFVA 1OZ0A 4J30B 3GANA 1K9MW 2BOCC 4FX5A 3LDCA 2Y48A 4RBNA 3ZMZA 3ASOC 1ORQC 3UNGC 4MW8A 4U5EE 1VQLV 1GMGA 5B1OA 3ZMSA 1K33A 1K92A 4L87A 3W7SA 5L3BA 4JAVA 4WFGA 2DYSC 3ABMB 1WLEA 1KC8W 2HVKC 2P7TC 3ZIAG 1HWYA 4CS8C 3K06A 3ML0A 1R6KA 1KQSU 5EK0A 3K66A 4XLNF 2B5UA 3W2WA 3LEVA 2C03A 2GHYA 3ZVRA 4IRUA 3TCUA 3NG1A 4PA3A 3CCQV 3K04A 3Q7LA 2PP4A 3UGPA 5DQZA 4HFFB 2H7BA 2KW3C 3W7UA 2WVOA 4UV8A 3T2MA 1M9NA 1ZWIC 3SYNA 2WLNA 1R6NA 1OCRC 4RO2A 3CCVV 3EH1A 3E2EA 1B6QA 1PNMA 1O87A 3OEEG 2Q3TA 3AG3C 1LS1A 1E1RG 4FMTA 4GYTA 2ZQMA 5E1AC 4KUMA 1EFRG 3EGDB 4DBQA 1IXMA 1K73W 3EQLF 2A0LA 4BJ1A 4K0DA 4R50A 2AHZA 3QZCA 1PL0A 4MT8A 1PD3A 5LGTA 4DBRA 1OKKA 4U7OA 3ZMTA 1KP3A 4IAOA 2EZOA 4PDVA 3B9QA 1DF4A 4LLCA 2J0XA 3ABUA 4JTAB 2ZXPA 2W6IG 1I5YA 3S28A 3A0RA 3K0DA 1JPXA 2HLDG 4H33A 3OEHG 1M56C 2NUTB 2PX0A 1MG1A 4UUJC 1MMDA 3PJSK 4X89A 1PKXA 1KP2A 3LLIA 3T1CA 3E8BA 4JPRA 2OTJV 5T3TA 4KNVA 2A6EF 4LC1A 2IJJA 3EGDA 4JAUA 2Q69A 3JYHA 3F47A 1MMNA 3DZAA 3CYOA 2IJIA 2G3VA 1FXKC 1YJWV 1BMFG 3JCUQ 4JW1A 3EPVA 5KYXB 3LS0A 4G0HA 5L3VA 3H01A 1W2WA 4ANJA 1Y4MA 5KYUB 2QA4V 3UKMA 2FTKA 2Z15A 1SF8A 1GM9A 4BJ6A 2NUTA 3MD0A 4HFKB 4AX2A 4QNHB 3TD7A 3IEEA 1AI6A 3LNRA 3DM5A 4P6IC 4K7BA 3CCMV 2IXMA 3K03A 3QO7A 3UMKA 2R9IA 3W2VA 1ENVA 1ROPA 2X6AA 2L81A 3JCZA 5KA6A 4BJTA 4MVOA 4U5FE 5IDJA 4WFBV 1G8XA 3F46A 2MYSA 3FKSG 4XBFA 1PCXA 4RUEA 5KYWA 3SPCA 2WL8A 1FS0G 2WPDG 4UVBA 4KI2A 4UVAA 3G4SV 4OIQF 1VQ9V 4IWBA 4CBCA 3AG1B 2R7SA 3O6XA 4XDJA 4I9WA 3IC7A 3JD2A 4MVSA 4CS9C 3JT1A 4QI0A 1QR8A 4X88A 1NG1A 3X2QB 4O6YA 1YITV 2QM8A 2KJGA 4GEHA 3ASNC 2QM7A 2KB1A 2W0FC 3EGXA 3QNEA 1THZA 5C93A 3OWTA 4PDRA 5DVWA 1MNDA 2XRHA 1IW7F 3ZJZA 1KKDA 3FB5C 1ZHWA 1VYKA 3IGAC 1GTOA 4FESA 4E2LA 5DLJA 4G7ZF 2X6CA 1LKXA 1W2BU 5E33A 2WVNA 2HFEC 2EINC 1RM1C 2FGYA 2Y3HA 2XL4A 5CBFA 4KBLA 3M1CB 3EZIA 3SP1A 4HZ3A 1VK5A 2UXXA 2J9VA 4C3BA 2V7QG 2X6BA 2YHSA 4YXWG 1V54B 3SYQA 3I55V 2CNWD 4U5BE 4TT3G 1H8HG 1R3KC 5E3AA 2R7VA 4LERA 1MMAA 4OD4A 1K4DC 3QMKA 4F4LA 3OMAB 1VMAA 4RDAA 4FK5C 1JQ0A 1M57C 2B1GA 3Q6NA 2PF4E 1OCOB 1M2OA 4QIWF 2OCCB 1ZHYA 1GO3F 2B1IA 3OEOA 1NR1A 1YHQV 3CMAV 5CN0A 2ZD9A 1KD1W 4X0RA 1GM8A 3OW2U 1VQ5V 3LS1A 5D92A 1FXVA 3JRTA 3V7OA 4MW3A 4RD9A 5DS5A 5DN6G 4MTFA 3RFYA 1NR7A 2EIJB 2IJHA 1D0YA 1F4NA 4MTGA 1DTOA 1OCCB 3UM7A 5HFMA 1SMYF 4Q20A 1YIJV 3JD1A 2W45A 1GK9A 3WG7B 5KUMA 1OCZB 2X7RB 3CCRV 1IZMA 1Q81W 1G8MA 3K1HA 3CCLV 1QLEC 4GX5A 4UXNA 2WLLA 3AG4C 1P4RA 4O79A 2NG1A 1J8MF 2XASA 2WVQA 3DXJF 1SETA 3PHF2 1BR1A 3EFOB 1VQ7V 3T4DA 4N23A 1JJ2U 4JF3A 3E70C 2KGOA 3W7XA 1NU7D 2H8PC 4B6IA 2IU3A 1D1BA 5BUOA 4C7OB 1VQKV 3KMIA 5IYBO 3DJUB 2B0JA 3TK1A 4GT1A 4WF9V 2HJFC 3AG2C 1BR4A 3X1OA 3EHNA 4P30A 2WSSG 1D0XA 4X8AA 5EBLC 1E79G 4J32B 2FFHA 1VQPV 2WZGA 5B1AC 4PDMA 2WZLA 4JCHA 4WCEV 3F7VC 2XSEA 3CC4V 3JYCA 1Q7YW 2CW0F 2R7XA 3T6BA 5DQTA 1ZU4A 2Y39A 3CP1A 3NXSA 2EIKB 3I5PA 1XL4A 2YSUB 2JJ2G 2A6HF 4A2NB 2WLMA 4U5DE 4CSAA 1SRYA 1S77D 2M4EA 2NUPB 3SPIA 3H65A 3ASOB 3LSQA 4C7OA 3VAYA 3ZN1A 3OUFA 4FPPA 5HFLA 3KG2A 3R65A 4YJWA 1H38A 3CZ6A 4JTDB 5B3SC 5L3EA 4GX2A 5E2QA 2DYSB 2J7PD 3FB7C 2H7OA 4Q5SF 3K0GA 1S76D 2W4BA 3ZIBA 1FFTC 2HKOA 4O6NA 1NVPD 1S0VA 3P32A 4R8CA 1COWG 3LSSA 4QJFB 1S7ZA 4WFEA 2P90A 4U5GA 1AI5A 2IYLD 4IJJA 2Y3GA 2WLIB 3T6JA 2JIZG 4BJ5A 2P67A 4JJFA 3F5WC 1JX9A 1NH2D 4J9ZB 1KU2A 1OCRB 1K8AW 3SYCA 2IXOA 2XXAB 3AG3B 1KECA 3OR6C 3HTKC 3L0IA 1K34A 3ABLC 1ZHXA 4HEAJ 3DAGA 2D3OW 4JGSA 3OAAG 2YZSA 1NH2B 2R7WA 1SERA 4YT5A 2CDQA 2IOQA 3RYLA 2DQ0A 2IU0A 2P7VA 3K79A 3BEHA 2XAJA 1ZU5A 4OD5A 4JVSA 1M1KW 4OIOF 4M63A 3E83A 3EZHA 2NLJC 4MVZA 5KUKA 2XOKG 3NYJA 5EBWC 1YJ9V 4KNWA 3JSZA 3K6BA 3B0UX 3SPHA 2W6JG 5L3CA 4DO2A 4F4BA 5CBHA 1JVMA 1EBOA 2R7TA 3CSKA 3MHSC 4AK9A 1S3JA 2YEVB 1M56B 3RKOF 1M2VB 1E1QG 1ZYRF 3ZMVA 3HPLC 1BL8A 2WAMA 4HYOA 4PA6A 3MHHC 3T4ZA 1JPNA 3BY6A 2A68F 2CK3G 1NKDA 2J0WA 5DS6A 4LLEA 3SEOA 1DLBA 1PNKA 4WFAV 2QY9A 3E8HA 4XDLA 4P2ZA 2DYRC 1FMVA 3CPWU 5LHGA 1FXKB 4BIUA 2Y69C 2IH3C 4DVYP 3DGEA 1VQOV 2V1DA 4QE7A 5KYXA 2LFRA 4PA4A 3LAYA 1MMGA 4P9OA 2ZXWC 4FIPC 1W0JG 3RVZA 2H94A 1R3IC 2ATKC 1Z3IX 5KYUA 4Q7CA 2Z5UA 2PI5A 2J45A 2C04A 3ZSUA 1RPOA 1H8EG 3Q6MA 1Y66A 2YEVA 3RIPA 2WZFA 3N0TA 3TETA 1L1FA 4I1OB 2VB6A 4KC9A 5KYYB 1S5HC 4G7OF 2Q6AA 2IH1C 2ZPAA 1YSCA 1LVKA 1N1CA 2Q9CA 1NJIW 3F7YC 3ZCCA 4PJLA 4U5HA 2Q9AA 1VYIA 3G71V
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCR C;  3LDD A;  3LUT B;  4PDM A;  4RO2 A;  3ZRS A;  4HYO A;  2EIM C;  1V54 C;  4PA6 A;  3VOU A;  3F7V C;  3T4Z A;  2X6B A;  3SJQ C;  2K1E A;  5BZB A;  1R3J C;  3AG1 C;  3JYC A;  2Q69 A;  3OUS A;  4R6Z A;  4MSW C;  1LNQ A;  3SYQ A;  4CBC A;  2A9H A;  3AG3 C;  1G4Y B;  3SYC A;  1QLE C;  2EIK C;  4LCU C;  3FB8 C;  2WLL B;  2ITC C;  4TWK A;  4XDJ A;  3OR7 C;  4LBE C;  4GX5 A;  3STL C;  4I9W A;  3OR6 C;  2WLL A;  4G28 B;  4LP8 A;  4MVR A;  3AG4 C;  3E8H A;  4XDL A;  4ZBM A;  4MVS A;  1R3K C;  2QTO A;  4P2Z A;  1XL4 A;  3E89 A;  4WFF A;  4MTO A;  5E1A C;  2DYR C;  1K4C C;  2WLM A;  2WLJ A;  2BOC C;  4GX1 A;  3LDC A;  3ABL C;  4JTC B;  4MVQ A;  3SYP A;  3ASO C;  1ORQ C;  1R3L C;  4X88 A;  3SPI A;  1K4D C;  3T4D A;  3X2Q C;  4F4L A;  3ABK C;  2Y69 C;  2A0L A;  4MW8 A;  2IH3 C;  5IY5 C;  4RUF A;  1OCO C;  3E8F A;  3OUF A;  3E8G A;  1M57 C;  4QE7 A;  3KG2 A;  5EC2 C;  4PA4 A;  2DWE C;  3R65 A;  3ASN C;  4R50 A;  2AHZ A;  3ABM C;  3RBZ A;  1P7B A;  2Q67 A;  2OCC C;  4WFG A;  2DYS C;  2KB1 A;  4JTD B;  2W0F C;  5B1B C;  4P9O A;  5B3S C;  4GX2 A;  2HVK C;  2P7T C;  4EKW A;  2QKS A;  2ZXW C;  4PA7 A;  3K08 A;  4H37 A;  2H8P C;  2WLH A;  3K06 A;  3RVZ A;  4PDR A;  1R3I C;  2ATK C;  3FB7 C;  2EIL C;  3SPG A;  3FB6 C;  3UKM A;  5EK0 A;  3BEH A;  3K0G A;  3RVY A;  4QE9 A;  5EBM C;  3LNM B;  2BOB C;  2ZD9 A;  1J95 A;  1FFT C;  4MVM A;  1OCZ C;  4PDV A;  5J9P C;  2ITD C;  2HG5 C;  4KFM A;  3ZJZ A;  3SYO A;  4MS2 A;  1KKD A;  5EC1 C;  3E83 A;  3FB5 C;  3SPJ A;  4R8C A;  2YEV A;  4MW3 A;  2WLK A;  2NLJ C;  3TCU A;  4MVZ A;  4JTA B;  4PA3 A;  4QNH B;  3RW0 A;  3T1C A;  5KUK A;  3TET A;  2HJF C;  2JK5 C;  2EIJ C;  3AG2 C;  5EBW C;  2AHY A;  3K04 A;  4GX0 A;  4MTF A;  3STZ C;  4WFH A;  4DXW A;  3IGA C;  2HVJ C;  4P9P A;  4OXS A;  4WFE A;  1XL6 A;  2Q68 A;  1OCC C;  1S5H C;  3IFX A;  3K03 A;  4J9Y B;  2X6C A;  4R7C A;  3SPH A;  2Q6A A;  2R9R B;  2A79 B;  3K0D A;  2IH1 C;  4MTG A;  4P30 A;  3GB7 C;  3LDE A;  2HFE C;  4H33 A;  3UM7 A;  5CBH A;  4X8A A;  5EBL C;  4MVU A;  1JVM A;  2WLI B;  2X6A A;  3EFF K;  3E86 A;  3F7Y C;  4RAI A;  2EIN C;  3OGC C;  4XDK A;  5CBG A;  4BW5 A;  1M56 C;  2WLI A;  4MVO A;  4PDL A;  5CBF A;  4PA9 A;  2DWD C;  3WG7 C;  4UUJ C;  3SYA A;  3PJS K;  4X89 A;  3T2M A;  4G27 B;  5B1A C;  3F5W C;  5KUM A;  1ZWI C;  1V55 C;  4RUE A;  4HZ3 A;  2WLN A;  3HPL C;  3E8B A;  3SPC A;  4J9Z B;  1BL8 A; 
#chains in the Genus database with same CATH topology
 1BE3 H;  3E22 B;  4JV5 O;  4YL0 A;  5L3G A;  1CPY A;  2VH3 A;  3C8G A;  3JAS A;  1FXK A;  3I4U A;  3NDB B;  1MSD A;  3O65 A;  3OUS A;  1I5N A;  2Y3D A;  2M64 A;  4NXM B;  1VEW A;  4N6C A;  1VP7 A;  1FXH A;  2CTP A;  2JRI A;  1VAR A;  3DJN B;  1FFX A;  2YS8 A;  1WPB A;  1L3P A;  1YTF D;  4KP4 A;  4TV8 A;  1F23 A;  4X1K A;  4BR6 A;  4DVZ A;  4XEK A;  3TJT A;  3D36 C;  4PJN A;  4YY3 O;  2E74 B;  1B3Q A;  4R32 A;  1X59 A;  3SYP A;  2Y0P A;  1FMW A;  1HY5 A;  3ABK C;  1NFN A;  4K0K O;  3ZC4 A;  4FLY A;  1HW1 A;  4LNU A;  2ZCE A;  1Q6H A;  4PJM A;  4PD4 F;  4ZI7 B;  3EHB B;  1VMG A;  3S29 A;  1IBK B;  3ICX A;  5B66 Z;  5L3F A;  2F43 G;  2ZT9 B;  1P7B A;  1BT8 A;  1R73 A;  1Q0D A;  4F6E A;  2HZ8 A;  3ASN B;  2XS1 A;  1PNL A;  5B1B C;  3OD4 A;  3G4Z A;  2XUM A;  3MFN A;  4DV6 O;  3K08 A;  3FAV A;  3BCC H;  4X9Q A;  2UXB B;  3ABT A;  4YN0 B;  5DS4 A;  3ZQY A;  2EIL C;  5KYY A;  1D1A A;  4DUZ B;  1WB7 A;  2ZR2 A;  1G1X B;  2YWA A;  4U5C E;  4MVM A;  3G6E V;  3NYL A;  2UUB B;  2P06 A;  4JI8 B;  4XLP F;  1D0Z A;  1Z23 A;  4O6M A;  1PV0 A;  4KFM A;  3SYO A;  2LFD A;  2CE4 A;  3KKB A;  1GKF A;  5EC1 C;  1RJ9 B;  5KLV H;  3GOD A;  3AJM A;  1XMO O;  3EG9 B;  2QWN B;  1BR2 A;  3BAA A;  2E5L O;  3RW0 A;  1NZE A;  3EH2 A;  3CEI A;  4PI0 A;  2R7U A;  2CCY A;  4WFH A;  2WB7 A;  4OIR F;  2HVJ C;  4ONS A;  1Y6X A;  3K7D A;  2HKV A;  1GRJ A;  3S3W A;  4BG0 A;  4GCZ A;  2JS3 A;  5CMU A;  4DV0 O;  2LO1 A;  2E76 B;  1K04 A;  4U7N A;  5HSW A;  5DEC A;  2YI9 A;  3EFF K;  1F7Y A;  3OGC C;  4BEJ A;  2ILM A;  1ZHT A;  5JT4 A;  3RH3 A;  4PDL A;  5BR8 O;  5CA3 A;  2EIN B;  5A69 A;  1NQT A;  1RM1 B;  3KH2 A;  2IJK A;  3NKD A;  2F95 B;  1K40 A;  4JIO A;  1V55 C;  2CTQ A;  4CS9 A;  1UJW B;  1BS3 A;  1RPR A;  1XWJ A;  2EIM C;  1JR8 A;  5H2F Z;  2H3O A;  3AOU A;  2K1E A;  5BZB A;  1AR5 A;  4X65 B;  3CD6 V;  2JJ1 G;  1I5X A;  1CEZ A;  1OW6 A;  4PFP A;  2GV9 A;  3SJC C;  2DOS A;  3BAB A;  4K8Z A;  3B71 A;  5IWA O;  4JYB A;  4ZI7 A;  4DR7 O;  1U0B B;  5JWP A;  4LP8 A;  3W7T A;  2EZP A;  1S72 V;  3OA1 A;  3OE7 G;  4I1M A;  4CH6 A;  1J5E O;  3Q7G A;  3CXC U;  5IJ0 B;  4GX1 A;  1MZF A;  1U96 A;  3H1K H;  4I5S A;  3CCS V;  3MLG A;  3MX3 A;  1ZTE A;  4K8X A;  2XLE A;  4NTA A;  4NY3 A;  1YLM A;  1P49 A;  1XMQ B;  4PFO A;  3HKB B;  4JI5 B;  1K97 A;  2OIE A;  5H9C A;  3DMD A;  4E7S A;  1I0H A;  3QO5 A;  3ETE A;  3E8G A;  2YIC A;  5JJN B;  3EXA A;  3ABM C;  4IHJ A;  4NVP A;  5LL6 Y;  1M57 B;  3S27 A;  3ZWI A;  4MTX A;  1RJ9 A;  4JYC A;  3C62 A;  2Z3Y A;  2OEV A;  4PK4 A;  3EG9 A;  2OJQ A;  1AI4 A;  1OHH G;  2R9A A;  1CP9 A;  3B77 A;  4I50 A;  1T9K A;  4NTB A;  3KKY A;  5FPR A;  2DGJ A;  2WLH A;  3UMH A;  3CRM A;  4X1Y B;  3FOP A;  3I56 V;  3CME V;  4LAC B;  1J95 A;  2A3Q A;  5EYP A;  3APO A;  3W8I A;  5COM A;  1OV9 A;  1ZHZ A;  4IAR A;  1QQC A;  2QSA A;  3SPJ A;  3IHU A;  1GQA A;  2RQ6 A;  1N0J A;  4U9D A;  4O4L B;  3VYW A;  2N05 A;  4U9E A;  3PMR A;  4JZ2 A;  3STZ C;  1GGQ A;  4AL1 A;  4DXW A;  4H4K C;  1YDX A;  3NYM A;  5L3D A;  2ASR A;  4K1O A;  3T6G B;  3IFX A;  2G62 A;  2K9P A;  1FKA O;  4DUY O;  3W7W A;  4ULW A;  2KQ9 A;  3K58 A;  1LIH A;  3POV A;  2Q4P A;  4TSF G;  3QVZ A;  1HNX B;  4DV5 O;  3A2F A;  5CBG A;  2GTA A;  4MQ9 F;  5L0I A;  3B8N A;  3HLZ A;  3ZRV A;  1XQ8 A;  3ZHR A;  2LP4 A;  5JRA A;  4JI2 O;  1TKN A;  2Y3B A;  2DB4 A;  4UB6 Z;  2ZIM A;  4UVC A;  5IJ0 A;  3R66 A;  5B1N A;  4XTK A;  3ZHV A;  4ZKI A;  4I7Z B;  4JI3 B;  2ICW G;  1OKK D;  1GN3 A;  3JAT A;  4JZG A;  1NS1 A;  1F1M A;  2A69 F;  1R3J C;  1FAP B;  2M7W A;  4JYY A;  5KYN A;  1FFH A;  1PV3 A;  3HKB A;  4ZLC A;  3CB2 A;  3AK1 A;  3DSQ A;  2IW5 A;  4LR3 A;  2HS5 A;  1QLE B;  5IT9 N;  4PJJ A;  1VQN V;  1H2K A;  3E35 A;  2XL8 A;  4ZBM A;  2XHB A;  3M8A A;  3JAL B;  3AG4 B;  3B40 A;  4DR4 B;  5LA6 B;  4NKG B;  1GH6 A;  3NRH A;  3N2G B;  3ZBH A;  1WN7 A;  3U0Z A;  3L34 A;  3SJB C;  4X1Y A;  1YZA A;  3OMI B;  2C2A A;  2A1D D;  3EFO A;  2BC5 A;  4CZZ A;  3NMK A;  3E8F A;  5EC2 C;  2YDE A;  3U2L A;  3RBZ A;  4FLU A;  2Q67 A;  2UXD O;  5CB4 A;  2Y4U A;  4FLX A;  4CIH A;  4DOZ A;  2XLM A;  4G78 A;  4X1I A;  5F5F A;  2IXP A;  2BE5 F;  2KG7 B;  2YIB D;  5LGN A;  2XLV A;  4OIP F;  1BHA A;  3JD0 A;  2CGE A;  2UUA O;  3SPG A;  3FB6 C;  3HB3 B;  5JH7 A;  3O9O A;  2YL7 A;  1O5H A;  5EBM C;  1LE2 A;  1I4Y A;  1GN4 A;  2DN9 A;  2J9U A;  4OPH A;  2YL3 A;  3PDM P;  1P84 F;  2XM4 A;  3UQ8 A;  2HG5 C;  3I5Q A;  3ZRW B;  1X4T A;  3HKK A;  3HKC B;  1GS9 A;  2XAF A;  1W59 A;  1XOU A;  2ZR3 A;  3DAF A;  4UCT A;  3AGU A;  3OM3 B;  2JEU A;  2VC9 A;  4CBE A;  2AZ0 A;  3AG2 B;  1JMK C;  1K7D A;  2Y4T A;  4R7C A;  2ZDI A;  2UUC O;  2A79 B;  4BIZ A;  4EWC A;  4YIO A;  3C63 A;  4BJ6 C;  2R7R A;  3T1H B;  1MSW D;  5KA5 A;  4MVU A;  1EI7 A;  1Q86 W;  2G3K A;  3IQ6 A;  4XDK A;  2GTS A;  3JAR B;  2NNU A;  3HJC A;  3FAJ A;  4N21 A;  4PA9 A;  3DI5 A;  3IQT A;  3ZS8 C;  3ZN0 A;  3G6B A;  3JAL A;  4B08 A;  1CGO A;  3CS5 A;  5B1A B;  2ZM6 O;  4MND A;  3ZRS A;  2QTS A;  4CC5 A;  4JI7 B;  1AI7 A;  2QTV A;  3ECS A;  5FPO A;  1VQM V;  5JCO A;  1MOF A;  2VS0 A;  2V26 A;  5CI9 A;  5F5H A;  4LF9 B;  3GM3 A;  3EJN A;  3H2U A;  3QO8 A;  3FVY A;  2KYH A;  2KNH A;  3FB8 C;  5IYZ B;  1GM7 A;  2ZXR A;  4FJC C;  4HE8 D;  3STL C;  4DR1 O;  3G4X A;  4G28 B;  2D5R B;  1JOY A;  1VB5 A;  2QTO A;  1I08 A;  3H1I H;  4WFF A;  3IPM O;  1QLN A;  4LFA B;  3KL4 A;  3WOD F;  1XNQ O;  3N2Z B;  3N24 A;  2LP7 A;  1K4C C;  2XAG A;  1T6U A;  4DRX A;  4XWJ A;  2PGG A;  3UCS C;  4P9F A;  3NR7 A;  4TQD A;  3ITF A;  2NUP A;  2VRZ A;  3LLK A;  4A4A A;  1VLS A;  3JYY A;  4B7E A;  1NVP B;  2W4M A;  5E3C A;  4W4K A;  1W0K G;  1YAR O;  1QBZ A;  4YT2 A;  1NU1 H;  5F2V O;  4X66 B;  3T1Y B;  4FWV A;  4Z1M G;  3ZRW A;  2EBO A;  4FLZ A;  4W4L A;  2Q4F A;  4B7K A;  2VAS A;  1V74 B;  2QKS A;  4PA7 A;  5B3S B;  1YI2 V;  1E83 A;  4ZLD A;  4AE4 B;  4I4T B;  1VQ4 V;  4FM0 A;  1PD1 A;  2MK3 A;  4CS8 A;  1K3E A;  1FTS A;  4J7K A;  5GON A;  1WJZ A;  5IYD O;  4LDQ A;  4YWQ A;  4UV9 A;  3CCJ V;  3DXR B;  5J9P C;  3OTO B;  2DW4 A;  1O3U A;  1FFT B;  1XNR B;  1V4A A;  3GWO A;  5KHI A;  3TXS A;  4E7Z A;  3L8I A;  1AR1 B;  2QNL A;  3CC2 V;  4WJ0 A;  4ZHQ A;  2F66 C;  4GX0 A;  1ZW3 A;  1J8Y F;  1OW8 A;  2HV6 A;  2LW7 A;  4B3S B;  2IXN A;  2Q5Z A;  4B3R B;  2Q68 A;  4J9Y B;  2KK1 A;  2X0L A;  5CA0 B;  3C3T A;  3FYI B;  4ZOL B;  1SZT A;  2Q0O C;  2W9Y A;  5H6R A;  3K1I C;  1ST6 A;  2WWW A;  1QCE A;  1E86 A;  5EGY A;  1SZI A;  2JEX A;  2ETN A;  4LFC O;  2WLI A;  3O39 A;  1JJO A;  3VQW A;  1M4U A;  4XPW A;  4B3T O;  5KYW B;  2OT5 A;  5LP6 C;  3DM9 B;  4YJ2 A;  1KNY A;  2J7P A;  3OMN B;  1AJP A;  1HR0 O;  1Z5Z A;  2BSK A;  3LDD A;  1GN6 A;  2P6J A;  3DD7 A;  2BCC H;  2JDI G;  1TR2 A;  4O4I B;  5BMV B;  1SQF A;  2AGA A;  2F23 A;  4WBN B;  3AG1 C;  1EN5 A;  2R72 A;  1EM1 A;  1LNQ A;  4QPK A;  4CH4 A;  1BHB A;  4DR2 O;  4YT4 A;  1NTM H;  5A6B A;  1NU9 C;  2ITC C;  4TWK A;  4EFB A;  2R7O A;  2AZ2 A;  3OR7 C;  4LBE C;  1WGW A;  2L6H A;  3L8J A;  4DR5 O;  3O55 A;  2ZIN A;  2XXA A;  2CTW A;  2P4K A;  2I15 A;  5BXZ A;  4JCZ A;  1Q82 W;  2OTL V;  1YAU O;  2RJZ A;  4JI4 B;  4LF8 B;  4DRJ B;  1AIL A;  2WLJ A;  4X64 B;  4JUR I;  3AEI A;  5A6J A;  3H1H H;  3SZR A;  2PX3 A;  3C8G D;  2ADP A;  3KZI Z;  3N2K A;  4TUY A;  4AE4 A;  1M90 W;  3ABL B;  2R7Q A;  4I4T A;  2OWO A;  3X2Q C;  4QI2 A;  2L6G A;  2OKU A;  2PTM A;  4I9Q A;  1CXZ B;  4DR6 B;  4CS7 A;  4GKK O;  4J7T A;  3VBB A;  4FFB B;  4IYI A;  4G2K A;  4DJ9 A;  1TFO B;  3U2M A;  3DXR A;  3UGO A;  2LFS A;  3EGX B;  1QQ3 A;  5K0I A;  2R25 A;  1K5S A;  3JSE O;  3LJB A;  4JJG A;  1N33 B;  2LIG A;  1EKY A;  3UR3 C;  1A7D A;  1MA1 A;  1WNS A;  4ASU G;  3GM2 A;  2HV7 A;  5C8Y A;  4W8K A;  1Z63 A;  1MNE A;  5CA0 A;  3RVY A;  1QR9 A;  4QE9 A;  5DM6 V;  5L0G A;  4TV9 A;  3B0P A;  3JD4 A;  4FLT A;  5IJ9 B;  1H7I A;  1XEQ A;  1D5N A;  2I8B A;  3ZDL A;  2WA3 A;  4RQF A;  1SA0 B;  2P22 C;  2BTQ A;  2WLK A;  3RYI A;  1K5Q A;  2XT9 A;  1H2G A;  3Q4H B;  4PV1 B;  5DED A;  3THO A;  1H2L A;  5LBQ A;  2VQF O;  1GN2 A;  2GFH A;  5FLX N;  1N8R W;  3RYF B;  4NXN O;  1PD0 A;  4LF6 O;  2P61 A;  5FL7 G;  1Y6D A;  4DV3 B;  4KHP B;  5IYC O;  4NB5 A;  1HNW O;  3EHM A;  3NKE A;  4AL0 A;  4WBN A;  3F5T A;  4C3E A;  3RT3 C;  1SES A;  1Z6A A;  1D1C A;  4RAI A;  3E86 A;  3K59 A;  3R7C A;  4BAY A;  5L0F A;  2J9W A;  3AQB A;  2AW9 A;  4GKJ O;  1ZAU A;  2QE7 G;  3UT5 B;  3SXY A;  3SNH A;  4DV2 O;  5GTH Z;  3E9V A;  4DV1 B;  3ETD A;  2ZNJ A;  5A6A A;  2DI3 A;  1M2V A;  1NLX A;  2YXH A;  1V54 C;  2EPM X;  2JS5 A;  1BQ0 A;  3SXK A;  1YZB A;  2YXL A;  3OFN G;  4JAS A;  4MSW C;  3FHD A;  3M79 A;  2V3C C;  1CPQ A;  2EPN A;  4U3F H;  1T5O A;  1Y74 A;  2MWQ A;  4FFB A;  1M93 A;  1LM3 B;  4MVR A;  1SQB H;  5GW7 A;  1EN4 A;  4HAM A;  2Q9B A;  3C7J A;  4JI0 O;  4PEL A;  2XAH A;  1Z2G A;  2UU9 O;  3U10 A;  1DOW A;  3L72 H;  1QZX A;  2L9J A;  2DYR B;  2JPU A;  3AQC A;  4N4W A;  2EJ7 A;  2JX0 A;  1JCH A;  1MAB G;  3V5X A;  2PYL A;  1QVF U;  4LFB B;  2LSE A;  2AVK A;  4QPJ A;  1ZVZ A;  2RN9 A;  1DF5 A;  2TMV P;  3HNK A;  4N06 A;  1R4T A;  2R70 A;  2NR5 A;  4RQE A;  1OCO C;  3N27 A;  2Y69 B;  3K5N A;  1N32 B;  5AC5 A;  1PL4 A;  2DWE C;  4CS4 A;  3ATP A;  2OG2 A;  5KMG A;  2OCC C;  4LWS B;  3B0V C;  5CA1 B;  1IBM B;  1SA0 A;  2YL1 A;  3ZG1 A;  5LHI A;  4B3M B;  5T1D B;  4H37 A;  1VF6 A;  2XND G;  3FYE B;  2ZXW B;  3RYF A;  4YHH O;  5FCL A;  5KAF Z;  1Q0M A;  1MMM A;  3DTU B;  3UMI A;  1NBB A;  1Q0K A;  4JZA A;  1WA8 B;  1HNZ O;  1RSO A;  1WPX A;  3K9A A;  3IQ5 A;  1H2M A;  1F51 A;  2ITD C;  2O57 A;  3CCU V;  1BCC H;  2QWQ B;  1M6T A;  4NXM O;  2PNO A;  2NPU A;  2YLD A;  1EZJ A;  4MS2 A;  2B0H A;  3L74 H;  4DW0 A;  1QVG U;  2P6V A;  5EHH A;  1YCI A;  1XI1 A;  2EIJ C;  2GSM B;  2CGN A;  3IQC A;  4P9P A;  5H6Q A;  4OXS A;  3K3W A;  1VOM A;  1OCC C;  5LYJ B;  4EB6 B;  2R9R B;  4CS3 A;  3T9O A;  3LDE A;  2E87 A;  2JGU A;  3RYC B;  2QE9 A;  5K1P A;  4DV7 B;  1YXB A;  3WU2 Z;  4BW5 A;  2E5L B;  2J46 A;  3FFQ A;  5LMN B;  3U8P A;  4UCS A;  3CCE V;  3WG7 C;  1IBK O;  1YTF B;  1BQZ A;  5CI8 A;  3SYA A;  2OU6 A;  4EEQ A;  2O9X A;  4G27 B;  3TK0 A;  2YVK A;  1ARO P;  1XHZ A;  2R03 A;  1OCZ C;  1BZK A;  3CC7 V;  1OW7 A;  4I3M A;  4HNA B;  3LUT B;  5L3Q A;  4C3D A;  3VOU A;  2H7V C;  3E22 A;  4WAB A;  3SGI A;  2HR3 A;  3GEH A;  2CH7 B;  2EJR A;  2FAP B;  5LHH A;  1YJN V;  2R02 A;  4OPA A;  2PBE A;  4I44 A;  4DUZ O;  3T4R A;  2X51 A;  2DQ3 A;  4D7S A;  3K33 A;  2WLL B;  3J80 N;  2XM0 A;  4H13 B;  2QWR B;  3CSX A;  2Q7E A;  1I7F A;  1TWH A;  1NBM G;  4JI8 O;  2QEX V;  2UXC B;  5COG A;  2YID A;  3CEX A;  1Z5W A;  3E89 A;  5CA1 A;  3IJ4 A;  2HHH B;  1ORJ A;  4MTO A;  3ETG A;  2PFD A;  1HE9 A;  4JC7 A;  1U97 A;  1OR3 A;  4JTC B;  4MVQ A;  4IIJ B;  3G50 A;  3A11 A;  4PR9 A;  4RWU A;  3P30 A;  1I94 B;  3FDQ A;  1WWP A;  4CJO A;  1R3L C;  1VQ6 V;  3W8H A;  1C02 A;  4DR7 B;  2PYJ A;  3GM1 A;  5IY5 C;  4RUF A;  3ABK B;  2XLD A;  2PY5 A;  2LJ2 A;  1RFY A;  4QDL A;  4UDV A;  4CSA C;  3GEE A;  1IZ3 A;  1TWC A;  1EQ1 A;  2GAQ A;  4G7H F;  4EKW A;  1JRA A;  1VQ8 V;  4EBJ A;  3M99 B;  5B1B B;  2DJV A;  2PI4 A;  4FZ0 A;  2XL6 A;  3QW0 A;  4J80 A;  3LES A;  1TWG A;  1RKE B;  3D3I A;  4Z9H A;  2ZXO A;  1N0N A;  1F4M A;  2EIL B;  3LNM B;  2BOB C;  2YIA A;  3NMJ A;  4O7G A;  2G38 A;  4DR3 B;  2F22 A;  3TOL A;  5KHH A;  3S0X A;  2CTR A;  1AJN A;  5JVD B;  1TWA A;  1EA8 A;  1JOG A;  4TOI A;  3HNL A;  1TUE B;  5D91 A;  3K5L A;  2ZDI C;  2JD3 A;  2HP8 A;  2JK5 C;  2AHY A;  1AJQ A;  2EPK X;  1XL6 A;  4HNA A;  4BWA A;  1ZZP A;  3A0B Z;  3GB7 C;  4IB4 A;  4XEF A;  1LPE A;  3W4Y A;  5K1X A;  4Z1V A;  1XMQ O;  1JFF B;  2ODM A;  4JI5 O;  1G4W R;  5LGU A;  2CNW A;  5J2T B;  5A9G A;  4OIN F;  1H9G A;  1K05 A;  1B06 A;  5JJE B;  1A7E A;  2XAQ A;  1OJH A;  3ZRX A;  2DWD C;  4NR1 A;  5KX5 B;  4NYK A;  4LF7 B;  3CQZ A;  5D5P A;  3RQF A;  4LF5 O;  3ZMU A;  1V55 B;  2H8A A;  4AQY B;  1NZ6 A;  3PCV A;  4IIJ A;  5T3W A;  4YT8 A;  3D36 A;  3SJQ C;  2EIM B;  1JPJ A;  2P1A A;  1S5J A;  4R6Z A;  3CWB H;  2UXN A;  2A9H A;  3QTC A;  1G4Y B;  4Q4Z F;  4EBB A;  2EIK C;  4LCU C;  5IY5 B;  3JD3 A;  4BJ5 C;  3B8M A;  4E0H A;  2HMQ A;  4E0I A;  4OX9 B;  1MQV A;  1L0L H;  3CRR A;  3MDS A;  3WFV A;  1OZ0 A;  4J30 B;  2GUZ B;  1KMI Z;  1MNG A;  1K9M W;  1H6G A;  2BOC C;  3GAN A;  4FX5 A;  3TOM A;  1TUB B;  3LDC A;  2Y48 A;  1WP8 A;  4RBN A;  3ZMZ A;  3ASO C;  1ORQ C;  3UNG C;  1HP8 A;  3QTH A;  4MW8 A;  4U5E E;  1VQL V;  1GMG A;  5B1O A;  3ZMS A;  1K33 A;  1K92 A;  4L87 A;  3W7S A;  1XBL A;  5L3B A;  3SXM A;  4JAV A;  1RKC A;  4WFG A;  2DYS C;  3JSN A;  5GTI Z;  1A0B A;  3ABM B;  1WLE A;  1KC8 W;  1Q0F A;  2HJM A;  3VM6 A;  2HVK C;  2P7T C;  3ZIA G;  1HWY A;  1US6 A;  3A8T A;  4CIP A;  2VQE B;  4CS8 C;  1R6T A;  3K06 A;  3ML0 A;  1R6K A;  1KQS U;  4K3A A;  5EK0 A;  4JI3 O;  3GOR A;  1LUW A;  3K66 A;  1MZE A;  4XLN F;  2B5U A;  2QKC A;  3W2W A;  2UXD B;  2YC0 A;  2MHR A;  3K57 A;  3LEV A;  5J2T A;  2C03 A;  2Q7G A;  2YKZ A;  2GHY A;  5JP7 A;  1YVI A;  5KX5 A;  4IRU A;  3ZVR A;  3TCU A;  3NG1 A;  4PA3 A;  3CCQ V;  1CGN A;  4DV4 B;  1ZSP A;  3K04 A;  1AVM A;  5FNV B;  4O4L A;  3Q7L A;  2PP4 A;  3UGP A;  2VWJ A;  2ZE6 A;  3DE8 A;  5DQZ A;  4D4N A;  4CC6 A;  1TAE A;  4HFF B;  4FFK A;  4JI1 O;  2LQG A;  2H7B A;  2KW3 C;  3W7U A;  2Z0A A;  2QM4 A;  5LMU B;  3FD9 A;  2WVO A;  1Q3E A;  2P4V A;  4UV8 A;  3LNN A;  4CS2 A;  4CH3 A;  3T2M A;  4FM2 A;  1M9N A;  1ZWI C;  3WB1 A;  5JJJ B;  3SYN A;  2WLN A;  2GUZ A;  1APC A;  2D2C B;  1R6N A;  5LOV B;  1OCR C;  4RO2 A;  2VCB A;  2JGD B;  3CCV V;  1TUB A;  3EH1 A;  3E2E A;  1P7G A;  1B6Q A;  1PNM A;  3QF7 A;  1O87 A;  3OEE G;  3M15 A;  2Q3T A;  3AG3 C;  1FD9 A;  1LS1 A;  1E1R G;  1IXB A;  3FMS A;  2QWO B;  1TQG A;  3ZQV A;  4FMT A;  4GYT A;  1IDS A;  4N6H A;  3WAQ A;  1GAX A;  4JI6 O;  3L9D A;  2ZQM A;  3GWN A;  2LD6 A;  5E1A C;  3K9S A;  4KUM A;  1OXB A;  4DRI B;  1N36 B;  1EFR G;  5LA6 A;  3ZED A;  2RMK B;  3N2G A;  3U11 A;  4I0X B;  4LF4 B;  3EGD B;  3DE9 A;  4DBQ A;  4GYC B;  1IXM A;  1K73 W;  3EQL F;  3DC6 A;  2A0L A;  4BJ1 A;  1SQP H;  4DR1 B;  1Q5O A;  5A6B D;  3T1H O;  4F6R B;  2VCC A;  4K0D A;  4R50 A;  2AHZ A;  3QZC A;  1PL0 A;  3LEO A;  4MT8 A;  4X62 B;  4CX9 A;  1PD3 A;  3H1L H;  1WAZ A;  3U3F A;  1A32 A;  5LGT A;  4DBR A;  1N4C A;  1OKK A;  4U7O A;  2KG7 A;  1XIL A;  3ZMT A;  1KP3 A;  4JI7 O;  4WGZ A;  5IE9 A;  3JAK B;  4GLX A;  1SQX H;  4IAO A;  3CRC A;  1Q43 A;  2EZO A;  1TA8 A;  2Q7H A;  4NTW A;  4PDV A;  1L7C A;  1QNM A;  1AP5 A;  2NSF A;  3B9Q A;  2HSB A;  1DF4 A;  1Y67 A;  2CGO A;  4O4J B;  4LLC A;  2J0X A;  3ABU A;  2FL4 A;  4JTA B;  3HKC A;  1SS3 A;  2ZXP A;  1CGM E;  4LFA O;  5CIV A;  2W6I G;  5LOV A;  1I5Y A;  3S28 A;  3A0R A;  4O4H B;  3K0D A;  1JPX A;  1T01 A;  4JYA B;  2HLD G;  1WTY A;  5L0J A;  4H33 A;  4U3J B;  1EZV H;  3KYI A;  3PN1 A;  1PP9 H;  3OEH G;  3J06 A;  1M56 C;  2NUT B;  2PX0 A;  3K5M A;  2RDC A;  1MG1 A;  5BQH A;  4UUJ C;  2GDC A;  1MMD A;  3MBG A;  3JAR A;  4PAC A;  3PJS K;  3AK2 A;  4PHZ A;  4X89 A;  4X66 O;  2F4V B;  4GQH A;  1PKX A;  3LSU A;  1KP2 A;  3LLI A;  3T1C A;  3E8B A;  2YIB A;  4JPR A;  5HV9 A;  1FJG B;  2OTJ V;  3TXQ A;  2CYD A;  1YA7 O;  4KNV A;  5T3T A;  3KCX A;  2A6E F;  2QLA A;  4LC1 A;  1H2N A;  2IJJ A;  2NN4 A;  3EGD A;  3ZTZ A;  2AWC A;  4JAU A;  2Q69 A;  2AXT Z;  5D5Q A;  2HMZ A;  3JYH A;  4LH6 A;  3HR0 A;  2Q73 A;  3F47 A;  1MMN A;  3DZA A;  4F6R A;  5IYZ A;  3OTO O;  3AGT A;  3CYO A;  5LXT B;  1XNR O;  4NQF A;  1YVW A;  5KHG A;  2IJI A;  3C8Z A;  4H54 A;  3RYH B;  2G3V A;  1FXK C;  2J8W A;  3U0C A;  4DK0 A;  1YJW V;  1BGY H;  1BMF G;  2YUA A;  1BZ4 A;  3JCU Q;  1C17 M;  4B3S O;  4B3R O;  3TQO A;  4JW1 A;  3EPV A;  5KYX B;  3L71 H;  3JZ0 A;  1T6I A;  2OJE D;  3LS0 A;  4G0H A;  4L8J A;  1AVO B;  2ZNI A;  2YLI A;  1G4U S;  5L3V A;  5JQG B;  3H01 A;  1W2W A;  5GPG B;  1VF6 C;  3S84 A;  3APQ A;  4ANJ A;  5BY1 A;  4E18 A;  1WP7 A;  3BHP A;  1Y4M A;  4NTX A;  5E79 Z;  4GUN A;  1YYJ A;  4TQF A;  5KYU B;  2QA4 V;  3UKM A;  2FTK A;  2Z15 A;  1AB3 A;  1SF8 A;  2F93 B;  2MW2 B;  1GM9 A;  2BL2 A;  4BJ6 A;  2UUI A;  2BE3 A;  1FNT c;  3QG5 A;  1TVK B;  2OQM A;  2NUT A;  4UFZ A;  2YQY A;  3NMI A;  1JR9 A;  3MD0 A;  3H9V A;  4QNH B;  4HFK B;  4AX2 A;  3TD7 A;  3IEE A;  1AI6 A;  3LNR A;  3DM5 A;  4P6I C;  4K7B A;  2LFF A;  1DOV A;  4JI4 O;  3CCM V;  4LF8 O;  4PI2 A;  2IXM A;  3K03 A;  3QO7 A;  1NTK H;  4I55 B;  1HMO A;  3I5D A;  2OYQ A;  3UMK A;  2R9I A;  3W2V A;  1ENV A;  1ROP A;  1IX9 A;  4ZOL A;  4J10 A;  3ZHT A;  1LI5 A;  2X6A A;  2L81 A;  3JCZ A;  5KA6 A;  4DR6 O;  1BSM A;  2Q9L A;  1KU9 A;  4BJT A;  4MVO A;  2VQF B;  5IDJ A;  4WFB V;  1G8X A;  2Y0I A;  3F46 A;  2MYS A;  4U5F E;  2EPO A;  1CPR A;  3FKS G;  1KKC A;  5J2U B;  1QKR A;  4XBF A;  2CUG A;  5LXT A;  1PCX A;  1AP6 A;  4RUE A;  1C03 A;  1N34 O;  5KYW A;  3SPC A;  2WL8 A;  2OIG A;  1FS0 G;  3C8G B;  5LP6 B;  1N33 O;  2WPD G;  4NTF A;  4UVB A;  3K5O A;  4KI2 A;  4UVA A;  1O9H A;  4CJG A;  4PJ0 Z;  3CXH F;  3G4S V;  4OIQ F;  1VQ9 V;  4O4I A;  1LS4 A;  5BMV A;  4IWB A;  4CBC A;  3AG1 B;  1DK1 A;  2R7S A;  1YF2 A;  2B9Z A;  1BBH A;  3O6X A;  1FFX B;  4XDJ A;  3C90 A;  5L0H A;  4I9W A;  1R1B A;  4XEV A;  4EBK A;  3IC7 A;  3JD2 A;  1L8D A;  4MVS A;  2LGW A;  4CS9 C;  4X1K B;  2EUL A;  2JVD A;  4DK1 A;  3JT1 A;  4O2A B;  4QI0 A;  1QR8 A;  4L6R A;  1YJG A;  4X88 A;  4LNU B;  4DV3 O;  1ZX3 A;  4ZIB A;  2W0X A;  4KHP O;  1NG1 A;  1KTM A;  3X2Q B;  4O6Y A;  1YIT V;  2HSQ A;  2QM8 A;  3P3N A;  2KJG A;  1IBL B;  4GEH A;  2UUH A;  3ASN C;  3O10 A;  2QGN A;  2RSE B;  3U8V A;  2QM7 A;  2KB1 A;  2W0F C;  3EGX A;  3QNE A;  4JV5 B;  1THZ A;  3MAQ A;  1I4Z A;  1SZX A;  4DYL A;  5C93 A;  1YZC A;  3OWT A;  4DV1 O;  2NSG A;  3U5S A;  3ZX6 A;  4PDR A;  5KHK A;  4ICG A;  2DE0 X;  1IUR A;  5DVW A;  3U9M A;  3DKA A;  1B04 A;  1MND A;  3ZHS A;  2XRH A;  1IW7 F;  3V5Z A;  5IJ9 A;  3RGB A;  3HNJ A;  4X20 B;  3ZJZ A;  1KKD A;  2FYU H;  2Q00 A;  3FB5 C;  1TFK B;  3FXH A;  5J2U A;  2D4U A;  4YY3 B;  1ZHW A;  5AG2 A;  1VYK A;  3Q4H A;  2ZE8 A;  3IGA C;  1GTO A;  4FES A;  4E2L A;  3TJ6 A;  5DLJ A;  4G7Z F;  5LP6 A;  1HNZ B;  2X6C A;  4K0K B;  3BRJ A;  1LKX A;  1W2B U;  4YL1 A;  2QDO A;  2WVN A;  2HFE C;  5E33 A;  4LFB O;  3US6 A;  3A9C A;  2KQX A;  2M6Y A;  5AGF A;  1YEW A;  2EIN C;  1AUE A;  1RM1 C;  2FGY A;  2Y3H A;  2XL4 A;  5CBF A;  1O9G A;  2P5O A;  1N32 O;  1AEP A;  1URF A;  4KBL A;  4DRH B;  4UB8 Z;  4DV6 B;  3UT5 A;  4FVM A;  1Y4C A;  3KYJ A;  3EZI A;  2GBO A;  1T6Q A;  3M1C B;  3SP1 A;  3GEI A;  4HZ3 A;  1IBM O;  5A6K A;  3CHX A;  2LW1 A;  1VK5 A;  2UXX A;  2J9V A;  4B3M O;  4C3B A;  2V7Q G;  2DMX A;  4O2A A;  2X6B A;  3G80 A;  4YXW G;  2YHS A;  1V54 B;  4H0L B;  3SYQ A;  2XLO A;  5BQG A;  5JVE A;  3I55 V;  2CNW D;  3ZHU A;  1XMO B;  3A0H Z;  4U5B E;  3FOO A;  3DWW A;  4TT3 G;  4JAA A;  1H8H G;  1R3K C;  5E3A A;  4P9T A;  4H44 B;  3G67 A;  2EPL X;  1WN0 A;  2R7V A;  2LCH A;  4LER A;  4DV0 B;  2HJD A;  1KB9 F;  1FR0 A;  1MMA A;  3FX7 A;  4OD4 A;  1K4D C;  5B5E Z;  4F4L A;  2UXB O;  3QMK A;  3OMA B;  4YL3 A;  1VMA A;  2LK4 A;  4RDA A;  5BR8 B;  1Y76 B;  1LI7 A;  4FK5 C;  4IHJ B;  1JQ0 A;  1M57 C;  2B1G A;  3JSL A;  3Q6N A;  2PF4 E;  1OCO B;  2L6L A;  4NCQ A;  1R5I D;  4X20 A;  4DV7 O;  2UUB O;  3TUL A;  1M2O A;  4LWS A;  2OCC B;  4QIW F;  5LMN O;  4I50 B;  5JLI A;  4BEM J;  2A0B A;  1ZHY A;  1GO3 F;  2B1I A;  3VQY A;  4KXR A;  3OEO A;  1NR1 A;  1XDC A;  1YHQ V;  2L6F A;  5EYP B;  3CMA V;  4UCU A;  5CN0 A;  2ZD9 A;  1KD1 W;  4X0R A;  4CDV A;  3BVO A;  5IWA B;  1GM8 A;  3J81 N;  1WA8 A;  1H2S B;  4YJ3 B;  3OW2 U;  1VQ5 V;  3LS1 A;  2A06 H;  3VQX A;  1YYX A;  5D92 A;  1FXV A;  3JRT A;  3V7O A;  4OGQ B;  3ETQ A;  1B68 A;  3RF3 A;  1J5E B;  1Q6I A;  4MW3 A;  2UXC O;  3B09 A;  4RD9 A;  5DS5 A;  4J42 A;  5DN6 G;  1D2D A;  4MTF A;  2HHH O;  3BA8 A;  3RFY A;  1NR7 A;  2EIJ B;  2IJH A;  2FKX A;  3UO2 A;  4BIO A;  1FAF A;  1D0Y A;  1VF7 A;  1F4N A;  4MTG A;  1DTO A;  1OCC B;  5LYJ A;  4EB6 A;  1I94 O;  4EUK B;  1QU7 A;  3UM7 A;  5HFM A;  1SMY F;  4Q20 A;  4X65 O;  1YIJ V;  3S90 A;  3JD1 A;  2PZS A;  3RYC A;  3MYF A;  2W45 A;  1RMV A;  1GK9 A;  1IVS A;  1OQC A;  2ZE5 A;  3WG7 B;  5KUM A;  3JAT B;  1OCZ B;  2X7R B;  3CCR V;  1L0N H;  1IZM A;  1ORS C;  1Q81 W;  2RNB A;  3L75 H;  2XLW A;  1G8M A;  3K1H A;  2CH7 A;  3CCL V;  3S3X A;  2WA4 A;  3CAX A;  1QLE C;  1Y76 A;  4DR3 O;  4UCO A;  3ZTM A;  4GX5 A;  4UXN A;  2YXY A;  2Q7R A;  2WLL A;  4BPM A;  3AG4 C;  1P4R A;  4O79 A;  2NG1 A;  4LF5 B;  2KC3 A;  1J8M F;  2XAS A;  2WVQ A;  3DXJ F;  1SET A;  3DC5 A;  3U3B A;  3JAM N;  4XQ1 A;  4Z9I A;  2YL0 A;  5JCO C;  4DUY B;  4A5U B;  1KUQ A;  3PHF 2;  1U89 A;  1BR1 A;  3EFO B;  1VQ7 V;  3CRQ A;  3T4D A;  4DV5 B;  2E3C A;  4N23 A;  3B29 A;  1Z5V A;  1SQV H;  4YJ3 A;  1JJ2 U;  4JF3 A;  1NT2 B;  2LGQ A;  5CB4 B;  4JI2 B;  4X1I B;  5BQI A;  3E70 C;  1LE4 A;  3RWR D;  4LF7 O;  2ARH A;  2KSF A;  1Z7Q c;  2KGO A;  2Q0A A;  3W7X A;  1NU7 D;  4ULV A;  2H8P C;  4B6I A;  2QJ1 A;  5B3I A;  5JH7 B;  2IU3 A;  4D6T H;  1VIB A;  4LDK A;  1D1B A;  5BUO A;  2OOC A;  3UO3 A;  1NSG B;  1RKE A;  4C7O B;  3AG7 A;  4AQY O;  1VQK V;  3U9J A;  4AIL C;  1Q8I A;  4J7J A;  3KMI A;  2HJ3 A;  5IYB O;  3WB0 A;  5JVD A;  3L70 H;  1NI8 A;  5A2Q N;  1HNX O;  3DJU B;  2B0J A;  1E2X A;  4OX9 O;  2HFI A;  3TK1 A;  3VQV A;  4GT1 A;  4WF9 V;  2F1M A;  2HJF C;  3AG2 C;  1BR4 A;  3QW1 A;  1G6U A;  3M4B A;  3X1O A;  4D7T A;  2R05 A;  2A0U A;  3EHN A;  4P30 A;  2BTO A;  2WSS G;  1D0X A;  1SQQ H;  1XHX A;  3S9O A;  3IC9 A;  4X8A A;  5EBL C;  4FM1 A;  3HNI A;  4KL1 A;  1E79 G;  4J32 B;  3HKD B;  2FFH A;  1VQP V;  1JFF A;  2WZG A;  1FPO A;  1WAS A;  1S05 A;  5B1A C;  2E75 B;  2UUA B;  4PDM A;  2WZL A;  4JI1 B;  2AWY A;  2YLG A;  4JCH A;  4WCE V;  3F7V C;  4DR4 O;  4XPX A;  2XSE A;  4IGG A;  1LUV A;  2VQE O;  3CC4 V;  3JYC A;  4Z2W A;  5L0D A;  1Q7Y W;  2XTA A;  2CW0 F;  2R7X A;  1UFI A;  3T6B A;  5DQT A;  1ZU4 A;  2Y39 A;  3CP1 A;  5L0C A;  1EN6 A;  3NXS A;  2EIK B;  4JE9 A;  3I5P A;  1XL4 A;  2YSU B;  2JJ2 G;  3AK3 A;  2A6H F;  4A2N B;  4K35 A;  4E17 A;  4DRX B;  1QHT A;  4W8P A;  2WLM A;  4U5D E;  4CSA A;  1SRY A;  3C18 A;  2UUC B;  4D4X A;  1S77 D;  4JRZ A;  4DV4 O;  1QVX A;  2M4E A;  2NUP B;  1HE1 A;  1ZL8 B;  1SR2 A;  1D5A A;  3FAP B;  3BFR A;  3H1J H;  4FLV A;  3SPI A;  3H65 A;  3BPZ A;  3ASO B;  3JCU Z;  3LSQ A;  4C7O A;  3VAY A;  2QKA A;  3ZN1 A;  4C7U A;  2ETS A;  1ZUQ A;  3OUF A;  2VWK A;  5HFL A;  4FPP A;  3KG2 A;  4JI6 B;  2ZIO A;  3R65 A;  4YJW A;  1H38 A;  3JAW B;  2IBZ H;  5TIS Z;  3CZ6 A;  5LMU O;  1PPJ H;  4JTD B;  2ADQ B;  1HDJ A;  2ZM6 B;  5B3S C;  5L3E A;  4GX2 A;  5E2Q A;  2DYS B;  3WB2 A;  2J7P D;  3RQE A;  4J7Z A;  4NC3 A;  1FYJ A;  2XLH A;  3FB7 C;  2H7O A;  2EX3 A;  1G5Z A;  5GON B;  1BDJ B;  4Q5S F;  3K0G A;  1S76 D;  256B A;  1YA9 A;  4Q6G A;  2W4B A;  3H2V A;  3ZIB A;  1FFT C;  3QVN A;  1XZQ A;  2HKO A;  4O2B B;  4O6N A;  1Q0G A;  2KSD A;  3HKD A;  1NVP D;  1S0V A;  4ABM A;  3P32 A;  1XNQ B;  4ZHQ B;  2A7W A;  4R8C A;  4LH7 A;  1DGS A;  2FML A;  2QUP A;  1COW G;  4YIP A;  4Z9J A;  1E85 A;  3LSS A;  4QJF B;  4HBN A;  4FLW A;  1SYQ A;  5H5N A;  4CDA A;  4CH5 A;  4UCR A;  1XUQ A;  1S7Z A;  3JRM O;  1H9T A;  2RCV A;  3KCY A;  1NTZ H;  4WFE A;  4EIY A;  5FNV A;  1OXK A;  4FAP B;  2P90 A;  1N36 O;  4IYH A;  4U5G A;  2HUJ A;  1AI5 A;  1JAF A;  4LF4 O;  2IYL D;  4IJJ A;  2Y3G A;  2WLI B;  1M5I A;  3T6J A;  4LF9 O;  3OTF A;  2JIZ G;  4XPY A;  4BJ5 A;  4YJ2 B;  4J7Y A;  2P67 A;  4JJF A;  3F5W C;  2BSK B;  4JKV A;  4X62 O;  1JX9 A;  1NH2 D;  4AI8 A;  4J9Z B;  1KU2 A;  2FB5 A;  4EHP A;  1OCR B;  3RQG A;  2JGD A;  1K8A W;  2LQT A;  1SQG A;  4IL6 Z;  1S5L Z;  1ZL8 A;  1PM9 A;  2N04 A;  4FZ1 A;  3SYC A;  5JUA A;  2IXO A;  2XXA B;  3AG3 B;  1HMD A;  1XRE A;  2PUS A;  2HEP A;  5AC4 A;  1KEC A;  2IBF A;  4LDR A;  3OR6 C;  3JAW A;  3HTK C;  4CDY A;  2QWP B;  3TJ5 A;  3L0I A;  3T1Y O;  2KKW A;  4TUY B;  3N2K B;  1K34 A;  1SKV A;  3ABL C;  1ZHX A;  2VCA A;  1ZW2 A;  1WB8 A;  3B2E E;  2N74 A;  4HEA J;  2L7A A;  3DAG A;  4YK5 A;  2D3O W;  1KYO F;  1ORY A;  5F28 E;  4I0X A;  1TGO A;  1UG7 A;  4JGS A;  3B4S A;  3CRA A;  2CDY A;  5EZY B;  4LFC B;  2RD9 A;  2AP3 A;  4JYA O;  4AHC A;  3OAA G;  1VTM P;  4B3T B;  4O2B A;  2YZS A;  4ER9 A;  2YI8 A;  3JTL O;  3L1M A;  3CE2 A;  1NH2 B;  1HR0 B;  1OR2 A;  2R7W A;  1SER A;  2ZKO A;  4YT5 A;  5EIB C;  1UFB A;  2CDQ A;  4BW9 A;  1ZLZ A;  2F4V O;  2IOQ A;  4DW1 A;  3OT7 A;  5C8Y B;  3RYL A;  2DQ0 A;  2IU0 A;  1FJG O;  2P7V A;  2GA0 A;  3K79 A;  4TV9 B;  3TGU H;  4DR2 B;  1HW7 A;  3BEH A;  3D8C A;  2XAJ A;  1ZU5 A;  3CJH B;  4OD5 A;  3MYI A;  4IAQ A;  2P0N A;  2XS8 A;  4JVS A;  2OEX A;  1U6H A;  2IM9 A;  3JAK A;  3VRC A;  4DR5 B;  1M1K W;  4OIO F;  2Q8V A;  4UCV A;  2BTQ B;  3RYI B;  3D3Q A;  4M63 A;  3E83 A;  2J9B A;  3EZH A;  1WAT A;  1SC5 B;  2NLJ C;  3HKE B;  4MVZ A;  5KUK A;  3VF0 A;  1SF9 A;  2XOK G;  2CAZ C;  4O4J A;  3NYJ A;  5ITZ B;  5EBW C;  1YJ9 V;  4KNW A;  3JSZ A;  3K6B A;  3B0U X;  3M4C A;  3ZHQ A;  3SPH A;  2W6J G;  5EIB D;  1V9P A;  5JS5 A;  5L3C A;  4GKK B;  3WHN A;  3GWL A;  1HW2 A;  4DO2 A;  4O4H A;  4J11 A;  5CBH A;  4F4B A;  1JVM A;  4U3J A;  1EBO A;  2AU5 A;  4JEA A;  2R7T A;  3CSK A;  3MHS C;  4AK9 A;  2QR4 A;  1S3J A;  2YEV B;  5JSL A;  1M56 B;  2GWW A;  1AR4 A;  3RKO F;  1M2V B;  2ZE7 A;  1YDI A;  3KPH A;  1E1Q G;  2OCH A;  1A41 A;  1ZYR F;  3ZMV A;  3HPL C;  1BL8 A;  5TJ5 E;  2WAM A;  1Q6U A;  4HYO A;  4PA6 A;  3MHH C;  4E4E A;  2YRF A;  3T4Z A;  4X64 O;  1JPN A;  3BA9 A;  1UPG A;  3BY6 A;  2A68 F;  2CK3 G;  1NKD A;  2J0W A;  5DS6 A;  5KAI Z;  1Y74 B;  5KHJ A;  4LLE A;  5EZY A;  1NFO A;  3SEO A;  1DLB A;  2L35 A;  1PNK A;  3BRC A;  4WFA V;  1N34 B;  2QY9 A;  3E8H A;  4XDL A;  4P2Z A;  3SR2 C;  4IT5 A;  3R2P A;  3GVM A;  4NXN B;  2DYR C;  1FMV A;  4LF6 B;  4JEB A;  1E84 A;  1VF5 B;  3CPW U;  1QPU A;  1HNW B;  3RYH A;  3JAS B;  5FZT A;  5LHG A;  1FXK B;  1RCP A;  4BIU A;  1A7V A;  2Y69 C;  2IH3 C;  3CJH A;  4DVY P;  3DGE A;  1VQO V;  2V1D A;  4GKJ B;  1LR1 A;  1JA8 A;  4QE7 A;  5KMG B;  5KYX A;  2LFR A;  4PA4 A;  4DV2 B;  3LAY A;  1MMG A;  4WGY A;  3P3P A;  1XZP A;  3SXZ A;  4TV8 B;  3EVK A;  4P9O A;  5JQG A;  3HKE A;  2ZXW C;  4FIP C;  5ITZ A;  1W0J G;  4NTY A;  2V4D A;  3RVZ A;  2H94 A;  2IM8 A;  1R3I C;  2ATK C;  1Z3I X;  5KYU A;  1RSO B;  4Q7C A;  2Z5U A;  2PI5 A;  3QVY A;  2J45 A;  1JMW A;  1KBH A;  4EFE A;  2C04 A;  3SJA C;  3RN4 A;  3ZSU A;  4GZR B;  1RPO A;  1H8E G;  4JI0 B;  3L73 H;  3Q6M A;  1Y66 A;  2YEV A;  2UU9 B;  1Q90 D;  1TVK A;  3M7M X;  3J7A U;  2WZF A;  3N0T A;  3RFR A;  3RIP A;  3TET A;  3FAV B;  2X0C A;  1L1F A;  4I1O B;  2VB6 A;  4KC9 A;  3C3S A;  5KYY B;  1S5H C;  4G7O F;  3OGI B;  2Q6A A;  4QGP A;  2IH1 C;  2ZPA A;  1RP3 B;  1YSC A;  4I55 A;  1LVK A;  3V5Y A;  3CX5 F;  1N1C A;  2Q9C A;  1NJI W;  3F7Y C;  1RXQ A;  3ZCC A;  4PJL A;  1WOL A;  1QSP A;  1VLT A;  3GWK C;  1IBL O;  1GM5 A;  3K1I A;  3SDL A;  3IAY A;  4U5H A;  5COF A;  2GDS A;  2Q9A A;  4YHH B;  1VYI A;  4J41 A;  1T5E A;  3G71 V; 
#chains in the Genus database with same CATH homology
 5L3G A;  1CPY A;  2VH3 A;  1FXK A;  3I4U A;  3NDB B;  3OUS A;  2Y3D A;  1FXH A;  3DJN B;  1YTF D;  4KP4 A;  1F23 A;  4DVZ A;  4PJN A;  3SYP A;  1FMW A;  3ABK C;  3ZC4 A;  4PJM A;  3EHB B;  3S29 A;  5L3F A;  2F43 G;  1P7B A;  1R73 A;  3ASN B;  1PNL A;  5B1B C;  3K08 A;  3ABT A;  4YN0 B;  5DS4 A;  2EIL C;  5KYY A;  1D1A A;  2ZR2 A;  4U5C E;  4MVM A;  3G6E V;  3NYL A;  4XLP F;  1D0Z A;  1Z23 A;  4O6M A;  4KFM A;  3SYO A;  3KKB A;  1GKF A;  5EC1 C;  1RJ9 B;  3GOD A;  3EG9 B;  1BR2 A;  3RW0 A;  1NZE A;  3EH2 A;  2R7U A;  2WB7 A;  4WFH A;  4OIR F;  2HVJ C;  3K7D A;  4BG0 A;  4GCZ A;  5CMU A;  4U7N A;  5HSW A;  3EFF K;  4BEJ A;  3OGC C;  1ZHT A;  3RH3 A;  4PDL A;  5CA3 A;  2EIN B;  1NQT A;  1RM1 B;  3KH2 A;  2IJK A;  3NKD A;  1V55 C;  4CS9 A;  1UJW B;  1RPR A;  2EIM C;  2K1E A;  5BZB A;  3CD6 V;  2JJ1 G;  1I5X A;  1CEZ A;  4PFP A;  4JYB A;  4LP8 A;  3W7T A;  2EZP A;  1S72 V;  3OA1 A;  3OE7 G;  4I1M A;  3Q7G A;  3CXC U;  4GX1 A;  4I5S A;  3CCS V;  3MLG A;  3MX3 A;  4NY3 A;  4PFO A;  1K97 A;  5H9C A;  3DMD A;  4E7S A;  3QO5 A;  3ETE A;  3E8G A;  3ABM C;  3S27 A;  1M57 B;  4MTX A;  1RJ9 A;  4JYC A;  2Z3Y A;  4PK4 A;  3EG9 A;  1AI4 A;  1OHH G;  1CP9 A;  3B77 A;  2DGJ A;  2WLH A;  3UMH A;  3I56 V;  3CME V;  4LAC B;  1J95 A;  3W8I A;  1ZHZ A;  3SPJ A;  3VYW A;  3PMR A;  3STZ C;  4DXW A;  4H4K C;  3NYM A;  5L3D A;  3IFX A;  2G62 A;  4ULW A;  3W7W A;  2KQ9 A;  3POV A;  4TSF G;  5CBG A;  4MQ9 F;  3B8N A;  3HLZ A;  3ZRV A;  1TKN A;  2Y3B A;  4UVC A;  5B1N A;  4XTK A;  4ZKI A;  1OKK D;  2A69 F;  1R3J C;  2M7W A;  5KYN A;  1FFH A;  4ZLC A;  2IW5 A;  1QLE B;  4PJJ A;  1VQN V;  3E35 A;  4ZBM A;  3AG4 B;  3NRH A;  3L34 A;  3OMI B;  2C2A A;  2A1D D;  3EFO A;  4CZZ A;  3E8F A;  5EC2 C;  3RBZ A;  2Q67 A;  4CIH A;  4DOZ A;  5F5F A;  2IXP A;  2BE5 F;  5LGN A;  4OIP F;  1BHA A;  3JD0 A;  2CGE A;  3SPG A;  3FB6 C;  3HB3 B;  1O5H A;  5EBM C;  2J9U A;  2HG5 C;  3I5Q A;  3ZRW B;  2XAF A;  2ZR3 A;  3DAF A;  3OM3 B;  2JEU A;  4CBE A;  3AG2 B;  1K7D A;  4R7C A;  2ZDI A;  2A79 B;  4BIZ A;  4EWC A;  4BJ6 C;  2R7R A;  1MSW D;  5KA5 A;  4MVU A;  1Q86 W;  2G3K A;  4XDK A;  3HJC A;  2NNU A;  3FAJ A;  4N21 A;  4PA9 A;  3ZN0 A;  5B1A B;  4MND A;  3ZRS A;  1AI7 A;  2QTV A;  3ECS A;  1VQM V;  5CI9 A;  1MOF A;  5F5H A;  2V26 A;  3EJN A;  3QO8 A;  3FVY A;  2KNH A;  3FB8 C;  1GM7 A;  2ZXR A;  4FJC C;  4HE8 D;  3STL C;  4G28 B;  2D5R B;  1JOY A;  2QTO A;  4WFF A;  3WOD F;  3KL4 A;  1QLN A;  3N2Z B;  3N24 A;  2LP7 A;  1K4C C;  2XAG A;  4XWJ A;  3ITF A;  2NUP A;  3LLK A;  1NVP B;  5E3C A;  2W4M A;  1W0K G;  1QBZ A;  4YT2 A;  4FWV A;  4Z1M G;  3ZRW A;  2EBO A;  2VAS A;  2QKS A;  4PA7 A;  5B3S B;  1YI2 V;  4ZLD A;  4AE4 B;  1VQ4 V;  1PD1 A;  2MK3 A;  4CS8 A;  1K3E A;  1FTS A;  5IYD O;  4YWQ A;  4UV9 A;  3CCJ V;  5J9P C;  2DW4 A;  1FFT B;  3GWO A;  4E7Z A;  1AR1 B;  3CC2 V;  4WJ0 A;  4GX0 A;  1J8Y F;  2HV6 A;  2IXN A;  2Q68 A;  4J9Y B;  2X0L A;  3FYI B;  1SZT A;  2W9Y A;  5H6R A;  3K1I C;  1ST6 A;  2WWW A;  1QCE A;  5EGY A;  1SZI A;  2JEX A;  3O39 A;  2WLI A;  5KYW B;  2OT5 A;  3DM9 B;  2J7P A;  3OMN B;  1AJP A;  1Z5Z A;  3DD7 A;  3LDD A;  2P6J A;  2JDI G;  1TR2 A;  3AG1 C;  1LNQ A;  4QPK A;  1BHB A;  4YT4 A;  1NU9 C;  2ITC C;  4TWK A;  2R7O A;  3OR7 C;  4LBE C;  1WGW A;  2XXA A;  1Q82 W;  2OTL V;  2WLJ A;  4JUR I;  3AEI A;  3SZR A;  2PX3 A;  4AE4 A;  1M90 W;  3ABL B;  2R7Q A;  3X2Q C;  4QI2 A;  4CS7 A;  3VBB A;  4G2K A;  3UGO A;  2LFS A;  3EGX B;  1K5S A;  3LJB A;  4JJG A;  3UR3 C;  4ASU G;  2HV7 A;  4W8K A;  1Z63 A;  1MNE A;  3RVY A;  1QR9 A;  4QE9 A;  5DM6 V;  3B0P A;  3JD4 A;  2I8B A;  4RQF A;  2WLK A;  1K5Q A;  5LBQ A;  1H2G A;  2GFH A;  1N8R W;  1PD0 A;  5FL7 G;  5IYC O;  3EHM A;  3NKE A;  4C3E A;  1SES A;  1Z6A A;  1D1C A;  4RAI A;  3E86 A;  4BAY A;  2J9W A;  3AQB A;  2QE7 G;  3SNH A;  3E9V A;  3ETD A;  1M2V A;  1V54 C;  3OFN G;  4JAS A;  4MSW C;  3FHD A;  2V3C C;  2MWQ A;  4MVR A;  5GW7 A;  4HAM A;  2Q9B A;  4PEL A;  2XAH A;  1QZX A;  2L9J A;  2DYR B;  3AQC A;  1JCH A;  1MAB G;  1QVF U;  2LSE A;  4QPJ A;  1DF5 A;  4N06 A;  4RQE A;  1OCO C;  2Y69 B;  2DWE C;  2OG2 A;  2OCC C;  3B0V C;  3ZG1 A;  5LHI A;  5T1D B;  4H37 A;  2XND G;  3FYE B;  2ZXW B;  5FCL A;  3DTU B;  3UMI A;  4JZA A;  1WPX A;  3K9A A;  1F51 A;  2ITD C;  3CCU V;  1EZJ A;  4MS2 A;  1QVG U;  2P6V A;  5EHH A;  2EIJ C;  2GSM B;  4P9P A;  5H6Q A;  4OXS A;  3K3W A;  1VOM A;  1OCC C;  2R9R B;  3LDE A;  2E87 A;  4BW5 A;  2J46 A;  3CCE V;  1YTF B;  3WG7 C;  5CI8 A;  3SYA A;  2O9X A;  4G27 B;  1ARO P;  1OCZ C;  3CC7 V;  4I3M A;  3LUT B;  5L3Q A;  4C3D A;  3VOU A;  2H7V C;  2HR3 A;  2EJR A;  5LHH A;  1YJN V;  4I44 A;  3T4R A;  2X51 A;  2DQ3 A;  3K33 A;  2WLL B;  1TWH A;  1NBM G;  2QEX V;  3E89 A;  4MTO A;  3ETG A;  2PFD A;  4JTC B;  4MVQ A;  3FDQ A;  3P30 A;  1R3L C;  1VQ6 V;  3W8H A;  5IY5 C;  4RUF A;  3ABK B;  4QDL A;  4CSA C;  1TWC A;  4G7H F;  4EKW A;  1VQ8 V;  3M99 B;  5B1B B;  2PI4 A;  3LES A;  1TWG A;  3D3I A;  2ZXO A;  1F4M A;  2EIL B;  3LNM B;  2BOB C;  4O7G A;  3S0X A;  1AJN A;  1TWA A;  1TUE B;  5D91 A;  2ZDI C;  2JD3 A;  2JK5 C;  2AHY A;  1AJQ A;  1XL6 A;  3GB7 C;  4OIN F;  2CNW A;  5LGU A;  2XAQ A;  3ZRX A;  2DWD C;  3CQZ A;  3ZMU A;  1V55 B;  4YT8 A;  5T3W A;  3D36 A;  3SJQ C;  2EIM B;  1JPJ A;  4R6Z A;  2UXN A;  2A9H A;  1G4Y B;  4Q4Z F;  4EBB A;  2EIK C;  4LCU C;  5IY5 B;  3JD3 A;  4BJ5 C;  3B8M A;  3WFV A;  1OZ0 A;  4J30 B;  3GAN A;  1K9M W;  2BOC C;  4FX5 A;  3LDC A;  2Y48 A;  4RBN A;  3ZMZ A;  3ASO C;  1ORQ C;  3UNG C;  4MW8 A;  4U5E E;  1VQL V;  1GMG A;  5B1O A;  3ZMS A;  1K33 A;  1K92 A;  4L87 A;  3W7S A;  5L3B A;  4JAV A;  4WFG A;  2DYS C;  3ABM B;  1WLE A;  1KC8 W;  2HVK C;  2P7T C;  3ZIA G;  1HWY A;  4CS8 C;  3K06 A;  3ML0 A;  1R6K A;  1KQS U;  5EK0 A;  3K66 A;  4XLN F;  2B5U A;  3W2W A;  3LEV A;  2C03 A;  2GHY A;  3ZVR A;  4IRU A;  3TCU A;  3NG1 A;  4PA3 A;  3CCQ V;  3K04 A;  3Q7L A;  2PP4 A;  3UGP A;  5DQZ A;  4HFF B;  2H7B A;  2KW3 C;  3W7U A;  2WVO A;  4UV8 A;  3T2M A;  1M9N A;  1ZWI C;  3SYN A;  2WLN A;  1R6N A;  1OCR C;  4RO2 A;  3CCV V;  3EH1 A;  3E2E A;  1B6Q A;  1PNM A;  1O87 A;  3OEE G;  2Q3T A;  3AG3 C;  1LS1 A;  1E1R G;  4FMT A;  4GYT A;  2ZQM A;  5E1A C;  4KUM A;  1EFR G;  3EGD B;  4DBQ A;  1IXM A;  1K73 W;  3EQL F;  2A0L A;  4BJ1 A;  4K0D A;  4R50 A;  2AHZ A;  3QZC A;  1PL0 A;  4MT8 A;  1PD3 A;  5LGT A;  4DBR A;  1OKK A;  4U7O A;  3ZMT A;  1KP3 A;  4IAO A;  2EZO A;  4PDV A;  3B9Q A;  1DF4 A;  4LLC A;  2J0X A;  3ABU A;  4JTA B;  2ZXP A;  2W6I G;  1I5Y A;  3S28 A;  3A0R A;  3K0D A;  1JPX A;  2HLD G;  4H33 A;  3OEH G;  1M56 C;  2NUT B;  2PX0 A;  1MG1 A;  4UUJ C;  1MMD A;  3PJS K;  4X89 A;  1PKX A;  1KP2 A;  3LLI A;  3T1C A;  3E8B A;  4JPR A;  2OTJ V;  5T3T A;  4KNV A;  2A6E F;  4LC1 A;  2IJJ A;  3EGD A;  4JAU A;  2Q69 A;  3JYH A;  3F47 A;  1MMN A;  3DZA A;  3CYO A;  2IJI A;  2G3V A;  1FXK C;  1YJW V;  1BMF G;  3JCU Q;  4JW1 A;  3EPV A;  5KYX B;  3LS0 A;  4G0H A;  5L3V A;  3H01 A;  1W2W A;  4ANJ A;  1Y4M A;  5KYU B;  2QA4 V;  3UKM A;  2FTK A;  2Z15 A;  1SF8 A;  1GM9 A;  4BJ6 A;  2NUT A;  3MD0 A;  4HFK B;  4AX2 A;  4QNH B;  3TD7 A;  3IEE A;  1AI6 A;  3LNR A;  3DM5 A;  4P6I C;  4K7B A;  3CCM V;  2IXM A;  3K03 A;  3QO7 A;  3UMK A;  2R9I A;  3W2V A;  1ENV A;  1ROP A;  2X6A A;  2L81 A;  3JCZ A;  5KA6 A;  4BJT A;  4MVO A;  4U5F E;  5IDJ A;  4WFB V;  1G8X A;  3F46 A;  2MYS A;  3FKS G;  4XBF A;  1PCX A;  4RUE A;  5KYW A;  3SPC A;  2WL8 A;  1FS0 G;  2WPD G;  4UVB A;  4KI2 A;  4UVA A;  3G4S V;  4OIQ F;  1VQ9 V;  4IWB A;  4CBC A;  3AG1 B;  2R7S A;  3O6X A;  4XDJ A;  4I9W A;  3IC7 A;  3JD2 A;  4MVS A;  4CS9 C;  3JT1 A;  4QI0 A;  1QR8 A;  4X88 A;  1NG1 A;  3X2Q B;  4O6Y A;  1YIT V;  2QM8 A;  2KJG A;  4GEH A;  3ASN C;  2QM7 A;  2KB1 A;  2W0F C;  3EGX A;  3QNE A;  1THZ A;  5C93 A;  3OWT A;  4PDR A;  5DVW A;  1MND A;  2XRH A;  1IW7 F;  3ZJZ A;  1KKD A;  3FB5 C;  1ZHW A;  1VYK A;  3IGA C;  1GTO A;  4FES A;  4E2L A;  5DLJ A;  4G7Z F;  2X6C A;  1LKX A;  1W2B U;  5E33 A;  2WVN A;  2HFE C;  2EIN C;  1RM1 C;  2FGY A;  2Y3H A;  2XL4 A;  5CBF A;  4KBL A;  3M1C B;  3EZI A;  3SP1 A;  4HZ3 A;  1VK5 A;  2UXX A;  2J9V A;  4C3B A;  2V7Q G;  2X6B A;  2YHS A;  4YXW G;  1V54 B;  3SYQ A;  3I55 V;  2CNW D;  4U5B E;  4TT3 G;  1H8H G;  1R3K C;  5E3A A;  2R7V A;  4LER A;  1MMA A;  4OD4 A;  1K4D C;  3QMK A;  4F4L A;  3OMA B;  1VMA A;  4RDA A;  4FK5 C;  1JQ0 A;  1M57 C;  2B1G A;  3Q6N A;  2PF4 E;  1OCO B;  1M2O A;  4QIW F;  2OCC B;  1ZHY A;  1GO3 F;  2B1I A;  3OEO A;  1NR1 A;  1YHQ V;  3CMA V;  5CN0 A;  2ZD9 A;  1KD1 W;  4X0R A;  1GM8 A;  3OW2 U;  1VQ5 V;  3LS1 A;  5D92 A;  1FXV A;  3JRT A;  3V7O A;  4MW3 A;  4RD9 A;  5DS5 A;  5DN6 G;  4MTF A;  3RFY A;  1NR7 A;  2EIJ B;  2IJH A;  1D0Y A;  1F4N A;  4MTG A;  1DTO A;  1OCC B;  3UM7 A;  5HFM A;  1SMY F;  4Q20 A;  1YIJ V;  3JD1 A;  2W45 A;  1GK9 A;  3WG7 B;  5KUM A;  1OCZ B;  2X7R B;  3CCR V;  1IZM A;  1Q81 W;  1G8M A;  3K1H A;  3CCL V;  1QLE C;  4GX5 A;  4UXN A;  2WLL A;  3AG4 C;  1P4R A;  4O79 A;  2NG1 A;  1J8M F;  2XAS A;  2WVQ A;  3DXJ F;  1SET A;  3PHF 2;  1BR1 A;  3EFO B;  1VQ7 V;  3T4D A;  4N23 A;  1JJ2 U;  4JF3 A;  3E70 C;  2KGO A;  3W7X A;  1NU7 D;  2H8P C;  4B6I A;  2IU3 A;  1D1B A;  5BUO A;  4C7O B;  1VQK V;  3KMI A;  5IYB O;  3DJU B;  2B0J A;  3TK1 A;  4GT1 A;  4WF9 V;  2HJF C;  3AG2 C;  1BR4 A;  3X1O A;  3EHN A;  4P30 A;  2WSS G;  1D0X A;  4X8A A;  5EBL C;  1E79 G;  4J32 B;  2FFH A;  1VQP V;  2WZG A;  5B1A C;  4PDM A;  2WZL A;  4JCH A;  4WCE V;  3F7V C;  2XSE A;  3CC4 V;  3JYC A;  1Q7Y W;  2CW0 F;  2R7X A;  3T6B A;  5DQT A;  1ZU4 A;  2Y39 A;  3CP1 A;  3NXS A;  2EIK B;  3I5P A;  1XL4 A;  2YSU B;  2JJ2 G;  2A6H F;  4A2N B;  2WLM A;  4U5D E;  4CSA A;  1SRY A;  1S77 D;  2M4E A;  2NUP B;  3SPI A;  3H65 A;  3ASO B;  3LSQ A;  4C7O A;  3VAY A;  3ZN1 A;  3OUF A;  4FPP A;  5HFL A;  3KG2 A;  3R65 A;  4YJW A;  1H38 A;  3CZ6 A;  4JTD B;  5B3S C;  5L3E A;  4GX2 A;  5E2Q A;  2DYS B;  2J7P D;  3FB7 C;  2H7O A;  4Q5S F;  3K0G A;  1S76 D;  2W4B A;  3ZIB A;  1FFT C;  2HKO A;  4O6N A;  1NVP D;  1S0V A;  3P32 A;  4R8C A;  1COW G;  3LSS A;  4QJF B;  1S7Z A;  4WFE A;  2P90 A;  4U5G A;  1AI5 A;  2IYL D;  4IJJ A;  2Y3G A;  2WLI B;  3T6J A;  2JIZ G;  4BJ5 A;  2P67 A;  4JJF A;  3F5W C;  1JX9 A;  1NH2 D;  4J9Z B;  1KU2 A;  1OCR B;  1K8A W;  3SYC A;  2IXO A;  2XXA B;  3AG3 B;  1KEC A;  3OR6 C;  3HTK C;  3L0I A;  1K34 A;  3ABL C;  1ZHX A;  4HEA J;  3DAG A;  2D3O W;  4JGS A;  3OAA G;  2YZS A;  1NH2 B;  2R7W A;  1SER A;  4YT5 A;  2CDQ A;  2IOQ A;  3RYL A;  2DQ0 A;  2IU0 A;  2P7V A;  3K79 A;  3BEH A;  2XAJ A;  1ZU5 A;  4OD5 A;  4JVS A;  1M1K W;  4OIO F;  4M63 A;  3E83 A;  3EZH A;  2NLJ C;  4MVZ A;  5KUK A;  2XOK G;  3NYJ A;  5EBW C;  1YJ9 V;  4KNW A;  3JSZ A;  3K6B A;  3B0U X;  3SPH A;  2W6J G;  5L3C A;  4DO2 A;  4F4B A;  5CBH A;  1JVM A;  1EBO A;  2R7T A;  3CSK A;  3MHS C;  4AK9 A;  1S3J A;  2YEV B;  1M56 B;  3RKO F;  1M2V B;  1E1Q G;  1ZYR F;  3ZMV A;  3HPL C;  1BL8 A;  2WAM A;  4HYO A;  4PA6 A;  3MHH C;  3T4Z A;  1JPN A;  3BY6 A;  2A68 F;  2CK3 G;  1NKD A;  2J0W A;  5DS6 A;  4LLE A;  3SEO A;  1DLB A;  1PNK A;  4WFA V;  2QY9 A;  3E8H A;  4XDL A;  4P2Z A;  2DYR C;  1FMV A;  3CPW U;  5LHG A;  1FXK B;  4BIU A;  2Y69 C;  2IH3 C;  4DVY P;  3DGE A;  1VQO V;  2V1D A;  4QE7 A;  5KYX A;  2LFR A;  4PA4 A;  3LAY A;  1MMG A;  4P9O A;  2ZXW C;  4FIP C;  1W0J G;  3RVZ A;  2H94 A;  1R3I C;  2ATK C;  1Z3I X;  5KYU A;  4Q7C A;  2Z5U A;  2PI5 A;  2J45 A;  2C04 A;  3ZSU A;  1RPO A;  1H8E G;  3Q6M A;  1Y66 A;  2YEV A;  3RIP A;  2WZF A;  3N0T A;  3TET A;  1L1F A;  4I1O B;  2VB6 A;  4KC9 A;  5KYY B;  1S5H C;  4G7O F;  2Q6A A;  2IH1 C;  2ZPA A;  1YSC A;  1LVK A;  1N1C A;  2Q9C A;  1NJI W;  3F7Y C;  3ZCC A;  4PJL A;  4U5H A;  2Q9A A;  1VYI A;  3G71 V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...