1M56C

Structure of cytochrome c oxidase from rhodobactor sphaeroides (wild type)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
265
structure length
265
Chain Sequence
b'AHAKNHDYHILPPSIWPFMASVGAFVMLFGAVLWMHGSGPWMGLIGLVVVLYTMFGWWSDVVTESLEGDHTPVVRLGLRWGFILFIMSEVMFFSAWFWSFFKHALYPMGPESPIIDGIFPPEGIITFDPWHLPLINTLILLCSGCAATWAHHALVHENNRRDVAWGLALAIALGALFTVFQAYEYSHAAFGFAGNIYGANFFMATGFHGFHVIVGTIFLLVCLIRVQRGHFTPEKHVGFEAAIWYWHFVDVVWLFLFASIYIWGQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE
publication title The X-ray crystal structures of wild-type and EQ(I-286) mutant cytochrome c oxidases from Rhodobacter sphaeroides.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 101
structure length 265
sequence length 265
chains with identical sequence I
ec nomenclature
pdb deposition date 2002-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00510 COX3 Cytochrome c oxidase subunit III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1m56C01
1.20.120.80 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1m56C02
4R50A 5CBGA 2HG5C 3KG2A 3LNMB 3SPHA 2WLIA 3E8FA 4JTCB 1R3KC 4PDVA 3SPIA 2BOCC 4RAIA 3FB7C 3UKMA 1M57C 3PJSK 4QE9A 3ASNC 3E8GA 2HJFC 2Q68A 3F7YC 4PA4A 3FB8C 1G4YB 3X2QC 1R3JC 3RVYA 2Q69A 5B1AC 3T4DA 1J95A 2Q67A 3E83A 2DYRC 2ZXWC 3K0DA 4MW8A 4P9PA 3IFXA 4DXWA 4MTOA 3JYCA 4MVMA 4EKWA 3SJQC 3K04A 3LDCA 2A9HA 5EC1C 2X6AA 4QNHB 1P7BA 2IH1C 4MVQA 4WFEA 3ZJZA 1OCRC 3BEHA 1K4DC 1LNQA 1OCOC 1V55C 2K1EA 2ITCC 2EINC 2Y69C 5EBMC 1QLEC 3OR6C 2X6BA 3STLC 5CBHA 2EIMC 1R3LC 3LDDA 2WLLA 3K0GA 2WLIB 1ZWIC 3E86A 2WLHA 2ZD9A 3FB6C 4OXSA 1S5HC 4MSWC 4WFGA 2R9RB 2W0FC 3ABLC 3AG3C 4PDMA 3E8BA 2OCCC 5E1AC 4G27B 4R7CA 4WFFA 4J9ZB 2WLKA 2H8PC 3OUSA 4LCUC 4MS2A 3OUFA 1K4CC 1OCZC 4HZ3A 4XDJA 4MVOA 2YEVA 4WFHA 2JK5C 2QTOA 4HYOA 4F4LA 2DWDC 3TETA 3K06A 5EBLC 2A0LA 2BOBC 2HVKC 4R8CA 5B1BC 3VOUA 3TCUA 3F5WC 4JTDB 2ATKC 3SPCA 4X88A 3RBZA 3STZC 4UUJC 3AG1C 2WLLB 3OR7C 4MVSA 4XDLA 3K03A 5EC2C 3SYAA 4H33A 3RW0A 3SYOA 3ZRSA 3AG4C 2X6CA 3R65A 4XDKA 4J9YB 3FB5C 1ORQC 2AHZA 4LBEC 4PA7A 1M56C 2EIKC 2EIJC 3ABMC 1V54C 5EK0A 3UM7A 2DWEC 2P7TC 3T4ZA 4R6ZA 2KB1A 3T2MA 2WLNA 5KUKA 2WLJA 4P2ZA 4MTFA 3LDEA 3ABKC 3ASOC 3EFFK 3IGAC 2NLJC 4GX0A 4ZBMA 4PA9A 1FFTC 4G28B 4H37A 5IY5C 4KFMA 1OCCC 4MVRA 1JVMA 3HPLC 4JTAB 3K08A 2EILC 1XL4A 4LP8A 4PDRA 4X8AA 3E8HA 1R3IC 5B3SC 2WLMA 3AG2C 5KUMA 3RVZA 5J9PC 2HFEC 4PA6A 4MW3A 4P9OA 3LUTB 2A79B 4GX5A 2ITDC 2QKSA 5CBFA 3OGCC 4GX1A 3SYPA 3T1CA 2AHYA 4MVZA 4RUEA 4PA3A 4GX2A 4P30A 4PDLA 4BW5A 3GB7C 3SPJA 4MVUA 4I9WA 3SPGA 3SYCA 5BZBA 3F7VC 5EBWC 1KKDA 2IH3C 4RO2A 4CBCA 4RUFA 1BL8A 1XL6A 3SYQA 2Q6AA 4MTGA 4TWKA 3WG7C 2HVJC 3E89A 4QE7A 4X89A 2DYSC
chains in the Genus database with same CATH superfamily
4MTXA 1QNMA 3LNMB 2KQ9A 4LLEA 4R32A 1VYIA 4PDVA 1VF7A 2EIMB 2AWYA 2QE9A 3M15A 4XEVA 2JGDB 2F23A 1Z23A 3HKEB 5B1AC 3K5MA 2KSDA 2ASRA 1GO3F 5B1AB 3JYCA 2IU0A 5LHIA 4J41A 1O9HA 3OMIB 4ZHQA 3UMIA 1LR1A 2F1MA 1MZFA 3KCXA 1EZVH 1Q82W 1BZKA 2UXDO 1WGWA 1JJ2U 5EBMC 4PELA 2AZ2A 1XILA 4YL3A 3D36C 5LYJB 2XUMA 3IQTA 3E86A 1XDCA 1GM5A 5JSLA 1S5HC 4B3SO 3U8VA 2W0FC 2ZE6A 3E8BA 3N2KA 3FAVB 4WFFA 5F28E 2WLKA 3QG5A 1THZA 3WB1A 3K9AA 2AWCA 2QDOA 1OCZC 2EIJB 1YI2V 2XLEA 4B7EA 4CH6A 3HTKC 4F4LA 3ZSUA 5FPRA 3ZHSA 2J9UA 3N2ZB 3D3IA 2W6IG 3RKOF 1M93A 4Q5SF 2XLVA 3JSNA 3RQGA 2IXMA 4JTDB 4YJ3B 2UUBB 1D0ZA 1KB9F 1VF6C 2N04A 3G80A 3JD1A 1PNMA 4DR1O 1YYXA 3AGUA 1E84A 1C17M 1ZL8A 2HR3A 2Y3GA 3TOMA 1G8MA 2OU6A 2DQ3A 4IIJA 2AHZA 1JFFA 3P30A 3NKDA 2IJKA 1AROP 3ABMC 4JASA 1UFIA 2P6JA 4K3AA 4LF5B 2PZSA 3ZMZA 3GWKC 5LMUB 3MHHC 3N24A 2R25A 3ABMB 1FFXA 1RKCA 5FZTA 2WLNA 5CMUA 3ZBHA 1R1BA 1VMAA 5KLVH 4MQ9F 1UPGA 5IYDO 2PI4A 3OMAB 3LS1A 3E2EA 1L7CA 1QHTA 1YVWA 5TISZ 2X7RB 4TSFG 1MMMA 3DJUB 4U3JA 1VQOV 3AG2C 4JI3O 2FB5A 3G4XA 4PA6A 3DMDA 4EB6A 2VC9A 2ILMA 1Z3IX 4RDAA 3VBBA 4KUMA 4U7NA 4CBCA 3G6EV 5H2FZ 3CYOA 3UMKA 4LNUA 2MYSA 3IC9A 2HVJC 4DRXA 4JE9A 3E35A 1RJ9A 3UMHA 3SYAA 1GK9A 2Y69B 4DV2B 2KW3C 1M2VA 2OYQA 3N2GA 1S05A 4UVAA 5KYXB 4I50B 4TV8A 1N32O 3WODF 1K92A 3DZAA 3SEOA 4FFKA 4O2AA 1YCIA 1G4YB 4JZGA 3OT7A 5LMNO 2YL3A 4Z2WA 2W4MA 1BR4A 4XQ1A 2NUTA 3EHMA 3VM6A 2ZE8A 3HJCA 3K04A 4JI8O 3BCCH 3GEIA 2X6AA 3B8MA 5GTHZ 2GWWA 2R02A 4XLNF 2MK3A 2W6JG 4LR3A 2V4DA 2YI9A 3CMAV 3A0HZ 1V55C 3DM9B 2MWQA 3NRHA 1D5AA 1R3LC 1FXHA 4MSWC 1M1KW 3ATPA 3PDMP 1KNYA 1H8EG 1PD0A 5AC4A 1E85A 1SRYA 2YIAA 3OUFA 3JD0A 1VQ5V 1LPEA 2R72A 1LE2A 4K0KO 4XWJA 4C3EA 1BGYH 2V1DA 3TK1A 3KYIA 3K06A 2Z0AA 2LFDA 2OOCA 2EULA 1ORYA 2V7QG 4X88A 4YT2A 4DR4B 2Q0AA 1IBKB 3H9VA 5CB4B 2CUGA 2HSBA 2EZOA 2KYHA 1I4ZA 4YIPA 4W4KA 5K1PA 3RIPA 2R7UA 4JJFA 4X1KB 4CSAC 1H2SB 4JZAA 4JYAO 5COMA 2WWWA 3UR3C 3F5TA 1OW7A 3K58A 4FIPC 4KNVA 4B08A 1NFNA 3EVKA 2EPLX 4E7ZA 1A7EA 2L81A 5KAIZ 3EGDA 1T6QA 4ONSA 2ZT9B 1YAUO 4N4WA 2H7OA 2Q7GA 4EEQA 2WA4A 3CB2A 4B3MB 4WGYA 3P3NA 1YZCA 2HFEC 5FPOA 2BTQB 3BA9A 4FFBB 1N4CA 2X0CA 4LWSB 3N0TA 3OEOA 1EZJA 3SYPA 3PN1A 4OX9B 1D5NA 4TUYB 1AUEA 2VB6A 2YVKA 2JDIG 3KCYA 1Z5ZA 4PDLA 4CBEA 2OKUA 4JZ2A 2Q7HA 3F7VC 2CW0F 1XBLA 2KK1A 4X64B 4MTGA 4X1YB 4L6RA 3TK0A 4O4HA 3POVA 4QE7A 2QR4A 1S0VA 2VS0A 2RN9A 5KHGA 3QTHA 1Y4MA 2QWOB 1VQ4V 1GAXA 2H8AA 4B3SB 1H7IA 4PR9A 3JATB 3DC5A 3TGUH 5TJ5E 1EFRG 4YT4A 4JAVA 3MYIA 2DB4A 4G7OF 3KKBA 2ZXWC 2KG7B 1DOWA 4MTOA 1U0BB 2BSKB 4JCZA 2ZXWB 1GN4A 3J06A 4DUYO 1HR0O 1O5HA 2QUPA 1FXKC 1F7YA 3C8ZA 4JEAA 1SZXA 2G3VA 2ITCC 4AL0A 2L6FA 3U0CA 4JV5B 1FXKB 4IYIA 2PI5A 4GLXA 4FX5A 2LQTA 2ZKOA 1EI7A 2ZD9A 4E4EA 3MBGA 3JRMO 5A9GA 1XMOO 1IVSA 3HLZA 2W0XA 3DKAA 3FOPA 2J9BA 2WB7A 2JS3A 1QVXA 3BHPA 3M4CA 2ZINA 1TA8A 2LCHA 1E83A 5D91A 4BJ6A 4GZRB 1SKVA 4I5SA 2WAMA 1Q7YW 4ULWA 3WFVA 2LSEA 2HSQA 4GKKO 1LS4A 5DS6A 5KYWB 4U5HA 1H8HG 1Q6IA 1N34B 2A0LA 4XPWA 1Z7Qc 3TXSA 2R7QA 5FNVA 1WP7A 1JR8A 4FAPB 1BBHA 3OR7C 2C03A 4LC1A 2R70A 3AG4C 5B3SB 1IXMA 1VEWA 4J9YB 3OWTA 3N2KB 1GGQA 3W8IA 2XXAA 1KYOF 2CE4A 1URFA 1KKCA 2ZDIA 4NKGB 3N27A 1W2BU 1GN2A 2CAZC 4A2NB 1NBMG 3FVYA 1NT2B 1DF5A 2QM4A 1Y74A 4FZ0A 3I5PA 4UXNA 2L6LA 4NVPA 4PHZA 5DEDA 2QM7A 1QR9A 1ZL8B 1F23A 2OTJV 3FXHA 3GWLA 2P0NA 1M57B 2QWQB 4CDAA 1CGNA 4IIJB 2YDEA 2LK4A 4E2LA 1OW6A 1JFFB 2E87A 4J30B 2DGJA 3ZIBA 1HW7A 2QKSA 4IL6Z 1ZHZA 4LFBB 1NTZH 3GANA 1Q0KA 4MVZA 4PA3A 3MDSA 3SYCA 4LF4O 2HKVA 1NTMH 5EBWC 3UT5A 3W7SA 3G71V 1D1CA 1V74B 4LERA 3CCMV 1XNQB 1MNEA 3H1LH 4PJMA 3NYMA 3THOA 4JC7A 1IZ3A 4JTCB 4JI4O 4YK5A 4RAIA 3T1YB 3GODA 2MW2B 2ZR3A 2AGAA 5H6QA 4YY3B 3HKEA 1KECA 1EKYA 1LM3B 4CS2A 2LD6A 3DI5A 3K0DA 1E1RG 5H5NA 2AVKA 3VF0A 1XHXA 1Y4CA 1NI8A 4HFFB 3B4SA 4DV3O 3BVOA 3K79A 2Q9LA 3VQXA 1Q6UA 2P1AA 1XMQO 4LNUB 1XNRO 1LKXA 3RT3C 1TAEA 1HMDA 3CCRV 2UU9O 1RJ9B 2A0BA 2HV7A 1ZHXA 1JOGA 1XQ8A 1WN7A 1Q0DA 2XLWA 4PDMA 2H94A 1B04A 1ROPA 2OCCC 5DM6V 3ZEDA 4O2AB 2UXCO 256BA 3FAVA 1QZXA 4LF6O 4DV4O 2KC3A 4J9ZB 2OCCB 1IBMB 4JAUA 1CGOA 4O4IB 2YEVB 3M99B 3QVZA 3QVYA 1ZZPA 4JYBA 5CA1A 5IJ0A 2YSUB 3LJBA 1LUVA 1K7DA 4J7TA 4AE4B 3A2FA 4DR5O 5BR8O 1G1XB 3FDQA 2PFDA 1J8YF 1HW2A 3AG1C 1PNKA 4MVSA 1SMYF 4ZLDA 3NYJA 3ZRSA 3IPMO 3AG1B 1K9MW 4JURI 2NSFA 2QGNA 2XAGA 3DTUB 2D4UA 5L3BA 3MAQA 3GEEA 5EK0A 2DWEC 2P7TC 3T4ZA 4C7UA 3CXHF 5D92A 4MT8A 1IZMA 4EUKB 4PA9A 2XL6A 3CCLV 2Q5ZA 1F4MA 1M6TA 2P4VA 4LDRA 2R7RA 1JVMA 1FJGO 1HDJA 4CZZA 1T5EA 4PDRA 2JGUA 2DYSB 1DTOA 5FCLA 3RVZA 1GS9A 4UFZA 1P49A 2HJDA 1R5ID 1N33B 2WSSG 2IW5A 2YKZA 3B0UX 2CNWD 2FKXA 4LDKA 4GX1A 2WVOA 2ZIMA 2LP4A 2AHYA 2VCBA 1K5QA 1AJPA 2AZ0A 1TWCA 1KKDA 1LE4A 5CIVA 1BL8A 1XL6A 4ZKIA 2A06H 3OM3B 4QPJA 1PM9A 2UUBO 3IAYA 4PFPA 4E0IA 1WA8B 4CDVA 1QLEB 2XAFA 5KYXA 5T1DB 3DC6A 1VLTA 1AR4A 2DW4A 2QWPB 4BEJA 2ARHA 4HEAJ 4LH7A 2IJIA 5F5FA 4UCUA 4LF5O 5LMUO 2R7VA 3G6BA 4DW1A 2KJGA 5EC1C 2P4KA 2IH1C 1RXQA 1N0JA 2Y48A 1J5EO 2OIGA 1EN4A 4DBRA 1K4DC 2IYLD 4BJ1A 4FMTA 2EINC 4O4HB 4BIOA 3OR6C 3U9MA 1E79G 3BPZA 3ABUA 2WLLA 2IJHA 2E75B 1K04A 1NVPD 4DRJB 2YLIA 3OAAG 1BZ4A 5E1AC 1K40A 4Z9HA 2QTSA 4BWAA 4HZ3A 2P5OA 2GSMB 3ZHTA 2J8WA 2NG1A 4LFAO 1YLMA 3ASOB 1BE3H 4I3MA 4IJJA 1FAPB 3F5WC 3SGIA 2ETSA 3EHBB 2L6GA 3V5YA 1OCCB 3RBZA 3U9JA 4DV2O 5CB4A 3CSKA 3PCVA 4I0XA 3K5LA 2PX3A 1MSWD 1S77D 1NU1H 3EFOB 1D0XA 3U3BA 4X1KA 4BJ6C 3L75H 4ZOLB 4CH3A 3EPVA 1ZVZA 5ITZB 3EH1A 2KB1A 4J42A 1JQ0A 2J0XA 3GM1A 2ZR2A 3B40A 1FFTC 2ZE5A 4GX0A 2EJ7A 3ETGA 3DSQA 4WABA 4H37A 1FFTB 5IY5C 1NKDA 2C2AA 4K8ZA 2A0UA 5IY5B 5FNVB 1R3IC 2FL4A 1YJ9V 2H7VC 2WLMA 3QTCA 4CX9A 2PF4E 5D5QA 5F2VO 1IXBA 1YF2A 4J10A 4FFBA 1ZU4A 4CS7A 4LWSA 4D7SA 2XXAB 3JCUZ 2UXXA 2A1DD 4K8XA 4TUYA 2ZDIC 3B0PA 1GRJA 4DV3B 3JAWB 5IYCO 4MNDA 1HP8A 1ZAUA 3H1JH 4H13B 2IH3C 3K9SA 2B0JA 2FTKA 3SYQA 1XMQB 1R6NA 2O9XA 4X1YA 4L8JA 3E89A 4FWVA 2WA3A 1WPBA 1B3QA 4DR4O 1IBKO 1WTYA 5JQGB 3C8GD 3QZCA 3PJSK 3D3QA 1HNWO 4KI2A 4P9TA 2DOSA 3AG3B 3S0XA 3CCSV 4NYKA 3IQCA 4DV6B 1K33A 1I5NA 3RYFA 1EN5A 1HY5A 1OV9A 3LDCA 2KKWA 1WLEA 5K0IA 2HJMA 3DXJF 3OA1A 4JI1B 3UT5B 2VQEB 4LF7B 1JPXA 3CCEV 5BR8B 2R05A 5LGNA 4D7TA 3NKEA 3MHSC 3J7AU 2Q00A 5CBHA 2EIMC 2XSEA 3KMIA 1BS3A 3ETQA 2BE3A 1BCCH 3VQVA 3NMJA 3C3TA 1XHZA 4WFBV 1WAZA 4B3MO 4OIRF 3HKKA 2QA4V 3L73H 2B0HA 1OQCA 1MMNA 2PGGA 1BMFG 1JMKC 1H2GA 1NTKH 4OX9O 1EQ1A 4TT3G 4N23A 1U97A 1ENVA 2OIEA 3TETA 2PUSA 5KYWA 2R03A 4PACA 3ZS8C 4X64O 2OEVA 2DJVA 4A5UB 5LGUA 2JJ1G 3FX7A 4FESA 2CTWA 3ML0A 1FJGB 3U10A 1L8DA 3DAGA 1D1BA 2IBZH 1PD1A 4I1MA 4NTFA 3SJAC 3ZDLA 3FB5C 4QDLA 1IURA 3VYWA 4FM0A 3L9DA 2EIJC 2G3KA 3HNLA 5KA6A 5JUAA 1U96A 1SQBH 3LNNA 1KMIZ 5EIBC 4JI5B 5CA1B 5IJ0B 2X51A 4EBJA 5B66Z 4GYCB 2YL0A 4DUZB 2CH7A 2DMXA 5FLXN 1VQMV 2NPUA 4X66B 1QCEA 2IM8A 4JV5O 3NDBB 4YXWG 2CTPA 1VQ6V 3HNIA 3NR7A 3WU2Z 1QR8A 4HBNA 2Q7EA 1NZEA 2FYUH 3B9QA 5JJEB 2Q9CA 2RDCA 4GX5A 2GUZA 3AG7A 1YSCA 1AR5A 4ZI7B 1ZSPA 3NMIA 3A0RA 3ZC4A 1PV3A 1VQ7V 4DRIB 3LS0A 3C8GB 2F95B 1ZTEA 1ZLZA 3GWOA 4RUFA 1N34O 1J5EB 1LI5A 3Q7GA 1VQPV 3C63A 2O57A 3FHDA 5JLIA 2GAQA 5A6BA 4D4XA 3TD7A 4G78A 1YIJV 3FB7C 4I4TB 1YDXA 2KSFA 3CE2A 1S72V 3CJHA 3K66A 3T4DA 4LF8B 3A9CA 1AP6A 1BHAA 3OW2U 2JEUA 1Z2GA 4DR6B 4EKWA 3K6BA 4XEKA 1A7DA 3ZG1A 4LFAB 5LOVB 3K5NA 3EZHA 2Q7RA 2BCCH 3H1KH 1ZX3A 2Y69C 1ZHTA 1EBOA 4KHPB 1ZYRF 5BY1A 1NH2D 3UGPA 2LW1A 4GT1A 2HEPA 4U3FH 1RKEB 3QO8A 2LQGA 1M56B 2EIKB 4QGPA 4JEBA 4O4IA 4MVOA 2YEVA 4LFBO 2GTSA 1W59A 4U5CE 3RYCA 2OT5A 3ZQVA 1Y6XA 2LGWA 5EBLC 4KNWA 1YZBA 1OXBA 1XNQO 4AE4A 4NTAA 1I7FA 1W2WA 3JSEO 1NFOA 2Q4FA 3T4RA 4X62B 1H9TA 3L0IA 1Q3EA 1PL4A 3RN4A 2WLLB 3R66A 1BT8A 3RW0A 5C8YB 2FGYA 2IU3A 1YYJA 3T1YO 1N36B 2XS8A 4YY3O 3O65A 1HE1A 3RGBA 4E17A 4F4BA 2EX3A 4GQHA 4HAMA 2F93B 1Q0MA 3MLGA 2Y3DA 4UV8A 1YARO 4DR7O 3CSXA 4FLXA 2ZXPA 3L70H 3QO5A 1K05A 1LI7A 3SYNA 4KXRA 5B5EZ 2OWOA 5LBQA 2YIBA 4ZLCA 4OPHA 1AI5A 4I0XB 3EJNA 4OD5A 1Y76A 2IJJA 1TVKB 1WWPA 1HNWB 3V5ZA 5KHIA 5KHJA 1IBMO 2E3CA 5EHHA 3GM3A 5DQZA 3ZMVA 1VQNV 2CK3G 3CRCA 3ZX6A 2OJQA 3GB7C 4CS9A 3KYJA 1EM1A 3L8JA 3ZTZA 1APCA 2J7PD 4K0DA 1RSOA 2RCVA 3KG2A 1WA8A 3ZTMA 2WPDG 1AI4A 3E8FA 4U7OA 3SPIA 3O9OA 1FD9A 3CXCU 3H01A 2YL1A 4LDQA 3G4SV 4WFAV 3SXMA 2F22A 1CGME 3E83A 1UFBA 1YXBA 2LFSA 4DXWA 3KH2A 1RPRA 5C93A 3WHNA 4DW0A 1TUEB 2XL8A 1GM9A 1SA0A 3I5QA 2ICWG 1FPOA 4WFEA 4ER9A 5KMGB 3K33A 5EYPB 2HUJA 5LL6Y 3PHF2 4YL0A 4AX2A 3CS5A 1IBLO 4UB6Z 4CH4A 2A6HF 4E7SA 3T9OA 3HKCB 1L0NH 1YA9A 1XWJA 4BIUA 4DRHB 1K34A 1N33O 4O6NA 1FXVA 2L35A 3ICXA 1Q81W 1T01A 2Q8VA 3DWWA 3RQFA 3RYFB 4LACB 4A4AA 2EZPA 3HKDB 1GTOA 2G62A 3MFNA 2XL4A 1CEZA 3FFQA 1NU9C 3SP1A 4ICGA 1OZ0A 4JI0O 3CEXA 4JF3A 4N21A 2YICA 4UUJC 2I15A 2XS1A 1RPOA 2Y3BA 2RJZA 1ORJA 4AHCA 1QKRA 4U5FE 5KYUA 2LP7A 4PJLA 3EFOA 4KL1A 3EHNA 4ZOLA 2VWKA 2R7OA 5ITZA 5L0IA 2QWNB 3SNHA 2C04A 3LDEA 4IARA 4WGZA 3IGAC 5KYYB 1ZU5A 5COGA 4UDVA 3C3SA 2ZCEA 1QPUA 4BG0A 4G28B 5A69A 4CJOA 3I56V 4B3TB 4BEMJ 2CNWA 5GTIZ 1FMVA 3QF7A 4DV5B 4DV1B 2YS8A 4NQFA 2XASA 3CPWU 5B3SC 5GONB 1W0KG 1TWAA 2EPNA 1Q6HA 2GA0A 4W8PA 4RWUA 5A2QN 4XEFA 1RCPA 4BJ5A 3P3PA 4U5GA 3T1CA 3QVNA 4QJFB 3FAJA 2XHBA 1TGOA 3SPGA 3SPJA 3JAWA 4MVUA 4BW5A 4BPMA 4RO2A 1W0JG 2JVDA 2YXYA 1JX9A 3BABA 1Z5VA 3ZCCA 2CH7B 1NBBA 1AJQA 1FMWA 2JX0A 2QKAA 3ZHQA 3B2EE 1O9GA 3ZMSA 1JAFA 2XOKG 2GHYA 2JPUA 5JQGA 4U9EA 1M57C 5LXTA 5IYBO 2N74A 1M5IA 1H2MA 4N06A 2Q69A 5HV9A 3PMRA 5D5PA 3CC7V 2DYRC 2GUZB 4WBNA 2IXOA 2AP3A 1KTMA 2UXBB 2DYRB 2UXNA 3ZRXA 1WNSA 4QNHB 4U5DE 3ZJZA 3OTOO 3CEIA 2D3OW 3JYYA 2CCYA 4NB5A 2Q9AA 1GKFA 5AGFA 1G6UA 3CD6V 1H2KA 4JIOA 4OIOF 5IT9N 2Y3HA 1TUBA 4OXSA 2XAHA 2YI8A 2WZFA 2R9RB 1WP8A 3CJHB 3T6GB 4JYYA 4C3DA 3S3XA 4AL1A 3G50A 4UCVA 4G0HA 3X1OA 1K4CC 1EN6A 3WB0A 2OCHA 1FFHA 4HYOA 1P7GA 3IHUA 4Q6GA 3OMNB 4OINF 2FAPB 1HNZO 4DR7B 1FR0A 1SQFA 5A6KA 3JRTA 3Q6MA 3GWNA 5IWAB 1MMDA 4DOZA 5E3CA 1VOMA 5E79Z 4CS8A 2EPKX 5J2UB 5CN0A 3GEHA 3JSZA 2JEXA 1K5SA 4DV7B 3R65A 4XBFA 1YJNV 5JCOA 3DJNB 3L72H 4X9QA 1DF4A 5JH7A 4DV6O 1S5JA 2B1GA 3OGIB 2NN4A 2HMZA 5H9CA 1AVMA 2JJ2G 2YC0A 1I5YA 2WLJA 1KBHA 4CC5A 3RYCB 2PX0A 1S3JA 3W7UA 4JI1O 2VQEO 4LF7O 4IWBA 2YZSA 3ETDA 4UB8Z 1SERA 5LHHA 1WJZA 4JTAB 2A68F 4NY3A 3E8HA 1HWYA 5J9PC 4N6CA 5DLJA 3EGXA 3K5OA 5BQGA 3W7WA 2XM4A 3AEIA 2LFFA 1N0NA 4Z9JA 4O6YA 4UCSA 4ZI7A 3MX3A 1H6GA 4O7GA 1R6KA 3ITFA 5L0FA 2ZXOA 4P30A 4C7OB 3C8GA 2L7AA 2G38A 4O4JB 1PCXA 1G5ZA 2R7XA 4YJWA 2Q6AA 2YHSA 1MA1A 5JRAA 3DD7A 1C03A 2XAQA 2LIGA 2DYSC 1VQ9V 1F4NA 1OKKA 2WLIA 2HV6A 1R3KC 4HNAA 1IBLB 4B3RB 3ZN1A 3OE7G 4I4TA 5KX5A 4NTBA 1TFOB 4D6TH 1Y76B 3F7YC 1T6IA 2EPMX 4RQEA 4P6IC 3ABLB 1GM7A 4J11A 1VLSA 2R9AA 4IB4A 3HNKA 1YEWA 4K35A 5A6AA 1PP9H 3IFXA 5LP6A 2Z15A 4IGGA 2VRZA 4CS9C 2A9HA 2QWRB 4JI5O 3AJMA 5JVDA 3CCVV 4CS4A 3G67A 4CS3A 1SQQH 5LOVA 2R7WA 4DUZO 5E33A 2CGEA 2XNDG 2CGNA 2JRIA 5EZYA 2ETNA 4X66O 1OJHA 5IJ9B 2XLHA 1QLEC 4JI0B 1M4UA 3L71H 1RSOB 2WLHA 1ZHYA 2CTRA 4DR3O 3CMEV 3A0BZ 2P06A 1RKEA 2NSGA 3C7JA 3AQBA 2H8PC 3CRRA 3BRCA 4XDJA 2GDSA 1SYQA 3S9OA 1QSPA 2IOQA 1SA0B 2HKOA 4JJGA 2QM8A 3Q4HA 4R8CA 3VOUA 3SZRA 4LFCB 1U89A 3K1HA 4RBNA 3FD9A 4FJCC 4TV9A 1SS3A 3K59A 5COFA 3ETEA 5C8YA 3C90A 3CZ6A 1XZPA 3VAYA 2HZ8A 3KPHA 1ORQC 5BMVB 4CDYA 2W9YA 4FLUA 3JCUQ 4LF8O 2QSAA 2A7WA 3T2MA 1FYJA 5KUKA 4DR6O 2DE0X 3IC7A 2DI3A 2IBFA 1UJWB 3LAYA 3JD4A 3ASOC 3EFFK 2UUAB 3IQ5A 1YTFD 3EZIA 4M63A 4JGSA 1AP5A 2R9IA 1TR2A 4KFMA 1OCCC 5L0CA 4DK1A 4FLYA 2QEXV 2RQ6A 4IT5A 4JRZA 4LP8A 4KHPO 1ZW3A 1GH6A 4O79A 1RMVA 3CAXA 5T3WA 3IEEA 1N8RW 2AU5A 4ANJA 5KYUB 3W4YA 3W2WA 1CXZB 1TVKA 1OR3A 3W2VA 1US6A 1K97A 1I94O 2XLMA 1VQLV 4RUEA 5HSWA 3I55V 1SZTA 4CJGA 4I9WA 4EFBA 3OTOB 5CI9A 1OCRB 3E22A 4F6RA 4UCRA 1HW1A 4DJ9A 2M7WA 1PNLA 4FLWA 2OJED 5JP7A 2F4VB 4GYTA 4X62O 5JS5A 4EBKA 2BOCC 4O4LA 1P84F 3O55A 4NTWA 4Z1VA 5KAFZ 1RP3B 2D2CB 5JJNB 1N36O 3SJCC 4BJ5C 4JYCA 3QW0A 4J7YA 3LESA 4P9PA 3UO3A 2Y4TA 1MABG 3L1MA 1JCHA 2XLOA 4MVMA 3SJQC 1QQ3A 2P90A 2B9ZA 1HNZB 2V3CC 2NNUA 1H2LA 2CGOA 1OHHG 5KMGA 3S29A 4DVYP 5EYPA 3M8AA 5B1BB 3I5DA 3DE9A 3W7XA 3TULA 1QLNA 3SXKA 5JVEA 2Q3TA 1VQKV 4I44A 1ZWIC 1VB5A 3FB6C 3HKCA 5LXTB 1JR9A 3H1IH 3FMSA 3AG3C 3CRAA 1ZW2A 2ZQMA 4YT8A 3T1HB 4WBNB 1D0YA 1V54B 1JMWA 3LEOA 3SXYA 3JCZA 3HKDA 4FM2A 2DWDC 2FFHA 1Q90D 2HVKC 4AQYB 1NVPB 1QQCA 1YA7O 1I4YA 2JS5A 5KA5A 3G4ZA 2Z3YA 1YVIA 3FOOA 5BXZA 4J7KA 4QPKA 2Z5UA 4H33A 4PI2A 1TUBB 3SYOA 1PPJH 1DOVA 2UUHA 3U0ZA 1YTFB 2OG2A 1WPXA 2Q9BA 5L0JA 4I9QA 4DR2O 4W8KA 1XEQA 4KP4A 5GW7A 3CRQA 4NXNO 3LEVA 1HNXB 3L8IA 5KYYA 3U3FA 4BR6A 1CPRA 2A3QA 4CS8C 4MVRA 3CWBH 1S76D 4X8AA 1AI7A 5DECA 1BQ0A 5GONA 5JCOC 1D1AA 1NU7D 2B5UA 4MW3A 4J7ZA 4P9OA 2J7PA 1MNDA 5JH7B 3APOA 2L6HA 2LGQA 1AEPA 3R2PA 1T9KA 2J46A 4B6IA 1GMGA 1N1CA 3S3WA 4I7ZB 3RFYA 4QI0A 4TWKA 2Q73A 5B1OA 3KL4A 3C62A 1NR7A 5AG2A 1IX9A 4NC3A 1M2OA 3UKMA 4ZIBA 1SC5B 2HJFC 3EGXB 1YJGA 5BQHA 4DR3B 1LIHA 5L0GA 3JASB 3W8HA 2HS5A 1Z5WA 5J2TB 1L3PA 4MW8A 1WB7A 1OCZB 5CA3A 1VK5A 3VRCA 2V26A 1BHBA 1TQGA 1V4AA 4W4LA 1SF8A 2PBEA 3JAKB 2YUAA 2PTMA 1EA8A 4JI6O 1L0LH 4B3TO 1NLXA 4DV0B 1U6HA 4FLZA 2CDQA 1KU9A 3STLC 3J81N 4QIWF 3E9VA 3LDDA 1CPQA 1Q0GA 4GEHA 4PJJA 3K0GA 2WLIB 4DV1O 4DV5O 4HNAB 2H3OA 5KX5B 2W45A 2VCAA 4K7BA 3M79A 2VQFO 2ZM6B 3E70C 3A11A 4NCQA 5LP6C 3OUSA 2ZXRA 4JKVA 5IYZB 4PJNA 5LP6B 2E5LB 3JD2A 2QTOA 4YHHB 4J80A 4LF9B 1AR1B 4PI0A 2L9JA 5JVDB 4LH6A 3SXZA 5T3TA 1G8XA 2RD9A 2GBOA 2XLDA 2P67A 3S90A 1WATA 2A6EF 2KQXA 1AILA 3OFNG 5EZYB 3JT1A 3BRJA 2KNHA 1GM8A 4Z1MG 5J2UA 4G2KA 5FL7G 3T6BA 3UO2A 2TMVP 4YL1A 3CC4V 2X6CA 3AG2B 4XDKA 1G4WR 3ZRWB 2ZNJA 4LBEC 1P4RA 4JAAA 3UCSC 1M56C 2EIKC 1XUQA 4I55B 3QO7A 3W7TA 1I94B 2QLAA 3JAMN 3AK2A 3M7MX 3UM7A 2IXPA 1MZEA 2YXLA 2I8BA 1SQVH 2UXBO 2PP4A 2LJ2A 3B77A 3ABKC 4ZBMA 4HE8D 3RQEA 3Q4HB 1WASA 3ABKB 4U5EE 2CDYA 3L74H 3TJ5A 1TWGA 2QJ1A 3JARB 5A6JA 2J0WA 4TV9B 3U5SA 1A0BA 2JIZG 3RYIB 5BUOA 1ZHWA 1T5OA 4PJ0Z 1LS1A 3EH2A 1BDJB 3RH3A 4E0HA 3EG9B 4WF9V 4WCEV 2CTQA 2VH3A 4C7OA 1KP3A 4O4JA 4IYHA 4RQFA 2NUPB 2X0LA 5IWAO 4E18A 2HHHB 3M1CB 4X89A 2AW9A 1V55B 3TJ6A 3HKBB 1A32A 2HG5C 3CX5F 5L0DA 4PFOA 2R7TA 1YHQV 3Q6NA 3NXSA 2WVQA 2XM0A 3L34A 4DV7O 2GTAA 4YJ2A 3WAQA 3RVYA 3RYHA 2ADPA 3V5XA 4BJTA 2XRHA 5LGTA 3FYIB 4JCHA 2WZGA 1C02A 2N05A 4MVQA 5E2QA 1M90W 3LLKA 3LSUA 2ADQB 3UGOA 3E22B 1XI1A 4F6RB 5L3CA 2PY5A 5DS4A 3AQCA 3FKSG 5IJ9A 2DN9A 5B1NA 1AI6A 4WJ0A 2J9WA 2HP8A 5CI8A 4X65B 4O4LB 1MQVA 1I5XA 1IW7F 3MD0A 2XTAA 4OIQF 1YJWV 3CCQV 4DR2B 2QE7G 4LCUC 3UNGC 1FKAO 3D8CA 3JD3A 5L3DA 1NG1A 1NJIW 4NXNB 3V7OA 2VCCA 4PV1B 4GKJB 1NH2B 2BC5A 4OIPF 2YWAA 4H54A 3LNRA 4KBLA 2Y4UA 2NR5A 5DVWA 3JALB 4DYLA 3U11A 4K1OA 2WZLA 3BA8A 3STZC 4H4KC 2LO1A 4B3RO 4JPRA 4O2BB 1GN3A 4ASUG 2B1IA 4PA7A 5BMVA 2PNOA 4LLCA 3BFRA 1PD3A 3KKYA 4P2ZA 1VQ8V 1S7ZA 3U8PA 2J45A 3O39A 1B6QA 2UXDB 3RFRA 4AK9A 1H38A 3K08A 2EILC 4GUNA 5EGYA 1BSMA 5IE9A 2A69F 3GM2A 4X20B 3JZ0A 2EILB 2P22C 2QY9A 4X1IB 1VYKA 3R7CA 1J8MF 1ST6A 1GN6A 2M4EA 5A6BD 2ODMA 5CBFA 4O6MA 5L3GA 1AB3A 4PD4F 1FAFA 1NSGB 4X0RA 1O87A 4N6HA 5CA0B 4NXMO 4UV9A 3OEEG 2HLDG 4LFCO 4JI6B 3AK1A 4DO2A 3ZMTA 3US6A 3K3WA 4DR1B 5JJJB 4DBQA 4XLPF 4OGQB 4QE9A 1F51A 3ABTA 2Q68A 3JSLA 1FNTc 2QKCA 4G7ZF 4Q7CA 4JI7O 3AOUA 2VQFB 1Q5OA 1Z6AA 4KC9A 1J95A 2M64A 1NR1A 4YN0B 4EFEA 1LVKA 2BE5F 1Y66A 5DN6G 3ZRVA 4ZHQB 4IHJA 2IM9A 3BEHA 2UUAO 1PKXA 2P61A 3CRMA 1LNQA 5F5HA 3U2MA 4CH5A 2HMQA 2RMKB 1NQTA 4CIHA 5JT4A 2X6BA 4UCTA 5LA6A 3P32A 3DXRA 1SZIA 1WN0A 4JI3B 4I1OB 4XPYA 2QNLA 4WFGA 3GORA 3AG4B 1E86A 4R7CA 2EPOA 2P7VA 2YL7A 4MS2A 2E76B 4BAYA 2KGOA 1Q8IA 3J80N 1JJOA 4WFHA 1SF9A 2PYLA 2Y0IA 4RD9A 1FXKA 2BOBC 1K3EA 2UUCO 5L3FA 3S28A 3A8TA 4TQFA 2WVNA 2F4VO 3HR0A 1N32B 5L3QA 5EC2C 1Q0FA 4CIPA 1Z63A 5LMNB 1WOLA 3DE8A 4NR1A 3ZN0A 2YLGA 4NTYA 4YWQA 3K57A 3NG1A 1JPJA 2YIBD 3GVMA 5KHKA 3Q7LA 2W4BA 3U2LA 4R6ZA 1FFXB 4JI8B 3AGTA 2OEXA 3K1IA 2NLJC 3JYHA 3ZHUA 2Q4PA 1MOFA 2K9PA 4JI2O 4B7KA 3VQWA 4TQDA 1PL0A 4U3JB 3LSSA 1TFKB 2JGDA 1JPNA 4IAOA 1QU7A 4EIYA 4EB6B 1DGSA 2A79B 4CC6A 3ZIAG 3T1HO 2CYDA 4K0KB 4GX2A 5E3AA 1PV0A 5BZBA 1O3UA 2GFHA 3BY6A 1Y67A 4AQYO 3HNJA 3MYFA 1XOUA 4DRXB 2ZE7A 5DS5A 5HFMA 3EQLF 1VARA 4R50A 2R7SA 1M2VB 1K73W 3N2GB 5LYJA 1YZAA 1NZ6A 4TV8B 2ZIOA 1TWHA 3D36A 1KU2A 4IRUA 4U9DA 3ZWIA 5B3IA 3ASNC 3E8GA 1TKNA 3ECSA 3WB2A 3FB8C 4H0LB 4Z9IA 3ASNB 4JYAB 1XZQA 2GV9A 3JASA 2NUTB 2LFRA 5J2TA 2F43G 2BTOA 4XPXA 1WB8A 4OD4A 1DLBA 1HNXO 2FMLA 3CCJV 1NS1A 1D2DA 1RM1C 1F1MA 3JAKA 1V9PA 1OCOC 2K1EA 3IJ4A 4YJ3A 3FAPB 1RM1B 1Q86W 1OCOB 5IDJA 1YITV 1VF6A 2Q0OC 1JRAA 2H7BA 1E1QG 3ABLC 1BQZA 4D4NA 4G27B 2AXTZ 2YQYA 4YJ2B 4EBBA 1AVOB 1K8AW 3RYHB 3EXAA 3LLIA 1YDIA 3B09A 5LHGA 1VF5B 4DVZA 3M4BA 2M6YA 1QBZA 5IYZA 1E2XA 2JK5C 3ZMUA 5KYNA 2J9VA 1SR2A 4UVBA 1QVGU 4FPPA 4YT5A 1VTMP 4FM1A 3DAFA 3O6XA 5BQIA 3F47A 1CP9A 2OTLV 1I0HA 4AI8A 3LSQA 3T6JA 1MMAA 2E74B 1BR2A 1VP7A 2LW7A 2IXNA 2HFIA 3QNEA 4BW9A 3RWRD 4L87A 4FLVA 3ZRWA 4FLTA 3CC2V 1H2NA 4I55A 4HFKB 1UG7A 4EHPA 1KQSU 4YIOA 1MMGA 3I4UA 4PK4A 3ZVRA 1MNGA 1KP2A 1JA8A 4DUYB 1HR0B 4NXMB 3NYLA 4U5BE 1T6UA 4NTXA 3SR2C 2XT9A 3EGDB 3IQ6A 4DV0O 2RNBA 3HPLC 1XL4A 2Y0PA 1A7VA 3JARA 4I50A 1HE9A 3AK3A 5H6RA 1XMOB 4UCOA 3RYIA 3CCUV 2UUIA 3F46A 4JI7B 2ZM6O 3H65A 2ITDC 3OGCC 3B0VC 3BAAA 2GDCA 3B8NA 4ABMA 3UQ8A 3RF3A 3EG9A 5AC5A 2E5LO 4YHHO 4LF9O 3SJBC 5KHHA 4GKKB 4Q4ZF 4JW1A 5DQTA 1VMGA 3RYLA 4JVSA 3VQYA 2NUPA 1SQPH 3H2UA 3WG7C 1R6TA 5CBGA 3SPHA 2EINB 1M9NA 3HKBA 4FVMA 3WG7B 2YXHA 3KZIZ 3ZHVA 1QVFU 1S5LZ 2P6VA 3OTFA 1ORSC 2RSEB 4PA4A 2XAJA 3X2QC 1R3JC 2YLDA 4TOIA 4FK5C 1H9GA 2Q67A 3X2QB 2ZNIA 1X59A 3ZHRA 3H2VA 1MSDA 1SQXH 1P7BA 1OXKA 1KUQA 4FZ1A 1OCRC 3ZQYA 2UUCB 2VASA 2EBOA 3S84A 4BIZA 3S27A 2WL8A 3TJTA 1HMOA 4G7HF 1FS0G 1KC8W 5K1XA 2HJ3A 1X4TA 4CSAA 3TXQA 1GQAA 1OR2A 4AILC 3DGEA 3B71A 1Y6DA 1JOYA 1SQGA 4GCZA 4LF4B 3O10A 4QI2A 4J32B 3DM5A 4XTKA 4DK0A 4IHJB 2VWJA 1SESA 1AJNA 5B1BC 1IDSA 3APQA 3CQZA 3TCUA 3TOLA 2HHHO 3JALA 2ATKC 1VIBA 3SPCA 4JI2B 4F6EA 2YRFA 3OEHG 1B68A 2QTVA 4JI4B 5LA6B 3DXRB 3K03A 4XDLA 1BR1A 3K7DA 1DK1A 5L3VA 4O2BA 5EIBD 1L1FA 3C18A 3H1HH 2BTQA 3JTLO 1COWG 1V54C 1Q43A 3SDLA 1B06A 4MTFA 3NMKA 4EWCA 1KD1W 2BL2A 1RFYA 2Y39A 1ZUQA 1Y74B 2OQMA 1XNRB 2ZPAA 5L0HA 1G4US 2EJRA 3TQOA 2UU9B 1FTSA 1CPYA 1XREA 1LUWA 1SETA 1R73A 3OD4A 4X20A 4X65O 2YIDA 5KUMA 1R4TA 2D5RB 1OW8A 3JATA 3QW1A 2F66C 4OPAA 5L3EA 4X1IA 2UXCB 2PYJA 4LF6B 1I08A 5JWPA 4DV4B 3LUTB 3HB3B 1OKKD 2KG7A 4P9FA 3B29A 2JD3A 2BSKA 3CHXA 3QMKA 3K1IC 1A41A 5CA0A 2DQ0A 4H44B 4J7JA 4GKJO 4ULVA 5GPGB 1MG1A 4DR5B 2MHRA 4IAQA 3CP1A 3FYEB 4C3BA 5HFLA 4Q20A 4UVCA
chains in the Genus database with same CATH topology
4MTXA 3LNMB 2KQ9A 4LLEA 1VYIA 4PDVA 2EIMB 1Z23A 5B1AC 1GO3F 5B1AB 3JYCA 2IU0A 5LHIA 3OMIB 3UMIA 1Q82W 1WGWA 1JJ2U 5EBMC 4PELA 3E86A 1S5HC 2W0FC 3E8BA 4WFFA 2WLKA 1THZA 3K9AA 1YI2V 1OCZC 2EIJB 3HTKC 4F4LA 3ZSUA 2J9UA 3D3IA 2W6IG 3RKOF 4Q5SF 2IXMA 4JTDB 1D0ZA 3JD1A 1PNMA 2HR3A 2Y3GA 1G8MA 2DQ3A 2AHZA 3P30A 3NKDA 2IJKA 1AROP 3ABMC 4JASA 2P6JA 3ZMZA 3N24A 3MHHC 3ABMB 2WLNA 5CMUA 1VMAA 4MQ9F 5IYDO 2PI4A 3OMAB 3LS1A 3E2EA 2X7RB 4TSFG 3DJUB 1VQOV 3AG2C 4PA6A 3DMDA 1Z3IX 4RDAA 3VBBA 4KUMA 4U7NA 4CBCA 3G6EV 3CYOA 3UMKA 2MYSA 2HVJC 3E35A 1RJ9A 3UMHA 3SYAA 1GK9A 2Y69B 2KW3C 1M2VA 5KYXB 4UVAA 3WODF 1K92A 3DZAA 3SEOA 1G4YB 2W4MA 1BR4A 2NUTA 3EHMA 3HJCA 3K04A 2X6AA 3B8MA 4XLNF 2MK3A 2W6JG 3CMAV 1V55C 3DM9B 2MWQA 3NRHA 1R3LC 1FXHA 4MSWC 1M1KW 1H8EG 1PD0A 1SRYA 3OUFA 3JD0A 1VQ5V 4XWJA 4C3EA 2V1DA 3TK1A 3K06A 2V7QG 4X88A 4YT2A 2EZOA 3RIPA 2R7UA 4JJFA 4CSAC 4JZAA 2WWWA 3UR3C 4FIPC 4KNVA 4E7ZA 2L81A 3EGDA 2H7OA 2HFEC 3OEOA 3N0TA 1EZJA 3SYPA 2VB6A 2JDIG 1Z5ZA 4PDLA 4CBEA 3F7VC 2CW0F 4MTGA 3POVA 4QE7A 1S0VA 1Y4MA 1VQ4V 1EFRG 4YT4A 4JAVA 4G7OF 3KKBA 2ZXWC 4MTOA 2ZXWB 1O5HA 1FXKC 2G3VA 2ITCC 1FXKB 2PI5A 4FX5A 2ZD9A 3HLZA 2WB7A 5D91A 4BJ6A 4I5SA 2WAMA 1Q7YW 4ULWA 3WFVA 2LSEA 5DS6A 5KYWB 4U5HA 1H8HG 2A0LA 2R7QA 3OR7C 2C03A 4LC1A 3AG4C 5B3SB 1IXMA 3OWTA 4J9YB 3W8IA 2XXAA 2ZDIA 1W2BU 4A2NB 1NBMG 3FVYA 1DF5A 3I5PA 4UXNA 2QM7A 1QR9A 1F23A 2OTJV 1M57B 4E2LA 2E87A 4J30B 2DGJA 3ZIBA 2QKSA 1ZHZA 3GANA 4MVZA 4PA3A 3SYCA 5EBWC 3W7SA 3G71V 1D1CA 4LERA 3CCMV 1MNEA 4PJMA 3NYMA 4JTCB 4RAIA 3GODA 2ZR3A 5H6QA 1KECA 3K0DA 1E1RG 4HFFB 3K79A 1LKXA 3CCRV 1RJ9B 2HV7A 1ZHXA 4PDMA 2H94A 1ROPA 2OCCC 5DM6V 1QZXA 4J9ZB 2OCCB 4JAUA 2YEVB 3M99B 4JYBA 3LJBA 2YSUB 1K7DA 4AE4B 3FDQA 2PFDA 1J8YF 3AG1C 1PNKA 4MVSA 1SMYF 4ZLDA 3NYJA 3ZRSA 3AG1B 1K9MW 4JURI 2XAGA 3DTUB 5L3BA 5EK0A 2DWEC 2P7TC 3T4ZA 5D92A 4MT8A 1IZMA 4PA9A 3CCLV 1F4MA 2R7RA 1JVMA 4CZZA 4PDRA 2DYSB 1DTOA 5FCLA 3RVZA 2WSSG 2IW5A 3B0UX 2CNWD 4GX1A 2WVOA 2AHYA 1K5QA 1AJPA 1TWCA 1KKDA 1BL8A 1XL6A 4ZKIA 3OM3B 4QPJA 4PFPA 1QLEB 2XAFA 5KYXA 5T1DB 2DW4A 4BEJA 4HEAJ 5F5FA 2IJIA 2R7VA 2KJGA 5EC1C 2IH1C 2Y48A 4DBRA 1K4DC 2IYLD 4BJ1A 4FMTA 2EINC 3OR6C 1E79G 3ABUA 2WLLA 2IJHA 1NVPD 3OAAG 5E1AC 4HZ3A 2GSMB 2NG1A 3ASOB 4I3MA 4IJJA 3F5WC 3EHBB 1OCCB 3RBZA 3CSKA 2PX3A 1MSWD 1S77D 3EFOB 1D0XA 4BJ6C 3EPVA 3EH1A 2KB1A 1JQ0A 2J0XA 2ZR2A 1FFTC 4GX0A 3ETGA 4H37A 1FFTB 5IY5C 1NKDA 2C2AA 5IY5B 1R3IC 1YJ9V 2H7VC 2WLMA 2PF4E 1ZU4A 4CS7A 2XXAB 2UXXA 2A1DD 2ZDIC 3B0PA 5IYCO 4MNDA 2IH3C 2B0JA 2FTKA 3SYQA 1R6NA 2O9XA 3E89A 4FWVA 3QZCA 3PJSK 4KI2A 3S0XA 3AG3B 3CCSV 1K33A 3LDCA 1WLEA 3DXJF 3OA1A 1JPXA 3CCEV 5LGNA 3NKEA 3MHSC 5CBHA 2EIMC 2XSEA 3KMIA 4WFBV 4OIRF 2QA4V 1MMNA 1BMFG 1H2GA 4TT3G 4N23A 1ENVA 3TETA 5KYWA 5LGUA 2JJ1G 4FESA 3ML0A 3DAGA 1D1BA 1PD1A 4I1MA 3FB5C 4QDLA 3VYWA 2EIJC 2G3KA 5KA6A 2X51A 1VQMV 1QCEA 3NDBB 4YXWG 1VQ6V 1QR8A 1NZEA 3B9QA 2Q9CA 4GX5A 1YSCA 3A0RA 3ZC4A 1VQ7V 3LS0A 3GWOA 4RUFA 3Q7GA 1VQPV 3FHDA 3TD7A 1YIJV 3FB7C 1S72V 3K66A 3T4DA 1BHAA 3OW2U 2JEUA 4EKWA 3K6BA 3ZG1A 3EZHA 2Y69C 1ZHTA 1EBOA 1ZYRF 1NH2D 3UGPA 4GT1A 3QO8A 1M56B 2EIKB 4MVOA 2YEVA 4U5CE 2OT5A 5EBLC 4KNWA 4AE4A 1W2WA 3T4RA 3L0IA 2WLLB 3RW0A 2FGYA 2IU3A 4F4BA 4HAMA 3MLGA 2Y3DA 4UV8A 2ZXPA 3QO5A 3SYNA 5LBQA 4ZLCA 1AI5A 3EJNA 4OD5A 2IJJA 5EHHA 5DQZA 3ZMVA 1VQNV 2CK3G 3GB7C 4CS9A 2J7PD 4K0DA 3KG2A 2WPDG 1AI4A 3E8FA 4U7OA 3SPIA 3CXCU 3H01A 3G4SV 4WFAV 3E83A 2LFSA 4DXWA 3KH2A 1RPRA 5C93A 1TUEB 1GM9A 3I5QA 4WFEA 3K33A 3PHF2 4AX2A 2A6HF 4E7SA 4BIUA 1K34A 4O6NA 1FXVA 1Q81W 4LACB 2EZPA 1GTOA 2G62A 2XL4A 1CEZA 1NU9C 3SP1A 1OZ0A 4JF3A 4N21A 4UUJC 1RPOA 2Y3BA 5KYUA 4U5FE 2LP7A 4PJLA 3EFOA 3EHNA 2R7OA 3SNHA 2C04A 3LDEA 3IGAC 5KYYB 1ZU5A 4BG0A 4G28B 3I56V 2CNWA 1FMVA 2XASA 3CPWU 5B3SC 1W0KG 1TWAA 4BJ5A 4U5GA 3T1CA 4QJFB 3FAJA 4BW5A 3SPGA 3SPJA 4MVUA 4RO2A 1W0JG 1JX9A 3ZCCA 1AJQA 1FMWA 3ZMSA 2XOKG 2GHYA 1M57C 5IYBO 4N06A 2Q69A 3PMRA 3CC7V 2DYRC 2IXOA 2DYRB 2UXNA 3ZRXA 4QNHB 4U5DE 3ZJZA 2D3OW 2Q9AA 1GKFA 3CD6V 4OIOF 2Y3HA 4OXSA 2XAHA 2WZFA 2R9RB 4C3DA 4G0HA 3X1OA 1K4CC 1FFHA 4HYOA 3OMNB 4OINF 3JRTA 3Q6MA 1MMDA 4DOZA 5E3CA 1VOMA 4CS8A 5CN0A 3JSZA 2JEXA 1K5SA 3R65A 4XBFA 1YJNV 3DJNB 1DF4A 2B1GA 5H9CA 2JJ2G 1I5YA 2WLJA 2PX0A 1S3JA 3W7UA 4IWBA 2YZSA 3ETDA 1SERA 5LHHA 4JTAB 2A68F 4NY3A 3E8HA 1HWYA 5J9PC 5DLJA 3EGXA 3W7WA 3AEIA 4O6YA 3MX3A 4O7GA 1R6KA 3ITFA 2ZXOA 4P30A 4C7OB 1PCXA 2R7XA 4YJWA 2Q6AA 2YHSA 3DD7A 2XAQA 1OKKA 2DYSC 1F4NA 1VQ9V 2WLIA 2HV6A 1R3KC 3ZN1A 3OE7G 3F7YC 4RQEA 4P6IC 3ABLB 1GM7A 3IFXA 2Z15A 4CS9C 2A9HA 3CCVV 2R7WA 5E33A 2CGEA 2XNDG 1QLEC 2WLHA 1ZHYA 3CMEV 3AQBA 2H8PC 4XDJA 2IOQA 2HKOA 4JJGA 2QM8A 4R8CA 3VOUA 3SZRA 3K1HA 4RBNA 4FJCC 3ETEA 3CZ6A 3VAYA 1ORQC 2W9YA 3JCUQ 3T2MA 5KUKA 3IC7A 1UJWB 3LAYA 3JD4A 3ASOC 3EFFK 4M63A 1YTFD 3EZIA 4JGSA 2R9IA 1TR2A 4KFMA 1OCCC 2QEXV 4LP8A 4O79A 5T3WA 3IEEA 1N8RW 4ANJA 5KYUB 3W2WA 3W2VA 1K97A 1VQLV 5HSWA 4RUEA 3I55V 1SZTA 4I9WA 5CI9A 1OCRB 2M7WA 1PNLA 4GYTA 2BOCC 4BJ5C 4JYCA 3LESA 4P9PA 1MABG 1JCHA 4MVMA 3SJQC 2P90A 2V3CC 2NNUA 1OHHG 3S29A 4DVYP 5B1BB 3W7XA 1QLNA 2Q3TA 1VQKV 4I44A 1ZWIC 3FB6C 3AG3C 2ZQMA 4YT8A 1D0YA 1V54B 3JCZA 2DWDC 2FFHA 4Q20A 2HVKC 1NVPB 5KA5A 2Z3YA 4QPKA 2Z5UA 4H33A 3SYOA 1YTFB 2OG2A 1WPXA 2Q9BA 4W8KA 4KP4A 5GW7A 3LEVA 5KYYA 4CS8C 4MVRA 1S76D 4X8AA 1AI7A 1D1AA 1NU7D 2B5UA 4MW3A 4P9OA 2J7PA 1MNDA 2J46A 4B6IA 1GMGA 1N1CA 3RFYA 4QI0A 4TWKA 5B1OA 3KL4A 1NR7A 1M2OA 3UKMA 2HJFC 3EGXB 3W8HA 4MW8A 1OCZB 5CA3A 1VK5A 2V26A 1BHBA 1SF8A 2CDQA 3E9VA 3STLC 4GEHA 4QIWF 3LDDA 4PJJA 3K0GA 2WLIB 2W45A 4K7BA 3E70C 3OUSA 2ZXRA 4PJNA 3JD2A 2QTOA 1AR1B 2L9JA 5T3TA 1G8XA 2P67A 2A6EF 3OFNG 3JT1A 2KNHA 1GM8A 4Z1MG 4G2KA 5FL7G 3T6BA 3CC4V 2X6CA 3AG2B 4XDKA 3ZRWB 4LBEC 1P4RA 1M56C 2EIKC 3W7TA 3QO7A 2IXPA 3UM7A 2I8BA 2PP4A 3B77A 3ABKC 4ZBMA 4HE8D 3ABKB 4U5EE 1TWGA 2J0WA 2JIZG 5BUOA 1ZHWA 1LS1A 3EH2A 3RH3A 3EG9B 4WF9V 4WCEV 2VH3A 4C7OA 1KP3A 2NUPB 4RQFA 2X0LA 3M1CB 4X89A 1V55B 2HG5C 4PFOA 2R7TA 1YHQV 3Q6NA 3NXSA 2WVQA 3L34A 3RVYA 4BJTA 2XRHA 5LGTA 3FYIB 4JCHA 2WZGA 4MVQA 5E2QA 1M90W 3LLKA 3UGOA 5L3CA 5DS4A 3AQCA 3FKSG 5B1NA 1AI6A 4WJ0A 2J9WA 5CI8A 1I5XA 1IW7F 3MD0A 4OIQF 1YJWV 3CCQV 2QE7G 4LCUC 3UNGC 3JD3A 5L3DA 1NG1A 1NJIW 3V7OA 1NH2B 4OIPF 3LNRA 4KBLA 5DVWA 2WZLA 3STZC 4H4KC 4JPRA 4ASUG 2B1IA 4PA7A 4LLCA 1PD3A 4P2ZA 1VQ8V 1S7ZA 2J45A 3O39A 1B6QA 4AK9A 1H38A 3K08A 2EILC 5EGYA 2A69F 2EILB 2QY9A 1VYKA 1J8MF 1ST6A 2M4EA 5CBFA 4O6MA 5L3GA 4X0RA 1O87A 4UV9A 3OEEG 2HLDG 4DO2A 3ZMTA 3K3WA 4DBQA 4XLPF 4QE9A 1F51A 3ABTA 2Q68A 4G7ZF 4Q7CA 1Z6AA 4KC9A 1J95A 1NR1A 4YN0B 1LVKA 2BE5F 1Y66A 5DN6G 3ZRVA 3BEHA 1PKXA 5F5HA 1LNQA 4CIHA 1NQTA 2X6BA 3P32A 1SZIA 4I1OB 4WFGA 3AG4B 4R7CA 2P7VA 4MS2A 2KGOA 4BAYA 4WFHA 4RD9A 1FXKA 2BOBC 1K3EA 5L3FA 3S28A 2WVNA 5L3QA 5EC2C 1Z63A 3ZN0A 4YWQA 3NG1A 1JPJA 3Q7LA 2W4BA 4R6ZA 2NLJC 3JYHA 1MOFA 1PL0A 3LSSA 1JPNA 4IAOA 2A79B 3ZIAG 4GX2A 5E3AA 5BZBA 2GFHA 3BY6A 5DS5A 5HFMA 3EQLF 4R50A 2R7SA 1M2VB 1K73W 1TWHA 3D36A 1KU2A 4IRUA 3ASNC 3E8GA 1TKNA 3ECSA 3FB8C 3ASNB 2NUTB 2LFRA 2F43G 4OD4A 1DLBA 3CCJV 1RM1C 1OCOC 2K1EA 1RM1B 1Q86W 1OCOB 5IDJA 1YITV 2H7BA 1E1QG 3ABLC 4G27B 4EBBA 1K8AW 3LLIA 5LHGA 4DVZA 1QBZA 2JK5C 3ZMUA 5KYNA 2J9VA 4UVBA 1QVGU 4FPPA 4YT5A 3DAFA 3O6XA 3F47A 1CP9A 2OTLV 3LSQA 3T6JA 1MMAA 1BR2A 2IXNA 3QNEA 4L87A 3ZRWA 3CC2V 4HFKB 1KQSU 1MMGA 4PK4A 3I4UA 3ZVRA 1KP2A 3NYLA 4U5BE 3EGDB 3HPLC 1XL4A 5H6RA 3CCUV 3F46A 3H65A 2ITDC 3OGCC 3B0VC 3B8NA 3EG9A 4Q4ZF 4JW1A 5DQTA 3RYLA 4JVSA 2NUPA 3WG7C 5CBGA 3SPHA 2EINB 1M9NA 3WG7B 1QVFU 2P6VA 4PA4A 2XAJA 3X2QC 1R3JC 4FK5C 2Q67A 3X2QB 1P7BA 1OCRC 2VASA 2EBOA 4BIZA 3S27A 2WL8A 4G7HF 1FS0G 1KC8W 4CSAA 3DGEA 1JOYA 4QI2A 4GCZA 4J32B 3DM5A 4XTKA 1SESA 1AJNA 5B1BC 3CQZA 3TCUA 2ATKC 3SPCA 3OEHG 2QTVA 4XDLA 3K03A 1BR1A 3K7DA 5L3VA 1L1FA 1COWG 1V54C 4MTFA 4EWCA 1KD1W 2Y39A 2ZPAA 2EJRA 1FTSA 1CPYA 1SETA 1R73A 5KUMA 2D5RB 5L3EA 3LUTB 3HB3B 1OKKD 2JD3A 3QMKA 3K1IC 2DQ0A 1MG1A 3CP1A 3FYEB 4C3BA 5HFLA 3N2ZB 4UVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R50 A;  5CBG A;  2HG5 C;  3KG2 A;  3LNM B;  3SPH A;  2WLI A;  3E8F A;  4JTC B;  1R3K C;  4PDV A;  3SPI A;  2BOC C;  4RAI A;  3FB7 C;  3UKM A;  1M57 C;  3PJS K;  4QE9 A;  3ASN C;  3E8G A;  2HJF C;  2Q68 A;  3F7Y C;  4PA4 A;  3FB8 C;  1G4Y B;  3X2Q C;  1R3J C;  3RVY A;  2Q69 A;  5B1A C;  3T4D A;  1J95 A;  2Q67 A;  3E83 A;  2DYR C;  2ZXW C;  3K0D A;  4MW8 A;  4P9P A;  3IFX A;  4DXW A;  4MTO A;  3JYC A;  4MVM A;  4EKW A;  3SJQ C;  3K04 A;  3LDC A;  2A9H A;  5EC1 C;  2X6A A;  4QNH B;  1P7B A;  2IH1 C;  4MVQ A;  4WFE A;  3ZJZ A;  1OCR C;  3BEH A;  1K4D C;  1LNQ A;  1OCO C;  1V55 C;  2K1E A;  2ITC C;  2EIN C;  2Y69 C;  5EBM C;  1QLE C;  3OR6 C;  2X6B A;  3STL C;  5CBH A;  2EIM C;  1R3L C;  3LDD A;  2WLL A;  3K0G A;  2WLI B;  1ZWI C;  3E86 A;  2WLH A;  2ZD9 A;  3FB6 C;  4OXS A;  1S5H C;  4MSW C;  4WFG A;  2R9R B;  2W0F C;  3ABL C;  3AG3 C;  4PDM A;  3E8B A;  2OCC C;  5E1A C;  4G27 B;  4R7C A;  4WFF A;  4J9Z B;  2WLK A;  2H8P C;  3OUS A;  4LCU C;  4MS2 A;  3OUF A;  1K4C C;  1OCZ C;  4HZ3 A;  4XDJ A;  4MVO A;  2YEV A;  4WFH A;  2JK5 C;  2QTO A;  4HYO A;  4F4L A;  2DWD C;  3TET A;  3K06 A;  5EBL C;  2A0L A;  2BOB C;  2HVK C;  4R8C A;  5B1B C;  3VOU A;  3TCU A;  3F5W C;  4JTD B;  2ATK C;  3SPC A;  4X88 A;  3RBZ A;  3STZ C;  4UUJ C;  3AG1 C;  2WLL B;  3OR7 C;  4MVS A;  4XDL A;  3K03 A;  5EC2 C;  3SYA A;  4H33 A;  3RW0 A;  3SYO A;  3ZRS A;  3AG4 C;  2X6C A;  3R65 A;  4XDK A;  4J9Y B;  3FB5 C;  1ORQ C;  2AHZ A;  4LBE C;  4PA7 A;  1M56 C;  2EIK C;  2EIJ C;  3ABM C;  1V54 C;  5EK0 A;  3UM7 A;  2DWE C;  2P7T C;  3T4Z A;  4R6Z A;  2KB1 A;  3T2M A;  2WLN A;  5KUK A;  2WLJ A;  4P2Z A;  4MTF A;  3LDE A;  3ABK C;  3ASO C;  3EFF K;  3IGA C;  2NLJ C;  4GX0 A;  4ZBM A;  4PA9 A;  1FFT C;  4G28 B;  4H37 A;  5IY5 C;  4KFM A;  1OCC C;  4MVR A;  1JVM A;  3HPL C;  4JTA B;  3K08 A;  2EIL C;  1XL4 A;  4LP8 A;  4PDR A;  4X8A A;  3E8H A;  1R3I C;  5B3S C;  2WLM A;  3AG2 C;  5KUM A;  3RVZ A;  5J9P C;  2HFE C;  4PA6 A;  4MW3 A;  4P9O A;  3LUT B;  2A79 B;  4GX5 A;  2ITD C;  2QKS A;  5CBF A;  3OGC C;  4GX1 A;  3SYP A;  3T1C A;  2AHY A;  4MVZ A;  4RUE A;  4PA3 A;  4GX2 A;  4P30 A;  4PDL A;  4BW5 A;  3GB7 C;  3SPJ A;  4MVU A;  4I9W A;  3SPG A;  3SYC A;  5BZB A;  3F7V C;  5EBW C;  1KKD A;  2IH3 C;  4RO2 A;  4CBC A;  4RUF A;  1BL8 A;  1XL6 A;  3SYQ A;  2Q6A A;  4MTG A;  4TWK A;  3WG7 C;  2HVJ C;  3E89 A;  4QE7 A;  4X89 A;  2DYS C; 
#chains in the Genus database with same CATH topology
 4MTX A;  1QNM A;  3LNM B;  2KQ9 A;  4LLE A;  4R32 A;  1VYI A;  4PDV A;  1VF7 A;  2EIM B;  2AWY A;  2QE9 A;  3M15 A;  4XEV A;  2JGD B;  2F23 A;  1Z23 A;  3HKE B;  5B1A C;  3K5M A;  2KSD A;  2ASR A;  1GO3 F;  5B1A B;  3JYC A;  2IU0 A;  5LHI A;  4J41 A;  1O9H A;  3OMI B;  4ZHQ A;  3UMI A;  1LR1 A;  2F1M A;  1MZF A;  3KCX A;  1EZV H;  1Q82 W;  1BZK A;  2UXD O;  1WGW A;  1JJ2 U;  5EBM C;  4PEL A;  2AZ2 A;  1XIL A;  4YL3 A;  3D36 C;  5LYJ B;  2XUM A;  3IQT A;  3E86 A;  1XDC A;  1GM5 A;  5JSL A;  1S5H C;  4B3S O;  3U8V A;  2W0F C;  2ZE6 A;  3E8B A;  3N2K A;  3FAV B;  4WFF A;  5F28 E;  2WLK A;  3QG5 A;  1THZ A;  3WB1 A;  3K9A A;  2AWC A;  2QDO A;  1OCZ C;  2EIJ B;  1YI2 V;  2XLE A;  4B7E A;  4CH6 A;  3HTK C;  4F4L A;  3ZSU A;  5FPR A;  3ZHS A;  2J9U A;  3N2Z B;  3D3I A;  2W6I G;  3RKO F;  1M93 A;  4Q5S F;  2XLV A;  3JSN A;  3RQG A;  2IXM A;  4JTD B;  4YJ3 B;  2UUB B;  1D0Z A;  1KB9 F;  1VF6 C;  2N04 A;  3G80 A;  3JD1 A;  1PNM A;  4DR1 O;  1YYX A;  3AGU A;  1E84 A;  1C17 M;  1ZL8 A;  2HR3 A;  2Y3G A;  3TOM A;  1G8M A;  2OU6 A;  2DQ3 A;  4IIJ A;  2AHZ A;  1JFF A;  3P30 A;  3NKD A;  2IJK A;  1ARO P;  3ABM C;  4JAS A;  1UFI A;  2P6J A;  4K3A A;  4LF5 B;  2PZS A;  3ZMZ A;  3GWK C;  5LMU B;  3MHH C;  3N24 A;  2R25 A;  3ABM B;  1FFX A;  1RKC A;  5FZT A;  2WLN A;  5CMU A;  3ZBH A;  1R1B A;  1VMA A;  5KLV H;  4MQ9 F;  1UPG A;  5IYD O;  2PI4 A;  3OMA B;  3LS1 A;  3E2E A;  1L7C A;  1QHT A;  1YVW A;  5TIS Z;  2X7R B;  4TSF G;  1MMM A;  3DJU B;  4U3J A;  1VQO V;  3AG2 C;  4JI3 O;  2FB5 A;  3G4X A;  4PA6 A;  3DMD A;  4EB6 A;  2VC9 A;  2ILM A;  1Z3I X;  4RDA A;  3VBB A;  4KUM A;  4U7N A;  4CBC A;  3G6E V;  5H2F Z;  3CYO A;  3UMK A;  4LNU A;  2MYS A;  3IC9 A;  2HVJ C;  4DRX A;  4JE9 A;  3E35 A;  1RJ9 A;  3UMH A;  3SYA A;  1GK9 A;  2Y69 B;  4DV2 B;  2KW3 C;  1M2V A;  2OYQ A;  3N2G A;  1S05 A;  4UVA A;  5KYX B;  4I50 B;  4TV8 A;  1N32 O;  3WOD F;  1K92 A;  3DZA A;  3SEO A;  4FFK A;  4O2A A;  1YCI A;  1G4Y B;  4JZG A;  3OT7 A;  5LMN O;  2YL3 A;  4Z2W A;  2W4M A;  1BR4 A;  4XQ1 A;  2NUT A;  3EHM A;  3VM6 A;  2ZE8 A;  3HJC A;  3K04 A;  4JI8 O;  3BCC H;  3GEI A;  2X6A A;  3B8M A;  5GTH Z;  2GWW A;  2R02 A;  4XLN F;  2MK3 A;  2W6J G;  4LR3 A;  2V4D A;  2YI9 A;  3CMA V;  3A0H Z;  1V55 C;  3DM9 B;  2MWQ A;  3NRH A;  1D5A A;  1R3L C;  1FXH A;  4MSW C;  1M1K W;  3ATP A;  3PDM P;  1KNY A;  1H8E G;  1PD0 A;  5AC4 A;  1E85 A;  1SRY A;  2YIA A;  3OUF A;  3JD0 A;  1VQ5 V;  1LPE A;  2R72 A;  1LE2 A;  4K0K O;  4XWJ A;  4C3E A;  1BGY H;  2V1D A;  3TK1 A;  3KYI A;  3K06 A;  2Z0A A;  2LFD A;  2OOC A;  2EUL A;  1ORY A;  2V7Q G;  4X88 A;  4YT2 A;  4DR4 B;  2Q0A A;  1IBK B;  3H9V A;  5CB4 B;  2CUG A;  2HSB A;  2EZO A;  2KYH A;  1I4Z A;  4YIP A;  4W4K A;  5K1P A;  3RIP A;  2R7U A;  4JJF A;  4X1K B;  4CSA C;  1H2S B;  4JZA A;  4JYA O;  5COM A;  2WWW A;  3UR3 C;  3F5T A;  1OW7 A;  3K58 A;  4FIP C;  4KNV A;  4B08 A;  1NFN A;  3EVK A;  2EPL X;  4E7Z A;  1A7E A;  2L81 A;  5KAI Z;  3EGD A;  1T6Q A;  4ONS A;  2ZT9 B;  1YAU O;  4N4W A;  2H7O A;  2Q7G A;  4EEQ A;  2WA4 A;  3CB2 A;  4B3M B;  4WGY A;  3P3N A;  1YZC A;  2HFE C;  5FPO A;  2BTQ B;  3BA9 A;  4FFB B;  1N4C A;  2X0C A;  4LWS B;  3N0T A;  3OEO A;  1EZJ A;  3SYP A;  3PN1 A;  4OX9 B;  1D5N A;  4TUY B;  1AUE A;  2VB6 A;  2YVK A;  2JDI G;  3KCY A;  1Z5Z A;  4PDL A;  4CBE A;  2OKU A;  4JZ2 A;  2Q7H A;  3F7V C;  2CW0 F;  1XBL A;  2KK1 A;  4X64 B;  4MTG A;  4X1Y B;  4L6R A;  3TK0 A;  4O4H A;  3POV A;  4QE7 A;  2QR4 A;  1S0V A;  2VS0 A;  2RN9 A;  5KHG A;  3QTH A;  1Y4M A;  2QWO B;  1VQ4 V;  1GAX A;  2H8A A;  4B3S B;  1H7I A;  4PR9 A;  3JAT B;  3DC5 A;  3TGU H;  5TJ5 E;  1EFR G;  4YT4 A;  4JAV A;  3MYI A;  2DB4 A;  4G7O F;  3KKB A;  2ZXW C;  2KG7 B;  1DOW A;  4MTO A;  1U0B B;  2BSK B;  4JCZ A;  2ZXW B;  1GN4 A;  3J06 A;  4DUY O;  1HR0 O;  1O5H A;  2QUP A;  1FXK C;  1F7Y A;  3C8Z A;  4JEA A;  1SZX A;  2G3V A;  2ITC C;  4AL0 A;  2L6F A;  3U0C A;  4JV5 B;  1FXK B;  4IYI A;  2PI5 A;  4GLX A;  4FX5 A;  2LQT A;  2ZKO A;  1EI7 A;  2ZD9 A;  4E4E A;  3MBG A;  3JRM O;  5A9G A;  1XMO O;  1IVS A;  3HLZ A;  2W0X A;  3DKA A;  3FOP A;  2J9B A;  2WB7 A;  2JS3 A;  1QVX A;  3BHP A;  3M4C A;  2ZIN A;  1TA8 A;  2LCH A;  1E83 A;  5D91 A;  4BJ6 A;  4GZR B;  1SKV A;  4I5S A;  2WAM A;  1Q7Y W;  4ULW A;  3WFV A;  2LSE A;  2HSQ A;  4GKK O;  1LS4 A;  5DS6 A;  5KYW B;  4U5H A;  1H8H G;  1Q6I A;  1N34 B;  2A0L A;  4XPW A;  1Z7Q c;  3TXS A;  2R7Q A;  5FNV A;  1WP7 A;  1JR8 A;  4FAP B;  1BBH A;  3OR7 C;  2C03 A;  4LC1 A;  2R70 A;  3AG4 C;  5B3S B;  1IXM A;  1VEW A;  4J9Y B;  3OWT A;  3N2K B;  1GGQ A;  3W8I A;  2XXA A;  1KYO F;  2CE4 A;  1URF A;  1KKC A;  2ZDI A;  4NKG B;  3N27 A;  1W2B U;  1GN2 A;  2CAZ C;  4A2N B;  1NBM G;  3FVY A;  1NT2 B;  1DF5 A;  2QM4 A;  1Y74 A;  4FZ0 A;  3I5P A;  4UXN A;  2L6L A;  4NVP A;  4PHZ A;  5DED A;  2QM7 A;  1QR9 A;  1ZL8 B;  1F23 A;  2OTJ V;  3FXH A;  3GWL A;  2P0N A;  1M57 B;  2QWQ B;  4CDA A;  1CGN A;  4IIJ B;  2YDE A;  2LK4 A;  4E2L A;  1OW6 A;  1JFF B;  2E87 A;  4J30 B;  2DGJ A;  3ZIB A;  1HW7 A;  2QKS A;  4IL6 Z;  1ZHZ A;  4LFB B;  1NTZ H;  3GAN A;  1Q0K A;  4MVZ A;  4PA3 A;  3MDS A;  3SYC A;  4LF4 O;  2HKV A;  1NTM H;  5EBW C;  3UT5 A;  3W7S A;  3G71 V;  1D1C A;  1V74 B;  4LER A;  3CCM V;  1XNQ B;  1MNE A;  3H1L H;  4PJM A;  3NYM A;  3THO A;  4JC7 A;  1IZ3 A;  4JTC B;  4JI4 O;  4YK5 A;  4RAI A;  3T1Y B;  3GOD A;  2MW2 B;  2ZR3 A;  2AGA A;  5H6Q A;  4YY3 B;  3HKE A;  1KEC A;  1EKY A;  1LM3 B;  4CS2 A;  2LD6 A;  3DI5 A;  3K0D A;  1E1R G;  5H5N A;  2AVK A;  3VF0 A;  1XHX A;  1Y4C A;  1NI8 A;  4HFF B;  3B4S A;  4DV3 O;  3BVO A;  3K79 A;  2Q9L A;  3VQX A;  1Q6U A;  2P1A A;  1XMQ O;  4LNU B;  1XNR O;  1LKX A;  3RT3 C;  1TAE A;  1HMD A;  3CCR V;  2UU9 O;  1RJ9 B;  2A0B A;  2HV7 A;  1ZHX A;  1JOG A;  1XQ8 A;  1WN7 A;  1Q0D A;  2XLW A;  4PDM A;  2H94 A;  1B04 A;  1ROP A;  2OCC C;  5DM6 V;  3ZED A;  4O2A B;  2UXC O;  256B A;  3FAV A;  1QZX A;  4LF6 O;  4DV4 O;  2KC3 A;  4J9Z B;  2OCC B;  1IBM B;  4JAU A;  1CGO A;  4O4I B;  2YEV B;  3M99 B;  3QVZ A;  3QVY A;  1ZZP A;  4JYB A;  5CA1 A;  5IJ0 A;  2YSU B;  3LJB A;  1LUV A;  1K7D A;  4J7T A;  4AE4 B;  3A2F A;  4DR5 O;  5BR8 O;  1G1X B;  3FDQ A;  2PFD A;  1J8Y F;  1HW2 A;  3AG1 C;  1PNK A;  4MVS A;  1SMY F;  4ZLD A;  3NYJ A;  3ZRS A;  3IPM O;  3AG1 B;  1K9M W;  4JUR I;  2NSF A;  2QGN A;  2XAG A;  3DTU B;  2D4U A;  5L3B A;  3MAQ A;  3GEE A;  5EK0 A;  2DWE C;  2P7T C;  3T4Z A;  4C7U A;  3CXH F;  5D92 A;  4MT8 A;  1IZM A;  4EUK B;  4PA9 A;  2XL6 A;  3CCL V;  2Q5Z A;  1F4M A;  1M6T A;  2P4V A;  4LDR A;  2R7R A;  1JVM A;  1FJG O;  1HDJ A;  4CZZ A;  1T5E A;  4PDR A;  2JGU A;  2DYS B;  1DTO A;  5FCL A;  3RVZ A;  1GS9 A;  4UFZ A;  1P49 A;  2HJD A;  1R5I D;  1N33 B;  2WSS G;  2IW5 A;  2YKZ A;  3B0U X;  2CNW D;  2FKX A;  4LDK A;  4GX1 A;  2WVO A;  2ZIM A;  2LP4 A;  2AHY A;  2VCB A;  1K5Q A;  1AJP A;  2AZ0 A;  1TWC A;  1KKD A;  1LE4 A;  5CIV A;  1BL8 A;  1XL6 A;  4ZKI A;  2A06 H;  3OM3 B;  4QPJ A;  1PM9 A;  2UUB O;  3IAY A;  4PFP A;  4E0I A;  1WA8 B;  4CDV A;  1QLE B;  2XAF A;  5KYX A;  5T1D B;  3DC6 A;  1VLT A;  1AR4 A;  2DW4 A;  2QWP B;  4BEJ A;  2ARH A;  4HEA J;  4LH7 A;  2IJI A;  5F5F A;  4UCU A;  4LF5 O;  5LMU O;  2R7V A;  3G6B A;  4DW1 A;  2KJG A;  5EC1 C;  2P4K A;  2IH1 C;  1RXQ A;  1N0J A;  2Y48 A;  1J5E O;  2OIG A;  1EN4 A;  4DBR A;  1K4D C;  2IYL D;  4BJ1 A;  4FMT A;  2EIN C;  4O4H B;  4BIO A;  3OR6 C;  3U9M A;  1E79 G;  3BPZ A;  3ABU A;  2WLL A;  2IJH A;  2E75 B;  1K04 A;  1NVP D;  4DRJ B;  2YLI A;  3OAA G;  1BZ4 A;  5E1A C;  1K40 A;  4Z9H A;  2QTS A;  4BWA A;  4HZ3 A;  2P5O A;  2GSM B;  3ZHT A;  2J8W A;  2NG1 A;  4LFA O;  1YLM A;  3ASO B;  1BE3 H;  4I3M A;  4IJJ A;  1FAP B;  3F5W C;  3SGI A;  2ETS A;  3EHB B;  2L6G A;  3V5Y A;  1OCC B;  3RBZ A;  3U9J A;  4DV2 O;  5CB4 A;  3CSK A;  3PCV A;  4I0X A;  3K5L A;  2PX3 A;  1MSW D;  1S77 D;  1NU1 H;  3EFO B;  1D0X A;  3U3B A;  4X1K A;  4BJ6 C;  3L75 H;  4ZOL B;  4CH3 A;  3EPV A;  1ZVZ A;  5ITZ B;  3EH1 A;  2KB1 A;  4J42 A;  1JQ0 A;  2J0X A;  3GM1 A;  2ZR2 A;  3B40 A;  1FFT C;  2ZE5 A;  4GX0 A;  2EJ7 A;  3ETG A;  3DSQ A;  4WAB A;  4H37 A;  1FFT B;  5IY5 C;  1NKD A;  2C2A A;  4K8Z A;  2A0U A;  5IY5 B;  5FNV B;  1R3I C;  2FL4 A;  1YJ9 V;  2H7V C;  2WLM A;  3QTC A;  4CX9 A;  2PF4 E;  5D5Q A;  5F2V O;  1IXB A;  1YF2 A;  4J10 A;  4FFB A;  1ZU4 A;  4CS7 A;  4LWS A;  4D7S A;  2XXA B;  3JCU Z;  2UXX A;  2A1D D;  4K8X A;  4TUY A;  2ZDI C;  3B0P A;  1GRJ A;  4DV3 B;  3JAW B;  5IYC O;  4MND A;  1HP8 A;  1ZAU A;  3H1J H;  4H13 B;  2IH3 C;  3K9S A;  2B0J A;  2FTK A;  3SYQ A;  1XMQ B;  1R6N A;  2O9X A;  4X1Y A;  4L8J A;  3E89 A;  4FWV A;  2WA3 A;  1WPB A;  1B3Q A;  4DR4 O;  1IBK O;  1WTY A;  5JQG B;  3C8G D;  3QZC A;  3PJS K;  3D3Q A;  1HNW O;  4KI2 A;  4P9T A;  2DOS A;  3AG3 B;  3S0X A;  3CCS V;  4NYK A;  3IQC A;  4DV6 B;  1K33 A;  1I5N A;  3RYF A;  1EN5 A;  1HY5 A;  1OV9 A;  3LDC A;  2KKW A;  1WLE A;  5K0I A;  2HJM A;  3DXJ F;  3OA1 A;  4JI1 B;  3UT5 B;  2VQE B;  4LF7 B;  1JPX A;  3CCE V;  5BR8 B;  2R05 A;  5LGN A;  4D7T A;  3NKE A;  3MHS C;  3J7A U;  2Q00 A;  5CBH A;  2EIM C;  2XSE A;  3KMI A;  1BS3 A;  3ETQ A;  2BE3 A;  1BCC H;  3VQV A;  3NMJ A;  3C3T A;  1XHZ A;  4WFB V;  1WAZ A;  4B3M O;  4OIR F;  3HKK A;  2QA4 V;  3L73 H;  2B0H A;  1OQC A;  1MMN A;  2PGG A;  1BMF G;  1JMK C;  1H2G A;  1NTK H;  4OX9 O;  1EQ1 A;  4TT3 G;  4N23 A;  1U97 A;  1ENV A;  2OIE A;  3TET A;  2PUS A;  5KYW A;  2R03 A;  4PAC A;  3ZS8 C;  4X64 O;  2OEV A;  2DJV A;  4A5U B;  5LGU A;  2JJ1 G;  3FX7 A;  4FES A;  2CTW A;  3ML0 A;  1FJG B;  3U10 A;  1L8D A;  3DAG A;  1D1B A;  2IBZ H;  1PD1 A;  4I1M A;  4NTF A;  3SJA C;  3ZDL A;  3FB5 C;  4QDL A;  1IUR A;  3VYW A;  4FM0 A;  3L9D A;  2EIJ C;  2G3K A;  3HNL A;  5KA6 A;  5JUA A;  1U96 A;  1SQB H;  3LNN A;  1KMI Z;  5EIB C;  4JI5 B;  5CA1 B;  5IJ0 B;  2X51 A;  4EBJ A;  5B66 Z;  4GYC B;  2YL0 A;  4DUZ B;  2CH7 A;  2DMX A;  5FLX N;  1VQM V;  2NPU A;  4X66 B;  1QCE A;  2IM8 A;  4JV5 O;  3NDB B;  4YXW G;  2CTP A;  1VQ6 V;  3HNI A;  3NR7 A;  3WU2 Z;  1QR8 A;  4HBN A;  2Q7E A;  1NZE A;  2FYU H;  3B9Q A;  5JJE B;  2Q9C A;  2RDC A;  4GX5 A;  2GUZ A;  3AG7 A;  1YSC A;  1AR5 A;  4ZI7 B;  1ZSP A;  3NMI A;  3A0R A;  3ZC4 A;  1PV3 A;  1VQ7 V;  4DRI B;  3LS0 A;  3C8G B;  2F95 B;  1ZTE A;  1ZLZ A;  3GWO A;  4RUF A;  1N34 O;  1J5E B;  1LI5 A;  3Q7G A;  1VQP V;  3C63 A;  2O57 A;  3FHD A;  5JLI A;  2GAQ A;  5A6B A;  4D4X A;  3TD7 A;  4G78 A;  1YIJ V;  3FB7 C;  4I4T B;  1YDX A;  2KSF A;  3CE2 A;  1S72 V;  3CJH A;  3K66 A;  3T4D A;  4LF8 B;  3A9C A;  1AP6 A;  1BHA A;  3OW2 U;  2JEU A;  1Z2G A;  4DR6 B;  4EKW A;  3K6B A;  4XEK A;  1A7D A;  3ZG1 A;  4LFA B;  5LOV B;  3K5N A;  3EZH A;  2Q7R A;  2BCC H;  3H1K H;  1ZX3 A;  2Y69 C;  1ZHT A;  1EBO A;  4KHP B;  1ZYR F;  5BY1 A;  1NH2 D;  3UGP A;  2LW1 A;  4GT1 A;  2HEP A;  4U3F H;  1RKE B;  3QO8 A;  2LQG A;  1M56 B;  2EIK B;  4QGP A;  4JEB A;  4O4I A;  4MVO A;  2YEV A;  4LFB O;  2GTS A;  1W59 A;  4U5C E;  3RYC A;  2OT5 A;  3ZQV A;  1Y6X A;  2LGW A;  5EBL C;  4KNW A;  1YZB A;  1OXB A;  1XNQ O;  4AE4 A;  4NTA A;  1I7F A;  1W2W A;  3JSE O;  1NFO A;  2Q4F A;  3T4R A;  4X62 B;  1H9T A;  3L0I A;  1Q3E A;  1PL4 A;  3RN4 A;  2WLL B;  3R66 A;  1BT8 A;  3RW0 A;  5C8Y B;  2FGY A;  2IU3 A;  1YYJ A;  3T1Y O;  1N36 B;  2XS8 A;  4YY3 O;  3O65 A;  1HE1 A;  3RGB A;  4E17 A;  4F4B A;  2EX3 A;  4GQH A;  4HAM A;  2F93 B;  1Q0M A;  3MLG A;  2Y3D A;  4UV8 A;  1YAR O;  4DR7 O;  3CSX A;  4FLX A;  2ZXP A;  3L70 H;  3QO5 A;  1K05 A;  1LI7 A;  3SYN A;  4KXR A;  5B5E Z;  2OWO A;  5LBQ A;  2YIB A;  4ZLC A;  4OPH A;  1AI5 A;  4I0X B;  3EJN A;  4OD5 A;  1Y76 A;  2IJJ A;  1TVK B;  1WWP A;  1HNW B;  3V5Z A;  5KHI A;  5KHJ A;  1IBM O;  2E3C A;  5EHH A;  3GM3 A;  5DQZ A;  3ZMV A;  1VQN V;  2CK3 G;  3CRC A;  3ZX6 A;  2OJQ A;  3GB7 C;  4CS9 A;  3KYJ A;  1EM1 A;  3L8J A;  3ZTZ A;  1APC A;  2J7P D;  4K0D A;  1RSO A;  2RCV A;  3KG2 A;  1WA8 A;  3ZTM A;  2WPD G;  1AI4 A;  3E8F A;  4U7O A;  3SPI A;  3O9O A;  1FD9 A;  3CXC U;  3H01 A;  2YL1 A;  4LDQ A;  3G4S V;  4WFA V;  3SXM A;  2F22 A;  1CGM E;  3E83 A;  1UFB A;  1YXB A;  2LFS A;  4DXW A;  3KH2 A;  1RPR A;  5C93 A;  3WHN A;  4DW0 A;  1TUE B;  2XL8 A;  1GM9 A;  1SA0 A;  3I5Q A;  2ICW G;  1FPO A;  4WFE A;  4ER9 A;  5KMG B;  3K33 A;  5EYP B;  2HUJ A;  5LL6 Y;  3PHF 2;  4YL0 A;  4AX2 A;  3CS5 A;  1IBL O;  4UB6 Z;  4CH4 A;  2A6H F;  4E7S A;  3T9O A;  3HKC B;  1L0N H;  1YA9 A;  1XWJ A;  4BIU A;  4DRH B;  1K34 A;  1N33 O;  4O6N A;  1FXV A;  2L35 A;  3ICX A;  1Q81 W;  1T01 A;  2Q8V A;  3DWW A;  3RQF A;  3RYF B;  4LAC B;  4A4A A;  2EZP A;  3HKD B;  1GTO A;  2G62 A;  3MFN A;  2XL4 A;  1CEZ A;  3FFQ A;  1NU9 C;  3SP1 A;  4ICG A;  1OZ0 A;  4JI0 O;  3CEX A;  4JF3 A;  4N21 A;  2YIC A;  4UUJ C;  2I15 A;  2XS1 A;  1RPO A;  2Y3B A;  2RJZ A;  1ORJ A;  4AHC A;  1QKR A;  4U5F E;  5KYU A;  2LP7 A;  4PJL A;  3EFO A;  4KL1 A;  3EHN A;  4ZOL A;  2VWK A;  2R7O A;  5ITZ A;  5L0I A;  2QWN B;  3SNH A;  2C04 A;  3LDE A;  4IAR A;  4WGZ A;  3IGA C;  5KYY B;  1ZU5 A;  5COG A;  4UDV A;  3C3S A;  2ZCE A;  1QPU A;  4BG0 A;  4G28 B;  5A69 A;  4CJO A;  3I56 V;  4B3T B;  4BEM J;  2CNW A;  5GTI Z;  1FMV A;  3QF7 A;  4DV5 B;  4DV1 B;  2YS8 A;  4NQF A;  2XAS A;  3CPW U;  5B3S C;  5GON B;  1W0K G;  1TWA A;  2EPN A;  1Q6H A;  2GA0 A;  4W8P A;  4RWU A;  5A2Q N;  4XEF A;  1RCP A;  4BJ5 A;  3P3P A;  4U5G A;  3T1C A;  3QVN A;  4QJF B;  3FAJ A;  2XHB A;  1TGO A;  3SPG A;  3SPJ A;  3JAW A;  4MVU A;  4BW5 A;  4BPM A;  4RO2 A;  1W0J G;  2JVD A;  2YXY A;  1JX9 A;  3BAB A;  1Z5V A;  3ZCC A;  2CH7 B;  1NBB A;  1AJQ A;  1FMW A;  2JX0 A;  2QKA A;  3ZHQ A;  3B2E E;  1O9G A;  3ZMS A;  1JAF A;  2XOK G;  2GHY A;  2JPU A;  5JQG A;  4U9E A;  1M57 C;  5LXT A;  5IYB O;  2N74 A;  1M5I A;  1H2M A;  4N06 A;  2Q69 A;  5HV9 A;  3PMR A;  5D5P A;  3CC7 V;  2DYR C;  2GUZ B;  4WBN A;  2IXO A;  2AP3 A;  1KTM A;  2UXB B;  2DYR B;  2UXN A;  3ZRX A;  1WNS A;  4QNH B;  4U5D E;  3ZJZ A;  3OTO O;  3CEI A;  2D3O W;  3JYY A;  2CCY A;  4NB5 A;  2Q9A A;  1GKF A;  5AGF A;  1G6U A;  3CD6 V;  1H2K A;  4JIO A;  4OIO F;  5IT9 N;  2Y3H A;  1TUB A;  4OXS A;  2XAH A;  2YI8 A;  2WZF A;  2R9R B;  1WP8 A;  3CJH B;  3T6G B;  4JYY A;  4C3D A;  3S3X A;  4AL1 A;  3G50 A;  4UCV A;  4G0H A;  3X1O A;  1K4C C;  1EN6 A;  3WB0 A;  2OCH A;  1FFH A;  4HYO A;  1P7G A;  3IHU A;  4Q6G A;  3OMN B;  4OIN F;  2FAP B;  1HNZ O;  4DR7 B;  1FR0 A;  1SQF A;  5A6K A;  3JRT A;  3Q6M A;  3GWN A;  5IWA B;  1MMD A;  4DOZ A;  5E3C A;  1VOM A;  5E79 Z;  4CS8 A;  2EPK X;  5J2U B;  5CN0 A;  3GEH A;  3JSZ A;  2JEX A;  1K5S A;  4DV7 B;  3R65 A;  4XBF A;  1YJN V;  5JCO A;  3DJN B;  3L72 H;  4X9Q A;  1DF4 A;  5JH7 A;  4DV6 O;  1S5J A;  2B1G A;  3OGI B;  2NN4 A;  2HMZ A;  5H9C A;  1AVM A;  2JJ2 G;  2YC0 A;  1I5Y A;  2WLJ A;  1KBH A;  4CC5 A;  3RYC B;  2PX0 A;  1S3J A;  3W7U A;  4JI1 O;  2VQE O;  4LF7 O;  4IWB A;  2YZS A;  3ETD A;  4UB8 Z;  1SER A;  5LHH A;  1WJZ A;  4JTA B;  2A68 F;  4NY3 A;  3E8H A;  1HWY A;  5J9P C;  4N6C A;  5DLJ A;  3EGX A;  3K5O A;  5BQG A;  3W7W A;  2XM4 A;  3AEI A;  2LFF A;  1N0N A;  4Z9J A;  4O6Y A;  4UCS A;  4ZI7 A;  3MX3 A;  1H6G A;  4O7G A;  1R6K A;  3ITF A;  5L0F A;  2ZXO A;  4P30 A;  4C7O B;  3C8G A;  2L7A A;  2G38 A;  4O4J B;  1PCX A;  1G5Z A;  2R7X A;  4YJW A;  2Q6A A;  2YHS A;  1MA1 A;  5JRA A;  3DD7 A;  1C03 A;  2XAQ A;  2LIG A;  2DYS C;  1VQ9 V;  1F4N A;  1OKK A;  2WLI A;  2HV6 A;  1R3K C;  4HNA A;  1IBL B;  4B3R B;  3ZN1 A;  3OE7 G;  4I4T A;  5KX5 A;  4NTB A;  1TFO B;  4D6T H;  1Y76 B;  3F7Y C;  1T6I A;  2EPM X;  4RQE A;  4P6I C;  3ABL B;  1GM7 A;  4J11 A;  1VLS A;  2R9A A;  4IB4 A;  3HNK A;  1YEW A;  4K35 A;  5A6A A;  1PP9 H;  3IFX A;  5LP6 A;  2Z15 A;  4IGG A;  2VRZ A;  4CS9 C;  2A9H A;  2QWR B;  4JI5 O;  3AJM A;  5JVD A;  3CCV V;  4CS4 A;  3G67 A;  4CS3 A;  1SQQ H;  5LOV A;  2R7W A;  4DUZ O;  5E33 A;  2CGE A;  2XND G;  2CGN A;  2JRI A;  5EZY A;  2ETN A;  4X66 O;  1OJH A;  5IJ9 B;  2XLH A;  1QLE C;  4JI0 B;  1M4U A;  3L71 H;  1RSO B;  2WLH A;  1ZHY A;  2CTR A;  4DR3 O;  3CME V;  3A0B Z;  2P06 A;  1RKE A;  2NSG A;  3C7J A;  3AQB A;  2H8P C;  3CRR A;  3BRC A;  4XDJ A;  2GDS A;  1SYQ A;  3S9O A;  1QSP A;  2IOQ A;  1SA0 B;  2HKO A;  4JJG A;  2QM8 A;  3Q4H A;  4R8C A;  3VOU A;  3SZR A;  4LFC B;  1U89 A;  3K1H A;  4RBN A;  3FD9 A;  4FJC C;  4TV9 A;  1SS3 A;  3K59 A;  5COF A;  3ETE A;  5C8Y A;  3C90 A;  3CZ6 A;  1XZP A;  3VAY A;  2HZ8 A;  3KPH A;  1ORQ C;  5BMV B;  4CDY A;  2W9Y A;  4FLU A;  3JCU Q;  4LF8 O;  2QSA A;  2A7W A;  3T2M A;  1FYJ A;  5KUK A;  4DR6 O;  2DE0 X;  3IC7 A;  2DI3 A;  2IBF A;  1UJW B;  3LAY A;  3JD4 A;  3ASO C;  3EFF K;  2UUA B;  3IQ5 A;  1YTF D;  3EZI A;  4M63 A;  4JGS A;  1AP5 A;  2R9I A;  1TR2 A;  4KFM A;  1OCC C;  5L0C A;  4DK1 A;  4FLY A;  2QEX V;  2RQ6 A;  4IT5 A;  4JRZ A;  4LP8 A;  4KHP O;  1ZW3 A;  1GH6 A;  4O79 A;  1RMV A;  3CAX A;  5T3W A;  3IEE A;  1N8R W;  2AU5 A;  4ANJ A;  5KYU B;  3W4Y A;  3W2W A;  1CXZ B;  1TVK A;  1OR3 A;  3W2V A;  1US6 A;  1K97 A;  1I94 O;  2XLM A;  1VQL V;  4RUE A;  5HSW A;  3I55 V;  1SZT A;  4CJG A;  4I9W A;  4EFB A;  3OTO B;  5CI9 A;  1OCR B;  3E22 A;  4F6R A;  4UCR A;  1HW1 A;  4DJ9 A;  2M7W A;  1PNL A;  4FLW A;  2OJE D;  5JP7 A;  2F4V B;  4GYT A;  4X62 O;  5JS5 A;  4EBK A;  2BOC C;  4O4L A;  1P84 F;  3O55 A;  4NTW A;  4Z1V A;  5KAF Z;  1RP3 B;  2D2C B;  5JJN B;  1N36 O;  3SJC C;  4BJ5 C;  4JYC A;  3QW0 A;  4J7Y A;  3LES A;  4P9P A;  3UO3 A;  2Y4T A;  1MAB G;  3L1M A;  1JCH A;  2XLO A;  4MVM A;  3SJQ C;  1QQ3 A;  2P90 A;  2B9Z A;  1HNZ B;  2V3C C;  2NNU A;  1H2L A;  2CGO A;  1OHH G;  5KMG A;  3S29 A;  4DVY P;  5EYP A;  3M8A A;  5B1B B;  3I5D A;  3DE9 A;  3W7X A;  3TUL A;  1QLN A;  3SXK A;  5JVE A;  2Q3T A;  1VQK V;  4I44 A;  1ZWI C;  1VB5 A;  3FB6 C;  3HKC A;  5LXT B;  1JR9 A;  3H1I H;  3FMS A;  3AG3 C;  3CRA A;  1ZW2 A;  2ZQM A;  4YT8 A;  3T1H B;  4WBN B;  1D0Y A;  1V54 B;  1JMW A;  3LEO A;  3SXY A;  3JCZ A;  3HKD A;  4FM2 A;  2DWD C;  2FFH A;  1Q90 D;  2HVK C;  4AQY B;  1NVP B;  1QQC A;  1YA7 O;  1I4Y A;  2JS5 A;  5KA5 A;  3G4Z A;  2Z3Y A;  1YVI A;  3FOO A;  5BXZ A;  4J7K A;  4QPK A;  2Z5U A;  4H33 A;  4PI2 A;  1TUB B;  3SYO A;  1PPJ H;  1DOV A;  2UUH A;  3U0Z A;  1YTF B;  2OG2 A;  1WPX A;  2Q9B A;  5L0J A;  4I9Q A;  4DR2 O;  4W8K A;  1XEQ A;  4KP4 A;  5GW7 A;  3CRQ A;  4NXN O;  3LEV A;  1HNX B;  3L8I A;  5KYY A;  3U3F A;  4BR6 A;  1CPR A;  2A3Q A;  4CS8 C;  4MVR A;  3CWB H;  1S76 D;  4X8A A;  1AI7 A;  5DEC A;  1BQ0 A;  5GON A;  5JCO C;  1D1A A;  1NU7 D;  2B5U A;  4MW3 A;  4J7Z A;  4P9O A;  2J7P A;  1MND A;  5JH7 B;  3APO A;  2L6H A;  2LGQ A;  1AEP A;  3R2P A;  1T9K A;  2J46 A;  4B6I A;  1GMG A;  1N1C A;  3S3W A;  4I7Z B;  3RFY A;  4QI0 A;  4TWK A;  2Q73 A;  5B1O A;  3KL4 A;  3C62 A;  1NR7 A;  5AG2 A;  1IX9 A;  4NC3 A;  1M2O A;  3UKM A;  4ZIB A;  1SC5 B;  2HJF C;  3EGX B;  1YJG A;  5BQH A;  4DR3 B;  1LIH A;  5L0G A;  3JAS B;  3W8H A;  2HS5 A;  1Z5W A;  5J2T B;  1L3P A;  4MW8 A;  1WB7 A;  1OCZ B;  5CA3 A;  1VK5 A;  3VRC A;  2V26 A;  1BHB A;  1TQG A;  1V4A A;  4W4L A;  1SF8 A;  2PBE A;  3JAK B;  2YUA A;  2PTM A;  1EA8 A;  4JI6 O;  1L0L H;  4B3T O;  1NLX A;  4DV0 B;  1U6H A;  4FLZ A;  2CDQ A;  1KU9 A;  3STL C;  3J81 N;  4QIW F;  3E9V A;  3LDD A;  1CPQ A;  1Q0G A;  4GEH A;  4PJJ A;  3K0G A;  2WLI B;  4DV1 O;  4DV5 O;  4HNA B;  2H3O A;  5KX5 B;  2W45 A;  2VCA A;  4K7B A;  3M79 A;  2VQF O;  2ZM6 B;  3E70 C;  3A11 A;  4NCQ A;  5LP6 C;  3OUS A;  2ZXR A;  4JKV A;  5IYZ B;  4PJN A;  5LP6 B;  2E5L B;  3JD2 A;  2QTO A;  4YHH B;  4J80 A;  4LF9 B;  1AR1 B;  4PI0 A;  2L9J A;  5JVD B;  4LH6 A;  3SXZ A;  5T3T A;  1G8X A;  2RD9 A;  2GBO A;  2XLD A;  2P67 A;  3S90 A;  1WAT A;  2A6E F;  2KQX A;  1AIL A;  3OFN G;  5EZY B;  3JT1 A;  3BRJ A;  2KNH A;  1GM8 A;  4Z1M G;  5J2U A;  4G2K A;  5FL7 G;  3T6B A;  3UO2 A;  2TMV P;  4YL1 A;  3CC4 V;  2X6C A;  3AG2 B;  4XDK A;  1G4W R;  3ZRW B;  2ZNJ A;  4LBE C;  1P4R A;  4JAA A;  3UCS C;  1M56 C;  2EIK C;  1XUQ A;  4I55 B;  3QO7 A;  3W7T A;  1I94 B;  2QLA A;  3JAM N;  3AK2 A;  3M7M X;  3UM7 A;  2IXP A;  1MZE A;  2YXL A;  2I8B A;  1SQV H;  2UXB O;  2PP4 A;  2LJ2 A;  3B77 A;  3ABK C;  4ZBM A;  4HE8 D;  3RQE A;  3Q4H B;  1WAS A;  3ABK B;  4U5E E;  2CDY A;  3L74 H;  3TJ5 A;  1TWG A;  2QJ1 A;  3JAR B;  5A6J A;  2J0W A;  4TV9 B;  3U5S A;  1A0B A;  2JIZ G;  3RYI B;  5BUO A;  1ZHW A;  1T5O A;  4PJ0 Z;  1LS1 A;  3EH2 A;  1BDJ B;  3RH3 A;  4E0H A;  3EG9 B;  4WF9 V;  4WCE V;  2CTQ A;  2VH3 A;  4C7O A;  1KP3 A;  4O4J A;  4IYH A;  4RQF A;  2NUP B;  2X0L A;  5IWA O;  4E18 A;  2HHH B;  3M1C B;  4X89 A;  2AW9 A;  1V55 B;  3TJ6 A;  3HKB B;  1A32 A;  2HG5 C;  3CX5 F;  5L0D A;  4PFO A;  2R7T A;  1YHQ V;  3Q6N A;  3NXS A;  2WVQ A;  2XM0 A;  3L34 A;  4DV7 O;  2GTA A;  4YJ2 A;  3WAQ A;  3RVY A;  3RYH A;  2ADP A;  3V5X A;  4BJT A;  2XRH A;  5LGT A;  3FYI B;  4JCH A;  2WZG A;  1C02 A;  2N05 A;  4MVQ A;  5E2Q A;  1M90 W;  3LLK A;  3LSU A;  2ADQ B;  3UGO A;  3E22 B;  1XI1 A;  4F6R B;  5L3C A;  2PY5 A;  5DS4 A;  3AQC A;  3FKS G;  5IJ9 A;  2DN9 A;  5B1N A;  1AI6 A;  4WJ0 A;  2J9W A;  2HP8 A;  5CI8 A;  4X65 B;  4O4L B;  1MQV A;  1I5X A;  1IW7 F;  3MD0 A;  2XTA A;  4OIQ F;  1YJW V;  3CCQ V;  4DR2 B;  2QE7 G;  4LCU C;  3UNG C;  1FKA O;  3D8C A;  3JD3 A;  5L3D A;  1NG1 A;  1NJI W;  4NXN B;  3V7O A;  2VCC A;  4PV1 B;  4GKJ B;  1NH2 B;  2BC5 A;  4OIP F;  2YWA A;  4H54 A;  3LNR A;  4KBL A;  2Y4U A;  2NR5 A;  5DVW A;  3JAL B;  4DYL A;  3U11 A;  4K1O A;  2WZL A;  3BA8 A;  3STZ C;  4H4K C;  2LO1 A;  4B3R O;  4JPR A;  4O2B B;  1GN3 A;  4ASU G;  2B1I A;  4PA7 A;  5BMV A;  2PNO A;  4LLC A;  3BFR A;  1PD3 A;  3KKY A;  4P2Z A;  1VQ8 V;  1S7Z A;  3U8P A;  2J45 A;  3O39 A;  1B6Q A;  2UXD B;  3RFR A;  4AK9 A;  1H38 A;  3K08 A;  2EIL C;  4GUN A;  5EGY A;  1BSM A;  5IE9 A;  2A69 F;  3GM2 A;  4X20 B;  3JZ0 A;  2EIL B;  2P22 C;  2QY9 A;  4X1I B;  1VYK A;  3R7C A;  1J8M F;  1ST6 A;  1GN6 A;  2M4E A;  5A6B D;  2ODM A;  5CBF A;  4O6M A;  5L3G A;  1AB3 A;  4PD4 F;  1FAF A;  1NSG B;  4X0R A;  1O87 A;  4N6H A;  5CA0 B;  4NXM O;  4UV9 A;  3OEE G;  2HLD G;  4LFC O;  4JI6 B;  3AK1 A;  4DO2 A;  3ZMT A;  3US6 A;  3K3W A;  4DR1 B;  5JJJ B;  4DBQ A;  4XLP F;  4OGQ B;  4QE9 A;  1F51 A;  3ABT A;  2Q68 A;  3JSL A;  1FNT c;  2QKC A;  4G7Z F;  4Q7C A;  4JI7 O;  3AOU A;  2VQF B;  1Q5O A;  1Z6A A;  4KC9 A;  1J95 A;  2M64 A;  1NR1 A;  4YN0 B;  4EFE A;  1LVK A;  2BE5 F;  1Y66 A;  5DN6 G;  3ZRV A;  4ZHQ B;  4IHJ A;  2IM9 A;  3BEH A;  2UUA O;  1PKX A;  2P61 A;  3CRM A;  1LNQ A;  5F5H A;  3U2M A;  4CH5 A;  2HMQ A;  2RMK B;  1NQT A;  4CIH A;  5JT4 A;  2X6B A;  4UCT A;  5LA6 A;  3P32 A;  3DXR A;  1SZI A;  1WN0 A;  4JI3 B;  4I1O B;  4XPY A;  2QNL A;  4WFG A;  3GOR A;  3AG4 B;  1E86 A;  4R7C A;  2EPO A;  2P7V A;  2YL7 A;  4MS2 A;  2E76 B;  4BAY A;  2KGO A;  1Q8I A;  3J80 N;  1JJO A;  4WFH A;  1SF9 A;  2PYL A;  2Y0I A;  4RD9 A;  1FXK A;  2BOB C;  1K3E A;  2UUC O;  5L3F A;  3S28 A;  3A8T A;  4TQF A;  2WVN A;  2F4V O;  3HR0 A;  1N32 B;  5L3Q A;  5EC2 C;  1Q0F A;  4CIP A;  1Z63 A;  5LMN B;  1WOL A;  3DE8 A;  4NR1 A;  3ZN0 A;  2YLG A;  4NTY A;  4YWQ A;  3K57 A;  3NG1 A;  1JPJ A;  2YIB D;  3GVM A;  5KHK A;  3Q7L A;  2W4B A;  3U2L A;  4R6Z A;  1FFX B;  4JI8 B;  3AGT A;  2OEX A;  3K1I A;  2NLJ C;  3JYH A;  3ZHU A;  2Q4P A;  1MOF A;  2K9P A;  4JI2 O;  4B7K A;  3VQW A;  4TQD A;  1PL0 A;  4U3J B;  3LSS A;  1TFK B;  2JGD A;  1JPN A;  4IAO A;  1QU7 A;  4EIY A;  4EB6 B;  1DGS A;  2A79 B;  4CC6 A;  3ZIA G;  3T1H O;  2CYD A;  4K0K B;  4GX2 A;  5E3A A;  1PV0 A;  5BZB A;  1O3U A;  2GFH A;  3BY6 A;  1Y67 A;  4AQY O;  3HNJ A;  3MYF A;  1XOU A;  4DRX B;  2ZE7 A;  5DS5 A;  5HFM A;  3EQL F;  1VAR A;  4R50 A;  2R7S A;  1M2V B;  1K73 W;  3N2G B;  5LYJ A;  1YZA A;  1NZ6 A;  4TV8 B;  2ZIO A;  1TWH A;  3D36 A;  1KU2 A;  4IRU A;  4U9D A;  3ZWI A;  5B3I A;  3ASN C;  3E8G A;  1TKN A;  3ECS A;  3WB2 A;  3FB8 C;  4H0L B;  4Z9I A;  3ASN B;  4JYA B;  1XZQ A;  2GV9 A;  3JAS A;  2NUT B;  2LFR A;  5J2T A;  2F43 G;  2BTO A;  4XPX A;  1WB8 A;  4OD4 A;  1DLB A;  1HNX O;  2FML A;  3CCJ V;  1NS1 A;  1D2D A;  1RM1 C;  1F1M A;  3JAK A;  1V9P A;  1OCO C;  2K1E A;  3IJ4 A;  4YJ3 A;  3FAP B;  1RM1 B;  1Q86 W;  1OCO B;  5IDJ A;  1YIT V;  1VF6 A;  2Q0O C;  1JRA A;  2H7B A;  1E1Q G;  3ABL C;  1BQZ A;  4D4N A;  4G27 B;  2AXT Z;  2YQY A;  4YJ2 B;  4EBB A;  1AVO B;  1K8A W;  3RYH B;  3EXA A;  3LLI A;  1YDI A;  3B09 A;  5LHG A;  1VF5 B;  4DVZ A;  3M4B A;  2M6Y A;  1QBZ A;  5IYZ A;  1E2X A;  2JK5 C;  3ZMU A;  5KYN A;  2J9V A;  1SR2 A;  4UVB A;  1QVG U;  4FPP A;  4YT5 A;  1VTM P;  4FM1 A;  3DAF A;  3O6X A;  5BQI A;  3F47 A;  1CP9 A;  2OTL V;  1I0H A;  4AI8 A;  3LSQ A;  3T6J A;  1MMA A;  2E74 B;  1BR2 A;  1VP7 A;  2LW7 A;  2IXN A;  2HFI A;  3QNE A;  4BW9 A;  3RWR D;  4L87 A;  4FLV A;  3ZRW A;  4FLT A;  3CC2 V;  1H2N A;  4I55 A;  4HFK B;  1UG7 A;  4EHP A;  1KQS U;  4YIO A;  1MMG A;  3I4U A;  4PK4 A;  3ZVR A;  1MNG A;  1KP2 A;  1JA8 A;  4DUY B;  1HR0 B;  4NXM B;  3NYL A;  4U5B E;  1T6U A;  4NTX A;  3SR2 C;  2XT9 A;  3EGD B;  3IQ6 A;  4DV0 O;  2RNB A;  3HPL C;  1XL4 A;  2Y0P A;  1A7V A;  3JAR A;  4I50 A;  1HE9 A;  3AK3 A;  5H6R A;  1XMO B;  4UCO A;  3RYI A;  3CCU V;  2UUI A;  3F46 A;  4JI7 B;  2ZM6 O;  3H65 A;  2ITD C;  3OGC C;  3B0V C;  3BAA A;  2GDC A;  3B8N A;  4ABM A;  3UQ8 A;  3RF3 A;  3EG9 A;  5AC5 A;  2E5L O;  4YHH O;  4LF9 O;  3SJB C;  5KHH A;  4GKK B;  4Q4Z F;  4JW1 A;  5DQT A;  1VMG A;  3RYL A;  4JVS A;  3VQY A;  2NUP A;  1SQP H;  3H2U A;  3WG7 C;  1R6T A;  5CBG A;  3SPH A;  2EIN B;  1M9N A;  3HKB A;  4FVM A;  3WG7 B;  2YXH A;  3KZI Z;  3ZHV A;  1QVF U;  1S5L Z;  2P6V A;  3OTF A;  1ORS C;  2RSE B;  4PA4 A;  2XAJ A;  3X2Q C;  1R3J C;  2YLD A;  4TOI A;  4FK5 C;  1H9G A;  2Q67 A;  3X2Q B;  2ZNI A;  1X59 A;  3ZHR A;  3H2V A;  1MSD A;  1SQX H;  1P7B A;  1OXK A;  1KUQ A;  4FZ1 A;  1OCR C;  3ZQY A;  2UUC B;  2VAS A;  2EBO A;  3S84 A;  4BIZ A;  3S27 A;  2WL8 A;  3TJT A;  1HMO A;  4G7H F;  1FS0 G;  1KC8 W;  5K1X A;  2HJ3 A;  1X4T A;  4CSA A;  3TXQ A;  1GQA A;  1OR2 A;  4AIL C;  3DGE A;  3B71 A;  1Y6D A;  1JOY A;  1SQG A;  4GCZ A;  4LF4 B;  3O10 A;  4QI2 A;  4J32 B;  3DM5 A;  4XTK A;  4DK0 A;  4IHJ B;  2VWJ A;  1SES A;  1AJN A;  5B1B C;  1IDS A;  3APQ A;  3CQZ A;  3TCU A;  3TOL A;  2HHH O;  3JAL A;  2ATK C;  1VIB A;  3SPC A;  4JI2 B;  4F6E A;  2YRF A;  3OEH G;  1B68 A;  2QTV A;  4JI4 B;  5LA6 B;  3DXR B;  3K03 A;  4XDL A;  1BR1 A;  3K7D A;  1DK1 A;  5L3V A;  4O2B A;  5EIB D;  1L1F A;  3C18 A;  3H1H H;  2BTQ A;  3JTL O;  1COW G;  1V54 C;  1Q43 A;  3SDL A;  1B06 A;  4MTF A;  3NMK A;  4EWC A;  1KD1 W;  2BL2 A;  1RFY A;  2Y39 A;  1ZUQ A;  1Y74 B;  2OQM A;  1XNR B;  2ZPA A;  5L0H A;  1G4U S;  2EJR A;  3TQO A;  2UU9 B;  1FTS A;  1CPY A;  1XRE A;  1LUW A;  1SET A;  1R73 A;  3OD4 A;  4X20 A;  4X65 O;  2YID A;  5KUM A;  1R4T A;  2D5R B;  1OW8 A;  3JAT A;  3QW1 A;  2F66 C;  4OPA A;  5L3E A;  4X1I A;  2UXC B;  2PYJ A;  4LF6 B;  1I08 A;  5JWP A;  4DV4 B;  3LUT B;  3HB3 B;  1OKK D;  2KG7 A;  4P9F A;  3B29 A;  2JD3 A;  2BSK A;  3CHX A;  3QMK A;  3K1I C;  1A41 A;  5CA0 A;  2DQ0 A;  4H44 B;  4J7J A;  4GKJ O;  4ULV A;  5GPG B;  1MG1 A;  4DR5 B;  2MHR A;  4IAQ A;  3CP1 A;  3FYE B;  4C3B A;  5HFL A;  4Q20 A;  4UVC A; 
#chains in the Genus database with same CATH homology
 4MTX A;  3LNM B;  2KQ9 A;  4LLE A;  1VYI A;  4PDV A;  2EIM B;  1Z23 A;  5B1A C;  1GO3 F;  5B1A B;  3JYC A;  2IU0 A;  5LHI A;  3OMI B;  3UMI A;  1Q82 W;  1WGW A;  1JJ2 U;  5EBM C;  4PEL A;  3E86 A;  1S5H C;  2W0F C;  3E8B A;  4WFF A;  2WLK A;  1THZ A;  3K9A A;  1YI2 V;  1OCZ C;  2EIJ B;  3HTK C;  4F4L A;  3ZSU A;  2J9U A;  3D3I A;  2W6I G;  3RKO F;  4Q5S F;  2IXM A;  4JTD B;  1D0Z A;  3JD1 A;  1PNM A;  2HR3 A;  2Y3G A;  1G8M A;  2DQ3 A;  2AHZ A;  3P30 A;  3NKD A;  2IJK A;  1ARO P;  3ABM C;  4JAS A;  2P6J A;  3ZMZ A;  3N24 A;  3MHH C;  3ABM B;  2WLN A;  5CMU A;  1VMA A;  4MQ9 F;  5IYD O;  2PI4 A;  3OMA B;  3LS1 A;  3E2E A;  2X7R B;  4TSF G;  3DJU B;  1VQO V;  3AG2 C;  4PA6 A;  3DMD A;  1Z3I X;  4RDA A;  3VBB A;  4KUM A;  4U7N A;  4CBC A;  3G6E V;  3CYO A;  3UMK A;  2MYS A;  2HVJ C;  3E35 A;  1RJ9 A;  3UMH A;  3SYA A;  1GK9 A;  2Y69 B;  2KW3 C;  1M2V A;  5KYX B;  4UVA A;  3WOD F;  1K92 A;  3DZA A;  3SEO A;  1G4Y B;  2W4M A;  1BR4 A;  2NUT A;  3EHM A;  3HJC A;  3K04 A;  2X6A A;  3B8M A;  4XLN F;  2MK3 A;  2W6J G;  3CMA V;  1V55 C;  3DM9 B;  2MWQ A;  3NRH A;  1R3L C;  1FXH A;  4MSW C;  1M1K W;  1H8E G;  1PD0 A;  1SRY A;  3OUF A;  3JD0 A;  1VQ5 V;  4XWJ A;  4C3E A;  2V1D A;  3TK1 A;  3K06 A;  2V7Q G;  4X88 A;  4YT2 A;  2EZO A;  3RIP A;  2R7U A;  4JJF A;  4CSA C;  4JZA A;  2WWW A;  3UR3 C;  4FIP C;  4KNV A;  4E7Z A;  2L81 A;  3EGD A;  2H7O A;  2HFE C;  3OEO A;  3N0T A;  1EZJ A;  3SYP A;  2VB6 A;  2JDI G;  1Z5Z A;  4PDL A;  4CBE A;  3F7V C;  2CW0 F;  4MTG A;  3POV A;  4QE7 A;  1S0V A;  1Y4M A;  1VQ4 V;  1EFR G;  4YT4 A;  4JAV A;  4G7O F;  3KKB A;  2ZXW C;  4MTO A;  2ZXW B;  1O5H A;  1FXK C;  2G3V A;  2ITC C;  1FXK B;  2PI5 A;  4FX5 A;  2ZD9 A;  3HLZ A;  2WB7 A;  5D91 A;  4BJ6 A;  4I5S A;  2WAM A;  1Q7Y W;  4ULW A;  3WFV A;  2LSE A;  5DS6 A;  5KYW B;  4U5H A;  1H8H G;  2A0L A;  2R7Q A;  3OR7 C;  2C03 A;  4LC1 A;  3AG4 C;  5B3S B;  1IXM A;  3OWT A;  4J9Y B;  3W8I A;  2XXA A;  2ZDI A;  1W2B U;  4A2N B;  1NBM G;  3FVY A;  1DF5 A;  3I5P A;  4UXN A;  2QM7 A;  1QR9 A;  1F23 A;  2OTJ V;  1M57 B;  4E2L A;  2E87 A;  4J30 B;  2DGJ A;  3ZIB A;  2QKS A;  1ZHZ A;  3GAN A;  4MVZ A;  4PA3 A;  3SYC A;  5EBW C;  3W7S A;  3G71 V;  1D1C A;  4LER A;  3CCM V;  1MNE A;  4PJM A;  3NYM A;  4JTC B;  4RAI A;  3GOD A;  2ZR3 A;  5H6Q A;  1KEC A;  3K0D A;  1E1R G;  4HFF B;  3K79 A;  1LKX A;  3CCR V;  1RJ9 B;  2HV7 A;  1ZHX A;  4PDM A;  2H94 A;  1ROP A;  2OCC C;  5DM6 V;  1QZX A;  4J9Z B;  2OCC B;  4JAU A;  2YEV B;  3M99 B;  4JYB A;  3LJB A;  2YSU B;  1K7D A;  4AE4 B;  3FDQ A;  2PFD A;  1J8Y F;  3AG1 C;  1PNK A;  4MVS A;  1SMY F;  4ZLD A;  3NYJ A;  3ZRS A;  3AG1 B;  1K9M W;  4JUR I;  2XAG A;  3DTU B;  5L3B A;  5EK0 A;  2DWE C;  2P7T C;  3T4Z A;  5D92 A;  4MT8 A;  1IZM A;  4PA9 A;  3CCL V;  1F4M A;  2R7R A;  1JVM A;  4CZZ A;  4PDR A;  2DYS B;  1DTO A;  5FCL A;  3RVZ A;  2WSS G;  2IW5 A;  3B0U X;  2CNW D;  4GX1 A;  2WVO A;  2AHY A;  1K5Q A;  1AJP A;  1TWC A;  1KKD A;  1BL8 A;  1XL6 A;  4ZKI A;  3OM3 B;  4QPJ A;  4PFP A;  1QLE B;  2XAF A;  5KYX A;  5T1D B;  2DW4 A;  4BEJ A;  4HEA J;  5F5F A;  2IJI A;  2R7V A;  2KJG A;  5EC1 C;  2IH1 C;  2Y48 A;  4DBR A;  1K4D C;  2IYL D;  4BJ1 A;  4FMT A;  2EIN C;  3OR6 C;  1E79 G;  3ABU A;  2WLL A;  2IJH A;  1NVP D;  3OAA G;  5E1A C;  4HZ3 A;  2GSM B;  2NG1 A;  3ASO B;  4I3M A;  4IJJ A;  3F5W C;  3EHB B;  1OCC B;  3RBZ A;  3CSK A;  2PX3 A;  1MSW D;  1S77 D;  3EFO B;  1D0X A;  4BJ6 C;  3EPV A;  3EH1 A;  2KB1 A;  1JQ0 A;  2J0X A;  2ZR2 A;  1FFT C;  4GX0 A;  3ETG A;  4H37 A;  1FFT B;  5IY5 C;  1NKD A;  2C2A A;  5IY5 B;  1R3I C;  1YJ9 V;  2H7V C;  2WLM A;  2PF4 E;  1ZU4 A;  4CS7 A;  2XXA B;  2UXX A;  2A1D D;  2ZDI C;  3B0P A;  5IYC O;  4MND A;  2IH3 C;  2B0J A;  2FTK A;  3SYQ A;  1R6N A;  2O9X A;  3E89 A;  4FWV A;  3QZC A;  3PJS K;  4KI2 A;  3S0X A;  3AG3 B;  3CCS V;  1K33 A;  3LDC A;  1WLE A;  3DXJ F;  3OA1 A;  1JPX A;  3CCE V;  5LGN A;  3NKE A;  3MHS C;  5CBH A;  2EIM C;  2XSE A;  3KMI A;  4WFB V;  4OIR F;  2QA4 V;  1MMN A;  1BMF G;  1H2G A;  4TT3 G;  4N23 A;  1ENV A;  3TET A;  5KYW A;  5LGU A;  2JJ1 G;  4FES A;  3ML0 A;  3DAG A;  1D1B A;  1PD1 A;  4I1M A;  3FB5 C;  4QDL A;  3VYW A;  2EIJ C;  2G3K A;  5KA6 A;  2X51 A;  1VQM V;  1QCE A;  3NDB B;  4YXW G;  1VQ6 V;  1QR8 A;  1NZE A;  3B9Q A;  2Q9C A;  4GX5 A;  1YSC A;  3A0R A;  3ZC4 A;  1VQ7 V;  3LS0 A;  3GWO A;  4RUF A;  3Q7G A;  1VQP V;  3FHD A;  3TD7 A;  1YIJ V;  3FB7 C;  1S72 V;  3K66 A;  3T4D A;  1BHA A;  3OW2 U;  2JEU A;  4EKW A;  3K6B A;  3ZG1 A;  3EZH A;  2Y69 C;  1ZHT A;  1EBO A;  1ZYR F;  1NH2 D;  3UGP A;  4GT1 A;  3QO8 A;  1M56 B;  2EIK B;  4MVO A;  2YEV A;  4U5C E;  2OT5 A;  5EBL C;  4KNW A;  4AE4 A;  1W2W A;  3T4R A;  3L0I A;  2WLL B;  3RW0 A;  2FGY A;  2IU3 A;  4F4B A;  4HAM A;  3MLG A;  2Y3D A;  4UV8 A;  2ZXP A;  3QO5 A;  3SYN A;  5LBQ A;  4ZLC A;  1AI5 A;  3EJN A;  4OD5 A;  2IJJ A;  5EHH A;  5DQZ A;  3ZMV A;  1VQN V;  2CK3 G;  3GB7 C;  4CS9 A;  2J7P D;  4K0D A;  3KG2 A;  2WPD G;  1AI4 A;  3E8F A;  4U7O A;  3SPI A;  3CXC U;  3H01 A;  3G4S V;  4WFA V;  3E83 A;  2LFS A;  4DXW A;  3KH2 A;  1RPR A;  5C93 A;  1TUE B;  1GM9 A;  3I5Q A;  4WFE A;  3K33 A;  3PHF 2;  4AX2 A;  2A6H F;  4E7S A;  4BIU A;  1K34 A;  4O6N A;  1FXV A;  1Q81 W;  4LAC B;  2EZP A;  1GTO A;  2G62 A;  2XL4 A;  1CEZ A;  1NU9 C;  3SP1 A;  1OZ0 A;  4JF3 A;  4N21 A;  4UUJ C;  1RPO A;  2Y3B A;  5KYU A;  4U5F E;  2LP7 A;  4PJL A;  3EFO A;  3EHN A;  2R7O A;  3SNH A;  2C04 A;  3LDE A;  3IGA C;  5KYY B;  1ZU5 A;  4BG0 A;  4G28 B;  3I56 V;  2CNW A;  1FMV A;  2XAS A;  3CPW U;  5B3S C;  1W0K G;  1TWA A;  4BJ5 A;  4U5G A;  3T1C A;  4QJF B;  3FAJ A;  4BW5 A;  3SPG A;  3SPJ A;  4MVU A;  4RO2 A;  1W0J G;  1JX9 A;  3ZCC A;  1AJQ A;  1FMW A;  3ZMS A;  2XOK G;  2GHY A;  1M57 C;  5IYB O;  4N06 A;  2Q69 A;  3PMR A;  3CC7 V;  2DYR C;  2IXO A;  2DYR B;  2UXN A;  3ZRX A;  4QNH B;  4U5D E;  3ZJZ A;  2D3O W;  2Q9A A;  1GKF A;  3CD6 V;  4OIO F;  2Y3H A;  4OXS A;  2XAH A;  2WZF A;  2R9R B;  4C3D A;  4G0H A;  3X1O A;  1K4C C;  1FFH A;  4HYO A;  3OMN B;  4OIN F;  3JRT A;  3Q6M A;  1MMD A;  4DOZ A;  5E3C A;  1VOM A;  4CS8 A;  5CN0 A;  3JSZ A;  2JEX A;  1K5S A;  3R65 A;  4XBF A;  1YJN V;  3DJN B;  1DF4 A;  2B1G A;  5H9C A;  2JJ2 G;  1I5Y A;  2WLJ A;  2PX0 A;  1S3J A;  3W7U A;  4IWB A;  2YZS A;  3ETD A;  1SER A;  5LHH A;  4JTA B;  2A68 F;  4NY3 A;  3E8H A;  1HWY A;  5J9P C;  5DLJ A;  3EGX A;  3W7W A;  3AEI A;  4O6Y A;  3MX3 A;  4O7G A;  1R6K A;  3ITF A;  2ZXO A;  4P30 A;  4C7O B;  1PCX A;  2R7X A;  4YJW A;  2Q6A A;  2YHS A;  3DD7 A;  2XAQ A;  1OKK A;  2DYS C;  1F4N A;  1VQ9 V;  2WLI A;  2HV6 A;  1R3K C;  3ZN1 A;  3OE7 G;  3F7Y C;  4RQE A;  4P6I C;  3ABL B;  1GM7 A;  3IFX A;  2Z15 A;  4CS9 C;  2A9H A;  3CCV V;  2R7W A;  5E33 A;  2CGE A;  2XND G;  1QLE C;  2WLH A;  1ZHY A;  3CME V;  3AQB A;  2H8P C;  4XDJ A;  2IOQ A;  2HKO A;  4JJG A;  2QM8 A;  4R8C A;  3VOU A;  3SZR A;  3K1H A;  4RBN A;  4FJC C;  3ETE A;  3CZ6 A;  3VAY A;  1ORQ C;  2W9Y A;  3JCU Q;  3T2M A;  5KUK A;  3IC7 A;  1UJW B;  3LAY A;  3JD4 A;  3ASO C;  3EFF K;  4M63 A;  1YTF D;  3EZI A;  4JGS A;  2R9I A;  1TR2 A;  4KFM A;  1OCC C;  2QEX V;  4LP8 A;  4O79 A;  5T3W A;  3IEE A;  1N8R W;  4ANJ A;  5KYU B;  3W2W A;  3W2V A;  1K97 A;  1VQL V;  5HSW A;  4RUE A;  3I55 V;  1SZT A;  4I9W A;  5CI9 A;  1OCR B;  2M7W A;  1PNL A;  4GYT A;  2BOC C;  4BJ5 C;  4JYC A;  3LES A;  4P9P A;  1MAB G;  1JCH A;  4MVM A;  3SJQ C;  2P90 A;  2V3C C;  2NNU A;  1OHH G;  3S29 A;  4DVY P;  5B1B B;  3W7X A;  1QLN A;  2Q3T A;  1VQK V;  4I44 A;  1ZWI C;  3FB6 C;  3AG3 C;  2ZQM A;  4YT8 A;  1D0Y A;  1V54 B;  3JCZ A;  2DWD C;  2FFH A;  4Q20 A;  2HVK C;  1NVP B;  5KA5 A;  2Z3Y A;  4QPK A;  2Z5U A;  4H33 A;  3SYO A;  1YTF B;  2OG2 A;  1WPX A;  2Q9B A;  4W8K A;  4KP4 A;  5GW7 A;  3LEV A;  5KYY A;  4CS8 C;  4MVR A;  1S76 D;  4X8A A;  1AI7 A;  1D1A A;  1NU7 D;  2B5U A;  4MW3 A;  4P9O A;  2J7P A;  1MND A;  2J46 A;  4B6I A;  1GMG A;  1N1C A;  3RFY A;  4QI0 A;  4TWK A;  5B1O A;  3KL4 A;  1NR7 A;  1M2O A;  3UKM A;  2HJF C;  3EGX B;  3W8H A;  4MW8 A;  1OCZ B;  5CA3 A;  1VK5 A;  2V26 A;  1BHB A;  1SF8 A;  2CDQ A;  3E9V A;  3STL C;  4GEH A;  4QIW F;  3LDD A;  4PJJ A;  3K0G A;  2WLI B;  2W45 A;  4K7B A;  3E70 C;  3OUS A;  2ZXR A;  4PJN A;  3JD2 A;  2QTO A;  1AR1 B;  2L9J A;  5T3T A;  1G8X A;  2P67 A;  2A6E F;  3OFN G;  3JT1 A;  2KNH A;  1GM8 A;  4Z1M G;  4G2K A;  5FL7 G;  3T6B A;  3CC4 V;  2X6C A;  3AG2 B;  4XDK A;  3ZRW B;  4LBE C;  1P4R A;  1M56 C;  2EIK C;  3W7T A;  3QO7 A;  2IXP A;  3UM7 A;  2I8B A;  2PP4 A;  3B77 A;  3ABK C;  4ZBM A;  4HE8 D;  3ABK B;  4U5E E;  1TWG A;  2J0W A;  2JIZ G;  5BUO A;  1ZHW A;  1LS1 A;  3EH2 A;  3RH3 A;  3EG9 B;  4WF9 V;  4WCE V;  2VH3 A;  4C7O A;  1KP3 A;  2NUP B;  4RQF A;  2X0L A;  3M1C B;  4X89 A;  1V55 B;  2HG5 C;  4PFO A;  2R7T A;  1YHQ V;  3Q6N A;  3NXS A;  2WVQ A;  3L34 A;  3RVY A;  4BJT A;  2XRH A;  5LGT A;  3FYI B;  4JCH A;  2WZG A;  4MVQ A;  5E2Q A;  1M90 W;  3LLK A;  3UGO A;  5L3C A;  5DS4 A;  3AQC A;  3FKS G;  5B1N A;  1AI6 A;  4WJ0 A;  2J9W A;  5CI8 A;  1I5X A;  1IW7 F;  3MD0 A;  4OIQ F;  1YJW V;  3CCQ V;  2QE7 G;  4LCU C;  3UNG C;  3JD3 A;  5L3D A;  1NG1 A;  1NJI W;  3V7O A;  1NH2 B;  4OIP F;  3LNR A;  4KBL A;  5DVW A;  2WZL A;  3STZ C;  4H4K C;  4JPR A;  4ASU G;  2B1I A;  4PA7 A;  4LLC A;  1PD3 A;  4P2Z A;  1VQ8 V;  1S7Z A;  2J45 A;  3O39 A;  1B6Q A;  4AK9 A;  1H38 A;  3K08 A;  2EIL C;  5EGY A;  2A69 F;  2EIL B;  2QY9 A;  1VYK A;  1J8M F;  1ST6 A;  2M4E A;  5CBF A;  4O6M A;  5L3G A;  4X0R A;  1O87 A;  4UV9 A;  3OEE G;  2HLD G;  4DO2 A;  3ZMT A;  3K3W A;  4DBQ A;  4XLP F;  4QE9 A;  1F51 A;  3ABT A;  2Q68 A;  4G7Z F;  4Q7C A;  1Z6A A;  4KC9 A;  1J95 A;  1NR1 A;  4YN0 B;  1LVK A;  2BE5 F;  1Y66 A;  5DN6 G;  3ZRV A;  3BEH A;  1PKX A;  5F5H A;  1LNQ A;  4CIH A;  1NQT A;  2X6B A;  3P32 A;  1SZI A;  4I1O B;  4WFG A;  3AG4 B;  4R7C A;  2P7V A;  4MS2 A;  2KGO A;  4BAY A;  4WFH A;  4RD9 A;  1FXK A;  2BOB C;  1K3E A;  5L3F A;  3S28 A;  2WVN A;  5L3Q A;  5EC2 C;  1Z63 A;  3ZN0 A;  4YWQ A;  3NG1 A;  1JPJ A;  3Q7L A;  2W4B A;  4R6Z A;  2NLJ C;  3JYH A;  1MOF A;  1PL0 A;  3LSS A;  1JPN A;  4IAO A;  2A79 B;  3ZIA G;  4GX2 A;  5E3A A;  5BZB A;  2GFH A;  3BY6 A;  5DS5 A;  5HFM A;  3EQL F;  4R50 A;  2R7S A;  1M2V B;  1K73 W;  1TWH A;  3D36 A;  1KU2 A;  4IRU A;  3ASN C;  3E8G A;  1TKN A;  3ECS A;  3FB8 C;  3ASN B;  2NUT B;  2LFR A;  2F43 G;  4OD4 A;  1DLB A;  3CCJ V;  1RM1 C;  1OCO C;  2K1E A;  1RM1 B;  1Q86 W;  1OCO B;  5IDJ A;  1YIT V;  2H7B A;  1E1Q G;  3ABL C;  4G27 B;  4EBB A;  1K8A W;  3LLI A;  5LHG A;  4DVZ A;  1QBZ A;  2JK5 C;  3ZMU A;  5KYN A;  2J9V A;  4UVB A;  1QVG U;  4FPP A;  4YT5 A;  3DAF A;  3O6X A;  3F47 A;  1CP9 A;  2OTL V;  3LSQ A;  3T6J A;  1MMA A;  1BR2 A;  2IXN A;  3QNE A;  4L87 A;  3ZRW A;  3CC2 V;  4HFK B;  1KQS U;  1MMG A;  4PK4 A;  3I4U A;  3ZVR A;  1KP2 A;  3NYL A;  4U5B E;  3EGD B;  3HPL C;  1XL4 A;  5H6R A;  3CCU V;  3F46 A;  3H65 A;  2ITD C;  3OGC C;  3B0V C;  3B8N A;  3EG9 A;  4Q4Z F;  4JW1 A;  5DQT A;  3RYL A;  4JVS A;  2NUP A;  3WG7 C;  5CBG A;  3SPH A;  2EIN B;  1M9N A;  3WG7 B;  1QVF U;  2P6V A;  4PA4 A;  2XAJ A;  3X2Q C;  1R3J C;  4FK5 C;  2Q67 A;  3X2Q B;  1P7B A;  1OCR C;  2VAS A;  2EBO A;  4BIZ A;  3S27 A;  2WL8 A;  4G7H F;  1FS0 G;  1KC8 W;  4CSA A;  3DGE A;  1JOY A;  4QI2 A;  4GCZ A;  4J32 B;  3DM5 A;  4XTK A;  1SES A;  1AJN A;  5B1B C;  3CQZ A;  3TCU A;  2ATK C;  3SPC A;  3OEH G;  2QTV A;  4XDL A;  3K03 A;  1BR1 A;  3K7D A;  5L3V A;  1L1F A;  1COW G;  1V54 C;  4MTF A;  4EWC A;  1KD1 W;  2Y39 A;  2ZPA A;  2EJR A;  1FTS A;  1CPY A;  1SET A;  1R73 A;  5KUM A;  2D5R B;  5L3E A;  3LUT B;  3HB3 B;  1OKK D;  2JD3 A;  3QMK A;  3K1I C;  2DQ0 A;  1MG1 A;  3CP1 A;  3FYE B;  4C3B A;  5HFL A;  3N2Z B;  4UVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...