1M56C

Structure of cytochrome c oxidase from rhodobactor sphaeroides (wild type)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
265
structure length
265
Chain Sequence
AHAKNHDYHILPPSIWPFMASVGAFVMLFGAVLWMHGSGPWMGLIGLVVVLYTMFGWWSDVVTESLEGDHTPVVRLGLRWGFILFIMSEVMFFSAWFWSFFKHALYPMGPESPIIDGIFPPEGIITFDPWHLPLINTLILLCSGCAATWAHHALVHENNRRDVAWGLALAIALGALFTVFQAYEYSHAAFGFAGNIYGANFFMATGFHGFHVIVGTIFLLVCLIRVQRGHFTPEKHVGFEAAIWYWHFVDVVWLFLFASIYIWGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-ray crystal structures of wild-type and EQ(I-286) mutant cytochrome c oxidases from Rhodobacter sphaeroides.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords CYTOCHROME C OXIDASE
total genus 101
structure length 265
sequence length 265
chains with identical sequence I
ec nomenclature
pdb deposition date 2002-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00510 COX3 Cytochrome c oxidase subunit III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1m56C01
1.20.120.80 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1m56C02
1OCZC 4GX5A 5IY5C 1OCRC 4PA7A 4H33A 4PDLA 4PA4A 1ORQC 3KG2A 3RVZA 3OR7C 4P30A 4R7CA 1KKDA 4TWKA 2HJFC 2WLLB 2WLKA 5CBFA 3LDCA 4BW5A 2A79B 3VOUA 3FB6C 2DYRC 5B1BC 3R65A 2ZXWC 3E8FA 5EC1C 4ZBMA 4UUJC 1R3IC 2YEVA 2OCCC 2X6AA 4PDMA 4LBEC 4P2ZA 3ABKC 3K03A 3HPLC 4MVSA 4WFHA 2WLIA 4I9WA 4PA6A 4RUEA 3RBZA 3LDEA 1P7BA 3PJSK 4PA9A 2P7TC 4HZ3A 4WFEA 4MS2A 3SYQA 2Q6AA 1OCCC 2BOCC 3TETA 3RVYA 3K04A 3ZRSA 4PA3A 3OGCC 3GB7C 3T4DA 2BOBC 2IH1C 4QNHB 3E8GA 4MTFA 4QE9A 2K1EA 4JTCB 3X2QC 1XL4A 2A9HA 3E86A 3UKMA 4MTGA 3UM7A 5B3SC 4RO2A 2WLLA 1J95A 3LNMB 4QE7A 1V54C 4R8CA 3LUTB 4F4LA 2H8PC 3OR6C 4RUFA 3K0GA 4KFMA 1K4CC 4G27B 5EBWC 3T2MA 2DWDC 2Y69C 4MTOA 3LDDA 3SYOA 2Q68A 2WLMA 3T4ZA 1JVMA 1S5HC 2R9RB 4XDKA 2EIJC 3SPHA 2Q67A 3FB5C 1BL8A 3ABMC 2ITCC 5CBHA 1FFTC 4JTAB 4G28B 2W0FC 2ATKC 3ASOC 2HVJC 3SYCA 4MVMA 3TCUA 2WLJA 3AG2C 5CBGA 3IFXA 3ABLC 3K06A 2JK5C 2X6BA 2WLIB 2QTOA 4GX1A 2ITDC 2DWEC 2Q69A 4MVZA 4OXSA 4X88A 5EK0A 4GX0A 2A0LA 1G4YB 3RW0A 3STZC 1LNQA 4PDVA 1M57C 4X8AA 1V55C 3F7VC 2EIMC 5B1AC 4MW3A 1M56C 3OUFA 4MVQA 2KB1A 4PDRA 2AHZA 5EBLC 3SPCA 4EKWA 4JTDB 4LP8A 2WLNA 3F5WC 4J9YB 3SYAA 5EBMC 2IH3C 3JYCA 4WFFA 3ZJZA 4P9OA 3FB8C 3OUSA 4XDLA 4DXWA 4R6ZA 3AG1C 3AG4C 4MVUA 5BZBA 4H37A 4LCUC 5KUMA 3WG7C 3T1CA 3ASNC 1QLEC 4X89A 3E8HA 3K0DA 1K4DC 4P9PA 1OCOC 1ZWIC 4RAIA 2EINC 4XDJA 4GX2A 3E8BA 3E89A 2WLHA 3BEHA 3E83A 1R3KC 2ZD9A 2DYSC 5EC2C 2EIKC 3SPGA 4HYOA 3K08A 2HFEC 3FB7C 2EILC 4MVOA 4MSWC 3F7YC 5KUKA 4CBCA 3IGAC 3STLC 3EFFK 2X6CA 5J9PC 2HVKC 1R3JC 4J9ZB 5E1AC 4R50A 1XL6A 3AG3C 2QKSA 4WFGA 2NLJC 3SYPA 4MVRA 2AHYA 1R3LC 3SPJA 3SPIA 2HG5C 4MW8A 3SJQC
chains in the Genus database with same CATH superfamily
3EFOB 4F4BA 5FNVA 1IBKO 4PA4A 2GDSA 1JOGA 1AI5A 3KG2A 2F95B 4DV7O 2XLHA 5JVEA 1YA7O 1HNXO 4U5DE 4CH4A 4OPHA 1XMOB 1QQCA 2V4DA 4LF5B 1H9TA 4B3RO 1Y4CA 3I5PA 3UR3C 5DS5A 1KD1W 2I15A 4YY3B 2XM4A 1RPRA 3K03A 3HB3B 3S27A 3HNLA 3A9CA 3OA1A 2WL8A 2XRHA 2LFSA 4RUEA 1ZU4A 4YT2A 3PJSK 3ITFA 2P7TC 2K9PA 4FLYA 5B66Z 5L3VA 3C3SA 2M4EA 1F4NA 2B1GA 3CXHF 4YIPA 5LOVB 5DQZA 3V5YA 4DRJB 1E1QG 1HW2A 1Z63A 2HJMA 1LUVA 1ZHWA 5J2UB 3LLKA 4MQ9F 2QTSA 1XL4A 1QR8A 2ASRA 1NU7D 2J9WA 4JJFA 1GGQA 4BJ5C 1V54C 3K58A 3EGXB 2LQTA 3THOA 3T2MA 3FHDA 1CPRA 1DTOA 4LDRA 4D4XA 4JYYA 3LDDA 1JCHA 2Q7EA 5K1XA 3H1KH 2XLOA 4JI6O 2Q4FA 1KUQA 1K5SA 4YJ2B 3KCYA 3G6EV 3I4UA 4IIJB 3QMKA 4E7SA 5EZYA 3T4RA 4PFOA 3JCZA 4A2NB 2JK5C 2FL4A 3KKYA 2ITDC 3ATPA 1BHBA 4X1YB 1QBZA 1N32B 1FPOA 3WHNA 4BEMJ 1I0HA 3O6XA 3VAYA 1US6A 1ZLZA 2EPMX 1XDCA 3J80N 2KB1A 4QDLA 2F93B 1K3EA 3X1OA 1NZ6A 1M6TA 2YXHA 2KK1A 4CDYA 1VLTA 2QTVA 2WLNA 5C8YB 4ICGA 3W4YA 1TUEB 4JIOA 3L8IA 1D5AA 2UXXA 5LHGA 1GKFA 1ZHXA 2ZE7A 2YVKA 3LEOA 2NR5A 4LWSA 5BZBA 4BJ6C 4H37A 3GWKC 4FAPB 2YICA 3CZ6A 4Q20A 3E22A 3JASB 2EINC 4EEQA 3DXRB 2KQXA 5KAFZ 2LO1A 4PELA 3HJCA 1L1FA 2IXMA 1EZJA 1E79G 1TGOA 3SPGA 2KJGA 4OGQB 1NBMG 2E87A 3KYIA 2CW0F 5L3QA 3S3XA 2G38A 2P6JA 2W0XA 2HVKC 4DBRA 5JWPA 1SESA 1NH2D 5JLIA 2ZXOA 1GM8A 5B3SB 4DV3B 4OIRF 2KQ9A 1MG1A 1K40A 3LSQA 1M5IA 5JUAA 1YITV 5IY5C 2QY9A 4CS7A 1XOUA 3RQEA 1F4MA 4DYLA 1SMYF 2HKOA 4HFFB 2NSFA 1ZYRF 4FPPA 2A79B 2ZDIC 4BPMA 2B0HA 4YK5A 4JASA 3CRRA 3DC5A 1CPYA 1VQPV 1YJGA 5IT9N 1MNDA 4MVSA 1ZW3A 5J2UA 1H7IA 4I9WA 4CJGA 2UXNA 2BC5A 3WB1A 4B7KA 3HKBA 3SJCC 1O9HA 4JZAA 4LDKA 2XT9A 1VB5A 2PF4E 4FM1A 3FOPA 3N2GA 1PL4A 3VQWA 3J81N 2E76B 5AGFA 3NYMA 1K34A 5LHHA 3L72H 4B08A 3AGUA 4I4TA 3H9VA 3UT5A 1QHTA 2A6EF 3ZBHA 1FXVA 4NTXA 4W4LA 1VARA 2XAQA 1GM5A 1M56B 4BWAA 4IL6Z 4KFMA 1HW7A 4QGPA 2ADQB 3ETQA 2Q4PA 4JAUA 4Z9IA 3WAQA 2Q68A 4DRHB 2HEPA 3CJHB 2R9RB 1EBOA 4XDKA 1JRAA 3ICXA 3CEXA 2EPOA 4HAMA 2Y48A 1UFBA 5FPOA 3Q7LA 3KCXA 3ASOC 3SYCA 2A68F 1HNZO 3K06A 4QNHB 2X6BA 2Y0PA 2JVDA 4YHHO 4PACA 3Q4HB 4ZI7B 3STZC 3CCUV 2CDQA 4O4HA 4X8AA 1J5EO 3S3WA 4K35A 2NSGA 4MW3A 1NTMH 3P3NA 2IYLD 2LD6A 3CJHA 4X66O 2D2CB 4J42A 5KLVH 4TUYB 5A6JA 3HNIA 3CQZA 1T9KA 2YXYA 4H44B 3S9OA 3T6BA 2VH3A 1JJ2U 4YY3O 2NUPB 3AG1C 3L73H 3UO3A 3CCSV 3KMIA 3E8HA 4IYHA 2L6GA 3E70C 2YIBA 2A69F 1MZFA 3CXCU 2XNDG 4TV8A 1WWPA 1RKEA 4AX2A 3DM9B 1IX9A 3CS5A 1B68A 1JR8A 3LLIA 1K7DA 4GCZA 4MSWC 3IGAC 2QM7A 2N04A 3TULA 2C2AA 5DN6G 1FJGO 3DTUB 3C18A 5BQHA 2B9ZA 2HP8A 5FCLA 4BG0A 2Q0AA 5CA1B 4H33A 1VQLV 2M7WA 2HJFC 1YDXA 3C8GA 3LDCA 4PV1B 1P49A 2Q7HA 2WVQA 1SQPH 5KHKA 2HFIA 4JF3A 1VQ7V 3PN1A 1ZL8A 1KMIZ 3UMKA 4YN0B 3K1IA 2WVNA 5E79Z 4I4TB 1T01A 2DE0X 2IXPA 3IPMO 1TWGA 4LR3A 2R03A 5CA3A 1VQ9V 2PBEA 2ZNJA 4I50B 2FMLA 2DJVA 3E8GA 2HMQA 3FXHA 3BA9A 3UKMA 5B3SC 4NQFA 3B8MA 1G6UA 3NYLA 3ECSA 1QLNA 2YIDA 3LUTB 2WAMA 1QVXA 3TJTA 4C7UA 3U3FA 1GMGA 4X65O 3SDLA 4UCRA 2EULA 1Y66A 1F7YA 2R7QA 3K59A 3Q4HA 4AE4A 4K8XA 2ZNIA 2EBOA 4DV0B 5AG2A 1H2NA 2JRIA 1M2VB 3W7TA 1E86A 1HNZB 2QUPA 1HR0B 2QTOA 2VQFO 1VOMA 3N24A 4N6HA 3IC9A 2Q8VA 3HLZA 4TUYA 1CXZB 2YS8A 5IJ0A 1ORYA 4LACB 3ABTA 2QNLA 1H2KA 2A0BA 2P6VA 3UMHA 4RWUA 3F7VC 1LS1A 1DF5A 5A9GA 3QO5A 1FXHA 2E5LB 5IYBO 2GTSA 3OTOB 3JD3A 2ZPAA 1Q3EA 3EZHA 1WOLA 1GN3A 1RFYA 1FAPB 3HKEB 3K1HA 5JQGA 1WB8A 4FZ0A 3R66A 4JEBA 4XDLA 1Q0MA 2ICWG 2YL1A 3BAAA 5JH7A 3WG7C 4AI8A 5F2VO 2KC3A 4RAIA 2V3CC 4B3MB 1OCOC 1KNYA 4IRUA 5IJ0B 2AW9A 1MMMA 5LYJA 1YF2A 2DYSC 3ZMTA 4DV6O 5IYCO 1M90W 3PCVA 1M57B 2M6YA 1FTSA 5KUKA 3TOLA 2VQEB 2Z0AA 1I4ZA 4CS8A 3NG1A 3QVNA 2XLMA 2VB6A 1YJWV 3FX7A 4I44A 1DOVA 2BE3A 4OIQF 1H2GA 4EIYA 1PNMA 1KQSU 3OGIB 1D1BA 2W6IG 3K6BA 1JR9A 3AG4B 3EZIA 3A0HZ 4TWKA 2KSDA 4EHPA 4U3JA 2BE5F 1I7FA 1ZHZA 2GUZB 2LFRA 5HSWA 2IOQA 3T9OA 1NT2B 2EIJB 3JALB 4ZOLB 4LF6B 1RKCA 3S84A 3AQBA 2Y4TA 2XSEA 4I0XA 2LCHA 3FYEB 3DXRA 3ZG1A 1SKVA 4PA9A 1VK5A 4NR1A 2VCAA 5KMGA 4J41A 2A1DD 4XTKA 2HV7A 3ZHTA 4ABMA 4ONSA 2BOCC 2OKUA 5TISZ 2W9YA 1S76D 1BBHA 1JMKC 4DVZA 3HKDA 2P4VA 2MW2B 3CX5F 4TQFA 4U7OA 1XNRB 2WB7A 4DW1A 2CNWA 3U2LA 4QI2A 3M4CA 3OR6C 4I3MA 3NRHA 5LHIA 2RSEB 4NTYA 2E74B 1YA9A 4CS9C 4JI1B 2GV9A 3D8CA 1WJZA 2AWCA 2B0JA 3JAWB 1NQTA 4LF9B 1I5NA 3ZN0A 2DI3A 3LJBA 5L0GA 3CC4V 3CRAA 2XL4A 1N32O 2ZIMA 3RFRA 4XPYA 2GDCA 2PGGA 2ZE6A 3ABMC 2D4UA 4U5HA 3L71H 1J8YF 3HTKC 2NG1A 1AUEA 1B6QA 2AZ0A 2HVJC 4MVMA 2Q9AA 1R4TA 1KBHA 2Q69A 4G2KA 4I55B 1AJNA 3BABA 1YSCA 4W8KA 1A32A 4IYIA 3JALA 2FTKA 2GSMB 2G3KA 2R7UA 4O4JB 5FNVB 3O55A 5CA0A 2YLDA 1HR0O 4NXMB 2JGDB 5DLJA 1SF8A 1SQBH 1BQ0A 2F66C 1RSOA 5IWAB 2QKCA 4DV5B 1RMVA 3S29A 4P9OA 3RYHA 3N2KA 4JVSA 3GM2A 1OW8A 2QDOA 3DE8A 4O4LA 1QLEC 1NTZH 4D4NA 4JYBA 4AK9A 5IYDO 2LP7A 4EB6B 3U0CA 4O4JA 5J2TB 1HE1A 1K5QA 4JI5O 3H65A 3OEEG 2EPNA 4UCTA 1CPQA 1LM3B 2OEVA 5CN0A 1BGYH 3ZHQA 2Y3DA 3BY6A 1U0BB 2EZOA 5JJJB 4OD5A 3NKEA 4DUZO 3ZIBA 3HKKA 3G50A 3HKEA 3NMJA 1ZAUA 3D3QA 4ULVA 1VMAA 3AG1B 2CTRA 3SXMA 2H7OA 1Y76B 4I0XB 2UXCB 2Q9CA 4E0IA 4U5CE 4P9TA 1EM1A 4BW5A 2Y0IA 2RCVA 3OMNB 3K5MA 1ROPA 4ZOLA 1XNRO 3UO2A 3P30A 5DM6V 1XMQO 1MMAA 3FAPB 2A0UA 4L8JA 1X4TA 1TVKB 1KU2A 1GM9A 2XOKG 3K5LA 2DW4A 1VQKV 5KYUB 1CEZA 3GWOA 1GQAA 1WNSA 4U9EA 1OCRB 3HKCB 3TETA 3T4DA 3OGCC 4OINF 4LF8B 4TV9B 1C03A 1PD0A 4QE9A 4JTCB 2QE9A 1KP2A 4F4LA 5A2QN 2IJHA 1YYJA 4G7ZF 3JSEO 3K1IC 2DWDC 2Y69C 3C7JA 4EFEA 3ZCCA 4LFAO 1L3PA 4FJCC 4FMTA 3J06A 4DRXB 1NTKH 1NSGB 2WVOA 3WG7B 4FM0A 2W0FC 4B3RB 3K66A 4K1OA 3DJUB 1T6UA 2VQFB 4CS9A 2H7VC 3SNHA 2DWEC 4DV1B 1FR0A 1FD9A 2IJJA 4DV4O 2O57A 3LS0A 1U6HA 4UXNA 2QA4V 1C02A 1V55C 1ZTEA 5LGNA 3S90A 3NKDA 1BDJB 4YT5A 3FMSA 2LK4A 2W6JG 4I1MA 3MAQA 4EWCA 3NR7A 3CD6V 4DOZA 4BJ1A 3SYAA 3M15A 4EBJA 1QKRA 3VBBA 1BQZA 1AP6A 2YSUB 3BPZA 1TUBA 5D5PA 1S72V 2Q7GA 5EIBD 1NU9C 1Q8IA 4WBNB 1W59A 5KUMA 4XPXA 4MTXA 4O6MA 1W0KG 1ZWIC 3AG2B 3G71V 2J9UA 4TT3G 3E8BA 1OXKA 4WGYA 4AL1A 4CZZA 4RQEA 2Q00A 2XS8A 5H5NA 5EIBC 4DR6O 2HJ3A 4PJNA 1N33B 2B5UA 2X6CA 1D2DA 4DUYB 4J9ZB 4YJ3A 3SYPA 1LPEA 3HNJA 4ZLCA 1HP8A 2JGDA 4PI2A 3ZS8C 1IBLB 2EX3A 2GWWA 1OCZC 2H94A 1WB7A 1ORQC 4FFBA 4FZ1A 3GWNA 3ASNB 2PP4A 2YXLA 1SF9A 1S05A 3CCQV 5KYXA 4PJLA 3E8FA 1H2SB 4IT5A 4UUJC 3OEOA 4JKVA 2XL6A 2X6AA 1SR2A 5BQGA 1Z5WA 4YJ3B 1F1MA 3D3IA 1V4AA 2F22A 1Y6DA 3UCSC 3JAKA 5KYUA 3FDQA 1OR3A 3U2MA 2DN9A 4RBNA 1K04A 1YHQV 4WFEA 1G8XA 1BSMA 4JW1A 3RYFA 1JA8A 3CMAV 3GANA 1JPNA 2YLIA 1ORJA 4HBNA 4MTGA 2HHHO 1GAXA 2CGOA 2N05A 3KKBA 4JI0O 4EUKB 1TFOB 2BTQA 2X0LA 3UT5B 1OCOB 1R6TA 3K57A 3Q6MA 2OU6A 1IZ3A 3BVOA 1OXBA 1WP8A 3FB5C 2FGYA 4K7BA 2LGQA 4DJ9A 4K0DA 3RH3A 1DGSA 4J30B 1FFHA 5BR8B 4DK0A 4Q6GA 2L9JA 3SYOA 3Q6NA 4X88A 1D5NA 3QZCA 4ZIBA 4FLUA 1G4YB 1IW7F 2R9IA 3JAMN 2ZR3A 1LNQA 1XNQB 5EYPA 5B1AC 5D5QA 1SYQA 2YIAA 4A5UB 5LMUB 5JJNB 2J0WA 2YRFA 4UCVA 4ZI7A 3RYIA 5LP6B 3U11A 4RQFA 3FVYA 1L0LH 4LNUA 3B9QA 2BL2A 4J7JA 3EXAA 4GLXA 3A0BZ 3H1IH 4BJ6A 1TQGA 1OKKA 3RQFA 1I5YA 4GZRB 4GX2A 3ZSUA 1R73A 2QLAA 3H2UA 4N06A 2QKAA 1IXMA 3DGEA 1FS0G 1AB3A 3MYIA 1PNLA 1VYIA 3DKAA 1AR4A 2HFEC 4J10A 3K5OA 5H2FZ 1NVPD 5B1OA 1AP5A 3I5DA 5K0IA 5GW7A 5TJ5E 1H8EG 4MW8A 5COGA 1BT8A 2NPUA 2E75B 4CC6A 3H1LH 2V1DA 1K92A 2XXAB 4K0KO 4N21A 5D91A 1OW6A 4WBNA 1P4RA 2ETSA 2R7TA 2EJRA 2CTWA 4IWBA 3WB2A 1HMDA 2J46A 3G4ZA 4ZBMA 5L3GA 2OCCC 2A3QA 4P2ZA 4WJ0A 1XHXA 1YCIA 1RJ9B 5KHGA 1GS9A 2NUPA 2EINB 3S28A 3A2FA 1XWJA 3CPWU 1P7BA 4FK5C 2XLVA 4FX5A 4DV4B 3V7OA 1LUWA 2XXAA 2Q6AA 1OCCC 1Q7YW 3FKSG 3UQ8A 3E22B 3JASA 3UGPA 4R32A 1BS3A 4C3BA 1Y4MA 1PV3A 1X59A 3UM7A 3LNMB 4DV6B 2P7VA 1JPXA 4G27B 1NKDA 4MTOA 3LSUA 1PPJH 2J7PA 1QLEB 2WLMA 2JD3A 1YZBA 2OQMA 2AWYA 3K9SA 4X20A 2KGOA 1PCXA 1NR1A 3QO7A 5HV9A 1G1XB 5F5FA 2W4MA 4DR6B 1K8AW 4OIPF 3ZRXA 2P22C 2HSQA 5A6AA 1WLEA 2YZSA 4FLXA 2XLEA 3ZC4A 2VWJA 1FXKA 3FAJA 1DF4A 2V7QG 3PDMP 1MNEA 3DJNB 3M99B 4YL1A 1KU9A 2YDEA 4BR6A 2L6FA 3WODF 2A6HF 1AVOB 4MVQA 2OOCA 5LGUA 4C7OB 4JC7A 4M63A 3AK2A 4U5EE 4LP8A 3HKBB 3ZHUA 2Z5UA 1LE2A 4UVAA 4GKJB 1S3JA 5IY5B 1MSDA 4W8PA 5CIVA 4R6ZA 2UU9O 2WZLA 1MSWD 1IXBA 1YARO 1Y74B 4NXMO 1FXKB 3TGUH 4O4IA 3AOUA 4DV1O 2W4BA 5B3IA 1EN6A 1QVGU 1T5EA 1YVIA 3EH1A 4JI4B 4CDVA 4DBQA 3F7YC 4LF7B 1XZPA 3U3BA 1A0BA 3EH2A 2EPLX 5E1AC 2XAJA 4CBEA 4E7ZA 4H4KC 4JI5B 2KW3C 1M2OA 2OIEA 3IC7A 4KHPO 1V54B 2J9BA 3A11A 3ZHVA 1DLBA 2ZM6O 3G6BA 1XBLA 4CIPA 2R7RA 1EI7A 3AQCA 2ARHA 3P3PA 3SGIA 5T1DB 1U97A 3DMDA 4JV5B 2CH7B 1Q6IA 1QCEA 2KG7B 1AI6A 1GH6A 1RJ9A 3QF7A 4AHCA 4GUNA 1ZUQA 2Q9LA 4DV2O 2R9AA 1MABG 2AZ2A 3CRCA 1Z6AA 3MX3A 4CSAC 4MS2A 1Z3IX 1ZSPA 2JS5A 3RVYA 3B77A 4LFAB 1YIJV 2CAZC 4H13B 2K1EA 3OM3B 3KPHA 3SP1A 2QWRB 1M1KW 1YTFB 2KG7A 3PMRA 3ETDA 5D92A 4OPAA 3GM3A 1XILA 2ZXWB 4LFBO 1G8MA 1HMOA 3CMEV 2FAPB 2X51A 3I56V 2YL7A 4WGZA 1Q82W 4LH6A 4G0HA 4LF8O 5E33A 2BTOA 2R7SA 3DM5A 1HNWB 3IQ6A 4O2AA 3S0XA 1SQQH 3CWBH 2ITCC 4GKJO 5KX5A 2EIKB 2J45A 1VQ8V 2OTJV 2OIGA 5B1NA 5CBGA 3N2ZB 5L0DA 1B06A 3ZMZA 2ZXRA 3LSSA 4RD9A 4J7TA 1APCA 3EGDB 2JS3A 2CCYA 4JI6B 3SXKA 4YL0A 1XMQB 4JYAB 2P4KA 1R1BA 5LMUO 3QVZA 1N34B 4QIWF 4JI7O 1Y74A 4B3TB 5GTIZ 4QPKA 4I55A 3RWRD 4DV5O 2P61A 2HS5A 3LESA 1SQVH 4LFBB 3ZJZA 4DXWA 3FD9A 2QM4A 3JT1A 3MDSA 3NXSA 4LCUC 5JSLA 2OJED 5BY1A 3TD7A 3SR2C 3JD2A 2LW7A 1RM1B 3E89A 1R3KC 3N2KB 1H8HG 1Z2GA 4JYCA 1YZCA 4TOIA 1C17M 4BIOA 2R25A 2XASA 2YKZA 3EFFK 1OW7A 3IJ4A 3DD7A 2RNBA 2CTQA 3BRCA 3A8TA 2QKSA 3B4SA 1EZVH 4MNDA 1N1CA 5LP6C 5L0JA 4KNWA 3T1YB 5FL7G 3V5ZA 3M7MX 1M2VA 1NZEA 2LIGA 1OCCB 2AP3A 2VCCA 4IARA 2JIZG 3HR0A 4JI1O 3R2PA 2HV6A 5KHJA 2UUIA 3UMIA 3RYCB 3JYHA 3G4SV 3L74H 3QO8A 3VOUA 2WWWA 5GTHZ 3J7AU 3EGDA 4HEAJ 2DYRC 5B1BC 2LJ2A 3O10A 5FPRA 5EC1C 4LNUB 4LFCO 1T6IA 5H6QA 4E2LA 3K5NA 4P9FA 2IXNA 1EQ1A 1LE4A 1VF6C 2XHBA 3E9VA 1VIBA 2PFDA 2R05A 5A6BD 5L3CA 1JJOA 1NJIW 2VC9A 3CC2V 2W45A 1JAFA 4W4KA 2R7OA 1XNQO 5B1AB 3QTCA 2B1IA 1I08A 1PV0A 4DVYP 3KL4A 2HUJA 3GEHA 4BAYA 2JX0A 3W8HA 1HY5A 1PD3A 4JZ2A 3BCCH 5DS6A 4RO2A 4JAVA 5L0HA 1SQGA 5KMGB 4DV0O 3L9DA 1FNTc 1K4CC 5BMVB 3JARA 3DAGA 2XS1A 1Z5VA 3DI5A 2EJ7A 1JVMA 4H54A 4ER9A 1N36B 3ZX6A 2EIJC 5L3DA 4JI2O 1NVPB 4XPWA 4O79A 3ZQVA 1XUQA 2R70A 2ATKC 3TQOA 1A7DA 5K1PA 4ZLDA 5BUOA 4WABA 1Q5OA 4XWJA 5EK0A 1QNMA 2DGJA 1NG1A 1JQ0A 2IJKA 5HFMA 3GWLA 4GX0A 3T1HB 2IJIA 3RKOF 3F47A 4O4HB 4DO2A 4JJGA 4JURI 1M57C 3OUFA 1IBKB 1TKNA 4J7YA 1E84A 1VF5B 4EKWA 2XL8A 5A69A 1GK9A 2JEXA 4DR5B 1S5JA 1SA0A 2LFDA 3OUSA 4O7GA 1MZEA 3AG4C 4MVUA 2UUCB 1T6QA 5KX5B 4X1IB 2VQEO 1UFIA 4J11A 1HW1A 4L6RA 5T3WA 4XDJA 1NI8A 1RP3B 3CAXA 5LMNB 1HDJA 2NNUA 4B3MO 1SZIA 3OMIB 3DAFA 1BMFG 1WTYA 2IM8A 2OTLV 3CSKA 2L7AA 2HG5C 5IJ9B 3SJQC 2AGAA 1WN0A 4CJOA 3LNNA 4PA7A 1P84F 4LF4O 4JI7B 4NXNB 3E2EA 1N34O 1QZXA 3AG7A 4R7CA 1KKDA 3GM1A 4LLCA 3TXQA 4U9DA 1KECA 4GEHA 2UXBB 3OWTA 4NTAA 3US6A 1OHHG 2ZIOA 1KC8W 2NN4A 3JCUQ 3ZEDA 2DYSB 3ETEA 3CSXA 4ZHQB 3CCRV 1SZXA 1W0JG 3ABKC 3CCMV 3U5SA 5JRAA 2OEXA 2BSKB 2BCCH 5DECA 3G80A 2QM8A 1J5EB 3JAWA 3ZQYA 5LA6A 4Q7CA 4UB6Z 4JZGA 2DQ3A 2UUBO 3VQYA 3SEOA 4MT8A 5BMVA 3CRQA 3BFRA 4PJ0Z 2XTAA 4MTFA 4CS3A 5J9PC 2KKWA 1RSOB 2RN9A 1M9NA 4E17A 1GN4A 4QE7A 2EIMB 1XREA 4U5BE 1CGME 1VQ6V 3OE7G 4BJTA 5EBWC 4UDVA 2G62A 2ZE8A 1K97A 1BR1A 3M1CB 2P67A 4FFBB 3T4ZA 3ZMSA 4PR9A 1BZ4A 1Q0FA 2CNWD 5B1BB 2PI5A 4GT1A 4CS2A 5LGTA 1PP9H 5IJ9A 1FYJA 1PNKA 5KYXB 4G78A 3ZN1A 3H01A 4BJ5A 4X64O 4IHJB 5HFLA 3K79A 3LEVA 5EZYB 3K9AA 4ZKIA 3IFXA 4DR1O 5GPGB 2Y39A 3GEIA 5KHIA 3VQVA 4PHZA 4NKGB 4CS4A 3NMKA 2VRZA 4JCZA 1Z23A 5DEDA 4GYCB 4PDRA 4PJMA 1Q6HA 4H0LB 5EBLC 1MMDA 2D5RB 1KYOF 3MLGA 1THZA 4J9YB 3DWWA 5EBMC 3FAVB 2J0XA 1OKKD 1SA0B 3K7DA 2WZFA 2Y3BA 1I94O 3HKCA 3Q7GA 4JI4O 3LS1A 2ZINA 4X9QA 1MQVA 2C03A 1TAEA 4YXWG 4TV9A 1VQ4V 2QGNA 2BTQB 3GVMA 3N0TA 2DYRB 3JYYA 5LYJB 2XM0A 3JSLA 1AR1B 4DV3O 1GN6A 2IXOA 3IHUA 5JP7A 3EHBB 1Q0KA 5COMA 2MK3A 4DUZB 2IW5A 4CSAA 2L81A 1MNGA 2YI9A 4XEFA 1Q0GA 3EPVA 2N74A 4CS8C 5CI9A 4B3TO 2LP4A 3SJBC 4B3SO 3MYFA 3KZIZ 5DS4A 2A7WA 4IJJA 4GX5A 2GTAA 1NS1A 1COWG 3RYLA 4JEAA 5LXTB 2Y3GA 5CMUA 2JGUA 2Q7RA 3AK1A 4CH6A 4X66B 1TA8A 2WLLB 3SXZA 4JRZA 4YT4A 1QU7A 3JATB 3ZIAG 4DV2B 2UUAO 5F28E 3TJ6A 1R3IC 2OT5A 5ITZA 3MBGA 1EN4A 3SXYA 1WN7A 2R7WA 1XI1A 1GRJA 4PFPA 4DW0A 3CB2A 2Z3YA 1HE9A 2WA4A 2X7RB 1P7GA 3LDEA 3DE9A 5LBQA 2WZGA 1VP7A 3SYQA 1OJHA 5LXTA 3JD0A 5IYZA 4KHPB 5L0IA 1CGNA 4PA3A 3GB7C 2R02A 3T6JA 4AILC 3DSQA 2HKVA 4YJWA 1OR2A 4Z9HA 3E86A 3EQLF 4LDQA 4U3JB 1S5LZ 1OCZB 3QTHA 2RDCA 2LGWA 2E3CA 3RT3C 3B0PA 4J7ZA 5F5HA 1O9GA 3RYCA 4LF9O 2P90A 1I5XA 1LVKA 1IBLO 5LOVA 2O9XA 2LFFA 4WCEV 3CYOA 1LS4A 2UU9B 2Q3TA 1F23A 1MOFA 1G4WR 4XBFA 2DOSA 1N33O 3ZHSA 3QVYA 5EGYA 5KYWA 4X20B 4K8ZA 3JCUZ 3AG3B 1H9GA 4HNAB 1Y6XA 5AC4A 3K3WA 4D7TA 2E5LO 4K0KB 3L8JA 4LLEA 4UCSA 1VTMP 3SPCA 3POVA 2Y69B 1BR4A 4JTDB 3B0UX 1WP7A 2IH3C 3RYHB 1D0ZA 1YJ9V 1I4YA 3VQXA 2VASA 4P6IC 2IU3A 4XQ1A 3ZTMA 4DV7B 1B04A 1WA8B 3H2VA 3W7SA 5FZTA 2WLHA 4TV8B 3RFYA 4CC5A 5LMNO 3FOOA 3W2WA 4HYOA 2Q73A 1LI5A 1Q90D 1EN5A 3AK3A 2F4VB 4GKKO 1I94B 1IBMB 3U8PA 2OJQA 3STLC 4TQDA 3CCLV 2KYHA 4Z2WA 1AVMA 4R50A 3U10A 4FLVA 1G4US 4EBBA 4QJFB 3OAAG 5CA1A 1WA8A 3OR7C 4QI0A 4OX9B 4ANJA 4J80A 1BHAA 1JPJA 4LERA 2PYJA 4WFBV 1SETA 3B71A 4U7NA 1YXBA 3JD1A 4PDMA 5BR8O 4BEJA 1PKXA 4OX9O 2QWNB 2UXDB 4JI3B 3ABLB 1NLXA 3SJAC 2UUAB 1E85A 4DR2O 4TSFG 2CGNA 1UJWB 3SYNA 4LWSB 4KP4A 3K04A 3ZRSA 1A7EA 2Q5ZA 2BOBC 1SS3A 3CP1A 4LC1A 2J9VA 4G7OF 4B3SB 3O9OA 3GODA 3ZDLA 5KYYA 1JOYA 3ZWIA 2WLLA 3DC6A 1K73W 4X62B 4GYTA 2CUGA 2QR4A 1MMGA 2Y4UA 1N8RW 2V26A 5EYPB 1L0NH 2QWQB 3ABKB 2PY5A 3E35A 1RXQA 1BR2A 4A4AA 1ZX3A 3C3TA 3OD4A 4CH3A 5FLXN 2JDIG 3WU2Z 3T1HO 1RCPA 4JTAB 1YI2V 3NMIA 1VF6A 1Z5ZA 1ZW2A 4N6CA 3QG5A 5KYWB 4EBKA 4O2BA 2RMKB 2CE4A 1YAUO 3CC7V 2AXTZ 5C8YA 3RW0A 2ZXPA 5LP6A 3L75H 4LFCB 5JVDB 1E1RG 1IZMA 2EIMC 4K3AA 3CCEV 2EILB 2FFHA 2RD9A 4LF4B 3OMAB 2QWOB 1UPGA 3RGBA 4JI8B 4I9QA 3DZAA 2VCBA 5L0CA 4FLWA 2YIBD 4PD4F 4JV5O 1QR9A 1AROP 5JQGB 4FM2A 3T1YO 4RDAA 2PX0A 4Q5SF 4Z1MG 1AI7A 4JE9A 1ORSC 1W2BU 2GUZA 1VQOV 3UNGC 4X89A 4C7OA 3K0DA 2HLDG 1K4DC 2C04A 2YI8A 2Y3HA 3U9MA 1ZZPA 1KKCA 3H1HH 2OCCB 2P0NA 3MFNA 4JI0B 1N0NA 4U3FH 5CB4A 4IHJA 2YWAA 4XEVA 4CBCA 3ETGA 1K33A 3DXJF 1DOWA 1R6KA 4JI3O 3B0VC 2KSFA 1QSPA 2ETNA 3AG3C 4AQYB 4LF5O 1NBBA 3SPJA 1FMWA 4FESA 2KNHA 4PDLA 1FMVA 3IQ5A 1WASA 3WFVA 3BHPA 3EJNA 1LI7A 1AEPA 1QPUA 3W2VA 3NYJA 2DQ0A 3FB6C 4I1OB 1ST6A 5L3EA 3H1JH 4PJJA 4UCUA 3HNKA 1Q0DA 3N2GB 2H7BA 3CE2A 1EA8A 3HPLC 2WLIA 1U96A 3MHSC 1BZKA 2UXBO 4DR2B 4XLPF 4HZ3A 1GN2A 1MA1A 4KNVA 3O65A 1YYXA 2LSEA 1O3UA 3VM6A 2P1AA 4KI2A 2F23A 2EPKX 3C8ZA 1M4UA 3TOMA 2L6LA 4C3DA 1GTOA 3CHXA 4YHHB 3G4XA 1JX9A 5JCOC 5L3FA 2MWQA 3HKDB 3B29A 5KYYB 4LF6O 1D1CA 1ZL8B 2OWOA 4R8CA 5H6RA 2P06A 2H8PC 4NVPA 4IB4A 3K0GA 1LIHA 4L87A 3IAYA 1H6GA 4XLNF 5IDJA 1SERA 3I55V 4FFKA 2Z15A 3L1MA 2HJDA 5IE9A 5AC5A 2QWPB 5E2QA 2Q67A 4C3EA 2PZSA 3P32A 4PI0A 2FYUH 4O4LB 4EFBA 4G28B 3JARB 4LF7O 3C90A 1E2XA 1TFKB 2WLJA 1ZU5A 3JSZA 3ABLC 2J8WA 4E4EA 4MVZA 2IBFA 1URFA 2R72A 3X2QB 2GAQA 3ZMUA 3ABUA 1N4CA 4PDVA 4FWVA 4CIHA 3EVKA 2D3OW 1GO3F 2AHZA 2ZM6B 4DUYO 4YIOA 2CGEA 2HZ8A 3OFNG 3F5WC 4WF9V 4AQYO 1FFTB 5CB4B 1NU1H 3OTOO 2CYDA 2AU5A 2XAGA 4BIZA 4EB6A 2RJZA 4KXRA 2CDYA 4KC9A 2EIKC 1K9MW 3ZMVA 4WFAV 1TVKA 5JH7B 1BCCH 2CH7A 5L0FA 1NFNA 1Q86W 5B5EZ 1FAFA 2YL3A 3OTFA 2NLJC 4WFGA 3C8GD 2UUBB 3JRMO 3W7XA 3K33A 4YT8A 1YJNV 1AI4A 1IDSA 4JYAO 4P30A 2ZT9B 3LNRA 4UFZA 2YUAA 5CBFA 4IGGA 2HMZA 1FXKC 1YEWA 2F1MA 2ZXWC 2ADPA 1AR5A 1R6NA 2VS0A 3JRTA 1YZAA 4LBEC 5L3BA 4OD4A 5JS5A 1XQ8A 2R7XA 1SQXH 4I50A 4PA6A 1KTMA 1AJQA 3B40A 4CX9A 4O2AB 3F46A 2PNOA 3RQGA 3L70H 2OG2A 1ZHYA 2BSKA 4NTFA 3B09A 2IH1C 4FLTA 2JPUA 4F6RA 3MD0A 4O6NA 1WGWA 1A7VA 1OQCA 1H38A 4XEKA 4X0RA 2Q9BA 2HR3A 3APOA 4RUFA 1ZVZA 1G5ZA 3AJMA 4N4WA 3GEEA 4NTWA 4NTBA 3TJ5A 3FYIB 1LR1A 4FLZA 1Q43A 4F6EA 3SPHA 5T3TA 1S77D 3CRMA 3N27A 3M79A 1VQNV 1EKYA 5CBHA 1Q81W 2ILMA 1QQ3A 3VF0A 5GONA 4F6RB 1XZQA 3ZRWA 3TK1A 1JFFA 4GX1A 4PK4A 1RM1C 5KHHA 2XLWA 2HSBA 4GQHA 2NUTA 1W2WA 5KA6A 1R5ID 3U0ZA 3CCJV 1IURA 4NB5A 1L8DA 1QVFU 4LH7A 4E0HA 2PI4A 2QJ1A 2JEUA 3IEEA 4UVCA 4DRIB 1UG7A 1O87A 4IAQA 1TUBB 1XHZA 3ABMB 3U9JA 1LKXA 2IM9A 3TXSA 2F43G 3O39A 2XAHA 1OV9A 3U8VA 3M4BA 1U89A 1HNXB 4DR7B 4O4IB 3E83A 2XAFA 2ZD9A 4D6TH 1J8MF 3D36A 3ZHRA 3VRCA 3K08A 2PUSA 4MVOA 2EILC 4DR1B 3JAKB 4B7EA 1R3JC 4Q4ZF 3OT7A 1XL6A 4MVRA 1T5OA 5EHHA 2DB4A 3C8GB 3ZTZA 1VEWA 4ULWA 1MMNA 2PX3A 3M8AA 1OCRC 1SC5B 2DMXA 2ZQMA 3A0RA 4KL1A 4J32B 3C63A 3RVZA 1YVWA 3ZRWB 4Z9JA 5CA0B 2EZPA 1NH2B 1CGOA 2YQYA 5JCOA 2NUTB 3L0IA 2X0CA 3T6GB 2J7PD 4U5FE 1B3QA 4YJ2A 3JZ0A 256BA 5CI8A 2L35A 3CEIA 4YWQA 1DK1A 5BQIA 1FFXB 3IQTA 2XUMA 2PTMA 1VQ5V 5COFA 4NCQA 2UUHA 1V9PA 1BE3H 2ZDIA 5E3CA 4X62O 3PHF2 2YL0A 4DK1A 4X65B 1VF7A 1AILA 4N23A 4UCOA 1NR7A 3X2QC 2A9HA 1J95A 1V55B 5LA6B 4DR5O 2F4VO 4GKKB 2OYQA 2RQ6A 5KAIZ 3F5TA 1PD1A 5A6KA 4QPJA 4NXNO 1SQFA 4HE8D 1FKAO 2FKXA 1Y76A 2QSAA 1GM7A 4FIPC 3SZRA 4JPRA 2G3VA 1FFTC 2TMVP 4UV8A 1ENVA 3I5QA 5GONB 1H2LA 1XEQA 4X64B 3TCUA 3AG2C 3KH2A 3RN4A 3BA8A 2WLIB 4OXSA 3JTLO 2QE7G 1ZHTA 2P5OA 4ASUG 1WPBA 2ZE5A 1OZ0A 2YEVB 3JSNA 4JAAA 2WSSG 4JGSA 2YC0A 5IYZB 4DRXA 3UGOA 2VWKA 4X1IA 1VQMV 4DR3B 4HNAA 3AEIA 3RYIB 4I7ZB 3EFOA 5H9CA 4ZHQA 5J2TA 2ODMA 1TR2A 3TK0A 1Y67A 2I8BA 5DVWA 3L34A 2UXCO 1O5HA 3EHMA 3ASNC 1CP9A 3EG9B 1D0XA 1Q6UA 2FB5A 2JJ1G 3APQA 4X1KB 1IVSA 1E83A 2GFHA 4AE4B 3BEHA 3QW1A 1EFRG 5EC2C 1N0JA 2WA3A 5JJEB 3ASOB 1WATA 2GA0A 3FB7C 5DQTA 3C62A 1AJPA 2ZCEA 2PYLA 1YDIA 1V74B 1R3LC 4KUMA 3SPIA 4JCHA 4O6YA 4JI2B 2IBZH 4UB8Z 3ZVRA 1HWYA 3D36C 1IBMO 4CH5A 2YLGA 2M64A 1WPXA 2YHSA 2WLKA 2CTPA 3WB0A 1L7CA 5KYNA 3LAYA 3W7WA 4AL0A 1TWCA 5BXZA 3R65A 4KBLA 4UV9A 5IWAO 2MYSA 2YEVA 4Z1VA 1TWAA 2AVKA 1A41A 1FFXA 4YL3A 4WFHA 4DR3O 3FFQA 3G67A 4FVMA 3RBZA 3OW2U 1S7ZA 3FAVA 5JVDA 3NDBB 4U5GA 4G7HF 3JD4A 4BIUA 1D1AA 1SRYA 4IAOA 2UXDO 2QEXV 3W7UA 3OEHG 3CCVV 4D7SA 2Q0OC 1RPOA 1VMGA 4NYKA 2GBOA 3RF3A 4CDAA 1S5HC 1RKEB 4DR7O 2H8AA 3QW0A 4HFKB 1BL8A 4DR4B 1KP3A 1SZTA 3EGXA 1VLSA 4IIJA 1H2MA 5E3AA 1Z7Qc 2L6HA 3IQCA 1N36O 2R7VA 2LW1A 2A0LA 1K05A 2IU0A 1YLMA 3QNEA 2WPDG 5A6BA 2GHYA 3B2EE 1M56C 3EHNA 1KB9F 4O2BB 3RYFB 1HNWO 1FJGB 1YTFD 3EG9A 4X1KA 3BRJA 3W8IA 4X1YA 3V5XA 3JYCA 4WFFA 1PM9A 3FB8C 3RIPA 4JI8O 2ZKOA 5KA5A 4BW9A 4NY3A 3T1CA 1TWHA 4P9PA 4OIOF 4UVBA 3ML0A 2JJ2G 2CK3G 3B8NA 5JT4A 2H3OA 2ZR2A 5C93A 3GORA 4NC3A 2A06H 3AGTA 4B6IA 3MHHC 1F51A 2OCHA 2UUCO 3R7CA 5ITZB 1NFOA 1JMWA 1JFFB 3KYJA 5LL6Y 4I5SA 1VYKA 1S0VA 4J7KA 1M93A 1XMOO 2HHHB 1D0YA 2AHYA 2MHRA 3VYWA 4DR4O 3JATA 3ZRVA 4E18A 1PL0A 1WAZA 2LQGA 2XLDA
chains in the Genus database with same CATH topology
3ZIBA 4FESA 2KNHA 3EFOB 2JIZG 4PDLA 1FMVA 4F4BA 4PA4A 1AI5A 3KG2A 3AG1B 3WFVA 1VMAA 2HV6A 2H7OA 3UMIA 3EJNA 2Q9CA 3JYHA 3G4SV 4U5DE 3QO8A 4U5CE 4BW5A 3W2VA 3VOUA 2WWWA 2DQ0A 3OMNB 3EGDA 3FB6C 2DYRC 3NYJA 5B1BC 4HEAJ 4I1OB 1ROPA 1ST6A 2R7RA 5EC1C 5L3EA 3P30A 5DM6V 4PJJA 1MMAA 5H6QA 4E2LA 3I5PA 3UR3C 5DS5A 1KD1W 2H7BA 2IXNA 1RPRA 3K03A 3HB3B 3HPLC 1KU2A 1GM9A 2XOKG 2PFDA 2WLIA 3E9VA 2DW4A 5L3CA 3OA1A 2WL8A 2XRHA 2LFSA 1NJIW 4RUEA 3MHSC 1VQKV 1ZU4A 1NZEA 4YT2A 5KYUB 3PJSK 1CEZA 3CC2V 2P7TC 4HZ3A 2W45A 3ITFA 4XLPF 3GWOA 4KNVA 5L3VA 2M4EA 2LSEA 2R7OA 1F4NA 2B1GA 5DQZA 5B1AB 4KI2A 1OCRB 2B1IA 1E1QG 1Z63A 3TETA 4C3DA 3T4DA 3OGCC 1ZHWA 3KL4A 4OINF 4DVYP 3LLKA 1GTOA 4BAYA 4MQ9F 3W8HA 1PD3A 1PD0A 4QE9A 4JTCB 1JX9A 5L3FA 1XL4A 1QR8A 2MWQA 5KYYB 5DS6A 4RO2A 4JAVA 1D1CA 1NU7D 2J9WA 4JJFA 1KP2A 4R8CA 1V54C 4F4LA 5H6RA 3EGXB 4BJ5C 2H8PC 4C7OA 3K0GA 1K4CC 2IJHA 4L87A 3T2MA 3FHDA 4G7ZF 1DTOA 3K1IC 2DWDC 2Y69C 3DAGA 3LDDA 4XLNF 1JCHA 3ZCCA 5IDJA 1SERA 3I55V 4FJCC 4FMTA 2Z15A 1JVMA 1K5SA 2EIJC 5L3DA 1NVPB 2WVOA 2Q67A 4O79A 5E2QA 4C3EA 3P32A 3G6EV 3I4UA 4G28B 3QMKA 4E7SA 3WG7B 3K66A 2W0FC 3T4RA 2ATKC 4PFOA 3DJUB 4ZLDA 3JCZA 2WLJA 4A2NB 5BUOA 1ZU5A 3JSZA 3ABLC 4CS9A 2JK5C 4XWJA 2H7VC 5EK0A 2ITDC 2DWEC 4MVZA 1BHBA 1JQ0A 2IJKA 1NG1A 2DGJA 3SNHA 5HFMA 4GX0A 1QBZA 3X2QB 2IJJA 2IJIA 3RKOF 3ZMUA 3F47A 3LS0A 3ABUA 4DO2A 4UXNA 4PDVA 1M57C 2QA4V 1V55C 3O6XA 4FWVA 5LGNA 4JJGA 4JURI 3VAYA 3OUFA 3NKDA 4YT5A 4CIHA 2D3OW 2KB1A 1TKNA 1GO3F 2W6JG 4I1MA 1K3EA 2AHZA 4QDLA 4EWCA 3X1OA 3CD6V 4DOZA 2CGEA 4EKWA 2QTVA 4BJ1A 3OFNG 2WLNA 3F5WC 3SYAA 4WF9V 1GK9A 2JEXA 3VBBA 1TUEB 2YSUB 1ZHXA 2UXXA 5LHGA 1GKFA 3OUSA 1S72V 4O7GA 1FFTB 3AG4C 4MVUA 5BZBA 1NU9C 4BJ6C 4H37A 5KUMA 4MTXA 4O6MA 3CZ6A 4Q20A 1W0KG 1ZWIC 3AG2B 3G71V 2J9UA 2XAGA 5T3WA 2EINC 4XDJA 3HJCA 4TT3G 3E8BA 4BIZA 4PELA 1L1FA 2IXMA 1E79G 1EZJA 4KC9A 2EIKC 4CZZA 1K9MW 3ZMVA 4RQEA 3SPGA 4WFAV 2KJGA 1NBMG 2E87A 4PJNA 2CW0F 5L3QA 2B5UA 2NNUA 2P6JA 2X6CA 3OMIB 1SZIA 3DAFA 2HVKC 1BMFG 4J9ZB 1Q86W 4DBRA 1SESA 1NH2D 4WFGA 2NLJC 3SYPA 2ZXOA 2OTLV 4ZLCA 1GM8A 5B3SB 3CSKA 4OIRF 2KQ9A 2HG5C 1MG1A 3LSQA 3SJQC 3W7XA 3K33A 1OCZC 4YT8A 2H94A 5IY5C 1YITV 4PA7A 2QY9A 4CS7A 1YJNV 1AI4A 1F4MA 1ORQC 3E2EA 1QZXA 4P30A 4R7CA 1KKDA 3LNRA 4LLCA 3ASNB 1KECA 5CBFA 1SMYF 2HKOA 4HFFB 4GEHA 1ZYRF 1FXKC 2A79B 4FPPA 2PP4A 1OHHG 2ZDIC 3OWTA 3CCQV 1KC8W 3JCUQ 5KYXA 4JASA 2ZXWC 3E8FA 4PJLA 1R6NA 4UUJC 3OEOA 2DYSB 3ETEA 2X6AA 1CPYA 4LBEC 5L3BA 3CCRV 3JRTA 3ABKC 1W0JG 1VQPV 4OD4A 3CCMV 2R7XA 1MNDA 3D3IA 4MVSA 4I9WA 4PA6A 3FDQA 5KYUA 2UXNA 4RBNA 2QM8A 1AJQA 3F46A 4JZAA 1YHQV 4WFEA 1G8XA 2PF4E 4Q7CA 2DQ3A 3SEOA 4JW1A 4MT8A 2OG2A 1K34A 5LHHA 1ZHYA 3NYMA 3CMAV 2IH1C 3GANA 1JPNA 4MTFA 3MD0A 5J9PC 4O6NA 1M9NA 1WGWA 2A6EF 4MTGA 1FXVA 1H38A 4X0RA 4QE7A 2EIMB 1FMWA 2HR3A 2XAQA 1M56B 2Q9BA 3KKBA 4RUFA 4U5BE 1VQ6V 3OE7G 4KFMA 4BJTA 5EBWC 2G62A 2X0LA 4JAUA 1K97A 1BR1A 3FYIB 3M1CB 2Q68A 2P67A 3T4ZA 3ZMSA 1OCOB 2CNWD 3Q6MA 2R9RB 1EBOA 5B1BB 4XDKA 2PI5A 4GT1A 3SPHA 5T3TA 1S77D 3FB5C 5LGTA 4HAMA 2Y48A 1VQNV 2FGYA 1PNKA 5CBHA 1Q81W 3ZN1A 3H01A 3Q7LA 4K7BA 4BJ5A 5KYXB 4K0DA 5HFLA 3RH3A 3K79A 3LEVA 4J30B 3ASOC 3SYCA 1FFHA 2A68F 3NKEA 3K9AA 4PK4A 3ZRWA 3TK1A 3IFXA 3K06A 4GX1A 3SYOA 2X6BA 4X88A 4QNHB 4ZKIA 1RM1C 2Y39A 2NUTA 3QZCA 1W2WA 1G4YB 1IW7F 2R9IA 5KA6A 3STZC 3CCUV 2CDQA 2ZR3A 1LNQA 4X8AA 5B1AC 1Z23A 4MW3A 3CCJV 2IYLD 1QVFU 4PDRA 4PJMA 2J0WA 5EBLC 1MMDA 2PI4A 2D5RB 3MLGA 1THZA 2JEUA 4J9YB 3IEEA 4UVCA 5EBMC 2J0XA 4RQFA 3CQZA 3FVYA 1O87A 1OKKD 3K7DA 3T6BA 2VH3A 1JJ2U 2WZFA 2Y3BA 3B9QA 3ABMB 2NUPB 3AG1C 1LKXA 3Q7GA 3CCSV 2F43G 3LS1A 2C03A 3KMIA 3O39A 1OKKA 3E8HA 2XAHA 4YXWG 1VQ4V 3E70C 4BJ6A 2A69F 1I5YA 3N0TA 2DYRB 4GX2A 3CXCU 2XNDG 3ZSUA 1R73A 4N06A 3E83A 2XAFA 2ZD9A 3DM9B 4AX2A 1IXMA 1J8MF 3D36A 1AR1B 2IXOA 3DGEA 3EHBB 4CSAA 1FS0G 2MK3A 3K08A 1PNLA 2IW5A 1VYIA 3LLIA 2HFEC 1K7DA 2EILC 4MVOA 4GCZA 4MSWC 2L81A 3IGAC 2QM7A 3EPVA 4CS8C 3Q6NA 2C2AA 1R3JC 5DN6G 1NVPD 5B1OA 5CI9A 4Q4ZF 1XL6A 3DTUB 4MVRA 5GW7A 5EHHA 5FCLA 5DS4A 1H8EG 4MW8A 4ULWA 1MMNA 4GX5A 4IJJA 2PX3A 4BG0A 1OCRC 2ZQMA 1COWG 3A0RA 2V1DA 1K92A 4H33A 1VQLV 4J32B 3RYLA 2XXAB 2Y3GA 2M7WA 5CMUA 3RVZA 4N21A 5D91A 3ZRWB 2HJFC 2WLLB 1P4RA 4YT4A 3LDCA 2EZPA 2EJRA 1NH2B 3ZIAG 3L0IA 2NUTB 4IWBA 2R7TA 2WVQA 2J7PD 4U5FE 2J46A 4JF3A 1VQ7V 4ZBMA 5L3GA 1R3IC 5CI8A 2OCCC 2OT5A 4P2ZA 4YWQA 3UMKA 4WJ0A 4YN0B 1RJ9B 2R7WA 2NUPA 2WVNA 4PFPA 2EINB 1VQ5V 2Z3YA 3S28A 2X7RB 3LDEA 3CPWU 2IXPA 1P7BA 4FK5C 1TWGA 5LBQA 2ZDIA 2WZGA 4FX5A 5E3CA 3PHF2 3SYQA 3V7OA 2G3KA 2XXAA 2Q6AA 1OCCC 3JD0A 5CA3A 1Q7YW 3FKSG 1VQ9V 4PA3A 3GB7C 3T6JA 3UGPA 4N23A 4YJWA 3E8GA 4C3BA 1NR7A 3X2QC 2A9HA 1Y4MA 3E86A 3UKMA 3B8MA 3UM7A 5B3SC 3EQLF 3NYLA 1J95A 1QLNA 1OCZB 1V55B 3LNMB 3ECSA 3LUTB 2WAMA 2P7VA 1JPXA 4G27B 1GMGA 3B0PA 1NKDA 4MTOA 1PD1A 4QPJA 2R7QA 4HE8D 1Y66A 2J7PA 5F5HA 1QLEB 2WLMA 2JD3A 2P90A 1I5XA 1LVKA 4AE4A 2KGOA 1GM7A 2EBOA 4FIPC 1PCXA 2O9XA 3SZRA 4JPRA 1NR1A 4WCEV 3CYOA 3QO7A 1FFTC 4UV8A 3W7TA 1M2VB 1ENVA 2G3VA 2Q3TA 3I5QA 1F23A 5F5FA 1MOFA 4XBFA 2W4MA 3TCUA 1K8AW 3AG2C 3KH2A 4OIPF 3ZRXA 2WLIB 2QTOA 4OXSA 2QE7G 5EGYA 5KYWA 1VOMA 1ZHTA 1WLEA 3N24A 2YZSA 3HLZA 3AG3B 3ZC4A 1FXKA 3FAJA 1DF4A 2V7QG 4ASUG 4LACB 3ABTA 1OZ0A 2YEVB 1MNEA 2P6VA 3M99B 3DJNB 3F7VC 1LS1A 3UMHA 1DF5A 3K3WA 4LLEA 3QO5A 3WODF 2WSSG 2A6HF 1FXHA 4JGSA 4MVQA 3UGOA 5IYBO 5LGUA 3SPCA 3POVA 4C7OB 2Y69B 3JD3A 1BR4A 2ZPAA 4M63A 4U5EE 3EZHA 1VQMV 4JTDB 4LP8A 3B0UX 3AEIA 2Z5UA 2IH3C 4UVAA 1D0ZA 1S3JA 5H9CA 5IY5B 3EFOA 3K1HA 1YJ9V 2R7UA 4XDLA 1TR2A 2VASA 4R6ZA 4P6IC 2WZLA 1MSWD 2I8BA 5DVWA 3WG7C 3L34A 2IU3A 1O5HA 3ASNC 3EHMA 1CP9A 3EG9B 4RAIA 1D0XA 2JJ1G 1OCOC 4IRUA 2V3CC 1FXKB 3W7SA 2GFHA 4AE4B 2WLHA 3BEHA 3RFYA 2W4BA 1EFRG 2DYSC 5EC2C 3ZMTA 1QVGU 5IYCO 1M90W 4HYOA 3EH1A 1M57B 3W2WA 3ASOB 1FTSA 3FB7C 5KUKA 3S27A 4DBQA 3F7YC 5DQTA 3STLC 3CCLV 1AJPA 3EH2A 5E1AC 4CS8A 4R50A 3NG1A 2VB6A 1YJWV 2XAJA 4CBEA 4E7ZA 4H4KC 1R3LC 4I44A 4KUMA 3SPIA 4JCHA 4O6YA 2KW3C 1M2OA 4OIQF 4EBBA 3ZVRA 4QJFB 3IC7A 1HWYA 1H2GA 1V54B 3OAAG 1PNMA 1KQSU 1D1BA 2W6IG 3K6BA 3AG4B 3EZIA 1DLBA 1WPXA 3OR7C 4QI0A 4TWKA 2YHSA 2WLKA 2BE5F 1ZHZA 4ANJA 5KYNA 1BHAA 2LFRA 3W7WA 1JPJA 1TWCA 3AQCA 3LAYA 4LERA 5HSWA 2IOQA 3R65A 1SETA 4WFBV 4KBLA 2EIJB 3DMDA 4U7NA 4UV9A 5T1DB 2MYSA 2YEVA 3JD1A 3AQBA 1QCEA 4PDMA 1TWAA 1AI6A 1RJ9A 4BEJA 1PKXA 2XSEA 4WFHA 3ABLB 3FYEB 3RBZA 3OW2U 1S7ZA 1MABG 4PA9A 1VK5A 1Z6AA 3MX3A 3ZG1A 4CSAC 4TSFG 3NDBB 4MS2A 2A1DD 4XTKA 2HV7A 1Z3IX 4U5GA 4G7HF 3JD4A 1UJWB 3SYNA 2BOCC 4BIUA 4KP4A 3RVYA 3B77A 3K04A 3ZRSA 1D1AA 1YIJV 1SRYA 2BOBC 1S76D 2W9YA 3CP1A 4LC1A 4IAOA 2J9VA 2QEXV 4DVZA 3W7UA 2K1EA 3OM3B 4G7OF 3OEHG 3GODA 5KYYA 3CCVV 1JOYA 3SP1A 4U7OA 2WLLA 1M1KW 1YTFB 2WB7A 2CNWA 3ETDA 3PMRA 4QI2A 1RPOA 5D92A 1K73W 2ZXWB 3OR6C 4I3MA 1G8MA 3NRHA 3CMEV 5LHIA 4GYTA 2X51A 3I56V 1MMGA 1N8RW 2V26A 4CS9C 1Q82W 3ABKB 4G0HA 2L9JA 5E33A 3E35A 1BR2A 2R7SA 3DM5A 2B0JA 1NQTA 1S5HC 2JDIG 3S0XA 3ZN0A 3LJBA 3CC4V 2XL4A 4HFKB 1BL8A 1KP3A 1SZTA 2ITCC 3ABMC 3EGXA 4U5HA 2EIKB 4JTAB 1YI2V 1VQ8V 2OTJV 1J8YF 2J45A 2NG1A 3HTKC 1B6QA 1Z5ZA 2HVJC 4MVMA 5B1NA 2Q9AA 5CBGA 5E3AA 3N2ZB 3ZMZA 5KYWB 2ZXRA 2Q69A 3LSSA 4RD9A 4G2KA 3CC7V 3EGDB 2R7VA 2A0LA 3RW0A 2ZXPA 1AJNA 2IU0A 1YSCA 4W8KA 3QNEA 1E1RG 2FTKA 2EIMC 2GHYA 2GSMB 2EILB 1M56C 2WPDG 3CCEV 1IZMA 2FFHA 3EHNA 4QIWF 3OMAB 3DZAA 1YTFD 3EG9A 4QPKA 3W8IA 5DLJA 3LESA 1SF8A 1QR9A 1AROP 3JYCA 4WFFA 3ZJZA 4P9OA 4RDAA 3S29A 2PX0A 3FB8C 4Q5SF 4Z1MG 1AI7A 4DXWA 3RIPA 4JVSA 3JT1A 5KA5A 3NXSA 4NY3A 1W2BU 4LCUC 3T1CA 1VQOV 3UNGC 1QLEC 4X89A 3K0DA 2HLDG 1K4DC 4P9PA 1TWHA 4OIOF 2C04A 4UVBA 3TD7A 4JYBA 4AK9A 5IYDO 2LP7A 3JD2A 1RM1B 2Y3HA 3E89A 3ML0A 1R3KC 2JJ2G 2CK3G 3B8NA 2OCCB 3H65A 1H8HG 1K5QA 2ZR2A 3OEEG 5C93A 4JYCA 4B6IA 3MHHC 1F51A 5CN0A 2XASA 3ETGA 1K33A 3EFFK 4CBCA 1R6KA 2Y3DA 3DXJF 3B0VC 3BY6A 3DD7A 4I5SA 1VYKA 2EZOA 1S0VA 3AG3C 2QKSA 1D0YA 4MNDA 4OD5A 2AHYA 1N1CA 3VYWA 3SPJA 3ZRVA 4KNWA 5FL7G 1PL0A 1M2VA 1OCCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCZ C;  4GX5 A;  5IY5 C;  1OCR C;  4PA7 A;  4H33 A;  4PDL A;  4PA4 A;  1ORQ C;  3KG2 A;  3RVZ A;  3OR7 C;  4P30 A;  4R7C A;  1KKD A;  4TWK A;  2HJF C;  2WLL B;  2WLK A;  5CBF A;  3LDC A;  4BW5 A;  2A79 B;  3VOU A;  3FB6 C;  2DYR C;  5B1B C;  3R65 A;  2ZXW C;  3E8F A;  5EC1 C;  4ZBM A;  4UUJ C;  1R3I C;  2YEV A;  2OCC C;  2X6A A;  4PDM A;  4LBE C;  4P2Z A;  3ABK C;  3K03 A;  3HPL C;  4MVS A;  4WFH A;  2WLI A;  4I9W A;  4PA6 A;  4RUE A;  3RBZ A;  3LDE A;  1P7B A;  3PJS K;  4PA9 A;  2P7T C;  4HZ3 A;  4WFE A;  4MS2 A;  3SYQ A;  2Q6A A;  1OCC C;  2BOC C;  3TET A;  3RVY A;  3K04 A;  3ZRS A;  4PA3 A;  3OGC C;  3GB7 C;  3T4D A;  2BOB C;  2IH1 C;  4QNH B;  3E8G A;  4MTF A;  4QE9 A;  2K1E A;  4JTC B;  3X2Q C;  1XL4 A;  2A9H A;  3E86 A;  3UKM A;  4MTG A;  3UM7 A;  5B3S C;  4RO2 A;  2WLL A;  1J95 A;  3LNM B;  4QE7 A;  1V54 C;  4R8C A;  3LUT B;  4F4L A;  2H8P C;  3OR6 C;  4RUF A;  3K0G A;  4KFM A;  1K4C C;  4G27 B;  5EBW C;  3T2M A;  2DWD C;  2Y69 C;  4MTO A;  3LDD A;  3SYO A;  2Q68 A;  2WLM A;  3T4Z A;  1JVM A;  1S5H C;  2R9R B;  4XDK A;  2EIJ C;  3SPH A;  2Q67 A;  3FB5 C;  1BL8 A;  3ABM C;  2ITC C;  5CBH A;  1FFT C;  4JTA B;  4G28 B;  2W0F C;  2ATK C;  3ASO C;  2HVJ C;  3SYC A;  4MVM A;  3TCU A;  2WLJ A;  3AG2 C;  5CBG A;  3IFX A;  3ABL C;  3K06 A;  2JK5 C;  2X6B A;  2WLI B;  2QTO A;  4GX1 A;  2ITD C;  2DWE C;  2Q69 A;  4MVZ A;  4OXS A;  4X88 A;  5EK0 A;  4GX0 A;  2A0L A;  1G4Y B;  3RW0 A;  3STZ C;  1LNQ A;  4PDV A;  1M57 C;  4X8A A;  1V55 C;  3F7V C;  2EIM C;  5B1A C;  4MW3 A;  1M56 C;  3OUF A;  4MVQ A;  2KB1 A;  4PDR A;  2AHZ A;  5EBL C;  3SPC A;  4EKW A;  4JTD B;  4LP8 A;  2WLN A;  3F5W C;  4J9Y B;  3SYA A;  5EBM C;  2IH3 C;  3JYC A;  4WFF A;  3ZJZ A;  4P9O A;  3FB8 C;  3OUS A;  4XDL A;  4DXW A;  4R6Z A;  3AG1 C;  3AG4 C;  4MVU A;  5BZB A;  4H37 A;  4LCU C;  5KUM A;  3WG7 C;  3T1C A;  3ASN C;  1QLE C;  4X89 A;  3E8H A;  3K0D A;  1K4D C;  4P9P A;  1OCO C;  1ZWI C;  4RAI A;  2EIN C;  4XDJ A;  4GX2 A;  3E8B A;  3E89 A;  2WLH A;  3BEH A;  3E83 A;  1R3K C;  2ZD9 A;  2DYS C;  5EC2 C;  2EIK C;  3SPG A;  4HYO A;  3K08 A;  2HFE C;  3FB7 C;  2EIL C;  4MVO A;  4MSW C;  3F7Y C;  5KUK A;  4CBC A;  3IGA C;  3STL C;  3EFF K;  2X6C A;  5J9P C;  2HVK C;  1R3J C;  4J9Z B;  5E1A C;  4R50 A;  1XL6 A;  3AG3 C;  2QKS A;  4WFG A;  2NLJ C;  3SYP A;  4MVR A;  2AHY A;  1R3L C;  3SPJ A;  3SPI A;  2HG5 C;  4MW8 A;  3SJQ C; 
#chains in the Genus database with same CATH topology
 3EFO B;  4F4B A;  5FNV A;  1IBK O;  4PA4 A;  2GDS A;  1JOG A;  1AI5 A;  3KG2 A;  2F95 B;  4DV7 O;  2XLH A;  5JVE A;  1YA7 O;  1HNX O;  4U5D E;  4CH4 A;  4OPH A;  1XMO B;  1QQC A;  2V4D A;  4LF5 B;  1H9T A;  4B3R O;  1Y4C A;  3I5P A;  3UR3 C;  5DS5 A;  1KD1 W;  2I15 A;  4YY3 B;  2XM4 A;  1RPR A;  3K03 A;  3HB3 B;  3S27 A;  3HNL A;  3A9C A;  3OA1 A;  2WL8 A;  2XRH A;  2LFS A;  4RUE A;  1ZU4 A;  4YT2 A;  3PJS K;  3ITF A;  2P7T C;  2K9P A;  4FLY A;  5B66 Z;  5L3V A;  3C3S A;  2M4E A;  1F4N A;  2B1G A;  3CXH F;  4YIP A;  5LOV B;  5DQZ A;  3V5Y A;  4DRJ B;  1E1Q G;  1HW2 A;  1Z63 A;  2HJM A;  1LUV A;  1ZHW A;  5J2U B;  3LLK A;  4MQ9 F;  2QTS A;  1XL4 A;  1QR8 A;  2ASR A;  1NU7 D;  2J9W A;  4JJF A;  1GGQ A;  4BJ5 C;  1V54 C;  3K58 A;  3EGX B;  2LQT A;  3THO A;  3T2M A;  3FHD A;  1CPR A;  1DTO A;  4LDR A;  4D4X A;  4JYY A;  3LDD A;  1JCH A;  2Q7E A;  5K1X A;  3H1K H;  2XLO A;  4JI6 O;  2Q4F A;  1KUQ A;  1K5S A;  4YJ2 B;  3KCY A;  3G6E V;  3I4U A;  4IIJ B;  3QMK A;  4E7S A;  5EZY A;  3T4R A;  4PFO A;  3JCZ A;  4A2N B;  2JK5 C;  2FL4 A;  3KKY A;  2ITD C;  3ATP A;  1BHB A;  4X1Y B;  1QBZ A;  1N32 B;  1FPO A;  3WHN A;  4BEM J;  1I0H A;  3O6X A;  3VAY A;  1US6 A;  1ZLZ A;  2EPM X;  1XDC A;  3J80 N;  2KB1 A;  4QDL A;  2F93 B;  1K3E A;  3X1O A;  1NZ6 A;  1M6T A;  2YXH A;  2KK1 A;  4CDY A;  1VLT A;  2QTV A;  2WLN A;  5C8Y B;  4ICG A;  3W4Y A;  1TUE B;  4JIO A;  3L8I A;  1D5A A;  2UXX A;  5LHG A;  1GKF A;  1ZHX A;  2ZE7 A;  2YVK A;  3LEO A;  2NR5 A;  4LWS A;  5BZB A;  4BJ6 C;  4H37 A;  3GWK C;  4FAP B;  2YIC A;  3CZ6 A;  4Q20 A;  3E22 A;  3JAS B;  2EIN C;  4EEQ A;  3DXR B;  2KQX A;  5KAF Z;  2LO1 A;  4PEL A;  3HJC A;  1L1F A;  2IXM A;  1EZJ A;  1E79 G;  1TGO A;  3SPG A;  2KJG A;  4OGQ B;  1NBM G;  2E87 A;  3KYI A;  2CW0 F;  5L3Q A;  3S3X A;  2G38 A;  2P6J A;  2W0X A;  2HVK C;  4DBR A;  5JWP A;  1SES A;  1NH2 D;  5JLI A;  2ZXO A;  1GM8 A;  5B3S B;  4DV3 B;  4OIR F;  2KQ9 A;  1MG1 A;  1K40 A;  3LSQ A;  1M5I A;  5JUA A;  1YIT V;  5IY5 C;  2QY9 A;  4CS7 A;  1XOU A;  3RQE A;  1F4M A;  4DYL A;  1SMY F;  2HKO A;  4HFF B;  2NSF A;  1ZYR F;  4FPP A;  2A79 B;  2ZDI C;  4BPM A;  2B0H A;  4YK5 A;  4JAS A;  3CRR A;  3DC5 A;  1CPY A;  1VQP V;  1YJG A;  5IT9 N;  1MND A;  4MVS A;  1ZW3 A;  5J2U A;  1H7I A;  4I9W A;  4CJG A;  2UXN A;  2BC5 A;  3WB1 A;  4B7K A;  3HKB A;  3SJC C;  1O9H A;  4JZA A;  4LDK A;  2XT9 A;  1VB5 A;  2PF4 E;  4FM1 A;  3FOP A;  3N2G A;  1PL4 A;  3VQW A;  3J81 N;  2E76 B;  5AGF A;  3NYM A;  1K34 A;  5LHH A;  3L72 H;  4B08 A;  3AGU A;  4I4T A;  3H9V A;  3UT5 A;  1QHT A;  2A6E F;  3ZBH A;  1FXV A;  4NTX A;  4W4L A;  1VAR A;  2XAQ A;  1GM5 A;  1M56 B;  4BWA A;  4IL6 Z;  4KFM A;  1HW7 A;  4QGP A;  2ADQ B;  3ETQ A;  2Q4P A;  4JAU A;  4Z9I A;  3WAQ A;  2Q68 A;  4DRH B;  2HEP A;  3CJH B;  2R9R B;  1EBO A;  4XDK A;  1JRA A;  3ICX A;  3CEX A;  2EPO A;  4HAM A;  2Y48 A;  1UFB A;  5FPO A;  3Q7L A;  3KCX A;  3ASO C;  3SYC A;  2A68 F;  1HNZ O;  3K06 A;  4QNH B;  2X6B A;  2Y0P A;  2JVD A;  4YHH O;  4PAC A;  3Q4H B;  4ZI7 B;  3STZ C;  3CCU V;  2CDQ A;  4O4H A;  4X8A A;  1J5E O;  3S3W A;  4K35 A;  2NSG A;  4MW3 A;  1NTM H;  3P3N A;  2IYL D;  2LD6 A;  3CJH A;  4X66 O;  2D2C B;  4J42 A;  5KLV H;  4TUY B;  5A6J A;  3HNI A;  3CQZ A;  1T9K A;  2YXY A;  4H44 B;  3S9O A;  3T6B A;  2VH3 A;  1JJ2 U;  4YY3 O;  2NUP B;  3AG1 C;  3L73 H;  3UO3 A;  3CCS V;  3KMI A;  3E8H A;  4IYH A;  2L6G A;  3E70 C;  2YIB A;  2A69 F;  1MZF A;  3CXC U;  2XND G;  4TV8 A;  1WWP A;  1RKE A;  4AX2 A;  3DM9 B;  1IX9 A;  3CS5 A;  1B68 A;  1JR8 A;  3LLI A;  1K7D A;  4GCZ A;  4MSW C;  3IGA C;  2QM7 A;  2N04 A;  3TUL A;  2C2A A;  5DN6 G;  1FJG O;  3DTU B;  3C18 A;  5BQH A;  2B9Z A;  2HP8 A;  5FCL A;  4BG0 A;  2Q0A A;  5CA1 B;  4H33 A;  1VQL V;  2M7W A;  2HJF C;  1YDX A;  3C8G A;  3LDC A;  4PV1 B;  1P49 A;  2Q7H A;  2WVQ A;  1SQP H;  5KHK A;  2HFI A;  4JF3 A;  1VQ7 V;  3PN1 A;  1ZL8 A;  1KMI Z;  3UMK A;  4YN0 B;  3K1I A;  2WVN A;  5E79 Z;  4I4T B;  1T01 A;  2DE0 X;  2IXP A;  3IPM O;  1TWG A;  4LR3 A;  2R03 A;  5CA3 A;  1VQ9 V;  2PBE A;  2ZNJ A;  4I50 B;  2FML A;  2DJV A;  3E8G A;  2HMQ A;  3FXH A;  3BA9 A;  3UKM A;  5B3S C;  4NQF A;  3B8M A;  1G6U A;  3NYL A;  3ECS A;  1QLN A;  2YID A;  3LUT B;  2WAM A;  1QVX A;  3TJT A;  4C7U A;  3U3F A;  1GMG A;  4X65 O;  3SDL A;  4UCR A;  2EUL A;  1Y66 A;  1F7Y A;  2R7Q A;  3K59 A;  3Q4H A;  4AE4 A;  4K8X A;  2ZNI A;  2EBO A;  4DV0 B;  5AG2 A;  1H2N A;  2JRI A;  1M2V B;  3W7T A;  1E86 A;  1HNZ B;  2QUP A;  1HR0 B;  2QTO A;  2VQF O;  1VOM A;  3N24 A;  4N6H A;  3IC9 A;  2Q8V A;  3HLZ A;  4TUY A;  1CXZ B;  2YS8 A;  5IJ0 A;  1ORY A;  4LAC B;  3ABT A;  2QNL A;  1H2K A;  2A0B A;  2P6V A;  3UMH A;  4RWU A;  3F7V C;  1LS1 A;  1DF5 A;  5A9G A;  3QO5 A;  1FXH A;  2E5L B;  5IYB O;  2GTS A;  3OTO B;  3JD3 A;  2ZPA A;  1Q3E A;  3EZH A;  1WOL A;  1GN3 A;  1RFY A;  1FAP B;  3HKE B;  3K1H A;  5JQG A;  1WB8 A;  4FZ0 A;  3R66 A;  4JEB A;  4XDL A;  1Q0M A;  2ICW G;  2YL1 A;  3BAA A;  5JH7 A;  3WG7 C;  4AI8 A;  5F2V O;  2KC3 A;  4RAI A;  2V3C C;  4B3M B;  1OCO C;  1KNY A;  4IRU A;  5IJ0 B;  2AW9 A;  1MMM A;  5LYJ A;  1YF2 A;  2DYS C;  3ZMT A;  4DV6 O;  5IYC O;  1M90 W;  3PCV A;  1M57 B;  2M6Y A;  1FTS A;  5KUK A;  3TOL A;  2VQE B;  2Z0A A;  1I4Z A;  4CS8 A;  3NG1 A;  3QVN A;  2XLM A;  2VB6 A;  1YJW V;  3FX7 A;  4I44 A;  1DOV A;  2BE3 A;  4OIQ F;  1H2G A;  4EIY A;  1PNM A;  1KQS U;  3OGI B;  1D1B A;  2W6I G;  3K6B A;  1JR9 A;  3AG4 B;  3EZI A;  3A0H Z;  4TWK A;  2KSD A;  4EHP A;  4U3J A;  2BE5 F;  1I7F A;  1ZHZ A;  2GUZ B;  2LFR A;  5HSW A;  2IOQ A;  3T9O A;  1NT2 B;  2EIJ B;  3JAL B;  4ZOL B;  4LF6 B;  1RKC A;  3S84 A;  3AQB A;  2Y4T A;  2XSE A;  4I0X A;  2LCH A;  3FYE B;  3DXR A;  3ZG1 A;  1SKV A;  4PA9 A;  1VK5 A;  4NR1 A;  2VCA A;  5KMG A;  4J41 A;  2A1D D;  4XTK A;  2HV7 A;  3ZHT A;  4ABM A;  4ONS A;  2BOC C;  2OKU A;  5TIS Z;  2W9Y A;  1S76 D;  1BBH A;  1JMK C;  4DVZ A;  3HKD A;  2P4V A;  2MW2 B;  3CX5 F;  4TQF A;  4U7O A;  1XNR B;  2WB7 A;  4DW1 A;  2CNW A;  3U2L A;  4QI2 A;  3M4C A;  3OR6 C;  4I3M A;  3NRH A;  5LHI A;  2RSE B;  4NTY A;  2E74 B;  1YA9 A;  4CS9 C;  4JI1 B;  2GV9 A;  3D8C A;  1WJZ A;  2AWC A;  2B0J A;  3JAW B;  1NQT A;  4LF9 B;  1I5N A;  3ZN0 A;  2DI3 A;  3LJB A;  5L0G A;  3CC4 V;  3CRA A;  2XL4 A;  1N32 O;  2ZIM A;  3RFR A;  4XPY A;  2GDC A;  2PGG A;  2ZE6 A;  3ABM C;  2D4U A;  4U5H A;  3L71 H;  1J8Y F;  3HTK C;  2NG1 A;  1AUE A;  1B6Q A;  2AZ0 A;  2HVJ C;  4MVM A;  2Q9A A;  1R4T A;  1KBH A;  2Q69 A;  4G2K A;  4I55 B;  1AJN A;  3BAB A;  1YSC A;  4W8K A;  1A32 A;  4IYI A;  3JAL A;  2FTK A;  2GSM B;  2G3K A;  2R7U A;  4O4J B;  5FNV B;  3O55 A;  5CA0 A;  2YLD A;  1HR0 O;  4NXM B;  2JGD B;  5DLJ A;  1SF8 A;  1SQB H;  1BQ0 A;  2F66 C;  1RSO A;  5IWA B;  2QKC A;  4DV5 B;  1RMV A;  3S29 A;  4P9O A;  3RYH A;  3N2K A;  4JVS A;  3GM2 A;  1OW8 A;  2QDO A;  3DE8 A;  4O4L A;  1QLE C;  1NTZ H;  4D4N A;  4JYB A;  4AK9 A;  5IYD O;  2LP7 A;  4EB6 B;  3U0C A;  4O4J A;  5J2T B;  1HE1 A;  1K5Q A;  4JI5 O;  3H65 A;  3OEE G;  2EPN A;  4UCT A;  1CPQ A;  1LM3 B;  2OEV A;  5CN0 A;  1BGY H;  3ZHQ A;  2Y3D A;  3BY6 A;  1U0B B;  2EZO A;  5JJJ B;  4OD5 A;  3NKE A;  4DUZ O;  3ZIB A;  3HKK A;  3G50 A;  3HKE A;  3NMJ A;  1ZAU A;  3D3Q A;  4ULV A;  1VMA A;  3AG1 B;  2CTR A;  3SXM A;  2H7O A;  1Y76 B;  4I0X B;  2UXC B;  2Q9C A;  4E0I A;  4U5C E;  4P9T A;  1EM1 A;  4BW5 A;  2Y0I A;  2RCV A;  3OMN B;  3K5M A;  1ROP A;  4ZOL A;  1XNR O;  3UO2 A;  3P30 A;  5DM6 V;  1XMQ O;  1MMA A;  3FAP B;  2A0U A;  4L8J A;  1X4T A;  1TVK B;  1KU2 A;  1GM9 A;  2XOK G;  3K5L A;  2DW4 A;  1VQK V;  5KYU B;  1CEZ A;  3GWO A;  1GQA A;  1WNS A;  4U9E A;  1OCR B;  3HKC B;  3TET A;  3T4D A;  3OGC C;  4OIN F;  4LF8 B;  4TV9 B;  1C03 A;  1PD0 A;  4QE9 A;  4JTC B;  2QE9 A;  1KP2 A;  4F4L A;  5A2Q N;  2IJH A;  1YYJ A;  4G7Z F;  3JSE O;  3K1I C;  2DWD C;  2Y69 C;  3C7J A;  4EFE A;  3ZCC A;  4LFA O;  1L3P A;  4FJC C;  4FMT A;  3J06 A;  4DRX B;  1NTK H;  1NSG B;  2WVO A;  3WG7 B;  4FM0 A;  2W0F C;  4B3R B;  3K66 A;  4K1O A;  3DJU B;  1T6U A;  2VQF B;  4CS9 A;  2H7V C;  3SNH A;  2DWE C;  4DV1 B;  1FR0 A;  1FD9 A;  2IJJ A;  4DV4 O;  2O57 A;  3LS0 A;  1U6H A;  4UXN A;  2QA4 V;  1C02 A;  1V55 C;  1ZTE A;  5LGN A;  3S90 A;  3NKD A;  1BDJ B;  4YT5 A;  3FMS A;  2LK4 A;  2W6J G;  4I1M A;  3MAQ A;  4EWC A;  3NR7 A;  3CD6 V;  4DOZ A;  4BJ1 A;  3SYA A;  3M15 A;  4EBJ A;  1QKR A;  3VBB A;  1BQZ A;  1AP6 A;  2YSU B;  3BPZ A;  1TUB A;  5D5P A;  1S72 V;  2Q7G A;  5EIB D;  1NU9 C;  1Q8I A;  4WBN B;  1W59 A;  5KUM A;  4XPX A;  4MTX A;  4O6M A;  1W0K G;  1ZWI C;  3AG2 B;  3G71 V;  2J9U A;  4TT3 G;  3E8B A;  1OXK A;  4WGY A;  4AL1 A;  4CZZ A;  4RQE A;  2Q00 A;  2XS8 A;  5H5N A;  5EIB C;  4DR6 O;  2HJ3 A;  4PJN A;  1N33 B;  2B5U A;  2X6C A;  1D2D A;  4DUY B;  4J9Z B;  4YJ3 A;  3SYP A;  1LPE A;  3HNJ A;  4ZLC A;  1HP8 A;  2JGD A;  4PI2 A;  3ZS8 C;  1IBL B;  2EX3 A;  2GWW A;  1OCZ C;  2H94 A;  1WB7 A;  1ORQ C;  4FFB A;  4FZ1 A;  3GWN A;  3ASN B;  2PP4 A;  2YXL A;  1SF9 A;  1S05 A;  3CCQ V;  5KYX A;  4PJL A;  3E8F A;  1H2S B;  4IT5 A;  4UUJ C;  3OEO A;  4JKV A;  2XL6 A;  2X6A A;  1SR2 A;  5BQG A;  1Z5W A;  4YJ3 B;  1F1M A;  3D3I A;  1V4A A;  2F22 A;  1Y6D A;  3UCS C;  3JAK A;  5KYU A;  3FDQ A;  1OR3 A;  3U2M A;  2DN9 A;  4RBN A;  1K04 A;  1YHQ V;  4WFE A;  1G8X A;  1BSM A;  4JW1 A;  3RYF A;  1JA8 A;  3CMA V;  3GAN A;  1JPN A;  2YLI A;  1ORJ A;  4HBN A;  4MTG A;  2HHH O;  1GAX A;  2CGO A;  2N05 A;  3KKB A;  4JI0 O;  4EUK B;  1TFO B;  2BTQ A;  2X0L A;  3UT5 B;  1OCO B;  1R6T A;  3K57 A;  3Q6M A;  2OU6 A;  1IZ3 A;  3BVO A;  1OXB A;  1WP8 A;  3FB5 C;  2FGY A;  4K7B A;  2LGQ A;  4DJ9 A;  4K0D A;  3RH3 A;  1DGS A;  4J30 B;  1FFH A;  5BR8 B;  4DK0 A;  4Q6G A;  2L9J A;  3SYO A;  3Q6N A;  4X88 A;  1D5N A;  3QZC A;  4ZIB A;  4FLU A;  1G4Y B;  1IW7 F;  2R9I A;  3JAM N;  2ZR3 A;  1LNQ A;  1XNQ B;  5EYP A;  5B1A C;  5D5Q A;  1SYQ A;  2YIA A;  4A5U B;  5LMU B;  5JJN B;  2J0W A;  2YRF A;  4UCV A;  4ZI7 A;  3RYI A;  5LP6 B;  3U11 A;  4RQF A;  3FVY A;  1L0L H;  4LNU A;  3B9Q A;  2BL2 A;  4J7J A;  3EXA A;  4GLX A;  3A0B Z;  3H1I H;  4BJ6 A;  1TQG A;  1OKK A;  3RQF A;  1I5Y A;  4GZR B;  4GX2 A;  3ZSU A;  1R73 A;  2QLA A;  3H2U A;  4N06 A;  2QKA A;  1IXM A;  3DGE A;  1FS0 G;  1AB3 A;  3MYI A;  1PNL A;  1VYI A;  3DKA A;  1AR4 A;  2HFE C;  4J10 A;  3K5O A;  5H2F Z;  1NVP D;  5B1O A;  1AP5 A;  3I5D A;  5K0I A;  5GW7 A;  5TJ5 E;  1H8E G;  4MW8 A;  5COG A;  1BT8 A;  2NPU A;  2E75 B;  4CC6 A;  3H1L H;  2V1D A;  1K92 A;  2XXA B;  4K0K O;  4N21 A;  5D91 A;  1OW6 A;  4WBN A;  1P4R A;  2ETS A;  2R7T A;  2EJR A;  2CTW A;  4IWB A;  3WB2 A;  1HMD A;  2J46 A;  3G4Z A;  4ZBM A;  5L3G A;  2OCC C;  2A3Q A;  4P2Z A;  4WJ0 A;  1XHX A;  1YCI A;  1RJ9 B;  5KHG A;  1GS9 A;  2NUP A;  2EIN B;  3S28 A;  3A2F A;  1XWJ A;  3CPW U;  1P7B A;  4FK5 C;  2XLV A;  4FX5 A;  4DV4 B;  3V7O A;  1LUW A;  2XXA A;  2Q6A A;  1OCC C;  1Q7Y W;  3FKS G;  3UQ8 A;  3E22 B;  3JAS A;  3UGP A;  4R32 A;  1BS3 A;  4C3B A;  1Y4M A;  1PV3 A;  1X59 A;  3UM7 A;  3LNM B;  4DV6 B;  2P7V A;  1JPX A;  4G27 B;  1NKD A;  4MTO A;  3LSU A;  1PPJ H;  2J7P A;  1QLE B;  2WLM A;  2JD3 A;  1YZB A;  2OQM A;  2AWY A;  3K9S A;  4X20 A;  2KGO A;  1PCX A;  1NR1 A;  3QO7 A;  5HV9 A;  1G1X B;  5F5F A;  2W4M A;  4DR6 B;  1K8A W;  4OIP F;  3ZRX A;  2P22 C;  2HSQ A;  5A6A A;  1WLE A;  2YZS A;  4FLX A;  2XLE A;  3ZC4 A;  2VWJ A;  1FXK A;  3FAJ A;  1DF4 A;  2V7Q G;  3PDM P;  1MNE A;  3DJN B;  3M99 B;  4YL1 A;  1KU9 A;  2YDE A;  4BR6 A;  2L6F A;  3WOD F;  2A6H F;  1AVO B;  4MVQ A;  2OOC A;  5LGU A;  4C7O B;  4JC7 A;  4M63 A;  3AK2 A;  4U5E E;  4LP8 A;  3HKB B;  3ZHU A;  2Z5U A;  1LE2 A;  4UVA A;  4GKJ B;  1S3J A;  5IY5 B;  1MSD A;  4W8P A;  5CIV A;  4R6Z A;  2UU9 O;  2WZL A;  1MSW D;  1IXB A;  1YAR O;  1Y74 B;  4NXM O;  1FXK B;  3TGU H;  4O4I A;  3AOU A;  4DV1 O;  2W4B A;  5B3I A;  1EN6 A;  1QVG U;  1T5E A;  1YVI A;  3EH1 A;  4JI4 B;  4CDV A;  4DBQ A;  3F7Y C;  4LF7 B;  1XZP A;  3U3B A;  1A0B A;  3EH2 A;  2EPL X;  5E1A C;  2XAJ A;  4CBE A;  4E7Z A;  4H4K C;  4JI5 B;  2KW3 C;  1M2O A;  2OIE A;  3IC7 A;  4KHP O;  1V54 B;  2J9B A;  3A11 A;  3ZHV A;  1DLB A;  2ZM6 O;  3G6B A;  1XBL A;  4CIP A;  2R7R A;  1EI7 A;  3AQC A;  2ARH A;  3P3P A;  3SGI A;  5T1D B;  1U97 A;  3DMD A;  4JV5 B;  2CH7 B;  1Q6I A;  1QCE A;  2KG7 B;  1AI6 A;  1GH6 A;  1RJ9 A;  3QF7 A;  4AHC A;  4GUN A;  1ZUQ A;  2Q9L A;  4DV2 O;  2R9A A;  1MAB G;  2AZ2 A;  3CRC A;  1Z6A A;  3MX3 A;  4CSA C;  4MS2 A;  1Z3I X;  1ZSP A;  2JS5 A;  3RVY A;  3B77 A;  4LFA B;  1YIJ V;  2CAZ C;  4H13 B;  2K1E A;  3OM3 B;  3KPH A;  3SP1 A;  2QWR B;  1M1K W;  1YTF B;  2KG7 A;  3PMR A;  3ETD A;  5D92 A;  4OPA A;  3GM3 A;  1XIL A;  2ZXW B;  4LFB O;  1G8M A;  1HMO A;  3CME V;  2FAP B;  2X51 A;  3I56 V;  2YL7 A;  4WGZ A;  1Q82 W;  4LH6 A;  4G0H A;  4LF8 O;  5E33 A;  2BTO A;  2R7S A;  3DM5 A;  1HNW B;  3IQ6 A;  4O2A A;  3S0X A;  1SQQ H;  3CWB H;  2ITC C;  4GKJ O;  5KX5 A;  2EIK B;  2J45 A;  1VQ8 V;  2OTJ V;  2OIG A;  5B1N A;  5CBG A;  3N2Z B;  5L0D A;  1B06 A;  3ZMZ A;  2ZXR A;  3LSS A;  4RD9 A;  4J7T A;  1APC A;  3EGD B;  2JS3 A;  2CCY A;  4JI6 B;  3SXK A;  4YL0 A;  1XMQ B;  4JYA B;  2P4K A;  1R1B A;  5LMU O;  3QVZ A;  1N34 B;  4QIW F;  4JI7 O;  1Y74 A;  4B3T B;  5GTI Z;  4QPK A;  4I55 A;  3RWR D;  4DV5 O;  2P61 A;  2HS5 A;  3LES A;  1SQV H;  4LFB B;  3ZJZ A;  4DXW A;  3FD9 A;  2QM4 A;  3JT1 A;  3MDS A;  3NXS A;  4LCU C;  5JSL A;  2OJE D;  5BY1 A;  3TD7 A;  3SR2 C;  3JD2 A;  2LW7 A;  1RM1 B;  3E89 A;  1R3K C;  3N2K B;  1H8H G;  1Z2G A;  4JYC A;  1YZC A;  4TOI A;  1C17 M;  4BIO A;  2R25 A;  2XAS A;  2YKZ A;  3EFF K;  1OW7 A;  3IJ4 A;  3DD7 A;  2RNB A;  2CTQ A;  3BRC A;  3A8T A;  2QKS A;  3B4S A;  1EZV H;  4MND A;  1N1C A;  5LP6 C;  5L0J A;  4KNW A;  3T1Y B;  5FL7 G;  3V5Z A;  3M7M X;  1M2V A;  1NZE A;  2LIG A;  1OCC B;  2AP3 A;  2VCC A;  4IAR A;  2JIZ G;  3HR0 A;  4JI1 O;  3R2P A;  2HV6 A;  5KHJ A;  2UUI A;  3UMI A;  3RYC B;  3JYH A;  3G4S V;  3L74 H;  3QO8 A;  3VOU A;  2WWW A;  5GTH Z;  3J7A U;  3EGD A;  4HEA J;  2DYR C;  5B1B C;  2LJ2 A;  3O10 A;  5FPR A;  5EC1 C;  4LNU B;  4LFC O;  1T6I A;  5H6Q A;  4E2L A;  3K5N A;  4P9F A;  2IXN A;  1EQ1 A;  1LE4 A;  1VF6 C;  2XHB A;  3E9V A;  1VIB A;  2PFD A;  2R05 A;  5A6B D;  5L3C A;  1JJO A;  1NJI W;  2VC9 A;  3CC2 V;  2W45 A;  1JAF A;  4W4K A;  2R7O A;  1XNQ O;  5B1A B;  3QTC A;  2B1I A;  1I08 A;  1PV0 A;  4DVY P;  3KL4 A;  2HUJ A;  3GEH A;  4BAY A;  2JX0 A;  3W8H A;  1HY5 A;  1PD3 A;  4JZ2 A;  3BCC H;  5DS6 A;  4RO2 A;  4JAV A;  5L0H A;  1SQG A;  5KMG B;  4DV0 O;  3L9D A;  1FNT c;  1K4C C;  5BMV B;  3JAR A;  3DAG A;  2XS1 A;  1Z5V A;  3DI5 A;  2EJ7 A;  1JVM A;  4H54 A;  4ER9 A;  1N36 B;  3ZX6 A;  2EIJ C;  5L3D A;  4JI2 O;  1NVP B;  4XPW A;  4O79 A;  3ZQV A;  1XUQ A;  2R70 A;  2ATK C;  3TQO A;  1A7D A;  5K1P A;  4ZLD A;  5BUO A;  4WAB A;  1Q5O A;  4XWJ A;  5EK0 A;  1QNM A;  2DGJ A;  1NG1 A;  1JQ0 A;  2IJK A;  5HFM A;  3GWL A;  4GX0 A;  3T1H B;  2IJI A;  3RKO F;  3F47 A;  4O4H B;  4DO2 A;  4JJG A;  4JUR I;  1M57 C;  3OUF A;  1IBK B;  1TKN A;  4J7Y A;  1E84 A;  1VF5 B;  4EKW A;  2XL8 A;  5A69 A;  1GK9 A;  2JEX A;  4DR5 B;  1S5J A;  1SA0 A;  2LFD A;  3OUS A;  4O7G A;  1MZE A;  3AG4 C;  4MVU A;  2UUC B;  1T6Q A;  5KX5 B;  4X1I B;  2VQE O;  1UFI A;  4J11 A;  1HW1 A;  4L6R A;  5T3W A;  4XDJ A;  1NI8 A;  1RP3 B;  3CAX A;  5LMN B;  1HDJ A;  2NNU A;  4B3M O;  1SZI A;  3OMI B;  3DAF A;  1BMF G;  1WTY A;  2IM8 A;  2OTL V;  3CSK A;  2L7A A;  2HG5 C;  5IJ9 B;  3SJQ C;  2AGA A;  1WN0 A;  4CJO A;  3LNN A;  4PA7 A;  1P84 F;  4LF4 O;  4JI7 B;  4NXN B;  3E2E A;  1N34 O;  1QZX A;  3AG7 A;  4R7C A;  1KKD A;  3GM1 A;  4LLC A;  3TXQ A;  4U9D A;  1KEC A;  4GEH A;  2UXB B;  3OWT A;  4NTA A;  3US6 A;  1OHH G;  2ZIO A;  1KC8 W;  2NN4 A;  3JCU Q;  3ZED A;  2DYS B;  3ETE A;  3CSX A;  4ZHQ B;  3CCR V;  1SZX A;  1W0J G;  3ABK C;  3CCM V;  3U5S A;  5JRA A;  2OEX A;  2BSK B;  2BCC H;  5DEC A;  3G80 A;  2QM8 A;  1J5E B;  3JAW A;  3ZQY A;  5LA6 A;  4Q7C A;  4UB6 Z;  4JZG A;  2DQ3 A;  2UUB O;  3VQY A;  3SEO A;  4MT8 A;  5BMV A;  3CRQ A;  3BFR A;  4PJ0 Z;  2XTA A;  4MTF A;  4CS3 A;  5J9P C;  2KKW A;  1RSO B;  2RN9 A;  1M9N A;  4E17 A;  1GN4 A;  4QE7 A;  2EIM B;  1XRE A;  4U5B E;  1CGM E;  1VQ6 V;  3OE7 G;  4BJT A;  5EBW C;  4UDV A;  2G62 A;  2ZE8 A;  1K97 A;  1BR1 A;  3M1C B;  2P67 A;  4FFB B;  3T4Z A;  3ZMS A;  4PR9 A;  1BZ4 A;  1Q0F A;  2CNW D;  5B1B B;  2PI5 A;  4GT1 A;  4CS2 A;  5LGT A;  1PP9 H;  5IJ9 A;  1FYJ A;  1PNK A;  5KYX B;  4G78 A;  3ZN1 A;  3H01 A;  4BJ5 A;  4X64 O;  4IHJ B;  5HFL A;  3K79 A;  3LEV A;  5EZY B;  3K9A A;  4ZKI A;  3IFX A;  4DR1 O;  5GPG B;  2Y39 A;  3GEI A;  5KHI A;  3VQV A;  4PHZ A;  4NKG B;  4CS4 A;  3NMK A;  2VRZ A;  4JCZ A;  1Z23 A;  5DED A;  4GYC B;  4PDR A;  4PJM A;  1Q6H A;  4H0L B;  5EBL C;  1MMD A;  2D5R B;  1KYO F;  3MLG A;  1THZ A;  4J9Y B;  3DWW A;  5EBM C;  3FAV B;  2J0X A;  1OKK D;  1SA0 B;  3K7D A;  2WZF A;  2Y3B A;  1I94 O;  3HKC A;  3Q7G A;  4JI4 O;  3LS1 A;  2ZIN A;  4X9Q A;  1MQV A;  2C03 A;  1TAE A;  4YXW G;  4TV9 A;  1VQ4 V;  2QGN A;  2BTQ B;  3GVM A;  3N0T A;  2DYR B;  3JYY A;  5LYJ B;  2XM0 A;  3JSL A;  1AR1 B;  4DV3 O;  1GN6 A;  2IXO A;  3IHU A;  5JP7 A;  3EHB B;  1Q0K A;  5COM A;  2MK3 A;  4DUZ B;  2IW5 A;  4CSA A;  2L81 A;  1MNG A;  2YI9 A;  4XEF A;  1Q0G A;  3EPV A;  2N74 A;  4CS8 C;  5CI9 A;  4B3T O;  2LP4 A;  3SJB C;  4B3S O;  3MYF A;  3KZI Z;  5DS4 A;  2A7W A;  4IJJ A;  4GX5 A;  2GTA A;  1NS1 A;  1COW G;  3RYL A;  4JEA A;  5LXT B;  2Y3G A;  5CMU A;  2JGU A;  2Q7R A;  3AK1 A;  4CH6 A;  4X66 B;  1TA8 A;  2WLL B;  3SXZ A;  4JRZ A;  4YT4 A;  1QU7 A;  3JAT B;  3ZIA G;  4DV2 B;  2UUA O;  5F28 E;  3TJ6 A;  1R3I C;  2OT5 A;  5ITZ A;  3MBG A;  1EN4 A;  3SXY A;  1WN7 A;  2R7W A;  1XI1 A;  1GRJ A;  4PFP A;  4DW0 A;  3CB2 A;  2Z3Y A;  1HE9 A;  2WA4 A;  2X7R B;  1P7G A;  3LDE A;  3DE9 A;  5LBQ A;  2WZG A;  1VP7 A;  3SYQ A;  1OJH A;  5LXT A;  3JD0 A;  5IYZ A;  4KHP B;  5L0I A;  1CGN A;  4PA3 A;  3GB7 C;  2R02 A;  3T6J A;  4AIL C;  3DSQ A;  2HKV A;  4YJW A;  1OR2 A;  4Z9H A;  3E86 A;  3EQL F;  4LDQ A;  4U3J B;  1S5L Z;  1OCZ B;  3QTH A;  2RDC A;  2LGW A;  2E3C A;  3RT3 C;  3B0P A;  4J7Z A;  5F5H A;  1O9G A;  3RYC A;  4LF9 O;  2P90 A;  1I5X A;  1LVK A;  1IBL O;  5LOV A;  2O9X A;  2LFF A;  4WCE V;  3CYO A;  1LS4 A;  2UU9 B;  2Q3T A;  1F23 A;  1MOF A;  1G4W R;  4XBF A;  2DOS A;  1N33 O;  3ZHS A;  3QVY A;  5EGY A;  5KYW A;  4X20 B;  4K8Z A;  3JCU Z;  3AG3 B;  1H9G A;  4HNA B;  1Y6X A;  5AC4 A;  3K3W A;  4D7T A;  2E5L O;  4K0K B;  3L8J A;  4LLE A;  4UCS A;  1VTM P;  3SPC A;  3POV A;  2Y69 B;  1BR4 A;  4JTD B;  3B0U X;  1WP7 A;  2IH3 C;  3RYH B;  1D0Z A;  1YJ9 V;  1I4Y A;  3VQX A;  2VAS A;  4P6I C;  2IU3 A;  4XQ1 A;  3ZTM A;  4DV7 B;  1B04 A;  1WA8 B;  3H2V A;  3W7S A;  5FZT A;  2WLH A;  4TV8 B;  3RFY A;  4CC5 A;  5LMN O;  3FOO A;  3W2W A;  4HYO A;  2Q73 A;  1LI5 A;  1Q90 D;  1EN5 A;  3AK3 A;  2F4V B;  4GKK O;  1I94 B;  1IBM B;  3U8P A;  2OJQ A;  3STL C;  4TQD A;  3CCL V;  2KYH A;  4Z2W A;  1AVM A;  4R50 A;  3U10 A;  4FLV A;  1G4U S;  4EBB A;  4QJF B;  3OAA G;  5CA1 A;  1WA8 A;  3OR7 C;  4QI0 A;  4OX9 B;  4ANJ A;  4J80 A;  1BHA A;  1JPJ A;  4LER A;  2PYJ A;  4WFB V;  1SET A;  3B71 A;  4U7N A;  1YXB A;  3JD1 A;  4PDM A;  5BR8 O;  4BEJ A;  1PKX A;  4OX9 O;  2QWN B;  2UXD B;  4JI3 B;  3ABL B;  1NLX A;  3SJA C;  2UUA B;  1E85 A;  4DR2 O;  4TSF G;  2CGN A;  1UJW B;  3SYN A;  4LWS B;  4KP4 A;  3K04 A;  3ZRS A;  1A7E A;  2Q5Z A;  2BOB C;  1SS3 A;  3CP1 A;  4LC1 A;  2J9V A;  4G7O F;  4B3S B;  3O9O A;  3GOD A;  3ZDL A;  5KYY A;  1JOY A;  3ZWI A;  2WLL A;  3DC6 A;  1K73 W;  4X62 B;  4GYT A;  2CUG A;  2QR4 A;  1MMG A;  2Y4U A;  1N8R W;  2V26 A;  5EYP B;  1L0N H;  2QWQ B;  3ABK B;  2PY5 A;  3E35 A;  1RXQ A;  1BR2 A;  4A4A A;  1ZX3 A;  3C3T A;  3OD4 A;  4CH3 A;  5FLX N;  2JDI G;  3WU2 Z;  3T1H O;  1RCP A;  4JTA B;  1YI2 V;  3NMI A;  1VF6 A;  1Z5Z A;  1ZW2 A;  4N6C A;  3QG5 A;  5KYW B;  4EBK A;  4O2B A;  2RMK B;  2CE4 A;  1YAU O;  3CC7 V;  2AXT Z;  5C8Y A;  3RW0 A;  2ZXP A;  5LP6 A;  3L75 H;  4LFC B;  5JVD B;  1E1R G;  1IZM A;  2EIM C;  4K3A A;  3CCE V;  2EIL B;  2FFH A;  2RD9 A;  4LF4 B;  3OMA B;  2QWO B;  1UPG A;  3RGB A;  4JI8 B;  4I9Q A;  3DZA A;  2VCB A;  5L0C A;  4FLW A;  2YIB D;  4PD4 F;  4JV5 O;  1QR9 A;  1ARO P;  5JQG B;  4FM2 A;  3T1Y O;  4RDA A;  2PX0 A;  4Q5S F;  4Z1M G;  1AI7 A;  4JE9 A;  1ORS C;  1W2B U;  2GUZ A;  1VQO V;  3UNG C;  4X89 A;  4C7O A;  3K0D A;  2HLD G;  1K4D C;  2C04 A;  2YI8 A;  2Y3H A;  3U9M A;  1ZZP A;  1KKC A;  3H1H H;  2OCC B;  2P0N A;  3MFN A;  4JI0 B;  1N0N A;  4U3F H;  5CB4 A;  4IHJ A;  2YWA A;  4XEV A;  4CBC A;  3ETG A;  1K33 A;  3DXJ F;  1DOW A;  1R6K A;  4JI3 O;  3B0V C;  2KSF A;  1QSP A;  2ETN A;  3AG3 C;  4AQY B;  4LF5 O;  1NBB A;  3SPJ A;  1FMW A;  4FES A;  2KNH A;  4PDL A;  1FMV A;  3IQ5 A;  1WAS A;  3WFV A;  3BHP A;  3EJN A;  1LI7 A;  1AEP A;  1QPU A;  3W2V A;  3NYJ A;  2DQ0 A;  3FB6 C;  4I1O B;  1ST6 A;  5L3E A;  3H1J H;  4PJJ A;  4UCU A;  3HNK A;  1Q0D A;  3N2G B;  2H7B A;  3CE2 A;  1EA8 A;  3HPL C;  2WLI A;  1U96 A;  3MHS C;  1BZK A;  2UXB O;  4DR2 B;  4XLP F;  4HZ3 A;  1GN2 A;  1MA1 A;  4KNV A;  3O65 A;  1YYX A;  2LSE A;  1O3U A;  3VM6 A;  2P1A A;  4KI2 A;  2F23 A;  2EPK X;  3C8Z A;  1M4U A;  3TOM A;  2L6L A;  4C3D A;  1GTO A;  3CHX A;  4YHH B;  3G4X A;  1JX9 A;  5JCO C;  5L3F A;  2MWQ A;  3HKD B;  3B29 A;  5KYY B;  4LF6 O;  1D1C A;  1ZL8 B;  2OWO A;  4R8C A;  5H6R A;  2P06 A;  2H8P C;  4NVP A;  4IB4 A;  3K0G A;  1LIH A;  4L87 A;  3IAY A;  1H6G A;  4XLN F;  5IDJ A;  1SER A;  3I55 V;  4FFK A;  2Z15 A;  3L1M A;  2HJD A;  5IE9 A;  5AC5 A;  2QWP B;  5E2Q A;  2Q67 A;  4C3E A;  2PZS A;  3P32 A;  4PI0 A;  2FYU H;  4O4L B;  4EFB A;  4G28 B;  3JAR B;  4LF7 O;  3C90 A;  1E2X A;  1TFK B;  2WLJ A;  1ZU5 A;  3JSZ A;  3ABL C;  2J8W A;  4E4E A;  4MVZ A;  2IBF A;  1URF A;  2R72 A;  3X2Q B;  2GAQ A;  3ZMU A;  3ABU A;  1N4C A;  4PDV A;  4FWV A;  4CIH A;  3EVK A;  2D3O W;  1GO3 F;  2AHZ A;  2ZM6 B;  4DUY O;  4YIO A;  2CGE A;  2HZ8 A;  3OFN G;  3F5W C;  4WF9 V;  4AQY O;  1FFT B;  5CB4 B;  1NU1 H;  3OTO O;  2CYD A;  2AU5 A;  2XAG A;  4BIZ A;  4EB6 A;  2RJZ A;  4KXR A;  2CDY A;  4KC9 A;  2EIK C;  1K9M W;  3ZMV A;  4WFA V;  1TVK A;  5JH7 B;  1BCC H;  2CH7 A;  5L0F A;  1NFN A;  1Q86 W;  5B5E Z;  1FAF A;  2YL3 A;  3OTF A;  2NLJ C;  4WFG A;  3C8G D;  2UUB B;  3JRM O;  3W7X A;  3K33 A;  4YT8 A;  1YJN V;  1AI4 A;  1IDS A;  4JYA O;  4P30 A;  2ZT9 B;  3LNR A;  4UFZ A;  2YUA A;  5CBF A;  4IGG A;  2HMZ A;  1FXK C;  1YEW A;  2F1M A;  2ZXW C;  2ADP A;  1AR5 A;  1R6N A;  2VS0 A;  3JRT A;  1YZA A;  4LBE C;  5L3B A;  4OD4 A;  5JS5 A;  1XQ8 A;  2R7X A;  1SQX H;  4I50 A;  4PA6 A;  1KTM A;  1AJQ A;  3B40 A;  4CX9 A;  4O2A B;  3F46 A;  2PNO A;  3RQG A;  3L70 H;  2OG2 A;  1ZHY A;  2BSK A;  4NTF A;  3B09 A;  2IH1 C;  4FLT A;  2JPU A;  4F6R A;  3MD0 A;  4O6N A;  1WGW A;  1A7V A;  1OQC A;  1H38 A;  4XEK A;  4X0R A;  2Q9B A;  2HR3 A;  3APO A;  4RUF A;  1ZVZ A;  1G5Z A;  3AJM A;  4N4W A;  3GEE A;  4NTW A;  4NTB A;  3TJ5 A;  3FYI B;  1LR1 A;  4FLZ A;  1Q43 A;  4F6E A;  3SPH A;  5T3T A;  1S77 D;  3CRM A;  3N27 A;  3M79 A;  1VQN V;  1EKY A;  5CBH A;  1Q81 W;  2ILM A;  1QQ3 A;  3VF0 A;  5GON A;  4F6R B;  1XZQ A;  3ZRW A;  3TK1 A;  1JFF A;  4GX1 A;  4PK4 A;  1RM1 C;  5KHH A;  2XLW A;  2HSB A;  4GQH A;  2NUT A;  1W2W A;  5KA6 A;  1R5I D;  3U0Z A;  3CCJ V;  1IUR A;  4NB5 A;  1L8D A;  1QVF U;  4LH7 A;  4E0H A;  2PI4 A;  2QJ1 A;  2JEU A;  3IEE A;  4UVC A;  4DRI B;  1UG7 A;  1O87 A;  4IAQ A;  1TUB B;  1XHZ A;  3ABM B;  3U9J A;  1LKX A;  2IM9 A;  3TXS A;  2F43 G;  3O39 A;  2XAH A;  1OV9 A;  3U8V A;  3M4B A;  1U89 A;  1HNX B;  4DR7 B;  4O4I B;  3E83 A;  2XAF A;  2ZD9 A;  4D6T H;  1J8M F;  3D36 A;  3ZHR A;  3VRC A;  3K08 A;  2PUS A;  4MVO A;  2EIL C;  4DR1 B;  3JAK B;  4B7E A;  1R3J C;  4Q4Z F;  3OT7 A;  1XL6 A;  4MVR A;  1T5O A;  5EHH A;  2DB4 A;  3C8G B;  3ZTZ A;  1VEW A;  4ULW A;  1MMN A;  2PX3 A;  3M8A A;  1OCR C;  1SC5 B;  2DMX A;  2ZQM A;  3A0R A;  4KL1 A;  4J32 B;  3C63 A;  3RVZ A;  1YVW A;  3ZRW B;  4Z9J A;  5CA0 B;  2EZP A;  1NH2 B;  1CGO A;  2YQY A;  5JCO A;  2NUT B;  3L0I A;  2X0C A;  3T6G B;  2J7P D;  4U5F E;  1B3Q A;  4YJ2 A;  3JZ0 A;  256B A;  5CI8 A;  2L35 A;  3CEI A;  4YWQ A;  1DK1 A;  5BQI A;  1FFX B;  3IQT A;  2XUM A;  2PTM A;  1VQ5 V;  5COF A;  4NCQ A;  2UUH A;  1V9P A;  1BE3 H;  2ZDI A;  5E3C A;  4X62 O;  3PHF 2;  2YL0 A;  4DK1 A;  4X65 B;  1VF7 A;  1AIL A;  4N23 A;  4UCO A;  1NR7 A;  3X2Q C;  2A9H A;  1J95 A;  1V55 B;  5LA6 B;  4DR5 O;  2F4V O;  4GKK B;  2OYQ A;  2RQ6 A;  5KAI Z;  3F5T A;  1PD1 A;  5A6K A;  4QPJ A;  4NXN O;  1SQF A;  4HE8 D;  1FKA O;  2FKX A;  1Y76 A;  2QSA A;  1GM7 A;  4FIP C;  3SZR A;  4JPR A;  2G3V A;  1FFT C;  2TMV P;  4UV8 A;  1ENV A;  3I5Q A;  5GON B;  1H2L A;  1XEQ A;  4X64 B;  3TCU A;  3AG2 C;  3KH2 A;  3RN4 A;  3BA8 A;  2WLI B;  4OXS A;  3JTL O;  2QE7 G;  1ZHT A;  2P5O A;  4ASU G;  1WPB A;  2ZE5 A;  1OZ0 A;  2YEV B;  3JSN A;  4JAA A;  2WSS G;  4JGS A;  2YC0 A;  5IYZ B;  4DRX A;  3UGO A;  2VWK A;  4X1I A;  1VQM V;  4DR3 B;  4HNA A;  3AEI A;  3RYI B;  4I7Z B;  3EFO A;  5H9C A;  4ZHQ A;  5J2T A;  2ODM A;  1TR2 A;  3TK0 A;  1Y67 A;  2I8B A;  5DVW A;  3L34 A;  2UXC O;  1O5H A;  3EHM A;  3ASN C;  1CP9 A;  3EG9 B;  1D0X A;  1Q6U A;  2FB5 A;  2JJ1 G;  3APQ A;  4X1K B;  1IVS A;  1E83 A;  2GFH A;  4AE4 B;  3BEH A;  3QW1 A;  1EFR G;  5EC2 C;  1N0J A;  2WA3 A;  5JJE B;  3ASO B;  1WAT A;  2GA0 A;  3FB7 C;  5DQT A;  3C62 A;  1AJP A;  2ZCE A;  2PYL A;  1YDI A;  1V74 B;  1R3L C;  4KUM A;  3SPI A;  4JCH A;  4O6Y A;  4JI2 B;  2IBZ H;  4UB8 Z;  3ZVR A;  1HWY A;  3D36 C;  1IBM O;  4CH5 A;  2YLG A;  2M64 A;  1WPX A;  2YHS A;  2WLK A;  2CTP A;  3WB0 A;  1L7C A;  5KYN A;  3LAY A;  3W7W A;  4AL0 A;  1TWC A;  5BXZ A;  3R65 A;  4KBL A;  4UV9 A;  5IWA O;  2MYS A;  2YEV A;  4Z1V A;  1TWA A;  2AVK A;  1A41 A;  1FFX A;  4YL3 A;  4WFH A;  4DR3 O;  3FFQ A;  3G67 A;  4FVM A;  3RBZ A;  3OW2 U;  1S7Z A;  3FAV A;  5JVD A;  3NDB B;  4U5G A;  4G7H F;  3JD4 A;  4BIU A;  1D1A A;  1SRY A;  4IAO A;  2UXD O;  2QEX V;  3W7U A;  3OEH G;  3CCV V;  4D7S A;  2Q0O C;  1RPO A;  1VMG A;  4NYK A;  2GBO A;  3RF3 A;  4CDA A;  1S5H C;  1RKE B;  4DR7 O;  2H8A A;  3QW0 A;  4HFK B;  1BL8 A;  4DR4 B;  1KP3 A;  1SZT A;  3EGX A;  1VLS A;  4IIJ A;  1H2M A;  5E3A A;  1Z7Q c;  2L6H A;  3IQC A;  1N36 O;  2R7V A;  2LW1 A;  2A0L A;  1K05 A;  2IU0 A;  1YLM A;  3QNE A;  2WPD G;  5A6B A;  2GHY A;  3B2E E;  1M56 C;  3EHN A;  1KB9 F;  4O2B B;  3RYF B;  1HNW O;  1FJG B;  1YTF D;  3EG9 A;  4X1K A;  3BRJ A;  3W8I A;  4X1Y A;  3V5X A;  3JYC A;  4WFF A;  1PM9 A;  3FB8 C;  3RIP A;  4JI8 O;  2ZKO A;  5KA5 A;  4BW9 A;  4NY3 A;  3T1C A;  1TWH A;  4P9P A;  4OIO F;  4UVB A;  3ML0 A;  2JJ2 G;  2CK3 G;  3B8N A;  5JT4 A;  2H3O A;  2ZR2 A;  5C93 A;  3GOR A;  4NC3 A;  2A06 H;  3AGT A;  4B6I A;  3MHH C;  1F51 A;  2OCH A;  2UUC O;  3R7C A;  5ITZ B;  1NFO A;  1JMW A;  1JFF B;  3KYJ A;  5LL6 Y;  4I5S A;  1VYK A;  1S0V A;  4J7K A;  1M93 A;  1XMO O;  2HHH B;  1D0Y A;  2AHY A;  2MHR A;  3VYW A;  4DR4 O;  3JAT A;  3ZRV A;  4E18 A;  1PL0 A;  1WAZ A;  2LQG A;  2XLD A; 
#chains in the Genus database with same CATH homology
 3ZIB A;  4FES A;  2KNH A;  3EFO B;  2JIZ G;  4PDL A;  1FMV A;  4F4B A;  4PA4 A;  1AI5 A;  3KG2 A;  3AG1 B;  3WFV A;  1VMA A;  2HV6 A;  2H7O A;  3UMI A;  3EJN A;  2Q9C A;  3JYH A;  3G4S V;  4U5D E;  3QO8 A;  4U5C E;  4BW5 A;  3W2V A;  3VOU A;  2WWW A;  2DQ0 A;  3OMN B;  3EGD A;  3FB6 C;  2DYR C;  3NYJ A;  5B1B C;  4HEA J;  4I1O B;  1ROP A;  1ST6 A;  2R7R A;  5EC1 C;  5L3E A;  3P30 A;  5DM6 V;  4PJJ A;  1MMA A;  5H6Q A;  4E2L A;  3I5P A;  3UR3 C;  5DS5 A;  1KD1 W;  2H7B A;  2IXN A;  1RPR A;  3K03 A;  3HB3 B;  3HPL C;  1KU2 A;  1GM9 A;  2XOK G;  2PFD A;  2WLI A;  3E9V A;  2DW4 A;  5L3C A;  3OA1 A;  2WL8 A;  2XRH A;  2LFS A;  1NJI W;  4RUE A;  3MHS C;  1VQK V;  1ZU4 A;  1NZE A;  4YT2 A;  5KYU B;  3PJS K;  1CEZ A;  3CC2 V;  2P7T C;  4HZ3 A;  2W45 A;  3ITF A;  4XLP F;  3GWO A;  4KNV A;  5L3V A;  2M4E A;  2LSE A;  2R7O A;  1F4N A;  2B1G A;  5DQZ A;  5B1A B;  4KI2 A;  1OCR B;  2B1I A;  1E1Q G;  1Z63 A;  3TET A;  4C3D A;  3T4D A;  3OGC C;  1ZHW A;  3KL4 A;  4OIN F;  4DVY P;  3LLK A;  1GTO A;  4BAY A;  4MQ9 F;  3W8H A;  1PD3 A;  1PD0 A;  4QE9 A;  4JTC B;  1JX9 A;  5L3F A;  1XL4 A;  1QR8 A;  2MWQ A;  5KYY B;  5DS6 A;  4RO2 A;  4JAV A;  1D1C A;  1NU7 D;  2J9W A;  4JJF A;  1KP2 A;  4R8C A;  1V54 C;  4F4L A;  5H6R A;  3EGX B;  4BJ5 C;  2H8P C;  4C7O A;  3K0G A;  1K4C C;  2IJH A;  4L87 A;  3T2M A;  3FHD A;  4G7Z F;  1DTO A;  3K1I C;  2DWD C;  2Y69 C;  3DAG A;  3LDD A;  4XLN F;  1JCH A;  3ZCC A;  5IDJ A;  1SER A;  3I55 V;  4FJC C;  4FMT A;  2Z15 A;  1JVM A;  1K5S A;  2EIJ C;  5L3D A;  1NVP B;  2WVO A;  2Q67 A;  4O79 A;  5E2Q A;  4C3E A;  3P32 A;  3G6E V;  3I4U A;  4G28 B;  3QMK A;  4E7S A;  3WG7 B;  3K66 A;  2W0F C;  3T4R A;  2ATK C;  4PFO A;  3DJU B;  4ZLD A;  3JCZ A;  2WLJ A;  4A2N B;  5BUO A;  1ZU5 A;  3JSZ A;  3ABL C;  4CS9 A;  2JK5 C;  4XWJ A;  2H7V C;  5EK0 A;  2ITD C;  2DWE C;  4MVZ A;  1BHB A;  1JQ0 A;  2IJK A;  1NG1 A;  2DGJ A;  3SNH A;  5HFM A;  4GX0 A;  1QBZ A;  3X2Q B;  2IJJ A;  2IJI A;  3RKO F;  3ZMU A;  3F47 A;  3LS0 A;  3ABU A;  4DO2 A;  4UXN A;  4PDV A;  1M57 C;  2QA4 V;  1V55 C;  3O6X A;  4FWV A;  5LGN A;  4JJG A;  4JUR I;  3VAY A;  3OUF A;  3NKD A;  4YT5 A;  4CIH A;  2D3O W;  2KB1 A;  1TKN A;  1GO3 F;  2W6J G;  4I1M A;  1K3E A;  2AHZ A;  4QDL A;  4EWC A;  3X1O A;  3CD6 V;  4DOZ A;  2CGE A;  4EKW A;  2QTV A;  4BJ1 A;  3OFN G;  2WLN A;  3F5W C;  3SYA A;  4WF9 V;  1GK9 A;  2JEX A;  3VBB A;  1TUE B;  2YSU B;  1ZHX A;  2UXX A;  5LHG A;  1GKF A;  3OUS A;  1S72 V;  4O7G A;  1FFT B;  3AG4 C;  4MVU A;  5BZB A;  1NU9 C;  4BJ6 C;  4H37 A;  5KUM A;  4MTX A;  4O6M A;  3CZ6 A;  4Q20 A;  1W0K G;  1ZWI C;  3AG2 B;  3G71 V;  2J9U A;  2XAG A;  5T3W A;  2EIN C;  4XDJ A;  3HJC A;  4TT3 G;  3E8B A;  4BIZ A;  4PEL A;  1L1F A;  2IXM A;  1E79 G;  1EZJ A;  4KC9 A;  2EIK C;  4CZZ A;  1K9M W;  3ZMV A;  4RQE A;  3SPG A;  4WFA V;  2KJG A;  1NBM G;  2E87 A;  4PJN A;  2CW0 F;  5L3Q A;  2B5U A;  2NNU A;  2P6J A;  2X6C A;  3OMI B;  1SZI A;  3DAF A;  2HVK C;  1BMF G;  4J9Z B;  1Q86 W;  4DBR A;  1SES A;  1NH2 D;  4WFG A;  2NLJ C;  3SYP A;  2ZXO A;  2OTL V;  4ZLC A;  1GM8 A;  5B3S B;  3CSK A;  4OIR F;  2KQ9 A;  2HG5 C;  1MG1 A;  3LSQ A;  3SJQ C;  3W7X A;  3K33 A;  1OCZ C;  4YT8 A;  2H94 A;  5IY5 C;  1YIT V;  4PA7 A;  2QY9 A;  4CS7 A;  1YJN V;  1AI4 A;  1F4M A;  1ORQ C;  3E2E A;  1QZX A;  4P30 A;  4R7C A;  1KKD A;  3LNR A;  4LLC A;  3ASN B;  1KEC A;  5CBF A;  1SMY F;  2HKO A;  4HFF B;  4GEH A;  1ZYR F;  1FXK C;  2A79 B;  4FPP A;  2PP4 A;  1OHH G;  2ZDI C;  3OWT A;  3CCQ V;  1KC8 W;  3JCU Q;  5KYX A;  4JAS A;  2ZXW C;  3E8F A;  4PJL A;  1R6N A;  4UUJ C;  3OEO A;  2DYS B;  3ETE A;  2X6A A;  1CPY A;  4LBE C;  5L3B A;  3CCR V;  3JRT A;  3ABK C;  1W0J G;  1VQP V;  4OD4 A;  3CCM V;  2R7X A;  1MND A;  3D3I A;  4MVS A;  4I9W A;  4PA6 A;  3FDQ A;  5KYU A;  2UXN A;  4RBN A;  2QM8 A;  1AJQ A;  3F46 A;  4JZA A;  1YHQ V;  4WFE A;  1G8X A;  2PF4 E;  4Q7C A;  2DQ3 A;  3SEO A;  4JW1 A;  4MT8 A;  2OG2 A;  1K34 A;  5LHH A;  1ZHY A;  3NYM A;  3CMA V;  2IH1 C;  3GAN A;  1JPN A;  4MTF A;  3MD0 A;  5J9P C;  4O6N A;  1M9N A;  1WGW A;  2A6E F;  4MTG A;  1FXV A;  1H38 A;  4X0R A;  4QE7 A;  2EIM B;  1FMW A;  2HR3 A;  2XAQ A;  1M56 B;  2Q9B A;  3KKB A;  4RUF A;  4U5B E;  1VQ6 V;  3OE7 G;  4KFM A;  4BJT A;  5EBW C;  2G62 A;  2X0L A;  4JAU A;  1K97 A;  1BR1 A;  3FYI B;  3M1C B;  2Q68 A;  2P67 A;  3T4Z A;  3ZMS A;  1OCO B;  2CNW D;  3Q6M A;  2R9R B;  1EBO A;  5B1B B;  4XDK A;  2PI5 A;  4GT1 A;  3SPH A;  5T3T A;  1S77 D;  3FB5 C;  5LGT A;  4HAM A;  2Y48 A;  1VQN V;  2FGY A;  1PNK A;  5CBH A;  1Q81 W;  3ZN1 A;  3H01 A;  3Q7L A;  4K7B A;  4BJ5 A;  5KYX B;  4K0D A;  5HFL A;  3RH3 A;  3K79 A;  3LEV A;  4J30 B;  3ASO C;  3SYC A;  1FFH A;  2A68 F;  3NKE A;  3K9A A;  4PK4 A;  3ZRW A;  3TK1 A;  3IFX A;  3K06 A;  4GX1 A;  3SYO A;  2X6B A;  4X88 A;  4QNH B;  4ZKI A;  1RM1 C;  2Y39 A;  2NUT A;  3QZC A;  1W2W A;  1G4Y B;  1IW7 F;  2R9I A;  5KA6 A;  3STZ C;  3CCU V;  2CDQ A;  2ZR3 A;  1LNQ A;  4X8A A;  5B1A C;  1Z23 A;  4MW3 A;  3CCJ V;  2IYL D;  1QVF U;  4PDR A;  4PJM A;  2J0W A;  5EBL C;  1MMD A;  2PI4 A;  2D5R B;  3MLG A;  1THZ A;  2JEU A;  4J9Y B;  3IEE A;  4UVC A;  5EBM C;  2J0X A;  4RQF A;  3CQZ A;  3FVY A;  1O87 A;  1OKK D;  3K7D A;  3T6B A;  2VH3 A;  1JJ2 U;  2WZF A;  2Y3B A;  3B9Q A;  3ABM B;  2NUP B;  3AG1 C;  1LKX A;  3Q7G A;  3CCS V;  2F43 G;  3LS1 A;  2C03 A;  3KMI A;  3O39 A;  1OKK A;  3E8H A;  2XAH A;  4YXW G;  1VQ4 V;  3E70 C;  4BJ6 A;  2A69 F;  1I5Y A;  3N0T A;  2DYR B;  4GX2 A;  3CXC U;  2XND G;  3ZSU A;  1R73 A;  4N06 A;  3E83 A;  2XAF A;  2ZD9 A;  3DM9 B;  4AX2 A;  1IXM A;  1J8M F;  3D36 A;  1AR1 B;  2IXO A;  3DGE A;  3EHB B;  4CSA A;  1FS0 G;  2MK3 A;  3K08 A;  1PNL A;  2IW5 A;  1VYI A;  3LLI A;  2HFE C;  1K7D A;  2EIL C;  4MVO A;  4GCZ A;  4MSW C;  2L81 A;  3IGA C;  2QM7 A;  3EPV A;  4CS8 C;  3Q6N A;  2C2A A;  1R3J C;  5DN6 G;  1NVP D;  5B1O A;  5CI9 A;  4Q4Z F;  1XL6 A;  3DTU B;  4MVR A;  5GW7 A;  5EHH A;  5FCL A;  5DS4 A;  1H8E G;  4MW8 A;  4ULW A;  1MMN A;  4GX5 A;  4IJJ A;  2PX3 A;  4BG0 A;  1OCR C;  2ZQM A;  1COW G;  3A0R A;  2V1D A;  1K92 A;  4H33 A;  1VQL V;  4J32 B;  3RYL A;  2XXA B;  2Y3G A;  2M7W A;  5CMU A;  3RVZ A;  4N21 A;  5D91 A;  3ZRW B;  2HJF C;  2WLL B;  1P4R A;  4YT4 A;  3LDC A;  2EZP A;  2EJR A;  1NH2 B;  3ZIA G;  3L0I A;  2NUT B;  4IWB A;  2R7T A;  2WVQ A;  2J7P D;  4U5F E;  2J46 A;  4JF3 A;  1VQ7 V;  4ZBM A;  5L3G A;  1R3I C;  5CI8 A;  2OCC C;  2OT5 A;  4P2Z A;  4YWQ A;  3UMK A;  4WJ0 A;  4YN0 B;  1RJ9 B;  2R7W A;  2NUP A;  2WVN A;  4PFP A;  2EIN B;  1VQ5 V;  2Z3Y A;  3S28 A;  2X7R B;  3LDE A;  3CPW U;  2IXP A;  1P7B A;  4FK5 C;  1TWG A;  5LBQ A;  2ZDI A;  2WZG A;  4FX5 A;  5E3C A;  3PHF 2;  3SYQ A;  3V7O A;  2G3K A;  2XXA A;  2Q6A A;  1OCC C;  3JD0 A;  5CA3 A;  1Q7Y W;  3FKS G;  1VQ9 V;  4PA3 A;  3GB7 C;  3T6J A;  3UGP A;  4N23 A;  4YJW A;  3E8G A;  4C3B A;  1NR7 A;  3X2Q C;  2A9H A;  1Y4M A;  3E86 A;  3UKM A;  3B8M A;  3UM7 A;  5B3S C;  3EQL F;  3NYL A;  1J95 A;  1QLN A;  1OCZ B;  1V55 B;  3LNM B;  3ECS A;  3LUT B;  2WAM A;  2P7V A;  1JPX A;  4G27 B;  1GMG A;  3B0P A;  1NKD A;  4MTO A;  1PD1 A;  4QPJ A;  2R7Q A;  4HE8 D;  1Y66 A;  2J7P A;  5F5H A;  1QLE B;  2WLM A;  2JD3 A;  2P90 A;  1I5X A;  1LVK A;  4AE4 A;  2KGO A;  1GM7 A;  2EBO A;  4FIP C;  1PCX A;  2O9X A;  3SZR A;  4JPR A;  1NR1 A;  4WCE V;  3CYO A;  3QO7 A;  1FFT C;  4UV8 A;  3W7T A;  1M2V B;  1ENV A;  2G3V A;  2Q3T A;  3I5Q A;  1F23 A;  5F5F A;  1MOF A;  4XBF A;  2W4M A;  3TCU A;  1K8A W;  3AG2 C;  3KH2 A;  4OIP F;  3ZRX A;  2WLI B;  2QTO A;  4OXS A;  2QE7 G;  5EGY A;  5KYW A;  1VOM A;  1ZHT A;  1WLE A;  3N24 A;  2YZS A;  3HLZ A;  3AG3 B;  3ZC4 A;  1FXK A;  3FAJ A;  1DF4 A;  2V7Q G;  4ASU G;  4LAC B;  3ABT A;  1OZ0 A;  2YEV B;  1MNE A;  2P6V A;  3M99 B;  3DJN B;  3F7V C;  1LS1 A;  3UMH A;  1DF5 A;  3K3W A;  4LLE A;  3QO5 A;  3WOD F;  2WSS G;  2A6H F;  1FXH A;  4JGS A;  4MVQ A;  3UGO A;  5IYB O;  5LGU A;  3SPC A;  3POV A;  4C7O B;  2Y69 B;  3JD3 A;  1BR4 A;  2ZPA A;  4M63 A;  4U5E E;  3EZH A;  1VQM V;  4JTD B;  4LP8 A;  3B0U X;  3AEI A;  2Z5U A;  2IH3 C;  4UVA A;  1D0Z A;  1S3J A;  5H9C A;  5IY5 B;  3EFO A;  3K1H A;  1YJ9 V;  2R7U A;  4XDL A;  1TR2 A;  2VAS A;  4R6Z A;  4P6I C;  2WZL A;  1MSW D;  2I8B A;  5DVW A;  3WG7 C;  3L34 A;  2IU3 A;  1O5H A;  3ASN C;  3EHM A;  1CP9 A;  3EG9 B;  4RAI A;  1D0X A;  2JJ1 G;  1OCO C;  4IRU A;  2V3C C;  1FXK B;  3W7S A;  2GFH A;  4AE4 B;  2WLH A;  3BEH A;  3RFY A;  2W4B A;  1EFR G;  2DYS C;  5EC2 C;  3ZMT A;  1QVG U;  5IYC O;  1M90 W;  4HYO A;  3EH1 A;  1M57 B;  3W2W A;  3ASO B;  1FTS A;  3FB7 C;  5KUK A;  3S27 A;  4DBQ A;  3F7Y C;  5DQT A;  3STL C;  3CCL V;  1AJP A;  3EH2 A;  5E1A C;  4CS8 A;  4R50 A;  3NG1 A;  2VB6 A;  1YJW V;  2XAJ A;  4CBE A;  4E7Z A;  4H4K C;  1R3L C;  4I44 A;  4KUM A;  3SPI A;  4JCH A;  4O6Y A;  2KW3 C;  1M2O A;  4OIQ F;  4EBB A;  3ZVR A;  4QJF B;  3IC7 A;  1HWY A;  1H2G A;  1V54 B;  3OAA G;  1PNM A;  1KQS U;  1D1B A;  2W6I G;  3K6B A;  3AG4 B;  3EZI A;  1DLB A;  1WPX A;  3OR7 C;  4QI0 A;  4TWK A;  2YHS A;  2WLK A;  2BE5 F;  1ZHZ A;  4ANJ A;  5KYN A;  1BHA A;  2LFR A;  3W7W A;  1JPJ A;  1TWC A;  3AQC A;  3LAY A;  4LER A;  5HSW A;  2IOQ A;  3R65 A;  1SET A;  4WFB V;  4KBL A;  2EIJ B;  3DMD A;  4U7N A;  4UV9 A;  5T1D B;  2MYS A;  2YEV A;  3JD1 A;  3AQB A;  1QCE A;  4PDM A;  1TWA A;  1AI6 A;  1RJ9 A;  4BEJ A;  1PKX A;  2XSE A;  4WFH A;  3ABL B;  3FYE B;  3RBZ A;  3OW2 U;  1S7Z A;  1MAB G;  4PA9 A;  1VK5 A;  1Z6A A;  3MX3 A;  3ZG1 A;  4CSA C;  4TSF G;  3NDB B;  4MS2 A;  2A1D D;  4XTK A;  2HV7 A;  1Z3I X;  4U5G A;  4G7H F;  3JD4 A;  1UJW B;  3SYN A;  2BOC C;  4BIU A;  4KP4 A;  3RVY A;  3B77 A;  3K04 A;  3ZRS A;  1D1A A;  1YIJ V;  1SRY A;  2BOB C;  1S76 D;  2W9Y A;  3CP1 A;  4LC1 A;  4IAO A;  2J9V A;  2QEX V;  4DVZ A;  3W7U A;  2K1E A;  3OM3 B;  4G7O F;  3OEH G;  3GOD A;  5KYY A;  3CCV V;  1JOY A;  3SP1 A;  4U7O A;  2WLL A;  1M1K W;  1YTF B;  2WB7 A;  2CNW A;  3ETD A;  3PMR A;  4QI2 A;  1RPO A;  5D92 A;  1K73 W;  2ZXW B;  3OR6 C;  4I3M A;  1G8M A;  3NRH A;  3CME V;  5LHI A;  4GYT A;  2X51 A;  3I56 V;  1MMG A;  1N8R W;  2V26 A;  4CS9 C;  1Q82 W;  3ABK B;  4G0H A;  2L9J A;  5E33 A;  3E35 A;  1BR2 A;  2R7S A;  3DM5 A;  2B0J A;  1NQT A;  1S5H C;  2JDI G;  3S0X A;  3ZN0 A;  3LJB A;  3CC4 V;  2XL4 A;  4HFK B;  1BL8 A;  1KP3 A;  1SZT A;  2ITC C;  3ABM C;  3EGX A;  4U5H A;  2EIK B;  4JTA B;  1YI2 V;  1VQ8 V;  2OTJ V;  1J8Y F;  2J45 A;  2NG1 A;  3HTK C;  1B6Q A;  1Z5Z A;  2HVJ C;  4MVM A;  5B1N A;  2Q9A A;  5CBG A;  5E3A A;  3N2Z B;  3ZMZ A;  5KYW B;  2ZXR A;  2Q69 A;  3LSS A;  4RD9 A;  4G2K A;  3CC7 V;  3EGD B;  2R7V A;  2A0L A;  3RW0 A;  2ZXP A;  1AJN A;  2IU0 A;  1YSC A;  4W8K A;  3QNE A;  1E1R G;  2FTK A;  2EIM C;  2GHY A;  2GSM B;  2EIL B;  1M56 C;  2WPD G;  3CCE V;  1IZM A;  2FFH A;  3EHN A;  4QIW F;  3OMA B;  3DZA A;  1YTF D;  3EG9 A;  4QPK A;  3W8I A;  5DLJ A;  3LES A;  1SF8 A;  1QR9 A;  1ARO P;  3JYC A;  4WFF A;  3ZJZ A;  4P9O A;  4RDA A;  3S29 A;  2PX0 A;  3FB8 C;  4Q5S F;  4Z1M G;  1AI7 A;  4DXW A;  3RIP A;  4JVS A;  3JT1 A;  5KA5 A;  3NXS A;  4NY3 A;  1W2B U;  4LCU C;  3T1C A;  1VQO V;  3UNG C;  1QLE C;  4X89 A;  3K0D A;  2HLD G;  1K4D C;  4P9P A;  1TWH A;  4OIO F;  2C04 A;  4UVB A;  3TD7 A;  4JYB A;  4AK9 A;  5IYD O;  2LP7 A;  3JD2 A;  1RM1 B;  2Y3H A;  3E89 A;  3ML0 A;  1R3K C;  2JJ2 G;  2CK3 G;  3B8N A;  2OCC B;  3H65 A;  1H8H G;  1K5Q A;  2ZR2 A;  3OEE G;  5C93 A;  4JYC A;  4B6I A;  3MHH C;  1F51 A;  5CN0 A;  2XAS A;  3ETG A;  1K33 A;  3EFF K;  4CBC A;  1R6K A;  2Y3D A;  3DXJ F;  3B0V C;  3BY6 A;  3DD7 A;  4I5S A;  1VYK A;  2EZO A;  1S0V A;  3AG3 C;  2QKS A;  1D0Y A;  4MND A;  4OD5 A;  2AHY A;  1N1C A;  3VYW A;  3SPJ A;  3ZRV A;  4KNW A;  5FL7 G;  1PL0 A;  1M2V A;  1OCC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...