1M56C

Structure of cytochrome c oxidase from rhodobactor sphaeroides (wild type)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
265
structure length
265
Chain Sequence
AHAKNHDYHILPPSIWPFMASVGAFVMLFGAVLWMHGSGPWMGLIGLVVVLYTMFGWWSDVVTESLEGDHTPVVRLGLRWGFILFIMSEVMFFSAWFWSFFKHALYPMGPESPIIDGIFPPEGIITFDPWHLPLINTLILLCSGCAATWAHHALVHENNRRDVAWGLALAIALGALFTVFQAYEYSHAAFGFAGNIYGANFFMATGFHGFHVIVGTIFLLVCLIRVQRGHFTPEKHVGFEAAIWYWHFVDVVWLFLFASIYIWGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE
publication title The X-ray crystal structures of wild-type and EQ(I-286) mutant cytochrome c oxidases from Rhodobacter sphaeroides.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 101
structure length 265
sequence length 265
chains with identical sequence I
ec nomenclature
pdb deposition date 2002-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00510 COX3 Cytochrome c oxidase subunit III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1m56C01
1.20.120.80 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1m56C02
3SYOA 3E8GA 4MVUA 5E1AC 3T1CA 3IGAC 4MTFA 3SPJA 4PA4A 2EILC 3FB7C 4GX5A 2DYRC 3SPIA 4JTDB 4MSWC 2WLJA 4XDJA 4PA9A 3VOUA 4X8AA 3K0DA 3T2MA 4MTGA 4TWKA 2X6BA 3K06A 3PJSK 4OXSA 3GB7C 4MTOA 2ITCC 3F7VC 2A0LA 4I9WA 3EFFK 4GX0A 1R3LC 2R9RB 4MVQA 1V54C 4UUJC 1OCOC 3OUSA 3RBZA 3WG7C 4R8CA 3ASNC 5KUKA 3UM7A 2X6AA 5IY5C 2ZD9A 3E83A 5CBHA 4RUFA 4XDLA 2A9HA 2Q67A 3ABLC 4GX2A 2EINC 3LDDA 2NLJC 4R7CA 5EC2C 4GX1A 4MVOA 2K1EA 4WFHA 4CBCA 1KKDA 3E8FA 3SJQC 5BZBA 5EBLC 2Y69C 3X2QC 1M56C 4DXWA 1R3IC 2ITDC 3F7YC 4RAIA 3SPHA 3OR7C 3RVZA 3E89A 2ATKC 4J9ZB 1BL8A 1S5HC 3SYCA 4J9YB 2IH1C 3LNMB 4P2ZA 5B1BC 2HFEC 4WFGA 1R3KC 2X6CA 2A79B 3E86A 2WLIA 2BOBC 1K4DC 1V55C 3KG2A 3SYAA 4EKWA 2HVKC 4WFEA 4MW8A 1XL6A 3STLC 2EIKC 3AG1C 4HZ3A 4HYOA 4LP8A 4QNHB 2Q68A 3K08A 3R65A 1K4CC 3T4DA 1JVMA 3E8BA 2DYSC 2W0FC 2Q69A 1ORQC 3F5WC 3FB5C 4G27B 4MS2A 2HVJC 1OCRC 4JTCB 5EBMC 2ZXWC 3TETA 4RUEA 3ABKC 4MVMA 3SPGA 2BOCC 3OUFA 4MW3A 2EIJC 2OCCC 4MVZA 3AG2C 4PA6A 4WFFA 4X88A 4XDKA 3RVYA 4QE9A 2WLLB 3HPLC 3SPCA 4QE7A 5KUMA 4LBEC 3OGCC 4MVSA 4G28B 3FB8C 4X89A 4KFMA 4PDMA 5J9PC 4P9OA 1P7BA 1XL4A 5EBWC 3RW0A 2AHYA 2Q6AA 2DWEC 4PA3A 2WLMA 2HG5C 3JYCA 2AHZA 1LNQA 4H37A 5EC1C 3T4ZA 1M57C 1OCCC 3FB6C 4P30A 2P7TC 3ZRSA 5CBGA 2JK5C 3OR6C 4PDVA 2H8PC 5EK0A 3K0GA 4PDLA 4MVRA 4P9PA 3UKMA 3E8HA 3IFXA 3LDCA 3SYPA 2EIMC 4R50A 4RO2A 1FFTC 1R3JC 2YEVA 1OCZC 3AG4C 3ABMC 4F4LA 1ZWIC 2WLHA 2WLIB 4R6ZA 3ZJZA 2IH3C 5CBFA 4JTAB 2QTOA 1J95A 3AG3C 5B1AC 5B3SC 3K04A 3STZC 2KB1A 4PA7A 3ASOC 2WLLA 3LDEA 3TCUA 1G4YB 4BW5A 2WLNA 2DWDC 4ZBMA 3LUTB 3BEHA 3SYQA 2WLKA 1QLEC 2HJFC 4LCUC 3K03A 2QKSA 4H33A 4PDRA
chains in the Genus database with same CATH superfamily
5AG2A 5KAIZ 5JJJB 1NLXA 1GRJA 3CCJV 4Q20A 2HHHB 2J45A 3G71V 4L6RA 3U8VA 4KHPB 2Y3HA 3VAYA 3ZMTA 1R5ID 3B0PA 3RQFA 1T6QA 2X6BA 1KD1W 2D2CB 3C8GB 4YY3B 1V54B 4F6RA 4NQFA 4W4LA 4I9QA 4AI8A 5HFMA 5CA0A 5GONA 3EFOB 1ZU4A 5H5NA 5CBHA 4WFAV 4PELA 1OR3A 3GEEA 4OPAA 3LEOA 4E7SA 3CCLV 4B3TO 3CX5F 5EC2C 5BMVA 1RPRA 1HNZO 1ZL8A 2KW3C 5DS4A 4GT1A 3C8ZA 1R3IC 4C7OA 4U5DE 4ZOLA 4DRIB 5L0GA 2Q9AA 2D3OW 3N2GA 1O87A 2MWQA 4BEMJ 4JE9A 3M8AA 4H4KC 4J9YB 2Q9LA 5T1DB 4CDYA 3E86A 4A5UB 5KYXA 5CI8A 2QWPB 3DC6A 3SYAA 4QDLA 1WPBA 3T6GB 3B9QA 3ZEDA 1DK1A 3K1IA 3ZS8C 1KQSU 3K08A 3BRCA 2F93B 2LGWA 3QO5A 5LGNA 2XS1A 1VQ7V 4UV8A 4Q5SF 4JI4B 2XLHA 5COFA 4DV3O 3VQWA 5FZTA 5JS5A 2IJHA 2P22C 2VQFO 4O2BA 3TXQA 2Z5UA 3CS5A 3FB8C 4G28B 1J8YF 4OD4A 1M5IA 5IE9A 1YA9A 4K0DA 3S0XA 1FJGO 4LDQA 5BMVB 1AP5A 5LP6B 2YVKA 1AI6A 3ZX6A 3GM3A 3E22A 1FR0A 1HW7A 1NH2D 1TFKB 1D0XA 2ZIMA 3K0GA 1FTSA 2QUPA 1I7FA 4CS9A 4H13B 3AQBA 4MVRA 4BJ5A 3E8HA 5BQGA 4DV5O 4TOIA 1NTKH 3AGTA 5D5PA 2HP8A 3NKEA 3E70C 4C3BA 3DJNB 1OCOB 1QQCA 2IH3C 3N24A 3NRHA 3RYIB 2XLDA 4I7ZB 2CTQA 1JOGA 2ICWG 2CNWD 2O9XA 1I0HA 3H1HH 1KMIZ 2XRHA 4I4TA 4DYLA 3B4SA 5JWPA 1ZZPA 3T1CA 2XTAA 3JAKB 4R32A 3U3FA 2Q0OC 1NS1A 2XAJA 3K59A 1AJQA 3X2QB 2H8AA 3JSZA 1HW1A 2DN9A 4MSWC 1BHBA 3K9AA 3CRAA 1D5NA 2G38A 3A0HZ 4OXSA 4O2BB 2KGOA 3SJAC 1NU1H 4FFBB 4I9WA 4Q7CA 4Q4ZF 1PD3A 2XAQA 3W2WA 1FAFA 4R8CA 4FK5C 2PX0A 3JD3A 4DRXA 5L3FA 1TAEA 4B3RB 2LCHA 4L87A 3RF3A 4IRUA 1Q0GA 3OM3B 3N2ZB 4CZZA 3WODF 4O4HA 5IT9N 2RD9A 1YYXA 1LVKA 1JQ0A 1GM7A 3B40A 5BZBA 4QI0A 3NR7A 4JI2O 3L8IA 1PD1A 3JRMO 2ZDIA 4RAIA 3CWBH 3E89A 1K40A 4H0LB 4YL3A 1S5HC 3V5XA 4FZ0A 4I4TB 5CI9A 1WJZA 2QKCA 1D1AA 1QVFU 1GTOA 4EKWA 3KG2A 2JDIG 5K0IA 1XL6A 3K1IC 5EYPA 1M57B 2QLAA 3W7SA 2AZ0A 4NXMB 2QJ1A 3CSXA 3K66A 1FXKC 2FL4A 1R6TA 3C90A 3ATPA 1TA8A 4Z9HA 2EIMB 1RMVA 2FB5A 4ZKIA 4MW3A 3ABMB 2OCCC 1CXZB 2QM7A 1IVSA 4UCOA 4MQ9F 1OW6A 3W4YA 3AG3B 4YN0B 4IYIA 3MBGA 3GWOA 2ZNJA 5ITZA 4LF8O 4JJFA 1OKKA 2BSKA 3APOA 2ZNIA 1VF6A 4LBEC 4MT8A 4TQFA 3M15A 4OIPF 3IEEA 4RDAA 5E3AA 1Q6UA 1QHTA 2WLMA 3JYCA 2FFHA 2YQYA 1JFFA 2JPUA 4E0HA 2DYRB 3IAYA 4UCTA 3GWKC 3BPZA 1QVGU 2NUPB 4CS9C 1NU7D 1JOYA 1QKRA 4BJ5C 4XEKA 4DV1O 4AX2A 1PNKA 3SYPA 1N33O 3K58A 4GYTA 4JYYA 2CDQA 4HFFB 1OV9A 3SDLA 4QI2A 2YWAA 1OCZC 2TMVP 3OTFA 5B1AB 4RQEA 2RDCA 4CSAA 3EGXA 1M2VB 4U3JA 1G4YB 1AR4A 3BEHA 1V9PA 2WLKA 1QLEC 4G7HF 4TSFG 2WAMA 2R9IA 3Q7LA 3SXKA 1OR2A 4H33A 5LOVB 1AEPA 4E0IA 5JRAA 2J0XA 5IJ0A 2ZE5A 2LQGA 1Y4CA 3K5LA 4YHHB 1SZIA 3JCUQ 3L73H 3UO3A 2WLJA 5DECA 5ITZB 1XNRO 2BSKB 3B2EE 2ZKOA 2KG7A 5KHGA 2ARHA 1OXKA 1QPUA 2IXOA 4E2LA 3OUSA 2AVKA 3U0CA 2HSQA 1VEWA 1MNEA 4YJ3A 1GK9A 5DM6V 1HY5A 2DYSB 4JYAB 2X51A 3ZHSA 1ST6A 3TD7A 1TUBB 4FFKA 2CTRA 2R7XA 2ZDIC 2NNUA 1Q0DA 1YDIA 3KH2A 2D4UA 3ZMVA 4UFZA 2P67A 5H9CA 1RSOB 4DV6O 2W6JG 2ZINA 1YCIA 4P2ZA 2HFEC 3CCQV 1JPJA 5HFLA 1G4US 2VASA 2YIDA 2EPMX 4YL1A 4AE4B 2CK3G 3TULA 5E3CA 2CW0F 3W7TA 1I08A 1BMFG 2KG7B 5F5FA 3FYEB 1ORYA 1IBMB 2O57A 3AG4B 3LESA 2R72A 3AG2C 3RVYA 3K57A 1DGSA 5FL7G 1IXMA 4OIRF 3S27A 1K05A 4YJ3B 5E79Z 3ASOB 3PHF2 4IAQA 1V4AA 3JALA 4X89A 1WP8A 3KKBA 3JT1A 3Q6MA 2Y3DA 4BW9A 1KYOF 3ZHVA 2ZR3A 3FMSA 2QR4A 3WHNA 4FLVA 4FLWA 3T4ZA 4JYBA 3FB6C 3ETQA 4OGQB 1MMGA 2Y39A 4CS3A 4GZRB 3LAYA 3S3XA 1EA8A 1A7DA 3VBBA 2YIBA 4QJFB 2AU5A 3IFXA 2ZXPA 4DV7O 2VWKA 3PDMP 4LF9B 4DR2O 2HEPA 3VQYA 1VARA 5LMNO 2N05A 4F4LA 3CMAV 3JATA 4LLEA 5DVWA 1QCEA 4NY3A 1K34A 5L0CA 1URFA 5B3SC 3CQZA 2XAHA 1GM5A 3L1MA 1RFYA 4FPPA 1I4ZA 2YLGA 1JPXA 1YZCA 2HJFC 2IXMA 4KNWA 1M2OA 3BAAA 5IYDO 1SF8A 4DW1A 4KBLA 4X20B 5FPOA 2H7OA 2BE3A 3DE8A 1M56B 1BHAA 4CX9A 3RYCA 3S3WA 1Q7YW 1M1KW 4O79A 2OIGA 4TWKA 4TV8B 1VLSA 2Q9BA 4JEAA 1YSCA 4AQYB 1KUQA 4U5HA 3JALB 2Q9CA 5BUOA 3F7VC 3RYFA 4BR6A 4GX0A 4MVQA 3NG1A 4UV9A 3QO7A 3T6BA 3OEEG 2WZFA 3H9VA 1Q3EA 2NPUA 3FKSG 5J2TA 1KNYA 4WFBV 1OCRB 1FFXA 1O9GA 2UUAO 5AGFA 4PHZA 4EBJA 2J46A 2YLIA 1T01A 3MX3A 1FMVA 3JASA 1UFIA 5HV9A 1DF4A 3ZRXA 5BR8B 1P7GA 2HFIA 1BL8A 3N0TA 1MSWD 3U5SA 1QR9A 4U9DA 5L3QA 2ZM6B 4CH5A 1YA7O 4ULVA 2HJ3A 1AJPA 1AROP 5B66Z 1V55C 2Y3GA 3UMHA 2JJ1G 5L0JA 1LE2A 1H8EG 4GQHA 3R7CA 2RJZA 3HKEA 1E85A 2DJVA 2PBEA 2Q7GA 1VQ8V 3B8NA 2JD3A 5JSLA 2YSUB 2L35A 1SMYF 5EBMC 4XBFA 5IYZB 4X88A 2YXHA 5LHGA 2J7PA 2F4VO 5JVEA 1A0BA 1VQPV 4QE9A 1RM1C 1XMQO 1ZHXA 5DQZA 3ZMSA 3OGIB 2PTMA 3Q7GA 2YZSA 1N4CA 4NC3A 1LPEA 1B06A 1FFXB 2ETSA 3H65A 1FXHA 4YJWA 1AILA 2ZE8A 2AHYA 3FAVB 4PA3A 1S05A 1RKCA 1MMDA 1J5EO 5KYWA 2LFRA 3CRRA 4UB6Z 3ZRSA 1FKAO 3C63A 1R1BA 3TQOA 2CDYA 4JV5B 5JUAA 3RWRD 1THZA 3WFVA 4G0HA 3WU2Z 1SESA 1YI2V 1YIJV 1WN7A 4GYCB 4K35A 1P4RA 4QIWF 2LFFA 2RCVA 1UG7A 4I55A 4E17A 4PA7A 3ASNB 3HKEB 3AGUA 3N27A 5L0DA 1KU2A 1SQPH 2A6EF 2LFSA 2DQ0A 1AI7A 1ZW3A 2VCBA 5E1AC 2WVOA 4XPWA 2UUIA 3GODA 1S3JA 2XL4A 1HR0O 3R66A 3NDBB 1HNWO 4DV0B 4YK5A 2R9AA 3APQA 1H7IA 3M99B 1YVWA 3C3TA 4JI3O 1K7DA 1CGNA 5LXTA 1K33A 5KYYB 1APCA 2EPOA 2R9RB 2M6YA 1H6GA 1YLMA 2XOKG 2N74A 4YIPA 4F4BA 3AG1B 3CD6V 2QEXV 4FM0A 2XHBA 2EINC 2ILMA 2OEXA 3ABUA 4CBCA 2G3KA 2EIJB 1N36O 4NTWA 3RQEA 2DW4A 2W4BA 3EHBB 3SPHA 2Q4PA 1KP2A 3JSLA 4J9ZB 4WBNB 3G80A 4GUNA 1L1FA 3OWTA 1QBZA 4X1KB 4JKVA 2BTOA 3ZCCA 1L7CA 4ABMA 3GM1A 5A6AA 2UU9B 4IYHA 4MW8A 2EIKC 3IPMO 3N2KA 2A0BA 3TGUH 3FB5C 2Q69A 2UUBO 3JYHA 2YL0A 3H2UA 4JCZA 4C3EA 3ABKC 4WFFA 4LR3A 2RNBA 1P49A 5BQHA 3U8PA 5JT4A 2XXAA 2ZIOA 3T1HB 2WL8A 3J80N 2IU0A 3RN4A 4CJGA 3CZ6A 3OTOO 1MNDA 1AR5A 4GKJB 3AJMA 4KFMA 4LFCO 4E4EA 5IDJA 4DUZB 3JAWB 2XUMA 2OG2A 2UUCO 4KUMA 2X7RB 2F66C 4DV2B 3JTLO 1K73W 3MLGA 2AHZA 3KKYA 4N4WA 4JI7B 3VQXA 2UXNA 1MABG 1SF9A 5EK0A 2Q7HA 3HNJA 4WABA 3CJHA 1JJ2U 4JVSA 1SQQH 3ZHQA 3RQGA 3DGEA 5CMUA 1JMWA 3SP1A 5LL6Y 3D3IA 2QTOA 1SQVH 4TV9A 3LDEA 4BWAA 2IJKA 3C18A 1ZYRF 3MYIA 3SPGA 3CEIA 5IYBO 4G7OF 3KYJA 1KC8W 2MYSA 3FAPB 1Q6HA 1BQZA 5JVDB 2Z0AA 4RQFA 2LJ2A 2XT9A 4I3MA 3V7OA 4PA9A 2XXAB 4YL0A 1HP8A 4X62O 5A6JA 3GB7C 2CCYA 1EZVH 3EPVA 2HV7A 4LC1A 4ONSA 2CE4A 2Q8VA 3U9JA 2VQEB 1RKEB 3C62A 1M93A 2PGGA 1PV0A 3MHHC 3F5TA 2KJGA 4U3FH 3HTKC 4OD5A 2AW9A 3QO8A 5K1PA 1EN6A 5IYCO 3HR0A 1IDSA 3NMJA 1I4YA 3FHDA 5T3TA 4CS8C 2R02A 2E5LO 3H1KH 4X1YA 4CS4A 3FDQA 1CPQA 2UUHA 4YT4A 1BT8A 3ETDA 1Y76B 1EQ1A 2UXBB 1UFBA 3L75H 4DXWA 3C7JA 3SXYA 3SNHA 3C8GD 2DOSA 2ATKC 4B7EA 1NBBA 5LMUB 3U9MA 1TWCA 1U97A 3ZVRA 1BR2A 2DB4A 4K7BA 4ICGA 2IYLD 4Z2WA 3LSSA 1E1QG 4TUYB 3KYIA 1IZMA 2LD6A 4KL1A 3PMRA 3UNGC 2W0FC 4MS2A 1BDJB 1TKNA 2FTKA 2V26A 1UJWB 4JI6B 4RUEA 4W8PA 3PN1A 1S76D 2Q7RA 2LQTA 2Q00A 2CGNA 2CTPA 3W7WA 3I55V 5KUMA 3VQVA 4NXNO 1ZSPA 5JH7A 1ZUQA 4L8JA 1TGOA 3KCYA 4LF4O 1PL0A 2WVQA 2F95B 5GW7A 3EG9A 1XDCA 1ZHTA 5A69A 2IW5A 3EZIA 1N0NA 2IJJA 2P7TC 3U3BA 4DR4B 3AG7A 1FXKA 1K8AW 2WPDG 4IT5A 4PK4A 5KA5A 4F6RB 2B5UA 2UXDO 5A2QN 3DKAA 5L3DA 2WLHA 3CRQA 5A9GA 1ZU5A 1B6QA 5CA0B 3K3WA 4LFBB 3O39A 5GONB 2JS5A 2OIEA 4B08A 2JEXA 4EBBA 1QZXA 1K5QA 3X1OA 4XPYA 3ZN0A 3CAXA 3C3SA 4JI5B 4XLNF 4Z1MG 4DR5B 1M9NA 1ZL8B 1LUVA 2QTSA 2YICA 4PA4A 1XZQA 4C7OB 1H2GA 4ZOLB 1SERA 1OW8A 4X8AA 3ZDLA 2YL7A 2ADPA 3N2GB 1VB5A 1YTFB 1XMOO 5DQTA 3DM5A 2F1MA 2UXXA 3ML0A 4MTOA 2ITCC 2XL8A 3E35A 1HE1A 4AHCA 5KYXB 4X1IA 1R3LC 3HKCA 1V54C 4DV4O 3BCCH 1Y4MA 4JEBA 5IY5C 4DOZA 2IM8A 1FXKB 2I15A 1IBKB 3LLKA 3D36A 1G8MA 3ZHUA 3CCVV 1C17M 1JJOA 4QPJA 1LE4A 4X64B 2K1EA 3LS1A 3U2LA 2W0XA 2OCCB 2YXLA 4DR1B 4JI0O 4X65B 4DR6O 2E75B 3OR7C 4LH6A 3BY6A 3A9CA 1MMNA 2GDCA 5CIVA 2PI4A 1A7EA 2GA0A 4LFAB 3I56V 3PCVA 1Y74A 3UO2A 2HHHO 2HJMA 2L81A 2Z3YA 2BOBC 1K4DC 1KKCA 4KHPO 3T4RA 4O4IA 3JCUZ 2UXCB 1TQGA 1WLEA 3E22B 4G7ZF 3QVNA 1LIHA 3RYHA 4BIUA 4PJMA 4X9QA 2XAGA 1NBMG 3HKKA 3HLZA 4YY3O 4DRHB 4D7SA 3OD4A 4JZGA 1OCZB 3ZMUA 4F6EA 1XBLA 1JAFA 2FKXA 3EGDA 3BRJA 3Q6NA 1WP7A 2Q7EA 1J8MF 3L72H 5C8YA 4FX5A 2FGYA 3CCRV 2Q3TA 1O9HA 1QLEB 4UXNA 1LS4A 1VQ5V 1M6TA 1SQXH 1EZJA 2WSSG 1P7BA 2H3OA 1C03A 3TK0A 3GEHA 3JARA 1NJIW 3A8TA 4H37A 2J9BA 5B1NA 3A0RA 4D4NA 4BIZA 3AK2A 5D91A 1DLBA 4HAMA 1I94B 1W59A 4JGSA 3CC2V 1G5ZA 2C03A 4FM2A 4ER9A 1ENVA 2YEVA 2JGDA 3CP1A 5B5EZ 2Q73A 3J81N 4DRXB 3US6A 2WLLA 5L0IA 1Q6IA 4BW5A 2WLNA 3SYQA 1YYJA 1VQLV 3OMIB 1PPJH 3OT7A 4O4HB 4JF3A 3ZRWA 4LF6B 3EJNA 1Z3IX 2R7OA 1XOUA 3FVYA 3VYWA 2EJRA 2DQ3A 4AILC 1CPYA 1US6A 4JI4O 3BVOA 3CB2A 1AI5A 3U2MA 1XNQB 5F28E 2QM8A 2Z15A 4LDRA 1VMGA 1GN2A 3B71A 1GH6A 3I5PA 4UCVA 2A0LA 3BA9A 3SYNA 2G62A 1EN5A 1GMGA 1MMMA 3JARB 5EYPB 3WG7C 4A2NB 4P9FA 3WAQA 2L9JA 4G2KA 3LSUA 2OU6A 3D36C 1B04A 4FZ1A 2YXYA 1QVXA 3M79A 5CB4A 4RUFA 5DN6G 2P7VA 5EHHA 1VTMP 1D0YA 4O4LA 3H2VA 3A0BZ 3ZIAG 4DR7B 4B3SB 2NR5A 2CTWA 4CBEA 2Y4UA 2CH7A 4J7YA 2KC3A 4JI8B 3AEIA 4QGPA 4O6YA 2IH1C 3T6JA 5KYNA 3CEXA 3VF0A 4EBKA 1JFFB 4EUKB 4WFEA 5COMA 1KU9A 1XHXA 2GUZA 2YRFA 3E8BA 3SYCA 3CPWU 5CA3A 2ZXWB 2HVJC 5K1XA 5FLXN 4X66B 3DSQA 2E87A 5L0FA 3DC5A 1GM8A 4MVMA 5IWAB 2AZ2A 5FCLA 4XDKA 5JQGA 3EGXB 1EM1A 4KP4A 2V4DA 4K8XA 2JX0A 1Y67A 4U3JB 5B3SB 5GTIZ 4IGGA 2JIZG 4J10A 4H44B 3QTCA 4B3RO 2A06H 1GAXA 1X4TA 5IJ0B 4O4LB 4P9OA 2Q6AA 4IIJA 4DR3B 4OX9B 3B8MA 2CH7B 3OR6C 3QG5A 3NMIA 3OMNB 1XZPA 2PFDA 5EZYA 1YAUO 2R7QA 2BTQA 4CJOA 4R50A 4RO2A 1R3JC 3HKBA 1HNXB 3OMAB 1U89A 3D8CA 2VH3A 2MW2B 2EZPA 5KHIA 4R6ZA 3NYMA 4Z1VA 5CBFA 4WCEV 5B1AC 1BS3A 2PY5A 4JURI 4ZI7A 4NXMO 2JS3A 3E2EA 1T6IA 4NTFA 1A32A 5LYJA 2GUZB 4I50A 1FFTB 1VLTA 4LCUC 2PNOA 4A4AA 5KUKA 4ANJA 3SYOA 1S5JA 5D5QA 3KPHA 1Q86W 3FB7C 1TR2A 2OJQA 3VOUA 3T2MA 3AK3A 3QW0A 3K06A 4IAOA 3SXMA 3IQCA 4HNAA 1WB8A 5KAFZ 4JAAA 3EFFK 1KB9F 3ZMZA 1N1CA 4GKKB 1JPNA 2PF4E 1R73A 4ZHQA 2P4KA 1N34B 1V55B 3TJ5A 2HR3A 5L3EA 1M4UA 2ZT9B 4WGZA 1GO3F 3ECSA 4K1OA 3IHUA 4LLCA 4J42A 3LDDA 3S28A 2F43G 3ZBHA 2OWOA 4TQDA 4AL1A 1S5LZ 1M90W 1K97A 3V5YA 3ABTA 1FYJA 2XASA 3W2VA 2CUGA 5J2UA 2QWOB 2J8WA 4ASUG 1Q0KA 4HEAJ 4WFGA 1Q8IA 1K3EA 2WLIA 4O4JA 3Q4HA 3EHMA 3OFNG 3CSKA 4YHHO 1F51A 2YIBD 3MHSC 1V74B 1AVOB 4HYOA 1SETA 3CE2A 1NZ6A 4LP8A 2WA3A 3ZQVA 5A6KA 1GKFA 4CS2A 4XTKA 5D92A 3QNEA 4JCHA 2DGJA 2C04A 4NTAA 1TUEB 3HNKA 1CGME 1BSMA 3ZWIA 3JATB 1A7VA 4ZLDA 3ZC4A 2P90A 2GHYA 2QM4A 1RJ9A 1YJ9V 3EVKA 3FX7A 3RYLA 3NXSA 4J7JA 3OEOA 2A7WA 1PL4A 4BJ6A 4JYAO 1Q0MA 5A6BD 3OW2U 1XILA 2QTVA 2B1IA 2NUTA 1XL4A 3KCXA 4EB6A 4UB8Z 4UVBA 3M4BA 3RYCB 3W8HA 2IBZH 5LHHA 3E9VA 2VRZA 5T3WA 1OCCC 2WB7A 4P30A 3WB2A 4CDAA 3ZQYA 1K04A 2AP3A 1EKYA 1OZ0A 3RYFB 1N32B 2GFHA 4U9EA 1FNTc 2WLIB 2QDOA 1B3QA 3RFRA 3KL4A 4E7ZA 2J9UA 2RSEB 1SQFA 2DWDC 4ZBMA 5J2TB 1BGYH 4ULWA 1VF7A 1Z5VA 3MYFA 1ZX3A 2EINB 4PDRA 3E8GA 2CGEA 1IBMO 3JASB 4GX5A 4FLTA 3K0DA 4PI0A 2J9VA 1IBLB 3LJBA 2V1DA 2MHRA 1NVPB 4B3MB 1GN3A 2OYQA 5L3GA 1VK5A 4K0KB 1NT2B 4IARA 4EB6B 4DVYP 1HWYA 1JR9A 1SQBH 3LS0A 3LNRA 4LF5B 1ZLZA 2EIKB 4LF7B 3K33A 4GX2A 4LF9O 3JZ0A 3T1YB 3TJTA 3K9SA 1SYQA 3K1HA 4WFHA 3ABKB 5L0HA 3SJQC 1WA8A 3J7AU 4YT2A 1FMWA 1IW7F 1WOLA 1Z63A 5KHJA 1YJWV 4N21A 3K6BA 1D5AA 4YJ2A 2AGAA 4O2AA 3QMKA 3CC4V 1H2LA 3UT5A 3MFNA 4DUYB 4O6MA 5GPGB 2LP7A 4PFOA 4JI1B 5KYWB 1WGWA 4DK1A 4LERA 3O65A 1VF5B 1ZHWA 5FNVA 3DAFA 3IQ6A 2H7VC 4CS8A 4AQYO 2HZ8A 5KHKA 1I5NA 3NMKA 4NYKA 3DXRA 2ADQB 1BR4A 4HBNA 3I4UA 4PJJA 4MTXA 4I55B 2LGQA 2R7WA 3G4SV 3JRTA 1NI8A 4IB4A 2RN9A 1SA0A 2M4EA 4BJ6C 1AP6A 4LNUA 5DS5A 1AB3A 3B09A 1D2DA 2XL6A 2QKAA 3HNIA 4JC7A 5J9PC 2A3QA 1Z5WA 1WA8B 1RPOA 3V5ZA 4PV1B 2VB6A 3HKDA 1K5SA 1YJNV 2JK5C 4PDVA 5BR8O 5LXTB 1JMKC 4PJ0Z 4O2AB 4BPMA 2ASRA 5DS6A 2ZCEA 2YS8A 2ZM6O 4B3TB 5COGA 3K79A 4NKGB 3U10A 3ZJZA 1HNZB 4ZLCA 2J9WA 1U6HA 3M7MX 3STZC 3IQ5A 4TT3G 4UDVA 4NTBA 4DBRA 3ZRVA 4J41A 2QKSA 1K92A 4XQ1A 3IC9A 4KXRA 3DXRB 1FD9A 4C7UA 2A6HF 2EILC 1Z2GA 3GVMA 4ZIBA 2K9PA 4JTDB 4E18A 2YI8A 2X0CA 2NG1A 2W4MA 2PP4A 2R70A 4LNUB 4I0XA 2A69F 1WNSA 4IJJA 1YJGA 3BHPA 2B1GA 1WN0A 3CXHF 1MZFA 1HE9A 1ZAUA 2MK3A 2ZR2A 1FAPB 3S9OA 4AK9A 3WB1A 4DV3B 3I5QA 3N2KB 4DW0A 1TVKA 4B6IA 5EIBC 1VYKA 1S77D 4JV5O 2VQFB 2EBOA 3R2PA 1W0KG 3UMIA 1ORSC 5L3CA 2ZE6A 3MD0A 2H7BA 3FFQA 1FJGB 2VS0A 5EBLC 2Y69C 2YUAA 3SZRA 3W7UA 3NKDA 1VYIA 3FD9A 4MNDA 4U5EE 3ZN1A 4CH4A 4YIOA 3UCSC 3GANA 4DV5B 3LNMB 1YVIA 5B1BC 1R3KC 3CHXA 3C8GA 2VCAA 2YI9A 1SS3A 2QY9A 5E33A 3JD4A 4PJNA 2R7TA 3LEVA 1NFOA 3S29A 1XHZA 1VQNV 2V3CC 4HZ3A 4DV0O 3CJHB 2LIGA 2Q68A 3R65A 3EFOA 3F5WC 1NQTA 2WVNA 4PFPA 1YITV 2PYLA 2PYJA 3ZHTA 4BAYA 1ZW2A 3UQ8A 2BOCC 1QLNA 3RT3C 4PA6A 4U5CE 4TV9B 1MNGA 3BFRA 3TJ6A 3HJCA 2FMLA 1NR7A 1AJNA 3DM9B 1LI5A 3RW0A 3POVA 2L6HA 5GTHZ 1MSDA 4DVZA 3FXHA 5CA1A 1IX9A 1YHQV 5H6QA 5CBGA 1XUQA 5AC5A 1VQ4V 4FWVA 3JSEO 2WZGA 2R25A 1FFHA 1L0NH 4JI2B 2UU9O 1COWG 2JVDA 1J95A 1T6UA 3SJCC 3K04A 1F7YA 4J7KA 5L3BA 4JW1A 5IY5B 4X1YB 2N04A 2B0HA 1WPXA 2YIAA 5KMGA 1JR8A 4Q6GA 3CCSV 3SPIA 1CEZA 5LP6A 1NTZH 2YC0A 3GWLA 4FLXA 4YXWG 3T1HO 3SEOA 1BZ4A 5DLJA 4GKJO 5BXZA 3HNLA 1R4TA 1Q43A 1NG1A 1KTMA 4DUZO 2B9ZA 3SR2C 4FLZA 2XLMA 4DV2O 2RQ6A 2R7VA 2XNDG 4JI7O 3T9OA 3ZIBA 4UCUA 2E76B 1FS0G 2X0LA 3RYIA 5CA1B 4LF8B 3P3PA 1SRYA 2J0WA 4GEHA 3E83A 2GTSA 4XDLA 3JD2A 1FPOA 1U96A 3ABLC 4JZAA 4XLPF 2VWJA 2CNWA 3ETEA 2EZOA 4MVOA 4HFKB 3CYOA 2C2AA 3E8FA 1Z6AA 2QSAA 2A0UA 1YTFD 2QGNA 3JAKA 2BE5F 3B29A 3GWNA 4PACA 3H1JH 3M1CB 5JH7B 3RGBA 2HSBA 1Q0FA 4WGYA 1YXBA 2OTJV 3TOMA 4DV1B 2EPNA 1CPRA 2LP4A 1H2NA 3UGOA 1N33B 4UVCA 2Y3BA 1LKXA 4FFBA 3EG9B 5EGYA 1SZTA 1RCPA 5KMGB 1W2BU 2IM9A 1ZTEA 2XM4A 3IQTA 2QA4V 3MAQA 5HSWA 2LW1A 4O7GA 4W4KA 2E74B 3L8JA 3W7XA 1YEWA 2GBOA 1NR1A 2A68F 1OQCA 4PJLA 1KECA 4DBQA 3KZIZ 4PD4F 3CRCA 1NH2B 3FAJA 4KC9A 3QZCA 2VQEO 2PX3A 4FAPB 2H94A 4K3AA 2B0JA 3P32A 1JCHA 1XNRB 3QVZA 2EPKX 3L0IA 3UMKA 1Q82W 3OEHG 3ICXA 4N6CA 4PDMA 1YARO 3A11A 3P3NA 1QNMA 2HKVA 1XI1A 1UPGA 1DOWA 1ZVZA 2GTAA 2UXBO 1NTMH 2CAZC 1PV3A 4J80A 3DZAA 4BEJA 5LMUO 4EIYA 1VQOV 4X1IB 1NKDA 3B0VC 3HKCB 4CDVA 2CYDA 1AVMA 1GM9A 2W9YA 1N8RW 1GQAA 1H8HG 3WG7B 3K5NA 1FXVA 4CC5A 2KB1A 4JIOA 4YT8A 4I44A 2XLEA 1ROPA 1YDXA 4IL6Z 3OA1A 3SGIA 4DV6B 3K03A 3IJ4A 2QWQB 4CC6A 2Y0PA 4JI6O 3DWWA 4J7TA 3IGAC 1ZHYA 2NSGA 2YDEA 5LP6C 2XAFA 1Q90D 1G6UA 1PD0A 1BZKA 4JYCA 1GS9A 2PUSA 4UCRA 1P84F 1TWGA 1NZEA 2NUPA 3DE9A 3QF7A 4UVAA 1JX9A 4EFEA 2P61A 4FLUA 3IC7A 1Y74B 4O4IB 4BIOA 1SZXA 4UUJC 1OCOC 1VQ6V 2IJIA 3AK1A 3RYHB 2QE7G 4GLXA 2PI5A 1NU9C 1Z5ZA 3JAMN 4DR4O 2X6AA 3CCUV 1M2VA 2HMZA 4XWJA 2BL2A 1HW2A 1YF2A 2NLJC 5LOVA 2D5RB 3EGDB 2OCHA 3X2QC 3ZHRA 4LFBO 5C8YB 3SJBC 2YL3A 1W0JG 3F7YC 3DXJF 4P6IC 1VMAA 4WF9V 4BJ1A 4JAUA 2M64A 4NR1A 2WA4A 1PCXA 4U5BE 3BA8A 1H38A 4DV7B 5DEDA 3DAGA 4JI5O 4DR2B 4DR5O 4NCQA 5LMNB 2X6CA 4JAVA 2A79B 4J7ZA 5LBQA 3M4CA 1Z7Qc 1O5HA 4J11A 1VIBA 1OW7A 1CGOA 1IXBA 1F23A 3CMEV 4JJGA 4Z9JA 1WB7A 3EZHA 3LNNA 2GAQA 3THOA 2L6FA 2YEVB 3FYIB 3O6XA 3W8IA 3U11A 3TETA 1OKKD 2VCCA 3AG2B 2JGDB 1TUBA 4NVPA 1S7ZA 3QTHA 3I5DA 4PR9A 2WLLB 1L0LH 3GEIA 1E79G 3RKOF 3ZRWB 2VC9A 1IBKO 3WB0A 4J30B 1RSOA 3DTUB 1LS1A 1DTOA 4X64O 2ETNA 5EBWC 3CC7V 1WASA 1LNQA 4FVMA 1Y6XA 4DR1O 5LA6A 4X65O 2WZLA 1M57C 4AE4A 2PZSA 2OJED 1LM3B 4QPKA 2Q4FA 1EI7A 3OAAG 2FYUH 3G50A 2EIMC 3B77A 2UUAB 3TK1A 3G6BA 4LFAO 2CGOA 4M63A 1SR2A 3BABA 3ABMC 1T5EA 2UXCO 1IURA 4DJ9A 3QW1A 1ZHZA 3AG3C 4FMTA 3G4XA 2I8BA 5CB4B 1VQ9V 3NYJA 1H2SB 2P1AA 2Y48A 3FOPA 3L74H 1BQ0A 4U7NA 2XLOA 4W8KA 4MTFA 1B68A 2DYRC 3ZTMA 3JD1A 4XDJA 2HMQA 2YHSA 1G1XB 3RIPA 3JD0A 4JZ2A 1F4MA 5H6RA 3AOUA 2F4VB 5LA6B 3DD7A 2HLDG 4I1OB 1XMQB 5JCOA 4LWSA 2KK1A 1BR1A 1I94O 1D1CA 1EBOA 1JRAA 1T9KA 2HV6A 1JA8A 1XWJA 1VQMV 2ZPAA 4EHPA 2P06A 5JQGB 1XEQA 4X20A 1J5EB 2P6VA 2ITDC 4YT5A 1D0ZA 2OEVA 3RVZA 3EHNA 1VF6C 5BY1A 1R6KA 4TV8A 2Q0AA 4LF6O 1HMDA 1W2WA 2BCCH 4XEFA 5LGTA 4G78A 4IIJB 3UR3C 2QE9A 3ITFA 1XNQO 1OCCB 4NTXA 2QWNB 4QNHB 2P0NA 5EZYB 5KYUA 1BCCH 2QWRB 4G27B 2DYSC 2BTQB 4MTGA 4X0RA 3ZSUA 4FM1A 4CIHA 3HKBB 4NTYA 2JGUA 2ZXWC 3OUFA 1Q5OA 3S84A 4MVZA 1O3UA 2LFDA 4CSAC 4ZI7B 1RM1B 2AXTZ 1HR0B 3SPCA 5F2VO 1MG1A 1C02A 4DO2A 1HNWB 5LYJB 1PNMA 4I50B 4LWSB 4NB5A 1MQVA 3DJUB 4FLYA 4IWBA 4JI3B 2JEUA 2R7SA 2OKUA 2ZQMA 2IBFA 2ZXOA 3HB3B 2DE0X 5KLVH 2DWEC 4DR7O 4B3SO 3FOOA 5H2FZ 3O10A 5EC1C 4WJ0A 1EN4A 1MOFA 1MZEA 2BC5A 3F46A 4LDKA 5A6BA 3L34A 3JYYA 4CIPA 4HNAB 4JI8O 2XM0A 4PDLA 4P9PA 2HS5A 1ORJA 4I1MA 3EXAA 5F5HA 1TWHA 4ZHQB 3AG4C 3TXSA 1LUWA 5IYZA 1N36B 1NSGB 3VM6A 1AR1B 5B3IA 4EFBA 3ASOC 3UGPA 2GSMB 1K9MW 4U5FE 3LUTB 5KYUB 3B0UX 1QR8A 3A2FA 1FFTC 2P6JA 4OPHA 4X66O 4OIOF 4U7OA 4MVUA 4FJCC 5IWAO 3SPJA 3AQCA 1N0JA 3FAVA 1E84A 1E83A 4DK0A 1U0BB 3S90A 4RWUA 2EX3A 1AI4A 5J2UB 1XREA 3PJSK 2AWYA 2HJDA 2L7AA 4OIQF 3VRCA 2UUBB 1LI7A 3GORA 3CXCU 2Q5ZA 4C3DA 1QU7A 4O4JB 3Q4HB 3CRMA 5B1OA 1RP3B 4P9TA 2IXNA 5JLIA 5CN0A 3RBZA 1Y6DA 4DR3O 4OX9O 5JCOC 2HUJA 3NYLA 1G8XA 256BA 3UM7A 2OTLV 4PI2A 3ZTZA 3OE7G 3OTOB 1PM9A 4LFCB 2EPLX 1QSPA 2XLWA 1HNXO 4N06A 2JRIA 1E86A 2LSEA 3EQLF 2UUCB 5BQIA 1RJ9B 2M7WA 4DRJB 1M56C 1NVPD 2EULA 3L70H 2DI3A 3JCZA 2AWCA 1X59A 2NSFA 1SKVA 4J32B 2NUTB 2GV9A 1H2MA 5KYYA 1MMAA 3F47A 3CCMV 2P5OA 3H1LH 1VQKV 2IU3A 2R03A 1EFRG 3MDSA 1MA1A 1TFOB 2J7PD 1K4CC 1JVMA 4IHJA 1ORQC 1Z23A 4JTCB 1OCRC 1YZAA 5LHIA 1L8DA 2W45A 2XLVA 4GKKO 4FIPC 1N34O 5LGUA 4LH7A 3HPLC 4LACB 4QE7A 1YZBA 2F23A 2IOQA 4X62B 1WATA 1Q81W 3OGCC 4MVSA 1VOMA 4WBNA 3O55A 3ETGA 3SXZA 2A1DD 4I5SA 3LLIA 4HE8D 2KQ9A 4X1KA 2EILB 2P4VA 2V7QG 3LSQA 4K8ZA 3H01A 2E5LB 2Y4TA 3LDCA 1PNLA 3G6EV 4BJTA 3J06A 3G67A 3G4ZA 5EIBD 2LW7A 3DMDA 1E1RG 3TCUA 1HMOA 4JASA 5JJNB 5IJ9A 2W6IG 3ZG1A 4IHJB 1GN6A 4EEQA 1QQ3A 4KI2A 2DMXA 1BE3H 3JAWA 4Z9IA 2R7UA 1OHHG 2Y69B 2YL1A 1F1MA 4AL0A 3O9OA 1CP9A 2LO1A 5JJEB 4YJ2B 4OINF 5TISZ 2GWWA 1T5OA 3UT5B 3KMIA 2R05A 5B1BB 3CCEV 1F4NA 1SQGA 4YWQA 4BG0A 2OT5A 1IZ3A 3P30A 5FNVB 4JPRA 2F22A 3ASNC 4NXNB 1S0VA 2WWWA 4XEVA 2ZD9A 2E3CA 4EWCA 1E2XA 1SC5B 2A9HA 2Q67A 5KA6A 1D1BA 5KX5A 1N32O 4RBNA 4R7CA 4N6HA 4O6NA 5FPRA 4GX1A 4LF4B 1KKDA 2GDSA 4CH6A 4XPXA 2QNLA 4KNVA 3EH1A 1SA0B 5JVDA 2R7RA 2YLDA 3QVYA 2NN4A 2ZXRA 2L6LA 3K5MA 1DOVA 4U5GA 1H9TA 5IJ9B 4CH3A 2KKWA 3L71H 1S72V 4H54A 2KYHA 2UXDB 1GGQA 1RKEA 2HVKC 2EJ7A 3HKDB 4N23A 2L6GA 3STLC 1LR1A 3AG1C 4D7TA 1IBLO 3TOLA 4CS7A 3T4DA 4B3MO 2OQMA 1H2KA 1AUEA 1TWAA 2JJ2G 4K0KO 4D6TH 2XSEA 4JRZA 3H1IH 3JSNA 2EIJC 1NFNA 1H9GA 2OOCA 1Y76A 5C93A 2ODMA 4LF5O 3U0ZA 4LF7O 1A41A 1L3PA 1XMOB 2YKZA 3GM2A 4D4XA 1I5YA 1KBHA 1HDJA 1G4WR 5KX5B 4RD9A 3T1YO 1I5XA 4B7KA 1WTYA 3RFYA 1KP3A 1XQ8A 5L3VA 2KQXA 4DV4B 2HG5C 5JP7A 5AC4A 3L9DA 3D3QA 5TJ5E 4I0XB 2H8PC 2Y0IA 1BBHA 1WWPA 1OXBA 1VP7A 4TUYA 4GCZA 3UKMA 5E2QA 2LK4A 1PP9H 1PKXA 4UCSA 5KHHA 2FAPB 2KNHA 2KSFA 2XS8A 3RH3A 1OJHA 2HKOA 2ZE7A 4DUYO 4JI1O 1R6NA 1ZWIC 1RXQA 4JTAB 1TVKB 4JI0B 1Y66A 4DR6B 3EH2A 3K7DA 4FESA 2RMKB 1DF5A 2G3VA 2IXPA 2KSDA 1GN4A 3DI5A 3ABLB 1WAZA 3K5OA
chains in the Genus database with same CATH topology
3CCJV 2J45A 4Q20A 3G71V 2Y3HA 3VAYA 3ZMTA 3B0PA 2X6BA 1KD1W 1V54B 5HFMA 3EFOB 1ZU4A 5CBHA 4WFAV 4PELA 4E7SA 3CCLV 5EC2C 1RPRA 5DS4A 2KW3C 4GT1A 1R3IC 4C7OA 4U5DE 2Q9AA 2D3OW 1O87A 2MWQA 4H4KC 4J9YB 5T1DB 3E86A 5KYXA 5CI8A 3SYAA 4QDLA 3B9QA 1KQSU 3K08A 3QO5A 5LGNA 1VQ7V 4UV8A 4Q5SF 2IJHA 4OD4A 2Z5UA 3FB8C 4G28B 1J8YF 4K0DA 3S0XA 1AI6A 1NH2D 4CS9A 1D0XA 3K0GA 1FTSA 3AQBA 4MVRA 4BJ5A 3E8HA 3NKEA 3E70C 4C3BA 3DJNB 1OCOB 2IH3C 3N24A 3NRHA 2CNWD 2O9XA 2XRHA 3T1CA 2XAJA 1AJQA 3X2QB 3JSZA 4MSWC 1BHBA 3K9AA 4OXSA 2KGOA 4I9WA 4Q7CA 4Q4ZF 1PD3A 2XAQA 3W2WA 4R8CA 4FK5C 2PX0A 3JD3A 5L3FA 4L87A 4IRUA 3OM3B 3N2ZB 4CZZA 3WODF 1LVKA 1JQ0A 1GM7A 5BZBA 4QI0A 1PD1A 2ZDIA 4RAIA 3E89A 1S5HC 5CI9A 1D1AA 1QVFU 1GTOA 4EKWA 3KG2A 2JDIG 1XL6A 3K1IC 1M57B 3W7SA 3K66A 1FXKC 2EIMB 4ZKIA 4MW3A 3ABMB 2OCCC 2QM7A 4MQ9F 3AG3B 4YN0B 3GWOA 4JJFA 1OKKA 4LBEC 4MT8A 4OIPF 3IEEA 4RDAA 5E3AA 2WLMA 3JYCA 2FFHA 2DYRB 2NUPB 1QVGU 4CS9C 1NU7D 1JOYA 4BJ5C 4AX2A 1PNKA 3SYPA 4GYTA 2CDQA 4HFFB 4QI2A 1OCZC 5B1AB 4RQEA 4CSAA 3EGXA 1M2VB 1G4YB 3BEHA 2WLKA 4G7HF 1QLEC 4TSFG 2WAMA 2R9IA 3Q7LA 4H33A 2J0XA 1SZIA 3JCUQ 2WLJA 2IXOA 4E2LA 3OUSA 1MNEA 1GK9A 5DM6V 2DYSB 2X51A 1ST6A 3TD7A 2R7XA 2ZDIC 2NNUA 3KH2A 3ZMVA 2P67A 5H9CA 2W6JG 4P2ZA 2HFEC 3CCQV 1JPJA 5HFLA 2VASA 4AE4B 2CK3G 5E3CA 2CW0F 3W7TA 1BMFG 5F5FA 3FYEB 3AG4B 3LESA 3AG2C 3RVYA 5FL7G 1IXMA 4OIRF 3S27A 3ASOB 3PHF2 4X89A 3KKBA 3JT1A 3Q6MA 2Y3DA 2ZR3A 3T4ZA 4JYBA 3FB6C 1MMGA 2Y39A 3LAYA 3VBBA 4QJFB 3IFXA 2ZXPA 4F4LA 3CMAV 4LLEA 5DVWA 1QCEA 4NY3A 1K34A 5B3SC 3CQZA 2XAHA 4FPPA 1JPXA 2HJFC 2IXMA 4KNWA 1M2OA 5IYDO 1SF8A 4KBLA 2H7OA 1M56B 1BHAA 1Q7YW 1M1KW 4O79A 4TWKA 2Q9BA 1YSCA 4U5HA 2Q9CA 5BUOA 3F7VC 4GX0A 4MVQA 3NG1A 4UV9A 3QO7A 3T6BA 3OEEG 2WZFA 3FKSG 4WFBV 1OCRB 2J46A 3MX3A 1FMVA 1DF4A 3ZRXA 1BL8A 3N0TA 1MSWD 1QR9A 5L3QA 1AJPA 1AROP 1V55C 2Y3GA 3UMHA 2JJ1G 1H8EG 1VQ8V 3B8NA 2JD3A 2YSUB 1SMYF 5EBMC 4XBFA 4X88A 5LHGA 2J7PA 1VQPV 4QE9A 1RM1C 1ZHXA 5DQZA 3ZMSA 3Q7GA 2YZSA 3H65A 1FXHA 4YJWA 2AHYA 4PA3A 1MMDA 5KYWA 2LFRA 3ZRSA 3WFVA 1THZA 4G0HA 1SESA 1YI2V 1YIJV 1P4RA 4QIWF 4PA7A 3ASNB 1KU2A 2A6EF 2LFSA 2DQ0A 1AI7A 5E1AC 2WVOA 3GODA 1S3JA 2XL4A 3NDBB 3M99B 1K7DA 5KYYB 1K33A 2R9RB 2XOKG 4F4BA 3AG1B 3CD6V 2QEXV 2EINC 3ABUA 4CBCA 2G3KA 2EIJB 2DW4A 2W4BA 3EHBB 3SPHA 1KP2A 4J9ZB 1L1FA 3OWTA 1QBZA 3ZCCA 4MW8A 2EIKC 3FB5C 2Q69A 3JYHA 4C3EA 3ABKC 4WFFA 2XXAA 2WL8A 2IU0A 3CZ6A 1MNDA 4KFMA 5IDJA 2OG2A 4KUMA 2X7RB 3MLGA 1K73W 2AHZA 2UXNA 1MABG 5EK0A 1JJ2U 4JVSA 3DGEA 5CMUA 3SP1A 3D3IA 2QTOA 3LDEA 2IJKA 1ZYRF 3SPGA 5IYBO 4G7OF 1KC8W 2MYSA 4RQFA 3V7OA 4I3MA 4PA9A 2XXAB 3GB7C 3EPVA 2HV7A 4LC1A 3MHHC 2KJGA 3HTKC 4OD5A 3QO8A 5IYCO 3FHDA 5T3TA 4CS8C 3FDQA 4YT4A 3ETDA 4DXWA 3SNHA 2ATKC 1TWCA 3ZVRA 1BR2A 4K7BA 2IYLD 3LSSA 1E1QG 1IZMA 3PMRA 3UNGC 2W0FC 4MS2A 1TKNA 2FTKA 2V26A 1UJWB 4RUEA 1S76D 3I55V 3W7WA 5KUMA 1PL0A 2WVQA 3EG9A 5GW7A 1ZHTA 2IW5A 3EZIA 2IJJA 2P7TC 1FXKA 1K8AW 2WPDG 4PK4A 5KA5A 2B5UA 5L3DA 2WLHA 1ZU5A 1B6QA 3K3WA 3O39A 2JEXA 4EBBA 1QZXA 1K5QA 3X1OA 3ZN0A 4XLNF 4Z1MG 1M9NA 4PA4A 4C7OB 1H2GA 1SERA 4X8AA 5DQTA 1YTFB 3DM5A 2UXXA 3ML0A 4MTOA 2ITCC 3E35A 5KYXB 1R3LC 1V54C 1Y4MA 5IY5C 4DOZA 1FXKB 3LLKA 3D36A 1G8MA 3CCVV 4QPJA 2K1EA 3LS1A 2OCCB 3OR7C 3BY6A 1MMNA 2PI4A 3I56V 2L81A 2Z3YA 2BOBC 1K4DC 3T4RA 1WLEA 4G7ZF 4BIUA 4PJMA 2XAGA 1NBMG 3HLZA 1OCZB 3ZMUA 3EGDA 3Q6NA 1J8MF 4FX5A 2FGYA 3CCRV 2Q3TA 1QLEB 4UXNA 1VQ5V 1EZJA 2WSSG 1P7BA 1NJIW 4H37A 5B1NA 3A0RA 4BIZA 5D91A 1DLBA 4HAMA 4JGSA 3CC2V 2C03A 1ENVA 2YEVA 3CP1A 2WLLA 4BW5A 2WLNA 3SYQA 1VQLV 3OMIB 3ZRWA 4JF3A 3EJNA 1Z3IX 2R7OA 3FVYA 3VYWA 2EJRA 2DQ3A 1CPYA 1AI5A 2QM8A 2Z15A 3I5PA 2A0LA 3SYNA 2G62A 1GMGA 3WG7C 4A2NB 2L9JA 4G2KA 5DN6G 4RUFA 2P7VA 5EHHA 1D0YA 3ZIAG 4CBEA 3AEIA 4O6YA 2IH1C 3T6JA 5KYNA 4WFEA 3E8BA 3SYCA 3CPWU 5CA3A 2ZXWB 2HVJC 2E87A 1GM8A 4MVMA 5FCLA 4XDKA 3EGXB 4KP4A 5B3SB 2JIZG 4P9OA 2Q6AA 3B8MA 3OR6C 3OMNB 2PFDA 2R7QA 4R50A 4RO2A 1R3JC 3OMAB 2VH3A 2EZPA 4R6ZA 3NYMA 5CBFA 4WCEV 5B1AC 4JURI 3E2EA 1FFTB 4LCUC 5KUKA 4ANJA 3SYOA 1Q86W 3FB7C 1TR2A 3VOUA 3T2MA 3K06A 4IAOA 3EFFK 3ZMZA 1N1CA 1JPNA 2PF4E 1R73A 1V55B 2HR3A 5L3EA 1GO3F 3ECSA 4LLCA 3LDDA 3S28A 2F43G 1M90W 1K97A 3ABTA 2XASA 3W2VA 4ASUG 4HEAJ 4WFGA 1K3EA 2WLIA 3EHMA 3OFNG 3CSKA 1F51A 3MHSC 4HYOA 1SETA 4LP8A 1GKFA 4XTKA 5D92A 3QNEA 4JCHA 2DGJA 2C04A 1TUEB 4ZLDA 3ZC4A 2P90A 2GHYA 1RJ9A 1YJ9V 3RYLA 3NXSA 4BJ6A 3OEOA 3OW2U 2QTVA 2B1IA 2NUTA 1XL4A 4UVBA 3W8HA 5LHHA 3E9VA 5T3WA 1OCCC 2WB7A 4P30A 1OZ0A 2GFHA 2WLIB 3KL4A 4E7ZA 2J9UA 2DWDC 4ZBMA 4ULWA 2EINB 4PDRA 3E8GA 2CGEA 4GX5A 3K0DA 2J9VA 3LJBA 2V1DA 1NVPB 5L3GA 1VK5A 4DVYP 1HWYA 3LS0A 3LNRA 2EIKB 3K33A 4GX2A 3K1HA 4WFHA 3ABKB 3SJQC 4YT2A 1FMWA 1IW7F 1Z63A 1YJWV 4N21A 3K6BA 3QMKA 3CC4V 4O6MA 2LP7A 4PFOA 5KYWB 1WGWA 4LERA 1ZHWA 3DAFA 2H7VC 4CS8A 4PJJA 1BR4A 3I4UA 4MTXA 2R7WA 3G4SV 3JRTA 2M4EA 4BJ6C 5DS5A 5J9PC 1RPOA 2VB6A 1K5SA 1YJNV 2JK5C 4PDVA 5DS6A 3K79A 3ZJZA 4ZLCA 2J9WA 3STZC 4TT3G 4DBRA 3ZRVA 2QKSA 1K92A 2A6HF 2EILC 4JTDB 2NG1A 2W4MA 2PP4A 2A69F 4IJJA 2B1GA 2MK3A 2ZR2A 4AK9A 3I5QA 4B6IA 1VYKA 1S77D 2EBOA 1W0KG 3UMIA 5L3CA 3MD0A 2H7BA 5EBLC 2Y69C 3SZRA 3W7UA 3NKDA 1VYIA 4MNDA 4U5EE 3ZN1A 3GANA 3LNMB 5B1BC 1R3KC 2QY9A 5E33A 3JD4A 4PJNA 2R7TA 3LEVA 3S29A 1VQNV 2V3CC 4HZ3A 2Q68A 3R65A 3EFOA 3F5WC 1NQTA 2WVNA 4PFPA 1YITV 4BAYA 2BOCC 1QLNA 4PA6A 4U5CE 3HJCA 1NR7A 1AJNA 3DM9B 3RW0A 3POVA 4DVZA 1YHQV 5H6QA 5CBGA 1VQ4V 4FWVA 2WZGA 1FFHA 1COWG 1J95A 3K04A 5L3BA 4JW1A 5IY5B 1WPXA 3CCSV 3SPIA 1CEZA 4YXWG 3SEOA 5DLJA 1NG1A 2R7VA 2XNDG 3ZIBA 2X0LA 1FS0G 1SRYA 2J0WA 4GEHA 3E83A 4XDLA 4XLPF 3ABLC 3JD2A 4JZAA 2CNWA 3ETEA 2EZOA 4MVOA 4HFKB 3CYOA 2C2AA 3E8FA 1Z6AA 1YTFD 2BE5F 3M1CB 2OTJV 3UGOA 4UVCA 2Y3BA 1LKXA 3EG9B 5EGYA 1SZTA 1W2BU 2QA4V 5HSWA 4O7GA 3W7XA 1NR1A 2A68F 4PJLA 1KECA 4DBQA 1NH2B 3FAJA 4KC9A 3QZCA 2PX3A 2H94A 2B0JA 3P32A 1JCHA 3L0IA 3UMKA 1Q82W 3OEHG 4PDMA 3DZAA 4BEJA 1VQOV 1NKDA 3B0VC 1GM9A 2W9YA 1N8RW 1H8HG 3WG7B 1FXVA 2KB1A 4YT8A 4I44A 1ROPA 3OA1A 3K03A 3IGAC 1ZHYA 2XAFA 1PD0A 4JYCA 1TWGA 1NZEA 2NUPA 4UVAA 1JX9A 3IC7A 4UUJC 1OCOC 1VQ6V 2IJIA 2PI5A 2QE7G 1NU9C 1Z5ZA 2X6AA 3CCUV 1M2VA 4XWJA 2NLJC 2D5RB 3EGDB 3X2QC 4P6IC 3DXJF 1W0JG 3F7YC 1VMAA 4WF9V 4BJ1A 4JAUA 1PCXA 4U5BE 1H38A 3DAGA 2X6CA 4JAVA 2A79B 5LBQA 1O5HA 1F23A 3CMEV 4JJGA 3EZHA 2YEVB 3FYIB 3O6XA 3W8IA 3TETA 1OKKD 3AG2B 1S7ZA 2WLLB 1E79G 3RKOF 3ZRWB 4J30B 3DTUB 1LS1A 1DTOA 5EBWC 3CC7V 1LNQA 2WZLA 1M57C 4AE4A 4QPKA 3OAAG 2EIMC 3B77A 3TK1A 4M63A 3ABMC 1ZHZA 3AG3C 4FMTA 2I8BA 1VQ9V 3NYJA 2Y48A 4U7NA 4W8KA 4MTFA 2DYRC 3JD1A 4XDJA 2YHSA 3RIPA 3JD0A 1F4MA 5H6RA 3DD7A 2HLDG 4I1OB 1BR1A 1D1CA 1EBOA 2HV6A 1VQMV 2ZPAA 2P6VA 2ITDC 4YT5A 1D0ZA 3RVZA 3EHNA 1R6KA 1W2WA 5LGTA 3UR3C 3ITFA 1OCCB 4QNHB 5KYUA 4MTGA 4G27B 2DYSC 3ZSUA 4X0RA 4CIHA 2ZXWC 3OUFA 4MVZA 4CSAC 1RM1B 3SPCA 1MG1A 4DO2A 1PNMA 3DJUB 4IWBA 2JEUA 2R7SA 2ZQMA 2ZXOA 3HB3B 2DWEC 5EC1C 4WJ0A 1MOFA 3F46A 3L34A 4PDLA 4P9PA 4I1MA 5F5HA 1TWHA 3AG4C 1AR1B 3ASOC 3UGPA 2GSMB 1K9MW 4U5FE 5KYUB 3LUTB 3B0UX 1QR8A 1FFTC 2P6JA 4OIOF 4U7OA 4MVUA 4FJCC 3SPJA 3AQCA 1AI4A 3PJSK 4OIQF 4C3DA 3CXCU 5B1OA 2IXNA 5CN0A 3RBZA 3NYLA 1G8XA 3UM7A 2OTLV 3OE7G 4N06A 2LSEA 3EQLF 1RJ9B 2M7WA 1M56C 1NVPD 3JCZA 4J32B 2NUTB 5KYYA 1MMAA 3F47A 3CCMV 1VQKV 2IU3A 1EFRG 2J7PD 1K4CC 1JVMA 1ORQC 1Z23A 4JTCB 1OCRC 5LHIA 2W45A 4FIPC 5LGUA 3HPLC 4LACB 4QE7A 2IOQA 1Q81W 3OGCC 4MVSA 1VOMA 3ETGA 2A1DD 4I5SA 3LLIA 4HE8D 2KQ9A 2EILB 2V7QG 3LSQA 3H01A 3LDCA 1PNLA 3G6EV 4BJTA 3DMDA 1E1RG 3TCUA 4JASA 3ZG1A 2W6IG 4KI2A 2R7UA 1OHHG 2Y69B 1CP9A 4OINF 3KMIA 5B1BB 3CCEV 1F4NA 4YWQA 4BG0A 2OT5A 3P30A 4JPRA 3ASNC 1S0VA 2WWWA 2ZD9A 4EWCA 2A9HA 2Q67A 5KA6A 1D1BA 4RBNA 4R7CA 4O6NA 4GX1A 1KKDA 4KNVA 3EH1A 2R7RA 2ZXRA 4U5GA 1S72V 2HVKC 4N23A 3STLC 3AG1C 4CS7A 3T4DA 1TWAA 2JJ2G 2XSEA 2EIJC 5C93A 1I5YA 4RD9A 1I5XA 3RFYA 1KP3A 5L3VA 2HG5C 2H8PC 4GCZA 3UKMA 5E2QA 1PKXA 2KNHA 3RH3A 2HKOA 1R6NA 1ZWIC 4JTAB 3EH2A 1Y66A 3K7DA 4FESA 1DF5A 2G3VA 2IXPA 3ABLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SYO A;  3E8G A;  4MVU A;  5E1A C;  3T1C A;  3IGA C;  4MTF A;  3SPJ A;  4PA4 A;  2EIL C;  3FB7 C;  4GX5 A;  2DYR C;  3SPI A;  4JTD B;  4MSW C;  2WLJ A;  4XDJ A;  4PA9 A;  3VOU A;  4X8A A;  3K0D A;  3T2M A;  4MTG A;  4TWK A;  2X6B A;  3K06 A;  3PJS K;  4OXS A;  3GB7 C;  4MTO A;  2ITC C;  3F7V C;  2A0L A;  4I9W A;  3EFF K;  4GX0 A;  1R3L C;  2R9R B;  4MVQ A;  1V54 C;  4UUJ C;  1OCO C;  3OUS A;  3RBZ A;  3WG7 C;  4R8C A;  3ASN C;  5KUK A;  3UM7 A;  2X6A A;  5IY5 C;  2ZD9 A;  3E83 A;  5CBH A;  4RUF A;  4XDL A;  2A9H A;  2Q67 A;  3ABL C;  4GX2 A;  2EIN C;  3LDD A;  2NLJ C;  4R7C A;  5EC2 C;  4GX1 A;  4MVO A;  2K1E A;  4WFH A;  4CBC A;  1KKD A;  3E8F A;  3SJQ C;  5BZB A;  5EBL C;  2Y69 C;  3X2Q C;  1M56 C;  4DXW A;  1R3I C;  2ITD C;  3F7Y C;  4RAI A;  3SPH A;  3OR7 C;  3RVZ A;  3E89 A;  2ATK C;  4J9Z B;  1BL8 A;  1S5H C;  3SYC A;  4J9Y B;  2IH1 C;  3LNM B;  4P2Z A;  5B1B C;  2HFE C;  4WFG A;  1R3K C;  2X6C A;  2A79 B;  3E86 A;  2WLI A;  2BOB C;  1K4D C;  1V55 C;  3KG2 A;  3SYA A;  4EKW A;  2HVK C;  4WFE A;  4MW8 A;  1XL6 A;  3STL C;  2EIK C;  3AG1 C;  4HZ3 A;  4HYO A;  4LP8 A;  4QNH B;  2Q68 A;  3K08 A;  3R65 A;  1K4C C;  3T4D A;  1JVM A;  3E8B A;  2DYS C;  2W0F C;  2Q69 A;  1ORQ C;  3F5W C;  3FB5 C;  4G27 B;  4MS2 A;  2HVJ C;  1OCR C;  4JTC B;  5EBM C;  2ZXW C;  3TET A;  4RUE A;  3ABK C;  4MVM A;  3SPG A;  2BOC C;  3OUF A;  4MW3 A;  2EIJ C;  2OCC C;  4MVZ A;  3AG2 C;  4PA6 A;  4WFF A;  4X88 A;  4XDK A;  3RVY A;  4QE9 A;  2WLL B;  3HPL C;  3SPC A;  4QE7 A;  5KUM A;  4LBE C;  3OGC C;  4MVS A;  4G28 B;  3FB8 C;  4X89 A;  4KFM A;  4PDM A;  5J9P C;  4P9O A;  1P7B A;  1XL4 A;  5EBW C;  3RW0 A;  2AHY A;  2Q6A A;  2DWE C;  4PA3 A;  2WLM A;  2HG5 C;  3JYC A;  2AHZ A;  1LNQ A;  4H37 A;  5EC1 C;  3T4Z A;  1M57 C;  1OCC C;  3FB6 C;  4P30 A;  2P7T C;  3ZRS A;  5CBG A;  2JK5 C;  3OR6 C;  4PDV A;  2H8P C;  5EK0 A;  3K0G A;  4PDL A;  4MVR A;  4P9P A;  3UKM A;  3E8H A;  3IFX A;  3LDC A;  3SYP A;  2EIM C;  4R50 A;  4RO2 A;  1FFT C;  1R3J C;  2YEV A;  1OCZ C;  3AG4 C;  3ABM C;  4F4L A;  1ZWI C;  2WLH A;  2WLI B;  4R6Z A;  3ZJZ A;  2IH3 C;  5CBF A;  4JTA B;  2QTO A;  1J95 A;  3AG3 C;  5B1A C;  5B3S C;  3K04 A;  3STZ C;  2KB1 A;  4PA7 A;  3ASO C;  2WLL A;  3LDE A;  3TCU A;  1G4Y B;  4BW5 A;  2WLN A;  2DWD C;  4ZBM A;  3LUT B;  3BEH A;  3SYQ A;  2WLK A;  1QLE C;  2HJF C;  4LCU C;  3K03 A;  2QKS A;  4H33 A;  4PDR A; 
#chains in the Genus database with same CATH topology
 5AG2 A;  5KAI Z;  5JJJ B;  1NLX A;  1GRJ A;  3CCJ V;  4Q20 A;  2HHH B;  2J45 A;  3G71 V;  4L6R A;  3U8V A;  4KHP B;  2Y3H A;  3VAY A;  3ZMT A;  1R5I D;  3B0P A;  3RQF A;  1T6Q A;  2X6B A;  1KD1 W;  2D2C B;  3C8G B;  4YY3 B;  1V54 B;  4F6R A;  4NQF A;  4W4L A;  4I9Q A;  4AI8 A;  5HFM A;  5CA0 A;  5GON A;  3EFO B;  1ZU4 A;  5H5N A;  5CBH A;  4WFA V;  4PEL A;  1OR3 A;  3GEE A;  4OPA A;  3LEO A;  4E7S A;  3CCL V;  4B3T O;  3CX5 F;  5EC2 C;  5BMV A;  1RPR A;  1HNZ O;  1ZL8 A;  2KW3 C;  5DS4 A;  4GT1 A;  3C8Z A;  1R3I C;  4C7O A;  4U5D E;  4ZOL A;  4DRI B;  5L0G A;  2Q9A A;  2D3O W;  3N2G A;  1O87 A;  2MWQ A;  4BEM J;  4JE9 A;  3M8A A;  4H4K C;  4J9Y B;  2Q9L A;  5T1D B;  4CDY A;  3E86 A;  4A5U B;  5KYX A;  5CI8 A;  2QWP B;  3DC6 A;  3SYA A;  4QDL A;  1WPB A;  3T6G B;  3B9Q A;  3ZED A;  1DK1 A;  3K1I A;  3ZS8 C;  1KQS U;  3K08 A;  3BRC A;  2F93 B;  2LGW A;  3QO5 A;  5LGN A;  2XS1 A;  1VQ7 V;  4UV8 A;  4Q5S F;  4JI4 B;  2XLH A;  5COF A;  4DV3 O;  3VQW A;  5FZT A;  5JS5 A;  2IJH A;  2P22 C;  2VQF O;  4O2B A;  3TXQ A;  2Z5U A;  3CS5 A;  3FB8 C;  4G28 B;  1J8Y F;  4OD4 A;  1M5I A;  5IE9 A;  1YA9 A;  4K0D A;  3S0X A;  1FJG O;  4LDQ A;  5BMV B;  1AP5 A;  5LP6 B;  2YVK A;  1AI6 A;  3ZX6 A;  3GM3 A;  3E22 A;  1FR0 A;  1HW7 A;  1NH2 D;  1TFK B;  1D0X A;  2ZIM A;  3K0G A;  1FTS A;  2QUP A;  1I7F A;  4CS9 A;  4H13 B;  3AQB A;  4MVR A;  4BJ5 A;  3E8H A;  5BQG A;  4DV5 O;  4TOI A;  1NTK H;  3AGT A;  5D5P A;  2HP8 A;  3NKE A;  3E70 C;  4C3B A;  3DJN B;  1OCO B;  1QQC A;  2IH3 C;  3N24 A;  3NRH A;  3RYI B;  2XLD A;  4I7Z B;  2CTQ A;  1JOG A;  2ICW G;  2CNW D;  2O9X A;  1I0H A;  3H1H H;  1KMI Z;  2XRH A;  4I4T A;  4DYL A;  3B4S A;  5JWP A;  1ZZP A;  3T1C A;  2XTA A;  3JAK B;  4R32 A;  3U3F A;  2Q0O C;  1NS1 A;  2XAJ A;  3K59 A;  1AJQ A;  3X2Q B;  2H8A A;  3JSZ A;  1HW1 A;  2DN9 A;  4MSW C;  1BHB A;  3K9A A;  3CRA A;  1D5N A;  2G38 A;  3A0H Z;  4OXS A;  4O2B B;  2KGO A;  3SJA C;  1NU1 H;  4FFB B;  4I9W A;  4Q7C A;  4Q4Z F;  1PD3 A;  2XAQ A;  3W2W A;  1FAF A;  4R8C A;  4FK5 C;  2PX0 A;  3JD3 A;  4DRX A;  5L3F A;  1TAE A;  4B3R B;  2LCH A;  4L87 A;  3RF3 A;  4IRU A;  1Q0G A;  3OM3 B;  3N2Z B;  4CZZ A;  3WOD F;  4O4H A;  5IT9 N;  2RD9 A;  1YYX A;  1LVK A;  1JQ0 A;  1GM7 A;  3B40 A;  5BZB A;  4QI0 A;  3NR7 A;  4JI2 O;  3L8I A;  1PD1 A;  3JRM O;  2ZDI A;  4RAI A;  3CWB H;  3E89 A;  1K40 A;  4H0L B;  4YL3 A;  1S5H C;  3V5X A;  4FZ0 A;  4I4T B;  5CI9 A;  1WJZ A;  2QKC A;  1D1A A;  1QVF U;  1GTO A;  4EKW A;  3KG2 A;  2JDI G;  5K0I A;  1XL6 A;  3K1I C;  5EYP A;  1M57 B;  2QLA A;  3W7S A;  2AZ0 A;  4NXM B;  2QJ1 A;  3CSX A;  3K66 A;  1FXK C;  2FL4 A;  1R6T A;  3C90 A;  3ATP A;  1TA8 A;  4Z9H A;  2EIM B;  1RMV A;  2FB5 A;  4ZKI A;  4MW3 A;  3ABM B;  2OCC C;  1CXZ B;  2QM7 A;  1IVS A;  4UCO A;  4MQ9 F;  1OW6 A;  3W4Y A;  3AG3 B;  4YN0 B;  4IYI A;  3MBG A;  3GWO A;  2ZNJ A;  5ITZ A;  4LF8 O;  4JJF A;  1OKK A;  2BSK A;  3APO A;  2ZNI A;  1VF6 A;  4LBE C;  4MT8 A;  4TQF A;  3M15 A;  4OIP F;  3IEE A;  4RDA A;  5E3A A;  1Q6U A;  1QHT A;  2WLM A;  3JYC A;  2FFH A;  2YQY A;  1JFF A;  2JPU A;  4E0H A;  2DYR B;  3IAY A;  4UCT A;  3GWK C;  3BPZ A;  1QVG U;  2NUP B;  4CS9 C;  1NU7 D;  1JOY A;  1QKR A;  4BJ5 C;  4XEK A;  4DV1 O;  4AX2 A;  1PNK A;  3SYP A;  1N33 O;  3K58 A;  4GYT A;  4JYY A;  2CDQ A;  4HFF B;  1OV9 A;  3SDL A;  4QI2 A;  2YWA A;  1OCZ C;  2TMV P;  3OTF A;  5B1A B;  4RQE A;  2RDC A;  4CSA A;  3EGX A;  1M2V B;  4U3J A;  1G4Y B;  1AR4 A;  3BEH A;  1V9P A;  2WLK A;  1QLE C;  4G7H F;  4TSF G;  2WAM A;  2R9I A;  3Q7L A;  3SXK A;  1OR2 A;  4H33 A;  5LOV B;  1AEP A;  4E0I A;  5JRA A;  2J0X A;  5IJ0 A;  2ZE5 A;  2LQG A;  1Y4C A;  3K5L A;  4YHH B;  1SZI A;  3JCU Q;  3L73 H;  3UO3 A;  2WLJ A;  5DEC A;  5ITZ B;  1XNR O;  2BSK B;  3B2E E;  2ZKO A;  2KG7 A;  5KHG A;  2ARH A;  1OXK A;  1QPU A;  2IXO A;  4E2L A;  3OUS A;  2AVK A;  3U0C A;  2HSQ A;  1VEW A;  1MNE A;  4YJ3 A;  1GK9 A;  5DM6 V;  1HY5 A;  2DYS B;  4JYA B;  2X51 A;  3ZHS A;  1ST6 A;  3TD7 A;  1TUB B;  4FFK A;  2CTR A;  2R7X A;  2ZDI C;  2NNU A;  1Q0D A;  1YDI A;  3KH2 A;  2D4U A;  3ZMV A;  4UFZ A;  2P67 A;  5H9C A;  1RSO B;  4DV6 O;  2W6J G;  2ZIN A;  1YCI A;  4P2Z A;  2HFE C;  3CCQ V;  1JPJ A;  5HFL A;  1G4U S;  2VAS A;  2YID A;  2EPM X;  4YL1 A;  4AE4 B;  2CK3 G;  3TUL A;  5E3C A;  2CW0 F;  3W7T A;  1I08 A;  1BMF G;  2KG7 B;  5F5F A;  3FYE B;  1ORY A;  1IBM B;  2O57 A;  3AG4 B;  3LES A;  2R72 A;  3AG2 C;  3RVY A;  3K57 A;  1DGS A;  5FL7 G;  1IXM A;  4OIR F;  3S27 A;  1K05 A;  4YJ3 B;  5E79 Z;  3ASO B;  3PHF 2;  4IAQ A;  1V4A A;  3JAL A;  4X89 A;  1WP8 A;  3KKB A;  3JT1 A;  3Q6M A;  2Y3D A;  4BW9 A;  1KYO F;  3ZHV A;  2ZR3 A;  3FMS A;  2QR4 A;  3WHN A;  4FLV A;  4FLW A;  3T4Z A;  4JYB A;  3FB6 C;  3ETQ A;  4OGQ B;  1MMG A;  2Y39 A;  4CS3 A;  4GZR B;  3LAY A;  3S3X A;  1EA8 A;  1A7D A;  3VBB A;  2YIB A;  4QJF B;  2AU5 A;  3IFX A;  2ZXP A;  4DV7 O;  2VWK A;  3PDM P;  4LF9 B;  4DR2 O;  2HEP A;  3VQY A;  1VAR A;  5LMN O;  2N05 A;  4F4L A;  3CMA V;  3JAT A;  4LLE A;  5DVW A;  1QCE A;  4NY3 A;  1K34 A;  5L0C A;  1URF A;  5B3S C;  3CQZ A;  2XAH A;  1GM5 A;  3L1M A;  1RFY A;  4FPP A;  1I4Z A;  2YLG A;  1JPX A;  1YZC A;  2HJF C;  2IXM A;  4KNW A;  1M2O A;  3BAA A;  5IYD O;  1SF8 A;  4DW1 A;  4KBL A;  4X20 B;  5FPO A;  2H7O A;  2BE3 A;  3DE8 A;  1M56 B;  1BHA A;  4CX9 A;  3RYC A;  3S3W A;  1Q7Y W;  1M1K W;  4O79 A;  2OIG A;  4TWK A;  4TV8 B;  1VLS A;  2Q9B A;  4JEA A;  1YSC A;  4AQY B;  1KUQ A;  4U5H A;  3JAL B;  2Q9C A;  5BUO A;  3F7V C;  3RYF A;  4BR6 A;  4GX0 A;  4MVQ A;  3NG1 A;  4UV9 A;  3QO7 A;  3T6B A;  3OEE G;  2WZF A;  3H9V A;  1Q3E A;  2NPU A;  3FKS G;  5J2T A;  1KNY A;  4WFB V;  1OCR B;  1FFX A;  1O9G A;  2UUA O;  5AGF A;  4PHZ A;  4EBJ A;  2J46 A;  2YLI A;  1T01 A;  3MX3 A;  1FMV A;  3JAS A;  1UFI A;  5HV9 A;  1DF4 A;  3ZRX A;  5BR8 B;  1P7G A;  2HFI A;  1BL8 A;  3N0T A;  1MSW D;  3U5S A;  1QR9 A;  4U9D A;  5L3Q A;  2ZM6 B;  4CH5 A;  1YA7 O;  4ULV A;  2HJ3 A;  1AJP A;  1ARO P;  5B66 Z;  1V55 C;  2Y3G A;  3UMH A;  2JJ1 G;  5L0J A;  1LE2 A;  1H8E G;  4GQH A;  3R7C A;  2RJZ A;  3HKE A;  1E85 A;  2DJV A;  2PBE A;  2Q7G A;  1VQ8 V;  3B8N A;  2JD3 A;  5JSL A;  2YSU B;  2L35 A;  1SMY F;  5EBM C;  4XBF A;  5IYZ B;  4X88 A;  2YXH A;  5LHG A;  2J7P A;  2F4V O;  5JVE A;  1A0B A;  1VQP V;  4QE9 A;  1RM1 C;  1XMQ O;  1ZHX A;  5DQZ A;  3ZMS A;  3OGI B;  2PTM A;  3Q7G A;  2YZS A;  1N4C A;  4NC3 A;  1LPE A;  1B06 A;  1FFX B;  2ETS A;  3H65 A;  1FXH A;  4YJW A;  1AIL A;  2ZE8 A;  2AHY A;  3FAV B;  4PA3 A;  1S05 A;  1RKC A;  1MMD A;  1J5E O;  5KYW A;  2LFR A;  3CRR A;  4UB6 Z;  3ZRS A;  1FKA O;  3C63 A;  1R1B A;  3TQO A;  2CDY A;  4JV5 B;  5JUA A;  3RWR D;  1THZ A;  3WFV A;  4G0H A;  3WU2 Z;  1SES A;  1YI2 V;  1YIJ V;  1WN7 A;  4GYC B;  4K35 A;  1P4R A;  4QIW F;  2LFF A;  2RCV A;  1UG7 A;  4I55 A;  4E17 A;  4PA7 A;  3ASN B;  3HKE B;  3AGU A;  3N27 A;  5L0D A;  1KU2 A;  1SQP H;  2A6E F;  2LFS A;  2DQ0 A;  1AI7 A;  1ZW3 A;  2VCB A;  5E1A C;  2WVO A;  4XPW A;  2UUI A;  3GOD A;  1S3J A;  2XL4 A;  1HR0 O;  3R66 A;  3NDB B;  1HNW O;  4DV0 B;  4YK5 A;  2R9A A;  3APQ A;  1H7I A;  3M99 B;  1YVW A;  3C3T A;  4JI3 O;  1K7D A;  1CGN A;  5LXT A;  1K33 A;  5KYY B;  1APC A;  2EPO A;  2R9R B;  2M6Y A;  1H6G A;  1YLM A;  2XOK G;  2N74 A;  4YIP A;  4F4B A;  3AG1 B;  3CD6 V;  2QEX V;  4FM0 A;  2XHB A;  2EIN C;  2ILM A;  2OEX A;  3ABU A;  4CBC A;  2G3K A;  2EIJ B;  1N36 O;  4NTW A;  3RQE A;  2DW4 A;  2W4B A;  3EHB B;  3SPH A;  2Q4P A;  1KP2 A;  3JSL A;  4J9Z B;  4WBN B;  3G80 A;  4GUN A;  1L1F A;  3OWT A;  1QBZ A;  4X1K B;  4JKV A;  2BTO A;  3ZCC A;  1L7C A;  4ABM A;  3GM1 A;  5A6A A;  2UU9 B;  4IYH A;  4MW8 A;  2EIK C;  3IPM O;  3N2K A;  2A0B A;  3TGU H;  3FB5 C;  2Q69 A;  2UUB O;  3JYH A;  2YL0 A;  3H2U A;  4JCZ A;  4C3E A;  3ABK C;  4WFF A;  4LR3 A;  2RNB A;  1P49 A;  5BQH A;  3U8P A;  5JT4 A;  2XXA A;  2ZIO A;  3T1H B;  2WL8 A;  3J80 N;  2IU0 A;  3RN4 A;  4CJG A;  3CZ6 A;  3OTO O;  1MND A;  1AR5 A;  4GKJ B;  3AJM A;  4KFM A;  4LFC O;  4E4E A;  5IDJ A;  4DUZ B;  3JAW B;  2XUM A;  2OG2 A;  2UUC O;  4KUM A;  2X7R B;  2F66 C;  4DV2 B;  3JTL O;  1K73 W;  3MLG A;  2AHZ A;  3KKY A;  4N4W A;  4JI7 B;  3VQX A;  2UXN A;  1MAB G;  1SF9 A;  5EK0 A;  2Q7H A;  3HNJ A;  4WAB A;  3CJH A;  1JJ2 U;  4JVS A;  1SQQ H;  3ZHQ A;  3RQG A;  3DGE A;  5CMU A;  1JMW A;  3SP1 A;  5LL6 Y;  3D3I A;  2QTO A;  1SQV H;  4TV9 A;  3LDE A;  4BWA A;  2IJK A;  3C18 A;  1ZYR F;  3MYI A;  3SPG A;  3CEI A;  5IYB O;  4G7O F;  3KYJ A;  1KC8 W;  2MYS A;  3FAP B;  1Q6H A;  1BQZ A;  5JVD B;  2Z0A A;  4RQF A;  2LJ2 A;  2XT9 A;  4I3M A;  3V7O A;  4PA9 A;  2XXA B;  4YL0 A;  1HP8 A;  4X62 O;  5A6J A;  3GB7 C;  2CCY A;  1EZV H;  3EPV A;  2HV7 A;  4LC1 A;  4ONS A;  2CE4 A;  2Q8V A;  3U9J A;  2VQE B;  1RKE B;  3C62 A;  1M93 A;  2PGG A;  1PV0 A;  3MHH C;  3F5T A;  2KJG A;  4U3F H;  3HTK C;  4OD5 A;  2AW9 A;  3QO8 A;  5K1P A;  1EN6 A;  5IYC O;  3HR0 A;  1IDS A;  3NMJ A;  1I4Y A;  3FHD A;  5T3T A;  4CS8 C;  2R02 A;  2E5L O;  3H1K H;  4X1Y A;  4CS4 A;  3FDQ A;  1CPQ A;  2UUH A;  4YT4 A;  1BT8 A;  3ETD A;  1Y76 B;  1EQ1 A;  2UXB B;  1UFB A;  3L75 H;  4DXW A;  3C7J A;  3SXY A;  3SNH A;  3C8G D;  2DOS A;  2ATK C;  4B7E A;  1NBB A;  5LMU B;  3U9M A;  1TWC A;  1U97 A;  3ZVR A;  1BR2 A;  2DB4 A;  4K7B A;  4ICG A;  2IYL D;  4Z2W A;  3LSS A;  1E1Q G;  4TUY B;  3KYI A;  1IZM A;  2LD6 A;  4KL1 A;  3PMR A;  3UNG C;  2W0F C;  4MS2 A;  1BDJ B;  1TKN A;  2FTK A;  2V26 A;  1UJW B;  4JI6 B;  4RUE A;  4W8P A;  3PN1 A;  1S76 D;  2Q7R A;  2LQT A;  2Q00 A;  2CGN A;  2CTP A;  3W7W A;  3I55 V;  5KUM A;  3VQV A;  4NXN O;  1ZSP A;  5JH7 A;  1ZUQ A;  4L8J A;  1TGO A;  3KCY A;  4LF4 O;  1PL0 A;  2WVQ A;  2F95 B;  5GW7 A;  3EG9 A;  1XDC A;  1ZHT A;  5A69 A;  2IW5 A;  3EZI A;  1N0N A;  2IJJ A;  2P7T C;  3U3B A;  4DR4 B;  3AG7 A;  1FXK A;  1K8A W;  2WPD G;  4IT5 A;  4PK4 A;  5KA5 A;  4F6R B;  2B5U A;  2UXD O;  5A2Q N;  3DKA A;  5L3D A;  2WLH A;  3CRQ A;  5A9G A;  1ZU5 A;  1B6Q A;  5CA0 B;  3K3W A;  4LFB B;  3O39 A;  5GON B;  2JS5 A;  2OIE A;  4B08 A;  2JEX A;  4EBB A;  1QZX A;  1K5Q A;  3X1O A;  4XPY A;  3ZN0 A;  3CAX A;  3C3S A;  4JI5 B;  4XLN F;  4Z1M G;  4DR5 B;  1M9N A;  1ZL8 B;  1LUV A;  2QTS A;  2YIC A;  4PA4 A;  1XZQ A;  4C7O B;  1H2G A;  4ZOL B;  1SER A;  1OW8 A;  4X8A A;  3ZDL A;  2YL7 A;  2ADP A;  3N2G B;  1VB5 A;  1YTF B;  1XMO O;  5DQT A;  3DM5 A;  2F1M A;  2UXX A;  3ML0 A;  4MTO A;  2ITC C;  2XL8 A;  3E35 A;  1HE1 A;  4AHC A;  5KYX B;  4X1I A;  1R3L C;  3HKC A;  1V54 C;  4DV4 O;  3BCC H;  1Y4M A;  4JEB A;  5IY5 C;  4DOZ A;  2IM8 A;  1FXK B;  2I15 A;  1IBK B;  3LLK A;  3D36 A;  1G8M A;  3ZHU A;  3CCV V;  1C17 M;  1JJO A;  4QPJ A;  1LE4 A;  4X64 B;  2K1E A;  3LS1 A;  3U2L A;  2W0X A;  2OCC B;  2YXL A;  4DR1 B;  4JI0 O;  4X65 B;  4DR6 O;  2E75 B;  3OR7 C;  4LH6 A;  3BY6 A;  3A9C A;  1MMN A;  2GDC A;  5CIV A;  2PI4 A;  1A7E A;  2GA0 A;  4LFA B;  3I56 V;  3PCV A;  1Y74 A;  3UO2 A;  2HHH O;  2HJM A;  2L81 A;  2Z3Y A;  2BOB C;  1K4D C;  1KKC A;  4KHP O;  3T4R A;  4O4I A;  3JCU Z;  2UXC B;  1TQG A;  1WLE A;  3E22 B;  4G7Z F;  3QVN A;  1LIH A;  3RYH A;  4BIU A;  4PJM A;  4X9Q A;  2XAG A;  1NBM G;  3HKK A;  3HLZ A;  4YY3 O;  4DRH B;  4D7S A;  3OD4 A;  4JZG A;  1OCZ B;  3ZMU A;  4F6E A;  1XBL A;  1JAF A;  2FKX A;  3EGD A;  3BRJ A;  3Q6N A;  1WP7 A;  2Q7E A;  1J8M F;  3L72 H;  5C8Y A;  4FX5 A;  2FGY A;  3CCR V;  2Q3T A;  1O9H A;  1QLE B;  4UXN A;  1LS4 A;  1VQ5 V;  1M6T A;  1SQX H;  1EZJ A;  2WSS G;  1P7B A;  2H3O A;  1C03 A;  3TK0 A;  3GEH A;  3JAR A;  1NJI W;  3A8T A;  4H37 A;  2J9B A;  5B1N A;  3A0R A;  4D4N A;  4BIZ A;  3AK2 A;  5D91 A;  1DLB A;  4HAM A;  1I94 B;  1W59 A;  4JGS A;  3CC2 V;  1G5Z A;  2C03 A;  4FM2 A;  4ER9 A;  1ENV A;  2YEV A;  2JGD A;  3CP1 A;  5B5E Z;  2Q73 A;  3J81 N;  4DRX B;  3US6 A;  2WLL A;  5L0I A;  1Q6I A;  4BW5 A;  2WLN A;  3SYQ A;  1YYJ A;  1VQL V;  3OMI B;  1PPJ H;  3OT7 A;  4O4H B;  4JF3 A;  3ZRW A;  4LF6 B;  3EJN A;  1Z3I X;  2R7O A;  1XOU A;  3FVY A;  3VYW A;  2EJR A;  2DQ3 A;  4AIL C;  1CPY A;  1US6 A;  4JI4 O;  3BVO A;  3CB2 A;  1AI5 A;  3U2M A;  1XNQ B;  5F28 E;  2QM8 A;  2Z15 A;  4LDR A;  1VMG A;  1GN2 A;  3B71 A;  1GH6 A;  3I5P A;  4UCV A;  2A0L A;  3BA9 A;  3SYN A;  2G62 A;  1EN5 A;  1GMG A;  1MMM A;  3JAR B;  5EYP B;  3WG7 C;  4A2N B;  4P9F A;  3WAQ A;  2L9J A;  4G2K A;  3LSU A;  2OU6 A;  3D36 C;  1B04 A;  4FZ1 A;  2YXY A;  1QVX A;  3M79 A;  5CB4 A;  4RUF A;  5DN6 G;  2P7V A;  5EHH A;  1VTM P;  1D0Y A;  4O4L A;  3H2V A;  3A0B Z;  3ZIA G;  4DR7 B;  4B3S B;  2NR5 A;  2CTW A;  4CBE A;  2Y4U A;  2CH7 A;  4J7Y A;  2KC3 A;  4JI8 B;  3AEI A;  4QGP A;  4O6Y A;  2IH1 C;  3T6J A;  5KYN A;  3CEX A;  3VF0 A;  4EBK A;  1JFF B;  4EUK B;  4WFE A;  5COM A;  1KU9 A;  1XHX A;  2GUZ A;  2YRF A;  3E8B A;  3SYC A;  3CPW U;  5CA3 A;  2ZXW B;  2HVJ C;  5K1X A;  5FLX N;  4X66 B;  3DSQ A;  2E87 A;  5L0F A;  3DC5 A;  1GM8 A;  4MVM A;  5IWA B;  2AZ2 A;  5FCL A;  4XDK A;  5JQG A;  3EGX B;  1EM1 A;  4KP4 A;  2V4D A;  4K8X A;  2JX0 A;  1Y67 A;  4U3J B;  5B3S B;  5GTI Z;  4IGG A;  2JIZ G;  4J10 A;  4H44 B;  3QTC A;  4B3R O;  2A06 H;  1GAX A;  1X4T A;  5IJ0 B;  4O4L B;  4P9O A;  2Q6A A;  4IIJ A;  4DR3 B;  4OX9 B;  3B8M A;  2CH7 B;  3OR6 C;  3QG5 A;  3NMI A;  3OMN B;  1XZP A;  2PFD A;  5EZY A;  1YAU O;  2R7Q A;  2BTQ A;  4CJO A;  4R50 A;  4RO2 A;  1R3J C;  3HKB A;  1HNX B;  3OMA B;  1U89 A;  3D8C A;  2VH3 A;  2MW2 B;  2EZP A;  5KHI A;  4R6Z A;  3NYM A;  4Z1V A;  5CBF A;  4WCE V;  5B1A C;  1BS3 A;  2PY5 A;  4JUR I;  4ZI7 A;  4NXM O;  2JS3 A;  3E2E A;  1T6I A;  4NTF A;  1A32 A;  5LYJ A;  2GUZ B;  4I50 A;  1FFT B;  1VLT A;  4LCU C;  2PNO A;  4A4A A;  5KUK A;  4ANJ A;  3SYO A;  1S5J A;  5D5Q A;  3KPH A;  1Q86 W;  3FB7 C;  1TR2 A;  2OJQ A;  3VOU A;  3T2M A;  3AK3 A;  3QW0 A;  3K06 A;  4IAO A;  3SXM A;  3IQC A;  4HNA A;  1WB8 A;  5KAF Z;  4JAA A;  3EFF K;  1KB9 F;  3ZMZ A;  1N1C A;  4GKK B;  1JPN A;  2PF4 E;  1R73 A;  4ZHQ A;  2P4K A;  1N34 B;  1V55 B;  3TJ5 A;  2HR3 A;  5L3E A;  1M4U A;  2ZT9 B;  4WGZ A;  1GO3 F;  3ECS A;  4K1O A;  3IHU A;  4LLC A;  4J42 A;  3LDD A;  3S28 A;  2F43 G;  3ZBH A;  2OWO A;  4TQD A;  4AL1 A;  1S5L Z;  1M90 W;  1K97 A;  3V5Y A;  3ABT A;  1FYJ A;  2XAS A;  3W2V A;  2CUG A;  5J2U A;  2QWO B;  2J8W A;  4ASU G;  1Q0K A;  4HEA J;  4WFG A;  1Q8I A;  1K3E A;  2WLI A;  4O4J A;  3Q4H A;  3EHM A;  3OFN G;  3CSK A;  4YHH O;  1F51 A;  2YIB D;  3MHS C;  1V74 B;  1AVO B;  4HYO A;  1SET A;  3CE2 A;  1NZ6 A;  4LP8 A;  2WA3 A;  3ZQV A;  5A6K A;  1GKF A;  4CS2 A;  4XTK A;  5D92 A;  3QNE A;  4JCH A;  2DGJ A;  2C04 A;  4NTA A;  1TUE B;  3HNK A;  1CGM E;  1BSM A;  3ZWI A;  3JAT B;  1A7V A;  4ZLD A;  3ZC4 A;  2P90 A;  2GHY A;  2QM4 A;  1RJ9 A;  1YJ9 V;  3EVK A;  3FX7 A;  3RYL A;  3NXS A;  4J7J A;  3OEO A;  2A7W A;  1PL4 A;  4BJ6 A;  4JYA O;  1Q0M A;  5A6B D;  3OW2 U;  1XIL A;  2QTV A;  2B1I A;  2NUT A;  1XL4 A;  3KCX A;  4EB6 A;  4UB8 Z;  4UVB A;  3M4B A;  3RYC B;  3W8H A;  2IBZ H;  5LHH A;  3E9V A;  2VRZ A;  5T3W A;  1OCC C;  2WB7 A;  4P30 A;  3WB2 A;  4CDA A;  3ZQY A;  1K04 A;  2AP3 A;  1EKY A;  1OZ0 A;  3RYF B;  1N32 B;  2GFH A;  4U9E A;  1FNT c;  2WLI B;  2QDO A;  1B3Q A;  3RFR A;  3KL4 A;  4E7Z A;  2J9U A;  2RSE B;  1SQF A;  2DWD C;  4ZBM A;  5J2T B;  1BGY H;  4ULW A;  1VF7 A;  1Z5V A;  3MYF A;  1ZX3 A;  2EIN B;  4PDR A;  3E8G A;  2CGE A;  1IBM O;  3JAS B;  4GX5 A;  4FLT A;  3K0D A;  4PI0 A;  2J9V A;  1IBL B;  3LJB A;  2V1D A;  2MHR A;  1NVP B;  4B3M B;  1GN3 A;  2OYQ A;  5L3G A;  1VK5 A;  4K0K B;  1NT2 B;  4IAR A;  4EB6 B;  4DVY P;  1HWY A;  1JR9 A;  1SQB H;  3LS0 A;  3LNR A;  4LF5 B;  1ZLZ A;  2EIK B;  4LF7 B;  3K33 A;  4GX2 A;  4LF9 O;  3JZ0 A;  3T1Y B;  3TJT A;  3K9S A;  1SYQ A;  3K1H A;  4WFH A;  3ABK B;  5L0H A;  3SJQ C;  1WA8 A;  3J7A U;  4YT2 A;  1FMW A;  1IW7 F;  1WOL A;  1Z63 A;  5KHJ A;  1YJW V;  4N21 A;  3K6B A;  1D5A A;  4YJ2 A;  2AGA A;  4O2A A;  3QMK A;  3CC4 V;  1H2L A;  3UT5 A;  3MFN A;  4DUY B;  4O6M A;  5GPG B;  2LP7 A;  4PFO A;  4JI1 B;  5KYW B;  1WGW A;  4DK1 A;  4LER A;  3O65 A;  1VF5 B;  1ZHW A;  5FNV A;  3DAF A;  3IQ6 A;  2H7V C;  4CS8 A;  4AQY O;  2HZ8 A;  5KHK A;  1I5N A;  3NMK A;  4NYK A;  3DXR A;  2ADQ B;  1BR4 A;  4HBN A;  3I4U A;  4PJJ A;  4MTX A;  4I55 B;  2LGQ A;  2R7W A;  3G4S V;  3JRT A;  1NI8 A;  4IB4 A;  2RN9 A;  1SA0 A;  2M4E A;  4BJ6 C;  1AP6 A;  4LNU A;  5DS5 A;  1AB3 A;  3B09 A;  1D2D A;  2XL6 A;  2QKA A;  3HNI A;  4JC7 A;  5J9P C;  2A3Q A;  1Z5W A;  1WA8 B;  1RPO A;  3V5Z A;  4PV1 B;  2VB6 A;  3HKD A;  1K5S A;  1YJN V;  2JK5 C;  4PDV A;  5BR8 O;  5LXT B;  1JMK C;  4PJ0 Z;  4O2A B;  4BPM A;  2ASR A;  5DS6 A;  2ZCE A;  2YS8 A;  2ZM6 O;  4B3T B;  5COG A;  3K79 A;  4NKG B;  3U10 A;  3ZJZ A;  1HNZ B;  4ZLC A;  2J9W A;  1U6H A;  3M7M X;  3STZ C;  3IQ5 A;  4TT3 G;  4UDV A;  4NTB A;  4DBR A;  3ZRV A;  4J41 A;  2QKS A;  1K92 A;  4XQ1 A;  3IC9 A;  4KXR A;  3DXR B;  1FD9 A;  4C7U A;  2A6H F;  2EIL C;  1Z2G A;  3GVM A;  4ZIB A;  2K9P A;  4JTD B;  4E18 A;  2YI8 A;  2X0C A;  2NG1 A;  2W4M A;  2PP4 A;  2R70 A;  4LNU B;  4I0X A;  2A69 F;  1WNS A;  4IJJ A;  1YJG A;  3BHP A;  2B1G A;  1WN0 A;  3CXH F;  1MZF A;  1HE9 A;  1ZAU A;  2MK3 A;  2ZR2 A;  1FAP B;  3S9O A;  4AK9 A;  3WB1 A;  4DV3 B;  3I5Q A;  3N2K B;  4DW0 A;  1TVK A;  4B6I A;  5EIB C;  1VYK A;  1S77 D;  4JV5 O;  2VQF B;  2EBO A;  3R2P A;  1W0K G;  3UMI A;  1ORS C;  5L3C A;  2ZE6 A;  3MD0 A;  2H7B A;  3FFQ A;  1FJG B;  2VS0 A;  5EBL C;  2Y69 C;  2YUA A;  3SZR A;  3W7U A;  3NKD A;  1VYI A;  3FD9 A;  4MND A;  4U5E E;  3ZN1 A;  4CH4 A;  4YIO A;  3UCS C;  3GAN A;  4DV5 B;  3LNM B;  1YVI A;  5B1B C;  1R3K C;  3CHX A;  3C8G A;  2VCA A;  2YI9 A;  1SS3 A;  2QY9 A;  5E33 A;  3JD4 A;  4PJN A;  2R7T A;  3LEV A;  1NFO A;  3S29 A;  1XHZ A;  1VQN V;  2V3C C;  4HZ3 A;  4DV0 O;  3CJH B;  2LIG A;  2Q68 A;  3R65 A;  3EFO A;  3F5W C;  1NQT A;  2WVN A;  4PFP A;  1YIT V;  2PYL A;  2PYJ A;  3ZHT A;  4BAY A;  1ZW2 A;  3UQ8 A;  2BOC C;  1QLN A;  3RT3 C;  4PA6 A;  4U5C E;  4TV9 B;  1MNG A;  3BFR A;  3TJ6 A;  3HJC A;  2FML A;  1NR7 A;  1AJN A;  3DM9 B;  1LI5 A;  3RW0 A;  3POV A;  2L6H A;  5GTH Z;  1MSD A;  4DVZ A;  3FXH A;  5CA1 A;  1IX9 A;  1YHQ V;  5H6Q A;  5CBG A;  1XUQ A;  5AC5 A;  1VQ4 V;  4FWV A;  3JSE O;  2WZG A;  2R25 A;  1FFH A;  1L0N H;  4JI2 B;  2UU9 O;  1COW G;  2JVD A;  1J95 A;  1T6U A;  3SJC C;  3K04 A;  1F7Y A;  4J7K A;  5L3B A;  4JW1 A;  5IY5 B;  4X1Y B;  2N04 A;  2B0H A;  1WPX A;  2YIA A;  5KMG A;  1JR8 A;  4Q6G A;  3CCS V;  3SPI A;  1CEZ A;  5LP6 A;  1NTZ H;  2YC0 A;  3GWL A;  4FLX A;  4YXW G;  3T1H O;  3SEO A;  1BZ4 A;  5DLJ A;  4GKJ O;  5BXZ A;  3HNL A;  1R4T A;  1Q43 A;  1NG1 A;  1KTM A;  4DUZ O;  2B9Z A;  3SR2 C;  4FLZ A;  2XLM A;  4DV2 O;  2RQ6 A;  2R7V A;  2XND G;  4JI7 O;  3T9O A;  3ZIB A;  4UCU A;  2E76 B;  1FS0 G;  2X0L A;  3RYI A;  5CA1 B;  4LF8 B;  3P3P A;  1SRY A;  2J0W A;  4GEH A;  3E83 A;  2GTS A;  4XDL A;  3JD2 A;  1FPO A;  1U96 A;  3ABL C;  4JZA A;  4XLP F;  2VWJ A;  2CNW A;  3ETE A;  2EZO A;  4MVO A;  4HFK B;  3CYO A;  2C2A A;  3E8F A;  1Z6A A;  2QSA A;  2A0U A;  1YTF D;  2QGN A;  3JAK A;  2BE5 F;  3B29 A;  3GWN A;  4PAC A;  3H1J H;  3M1C B;  5JH7 B;  3RGB A;  2HSB A;  1Q0F A;  4WGY A;  1YXB A;  2OTJ V;  3TOM A;  4DV1 B;  2EPN A;  1CPR A;  2LP4 A;  1H2N A;  3UGO A;  1N33 B;  4UVC A;  2Y3B A;  1LKX A;  4FFB A;  3EG9 B;  5EGY A;  1SZT A;  1RCP A;  5KMG B;  1W2B U;  2IM9 A;  1ZTE A;  2XM4 A;  3IQT A;  2QA4 V;  3MAQ A;  5HSW A;  2LW1 A;  4O7G A;  4W4K A;  2E74 B;  3L8J A;  3W7X A;  1YEW A;  2GBO A;  1NR1 A;  2A68 F;  1OQC A;  4PJL A;  1KEC A;  4DBQ A;  3KZI Z;  4PD4 F;  3CRC A;  1NH2 B;  3FAJ A;  4KC9 A;  3QZC A;  2VQE O;  2PX3 A;  4FAP B;  2H94 A;  4K3A A;  2B0J A;  3P32 A;  1JCH A;  1XNR B;  3QVZ A;  2EPK X;  3L0I A;  3UMK A;  1Q82 W;  3OEH G;  3ICX A;  4N6C A;  4PDM A;  1YAR O;  3A11 A;  3P3N A;  1QNM A;  2HKV A;  1XI1 A;  1UPG A;  1DOW A;  1ZVZ A;  2GTA A;  2UXB O;  1NTM H;  2CAZ C;  1PV3 A;  4J80 A;  3DZA A;  4BEJ A;  5LMU O;  4EIY A;  1VQO V;  4X1I B;  1NKD A;  3B0V C;  3HKC B;  4CDV A;  2CYD A;  1AVM A;  1GM9 A;  2W9Y A;  1N8R W;  1GQA A;  1H8H G;  3WG7 B;  3K5N A;  1FXV A;  4CC5 A;  2KB1 A;  4JIO A;  4YT8 A;  4I44 A;  2XLE A;  1ROP A;  1YDX A;  4IL6 Z;  3OA1 A;  3SGI A;  4DV6 B;  3K03 A;  3IJ4 A;  2QWQ B;  4CC6 A;  2Y0P A;  4JI6 O;  3DWW A;  4J7T A;  3IGA C;  1ZHY A;  2NSG A;  2YDE A;  5LP6 C;  2XAF A;  1Q90 D;  1G6U A;  1PD0 A;  1BZK A;  4JYC A;  1GS9 A;  2PUS A;  4UCR A;  1P84 F;  1TWG A;  1NZE A;  2NUP A;  3DE9 A;  3QF7 A;  4UVA A;  1JX9 A;  4EFE A;  2P61 A;  4FLU A;  3IC7 A;  1Y74 B;  4O4I B;  4BIO A;  1SZX A;  4UUJ C;  1OCO C;  1VQ6 V;  2IJI A;  3AK1 A;  3RYH B;  2QE7 G;  4GLX A;  2PI5 A;  1NU9 C;  1Z5Z A;  3JAM N;  4DR4 O;  2X6A A;  3CCU V;  1M2V A;  2HMZ A;  4XWJ A;  2BL2 A;  1HW2 A;  1YF2 A;  2NLJ C;  5LOV A;  2D5R B;  3EGD B;  2OCH A;  3X2Q C;  3ZHR A;  4LFB O;  5C8Y B;  3SJB C;  2YL3 A;  1W0J G;  3F7Y C;  3DXJ F;  4P6I C;  1VMA A;  4WF9 V;  4BJ1 A;  4JAU A;  2M64 A;  4NR1 A;  2WA4 A;  1PCX A;  4U5B E;  3BA8 A;  1H38 A;  4DV7 B;  5DED A;  3DAG A;  4JI5 O;  4DR2 B;  4DR5 O;  4NCQ A;  5LMN B;  2X6C A;  4JAV A;  2A79 B;  4J7Z A;  5LBQ A;  3M4C A;  1Z7Q c;  1O5H A;  4J11 A;  1VIB A;  1OW7 A;  1CGO A;  1IXB A;  1F23 A;  3CME V;  4JJG A;  4Z9J A;  1WB7 A;  3EZH A;  3LNN A;  2GAQ A;  3THO A;  2L6F A;  2YEV B;  3FYI B;  3O6X A;  3W8I A;  3U11 A;  3TET A;  1OKK D;  2VCC A;  3AG2 B;  2JGD B;  1TUB A;  4NVP A;  1S7Z A;  3QTH A;  3I5D A;  4PR9 A;  2WLL B;  1L0L H;  3GEI A;  1E79 G;  3RKO F;  3ZRW B;  2VC9 A;  1IBK O;  3WB0 A;  4J30 B;  1RSO A;  3DTU B;  1LS1 A;  1DTO A;  4X64 O;  2ETN A;  5EBW C;  3CC7 V;  1WAS A;  1LNQ A;  4FVM A;  1Y6X A;  4DR1 O;  5LA6 A;  4X65 O;  2WZL A;  1M57 C;  4AE4 A;  2PZS A;  2OJE D;  1LM3 B;  4QPK A;  2Q4F A;  1EI7 A;  3OAA G;  2FYU H;  3G50 A;  2EIM C;  3B77 A;  2UUA B;  3TK1 A;  3G6B A;  4LFA O;  2CGO A;  4M63 A;  1SR2 A;  3BAB A;  3ABM C;  1T5E A;  2UXC O;  1IUR A;  4DJ9 A;  3QW1 A;  1ZHZ A;  3AG3 C;  4FMT A;  3G4X A;  2I8B A;  5CB4 B;  1VQ9 V;  3NYJ A;  1H2S B;  2P1A A;  2Y48 A;  3FOP A;  3L74 H;  1BQ0 A;  4U7N A;  2XLO A;  4W8K A;  4MTF A;  1B68 A;  2DYR C;  3ZTM A;  3JD1 A;  4XDJ A;  2HMQ A;  2YHS A;  1G1X B;  3RIP A;  3JD0 A;  4JZ2 A;  1F4M A;  5H6R A;  3AOU A;  2F4V B;  5LA6 B;  3DD7 A;  2HLD G;  4I1O B;  1XMQ B;  5JCO A;  4LWS A;  2KK1 A;  1BR1 A;  1I94 O;  1D1C A;  1EBO A;  1JRA A;  1T9K A;  2HV6 A;  1JA8 A;  1XWJ A;  1VQM V;  2ZPA A;  4EHP A;  2P06 A;  5JQG B;  1XEQ A;  4X20 A;  1J5E B;  2P6V A;  2ITD C;  4YT5 A;  1D0Z A;  2OEV A;  3RVZ A;  3EHN A;  1VF6 C;  5BY1 A;  1R6K A;  4TV8 A;  2Q0A A;  4LF6 O;  1HMD A;  1W2W A;  2BCC H;  4XEF A;  5LGT A;  4G78 A;  4IIJ B;  3UR3 C;  2QE9 A;  3ITF A;  1XNQ O;  1OCC B;  4NTX A;  2QWN B;  4QNH B;  2P0N A;  5EZY B;  5KYU A;  1BCC H;  2QWR B;  4G27 B;  2DYS C;  2BTQ B;  4MTG A;  4X0R A;  3ZSU A;  4FM1 A;  4CIH A;  3HKB B;  4NTY A;  2JGU A;  2ZXW C;  3OUF A;  1Q5O A;  3S84 A;  4MVZ A;  1O3U A;  2LFD A;  4CSA C;  4ZI7 B;  1RM1 B;  2AXT Z;  1HR0 B;  3SPC A;  5F2V O;  1MG1 A;  1C02 A;  4DO2 A;  1HNW B;  5LYJ B;  1PNM A;  4I50 B;  4LWS B;  4NB5 A;  1MQV A;  3DJU B;  4FLY A;  4IWB A;  4JI3 B;  2JEU A;  2R7S A;  2OKU A;  2ZQM A;  2IBF A;  2ZXO A;  3HB3 B;  2DE0 X;  5KLV H;  2DWE C;  4DR7 O;  4B3S O;  3FOO A;  5H2F Z;  3O10 A;  5EC1 C;  4WJ0 A;  1EN4 A;  1MOF A;  1MZE A;  2BC5 A;  3F46 A;  4LDK A;  5A6B A;  3L34 A;  3JYY A;  4CIP A;  4HNA B;  4JI8 O;  2XM0 A;  4PDL A;  4P9P A;  2HS5 A;  1ORJ A;  4I1M A;  3EXA A;  5F5H A;  1TWH A;  4ZHQ B;  3AG4 C;  3TXS A;  1LUW A;  5IYZ A;  1N36 B;  1NSG B;  3VM6 A;  1AR1 B;  5B3I A;  4EFB A;  3ASO C;  3UGP A;  2GSM B;  1K9M W;  4U5F E;  3LUT B;  5KYU B;  3B0U X;  1QR8 A;  3A2F A;  1FFT C;  2P6J A;  4OPH A;  4X66 O;  4OIO F;  4U7O A;  4MVU A;  4FJC C;  5IWA O;  3SPJ A;  3AQC A;  1N0J A;  3FAV A;  1E84 A;  1E83 A;  4DK0 A;  1U0B B;  3S90 A;  4RWU A;  2EX3 A;  1AI4 A;  5J2U B;  1XRE A;  3PJS K;  2AWY A;  2HJD A;  2L7A A;  4OIQ F;  3VRC A;  2UUB B;  1LI7 A;  3GOR A;  3CXC U;  2Q5Z A;  4C3D A;  1QU7 A;  4O4J B;  3Q4H B;  3CRM A;  5B1O A;  1RP3 B;  4P9T A;  2IXN A;  5JLI A;  5CN0 A;  3RBZ A;  1Y6D A;  4DR3 O;  4OX9 O;  5JCO C;  2HUJ A;  3NYL A;  1G8X A;  256B A;  3UM7 A;  2OTL V;  4PI2 A;  3ZTZ A;  3OE7 G;  3OTO B;  1PM9 A;  4LFC B;  2EPL X;  1QSP A;  2XLW A;  1HNX O;  4N06 A;  2JRI A;  1E86 A;  2LSE A;  3EQL F;  2UUC B;  5BQI A;  1RJ9 B;  2M7W A;  4DRJ B;  1M56 C;  1NVP D;  2EUL A;  3L70 H;  2DI3 A;  3JCZ A;  2AWC A;  1X59 A;  2NSF A;  1SKV A;  4J32 B;  2NUT B;  2GV9 A;  1H2M A;  5KYY A;  1MMA A;  3F47 A;  3CCM V;  2P5O A;  3H1L H;  1VQK V;  2IU3 A;  2R03 A;  1EFR G;  3MDS A;  1MA1 A;  1TFO B;  2J7P D;  1K4C C;  1JVM A;  4IHJ A;  1ORQ C;  1Z23 A;  4JTC B;  1OCR C;  1YZA A;  5LHI A;  1L8D A;  2W45 A;  2XLV A;  4GKK O;  4FIP C;  1N34 O;  5LGU A;  4LH7 A;  3HPL C;  4LAC B;  4QE7 A;  1YZB A;  2F23 A;  2IOQ A;  4X62 B;  1WAT A;  1Q81 W;  3OGC C;  4MVS A;  1VOM A;  4WBN A;  3O55 A;  3ETG A;  3SXZ A;  2A1D D;  4I5S A;  3LLI A;  4HE8 D;  2KQ9 A;  4X1K A;  2EIL B;  2P4V A;  2V7Q G;  3LSQ A;  4K8Z A;  3H01 A;  2E5L B;  2Y4T A;  3LDC A;  1PNL A;  3G6E V;  4BJT A;  3J06 A;  3G67 A;  3G4Z A;  5EIB D;  2LW7 A;  3DMD A;  1E1R G;  3TCU A;  1HMO A;  4JAS A;  5JJN B;  5IJ9 A;  2W6I G;  3ZG1 A;  4IHJ B;  1GN6 A;  4EEQ A;  1QQ3 A;  4KI2 A;  2DMX A;  1BE3 H;  3JAW A;  4Z9I A;  2R7U A;  1OHH G;  2Y69 B;  2YL1 A;  1F1M A;  4AL0 A;  3O9O A;  1CP9 A;  2LO1 A;  5JJE B;  4YJ2 B;  4OIN F;  5TIS Z;  2GWW A;  1T5O A;  3UT5 B;  3KMI A;  2R05 A;  5B1B B;  3CCE V;  1F4N A;  1SQG A;  4YWQ A;  4BG0 A;  2OT5 A;  1IZ3 A;  3P30 A;  5FNV B;  4JPR A;  2F22 A;  3ASN C;  4NXN B;  1S0V A;  2WWW A;  4XEV A;  2ZD9 A;  2E3C A;  4EWC A;  1E2X A;  1SC5 B;  2A9H A;  2Q67 A;  5KA6 A;  1D1B A;  5KX5 A;  1N32 O;  4RBN A;  4R7C A;  4N6H A;  4O6N A;  5FPR A;  4GX1 A;  4LF4 B;  1KKD A;  2GDS A;  4CH6 A;  4XPX A;  2QNL A;  4KNV A;  3EH1 A;  1SA0 B;  5JVD A;  2R7R A;  2YLD A;  3QVY A;  2NN4 A;  2ZXR A;  2L6L A;  3K5M A;  1DOV A;  4U5G A;  1H9T A;  5IJ9 B;  4CH3 A;  2KKW A;  3L71 H;  1S72 V;  4H54 A;  2KYH A;  2UXD B;  1GGQ A;  1RKE A;  2HVK C;  2EJ7 A;  3HKD B;  4N23 A;  2L6G A;  3STL C;  1LR1 A;  3AG1 C;  4D7T A;  1IBL O;  3TOL A;  4CS7 A;  3T4D A;  4B3M O;  2OQM A;  1H2K A;  1AUE A;  1TWA A;  2JJ2 G;  4K0K O;  4D6T H;  2XSE A;  4JRZ A;  3H1I H;  3JSN A;  2EIJ C;  1NFN A;  1H9G A;  2OOC A;  1Y76 A;  5C93 A;  2ODM A;  4LF5 O;  3U0Z A;  4LF7 O;  1A41 A;  1L3P A;  1XMO B;  2YKZ A;  3GM2 A;  4D4X A;  1I5Y A;  1KBH A;  1HDJ A;  1G4W R;  5KX5 B;  4RD9 A;  3T1Y O;  1I5X A;  4B7K A;  1WTY A;  3RFY A;  1KP3 A;  1XQ8 A;  5L3V A;  2KQX A;  4DV4 B;  2HG5 C;  5JP7 A;  5AC4 A;  3L9D A;  3D3Q A;  5TJ5 E;  4I0X B;  2H8P C;  2Y0I A;  1BBH A;  1WWP A;  1OXB A;  1VP7 A;  4TUY A;  4GCZ A;  3UKM A;  5E2Q A;  2LK4 A;  1PP9 H;  1PKX A;  4UCS A;  5KHH A;  2FAP B;  2KNH A;  2KSF A;  2XS8 A;  3RH3 A;  1OJH A;  2HKO A;  2ZE7 A;  4DUY O;  4JI1 O;  1R6N A;  1ZWI C;  1RXQ A;  4JTA B;  1TVK B;  4JI0 B;  1Y66 A;  4DR6 B;  3EH2 A;  3K7D A;  4FES A;  2RMK B;  1DF5 A;  2G3V A;  2IXP A;  2KSD A;  1GN4 A;  3DI5 A;  3ABL B;  1WAZ A;  3K5O A; 
#chains in the Genus database with same CATH homology
 3CCJ V;  2J45 A;  4Q20 A;  3G71 V;  2Y3H A;  3VAY A;  3ZMT A;  3B0P A;  2X6B A;  1KD1 W;  1V54 B;  5HFM A;  3EFO B;  1ZU4 A;  5CBH A;  4WFA V;  4PEL A;  4E7S A;  3CCL V;  5EC2 C;  1RPR A;  5DS4 A;  2KW3 C;  4GT1 A;  1R3I C;  4C7O A;  4U5D E;  2Q9A A;  2D3O W;  1O87 A;  2MWQ A;  4H4K C;  4J9Y B;  5T1D B;  3E86 A;  5KYX A;  5CI8 A;  3SYA A;  4QDL A;  3B9Q A;  1KQS U;  3K08 A;  3QO5 A;  5LGN A;  1VQ7 V;  4UV8 A;  4Q5S F;  2IJH A;  4OD4 A;  2Z5U A;  3FB8 C;  4G28 B;  1J8Y F;  4K0D A;  3S0X A;  1AI6 A;  1NH2 D;  4CS9 A;  1D0X A;  3K0G A;  1FTS A;  3AQB A;  4MVR A;  4BJ5 A;  3E8H A;  3NKE A;  3E70 C;  4C3B A;  3DJN B;  1OCO B;  2IH3 C;  3N24 A;  3NRH A;  2CNW D;  2O9X A;  2XRH A;  3T1C A;  2XAJ A;  1AJQ A;  3X2Q B;  3JSZ A;  4MSW C;  1BHB A;  3K9A A;  4OXS A;  2KGO A;  4I9W A;  4Q7C A;  4Q4Z F;  1PD3 A;  2XAQ A;  3W2W A;  4R8C A;  4FK5 C;  2PX0 A;  3JD3 A;  5L3F A;  4L87 A;  4IRU A;  3OM3 B;  3N2Z B;  4CZZ A;  3WOD F;  1LVK A;  1JQ0 A;  1GM7 A;  5BZB A;  4QI0 A;  1PD1 A;  2ZDI A;  4RAI A;  3E89 A;  1S5H C;  5CI9 A;  1D1A A;  1QVF U;  1GTO A;  4EKW A;  3KG2 A;  2JDI G;  1XL6 A;  3K1I C;  1M57 B;  3W7S A;  3K66 A;  1FXK C;  2EIM B;  4ZKI A;  4MW3 A;  3ABM B;  2OCC C;  2QM7 A;  4MQ9 F;  3AG3 B;  4YN0 B;  3GWO A;  4JJF A;  1OKK A;  4LBE C;  4MT8 A;  4OIP F;  3IEE A;  4RDA A;  5E3A A;  2WLM A;  3JYC A;  2FFH A;  2DYR B;  2NUP B;  1QVG U;  4CS9 C;  1NU7 D;  1JOY A;  4BJ5 C;  4AX2 A;  1PNK A;  3SYP A;  4GYT A;  2CDQ A;  4HFF B;  4QI2 A;  1OCZ C;  5B1A B;  4RQE A;  4CSA A;  3EGX A;  1M2V B;  1G4Y B;  3BEH A;  2WLK A;  4G7H F;  1QLE C;  4TSF G;  2WAM A;  2R9I A;  3Q7L A;  4H33 A;  2J0X A;  1SZI A;  3JCU Q;  2WLJ A;  2IXO A;  4E2L A;  3OUS A;  1MNE A;  1GK9 A;  5DM6 V;  2DYS B;  2X51 A;  1ST6 A;  3TD7 A;  2R7X A;  2ZDI C;  2NNU A;  3KH2 A;  3ZMV A;  2P67 A;  5H9C A;  2W6J G;  4P2Z A;  2HFE C;  3CCQ V;  1JPJ A;  5HFL A;  2VAS A;  4AE4 B;  2CK3 G;  5E3C A;  2CW0 F;  3W7T A;  1BMF G;  5F5F A;  3FYE B;  3AG4 B;  3LES A;  3AG2 C;  3RVY A;  5FL7 G;  1IXM A;  4OIR F;  3S27 A;  3ASO B;  3PHF 2;  4X89 A;  3KKB A;  3JT1 A;  3Q6M A;  2Y3D A;  2ZR3 A;  3T4Z A;  4JYB A;  3FB6 C;  1MMG A;  2Y39 A;  3LAY A;  3VBB A;  4QJF B;  3IFX A;  2ZXP A;  4F4L A;  3CMA V;  4LLE A;  5DVW A;  1QCE A;  4NY3 A;  1K34 A;  5B3S C;  3CQZ A;  2XAH A;  4FPP A;  1JPX A;  2HJF C;  2IXM A;  4KNW A;  1M2O A;  5IYD O;  1SF8 A;  4KBL A;  2H7O A;  1M56 B;  1BHA A;  1Q7Y W;  1M1K W;  4O79 A;  4TWK A;  2Q9B A;  1YSC A;  4U5H A;  2Q9C A;  5BUO A;  3F7V C;  4GX0 A;  4MVQ A;  3NG1 A;  4UV9 A;  3QO7 A;  3T6B A;  3OEE G;  2WZF A;  3FKS G;  4WFB V;  1OCR B;  2J46 A;  3MX3 A;  1FMV A;  1DF4 A;  3ZRX A;  1BL8 A;  3N0T A;  1MSW D;  1QR9 A;  5L3Q A;  1AJP A;  1ARO P;  1V55 C;  2Y3G A;  3UMH A;  2JJ1 G;  1H8E G;  1VQ8 V;  3B8N A;  2JD3 A;  2YSU B;  1SMY F;  5EBM C;  4XBF A;  4X88 A;  5LHG A;  2J7P A;  1VQP V;  4QE9 A;  1RM1 C;  1ZHX A;  5DQZ A;  3ZMS A;  3Q7G A;  2YZS A;  3H65 A;  1FXH A;  4YJW A;  2AHY A;  4PA3 A;  1MMD A;  5KYW A;  2LFR A;  3ZRS A;  3WFV A;  1THZ A;  4G0H A;  1SES A;  1YI2 V;  1YIJ V;  1P4R A;  4QIW F;  4PA7 A;  3ASN B;  1KU2 A;  2A6E F;  2LFS A;  2DQ0 A;  1AI7 A;  5E1A C;  2WVO A;  3GOD A;  1S3J A;  2XL4 A;  3NDB B;  3M99 B;  1K7D A;  5KYY B;  1K33 A;  2R9R B;  2XOK G;  4F4B A;  3AG1 B;  3CD6 V;  2QEX V;  2EIN C;  3ABU A;  4CBC A;  2G3K A;  2EIJ B;  2DW4 A;  2W4B A;  3EHB B;  3SPH A;  1KP2 A;  4J9Z B;  1L1F A;  3OWT A;  1QBZ A;  3ZCC A;  4MW8 A;  2EIK C;  3FB5 C;  2Q69 A;  3JYH A;  4C3E A;  3ABK C;  4WFF A;  2XXA A;  2WL8 A;  2IU0 A;  3CZ6 A;  1MND A;  4KFM A;  5IDJ A;  2OG2 A;  4KUM A;  2X7R B;  3MLG A;  1K73 W;  2AHZ A;  2UXN A;  1MAB G;  5EK0 A;  1JJ2 U;  4JVS A;  3DGE A;  5CMU A;  3SP1 A;  3D3I A;  2QTO A;  3LDE A;  2IJK A;  1ZYR F;  3SPG A;  5IYB O;  4G7O F;  1KC8 W;  2MYS A;  4RQF A;  3V7O A;  4I3M A;  4PA9 A;  2XXA B;  3GB7 C;  3EPV A;  2HV7 A;  4LC1 A;  3MHH C;  2KJG A;  3HTK C;  4OD5 A;  3QO8 A;  5IYC O;  3FHD A;  5T3T A;  4CS8 C;  3FDQ A;  4YT4 A;  3ETD A;  4DXW A;  3SNH A;  2ATK C;  1TWC A;  3ZVR A;  1BR2 A;  4K7B A;  2IYL D;  3LSS A;  1E1Q G;  1IZM A;  3PMR A;  3UNG C;  2W0F C;  4MS2 A;  1TKN A;  2FTK A;  2V26 A;  1UJW B;  4RUE A;  1S76 D;  3I55 V;  3W7W A;  5KUM A;  1PL0 A;  2WVQ A;  3EG9 A;  5GW7 A;  1ZHT A;  2IW5 A;  3EZI A;  2IJJ A;  2P7T C;  1FXK A;  1K8A W;  2WPD G;  4PK4 A;  5KA5 A;  2B5U A;  5L3D A;  2WLH A;  1ZU5 A;  1B6Q A;  3K3W A;  3O39 A;  2JEX A;  4EBB A;  1QZX A;  1K5Q A;  3X1O A;  3ZN0 A;  4XLN F;  4Z1M G;  1M9N A;  4PA4 A;  4C7O B;  1H2G A;  1SER A;  4X8A A;  5DQT A;  1YTF B;  3DM5 A;  2UXX A;  3ML0 A;  4MTO A;  2ITC C;  3E35 A;  5KYX B;  1R3L C;  1V54 C;  1Y4M A;  5IY5 C;  4DOZ A;  1FXK B;  3LLK A;  3D36 A;  1G8M A;  3CCV V;  4QPJ A;  2K1E A;  3LS1 A;  2OCC B;  3OR7 C;  3BY6 A;  1MMN A;  2PI4 A;  3I56 V;  2L81 A;  2Z3Y A;  2BOB C;  1K4D C;  3T4R A;  1WLE A;  4G7Z F;  4BIU A;  4PJM A;  2XAG A;  1NBM G;  3HLZ A;  1OCZ B;  3ZMU A;  3EGD A;  3Q6N A;  1J8M F;  4FX5 A;  2FGY A;  3CCR V;  2Q3T A;  1QLE B;  4UXN A;  1VQ5 V;  1EZJ A;  2WSS G;  1P7B A;  1NJI W;  4H37 A;  5B1N A;  3A0R A;  4BIZ A;  5D91 A;  1DLB A;  4HAM A;  4JGS A;  3CC2 V;  2C03 A;  1ENV A;  2YEV A;  3CP1 A;  2WLL A;  4BW5 A;  2WLN A;  3SYQ A;  1VQL V;  3OMI B;  3ZRW A;  4JF3 A;  3EJN A;  1Z3I X;  2R7O A;  3FVY A;  3VYW A;  2EJR A;  2DQ3 A;  1CPY A;  1AI5 A;  2QM8 A;  2Z15 A;  3I5P A;  2A0L A;  3SYN A;  2G62 A;  1GMG A;  3WG7 C;  4A2N B;  2L9J A;  4G2K A;  5DN6 G;  4RUF A;  2P7V A;  5EHH A;  1D0Y A;  3ZIA G;  4CBE A;  3AEI A;  4O6Y A;  2IH1 C;  3T6J A;  5KYN A;  4WFE A;  3E8B A;  3SYC A;  3CPW U;  5CA3 A;  2ZXW B;  2HVJ C;  2E87 A;  1GM8 A;  4MVM A;  5FCL A;  4XDK A;  3EGX B;  4KP4 A;  5B3S B;  2JIZ G;  4P9O A;  2Q6A A;  3B8M A;  3OR6 C;  3OMN B;  2PFD A;  2R7Q A;  4R50 A;  4RO2 A;  1R3J C;  3OMA B;  2VH3 A;  2EZP A;  4R6Z A;  3NYM A;  5CBF A;  4WCE V;  5B1A C;  4JUR I;  3E2E A;  1FFT B;  4LCU C;  5KUK A;  4ANJ A;  3SYO A;  1Q86 W;  3FB7 C;  1TR2 A;  3VOU A;  3T2M A;  3K06 A;  4IAO A;  3EFF K;  3ZMZ A;  1N1C A;  1JPN A;  2PF4 E;  1R73 A;  1V55 B;  2HR3 A;  5L3E A;  1GO3 F;  3ECS A;  4LLC A;  3LDD A;  3S28 A;  2F43 G;  1M90 W;  1K97 A;  3ABT A;  2XAS A;  3W2V A;  4ASU G;  4HEA J;  4WFG A;  1K3E A;  2WLI A;  3EHM A;  3OFN G;  3CSK A;  1F51 A;  3MHS C;  4HYO A;  1SET A;  4LP8 A;  1GKF A;  4XTK A;  5D92 A;  3QNE A;  4JCH A;  2DGJ A;  2C04 A;  1TUE B;  4ZLD A;  3ZC4 A;  2P90 A;  2GHY A;  1RJ9 A;  1YJ9 V;  3RYL A;  3NXS A;  4BJ6 A;  3OEO A;  3OW2 U;  2QTV A;  2B1I A;  2NUT A;  1XL4 A;  4UVB A;  3W8H A;  5LHH A;  3E9V A;  5T3W A;  1OCC C;  2WB7 A;  4P30 A;  1OZ0 A;  2GFH A;  2WLI B;  3KL4 A;  4E7Z A;  2J9U A;  2DWD C;  4ZBM A;  4ULW A;  2EIN B;  4PDR A;  3E8G A;  2CGE A;  4GX5 A;  3K0D A;  2J9V A;  3LJB A;  2V1D A;  1NVP B;  5L3G A;  1VK5 A;  4DVY P;  1HWY A;  3LS0 A;  3LNR A;  2EIK B;  3K33 A;  4GX2 A;  3K1H A;  4WFH A;  3ABK B;  3SJQ C;  4YT2 A;  1FMW A;  1IW7 F;  1Z63 A;  1YJW V;  4N21 A;  3K6B A;  3QMK A;  3CC4 V;  4O6M A;  2LP7 A;  4PFO A;  5KYW B;  1WGW A;  4LER A;  1ZHW A;  3DAF A;  2H7V C;  4CS8 A;  4PJJ A;  1BR4 A;  3I4U A;  4MTX A;  2R7W A;  3G4S V;  3JRT A;  2M4E A;  4BJ6 C;  5DS5 A;  5J9P C;  1RPO A;  2VB6 A;  1K5S A;  1YJN V;  2JK5 C;  4PDV A;  5DS6 A;  3K79 A;  3ZJZ A;  4ZLC A;  2J9W A;  3STZ C;  4TT3 G;  4DBR A;  3ZRV A;  2QKS A;  1K92 A;  2A6H F;  2EIL C;  4JTD B;  2NG1 A;  2W4M A;  2PP4 A;  2A69 F;  4IJJ A;  2B1G A;  2MK3 A;  2ZR2 A;  4AK9 A;  3I5Q A;  4B6I A;  1VYK A;  1S77 D;  2EBO A;  1W0K G;  3UMI A;  5L3C A;  3MD0 A;  2H7B A;  5EBL C;  2Y69 C;  3SZR A;  3W7U A;  3NKD A;  1VYI A;  4MND A;  4U5E E;  3ZN1 A;  3GAN A;  3LNM B;  5B1B C;  1R3K C;  2QY9 A;  5E33 A;  3JD4 A;  4PJN A;  2R7T A;  3LEV A;  3S29 A;  1VQN V;  2V3C C;  4HZ3 A;  2Q68 A;  3R65 A;  3EFO A;  3F5W C;  1NQT A;  2WVN A;  4PFP A;  1YIT V;  4BAY A;  2BOC C;  1QLN A;  4PA6 A;  4U5C E;  3HJC A;  1NR7 A;  1AJN A;  3DM9 B;  3RW0 A;  3POV A;  4DVZ A;  1YHQ V;  5H6Q A;  5CBG A;  1VQ4 V;  4FWV A;  2WZG A;  1FFH A;  1COW G;  1J95 A;  3K04 A;  5L3B A;  4JW1 A;  5IY5 B;  1WPX A;  3CCS V;  3SPI A;  1CEZ A;  4YXW G;  3SEO A;  5DLJ A;  1NG1 A;  2R7V A;  2XND G;  3ZIB A;  2X0L A;  1FS0 G;  1SRY A;  2J0W A;  4GEH A;  3E83 A;  4XDL A;  4XLP F;  3ABL C;  3JD2 A;  4JZA A;  2CNW A;  3ETE A;  2EZO A;  4MVO A;  4HFK B;  3CYO A;  2C2A A;  3E8F A;  1Z6A A;  1YTF D;  2BE5 F;  3M1C B;  2OTJ V;  3UGO A;  4UVC A;  2Y3B A;  1LKX A;  3EG9 B;  5EGY A;  1SZT A;  1W2B U;  2QA4 V;  5HSW A;  4O7G A;  3W7X A;  1NR1 A;  2A68 F;  4PJL A;  1KEC A;  4DBQ A;  1NH2 B;  3FAJ A;  4KC9 A;  3QZC A;  2PX3 A;  2H94 A;  2B0J A;  3P32 A;  1JCH A;  3L0I A;  3UMK A;  1Q82 W;  3OEH G;  4PDM A;  3DZA A;  4BEJ A;  1VQO V;  1NKD A;  3B0V C;  1GM9 A;  2W9Y A;  1N8R W;  1H8H G;  3WG7 B;  1FXV A;  2KB1 A;  4YT8 A;  4I44 A;  1ROP A;  3OA1 A;  3K03 A;  3IGA C;  1ZHY A;  2XAF A;  1PD0 A;  4JYC A;  1TWG A;  1NZE A;  2NUP A;  4UVA A;  1JX9 A;  3IC7 A;  4UUJ C;  1OCO C;  1VQ6 V;  2IJI A;  2PI5 A;  2QE7 G;  1NU9 C;  1Z5Z A;  2X6A A;  3CCU V;  1M2V A;  4XWJ A;  2NLJ C;  2D5R B;  3EGD B;  3X2Q C;  4P6I C;  3DXJ F;  1W0J G;  3F7Y C;  1VMA A;  4WF9 V;  4BJ1 A;  4JAU A;  1PCX A;  4U5B E;  1H38 A;  3DAG A;  2X6C A;  4JAV A;  2A79 B;  5LBQ A;  1O5H A;  1F23 A;  3CME V;  4JJG A;  3EZH A;  2YEV B;  3FYI B;  3O6X A;  3W8I A;  3TET A;  1OKK D;  3AG2 B;  1S7Z A;  2WLL B;  1E79 G;  3RKO F;  3ZRW B;  4J30 B;  3DTU B;  1LS1 A;  1DTO A;  5EBW C;  3CC7 V;  1LNQ A;  2WZL A;  1M57 C;  4AE4 A;  4QPK A;  3OAA G;  2EIM C;  3B77 A;  3TK1 A;  4M63 A;  3ABM C;  1ZHZ A;  3AG3 C;  4FMT A;  2I8B A;  1VQ9 V;  3NYJ A;  2Y48 A;  4U7N A;  4W8K A;  4MTF A;  2DYR C;  3JD1 A;  4XDJ A;  2YHS A;  3RIP A;  3JD0 A;  1F4M A;  5H6R A;  3DD7 A;  2HLD G;  4I1O B;  1BR1 A;  1D1C A;  1EBO A;  2HV6 A;  1VQM V;  2ZPA A;  2P6V A;  2ITD C;  4YT5 A;  1D0Z A;  3RVZ A;  3EHN A;  1R6K A;  1W2W A;  5LGT A;  3UR3 C;  3ITF A;  1OCC B;  4QNH B;  5KYU A;  4MTG A;  4G27 B;  2DYS C;  3ZSU A;  4X0R A;  4CIH A;  2ZXW C;  3OUF A;  4MVZ A;  4CSA C;  1RM1 B;  3SPC A;  1MG1 A;  4DO2 A;  1PNM A;  3DJU B;  4IWB A;  2JEU A;  2R7S A;  2ZQM A;  2ZXO A;  3HB3 B;  2DWE C;  5EC1 C;  4WJ0 A;  1MOF A;  3F46 A;  3L34 A;  4PDL A;  4P9P A;  4I1M A;  5F5H A;  1TWH A;  3AG4 C;  1AR1 B;  3ASO C;  3UGP A;  2GSM B;  1K9M W;  4U5F E;  5KYU B;  3LUT B;  3B0U X;  1QR8 A;  1FFT C;  2P6J A;  4OIO F;  4U7O A;  4MVU A;  4FJC C;  3SPJ A;  3AQC A;  1AI4 A;  3PJS K;  4OIQ F;  4C3D A;  3CXC U;  5B1O A;  2IXN A;  5CN0 A;  3RBZ A;  3NYL A;  1G8X A;  3UM7 A;  2OTL V;  3OE7 G;  4N06 A;  2LSE A;  3EQL F;  1RJ9 B;  2M7W A;  1M56 C;  1NVP D;  3JCZ A;  4J32 B;  2NUT B;  5KYY A;  1MMA A;  3F47 A;  3CCM V;  1VQK V;  2IU3 A;  1EFR G;  2J7P D;  1K4C C;  1JVM A;  1ORQ C;  1Z23 A;  4JTC B;  1OCR C;  5LHI A;  2W45 A;  4FIP C;  5LGU A;  3HPL C;  4LAC B;  4QE7 A;  2IOQ A;  1Q81 W;  3OGC C;  4MVS A;  1VOM A;  3ETG A;  2A1D D;  4I5S A;  3LLI A;  4HE8 D;  2KQ9 A;  2EIL B;  2V7Q G;  3LSQ A;  3H01 A;  3LDC A;  1PNL A;  3G6E V;  4BJT A;  3DMD A;  1E1R G;  3TCU A;  4JAS A;  3ZG1 A;  2W6I G;  4KI2 A;  2R7U A;  1OHH G;  2Y69 B;  1CP9 A;  4OIN F;  3KMI A;  5B1B B;  3CCE V;  1F4N A;  4YWQ A;  4BG0 A;  2OT5 A;  3P30 A;  4JPR A;  3ASN C;  1S0V A;  2WWW A;  2ZD9 A;  4EWC A;  2A9H A;  2Q67 A;  5KA6 A;  1D1B A;  4RBN A;  4R7C A;  4O6N A;  4GX1 A;  1KKD A;  4KNV A;  3EH1 A;  2R7R A;  2ZXR A;  4U5G A;  1S72 V;  2HVK C;  4N23 A;  3STL C;  3AG1 C;  4CS7 A;  3T4D A;  1TWA A;  2JJ2 G;  2XSE A;  2EIJ C;  5C93 A;  1I5Y A;  4RD9 A;  1I5X A;  3RFY A;  1KP3 A;  5L3V A;  2HG5 C;  2H8P C;  4GCZ A;  3UKM A;  5E2Q A;  1PKX A;  2KNH A;  3RH3 A;  2HKO A;  1R6N A;  1ZWI C;  4JTA B;  3EH2 A;  1Y66 A;  3K7D A;  4FES A;  1DF5 A;  2G3V A;  2IXP A;  3ABL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...