1M56C

Structure of cytochrome c oxidase from rhodobactor sphaeroides (wild type)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
265
structure length
265
Chain Sequence
AHAKNHDYHILPPSIWPFMASVGAFVMLFGAVLWMHGSGPWMGLIGLVVVLYTMFGWWSDVVTESLEGDHTPVVRLGLRWGFILFIMSEVMFFSAWFWSFFKHALYPMGPESPIIDGIFPPEGIITFDPWHLPLINTLILLCSGCAATWAHHALVHENNRRDVAWGLALAIALGALFTVFQAYEYSHAAFGFAGNIYGANFFMATGFHGFHVIVGTIFLLVCLIRVQRGHFTPEKHVGFEAAIWYWHFVDVVWLFLFASIYIWGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-ray crystal structures of wild-type and EQ(I-286) mutant cytochrome c oxidases from Rhodobacter sphaeroides.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords CYTOCHROME C OXIDASE
total genus 101
structure length 265
sequence length 265
chains with identical sequence I
ec nomenclature
pdb deposition date 2002-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00510 COX3 Cytochrome c oxidase subunit III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1m56C01
1.20.120.80 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1m56C02
4R7CA 3SJQC 3T4DA 2Q68A 2HVKC 3RVYA 5CBGA 3SPCA 5CBHA 2WLKA 4G28B 4F4LA 3TETA 5KUMA 2WLIB 4PDRA 5B1BC 3T1CA 4MVOA 1XL4A 4MVQA 3OGCC 3STZC 3RW0A 3E89A 3SYOA 5B3SC 3FB8C 4WFHA 3STLC 3LDDA 3K03A 5EBMC 3SPHA 1R3LC 2DYSC 2HFEC 4TWKA 5EC2C 4RO2A 4LP8A 4PDVA 4LBEC 2WLLB 4UUJC 2R9RB 5EK0A 1OCCC 3SPJA 2DWDC 4PA6A 1R3KC 3RVZA 3AG1C 4MTFA 3E8BA 3K0DA 1M56C 4JTDB 4PA9A 4MVUA 3K06A 3R65A 2OCCC 1S5HC 2EIMC 3AG2C 4PA3A 2HG5C 3IFXA 4PA7A 4BW5A 4EKWA 3JYCA 1XL6A 2WLJA 2QKSA 3LNMB 1ZWIC 3FB6C 4H37A 2K1EA 5E1AC 3SYPA 5CBFA 3K08A 3ABKC 2A9HA 2EIKC 4QNHB 3PJSK 4I9WA 4LCUC 2AHZA 4RAIA 1K4CC 3E8HA 3ZJZA 4WFEA 3OR6C 2Q69A 2Y69C 3F5WC 2ZD9A 3AG4C 4PDMA 4MVMA 4X8AA 5IY5C 3LDEA 4ZBMA 2IH1C 3OUFA 2IH3C 3TCUA 1V54C 3ASOC 5KUKA 1R3IC 4X88A 1BL8A 3LUTB 4QE7A 5EBWC 3SYAA 1OCRC 3SYQA 4MS2A 4PA4A 3UM7A 3OR7C 5J9PC 4MTOA 2AHYA 3SYCA 3T2MA 2A0LA 1K4DC 2NLJC 3X2QC 3BEHA 1J95A 4WFFA 2WLLA 3E8FA 2X6AA 4MVRA 4MTGA 5EC1C 4WFGA 4X89A 3E83A 4GX0A 4P2ZA 1V55C 2W0FC 3F7YC 4MVSA 4P30A 4RUEA 4QE9A 4XDKA 1ORQC 1P7BA 3E8GA 4MW3A 3RBZA 3ZRSA 2BOBC 4MSWC 5BZBA 4P9OA 2DYRC 1LNQA 3FB7C 3ABMC 3T4ZA 2Q6AA 2ATKC 2YEVA 1OCOC 4H33A 4GX2A 1G4YB 4JTCB 3IGAC 1JVMA 4MVZA 4PDLA 3VOUA 2HJFC 2A79B 4HZ3A 4HYOA 3LDCA 1QLEC 4J9YB 4OXSA 3ASNC 3UKMA 1M57C 2EILC 4RUFA 2DWEC 4GX5A 1OCZC 4MW8A 2Q67A 2KB1A 4KFMA 2WLHA 2HVJC 3GB7C 3F7VC 2P7TC 3SPIA 4R8CA 4P9PA 2QTOA 2JK5C 2X6BA 2EINC 2ITCC 4G27B 1FFTC 2BOCC 3EFFK 3FB5C 4J9ZB 3SPGA 1R3JC 4DXWA 4JTAB 3OUSA 3KG2A 2WLNA 3WG7C 2ITDC 4R6ZA 3AG3C 4XDJA 2EIJC 2WLMA 5B1AC 1KKDA 5EBLC 2WLIA 4GX1A 4XDLA 2ZXWC 3ABLC 4CBCA 3HPLC 3E86A 2H8PC 2X6CA 3K04A 4R50A 3K0GA
chains in the Genus database with same CATH superfamily
1EI7A 1KQSU 3H1LH 4XLNF 5EHHA 5DQZA 4LF7O 5CBGA 1D0XA 5KYXA 2CNWA 4ZLDA 1A7DA 1QVGU 3E89A 3L73H 3TGUH 3MDSA 2J7PA 4J80A 1Y74A 4LLCA 2XL4A 3STLC 4FK5C 3EPVA 4NTBA 2J45A 4C3EA 1GRJA 3LSUA 2UUAB 3ZSUA 4UUJC 2A0UA 5EK0A 3C8GA 1ZAUA 1S76D 2QJ1A 4KUMA 1VYIA 4JI5B 1RKEB 1Z63A 1H9GA 4NY3A 5E2QA 3R65A 3CCRV 5L0JA 1R6NA 1N32B 4BIUA 4BJ5A 3OD4A 1VQNV 2YL7A 5JLIA 3X1OA 4NYKA 2IU3A 4ICGA 4H37A 1AI4A 4FMTA 2OIGA 2R7TA 4PELA 5TISZ 2EPMX 2L6FA 4O4IA 2G3KA 2W4MA 1QBZA 4HFKB 1Q86W 3IHUA 2Y69C 3D36A 3U3BA 1BQZA 4I0XA 3BY6A 1TA8A 3RYCA 3QW0A 4P6IC 3ZHSA 1BHBA 4IAQA 1YLMA 4ZHQB 2XXAB 4LF8O 3CCEV 4I4TB 3BVOA 3OEEG 1ZHWA 1Y6DA 5KX5B 3QO5A 3LAYA 4NTAA 3CSXA 5GW7A 2PUSA 4WFFA 2ADPA 3AK1A 3U9MA 2WA4A 4HNAA 1Y76B 3Q6NA 2HUJA 4P30A 2MK3A 3S3WA 2W4BA 4QE9A 3M1CB 1VF5B 1I4ZA 1KC8W 4P9OA 2Z5UA 1ZHTA 4EIYA 3IGAC 5F5FA 1NVPD 3Q4HA 1QCEA 1CP9A 1XEQA 2A79B 3WAQA 1DOWA 3QO8A 2CTQA 4OXSA 5DECA 3TULA 3K59A 1M57B 4DR7O 2DWEC 1Y66A 4U5HA 2HJ3A 2F95B 1AVOB 3LNRA 4YK5A 3EH1A 2R7WA 1BGYH 1AROP 3QZCA 1YA7O 1X59A 2OOCA 2W6IG 3MHHC 2Y0PA 2Y69B 5DN6G 1US6A 3B71A 3I5QA 4DV2B 1VQKV 3ZRXA 2LGQA 2ZE6A 3CMEV 3EZHA 1H9TA 1GM9A 2DQ3A 1ZX3A 2R7QA 4F6RB 5EIBC 4QI0A 4JI3O 4LFBB 5K0IA 4B3RB 3ABLC 4DR1O 3G6BA 1QVXA 2AVKA 1QSPA 3EXAA 5L3GA 3JATA 1LE4A 3B8NA 4G28B 5B1BC 1Q82W 2JDIG 2DB4A 1MMAA 2BTQB 2DYSB 3T1YO 3SJAC 3W8HA 2IXMA 1XNRB 1EKYA 4TV9A 2UU9B 3ZMTA 4L87A 1YF2A 2IM8A 1CGOA 4LBEC 3DC6A 2Q8VA 2HFIA 4YHHB 3ZIAG 2EINB 5E3CA 2GV9A 1KECA 4DYLA 4PI2A 2FTKA 4JI7O 3MLGA 5T1DB 2OCCC 2P67A 3B77A 5JS5A 1DF4A 1KD1W 1Z23A 2YLGA 5KMGB 1FYJA 4K8ZA 3AQBA 5JQGB 5AGFA 3SYPA 2IW5A 5L3DA 1S77D 3T6GB 4BAYA 4DV1B 1VMAA 1NT2B 3DAGA 1UJWB 4Z9JA 2PBEA 3OM3B 3F5TA 3OEHG 2R72A 2ZD9A 5IY5C 2LFDA 1IDSA 4CJOA 2RDCA 1G5ZA 2EX3A 3NYLA 4IT5A 4NKGB 2VQFO 2EPKX 4HBNA 2Q9LA 3UMIA 4NXNO 1SRYA 1RM1C 2R03A 4DV2O 4LERA 1L7CA 1XQ8A 2LQTA 4BG0A 4DV0O 1NZ6A 3HNJA 3ZHQA 1J95A 2HJDA 2Q4PA 4YIPA 3DJUB 1OXKA 1JFFB 1IZMA 1KUQA 2QKAA 2CGNA 3JT1A 3F7YC 4JI0O 2QM7A 1SZIA 3E8GA 3U2LA 3ICXA 4NTYA 4Q20A 2YKZA 3T4ZA 5EYPA 1YJNV 4PDLA 1OCOC 3TK1A 1P84F 2Q5ZA 2VQEO 1S72V 5DM6V 4YWQA 1UFIA 3L9DA 4O4HB 3UKMA 2D3OW 4JVSA 5D5PA 2YRFA 5BQIA 4ZI7B 1N36O 4KHPO 3P3PA 1OKKD 4YT8A 4KC9A 1N0JA 2P7TC 2JGDA 3RT3C 4O6YA 1BBHA 1VQ4V 1FAFA 4I1MA 1U0BB 3JD2A 2Q9AA 1JX9A 1SMYF 4WJ0A 1K34A 3J06A 1J5EO 2ZDIA 2XLMA 3S28A 1G6UA 3MD0A 1PV3A 4DRHB 1YITV 5IT9N 3R2PA 1QR8A 2UXDO 1XREA 3OAAG 5IYZB 3TQOA 2LFSA 4R7CA 4U3FH 2R7SA 1IBMB 1WB7A 3DC5A 2JS5A 4NTWA 5FPRA 2QY9A 4D7SA 4RBNA 3C62A 5B3SC 1NH2D 4JAAA 1IURA 4PJJA 1QKRA 1E1RG 1Q0MA 2Y0IA 3A2FA 3VAYA 3LDDA 4XWJA 2KSDA 4AE4B 5EBMC 3SPHA 3DWWA 4DR7B 2XS8A 2P0NA 2UXXA 4LDRA 1K92A 2BE3A 4B3TO 4DBQA 1ZW2A 1LR1A 1QHTA 3KKBA 5F28E 1D5NA 4YIOA 1U96A 3PCVA 1XWJA 1SQXH 1SS3A 1SR2A 2XLDA 5LXTA 1UG7A 4EKWA 2JPUA 5B1OA 1Z6AA 1M1KW 1EN6A 2YI8A 3LNMB 3CEXA 2E87A 2XSEA 3FXHA 3QTHA 2V3CC 4IWBA 5FNVA 1VQLV 3RFRA 1EA8A 2EPNA 3LSQA 4JEBA 1DGSA 1K97A 1N4CA 1JPNA 3AG4C 1MNDA 4DV3O 3ZG1A 1F4NA 2IH1C 5CB4B 3G4ZA 4O4JA 1PV0A 1GTOA 4JI6O 4BPMA 1AI6A 1OW7A 4QE7A 3LUTB 3U0CA 4J10A 5F2VO 1HNZO 3JALA 4ZOLB 5FNVB 4FFBB 2BTQA 3V5ZA 1TFOB 3VQWA 2JEXA 3QW1A 1OW6A 3IC7A 1SQVH 1E84A 1WJZA 2XOKG 2X6AA 3ATPA 3LS0A 2DW4A 4JZAA 4Z1VA 1ORYA 1MNEA 3CCMV 3H1HH 3HR0A 2VCCA 3UT5A 1G1XB 1BZ4A 4A4AA 3SJCC 3H2VA 2YEVA 3JRTA 4NVPA 4JI2B 3VOUA 2HJFC 1KMIZ 1XMQO 1XNQB 2V26A 4J9YB 4UVAA 2ZINA 4Z9IA 2YDEA 4NB5A 4ZI7A 4FFBA 3THOA 4TV8B 5LMNB 4X66O 3ASOB 2HS5A 4ONSA 5HSWA 3U9JA 3OFNG 4DO2A 2HV6A 3PHF2 3V5XA 3QO7A 1M2OA 3ABTA 4QIWF 4FAPB 2ZNIA 4X1IB 2YL1A 2XL8A 2V7QG 4GX1A 1GM7A 1LUWA 2BCCH 1EZJA 4DR1B 2H8PC 4I50A 3JYHA 2X7RB 4BR6A 5LMUB 3F46A 3IQ6A 1JMKC 4CS9A 2HVKC 1YYJA 2AXTZ 5KUMA 2R9AA 4GYCB 4GQHA 1XUQA 4M63A 4K8XA 2D4UA 1GH6A 3C8ZA 4DW1A 5LP6A 1NG1A 3O55A 5B1AB 1S0VA 2KSFA 1RPOA 2A69F 4I9QA 4TWKA 3BA8A 3CMAV 2A0BA 2JD3A 1IBKB 2UUHA 1WNSA 5FL7G 5LA6A 3KH2A 2FL4A 5JJNB 1AILA 3K0DA 3B0PA 1VTMP 3ZHUA 3EH2A 1SESA 3HLZA 3PDMP 2HG5C 1RM1B 3UO2A 1EN5A 1XL6A 2MW2B 2WLJA 3K9AA 5L3VA 3EFOA 3UT5B 1OR2A 4B6IA 1QLNA 4I9WA 2H7VC 2Q9BA 1XZPA 1VQMV 3ZBHA 5GONB 3CCJV 4N23A 1I94B 1FTSA 3ZTMA 2IJHA 1F23A 4BEMJ 5KUKA 5L0GA 2YIDA 4YXWG 4DR6O 4NCQA 3ASNB 1V4AA 4LLEA 2JS3A 2AHYA 2X0LA 3T2MA 5L3FA 2LFFA 4O2BB 3ZWIA 1SQBH 2CTPA 3TJTA 1JAFA 4DV5B 5BXZA 1ORQC 3FX7A 2B0HA 3JAKA 1I5YA 1SZXA 2DYRC 2X0CA 4C3DA 3GVMA 3GM3A 5GTHZ 1VARA 2Z3YA 2ASRA 4J7ZA 2R70A 1GGQA 4JI4O 1D0ZA 5IYDO 2OQMA 5CI8A 1VP7A 1PPJH 2KB1A 4KFMA 2RNBA 1VF7A 2XAJA 4IJJA 2XAQA 1MSDA 2X6BA 3HB3B 5L3EA 1VYKA 4Q7CA 3EHMA 3ZRWA 1S5JA 2LIGA 4J9ZB 2YIBA 1BSMA 3WG7C 4K3AA 2VQFB 3UR3C 3ETDA 2KNHA 2QR4A 2FKXA 4XEKA 2ZIMA 2HJMA 2PNOA 3L71H 2F4VB 3DKAA 3T4DA 2AWCA 2R7VA 4CJGA 4F4LA 1JRAA 3S0XA 4TUYA 5B1NA 1VQ5V 1KU9A 4HFFB 1K73W 1D1AA 1JFFA 2QNLA 1T6UA 4LF9B 3DI5A 4DVZA 2W6JG 1HR0B 1VQOV 1JMWA 2KYHA 4JURI 5BMVB 1IVSA 4J7TA 4FIPC 4RDAA 1S3JA 3K03A 3HKBB 3W7TA 3E35A 1VB5A 5JRAA 4R32A 2Y4UA 2ZR2A 3W7XA 2ZE7A 1NH2B 4AILC 4DBRA 3G6EV 2MHRA 4LF5B 5L3QA 3VYWA 2ZCEA 2KG7A 3H9VA 3FOPA 1SF8A 4JI8O 2ZR3A 4X1KB 1EBOA 2RQ6A 4CZZA 2YL3A 5L3CA 4DV7B 3U3FA 4FM1A 1X4TA 3K08A 4FLXA 2LCHA 3K33A 3OTOB 3EGDB 3N2KB 4B3RO 3LDEA 3RYCB 3TCUA 1V54C 2LP4A 3S29A 4UCVA 2AW9A 1PP9H 3K1HA 3RH3A 4K7BA 3BA9A 2IJIA 3ZQYA 1U6HA 2AWYA 1XMOO 3U5SA 1HW7A 3D8CA 1K4DC 3CP1A 2F43G 4LNUA 2PGGA 1T6IA 3SZRA 4MVRA 4MTGA 4FZ0A 3NRHA 5KYUB 3MFNA 1AP6A 4TQFA 4OIRF 4GX0A 4P2ZA 5L0FA 4LWSA 1NJIW 3K58A 1GKFA 1P7BA 1ZL8A 2J9UA 1EFRG 2JJ1G 2VH3A 2ADQB 3ZRWB 2CNWD 1SC5B 1JQ0A 4CDVA 3GEEA 3CJHA 4B08A 2X51A 2Q7GA 1PM9A 2CH7A 5EYPB 1TWGA 5COGA 3CXCU 4GX5A 2OCCB 4U5GA 5KHIA 5IJ0B 4QJFB 3JCUQ 4JI1B 4YN0B 2NNUA 2DMXA 3C8GD 3SP1A 1K5SA 1D2DA 2MWQA 4I1OB 1H7IA 1JCHA 2HSQA 3UO3A 1RMVA 3LLIA 2CUGA 2JVDA 2BTOA 4I7ZB 2JGDB 1XZQA 4UCTA 3ML0A 1K04A 3B09A 3GODA 2B9ZA 5KHHA 2QLAA 1Q43A 1HNZB 2FB5A 3B4SA 4EFEA 1B04A 1JJ2U 2H7OA 4MVOA 2XS1A 4EEQA 2XASA 1JJOA 3F47A 5BQHA 4MNDA 1FS0G 2BL2A 2EIJB 3N2ZB 2EIKB 4U7NA 2LD6A 5KX5A 1AR4A 1SETA 1A41A 1WPXA 2NG1A 2GUZA 1V74B 1EM1A 1MQVA 2L7AA 1AP5A 2JEUA 2QKCA 2R9RB 3HNIA 2E5LB 3NMKA 1VQPV 4HE8D 5TJ5E 2OJQA 5EGYA 1NR7A 3JASA 5C8YA 3E8BA 2QA4V 3ZMZA 2ZXOA 3B0VC 4PA7A 4UVCA 4Z2WA 3ZCCA 3LESA 5HFLA 4DV6O 2K9PA 2K1EA 2UUCO 3SEOA 2A9HA 3L72H 4RQEA 3JSLA 3CC7V 2YLDA 3R7CA 1BE3H 4O4LB 3WB1A 3Q7GA 1O87A 1ZW3A 4CIPA 1N33O 2QTSA 1QPUA 2YXLA 5J2TB 1YI2V 3CYOA 2J7PD 4FPPA 4DUZO 4PJ0Z 4JI1O 1HE9A 1M5IA 1OCRC 5E79Z 2ZXRA 1HMDA 5K1PA 3SYCA 1SQFA 5A9GA 2LQGA 2WVNA 3ZRVA 1G8XA 2IJKA 3RYFA 3RYHB 1ZU4A 2KW3C 4WCEV 4JCHA 1Q6IA 2Y4TA 1IXBA 1A7VA 4O2AA 5LYJB 3MHSC 4HYOA 1KB9F 3GORA 4DW0A 5HV9A 3EHBB 1YZAA 5JJEB 5LGTA 3HNLA 1BDJB 4JC7A 1RKEA 4MQ9F 3CE2A 4MW8A 4LFBO 1VLSA 4GKJB 4J41A 2ZE8A 5L0DA 4GUNA 3DSQA 4DUYO 1HW2A 4AL0A 1YIJV 2YI9A 1WP8A 4LACB 3L70H 1KNYA 5D91A 3KZIZ 1VMGA 3SPGA 1YYXA 3SXZA 2G62A 3M8AA 4LC1A 3I55V 2QM8A 1UPGA 2B0JA 5CMUA 1TR2A 2LGWA 2P4KA 3G67A 3B29A 3N24A 2WLIA 2Q7EA 3GWKC 2LP7A 2CTRA 5JH7A 3JYYA 2YXHA 2UXCB 3N0TA 3T6JA 3G80A 2ZQMA 4FM0A 2R25A 3KYIA 2WLKA 3JTLO 4WBNA 4X64O 4Z9HA 1Z2GA 4CH4A 3BRJA 3RW0A 2Y48A 3QVNA 2PP4A 2UUBB 1NLXA 1FXKB 1PNMA 1SQQH 1C03A 1R3LC 2DYSC 2I15A 4JYBA 5EC2C 4PDVA 3FHDA 3K5MA 3IQTA 1FPOA 2CAZC 3AG1C 1GN4A 2GDSA 3RN4A 1SF9A 1AEPA 4QGPA 5KHGA 2I8BA 5L0CA 2XXAA 1WATA 1OJHA 1K7DA 2E76B 4LNUB 1MZEA 1T5EA 4JYCA 3S9OA 5D5QA 5A6BD 1TWCA 2R7UA 2B5UA 2RMKB 5LMNO 2VASA 2P90A 3I4UA 1NFNA 2AHZA 4CS2A 1MA1A 4RAIA 4CBEA 1H2SB 2M7WA 5JVDB 2PY5A 1S05A 1AR1B 3K57A 4LFCB 3HKCA 2QWOB 4JZGA 2IH3C 3OMIB 4CC5A 2EJ7A 4CH3A 2QWRB 2NPUA 4EB6B 4IHJB 2UUAO 1VF6C 2AZ2A 2XM4A 1KP3A 5CA0B 3N2GA 1H2KA 1BR4A 4B3SB 2NLJC 4UFZA 3X2QC 1H2MA 3UQ8A 4JI4B 1OV9A 3H1IH 3AG3B 4O7GA 5L0IA 3E83A 3RQEA 5CIVA 2FMLA 5FZTA 2Q0AA 3JATB 5H2FZ 1KYOF 2EZOA 4J7JA 2IXPA 1ZU5A 4A2NB 1JVMA 5KAIZ 4C7UA 1QLEC 3AQCA 4FLVA 3O9OA 1W2WA 1F51A 4XQ1A 2OEVA 4JE9A 1IBLO 3GWNA 1OCZC 2ETNA 3CRRA 2WZGA 3D36C 3K5OA 4KNWA 4XPXA 2VC9A 5JH7B 1U97A 3HJCA 4FFKA 4BWAA 3F7VC 2IBFA 3TXSA 1FFTC 1QQCA 2E75B 1TKNA 2HKOA 5DS4A 4H44B 1GK9A 4MT8A 3FB5C 4DRJB 2HMZA 1TUBB 4GYTA 3PMRA 4HAMA 1O5HA 3EGDA 3OGIB 1RKCA 2WLMA 3AOUA 4EBKA 4B3TB 1MSWD 2ZXWC 3Q7LA 1MG1A 4X62B 2PI4A 3K04A 3ITFA 4R50A 4XPWA 1GN6A 3RYIB 3SJQC 4U5CE 2P6JA 5CBHA 1THZA 1CGME 1ZYRF 1AR5A 2A3QA 1BHAA 2Q3TA 4JKVA 4JGSA 3OGCC 3STZC 5KAFZ 4B7EA 1XDCA 4X1IA 2WAMA 1NU7D 1T01A 3SXMA 1RSOB 5COMA 5A69A 2HFEC 5BMVA 3APOA 3BABA 1OZ0A 5LP6C 1SA0B 3S27A 3K7DA 2P1AA 3C18A 4KL1A 4MTFA 3O39A 4PA9A 1VEWA 4JI7B 2B1GA 2R7XA 1BCCH 2PTMA 1TWAA 3IFXA 5LP6B 1YTFB 5E3AA 1FNTc 1MNGA 2YEVB 3A8TA 1N1CA 4WABA 1K9MW 4XPYA 1BMFG 2XHBA 2J46A 5LGNA 4U3JA 4DV4O 2YHSA 4YT5A 5L0HA 4X1KA 4AQYB 1Q5OA 2ODMA 3CB2A 1XNRO 2CW0F 2J9WA 2A06H 4J7KA 2UUCB 3ZC4A 1M9NA 4WF9V 1H8EG 2L35A 3ZN0A 1TVKA 2WPDG 1LUVA 3MAQA 4DR6B 3FAJA 3UGPA 1AJPA 5DS6A 5BR8O 4FLYA 4CS8C 3ABUA 3JASB 2Y3BA 4UV8A 1ZSPA 4LFAO 4X1YA 2EJRA 5KYYB 1I08A 5F5HA 3ZJZA 3RBZA 4X62O 2CYDA 3EJNA 4PK4A 2ATKC 1Q8IA 3E22B 1Q7YW 2ETSA 2GA0A 2Q4FA 3T6BA 4YJ2B 3NG1A 2JGUA 5KHKA 1HW1A 3FYEB 3EG9B 1M6TA 2NUTB 3T9OA 2EILB 2PYJA 4FWVA 1RSOA 2BSKB 4ZIBA 3AG2B 3ZMSA 3ZTZA 5BR8B 1M4UA 3IQCA 1KP2A 1PNLA 1L3PA 4EHPA 4JYAO 3K79A 1LVKA 2E3CA 4JCZA 4AHCA 4YL0A 4JI8B 1BR1A 2N74A 2OT5A 2UXBO 3MX3A 3K1IA 4PFPA 4KNVA 4LF5O 4K0KO 4W4LA 1D5AA 3E22A 1W0KG 3X2QB 1B68A 1RXQA 4QPKA 4I3MA 4UCSA 3VQVA 2X6CA 3EFOB 2H7BA 2EIMB 1MOFA 3N2GB 4KP4A 5LMUO 1NU9C 3CCSV 3TD7A 2QGNA 2LW7A 1AUEA 3TETA 3CRQA 4CS4A 3CS5A 3ZIBA 2XLEA 2XLVA 1SA0A 2OIEA 3FOOA 2P6VA 3OTFA 4IB4A 1W2BU 4OIQF 1P4RA 2RCVA 4FVMA 2F93B 3BCCH 5H6QA 2EBOA 4GKKB 3S90A 2XM0A 2NUPB 3VQYA 1OCCC 3K66A 3W2WA 1Q3EA 2AP3A 4DV3B 5EIBD 4KXRA 1S5HC 1WA8B 3IC9A 3AG7A 1ZWIC 3ECSA 3FB6C 2JRIA 2MYSA 3L8JA 1BS3A 2ZIOA 2GBOA 1N34O 4ASUG 3K5NA 5DS5A 2PI5A 1GN3A 1L0NH 1TUBA 2C2AA 3CSKA 1E79G 1NVPB 1R4TA 3NMJA 4CS3A 2LW1A 1C17M 1Z5ZA 1L8DA 4DR5O 4NXNB 3MYIA 2OEXA 3SXKA 1HE1A 1NS1A 3SGIA 3GM2A 5J9PC 2J9BA 1N36B 4KHPB 1LKXA 3U8PA 2EZPA 2QEXV 4X89A 1G4US 4IGGA 4EBBA 1YARO 2UXDB 3DE9A 4Q5SF 2IJJA 1R6KA 3ABMC 1M2VB 1FXVA 3JSZA 5DVWA 3RKOF 2R7OA 3DXRB 4H33A 2AGAA 4RWUA 2ARHA 1L1FA 4EBJA 5IYBO 2O9XA 2EILC 4DR4O 3L0IA 1VIBA 4QDLA 3P32A 3GB7C 1PD1A 4GEHA 2YL0A 1UFBA 3RYLA 4K0KB 5EZYA 2FAPB 2YVKA 1WOLA 1PD3A 4DXWA 2IXOA 2OU6A 4Q4ZF 4XLPF 3WG7B 1N33B 2ILMA 4XDJA 2EIJC 1KKDA 2PYLA 1XILA 2EPLX 5KLVH 3IAYA 4DV6B 3UCSC 4U5EE 3G4SV 2BSKA 2Q68A 4I50B 2YUAA 4CC6A 4C7OA 2VRZA 4OPHA 4PDRA 4WGZA 3QNEA 2OKUA 4X20A 1E83A 5GTIZ 1I7FA 1PCXA 4AE4A 4UB8Z 3IPMO 4JYYA 3EG9A 4ZKIA 4CH5A 3I56V 5AC4A 3T1YB 4GKKO 4H0LB 3JZ0A 4TV8A 1YZCA 2RJZA 3FD9A 5HFMA 3CC4V 4JTDB 2A68F 3K5LA 5D92A 1CPRA 2EIMC 4PA3A 4YY3O 3K3WA 4W8PA 1OCRB 2VWJA 1ZTEA 4F4BA 1P49A 2HMQA 2RSEB 3EZIA 2YQYA 2Q73A 1I94O 5CBFA 3PJSK 4JI0B 1VK5A 2F23A 4OIPF 3ZMUA 1HDJA 1E85A 1YJ9V 1NBMG 1JA8A 2WZFA 5JCOA 4ULWA 1VQ9V 2G38A 2KKWA 3LSSA 256BA 4L8JA 1LM3B 5DEDA 4J42A 4JI2O 3L74H 4J32B 5LBQA 3L75H 3CPWU 1WGWA 1BL8A 3DXJF 1NTZH 4LF8B 4O4LA 1M90W 3UM7A 4J30B 1HMOA 4DV5O 4PJMA 4LF4B 3HKCB 4JYAB 3RQFA 5KYXB 2XUMA 3TJ5A 3CRCA 1A0BA 3U2MA 3AG4B 4O4IB 1R5ID 3NKEA 3UMKA 2YS8A 1LNQA 3JAMN 4PJNA 2Q6AA 3Q6MA 1T5OA 4OGQB 1G4YB 1YDXA 1F4MA 1GN2A 5BQGA 4JZ2A 2H8AA 5A6BA 2YXYA 1AJQA 4NTXA 2E5LO 2ZPAA 3T4RA 1JOGA 4FESA 1I5XA 3OE7G 3S3XA 1YA9A 1COWG 3G71V 2AZ0A 2XLOA 2Y39A 4CDAA 1GM8A 1IXMA 5GPGB 4DR3O 3CCVV 5A2QN 1XI1A 4YL3A 1K8AW 1D0YA 1WB8A 2ZDIC 3OUSA 3HNKA 1FFXB 1O9HA 2D2CB 4FM2A 5CN0A 4UDVA 2NUTA 5EBLC 4WBNB 4CBCA 2BC5A 1AVMA 2YLIA 3CX5F 2Y3HA 1Y6XA 3NXSA 4H13B 5KMGA 3SXYA 1IBLB 1ZHYA 4FLWA 2WLIB 4LH7A 2UXNA 1FXHA 1XMOB 2JX0A 3ZHTA 4UCRA 4IYHA 3OW2U 3MYFA 3SYOA 3G4XA 1YXBA 4X1YB 4EFBA 4UV9A 4IIJA 1P7GA 3ETGA 4G7ZF 1Y4CA 3FYIB 4TV9B 2QWQB 3CQZA 2RD9A 1EN4A 3LLKA 1LPEA 1HNWO 2WLLB 1JR9A 3GWOA 3QG5A 3CJHB 3ETQA 1YCIA 5KYWB 4OIOF 4FLTA 1EZVH 1M56B 4QPJA 1ZZPA 2O57A 1WTYA 1NKDA 3OMAB 5CA3A 4IHJA 2XRHA 2C03A 3A11A 4O79A 5LYJA 4O2AB 2H94A 5E1AC 1F1MA 4YJWA 2EULA 2V1DA 4B3MB 2KQXA 4CX9A 4N6CA 3JD4A 4AQYO 4RQFA 1TWHA 4E17A 3EQLF 3U0ZA 5C93A 1FJGB 4JF3A 4U7OA 4X8AA 4ZHQA 1XMQB 1H2NA 3W7SA 1O3UA 3OA1A 5IWAB 1K05A 5IJ0A 2WVQA 1AI7A 2YICA 4J11A 3M15A 1JPJA 3DAFA 2N05A 4MTOA 3ZHVA 1FMWA 2DQ0A 2KK1A 2B1IA 4DR2B 3DZAA 3OWTA 2LFRA 4N06A 4MVSA 5B3IA 4B7KA 2P22C 4MW3A 1MMDA 4UVBA 4ER9A 4Q6GA 3ETEA 1OW8A 3JRMO 1ROPA 4LWSB 2VB6A 2HEPA 3KCYA 3RGBA 3H1KH 4YJ3A 2Q00A 4BEJA 1E86A 1MMMA 2R05A 1V54B 4GCZA 2WLHA 1HY5A 4IIJB 4R8CA 2LO1A 4H54A 3BAAA 2EINC 1CEZA 1RP3B 3VQXA 1J5EB 4TUYB 3V7OA 4E4EA 3EFFK 4E0HA 4OX9B 4JAUA 3JAWB 2WLNA 4XEVA 5KA6A 5A6KA 1MMGA 1T9KA 1KBHA 1YSCA 5B1AC 3SDLA 3KL4A 1R6TA 4NTFA 4DVYP 4O2BA 3E86A 1NR1A 3A0HZ 4DUYB 3NMIA 1GO3F 5B1BB 3ZN1A 3AG1B 4B3MO 4P9FA 3US6A 3JD3A 3T1CA 4YJ2A 1B06A 1XL4A 3RF3A 1IW7F 3FB8C 1OQCA 4WFHA 4U9DA 4ULVA 1E1QG 2OYQA 4PD4F 3RYFB 2CGOA 3HKBA 3EHNA 1VQ8V 4G7HF 2P4VA 4PI0A 1VQ7V 2XTAA 4LP8A 1HR0O 3G50A 1QNMA 3ZX6A 4NC3A 1K33A 2V4DA 3CC2V 1XHXA 4LDKA 4NXMO 2IOQA 3NR7A 1M93A 5DQTA 3O6XA 1NFOA 1WA8A 2QTVA 2EIKC 3C3SA 4E7SA 1DF5A 5IY5B 5FLXN 1OR3A 2NSFA 3HTKC 3TJ6A 2ZNJA 1PL0A 4DRXA 4JV5B 4JJFA 2VQEB 4X0RA 1Q90D 2KJGA 3C8GB 4C3BA 1XHZA 3W2VA 5GONA 4I44A 1DK1A 1ENVA 1FR0A 1VQ6V 4DK1A 3JAWA 4W8KA 2KGOA 4WFBV 3FKSG 3OR7C 1VOMA 1YEWA 2A0LA 1SQPH 5EZYB 3HKKA 5A6AA 4CSAC 4BW9A 3GEHA 3VBBA 3AJMA 3LJBA 4TOIA 3OT7A 4JRZA 2LJ2A 4DV4B 3N2KA 5K1XA 4GKJO 1WLEA 3ZRSA 1V55B 2WL8A 4KBLA 2UUBO 5IDJA 4MSWC 3FB7C 1HWYA 4GLXA 1APCA 1Q0GA 2L6GA 3FVYA 2H3OA 2PX0A 3QVYA 4HZ3A 3A9CA 4N4WA 5BUOA 1JOYA 4N6HA 4TSFG 1M2VA 3FDQA 2IM9A 3FAPB 2DE0X 2OTJV 1ZL8B 4BJ6A 3RYIA 4DR4B 2F22A 4OPAA 3UGOA 3H1JH 3B8MA 1L0LH 2HVJC 3CD6V 2E74B 4B3SO 4P9TA 4UCUA 2QTOA 2JK5C 4GZRB 4IRUA 1B6QA 1MABG 3DE8A 4JI3B 3ABLB 2JJ2G 2M64A 5LHGA 1N32O 4XBFA 4FLZA 2PF4E 1QZXA 1R3JC 1CXZB 2WB7A 4F6EA 3KG2A 1Y74B 3W4YA 2ITDC 4NQFA 3U10A 1XBLA 2ZM6B 1G4WR 2IYLD 2OG2A 4YHHO 4G78A 4LFCO 4CS7A 3HKEA 2GDCA 1Z5WA 3IEEA 1ZUQA 2IBZH 3SNHA 2UU9O 1BZKA 3M7MX 4DRIB 2HV7A 2ZXPA 1QVFU 4PFOA 3WB0A 1QU7A 4JJGA 3HKDA 3SPCA 2CH7B 3LEVA 2DN9A 1ZVZA 1H6GA 4PJLA 5CB4A 3AK3A 3SJBC 2CGEA 1Q6UA 3E2EA 5ITZB 2FYUH 4OX9O 4JV5O 2Q7HA 4HEAJ 2GHYA 3H01A 4FLUA 2Z0AA 1N34B 4I55B 4QI2A 1I5NA 2Q0OC 1Q6HA 3A0BZ 2R7RA 3M79A 3NYMA 3TOLA 2NUPA 4BJ5C 2DWDC 5CA0A 2KQ9A 1M56C 4DK0A 4FZ1A 3JARB 3ZMVA 3D3IA 1WAZA 5A6JA 2J0XA 2XAFA 4JPRA 3FAVA 4IL6Z 3UNGC 3WHNA 4X9QA 3DGEA 2GWWA 4W4KA 3E70C 3E8HA 4ZLCA 1FD9A 4WFEA 5LA6B 3GM1A 5JVEA 3F5WC 1SKVA 4X65O 2UUIA 2HR3A 3OUFA 4JI6B 3ASOC 4JEAA 3GWLA 2ZT9B 1LS4A 1TAEA 2GUZB 1BT8A 3SYAA 4U5DE 2KG7B 1NBBA 2A6EF 4LH6A 4X66B 1LE2A 2EPOA 2CE4A 4AI8A 2YIAA 1Y4MA 3CAXA 1GS9A 3B2EE 1QQ3A 4X20B 2CTWA 3TXQA 2WLLA 3W8IA 2GTSA 5EC1C 4DOZA 4WFGA 5LXTB 2XL6A 4XDKA 4YL1A 1JR8A 4RUEA 1VLTA 3NDBB 2C04A 2BOBC 2UXBB 4CS8A 1QR9A 1WP7A 2WSSG 4CS9C 4FX5A 1PNKA 4MVZA 4DJ9A 2P06A 5KHJA 1TFKB 3T1HO 4O6NA 2A6HF 4F6RA 4O6MA 1IZ3A 3ZS8C 2DJVA 3AEIA 4DV0B 1N8RW 3RIPA 3W7WA 3AGUA 3SPIA 3M99B 4XEFA 3ZVRA 1E2XA 3IJ4A 3CRMA 3JD1A 1DLBA 2NR5A 1NTMH 3DJNB 5CA1A 1A7EA 4PR9A 1H2GA 1ZHXA 1EQ1A 4R6ZA 4YT4A 2DI3A 2GAQA 3I5PA 5E33A 1IBMO 2GFHA 3NKDA 4BJ6C 3VM6A 1AI5A 4DV1O 5BY1A 5H6RA 4D7TA 1H38A 3TOMA 1ZHZA 2AU5A 3K0GA 1K40A 2WWWA 4EWCA 4E2LA 1PL4A 2YC0A 2J0WA 5JT4A 1C02A 1WPBA 3RVYA 4U3JB 1YHQV 1IX9A 3E9VA 2P7VA 3KMIA 5JSLA 2VCAA 2CCYA 1YDIA 3RQGA 3P30A 4EUKB 1RJ9B 1K3EA 4LF7B 4AL1A 1OCOB 2L6HA 3FMSA 3M4CA 1YVIA 4I55A 5L3BA 3R66A 3C63A 1G8MA 4RO2A 1RPRA 4I0XB 4XTKA 4AX2A 1DOVA 5JQGA 5IYCO 1XNQO 3RVZA 3ZHRA 3QTCA 2D5RB 1S7ZA 4MVUA 3L8IA 4CDYA 1OCZB 5KYYA 5C8YB 3JYCA 2WZLA 1NQTA 2QKSA 3DXRA 1QLEB 2J9VA 4OD5A 5KA5A 1N0NA 3BFRA 2G3VA 1FKAO 3CXHF 1YTFD 3OTOO 1K4CC 5LL6Y 3OR6C 3BPZA 4PDMA 4ZBMA 1PD0A 1MZFA 2HZ8A 1J8YF 3DMDA 4X64B 2XNDG 5DLJA 5EBWC 4IYIA 4PA4A 4U5BE 3JCZA 1TQGA 1V9PA 1ORJA 1TUEB 2HHHO 1KTMA 3LEOA 2QSAA 2GSMB 1ORSC 3W7UA 3LS1A 1W59A 2GTAA 3A0RA 3HKDB 3TK0A 2DYRB 1RFYA 2RN9A 2OTLV 1FMVA 3T1HB 1V55C 3IQ5A 1BR2A 3JD0A 1A32A 5BZBA 3B9QA 3POVA 1VF6A 3KCXA 5T3TA 5B66Z 1S5LZ 1F7YA 5JCOC 2HP8A 2QM4A 5IWAO 2ICWG 3WODF 3LDCA 1R1BA 5H5NA 5JP7A 4BJTA 3ASNC 3QF7A 3KYJA 1GAXA 4D4NA 2Q67A 3JSEO 3J80N 1RJ9A 1SYQA 1LIHA 4P9PA 4G27B 4JASA 1TVKB 2ITCC 2WA3A 3JSNA 3S84A 1WASA 3CEIA 2ZXWB 4D6TH 2WVOA 3OEOA 1LI5A 4JTAB 1RCPA 3CCLV 1NTKH 4TQDA 3K1IC 1H8HG 2UXCO 4J7YA 4JIOA 3UMHA 1URFA 4CSAA 1FFTB 5COFA 1YAUO 1HP8A 3VF0A 3MBGA 3JCUZ 4PACA 3CCQV 2FFHA 3C7JA 4LR3A 3V5YA 3JAKB 3CRAA 1JPXA 2Y3GA 1WN7A 3OMNB 4DUZB 1NI8A 4MVQA 1D1BA 1Q0KA 4ABMA 4OINF 1SZTA 3ABMB 2HKVA 3BRCA 2QE7G 2XT9A 4U5FE 5CI9A 5FPOA 2P5OA 5KYUA 3U11A 4ANJA 4X65B 4FJCC 5AC5A 2W45A 3K6BA 2OWOA 3SPJA 1K5QA 1GM5A 4LDQA 2JIZG 3ZDLA 1FXKA 4O4HA 3AG2C 2PX3A 2Q7RA 5ITZA 2OCHA 2CDYA 4HNAB 3RFYA 1YJGA 2KC3A 3M4BA 5LHHA 1CPYA 3ABKC 4RD9A 3WU2Z 1OHHG 3D3QA 2NSGA 2TMVP 1U89A 2Y3DA 4WGYA 4G7OF 5LHIA 5JJJB 5CA1B 3GANA 3ABKB 3HKEB 4O4JB 2QUPA 4IARA 3VRCA 1R3IC 3J7AU 3RWRD 4KI2A 1NU1H 4I5SA 4DR5B 1CPQA 1Q0DA 3EGXA 3SYQA 3SYNA 2L6LA 4H4KC 3FAVB 2Z15A 3L1MA 3BEHA 4DRXB 2PFDA 5JWPA 3E8FA 3EVKA 3I5DA 2BE5F 1LI7A 3CZ6A 1PKXA 4E7ZA 4BIOA 1WWPA 1NSGB 4JTCB 4Z1MG 1HNXB 4A5UB 1I4YA 4WFAV 4BJ1A 3U8VA 1DTOA 4UB6Z 2PZSA 1Q0FA 2YZSA 1FJGO 3BHPA 4L6RA 3APQA 4RUFA 4N21A 2R9IA 2ZM6O 2XLHA 3J81N 3KPHA 2ZE5A 5LGUA 2FGYA 5KYNA 3P3NA 2A1DD 4NR1A 2F66C 4LF9O 5B5EZ 4LF6B 3AK2A 3WFVA 4U9EA 3ZQVA 2A7WA 4PV1B 5IJ9B 1SERA 3SR2C 2M6YA 3RYHA 3CHXA 4D4XA 5JVDA 4LF6O 1SQGA 5IYZA 2F4VO 1BQ0A 2XAGA 4XDLA 4G2KA 3HPLC 5LOVA 1HNWB 1H2LA 3LNNA 2J8WA 4PHZA 5FCLA 3DTUB 3QVZA 4G0HA 3O65A 1OCCB 3C90A 4NXMB 1Q81W 1YVWA 2OJED 3B40A 2YWAA 3DM5A 5T3WA 1R73A 5KYWA 5J2TA 4CIHA 1B3QA 1TGOA 2NN4A 4LFAB 1CGNA 3CCUV 3EGXB 2L9JA 3DM9B 3JALB 4ZOLA 1OKKA 2VWKA 5IE9A 1T6QA 5B3SB 1IBKO 5JUAA 2HLDG 1AB3A 5J2UB 3NYJA 2IU0A 2HHHB 1FFHA 4PA6A 1R3KC 2YSUB 1J8MF 1NZEA 2R02A 2YIBD 4BIZA 3K06A 3H2UA 1Z5VA 3H65A 3K9SA 3ZEDA 4BW5A 3PN1A 1Z7Qc 4OD4A 3N27A 3FFQA 4DR3B 4K1OA 2XAHA 2IXNA 4QNHB 4K0DA 4LCUC 3O10A 4E18A 2VCBA 4UCOA 4DR2O 2Q69A 4GT1A 2W9YA 4MVMA 3GEIA 2XLWA 2QDOA 4UXNA 4MTXA 1O9GA 4YT2A 4AK9A 4TT3G 4K35A 1KKCA 1OXBA 4C7OB 4X88A 5AG2A 4I4TA 3KKYA 4MS2A 2L81A 3C3TA 1LS1A 1I0HA 4CH6A 2LSEA 2P61A 1WN0A 5LOVB 1KU2A 4LF4O 2QWNB 4DV7O 2VS0A 2DOSA 1MMNA 1HNXO 3B0UX 2W0FC 1FAPB 2M4EA 1W0JG 1XOUA 3DD7A 1YZBA 2CDQA 2CK3G 4JI5O 5IJ9A 4YJ3B 2ZKOA 1Z3IX 1Y67A 4GX2A 3AGTA 3Q4HB 5J2UA 1AJNA 4E0IA 1FFXA 4IAOA 2F1MA 3JARA 1M57C 2W0XA 4JAVA 5H9CA 1Y76A 1ZLZA 1GMGA 2N04A 1D1CA 2HSBA 2BOCC 2QE9A 4YY3B 1YJWV 3QMKA 1GQAA 3CWBH 3AG3C 1ST6A 4EB6A 1FXKC 2QWPB 2LK4A 3L34A 4JW1A 2DGJA 2Q9CA 3WB2A
chains in the Genus database with same CATH topology
1KQSU 3CCSV 2HV7A 2ZXPA 3T4DA 4XLNF 1QVFU 3TD7A 4PFOA 5EHHA 5DQZA 4JJGA 2R7VA 5CBGA 1D0XA 3SPCA 3LEVA 4F4LA 2CNWA 5KYXA 3TETA 3S0XA 5B1NA 1VQ5V 4ZLDA 1QVGU 4HFFB 1K73W 4PJLA 1D1AA 3ZIBA 3E89A 2J7PA 2CGEA 3E2EA 4LLCA 2XL4A 4HEAJ 2P6VA 4DVZA 2W6JG 4JURI 3STLC 1VQOV 4FK5C 2GHYA 3H01A 1W2BU 3EPVA 4RDAA 4FIPC 1S3JA 3K03A 2J45A 4C3EA 5DVWA 4QI2A 4OIQF 1P4RA 3W7TA 3E35A 2R7RA 2ZR2A 3ZSUA 5H6QA 2EBOA 3W7XA 3NYMA 2NUPA 2NUPB 4UUJC 1NH2B 4BJ5C 5EK0A 4DBRA 1OCCC 2DWDC 1S76D 3G6EV 3K66A 4KUMA 1VYIA 3W2WA 2KQ9A 5L3QA 1Z63A 1M56C 3VYWA 4NY3A 5E2QA 3R65A 3CCRV 1S5HC 3D3IA 3ZMVA 1SF8A 1R6NA 4CS9C 4BIUA 4BJ5A 2ZR3A 1VQNV 1EBOA 4CZZA 3X1OA 5L3CA 1ZWIC 2IU3A 3ECSA 3FB6C 4H37A 2J0XA 2MYSA 1AI4A 2XAFA 3K08A 4FMTA 4JPRA 2R7TA 3UNGC 4PELA 3K33A 2G3KA 3DGEA 2W4MA 4ASUG 1QBZA 3E70C 4HFKB 3E8HA 1Q86W 5DS5A 4ZLCA 2PI5A 4WFEA 3EGDB 2Y69C 3D36A 3F5WC 2C2AA 3CSKA 2HR3A 3LDEA 3BY6A 3OUFA 1E79G 4P6IC 3TCUA 1NVPB 1BHBA 1V54C 3ASOC 1Z5ZA 2XXAB 3S29A 3CCEV 3SYAA 4U5DE 3K1HA 3OEEG 3RH3A 1ZHWA 2A6EF 4K7BA 2IJIA 5J9PC 3QO5A 3LAYA 1Y4MA 1K4DC 1LKXA 3CP1A 2F43G 5GW7A 4WFFA 2EZPA 2WLLA 3SZRA 3W8IA 4MVRA 5EC1C 4MTGA 4DOZA 4WFGA 4X89A 2QEXV 3NRHA 3Q6NA 4OIRF 5KYUB 4GX0A 4P2ZA 4P30A 4XDKA 4RUEA 2MK3A 1NJIW 2W4BA 4QE9A 3M1CB 2C04A 1GKFA 1P7BA 4EBBA 2J9UA 2BOBC 1EFRG 1KC8W 4P9OA 4CS8A 2JJ1G 2IJJA 1R6KA 3ABMC 1QR9A 1FXVA 2Z5UA 2WSSG 3ZRWB 1M2VB 1PNKA 1JQ0A 4H33A 1ZHTA 4MVZA 2CNWD 2R7OA 3IGAC 4FX5A 1NVPD 4O6NA 5F5FA 1QCEA 1CP9A 2A79B 1L1FA 2A6HF 2X51A 3QO8A 1TWGA 4OXSA 3CXCU 5IYBO 2O9XA 1M57B 2EILC 2DWEC 1Y66A 3AEIA 4GX5A 3L0IA 4O6MA 4U5HA 3LNRA 2OCCB 3EH1A 4U5GA 1N8RW 2R7WA 3QZCA 1AROP 4QDLA 3RIPA 3P32A 3GB7C 3SPIA 4QJFB 3M99B 3W7WA 1PD1A 2W6IG 3MHHC 3JCUQ 4GEHA 3JD1A 4YN0B 3ZVRA 2NNUA 2Y69B 5DN6G 1DLBA 3DJNB 3I5QA 3RYLA 1K5SA 2MWQA 3SP1A 1VQKV 4I1OB 3ZRXA 1JCHA 3CMEV 3EZHA 1H2GA 1PD3A 4DXWA 2IXOA 4Q4ZF 1GM9A 2DQ3A 1ZHXA 4XLPF 3WG7B 2R7QA 3LLIA 4R6ZA 4XDJA 3ZC4A 2EIJC 3I5PA 4QI0A 5E33A 4YT4A 2GFHA 3NKDA 4BJ6C 1KKDA 1AI5A 3ABLC 5H6RA 1H38A 3ML0A 1ZHZA 3GODA 3K0GA 2WWWA 4EWCA 4E2LA 4U5EE 3G4SV 2J0WA 2Q68A 5L3GA 3RVYA 3B8NA 4G28B 1YHQV 3E9VA 4PDRA 5B1BC 1JJ2U 2H7OA 2P7VA 3KMIA 3QNEA 4MVOA 1Q82W 2JDIG 1MMAA 2DYSB 2XASA 3P30A 1RJ9B 1K3EA 3F47A 1OCOB 4MNDA 1FS0G 3W8HA 3RKOF 2EIJB 3N2ZB 1PCXA 2EIKB 2IXMA 5L3BA 4U7NA 4AE4A 1SETA 3ZMTA 4L87A 4ZKIA 1G8MA 1WPXA 4RO2A 2NG1A 1RPRA 3EG9A 4LBEC 3I56V 4XTKA 2JEUA 4AX2A 2R9RB 4HE8D 5IYCO 3ZIAG 1VQPV 2EINB 5EGYA 1NR7A 5E3CA 3RVZA 5HFMA 1KECA 3CC4V 2D5RB 3E8BA 4JTDB 2A68F 2FTKA 2QA4V 3MLGA 1S7ZA 5D92A 5T1DB 4MVUA 3ZMZA 2OCCC 2ZXOA 2EIMC 3B0VC 4PA3A 2P67A 3K3WA 1OCZB 1OCRB 4PA7A 3B77A 4UVCA 4F4BA 1DF4A 3JYCA 1KD1W 1Z23A 2WZLA 5KYYA 3ZCCA 1NQTA 2QKSA 3AQBA 5HFLA 3LESA 1QLEB 2J9VA 4Q7CA 3EZIA 2K1EA 4OD5A 3SYPA 5KA5A 2IW5A 5L3DA 5CBFA 2A9HA 1S77D 2G3VA 3PJSK 3SEOA 4RQEA 3CC7V 4BAYA 1VK5A 1VMAA 1YTFD 4OIPF 3ZMUA 3DAGA 1UJWB 1K4CC 3Q7GA 1YJ9V 1O87A 1NBMG 3OM3B 3OR6C 3OEHG 2WZFA 4ULWA 2ZD9A 4PDMA 1VQ9V 5IY5C 4ZBMA 3LSSA 1YI2V 3CYOA 2J7PD 1J8YF 3NYLA 4FPPA 3DMDA 5LBQA 4J32B 2XNDG 3CPWU 5DLJA 1WGWA 1BL8A 5EBWC 3DXJF 3UMIA 1OCRC 1SRYA 1M90W 1RM1C 2ZXRA 4PA4A 3UM7A 4J30B 4LERA 3JCZA 4U5BE 4BG0A 3SYCA 1TUEB 4PJMA 2GSMB 4C7OA 3W7UA 3LS1A 1J95A 3A0RA 2WVNA 4Q5SF 3ZRVA 3DJUB 5KYXB 1IZMA 2DYRB 1G8XA 2OTLV 1FMVA 3JT1A 1V55C 3AG4B 3F7YC 1BR2A 3JD0A 2IJKA 2QM7A 1SZIA 3E8GA 5BZBA 1ZU4A 3NKEA 3UMKA 2KW3C 4Q20A 4WCEV 3B9QA 1LNQA 4JCHA 3T4ZA 4PJNA 3POVA 2Q6AA 3Q6MA 1YJNV 4PDLA 1OCOC 5T3TA 3TK1A 1G4YB 1F4MA 1S72V 3MHSC 4HYOA 5DM6V 3WODF 1AJQA 3LDCA 4YWQA 2ZPAA 3EHBB 4BJTA 3T4RA 5LGTA 3ASNC 3UKMA 2D3OW 4FESA 1I5XA 3OE7G 4MQ9F 4JVSA 4MW8A 1COWG 2Q67A 3G71V 2Y39A 1OKKD 1GM8A 1RJ9A 4YT8A 4KC9A 1IXMA 2P7TC 1YIJV 4P9PA 3CCVV 4G27B 4JASA 4O6YA 2ITCC 4LACB 1VQ4V 2ZXWB 2WVOA 3OEOA 5D91A 1K8AW 1D0YA 4I1MA 2ZDIC 3SPGA 3JD2A 2Q9AA 1JX9A 4JTAB 1SMYF 3OUSA 4LC1A 1K34A 2QM8A 3I55V 3CCLV 2G62A 4WJ0A 2B0JA 3K1IC 1H8HG 5CMUA 5CN0A 2ZDIA 3S28A 1TR2A 2NUTA 3MD0A 3UMHA 5EBLC 3N24A 2WLIA 4CBCA 4CSAA 1FFTB 1YITV 1QR8A 2LP7A 3OAAG 2Y3HA 3NXSA 2LFSA 4R7CA 3N0TA 3T6JA 2R7SA 3CCQV 2ZQMA 2FFHA 1ZHYA 1JPXA 2WLKA 2Y3GA 2QY9A 2WLIB 3OMNB 2UXNA 1FXHA 3OW2U 4RBNA 4MVQA 5B3SC 3SYOA 1NH2D 3RW0A 4PJJA 3NDBB 1E1RG 4UV9A 2Y48A 1D1BA 3VAYA 2PP4A 3ETGA 3JSZA 3LDDA 4OINF 4XWJA 1SZTA 1FXKB 4G7ZF 3ABMB 1PNMA 2QE7G 3FYIB 4U5FE 5EBMC 3SPHA 1R3LC 2DYSC 4AE4B 5CI9A 3CQZA 5KYUA 4JYBA 5EC2C 3LLKA 4PDVA 3FHDA 4ANJA 2UXXA 1K92A 2WLLB 4FJCC 3GWOA 2W45A 3K6BA 4DBQA 3SPJA 1NU9C 1K5QA 5KYWB 3KKBA 3AG1C 4OIOF 1M56B 4QPJA 2JIZG 1FXKA 2I8BA 3AG2C 1NKDA 3OMAB 2PX3A 5CA3A 2XRHA 2C03A 2XXAA 4EKWA 5B1OA 1Z6AA 1M1KW 3RFYA 4O79A 3LNMB 1K7DA 5LHHA 4JYCA 2H94A 5E1AC 2E87A 1TWCA 2XSEA 1CPYA 2B5UA 3ABKC 2V1DA 4RD9A 4YJWA 2V3CC 2R7UA 4IWBA 1OHHG 2VASA 2P90A 3JD4A 3I4UA 2AHZA 4RAIA 4RQFA 1VQLV 1TWHA 2Y3DA 4CBEA 2M7WA 3EQLF 3LSQA 5C93A 4JF3A 4G7OF 1AR1B 5LHIA 1K97A 1JPNA 4U7OA 3AG4C 4X8AA 1MNDA 3GANA 3ZG1A 1F4NA 2IH1C 3W7SA 3ABKB 2IH3C 3OA1A 3OMIB 1GTOA 1R3IC 1AI6A 2VH3A 4I5SA 3LUTB 4QE7A 2WVQA 1AI7A 3EGXA 4KI2A 3SYQA 1JPJA 3DAFA 3SYNA 4H4KC 1KP3A 4MTOA 2JEXA 1FMWA 1BR4A 2DQ0A 2NLJC 2Z15A 3X2QC 3BEHA 3IC7A 2PFDA 2B1IA 2XOKG 3OWTA 3DZAA 3AG3B 3E8FA 2X6AA 4O7GA 2LFRA 2BE5F 3E83A 3LS0A 2DW4A 4JZAA 4N06A 4MVSA 1MNEA 3CZ6A 3CCMV 1MMDA 4MW3A 4UVBA 1PKXA 4E7ZA 2EZOA 3ETEA 1ROPA 2VB6A 2IXPA 2YEVA 4JTCB 4Z1MG 1ZU5A 3JRTA 1JVMA 4A2NB 3VOUA 2HJFC 4WFAV 4BJ1A 4E7SA 2V26A 1DTOA 1QLEC 3AQCA 4BEJA 4J9YB 4UVAA 1W2WA 1F51A 2YZSA 4RUFA 4N21A 1OCZC 2R9IA 2WZGA 4KNWA 5LGUA 2FGYA 3ASOB 1V54B 2WLHA 4GCZA 3IEEA 5KYNA 3HJCA 2A1DD 5HSWA 3F7VC 3OFNG 4R8CA 4DO2A 2HV6A 2EINC 1CEZA 1FFTC 3WFVA 1TKNA 2HKOA 3V7OA 5DS4A 3PHF2 1GK9A 4MT8A 3EFFK 3FB5C 1SERA 4GYTA 3QO7A 1M2OA 4HAMA 3ABTA 4QIWF 4JAUA 1O5HA 3PMRA 2WLNA 3EGDA 5KA6A 1MMGA 2WLMA 2V7QG 3KL4A 1YSCA 5B1AC 1MSWD 4GX1A 1GM7A 2XAGA 4XDLA 1EZJA 2ZXWC 4G2KA 1MG1A 3E86A 3HPLC 3Q7LA 4DVYP 2H8PC 2PI4A 1NR1A 3K04A 3ITFA 1GO3F 4R50A 2X7RB 3JYHA 5B1BB 5FCLA 3DTUB 3F46A 3ZN1A 3SJQC 3AG1B 4CS9A 2HVKC 4U5CE 2P6JA 4G0HA 1OCCB 5CBHA 1THZA 3JD3A 1ZYRF 5KUMA 3T1CA 1Q81W 1BHAA 2Q3TA 5T3WA 3DM5A 4M63A 1R73A 1XL4A 3OGCC 4JGSA 3STZC 5KYWA 1IW7F 4CIHA 1NG1A 3FB8C 5B1AB 4WFHA 3CCUV 3EGXB 2WAMA 1E1QG 1NU7D 2L9JA 1S0VA 3DM9B 1RPOA 2A69F 3EHNA 2HFEC 1VQ8V 1VQ7V 4G7HF 1OKKA 4TWKA 5B3SB 4LP8A 3CMAV 2JD3A 2HLDG 1OZ0A 3S27A 5FL7G 3KH2A 3NYJA 2IU0A 1FFHA 3K7DA 4PA6A 1R3KC 2YSUB 1J8MF 4MTFA 1NZEA 3O39A 3K0DA 4PA9A 1K33A 3B0PA 4BIZA 3CC2V 3EH2A 1SESA 3K06A 3HLZA 2B1GA 2R7XA 2HG5C 1RM1B 3IFXA 1TWAA 4BW5A 2IOQA 3H65A 1YTFB 1XL6A 2WLJA 3K9AA 5E3AA 5DQTA 1N1CA 2YEVB 3O6XA 4OD4A 5L3VA 1K9MW 3EFOA 1BMFG 2J46A 5LGNA 2QTVA 2YHSA 2XAHA 2IXNA 2EIKC 4QNHB 4K0DA 4YT5A 1DF5A 4B6IA 5IY5B 4I9WA 1QLNA 2H7VC 4LCUC 2Q9BA 3HTKC 1VQMV 2CW0F 2J9WA 2Q69A 4GT1A 1PL0A 4N23A 3CCJV 1FTSA 1M9NA 4MVMA 2W9YA 4JJFA 4X0RA 4UXNA 4MTXA 4WF9V 1H8EG 2IJHA 4AK9A 4TT3G 4YT2A 2KJGA 3ZN0A 4C3BA 1F23A 3W2VA 2WPDG 5KUKA 4I44A 4C7OB 3FAJA 1ENVA 4X88A 3UGPA 4YXWG 1VQ6V 1AJPA 5DS6A 4W8KA 2KGOA 3ASNB 4MS2A 4WFBV 2L81A 3FKSG 1LS1A 4LLEA 3OR7C 4CS8C 2AHYA 1VOMA 2X0LA 3ABUA 2LSEA 3T2MA 2A0LA 5L3FA 4CSAC 3VBBA 2Y3BA 3LJBA 4UV8A 1KU2A 2EJRA 5KYYB 1MMNA 5F5HA 3ZJZA 2W0FC 3B0UX 1WLEA 3RBZA 1V55B 3ZRSA 2M4EA 1ORQC 1W0JG 2WL8A 3DD7A 4KBLA 5IDJA 4MSWC 1I5YA 3FB7C 2DYRC 3EJNA 2CDQA 2CK3G 4PK4A 2ATKC 1HWYA 1Z3IX 4GX2A 1Q7YW 3T6BA 3FVYA 4C3DA 5BUOA 2PX0A 4HZ3A 3NG1A 1AJNA 1JOYA 2Z3YA 4TSFG 3FYEB 4IAOA 1M2VA 3EG9B 3FDQA 2NUTB 1M57C 2EILB 2OTJV 4FWVA 4BJ6A 1D0ZA 5IYDO 5CI8A 3AG2B 4JAVA 3ZMSA 2KB1A 4KFMA 3B8MA 2HVJC 5H9CA 1KP2A 1PNLA 2XAJA 2XAQA 4IJJA 3UGOA 3CD6V 3K79A 1GMGA 1LVKA 1D1CA 2QTOA 2JK5C 2X6BA 3HB3B 5L3EA 1B6QA 1MABG 1VYKA 3EHMA 2BOCC 4IRUA 3ABLB 3ZRWA 2JJ2G 2WB7A 5LHGA 1YJWV 4J9ZB 4XBFA 1BR1A 2OT5A 1R3JC 1QZXA 2PF4E 3MX3A 4PFPA 3QMKA 3KG2A 3WG7C 4KNVA 2ITDC 3UR3C 3AG3C 1ST6A 3ETDA 1FXKC 2KNHA 2IYLD 2OG2A 1W0KG 3X2QB 4CS7A 3L34A 4JW1A 4QPKA 4I3MA 2DGJA 2Q9CA 2X6CA 3EFOB 2H7BA 2EIMB 1PD0A 1MOFA 3SNHA 4KP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R7C A;  3SJQ C;  3T4D A;  2Q68 A;  2HVK C;  3RVY A;  5CBG A;  3SPC A;  5CBH A;  2WLK A;  4G28 B;  4F4L A;  3TET A;  5KUM A;  2WLI B;  4PDR A;  5B1B C;  3T1C A;  4MVO A;  1XL4 A;  4MVQ A;  3OGC C;  3STZ C;  3RW0 A;  3E89 A;  3SYO A;  5B3S C;  3FB8 C;  4WFH A;  3STL C;  3LDD A;  3K03 A;  5EBM C;  3SPH A;  1R3L C;  2DYS C;  2HFE C;  4TWK A;  5EC2 C;  4RO2 A;  4LP8 A;  4PDV A;  4LBE C;  2WLL B;  4UUJ C;  2R9R B;  5EK0 A;  1OCC C;  3SPJ A;  2DWD C;  4PA6 A;  1R3K C;  3RVZ A;  3AG1 C;  4MTF A;  3E8B A;  3K0D A;  1M56 C;  4JTD B;  4PA9 A;  4MVU A;  3K06 A;  3R65 A;  2OCC C;  1S5H C;  2EIM C;  3AG2 C;  4PA3 A;  2HG5 C;  3IFX A;  4PA7 A;  4BW5 A;  4EKW A;  3JYC A;  1XL6 A;  2WLJ A;  2QKS A;  3LNM B;  1ZWI C;  3FB6 C;  4H37 A;  2K1E A;  5E1A C;  3SYP A;  5CBF A;  3K08 A;  3ABK C;  2A9H A;  2EIK C;  4QNH B;  3PJS K;  4I9W A;  4LCU C;  2AHZ A;  4RAI A;  1K4C C;  3E8H A;  3ZJZ A;  4WFE A;  3OR6 C;  2Q69 A;  2Y69 C;  3F5W C;  2ZD9 A;  3AG4 C;  4PDM A;  4MVM A;  4X8A A;  5IY5 C;  3LDE A;  4ZBM A;  2IH1 C;  3OUF A;  2IH3 C;  3TCU A;  1V54 C;  3ASO C;  5KUK A;  1R3I C;  4X88 A;  1BL8 A;  3LUT B;  4QE7 A;  5EBW C;  3SYA A;  1OCR C;  3SYQ A;  4MS2 A;  4PA4 A;  3UM7 A;  3OR7 C;  5J9P C;  4MTO A;  2AHY A;  3SYC A;  3T2M A;  2A0L A;  1K4D C;  2NLJ C;  3X2Q C;  3BEH A;  1J95 A;  4WFF A;  2WLL A;  3E8F A;  2X6A A;  4MVR A;  4MTG A;  5EC1 C;  4WFG A;  4X89 A;  3E83 A;  4GX0 A;  4P2Z A;  1V55 C;  2W0F C;  3F7Y C;  4MVS A;  4P30 A;  4RUE A;  4QE9 A;  4XDK A;  1ORQ C;  1P7B A;  3E8G A;  4MW3 A;  3RBZ A;  3ZRS A;  2BOB C;  4MSW C;  5BZB A;  4P9O A;  2DYR C;  1LNQ A;  3FB7 C;  3ABM C;  3T4Z A;  2Q6A A;  2ATK C;  2YEV A;  1OCO C;  4H33 A;  4GX2 A;  1G4Y B;  4JTC B;  3IGA C;  1JVM A;  4MVZ A;  4PDL A;  3VOU A;  2HJF C;  2A79 B;  4HZ3 A;  4HYO A;  3LDC A;  1QLE C;  4J9Y B;  4OXS A;  3ASN C;  3UKM A;  1M57 C;  2EIL C;  4RUF A;  2DWE C;  4GX5 A;  1OCZ C;  4MW8 A;  2Q67 A;  2KB1 A;  4KFM A;  2WLH A;  2HVJ C;  3GB7 C;  3F7V C;  2P7T C;  3SPI A;  4R8C A;  4P9P A;  2QTO A;  2JK5 C;  2X6B A;  2EIN C;  2ITC C;  4G27 B;  1FFT C;  2BOC C;  3EFF K;  3FB5 C;  4J9Z B;  3SPG A;  1R3J C;  4DXW A;  4JTA B;  3OUS A;  3KG2 A;  2WLN A;  3WG7 C;  2ITD C;  4R6Z A;  3AG3 C;  4XDJ A;  2EIJ C;  2WLM A;  5B1A C;  1KKD A;  5EBL C;  2WLI A;  4GX1 A;  4XDL A;  2ZXW C;  3ABL C;  4CBC A;  3HPL C;  3E86 A;  2H8P C;  2X6C A;  3K04 A;  4R50 A;  3K0G A; 
#chains in the Genus database with same CATH topology
 1EI7 A;  1KQS U;  3H1L H;  4XLN F;  5EHH A;  5DQZ A;  4LF7 O;  5CBG A;  1D0X A;  5KYX A;  2CNW A;  4ZLD A;  1A7D A;  1QVG U;  3E89 A;  3L73 H;  3TGU H;  3MDS A;  2J7P A;  4J80 A;  1Y74 A;  4LLC A;  2XL4 A;  3STL C;  4FK5 C;  3EPV A;  4NTB A;  2J45 A;  4C3E A;  1GRJ A;  3LSU A;  2UUA B;  3ZSU A;  4UUJ C;  2A0U A;  5EK0 A;  3C8G A;  1ZAU A;  1S76 D;  2QJ1 A;  4KUM A;  1VYI A;  4JI5 B;  1RKE B;  1Z63 A;  1H9G A;  4NY3 A;  5E2Q A;  3R65 A;  3CCR V;  5L0J A;  1R6N A;  1N32 B;  4BIU A;  4BJ5 A;  3OD4 A;  1VQN V;  2YL7 A;  5JLI A;  3X1O A;  4NYK A;  2IU3 A;  4ICG A;  4H37 A;  1AI4 A;  4FMT A;  2OIG A;  2R7T A;  4PEL A;  5TIS Z;  2EPM X;  2L6F A;  4O4I A;  2G3K A;  2W4M A;  1QBZ A;  4HFK B;  1Q86 W;  3IHU A;  2Y69 C;  3D36 A;  3U3B A;  1BQZ A;  4I0X A;  3BY6 A;  1TA8 A;  3RYC A;  3QW0 A;  4P6I C;  3ZHS A;  1BHB A;  4IAQ A;  1YLM A;  4ZHQ B;  2XXA B;  4LF8 O;  3CCE V;  4I4T B;  3BVO A;  3OEE G;  1ZHW A;  1Y6D A;  5KX5 B;  3QO5 A;  3LAY A;  4NTA A;  3CSX A;  5GW7 A;  2PUS A;  4WFF A;  2ADP A;  3AK1 A;  3U9M A;  2WA4 A;  4HNA A;  1Y76 B;  3Q6N A;  2HUJ A;  4P30 A;  2MK3 A;  3S3W A;  2W4B A;  4QE9 A;  3M1C B;  1VF5 B;  1I4Z A;  1KC8 W;  4P9O A;  2Z5U A;  1ZHT A;  4EIY A;  3IGA C;  5F5F A;  1NVP D;  3Q4H A;  1QCE A;  1CP9 A;  1XEQ A;  2A79 B;  3WAQ A;  1DOW A;  3QO8 A;  2CTQ A;  4OXS A;  5DEC A;  3TUL A;  3K59 A;  1M57 B;  4DR7 O;  2DWE C;  1Y66 A;  4U5H A;  2HJ3 A;  2F95 B;  1AVO B;  3LNR A;  4YK5 A;  3EH1 A;  2R7W A;  1BGY H;  1ARO P;  3QZC A;  1YA7 O;  1X59 A;  2OOC A;  2W6I G;  3MHH C;  2Y0P A;  2Y69 B;  5DN6 G;  1US6 A;  3B71 A;  3I5Q A;  4DV2 B;  1VQK V;  3ZRX A;  2LGQ A;  2ZE6 A;  3CME V;  3EZH A;  1H9T A;  1GM9 A;  2DQ3 A;  1ZX3 A;  2R7Q A;  4F6R B;  5EIB C;  4QI0 A;  4JI3 O;  4LFB B;  5K0I A;  4B3R B;  3ABL C;  4DR1 O;  3G6B A;  1QVX A;  2AVK A;  1QSP A;  3EXA A;  5L3G A;  3JAT A;  1LE4 A;  3B8N A;  4G28 B;  5B1B C;  1Q82 W;  2JDI G;  2DB4 A;  1MMA A;  2BTQ B;  2DYS B;  3T1Y O;  3SJA C;  3W8H A;  2IXM A;  1XNR B;  1EKY A;  4TV9 A;  2UU9 B;  3ZMT A;  4L87 A;  1YF2 A;  2IM8 A;  1CGO A;  4LBE C;  3DC6 A;  2Q8V A;  2HFI A;  4YHH B;  3ZIA G;  2EIN B;  5E3C A;  2GV9 A;  1KEC A;  4DYL A;  4PI2 A;  2FTK A;  4JI7 O;  3MLG A;  5T1D B;  2OCC C;  2P67 A;  3B77 A;  5JS5 A;  1DF4 A;  1KD1 W;  1Z23 A;  2YLG A;  5KMG B;  1FYJ A;  4K8Z A;  3AQB A;  5JQG B;  5AGF A;  3SYP A;  2IW5 A;  5L3D A;  1S77 D;  3T6G B;  4BAY A;  4DV1 B;  1VMA A;  1NT2 B;  3DAG A;  1UJW B;  4Z9J A;  2PBE A;  3OM3 B;  3F5T A;  3OEH G;  2R72 A;  2ZD9 A;  5IY5 C;  2LFD A;  1IDS A;  4CJO A;  2RDC A;  1G5Z A;  2EX3 A;  3NYL A;  4IT5 A;  4NKG B;  2VQF O;  2EPK X;  4HBN A;  2Q9L A;  3UMI A;  4NXN O;  1SRY A;  1RM1 C;  2R03 A;  4DV2 O;  4LER A;  1L7C A;  1XQ8 A;  2LQT A;  4BG0 A;  4DV0 O;  1NZ6 A;  3HNJ A;  3ZHQ A;  1J95 A;  2HJD A;  2Q4P A;  4YIP A;  3DJU B;  1OXK A;  1JFF B;  1IZM A;  1KUQ A;  2QKA A;  2CGN A;  3JT1 A;  3F7Y C;  4JI0 O;  2QM7 A;  1SZI A;  3E8G A;  3U2L A;  3ICX A;  4NTY A;  4Q20 A;  2YKZ A;  3T4Z A;  5EYP A;  1YJN V;  4PDL A;  1OCO C;  3TK1 A;  1P84 F;  2Q5Z A;  2VQE O;  1S72 V;  5DM6 V;  4YWQ A;  1UFI A;  3L9D A;  4O4H B;  3UKM A;  2D3O W;  4JVS A;  5D5P A;  2YRF A;  5BQI A;  4ZI7 B;  1N36 O;  4KHP O;  3P3P A;  1OKK D;  4YT8 A;  4KC9 A;  1N0J A;  2P7T C;  2JGD A;  3RT3 C;  4O6Y A;  1BBH A;  1VQ4 V;  1FAF A;  4I1M A;  1U0B B;  3JD2 A;  2Q9A A;  1JX9 A;  1SMY F;  4WJ0 A;  1K34 A;  3J06 A;  1J5E O;  2ZDI A;  2XLM A;  3S28 A;  1G6U A;  3MD0 A;  1PV3 A;  4DRH B;  1YIT V;  5IT9 N;  3R2P A;  1QR8 A;  2UXD O;  1XRE A;  3OAA G;  5IYZ B;  3TQO A;  2LFS A;  4R7C A;  4U3F H;  2R7S A;  1IBM B;  1WB7 A;  3DC5 A;  2JS5 A;  4NTW A;  5FPR A;  2QY9 A;  4D7S A;  4RBN A;  3C62 A;  5B3S C;  1NH2 D;  4JAA A;  1IUR A;  4PJJ A;  1QKR A;  1E1R G;  1Q0M A;  2Y0I A;  3A2F A;  3VAY A;  3LDD A;  4XWJ A;  2KSD A;  4AE4 B;  5EBM C;  3SPH A;  3DWW A;  4DR7 B;  2XS8 A;  2P0N A;  2UXX A;  4LDR A;  1K92 A;  2BE3 A;  4B3T O;  4DBQ A;  1ZW2 A;  1LR1 A;  1QHT A;  3KKB A;  5F28 E;  1D5N A;  4YIO A;  1U96 A;  3PCV A;  1XWJ A;  1SQX H;  1SS3 A;  1SR2 A;  2XLD A;  5LXT A;  1UG7 A;  4EKW A;  2JPU A;  5B1O A;  1Z6A A;  1M1K W;  1EN6 A;  2YI8 A;  3LNM B;  3CEX A;  2E87 A;  2XSE A;  3FXH A;  3QTH A;  2V3C C;  4IWB A;  5FNV A;  1VQL V;  3RFR A;  1EA8 A;  2EPN A;  3LSQ A;  4JEB A;  1DGS A;  1K97 A;  1N4C A;  1JPN A;  3AG4 C;  1MND A;  4DV3 O;  3ZG1 A;  1F4N A;  2IH1 C;  5CB4 B;  3G4Z A;  4O4J A;  1PV0 A;  1GTO A;  4JI6 O;  4BPM A;  1AI6 A;  1OW7 A;  4QE7 A;  3LUT B;  3U0C A;  4J10 A;  5F2V O;  1HNZ O;  3JAL A;  4ZOL B;  5FNV B;  4FFB B;  2BTQ A;  3V5Z A;  1TFO B;  3VQW A;  2JEX A;  3QW1 A;  1OW6 A;  3IC7 A;  1SQV H;  1E84 A;  1WJZ A;  2XOK G;  2X6A A;  3ATP A;  3LS0 A;  2DW4 A;  4JZA A;  4Z1V A;  1ORY A;  1MNE A;  3CCM V;  3H1H H;  3HR0 A;  2VCC A;  3UT5 A;  1G1X B;  1BZ4 A;  4A4A A;  3SJC C;  3H2V A;  2YEV A;  3JRT A;  4NVP A;  4JI2 B;  3VOU A;  2HJF C;  1KMI Z;  1XMQ O;  1XNQ B;  2V26 A;  4J9Y B;  4UVA A;  2ZIN A;  4Z9I A;  2YDE A;  4NB5 A;  4ZI7 A;  4FFB A;  3THO A;  4TV8 B;  5LMN B;  4X66 O;  3ASO B;  2HS5 A;  4ONS A;  5HSW A;  3U9J A;  3OFN G;  4DO2 A;  2HV6 A;  3PHF 2;  3V5X A;  3QO7 A;  1M2O A;  3ABT A;  4QIW F;  4FAP B;  2ZNI A;  4X1I B;  2YL1 A;  2XL8 A;  2V7Q G;  4GX1 A;  1GM7 A;  1LUW A;  2BCC H;  1EZJ A;  4DR1 B;  2H8P C;  4I50 A;  3JYH A;  2X7R B;  4BR6 A;  5LMU B;  3F46 A;  3IQ6 A;  1JMK C;  4CS9 A;  2HVK C;  1YYJ A;  2AXT Z;  5KUM A;  2R9A A;  4GYC B;  4GQH A;  1XUQ A;  4M63 A;  4K8X A;  2D4U A;  1GH6 A;  3C8Z A;  4DW1 A;  5LP6 A;  1NG1 A;  3O55 A;  5B1A B;  1S0V A;  2KSF A;  1RPO A;  2A69 F;  4I9Q A;  4TWK A;  3BA8 A;  3CMA V;  2A0B A;  2JD3 A;  1IBK B;  2UUH A;  1WNS A;  5FL7 G;  5LA6 A;  3KH2 A;  2FL4 A;  5JJN B;  1AIL A;  3K0D A;  3B0P A;  1VTM P;  3ZHU A;  3EH2 A;  1SES A;  3HLZ A;  3PDM P;  2HG5 C;  1RM1 B;  3UO2 A;  1EN5 A;  1XL6 A;  2MW2 B;  2WLJ A;  3K9A A;  5L3V A;  3EFO A;  3UT5 B;  1OR2 A;  4B6I A;  1QLN A;  4I9W A;  2H7V C;  2Q9B A;  1XZP A;  1VQM V;  3ZBH A;  5GON B;  3CCJ V;  4N23 A;  1I94 B;  1FTS A;  3ZTM A;  2IJH A;  1F23 A;  4BEM J;  5KUK A;  5L0G A;  2YID A;  4YXW G;  4DR6 O;  4NCQ A;  3ASN B;  1V4A A;  4LLE A;  2JS3 A;  2AHY A;  2X0L A;  3T2M A;  5L3F A;  2LFF A;  4O2B B;  3ZWI A;  1SQB H;  2CTP A;  3TJT A;  1JAF A;  4DV5 B;  5BXZ A;  1ORQ C;  3FX7 A;  2B0H A;  3JAK A;  1I5Y A;  1SZX A;  2DYR C;  2X0C A;  4C3D A;  3GVM A;  3GM3 A;  5GTH Z;  1VAR A;  2Z3Y A;  2ASR A;  4J7Z A;  2R70 A;  1GGQ A;  4JI4 O;  1D0Z A;  5IYD O;  2OQM A;  5CI8 A;  1VP7 A;  1PPJ H;  2KB1 A;  4KFM A;  2RNB A;  1VF7 A;  2XAJ A;  4IJJ A;  2XAQ A;  1MSD A;  2X6B A;  3HB3 B;  5L3E A;  1VYK A;  4Q7C A;  3EHM A;  3ZRW A;  1S5J A;  2LIG A;  4J9Z B;  2YIB A;  1BSM A;  3WG7 C;  4K3A A;  2VQF B;  3UR3 C;  3ETD A;  2KNH A;  2QR4 A;  2FKX A;  4XEK A;  2ZIM A;  2HJM A;  2PNO A;  3L71 H;  2F4V B;  3DKA A;  3T4D A;  2AWC A;  2R7V A;  4CJG A;  4F4L A;  1JRA A;  3S0X A;  4TUY A;  5B1N A;  1VQ5 V;  1KU9 A;  4HFF B;  1K73 W;  1D1A A;  1JFF A;  2QNL A;  1T6U A;  4LF9 B;  3DI5 A;  4DVZ A;  2W6J G;  1HR0 B;  1VQO V;  1JMW A;  2KYH A;  4JUR I;  5BMV B;  1IVS A;  4J7T A;  4FIP C;  4RDA A;  1S3J A;  3K03 A;  3HKB B;  3W7T A;  3E35 A;  1VB5 A;  5JRA A;  4R32 A;  2Y4U A;  2ZR2 A;  3W7X A;  2ZE7 A;  1NH2 B;  4AIL C;  4DBR A;  3G6E V;  2MHR A;  4LF5 B;  5L3Q A;  3VYW A;  2ZCE A;  2KG7 A;  3H9V A;  3FOP A;  1SF8 A;  4JI8 O;  2ZR3 A;  4X1K B;  1EBO A;  2RQ6 A;  4CZZ A;  2YL3 A;  5L3C A;  4DV7 B;  3U3F A;  4FM1 A;  1X4T A;  3K08 A;  4FLX A;  2LCH A;  3K33 A;  3OTO B;  3EGD B;  3N2K B;  4B3R O;  3LDE A;  3RYC B;  3TCU A;  1V54 C;  2LP4 A;  3S29 A;  4UCV A;  2AW9 A;  1PP9 H;  3K1H A;  3RH3 A;  4K7B A;  3BA9 A;  2IJI A;  3ZQY A;  1U6H A;  2AWY A;  1XMO O;  3U5S A;  1HW7 A;  3D8C A;  1K4D C;  3CP1 A;  2F43 G;  4LNU A;  2PGG A;  1T6I A;  3SZR A;  4MVR A;  4MTG A;  4FZ0 A;  3NRH A;  5KYU B;  3MFN A;  1AP6 A;  4TQF A;  4OIR F;  4GX0 A;  4P2Z A;  5L0F A;  4LWS A;  1NJI W;  3K58 A;  1GKF A;  1P7B A;  1ZL8 A;  2J9U A;  1EFR G;  2JJ1 G;  2VH3 A;  2ADQ B;  3ZRW B;  2CNW D;  1SC5 B;  1JQ0 A;  4CDV A;  3GEE A;  3CJH A;  4B08 A;  2X51 A;  2Q7G A;  1PM9 A;  2CH7 A;  5EYP B;  1TWG A;  5COG A;  3CXC U;  4GX5 A;  2OCC B;  4U5G A;  5KHI A;  5IJ0 B;  4QJF B;  3JCU Q;  4JI1 B;  4YN0 B;  2NNU A;  2DMX A;  3C8G D;  3SP1 A;  1K5S A;  1D2D A;  2MWQ A;  4I1O B;  1H7I A;  1JCH A;  2HSQ A;  3UO3 A;  1RMV A;  3LLI A;  2CUG A;  2JVD A;  2BTO A;  4I7Z B;  2JGD B;  1XZQ A;  4UCT A;  3ML0 A;  1K04 A;  3B09 A;  3GOD A;  2B9Z A;  5KHH A;  2QLA A;  1Q43 A;  1HNZ B;  2FB5 A;  3B4S A;  4EFE A;  1B04 A;  1JJ2 U;  2H7O A;  4MVO A;  2XS1 A;  4EEQ A;  2XAS A;  1JJO A;  3F47 A;  5BQH A;  4MND A;  1FS0 G;  2BL2 A;  2EIJ B;  3N2Z B;  2EIK B;  4U7N A;  2LD6 A;  5KX5 A;  1AR4 A;  1SET A;  1A41 A;  1WPX A;  2NG1 A;  2GUZ A;  1V74 B;  1EM1 A;  1MQV A;  2L7A A;  1AP5 A;  2JEU A;  2QKC A;  2R9R B;  3HNI A;  2E5L B;  3NMK A;  1VQP V;  4HE8 D;  5TJ5 E;  2OJQ A;  5EGY A;  1NR7 A;  3JAS A;  5C8Y A;  3E8B A;  2QA4 V;  3ZMZ A;  2ZXO A;  3B0V C;  4PA7 A;  4UVC A;  4Z2W A;  3ZCC A;  3LES A;  5HFL A;  4DV6 O;  2K9P A;  2K1E A;  2UUC O;  3SEO A;  2A9H A;  3L72 H;  4RQE A;  3JSL A;  3CC7 V;  2YLD A;  3R7C A;  1BE3 H;  4O4L B;  3WB1 A;  3Q7G A;  1O87 A;  1ZW3 A;  4CIP A;  1N33 O;  2QTS A;  1QPU A;  2YXL A;  5J2T B;  1YI2 V;  3CYO A;  2J7P D;  4FPP A;  4DUZ O;  4PJ0 Z;  4JI1 O;  1HE9 A;  1M5I A;  1OCR C;  5E79 Z;  2ZXR A;  1HMD A;  5K1P A;  3SYC A;  1SQF A;  5A9G A;  2LQG A;  2WVN A;  3ZRV A;  1G8X A;  2IJK A;  3RYF A;  3RYH B;  1ZU4 A;  2KW3 C;  4WCE V;  4JCH A;  1Q6I A;  2Y4T A;  1IXB A;  1A7V A;  4O2A A;  5LYJ B;  3MHS C;  4HYO A;  1KB9 F;  3GOR A;  4DW0 A;  5HV9 A;  3EHB B;  1YZA A;  5JJE B;  5LGT A;  3HNL A;  1BDJ B;  4JC7 A;  1RKE A;  4MQ9 F;  3CE2 A;  4MW8 A;  4LFB O;  1VLS A;  4GKJ B;  4J41 A;  2ZE8 A;  5L0D A;  4GUN A;  3DSQ A;  4DUY O;  1HW2 A;  4AL0 A;  1YIJ V;  2YI9 A;  1WP8 A;  4LAC B;  3L70 H;  1KNY A;  5D91 A;  3KZI Z;  1VMG A;  3SPG A;  1YYX A;  3SXZ A;  2G62 A;  3M8A A;  4LC1 A;  3I55 V;  2QM8 A;  1UPG A;  2B0J A;  5CMU A;  1TR2 A;  2LGW A;  2P4K A;  3G67 A;  3B29 A;  3N24 A;  2WLI A;  2Q7E A;  3GWK C;  2LP7 A;  2CTR A;  5JH7 A;  3JYY A;  2YXH A;  2UXC B;  3N0T A;  3T6J A;  3G80 A;  2ZQM A;  4FM0 A;  2R25 A;  3KYI A;  2WLK A;  3JTL O;  4WBN A;  4X64 O;  4Z9H A;  1Z2G A;  4CH4 A;  3BRJ A;  3RW0 A;  2Y48 A;  3QVN A;  2PP4 A;  2UUB B;  1NLX A;  1FXK B;  1PNM A;  1SQQ H;  1C03 A;  1R3L C;  2DYS C;  2I15 A;  4JYB A;  5EC2 C;  4PDV A;  3FHD A;  3K5M A;  3IQT A;  1FPO A;  2CAZ C;  3AG1 C;  1GN4 A;  2GDS A;  3RN4 A;  1SF9 A;  1AEP A;  4QGP A;  5KHG A;  2I8B A;  5L0C A;  2XXA A;  1WAT A;  1OJH A;  1K7D A;  2E76 B;  4LNU B;  1MZE A;  1T5E A;  4JYC A;  3S9O A;  5D5Q A;  5A6B D;  1TWC A;  2R7U A;  2B5U A;  2RMK B;  5LMN O;  2VAS A;  2P90 A;  3I4U A;  1NFN A;  2AHZ A;  4CS2 A;  1MA1 A;  4RAI A;  4CBE A;  1H2S B;  2M7W A;  5JVD B;  2PY5 A;  1S05 A;  1AR1 B;  3K57 A;  4LFC B;  3HKC A;  2QWO B;  4JZG A;  2IH3 C;  3OMI B;  4CC5 A;  2EJ7 A;  4CH3 A;  2QWR B;  2NPU A;  4EB6 B;  4IHJ B;  2UUA O;  1VF6 C;  2AZ2 A;  2XM4 A;  1KP3 A;  5CA0 B;  3N2G A;  1H2K A;  1BR4 A;  4B3S B;  2NLJ C;  4UFZ A;  3X2Q C;  1H2M A;  3UQ8 A;  4JI4 B;  1OV9 A;  3H1I H;  3AG3 B;  4O7G A;  5L0I A;  3E83 A;  3RQE A;  5CIV A;  2FML A;  5FZT A;  2Q0A A;  3JAT B;  5H2F Z;  1KYO F;  2EZO A;  4J7J A;  2IXP A;  1ZU5 A;  4A2N B;  1JVM A;  5KAI Z;  4C7U A;  1QLE C;  3AQC A;  4FLV A;  3O9O A;  1W2W A;  1F51 A;  4XQ1 A;  2OEV A;  4JE9 A;  1IBL O;  3GWN A;  1OCZ C;  2ETN A;  3CRR A;  2WZG A;  3D36 C;  3K5O A;  4KNW A;  4XPX A;  2VC9 A;  5JH7 B;  1U97 A;  3HJC A;  4FFK A;  4BWA A;  3F7V C;  2IBF A;  3TXS A;  1FFT C;  1QQC A;  2E75 B;  1TKN A;  2HKO A;  5DS4 A;  4H44 B;  1GK9 A;  4MT8 A;  3FB5 C;  4DRJ B;  2HMZ A;  1TUB B;  4GYT A;  3PMR A;  4HAM A;  1O5H A;  3EGD A;  3OGI B;  1RKC A;  2WLM A;  3AOU A;  4EBK A;  4B3T B;  1MSW D;  2ZXW C;  3Q7L A;  1MG1 A;  4X62 B;  2PI4 A;  3K04 A;  3ITF A;  4R50 A;  4XPW A;  1GN6 A;  3RYI B;  3SJQ C;  4U5C E;  2P6J A;  5CBH A;  1THZ A;  1CGM E;  1ZYR F;  1AR5 A;  2A3Q A;  1BHA A;  2Q3T A;  4JKV A;  4JGS A;  3OGC C;  3STZ C;  5KAF Z;  4B7E A;  1XDC A;  4X1I A;  2WAM A;  1NU7 D;  1T01 A;  3SXM A;  1RSO B;  5COM A;  5A69 A;  2HFE C;  5BMV A;  3APO A;  3BAB A;  1OZ0 A;  5LP6 C;  1SA0 B;  3S27 A;  3K7D A;  2P1A A;  3C18 A;  4KL1 A;  4MTF A;  3O39 A;  4PA9 A;  1VEW A;  4JI7 B;  2B1G A;  2R7X A;  1BCC H;  2PTM A;  1TWA A;  3IFX A;  5LP6 B;  1YTF B;  5E3A A;  1FNT c;  1MNG A;  2YEV B;  3A8T A;  1N1C A;  4WAB A;  1K9M W;  4XPY A;  1BMF G;  2XHB A;  2J46 A;  5LGN A;  4U3J A;  4DV4 O;  2YHS A;  4YT5 A;  5L0H A;  4X1K A;  4AQY B;  1Q5O A;  2ODM A;  3CB2 A;  1XNR O;  2CW0 F;  2J9W A;  2A06 H;  4J7K A;  2UUC B;  3ZC4 A;  1M9N A;  4WF9 V;  1H8E G;  2L35 A;  3ZN0 A;  1TVK A;  2WPD G;  1LUV A;  3MAQ A;  4DR6 B;  3FAJ A;  3UGP A;  1AJP A;  5DS6 A;  5BR8 O;  4FLY A;  4CS8 C;  3ABU A;  3JAS B;  2Y3B A;  4UV8 A;  1ZSP A;  4LFA O;  4X1Y A;  2EJR A;  5KYY B;  1I08 A;  5F5H A;  3ZJZ A;  3RBZ A;  4X62 O;  2CYD A;  3EJN A;  4PK4 A;  2ATK C;  1Q8I A;  3E22 B;  1Q7Y W;  2ETS A;  2GA0 A;  2Q4F A;  3T6B A;  4YJ2 B;  3NG1 A;  2JGU A;  5KHK A;  1HW1 A;  3FYE B;  3EG9 B;  1M6T A;  2NUT B;  3T9O A;  2EIL B;  2PYJ A;  4FWV A;  1RSO A;  2BSK B;  4ZIB A;  3AG2 B;  3ZMS A;  3ZTZ A;  5BR8 B;  1M4U A;  3IQC A;  1KP2 A;  1PNL A;  1L3P A;  4EHP A;  4JYA O;  3K79 A;  1LVK A;  2E3C A;  4JCZ A;  4AHC A;  4YL0 A;  4JI8 B;  1BR1 A;  2N74 A;  2OT5 A;  2UXB O;  3MX3 A;  3K1I A;  4PFP A;  4KNV A;  4LF5 O;  4K0K O;  4W4L A;  1D5A A;  3E22 A;  1W0K G;  3X2Q B;  1B68 A;  1RXQ A;  4QPK A;  4I3M A;  4UCS A;  3VQV A;  2X6C A;  3EFO B;  2H7B A;  2EIM B;  1MOF A;  3N2G B;  4KP4 A;  5LMU O;  1NU9 C;  3CCS V;  3TD7 A;  2QGN A;  2LW7 A;  1AUE A;  3TET A;  3CRQ A;  4CS4 A;  3CS5 A;  3ZIB A;  2XLE A;  2XLV A;  1SA0 A;  2OIE A;  3FOO A;  2P6V A;  3OTF A;  4IB4 A;  1W2B U;  4OIQ F;  1P4R A;  2RCV A;  4FVM A;  2F93 B;  3BCC H;  5H6Q A;  2EBO A;  4GKK B;  3S90 A;  2XM0 A;  2NUP B;  3VQY A;  1OCC C;  3K66 A;  3W2W A;  1Q3E A;  2AP3 A;  4DV3 B;  5EIB D;  4KXR A;  1S5H C;  1WA8 B;  3IC9 A;  3AG7 A;  1ZWI C;  3ECS A;  3FB6 C;  2JRI A;  2MYS A;  3L8J A;  1BS3 A;  2ZIO A;  2GBO A;  1N34 O;  4ASU G;  3K5N A;  5DS5 A;  2PI5 A;  1GN3 A;  1L0N H;  1TUB A;  2C2A A;  3CSK A;  1E79 G;  1NVP B;  1R4T A;  3NMJ A;  4CS3 A;  2LW1 A;  1C17 M;  1Z5Z A;  1L8D A;  4DR5 O;  4NXN B;  3MYI A;  2OEX A;  3SXK A;  1HE1 A;  1NS1 A;  3SGI A;  3GM2 A;  5J9P C;  2J9B A;  1N36 B;  4KHP B;  1LKX A;  3U8P A;  2EZP A;  2QEX V;  4X89 A;  1G4U S;  4IGG A;  4EBB A;  1YAR O;  2UXD B;  3DE9 A;  4Q5S F;  2IJJ A;  1R6K A;  3ABM C;  1M2V B;  1FXV A;  3JSZ A;  5DVW A;  3RKO F;  2R7O A;  3DXR B;  4H33 A;  2AGA A;  4RWU A;  2ARH A;  1L1F A;  4EBJ A;  5IYB O;  2O9X A;  2EIL C;  4DR4 O;  3L0I A;  1VIB A;  4QDL A;  3P32 A;  3GB7 C;  1PD1 A;  4GEH A;  2YL0 A;  1UFB A;  3RYL A;  4K0K B;  5EZY A;  2FAP B;  2YVK A;  1WOL A;  1PD3 A;  4DXW A;  2IXO A;  2OU6 A;  4Q4Z F;  4XLP F;  3WG7 B;  1N33 B;  2ILM A;  4XDJ A;  2EIJ C;  1KKD A;  2PYL A;  1XIL A;  2EPL X;  5KLV H;  3IAY A;  4DV6 B;  3UCS C;  4U5E E;  3G4S V;  2BSK A;  2Q68 A;  4I50 B;  2YUA A;  4CC6 A;  4C7O A;  2VRZ A;  4OPH A;  4PDR A;  4WGZ A;  3QNE A;  2OKU A;  4X20 A;  1E83 A;  5GTI Z;  1I7F A;  1PCX A;  4AE4 A;  4UB8 Z;  3IPM O;  4JYY A;  3EG9 A;  4ZKI A;  4CH5 A;  3I56 V;  5AC4 A;  3T1Y B;  4GKK O;  4H0L B;  3JZ0 A;  4TV8 A;  1YZC A;  2RJZ A;  3FD9 A;  5HFM A;  3CC4 V;  4JTD B;  2A68 F;  3K5L A;  5D92 A;  1CPR A;  2EIM C;  4PA3 A;  4YY3 O;  3K3W A;  4W8P A;  1OCR B;  2VWJ A;  1ZTE A;  4F4B A;  1P49 A;  2HMQ A;  2RSE B;  3EZI A;  2YQY A;  2Q73 A;  1I94 O;  5CBF A;  3PJS K;  4JI0 B;  1VK5 A;  2F23 A;  4OIP F;  3ZMU A;  1HDJ A;  1E85 A;  1YJ9 V;  1NBM G;  1JA8 A;  2WZF A;  5JCO A;  4ULW A;  1VQ9 V;  2G38 A;  2KKW A;  3LSS A;  256B A;  4L8J A;  1LM3 B;  5DED A;  4J42 A;  4JI2 O;  3L74 H;  4J32 B;  5LBQ A;  3L75 H;  3CPW U;  1WGW A;  1BL8 A;  3DXJ F;  1NTZ H;  4LF8 B;  4O4L A;  1M90 W;  3UM7 A;  4J30 B;  1HMO A;  4DV5 O;  4PJM A;  4LF4 B;  3HKC B;  4JYA B;  3RQF A;  5KYX B;  2XUM A;  3TJ5 A;  3CRC A;  1A0B A;  3U2M A;  3AG4 B;  4O4I B;  1R5I D;  3NKE A;  3UMK A;  2YS8 A;  1LNQ A;  3JAM N;  4PJN A;  2Q6A A;  3Q6M A;  1T5O A;  4OGQ B;  1G4Y B;  1YDX A;  1F4M A;  1GN2 A;  5BQG A;  4JZ2 A;  2H8A A;  5A6B A;  2YXY A;  1AJQ A;  4NTX A;  2E5L O;  2ZPA A;  3T4R A;  1JOG A;  4FES A;  1I5X A;  3OE7 G;  3S3X A;  1YA9 A;  1COW G;  3G71 V;  2AZ0 A;  2XLO A;  2Y39 A;  4CDA A;  1GM8 A;  1IXM A;  5GPG B;  4DR3 O;  3CCV V;  5A2Q N;  1XI1 A;  4YL3 A;  1K8A W;  1D0Y A;  1WB8 A;  2ZDI C;  3OUS A;  3HNK A;  1FFX B;  1O9H A;  2D2C B;  4FM2 A;  5CN0 A;  4UDV A;  2NUT A;  5EBL C;  4WBN B;  4CBC A;  2BC5 A;  1AVM A;  2YLI A;  3CX5 F;  2Y3H A;  1Y6X A;  3NXS A;  4H13 B;  5KMG A;  3SXY A;  1IBL B;  1ZHY A;  4FLW A;  2WLI B;  4LH7 A;  2UXN A;  1FXH A;  1XMO B;  2JX0 A;  3ZHT A;  4UCR A;  4IYH A;  3OW2 U;  3MYF A;  3SYO A;  3G4X A;  1YXB A;  4X1Y B;  4EFB A;  4UV9 A;  4IIJ A;  1P7G A;  3ETG A;  4G7Z F;  1Y4C A;  3FYI B;  4TV9 B;  2QWQ B;  3CQZ A;  2RD9 A;  1EN4 A;  3LLK A;  1LPE A;  1HNW O;  2WLL B;  1JR9 A;  3GWO A;  3QG5 A;  3CJH B;  3ETQ A;  1YCI A;  5KYW B;  4OIO F;  4FLT A;  1EZV H;  1M56 B;  4QPJ A;  1ZZP A;  2O57 A;  1WTY A;  1NKD A;  3OMA B;  5CA3 A;  4IHJ A;  2XRH A;  2C03 A;  3A11 A;  4O79 A;  5LYJ A;  4O2A B;  2H94 A;  5E1A C;  1F1M A;  4YJW A;  2EUL A;  2V1D A;  4B3M B;  2KQX A;  4CX9 A;  4N6C A;  3JD4 A;  4AQY O;  4RQF A;  1TWH A;  4E17 A;  3EQL F;  3U0Z A;  5C93 A;  1FJG B;  4JF3 A;  4U7O A;  4X8A A;  4ZHQ A;  1XMQ B;  1H2N A;  3W7S A;  1O3U A;  3OA1 A;  5IWA B;  1K05 A;  5IJ0 A;  2WVQ A;  1AI7 A;  2YIC A;  4J11 A;  3M15 A;  1JPJ A;  3DAF A;  2N05 A;  4MTO A;  3ZHV A;  1FMW A;  2DQ0 A;  2KK1 A;  2B1I A;  4DR2 B;  3DZA A;  3OWT A;  2LFR A;  4N06 A;  4MVS A;  5B3I A;  4B7K A;  2P22 C;  4MW3 A;  1MMD A;  4UVB A;  4ER9 A;  4Q6G A;  3ETE A;  1OW8 A;  3JRM O;  1ROP A;  4LWS B;  2VB6 A;  2HEP A;  3KCY A;  3RGB A;  3H1K H;  4YJ3 A;  2Q00 A;  4BEJ A;  1E86 A;  1MMM A;  2R05 A;  1V54 B;  4GCZ A;  2WLH A;  1HY5 A;  4IIJ B;  4R8C A;  2LO1 A;  4H54 A;  3BAA A;  2EIN C;  1CEZ A;  1RP3 B;  3VQX A;  1J5E B;  4TUY B;  3V7O A;  4E4E A;  3EFF K;  4E0H A;  4OX9 B;  4JAU A;  3JAW B;  2WLN A;  4XEV A;  5KA6 A;  5A6K A;  1MMG A;  1T9K A;  1KBH A;  1YSC A;  5B1A C;  3SDL A;  3KL4 A;  1R6T A;  4NTF A;  4DVY P;  4O2B A;  3E86 A;  1NR1 A;  3A0H Z;  4DUY B;  3NMI A;  1GO3 F;  5B1B B;  3ZN1 A;  3AG1 B;  4B3M O;  4P9F A;  3US6 A;  3JD3 A;  3T1C A;  4YJ2 A;  1B06 A;  1XL4 A;  3RF3 A;  1IW7 F;  3FB8 C;  1OQC A;  4WFH A;  4U9D A;  4ULV A;  1E1Q G;  2OYQ A;  4PD4 F;  3RYF B;  2CGO A;  3HKB A;  3EHN A;  1VQ8 V;  4G7H F;  2P4V A;  4PI0 A;  1VQ7 V;  2XTA A;  4LP8 A;  1HR0 O;  3G50 A;  1QNM A;  3ZX6 A;  4NC3 A;  1K33 A;  2V4D A;  3CC2 V;  1XHX A;  4LDK A;  4NXM O;  2IOQ A;  3NR7 A;  1M93 A;  5DQT A;  3O6X A;  1NFO A;  1WA8 A;  2QTV A;  2EIK C;  3C3S A;  4E7S A;  1DF5 A;  5IY5 B;  5FLX N;  1OR3 A;  2NSF A;  3HTK C;  3TJ6 A;  2ZNJ A;  1PL0 A;  4DRX A;  4JV5 B;  4JJF A;  2VQE B;  4X0R A;  1Q90 D;  2KJG A;  3C8G B;  4C3B A;  1XHZ A;  3W2V A;  5GON A;  4I44 A;  1DK1 A;  1ENV A;  1FR0 A;  1VQ6 V;  4DK1 A;  3JAW A;  4W8K A;  2KGO A;  4WFB V;  3FKS G;  3OR7 C;  1VOM A;  1YEW A;  2A0L A;  1SQP H;  5EZY B;  3HKK A;  5A6A A;  4CSA C;  4BW9 A;  3GEH A;  3VBB A;  3AJM A;  3LJB A;  4TOI A;  3OT7 A;  4JRZ A;  2LJ2 A;  4DV4 B;  3N2K A;  5K1X A;  4GKJ O;  1WLE A;  3ZRS A;  1V55 B;  2WL8 A;  4KBL A;  2UUB O;  5IDJ A;  4MSW C;  3FB7 C;  1HWY A;  4GLX A;  1APC A;  1Q0G A;  2L6G A;  3FVY A;  2H3O A;  2PX0 A;  3QVY A;  4HZ3 A;  3A9C A;  4N4W A;  5BUO A;  1JOY A;  4N6H A;  4TSF G;  1M2V A;  3FDQ A;  2IM9 A;  3FAP B;  2DE0 X;  2OTJ V;  1ZL8 B;  4BJ6 A;  3RYI A;  4DR4 B;  2F22 A;  4OPA A;  3UGO A;  3H1J H;  3B8M A;  1L0L H;  2HVJ C;  3CD6 V;  2E74 B;  4B3S O;  4P9T A;  4UCU A;  2QTO A;  2JK5 C;  4GZR B;  4IRU A;  1B6Q A;  1MAB G;  3DE8 A;  4JI3 B;  3ABL B;  2JJ2 G;  2M64 A;  5LHG A;  1N32 O;  4XBF A;  4FLZ A;  2PF4 E;  1QZX A;  1R3J C;  1CXZ B;  2WB7 A;  4F6E A;  3KG2 A;  1Y74 B;  3W4Y A;  2ITD C;  4NQF A;  3U10 A;  1XBL A;  2ZM6 B;  1G4W R;  2IYL D;  2OG2 A;  4YHH O;  4G78 A;  4LFC O;  4CS7 A;  3HKE A;  2GDC A;  1Z5W A;  3IEE A;  1ZUQ A;  2IBZ H;  3SNH A;  2UU9 O;  1BZK A;  3M7M X;  4DRI B;  2HV7 A;  2ZXP A;  1QVF U;  4PFO A;  3WB0 A;  1QU7 A;  4JJG A;  3HKD A;  3SPC A;  2CH7 B;  3LEV A;  2DN9 A;  1ZVZ A;  1H6G A;  4PJL A;  5CB4 A;  3AK3 A;  3SJB C;  2CGE A;  1Q6U A;  3E2E A;  5ITZ B;  2FYU H;  4OX9 O;  4JV5 O;  2Q7H A;  4HEA J;  2GHY A;  3H01 A;  4FLU A;  2Z0A A;  1N34 B;  4I55 B;  4QI2 A;  1I5N A;  2Q0O C;  1Q6H A;  3A0B Z;  2R7R A;  3M79 A;  3NYM A;  3TOL A;  2NUP A;  4BJ5 C;  2DWD C;  5CA0 A;  2KQ9 A;  1M56 C;  4DK0 A;  4FZ1 A;  3JAR B;  3ZMV A;  3D3I A;  1WAZ A;  5A6J A;  2J0X A;  2XAF A;  4JPR A;  3FAV A;  4IL6 Z;  3UNG C;  3WHN A;  4X9Q A;  3DGE A;  2GWW A;  4W4K A;  3E70 C;  3E8H A;  4ZLC A;  1FD9 A;  4WFE A;  5LA6 B;  3GM1 A;  5JVE A;  3F5W C;  1SKV A;  4X65 O;  2UUI A;  2HR3 A;  3OUF A;  4JI6 B;  3ASO C;  4JEA A;  3GWL A;  2ZT9 B;  1LS4 A;  1TAE A;  2GUZ B;  1BT8 A;  3SYA A;  4U5D E;  2KG7 B;  1NBB A;  2A6E F;  4LH6 A;  4X66 B;  1LE2 A;  2EPO A;  2CE4 A;  4AI8 A;  2YIA A;  1Y4M A;  3CAX A;  1GS9 A;  3B2E E;  1QQ3 A;  4X20 B;  2CTW A;  3TXQ A;  2WLL A;  3W8I A;  2GTS A;  5EC1 C;  4DOZ A;  4WFG A;  5LXT B;  2XL6 A;  4XDK A;  4YL1 A;  1JR8 A;  4RUE A;  1VLT A;  3NDB B;  2C04 A;  2BOB C;  2UXB B;  4CS8 A;  1QR9 A;  1WP7 A;  2WSS G;  4CS9 C;  4FX5 A;  1PNK A;  4MVZ A;  4DJ9 A;  2P06 A;  5KHJ A;  1TFK B;  3T1H O;  4O6N A;  2A6H F;  4F6R A;  4O6M A;  1IZ3 A;  3ZS8 C;  2DJV A;  3AEI A;  4DV0 B;  1N8R W;  3RIP A;  3W7W A;  3AGU A;  3SPI A;  3M99 B;  4XEF A;  3ZVR A;  1E2X A;  3IJ4 A;  3CRM A;  3JD1 A;  1DLB A;  2NR5 A;  1NTM H;  3DJN B;  5CA1 A;  1A7E A;  4PR9 A;  1H2G A;  1ZHX A;  1EQ1 A;  4R6Z A;  4YT4 A;  2DI3 A;  2GAQ A;  3I5P A;  5E33 A;  1IBM O;  2GFH A;  3NKD A;  4BJ6 C;  3VM6 A;  1AI5 A;  4DV1 O;  5BY1 A;  5H6R A;  4D7T A;  1H38 A;  3TOM A;  1ZHZ A;  2AU5 A;  3K0G A;  1K40 A;  2WWW A;  4EWC A;  4E2L A;  1PL4 A;  2YC0 A;  2J0W A;  5JT4 A;  1C02 A;  1WPB A;  3RVY A;  4U3J B;  1YHQ V;  1IX9 A;  3E9V A;  2P7V A;  3KMI A;  5JSL A;  2VCA A;  2CCY A;  1YDI A;  3RQG A;  3P30 A;  4EUK B;  1RJ9 B;  1K3E A;  4LF7 B;  4AL1 A;  1OCO B;  2L6H A;  3FMS A;  3M4C A;  1YVI A;  4I55 A;  5L3B A;  3R66 A;  3C63 A;  1G8M A;  4RO2 A;  1RPR A;  4I0X B;  4XTK A;  4AX2 A;  1DOV A;  5JQG A;  5IYC O;  1XNQ O;  3RVZ A;  3ZHR A;  3QTC A;  2D5R B;  1S7Z A;  4MVU A;  3L8I A;  4CDY A;  1OCZ B;  5KYY A;  5C8Y B;  3JYC A;  2WZL A;  1NQT A;  2QKS A;  3DXR A;  1QLE B;  2J9V A;  4OD5 A;  5KA5 A;  1N0N A;  3BFR A;  2G3V A;  1FKA O;  3CXH F;  1YTF D;  3OTO O;  1K4C C;  5LL6 Y;  3OR6 C;  3BPZ A;  4PDM A;  4ZBM A;  1PD0 A;  1MZF A;  2HZ8 A;  1J8Y F;  3DMD A;  4X64 B;  2XND G;  5DLJ A;  5EBW C;  4IYI A;  4PA4 A;  4U5B E;  3JCZ A;  1TQG A;  1V9P A;  1ORJ A;  1TUE B;  2HHH O;  1KTM A;  3LEO A;  2QSA A;  2GSM B;  1ORS C;  3W7U A;  3LS1 A;  1W59 A;  2GTA A;  3A0R A;  3HKD B;  3TK0 A;  2DYR B;  1RFY A;  2RN9 A;  2OTL V;  1FMV A;  3T1H B;  1V55 C;  3IQ5 A;  1BR2 A;  3JD0 A;  1A32 A;  5BZB A;  3B9Q A;  3POV A;  1VF6 A;  3KCX A;  5T3T A;  5B66 Z;  1S5L Z;  1F7Y A;  5JCO C;  2HP8 A;  2QM4 A;  5IWA O;  2ICW G;  3WOD F;  3LDC A;  1R1B A;  5H5N A;  5JP7 A;  4BJT A;  3ASN C;  3QF7 A;  3KYJ A;  1GAX A;  4D4N A;  2Q67 A;  3JSE O;  3J80 N;  1RJ9 A;  1SYQ A;  1LIH A;  4P9P A;  4G27 B;  4JAS A;  1TVK B;  2ITC C;  2WA3 A;  3JSN A;  3S84 A;  1WAS A;  3CEI A;  2ZXW B;  4D6T H;  2WVO A;  3OEO A;  1LI5 A;  4JTA B;  1RCP A;  3CCL V;  1NTK H;  4TQD A;  3K1I C;  1H8H G;  2UXC O;  4J7Y A;  4JIO A;  3UMH A;  1URF A;  4CSA A;  1FFT B;  5COF A;  1YAU O;  1HP8 A;  3VF0 A;  3MBG A;  3JCU Z;  4PAC A;  3CCQ V;  2FFH A;  3C7J A;  4LR3 A;  3V5Y A;  3JAK B;  3CRA A;  1JPX A;  2Y3G A;  1WN7 A;  3OMN B;  4DUZ B;  1NI8 A;  4MVQ A;  1D1B A;  1Q0K A;  4ABM A;  4OIN F;  1SZT A;  3ABM B;  2HKV A;  3BRC A;  2QE7 G;  2XT9 A;  4U5F E;  5CI9 A;  5FPO A;  2P5O A;  5KYU A;  3U11 A;  4ANJ A;  4X65 B;  4FJC C;  5AC5 A;  2W45 A;  3K6B A;  2OWO A;  3SPJ A;  1K5Q A;  1GM5 A;  4LDQ A;  2JIZ G;  3ZDL A;  1FXK A;  4O4H A;  3AG2 C;  2PX3 A;  2Q7R A;  5ITZ A;  2OCH A;  2CDY A;  4HNA B;  3RFY A;  1YJG A;  2KC3 A;  3M4B A;  5LHH A;  1CPY A;  3ABK C;  4RD9 A;  3WU2 Z;  1OHH G;  3D3Q A;  2NSG A;  2TMV P;  1U89 A;  2Y3D A;  4WGY A;  4G7O F;  5LHI A;  5JJJ B;  5CA1 B;  3GAN A;  3ABK B;  3HKE B;  4O4J B;  2QUP A;  4IAR A;  3VRC A;  1R3I C;  3J7A U;  3RWR D;  4KI2 A;  1NU1 H;  4I5S A;  4DR5 B;  1CPQ A;  1Q0D A;  3EGX A;  3SYQ A;  3SYN A;  2L6L A;  4H4K C;  3FAV B;  2Z15 A;  3L1M A;  3BEH A;  4DRX B;  2PFD A;  5JWP A;  3E8F A;  3EVK A;  3I5D A;  2BE5 F;  1LI7 A;  3CZ6 A;  1PKX A;  4E7Z A;  4BIO A;  1WWP A;  1NSG B;  4JTC B;  4Z1M G;  1HNX B;  4A5U B;  1I4Y A;  4WFA V;  4BJ1 A;  3U8V A;  1DTO A;  4UB6 Z;  2PZS A;  1Q0F A;  2YZS A;  1FJG O;  3BHP A;  4L6R A;  3APQ A;  4RUF A;  4N21 A;  2R9I A;  2ZM6 O;  2XLH A;  3J81 N;  3KPH A;  2ZE5 A;  5LGU A;  2FGY A;  5KYN A;  3P3N A;  2A1D D;  4NR1 A;  2F66 C;  4LF9 O;  5B5E Z;  4LF6 B;  3AK2 A;  3WFV A;  4U9E A;  3ZQV A;  2A7W A;  4PV1 B;  5IJ9 B;  1SER A;  3SR2 C;  2M6Y A;  3RYH A;  3CHX A;  4D4X A;  5JVD A;  4LF6 O;  1SQG A;  5IYZ A;  2F4V O;  1BQ0 A;  2XAG A;  4XDL A;  4G2K A;  3HPL C;  5LOV A;  1HNW B;  1H2L A;  3LNN A;  2J8W A;  4PHZ A;  5FCL A;  3DTU B;  3QVZ A;  4G0H A;  3O65 A;  1OCC B;  3C90 A;  4NXM B;  1Q81 W;  1YVW A;  2OJE D;  3B40 A;  2YWA A;  3DM5 A;  5T3W A;  1R73 A;  5KYW A;  5J2T A;  4CIH A;  1B3Q A;  1TGO A;  2NN4 A;  4LFA B;  1CGN A;  3CCU V;  3EGX B;  2L9J A;  3DM9 B;  3JAL B;  4ZOL A;  1OKK A;  2VWK A;  5IE9 A;  1T6Q A;  5B3S B;  1IBK O;  5JUA A;  2HLD G;  1AB3 A;  5J2U B;  3NYJ A;  2IU0 A;  2HHH B;  1FFH A;  4PA6 A;  1R3K C;  2YSU B;  1J8M F;  1NZE A;  2R02 A;  2YIB D;  4BIZ A;  3K06 A;  3H2U A;  1Z5V A;  3H65 A;  3K9S A;  3ZED A;  4BW5 A;  3PN1 A;  1Z7Q c;  4OD4 A;  3N27 A;  3FFQ A;  4DR3 B;  4K1O A;  2XAH A;  2IXN A;  4QNH B;  4K0D A;  4LCU C;  3O10 A;  4E18 A;  2VCB A;  4UCO A;  4DR2 O;  2Q69 A;  4GT1 A;  2W9Y A;  4MVM A;  3GEI A;  2XLW A;  2QDO A;  4UXN A;  4MTX A;  1O9G A;  4YT2 A;  4AK9 A;  4TT3 G;  4K35 A;  1KKC A;  1OXB A;  4C7O B;  4X88 A;  5AG2 A;  4I4T A;  3KKY A;  4MS2 A;  2L81 A;  3C3T A;  1LS1 A;  1I0H A;  4CH6 A;  2LSE A;  2P61 A;  1WN0 A;  5LOV B;  1KU2 A;  4LF4 O;  2QWN B;  4DV7 O;  2VS0 A;  2DOS A;  1MMN A;  1HNX O;  3B0U X;  2W0F C;  1FAP B;  2M4E A;  1W0J G;  1XOU A;  3DD7 A;  1YZB A;  2CDQ A;  2CK3 G;  4JI5 O;  5IJ9 A;  4YJ3 B;  2ZKO A;  1Z3I X;  1Y67 A;  4GX2 A;  3AGT A;  3Q4H B;  5J2U A;  1AJN A;  4E0I A;  1FFX A;  4IAO A;  2F1M A;  3JAR A;  1M57 C;  2W0X A;  4JAV A;  5H9C A;  1Y76 A;  1ZLZ A;  1GMG A;  2N04 A;  1D1C A;  2HSB A;  2BOC C;  2QE9 A;  4YY3 B;  1YJW V;  3QMK A;  1GQA A;  3CWB H;  3AG3 C;  1ST6 A;  4EB6 A;  1FXK C;  2QWP B;  2LK4 A;  3L34 A;  4JW1 A;  2DGJ A;  2Q9C A;  3WB2 A; 
#chains in the Genus database with same CATH homology
 1KQS U;  3CCS V;  2HV7 A;  2ZXP A;  3T4D A;  4XLN F;  1QVF U;  3TD7 A;  4PFO A;  5EHH A;  5DQZ A;  4JJG A;  2R7V A;  5CBG A;  1D0X A;  3SPC A;  3LEV A;  4F4L A;  2CNW A;  5KYX A;  3TET A;  3S0X A;  5B1N A;  1VQ5 V;  4ZLD A;  1QVG U;  4HFF B;  1K73 W;  4PJL A;  1D1A A;  3ZIB A;  3E89 A;  2J7P A;  2CGE A;  3E2E A;  4LLC A;  2XL4 A;  4HEA J;  2P6V A;  4DVZ A;  2W6J G;  4JUR I;  3STL C;  1VQO V;  4FK5 C;  2GHY A;  3H01 A;  1W2B U;  3EPV A;  4RDA A;  4FIP C;  1S3J A;  3K03 A;  2J45 A;  4C3E A;  5DVW A;  4QI2 A;  4OIQ F;  1P4R A;  3W7T A;  3E35 A;  2R7R A;  2ZR2 A;  3ZSU A;  5H6Q A;  2EBO A;  3W7X A;  3NYM A;  2NUP A;  2NUP B;  4UUJ C;  1NH2 B;  4BJ5 C;  5EK0 A;  4DBR A;  1OCC C;  2DWD C;  1S76 D;  3G6E V;  3K66 A;  4KUM A;  1VYI A;  3W2W A;  2KQ9 A;  5L3Q A;  1Z63 A;  1M56 C;  3VYW A;  4NY3 A;  5E2Q A;  3R65 A;  3CCR V;  1S5H C;  3D3I A;  3ZMV A;  1SF8 A;  1R6N A;  4CS9 C;  4BIU A;  4BJ5 A;  2ZR3 A;  1VQN V;  1EBO A;  4CZZ A;  3X1O A;  5L3C A;  1ZWI C;  2IU3 A;  3ECS A;  3FB6 C;  4H37 A;  2J0X A;  2MYS A;  1AI4 A;  2XAF A;  3K08 A;  4FMT A;  4JPR A;  2R7T A;  3UNG C;  4PEL A;  3K33 A;  2G3K A;  3DGE A;  2W4M A;  4ASU G;  1QBZ A;  3E70 C;  4HFK B;  3E8H A;  1Q86 W;  5DS5 A;  4ZLC A;  2PI5 A;  4WFE A;  3EGD B;  2Y69 C;  3D36 A;  3F5W C;  2C2A A;  3CSK A;  2HR3 A;  3LDE A;  3BY6 A;  3OUF A;  1E79 G;  4P6I C;  3TCU A;  1NVP B;  1BHB A;  1V54 C;  3ASO C;  1Z5Z A;  2XXA B;  3S29 A;  3CCE V;  3SYA A;  4U5D E;  3K1H A;  3OEE G;  3RH3 A;  1ZHW A;  2A6E F;  4K7B A;  2IJI A;  5J9P C;  3QO5 A;  3LAY A;  1Y4M A;  1K4D C;  1LKX A;  3CP1 A;  2F43 G;  5GW7 A;  4WFF A;  2EZP A;  2WLL A;  3SZR A;  3W8I A;  4MVR A;  5EC1 C;  4MTG A;  4DOZ A;  4WFG A;  4X89 A;  2QEX V;  3NRH A;  3Q6N A;  4OIR F;  5KYU B;  4GX0 A;  4P2Z A;  4P30 A;  4XDK A;  4RUE A;  2MK3 A;  1NJI W;  2W4B A;  4QE9 A;  3M1C B;  2C04 A;  1GKF A;  1P7B A;  4EBB A;  2J9U A;  2BOB C;  1EFR G;  1KC8 W;  4P9O A;  4CS8 A;  2JJ1 G;  2IJJ A;  1R6K A;  3ABM C;  1QR9 A;  1FXV A;  2Z5U A;  2WSS G;  3ZRW B;  1M2V B;  1PNK A;  1JQ0 A;  4H33 A;  1ZHT A;  4MVZ A;  2CNW D;  2R7O A;  3IGA C;  4FX5 A;  1NVP D;  4O6N A;  5F5F A;  1QCE A;  1CP9 A;  2A79 B;  1L1F A;  2A6H F;  2X51 A;  3QO8 A;  1TWG A;  4OXS A;  3CXC U;  5IYB O;  2O9X A;  1M57 B;  2EIL C;  2DWE C;  1Y66 A;  3AEI A;  4GX5 A;  3L0I A;  4O6M A;  4U5H A;  3LNR A;  2OCC B;  3EH1 A;  4U5G A;  1N8R W;  2R7W A;  3QZC A;  1ARO P;  4QDL A;  3RIP A;  3P32 A;  3GB7 C;  3SPI A;  4QJF B;  3M99 B;  3W7W A;  1PD1 A;  2W6I G;  3MHH C;  3JCU Q;  4GEH A;  3JD1 A;  4YN0 B;  3ZVR A;  2NNU A;  2Y69 B;  5DN6 G;  1DLB A;  3DJN B;  3I5Q A;  3RYL A;  1K5S A;  2MWQ A;  3SP1 A;  1VQK V;  4I1O B;  3ZRX A;  1JCH A;  3CME V;  3EZH A;  1H2G A;  1PD3 A;  4DXW A;  2IXO A;  4Q4Z F;  1GM9 A;  2DQ3 A;  1ZHX A;  4XLP F;  3WG7 B;  2R7Q A;  3LLI A;  4R6Z A;  4XDJ A;  3ZC4 A;  2EIJ C;  3I5P A;  4QI0 A;  5E33 A;  4YT4 A;  2GFH A;  3NKD A;  4BJ6 C;  1KKD A;  1AI5 A;  3ABL C;  5H6R A;  1H38 A;  3ML0 A;  1ZHZ A;  3GOD A;  3K0G A;  2WWW A;  4EWC A;  4E2L A;  4U5E E;  3G4S V;  2J0W A;  2Q68 A;  5L3G A;  3RVY A;  3B8N A;  4G28 B;  1YHQ V;  3E9V A;  4PDR A;  5B1B C;  1JJ2 U;  2H7O A;  2P7V A;  3KMI A;  3QNE A;  4MVO A;  1Q82 W;  2JDI G;  1MMA A;  2DYS B;  2XAS A;  3P30 A;  1RJ9 B;  1K3E A;  3F47 A;  1OCO B;  4MND A;  1FS0 G;  3W8H A;  3RKO F;  2EIJ B;  3N2Z B;  1PCX A;  2EIK B;  2IXM A;  5L3B A;  4U7N A;  4AE4 A;  1SET A;  3ZMT A;  4L87 A;  4ZKI A;  1G8M A;  1WPX A;  4RO2 A;  2NG1 A;  1RPR A;  3EG9 A;  4LBE C;  3I56 V;  4XTK A;  2JEU A;  4AX2 A;  2R9R B;  4HE8 D;  5IYC O;  3ZIA G;  1VQP V;  2EIN B;  5EGY A;  1NR7 A;  5E3C A;  3RVZ A;  5HFM A;  1KEC A;  3CC4 V;  2D5R B;  3E8B A;  4JTD B;  2A68 F;  2FTK A;  2QA4 V;  3MLG A;  1S7Z A;  5D92 A;  5T1D B;  4MVU A;  3ZMZ A;  2OCC C;  2ZXO A;  2EIM C;  3B0V C;  4PA3 A;  2P67 A;  3K3W A;  1OCZ B;  1OCR B;  4PA7 A;  3B77 A;  4UVC A;  4F4B A;  1DF4 A;  3JYC A;  1KD1 W;  1Z23 A;  2WZL A;  5KYY A;  3ZCC A;  1NQT A;  2QKS A;  3AQB A;  5HFL A;  3LES A;  1QLE B;  2J9V A;  4Q7C A;  3EZI A;  2K1E A;  4OD5 A;  3SYP A;  5KA5 A;  2IW5 A;  5L3D A;  5CBF A;  2A9H A;  1S77 D;  2G3V A;  3PJS K;  3SEO A;  4RQE A;  3CC7 V;  4BAY A;  1VK5 A;  1VMA A;  1YTF D;  4OIP F;  3ZMU A;  3DAG A;  1UJW B;  1K4C C;  3Q7G A;  1YJ9 V;  1O87 A;  1NBM G;  3OM3 B;  3OR6 C;  3OEH G;  2WZF A;  4ULW A;  2ZD9 A;  4PDM A;  1VQ9 V;  5IY5 C;  4ZBM A;  3LSS A;  1YI2 V;  3CYO A;  2J7P D;  1J8Y F;  3NYL A;  4FPP A;  3DMD A;  5LBQ A;  4J32 B;  2XND G;  3CPW U;  5DLJ A;  1WGW A;  1BL8 A;  5EBW C;  3DXJ F;  3UMI A;  1OCR C;  1SRY A;  1M90 W;  1RM1 C;  2ZXR A;  4PA4 A;  3UM7 A;  4J30 B;  4LER A;  3JCZ A;  4U5B E;  4BG0 A;  3SYC A;  1TUE B;  4PJM A;  2GSM B;  4C7O A;  3W7U A;  3LS1 A;  1J95 A;  3A0R A;  2WVN A;  4Q5S F;  3ZRV A;  3DJU B;  5KYX B;  1IZM A;  2DYR B;  1G8X A;  2OTL V;  1FMV A;  3JT1 A;  1V55 C;  3AG4 B;  3F7Y C;  1BR2 A;  3JD0 A;  2IJK A;  2QM7 A;  1SZI A;  3E8G A;  5BZB A;  1ZU4 A;  3NKE A;  3UMK A;  2KW3 C;  4Q20 A;  4WCE V;  3B9Q A;  1LNQ A;  4JCH A;  3T4Z A;  4PJN A;  3POV A;  2Q6A A;  3Q6M A;  1YJN V;  4PDL A;  1OCO C;  5T3T A;  3TK1 A;  1G4Y B;  1F4M A;  1S72 V;  3MHS C;  4HYO A;  5DM6 V;  3WOD F;  1AJQ A;  3LDC A;  4YWQ A;  2ZPA A;  3EHB B;  4BJT A;  3T4R A;  5LGT A;  3ASN C;  3UKM A;  2D3O W;  4FES A;  1I5X A;  3OE7 G;  4MQ9 F;  4JVS A;  4MW8 A;  1COW G;  2Q67 A;  3G71 V;  2Y39 A;  1OKK D;  1GM8 A;  1RJ9 A;  4YT8 A;  4KC9 A;  1IXM A;  2P7T C;  1YIJ V;  4P9P A;  3CCV V;  4G27 B;  4JAS A;  4O6Y A;  2ITC C;  4LAC B;  1VQ4 V;  2ZXW B;  2WVO A;  3OEO A;  5D91 A;  1K8A W;  1D0Y A;  4I1M A;  2ZDI C;  3SPG A;  3JD2 A;  2Q9A A;  1JX9 A;  4JTA B;  1SMY F;  3OUS A;  4LC1 A;  1K34 A;  2QM8 A;  3I55 V;  3CCL V;  2G62 A;  4WJ0 A;  2B0J A;  3K1I C;  1H8H G;  5CMU A;  5CN0 A;  2ZDI A;  3S28 A;  1TR2 A;  2NUT A;  3MD0 A;  3UMH A;  5EBL C;  3N24 A;  2WLI A;  4CBC A;  4CSA A;  1FFT B;  1YIT V;  1QR8 A;  2LP7 A;  3OAA G;  2Y3H A;  3NXS A;  2LFS A;  4R7C A;  3N0T A;  3T6J A;  2R7S A;  3CCQ V;  2ZQM A;  2FFH A;  1ZHY A;  1JPX A;  2WLK A;  2Y3G A;  2QY9 A;  2WLI B;  3OMN B;  2UXN A;  1FXH A;  3OW2 U;  4RBN A;  4MVQ A;  5B3S C;  3SYO A;  1NH2 D;  3RW0 A;  4PJJ A;  3NDB B;  1E1R G;  4UV9 A;  2Y48 A;  1D1B A;  3VAY A;  2PP4 A;  3ETG A;  3JSZ A;  3LDD A;  4OIN F;  4XWJ A;  1SZT A;  1FXK B;  4G7Z F;  3ABM B;  1PNM A;  2QE7 G;  3FYI B;  4U5F E;  5EBM C;  3SPH A;  1R3L C;  2DYS C;  4AE4 B;  5CI9 A;  3CQZ A;  5KYU A;  4JYB A;  5EC2 C;  3LLK A;  4PDV A;  3FHD A;  4ANJ A;  2UXX A;  1K92 A;  2WLL B;  4FJC C;  3GWO A;  2W45 A;  3K6B A;  4DBQ A;  3SPJ A;  1NU9 C;  1K5Q A;  5KYW B;  3KKB A;  3AG1 C;  4OIO F;  1M56 B;  4QPJ A;  2JIZ G;  1FXK A;  2I8B A;  3AG2 C;  1NKD A;  3OMA B;  2PX3 A;  5CA3 A;  2XRH A;  2C03 A;  2XXA A;  4EKW A;  5B1O A;  1Z6A A;  1M1K W;  3RFY A;  4O79 A;  3LNM B;  1K7D A;  5LHH A;  4JYC A;  2H94 A;  5E1A C;  2E87 A;  1TWC A;  2XSE A;  1CPY A;  2B5U A;  3ABK C;  2V1D A;  4RD9 A;  4YJW A;  2V3C C;  2R7U A;  4IWB A;  1OHH G;  2VAS A;  2P90 A;  3JD4 A;  3I4U A;  2AHZ A;  4RAI A;  4RQF A;  1VQL V;  1TWH A;  2Y3D A;  4CBE A;  2M7W A;  3EQL F;  3LSQ A;  5C93 A;  4JF3 A;  4G7O F;  1AR1 B;  5LHI A;  1K97 A;  1JPN A;  4U7O A;  3AG4 C;  4X8A A;  1MND A;  3GAN A;  3ZG1 A;  1F4N A;  2IH1 C;  3W7S A;  3ABK B;  2IH3 C;  3OA1 A;  3OMI B;  1GTO A;  1R3I C;  1AI6 A;  2VH3 A;  4I5S A;  3LUT B;  4QE7 A;  2WVQ A;  1AI7 A;  3EGX A;  4KI2 A;  3SYQ A;  1JPJ A;  3DAF A;  3SYN A;  4H4K C;  1KP3 A;  4MTO A;  2JEX A;  1FMW A;  1BR4 A;  2DQ0 A;  2NLJ C;  2Z15 A;  3X2Q C;  3BEH A;  3IC7 A;  2PFD A;  2B1I A;  2XOK G;  3OWT A;  3DZA A;  3AG3 B;  3E8F A;  2X6A A;  4O7G A;  2LFR A;  2BE5 F;  3E83 A;  3LS0 A;  2DW4 A;  4JZA A;  4N06 A;  4MVS A;  1MNE A;  3CZ6 A;  3CCM V;  1MMD A;  4MW3 A;  4UVB A;  1PKX A;  4E7Z A;  2EZO A;  3ETE A;  1ROP A;  2VB6 A;  2IXP A;  2YEV A;  4JTC B;  4Z1M G;  1ZU5 A;  3JRT A;  1JVM A;  4A2N B;  3VOU A;  2HJF C;  4WFA V;  4BJ1 A;  4E7S A;  2V26 A;  1DTO A;  1QLE C;  3AQC A;  4BEJ A;  4J9Y B;  4UVA A;  1W2W A;  1F51 A;  2YZS A;  4RUF A;  4N21 A;  1OCZ C;  2R9I A;  2WZG A;  4KNW A;  5LGU A;  2FGY A;  3ASO B;  1V54 B;  2WLH A;  4GCZ A;  3IEE A;  5KYN A;  3HJC A;  2A1D D;  5HSW A;  3F7V C;  3OFN G;  4R8C A;  4DO2 A;  2HV6 A;  2EIN C;  1CEZ A;  1FFT C;  3WFV A;  1TKN A;  2HKO A;  3V7O A;  5DS4 A;  3PHF 2;  1GK9 A;  4MT8 A;  3EFF K;  3FB5 C;  1SER A;  4GYT A;  3QO7 A;  1M2O A;  4HAM A;  3ABT A;  4QIW F;  4JAU A;  1O5H A;  3PMR A;  2WLN A;  3EGD A;  5KA6 A;  1MMG A;  2WLM A;  2V7Q G;  3KL4 A;  1YSC A;  5B1A C;  1MSW D;  4GX1 A;  1GM7 A;  2XAG A;  4XDL A;  1EZJ A;  2ZXW C;  4G2K A;  1MG1 A;  3E86 A;  3HPL C;  3Q7L A;  4DVY P;  2H8P C;  2PI4 A;  1NR1 A;  3K04 A;  3ITF A;  1GO3 F;  4R50 A;  2X7R B;  3JYH A;  5B1B B;  5FCL A;  3DTU B;  3F46 A;  3ZN1 A;  3SJQ C;  3AG1 B;  4CS9 A;  2HVK C;  4U5C E;  2P6J A;  4G0H A;  1OCC B;  5CBH A;  1THZ A;  3JD3 A;  1ZYR F;  5KUM A;  3T1C A;  1Q81 W;  1BHA A;  2Q3T A;  5T3W A;  3DM5 A;  4M63 A;  1R73 A;  1XL4 A;  3OGC C;  4JGS A;  3STZ C;  5KYW A;  1IW7 F;  4CIH A;  1NG1 A;  3FB8 C;  5B1A B;  4WFH A;  3CCU V;  3EGX B;  2WAM A;  1E1Q G;  1NU7 D;  2L9J A;  1S0V A;  3DM9 B;  1RPO A;  2A69 F;  3EHN A;  2HFE C;  1VQ8 V;  1VQ7 V;  4G7H F;  1OKK A;  4TWK A;  5B3S B;  4LP8 A;  3CMA V;  2JD3 A;  2HLD G;  1OZ0 A;  3S27 A;  5FL7 G;  3KH2 A;  3NYJ A;  2IU0 A;  1FFH A;  3K7D A;  4PA6 A;  1R3K C;  2YSU B;  1J8M F;  4MTF A;  1NZE A;  3O39 A;  3K0D A;  4PA9 A;  1K33 A;  3B0P A;  4BIZ A;  3CC2 V;  3EH2 A;  1SES A;  3K06 A;  3HLZ A;  2B1G A;  2R7X A;  2HG5 C;  1RM1 B;  3IFX A;  1TWA A;  4BW5 A;  2IOQ A;  3H65 A;  1YTF B;  1XL6 A;  2WLJ A;  3K9A A;  5E3A A;  5DQT A;  1N1C A;  2YEV B;  3O6X A;  4OD4 A;  5L3V A;  1K9M W;  3EFO A;  1BMF G;  2J46 A;  5LGN A;  2QTV A;  2YHS A;  2XAH A;  2IXN A;  2EIK C;  4QNH B;  4K0D A;  4YT5 A;  1DF5 A;  4B6I A;  5IY5 B;  4I9W A;  1QLN A;  2H7V C;  4LCU C;  2Q9B A;  3HTK C;  1VQM V;  2CW0 F;  2J9W A;  2Q69 A;  4GT1 A;  1PL0 A;  4N23 A;  3CCJ V;  1FTS A;  1M9N A;  4MVM A;  2W9Y A;  4JJF A;  4X0R A;  4UXN A;  4MTX A;  4WF9 V;  1H8E G;  2IJH A;  4AK9 A;  4TT3 G;  4YT2 A;  2KJG A;  3ZN0 A;  4C3B A;  1F23 A;  3W2V A;  2WPD G;  5KUK A;  4I44 A;  4C7O B;  3FAJ A;  1ENV A;  4X88 A;  3UGP A;  4YXW G;  1VQ6 V;  1AJP A;  5DS6 A;  4W8K A;  2KGO A;  3ASN B;  4MS2 A;  4WFB V;  2L81 A;  3FKS G;  1LS1 A;  4LLE A;  3OR7 C;  4CS8 C;  2AHY A;  1VOM A;  2X0L A;  3ABU A;  2LSE A;  3T2M A;  2A0L A;  5L3F A;  4CSA C;  3VBB A;  2Y3B A;  3LJB A;  4UV8 A;  1KU2 A;  2EJR A;  5KYY B;  1MMN A;  5F5H A;  3ZJZ A;  2W0F C;  3B0U X;  1WLE A;  3RBZ A;  1V55 B;  3ZRS A;  2M4E A;  1ORQ C;  1W0J G;  2WL8 A;  3DD7 A;  4KBL A;  5IDJ A;  4MSW C;  1I5Y A;  3FB7 C;  2DYR C;  3EJN A;  2CDQ A;  2CK3 G;  4PK4 A;  2ATK C;  1HWY A;  1Z3I X;  4GX2 A;  1Q7Y W;  3T6B A;  3FVY A;  4C3D A;  5BUO A;  2PX0 A;  4HZ3 A;  3NG1 A;  1AJN A;  1JOY A;  2Z3Y A;  4TSF G;  3FYE B;  4IAO A;  1M2V A;  3EG9 B;  3FDQ A;  2NUT B;  1M57 C;  2EIL B;  2OTJ V;  4FWV A;  4BJ6 A;  1D0Z A;  5IYD O;  5CI8 A;  3AG2 B;  4JAV A;  3ZMS A;  2KB1 A;  4KFM A;  3B8M A;  2HVJ C;  5H9C A;  1KP2 A;  1PNL A;  2XAJ A;  2XAQ A;  4IJJ A;  3UGO A;  3CD6 V;  3K79 A;  1GMG A;  1LVK A;  1D1C A;  2QTO A;  2JK5 C;  2X6B A;  3HB3 B;  5L3E A;  1B6Q A;  1MAB G;  1VYK A;  3EHM A;  2BOC C;  4IRU A;  3ABL B;  3ZRW A;  2JJ2 G;  2WB7 A;  5LHG A;  1YJW V;  4J9Z B;  4XBF A;  1BR1 A;  2OT5 A;  1R3J C;  1QZX A;  2PF4 E;  3MX3 A;  4PFP A;  3QMK A;  3KG2 A;  3WG7 C;  4KNV A;  2ITD C;  3UR3 C;  3AG3 C;  1ST6 A;  3ETD A;  1FXK C;  2KNH A;  2IYL D;  2OG2 A;  1W0K G;  3X2Q B;  4CS7 A;  3L34 A;  4JW1 A;  4QPK A;  4I3M A;  2DGJ A;  2Q9C A;  2X6C A;  3EFO B;  2H7B A;  2EIM B;  1PD0 A;  1MOF A;  3SNH A;  4KP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...