1M56C

Structure of cytochrome c oxidase from rhodobactor sphaeroides (wild type)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
265
structure length
265
Chain Sequence
AHAKNHDYHILPPSIWPFMASVGAFVMLFGAVLWMHGSGPWMGLIGLVVVLYTMFGWWSDVVTESLEGDHTPVVRLGLRWGFILFIMSEVMFFSAWFWSFFKHALYPMGPESPIIDGIFPPEGIITFDPWHLPLINTLILLCSGCAATWAHHALVHENNRRDVAWGLALAIALGALFTVFQAYEYSHAAFGFAGNIYGANFFMATGFHGFHVIVGTIFLLVCLIRVQRGHFTPEKHVGFEAAIWYWHFVDVVWLFLFASIYIWGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-ray crystal structures of wild-type and EQ(I-286) mutant cytochrome c oxidases from Rhodobacter sphaeroides.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords CYTOCHROME C OXIDASE
total genus 101
structure length 265
sequence length 265
chains with identical sequence I
ec nomenclature
pdb deposition date 2002-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00510 COX3 Cytochrome c oxidase subunit III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1m56C01
1.20.120.80 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1m56C02
3T4ZA 2HJFC 2Q6AA 3E89A 3OUSA 2EILC 3ABKC 4PA4A 3SPCA 2X6BA 3ABMC 3LDEA 2R9RB 4R8CA 1K4DC 4X8AA 3LDCA 3RVYA 3IFXA 3T4DA 1R3IC 2WLJA 2W0FC 3JYCA 2P7TC 3AG2C 3AG4C 3PJSK 3OR7C 4R50A 1OCCC 3K04A 3AG3C 4JTCB 3KG2A 2Q67A 1XL4A 4GX5A 5CBFA 2QKSA 2HG5C 4HYOA 3SYQA 2HVKC 3UKMA 4R7CA 5B3SC 4JTDB 3EFFK 2EINC 5B1AC 3SPJA 1BL8A 5EC1C 1R3JC 3F5WC 1M56C 2X6AA 3LNMB 3ZRSA 4WFHA 5E1AC 3AG1C 5EBMC 2H8PC 3LDDA 2ITCC 2Y69C 2JK5C 4MVRA 5KUMA 3RVZA 3OR6C 4X88A 3SYPA 3E83A 1ZWIC 4HZ3A 4MVMA 4RUFA 2DYSC 4GX1A 4J9YB 3X2QC 4I9WA 3K0GA 2Q69A 3OUFA 4MTOA 4RUEA 4TWKA 1P7BA 2ITDC 2ZD9A 3GB7C 2WLNA 3BEHA 4PDLA 4JTAB 2OCCC 4PA7A 4XDKA 3UM7A 4DXWA 1OCRC 4PDRA 3ABLC 3LUTB 2AHYA 4PA6A 4MW8A 3SPGA 3TCUA 5BZBA 2A79B 4MSWC 1V54C 3E86A 1ORQC 2WLKA 3STLC 4CBCA 3IGAC 2DYRC 3FB8C 3HPLC 3SYCA 4BW5A 3SYOA 4P9PA 4PDVA 4QNHB 4EKWA 4MVZA 2WLLA 3SJQC 1S5HC 1KKDA 4MTGA 2HVJC 4LP8A 3FB7C 3K06A 2WLHA 4P30A 1V55C 3ASOC 3OGCC 2A0LA 4PA3A 4RAIA 4MVOA 3VOUA 2DWDC 5CBHA 3K03A 1R3LC 3ZJZA 1XL6A 1M57C 4ZBMA 4QE7A 4LCUC 2K1EA 4G28B 3E8FA 4OXSA 4WFFA 2YEVA 4MW3A 3SYAA 2KB1A 3RW0A 4XDLA 3E8GA 3ASNC 5EBLC 2AHZA 4G27B 4P2ZA 3F7VC 4H33A 4MTFA 2WLIB 2EIJC 2WLLB 3K08A 3SPIA 2NLJC 5J9PC 2IH1C 2X6CA 2HFEC 4X89A 3E8BA 4PDMA 2WLMA 3F7YC 4UUJC 4WFEA 5EK0A 3R65A 4P9OA 5EC2C 3STZC 2DWEC 2WLIA 1FFTC 2EIMC 1QLEC 1R3KC 1J95A 4MS2A 3FB5C 3WG7C 5CBGA 2Q68A 1G4YB 1OCZC 4GX0A 4PA9A 4R6ZA 2A9HA 2BOCC 4J9ZB 4F4LA 4MVSA 1JVMA 4QE9A 2IH3C 2QTOA 2ZXWC 4MVUA 4RO2A 3T1CA 3SPHA 3T2MA 3FB6C 4KFMA 3E8HA 2ATKC 4WFGA 5EBWC 4GX2A 5B1BC 3TETA 1LNQA 3K0DA 3RBZA 5IY5C 4XDJA 2EIKC 4H37A 4LBEC 1K4CC 2BOBC 1OCOC 4MVQA 5KUKA
chains in the Genus database with same CATH superfamily
1K40A 2Q00A 1YTFB 3APOA 1Q7YW 5KHIA 2Q6AA 2QA4V 4U3JA 1D1CA 2Z0AA 3ZHSA 1WP7A 1Z5VA 5J2TB 3E70C 4E0IA 3GVMA 4L8JA 1L1FA 5LHHA 2B5UA 3L8IA 4YT4A 1VQ7V 1SR2A 5FNVB 3MLGA 5HSWA 1NSGB 2ZE8A 5LOVA 2XS1A 3QG5A 2W4BA 3KKBA 3QTHA 3ZQYA 4TUYB 1LIHA 2PP4A 4MQ9F 2YICA 5JVDA 2WZGA 2ITCC 2E5LO 2Y69C 3DTUB 4MVRA 1YVWA 2N04A 5AC5A 2UUAB 1HNXB 1TFKB 2FAPB 3CS5A 1VLTA 3UGOA 4W8KA 2I15A 1T6IA 4GYCB 2GWWA 2HMQA 3AJMA 3DM5A 1GQAA 3H1JH 2NN4A 1WNSA 2PUSA 2MHRA 3K7DA 5E79Z 3RYHB 3ZTZA 1SQXH 2XM0A 5IJ9A 4I55A 3B0VC 4X62O 4LFAO 2WLLA 5JVDB 1SQFA 3QNEA 3OMIB 2A0BA 4ZLCA 1IX9A 1ZW2A 3TK0A 3Q4HA 1XNRO 1FTSA 1I7FA 3W7XA 1BQ0A 1VARA 5DQZA 2M7WA 2AHZA 2XLVA 2P7VA 1S0VA 3CAXA 4NXNB 3FXHA 3NMKA 1KU2A 1NBMG 1MSDA 1AVOB 3L34A 4UB6Z 4X9QA 4W8PA 4IIJA 4NTWA 1A7VA 5J2TA 1PM9A 2DWEC 4EFBA 3EHMA 3M8AA 1V54B 3OEOA 1RXQA 2QWNB 4PA9A 4NYKA 5KLVH 1WLEA 4DRIB 1NR7A 1OV9A 4X1IA 5LL6Y 1UG7A 2FL4A 1MA1A 4DRHB 5GTHZ 2QGNA 4UCSA 3S84A 3SPHA 3G4ZA 1MZEA 4DVYP 1EKYA 1FR0A 4WFGA 3ASOB 3HKCA 3GODA 3LLKA 1Q6HA 4TT3G 3C18A 1M2VB 4RDAA 1NZ6A 4QI2A 1U96A 2BTOA 5C8YB 1LKXA 3T1HO 1NTKH 2F1MA 1Y66A 3G50A 4M63A 2F23A 4P6IC 1R6NA 4X8AA 1QQCA 2E87A 2YQYA 2GTSA 1PP9H 4OPAA 2VQEO 3B40A 2ETSA 3EPVA 4FFBB 1ZHTA 3KG2A 5IJ0A 1G5ZA 2GHYA 1RKCA 4B3MO 1XZPA 1B6QA 2CYDA 4CS9C 4WABA 3CC4V 2BTQB 3JCUQ 5GTIZ 2KKWA 2PGGA 3UCSC 4U5GA 1Y4CA 4KBLA 2P6VA 3X1OA 4DR1O 2J9VA 3AG1C 5BQIA 3W7WA 3LDDA 4A5UB 5LA6A 5KA6A 1G8XA 1JOGA 3Q6NA 3TOLA 1YJNV 2YXLA 3OT7A 1OCZB 1XHXA 4X64O 2XSEA 3GORA 4H54A 4JE9A 4TQFA 4DRXB 3S28A 4D7TA 1F4MA 3HNKA 3K59A 1MMGA 1HNZB 3BEHA 1I4ZA 3TD7A 3ZEDA 4ANJA 1FMVA 1YDIA 2NUPB 1Y74B 1YCIA 1BHBA 5KYWA 2FYUH 1TFOB 1ORSC 2IJIA 1XOUA 2QSAA 2QEXV 1E1RG 4Q7CA 3KL4A 1I4YA 3UGPA 5KYXA 2A0LA 2Q4FA 3GEIA 3CB2A 1L3PA 2Q7EA 2OYQA 4WFFA 1FXHA 5BR8B 2YHSA 3GM1A 1IBKB 1AP6A 2AU5A 4PJMA 2AW9A 5EIBD 2VCBA 1Y76B 1XUQA 5A9GA 4EBKA 4YJ2A 3LSQA 4G7ZF 1CGNA 3AEIA 5EK0A 4BG0A 1Y67A 3NG1A 1GM8A 3CCQV 2NUTA 4W4LA 4XLPF 3F46A 1L8DA 3FOOA 5BQHA 2CTPA 3RQFA 1YZCA 3JSLA 1K05A 1I08A 4CH5A 2LFRA 4DRXA 4MVSA 1JVMA 2YVKA 2HMZA 3EZIA 3T6JA 4KFMA 3K66A 3JAMN 2MYSA 1YDXA 1BCCH 5B1BC 2YKZA 3JATA 5KHKA 3N0TA 3IQ6A 2BE3A 1J8YF 3PDMP 4XDJA 1RMVA 2QKAA 2L6FA 1PD1A 1OCOC 4GKJB 3HKEA 3IHUA 3ZC4A 2HV7A 2CCYA 1H8HG 4CS4A 2Q7HA 2F66C 1O87A 1WOLA 2QWRB 2R9RB 3LDCA 4XEVA 4ZLDA 2F43G 3FKSG 2ZXPA 1MMAA 2W0FC 2ZPAA 4GEHA 3EFOB 4J11A 2XAHA 1YI2V 1JAFA 1H2SB 2Q67A 4RBNA 2EX3A 2D2CB 3C3TA 2RDCA 2QKSA 2BSKA 2HEPA 3WG7B 2Q5ZA 2XT9A 3A8TA 4TV8B 4GCZA 3IQCA 1SERA 1SC5B 5IYCO 3SZRA 1WB7A 3HJCA 4Z1VA 2A6EF 4DR7O 4ABMA 2EPNA 1JQ0A 5E1AC 2UU9O 4DW0A 3L1MA 3B0PA 3BA8A 4EUKB 2A7WA 3ZRWA 3CEIA 4MNDA 1V9PA 3HKDB 2GTAA 3EGDA 4J80A 4QI0A 4FFKA 3K6BA 2RNBA 3OUFA 4JAAA 4IYIA 2CH7B 2ZD9A 3UMIA 3RQEA 3RFYA 4LFCO 1OKKA 4PA7A 2KYHA 2V26A 2H3OA 2NUTB 1N8RW 2O57A 3E86A 4YT2A 5IE9A 2H7VC 3R7CA 4JI2B 3FB8C 1D1BA 3UNGC 3JRTA 2PZSA 3RFRA 1D0YA 1B04A 1V55C 4TV9A 4J7KA 4NQFA 1Z2GA 3SYAA 1Y6DA 2KB1A 1RKEA 4DK1A 3HNLA 3CCMV 5L0HA 2A06H 1W0KG 1ZSPA 4O4HA 5L0JA 1FS0G 3NXSA 4IJJA 1YA7O 1M57B 4DV0O 1GKFA 1YF2A 5B1AB 3E8BA 4PDMA 4CDVA 2WLMA 4YL3A 4WFEA 3ASNB 1QHTA 2LGQA 4IHJB 3EH2A 4YJ3B 2MW2B 4MS2A 4DV5O 4G0HA 5LBQA 4KC9A 2R25A 2ZM6B 2LW1A 3CE2A 3T1CA 3ETDA 5L0GA 5EZYA 3JAWA 4ZHQB 4NR1A 4RQEA 3SYNA 4DUZO 1YXBA 1BZ4A 5A2QN 1SQGA 2DMXA 2HSQA 3K0DA 3UMHA 4ZI7A 4YIPA 2CGNA 4KHPO 1BZKA 3ETGA 3A9CA 4H37A 5JQGB 1NVPD 3CD6V 3JT1A 3QVZA 2KC3A 1AP5A 5H2FZ 4AI8A 2P06A 3ZHVA 2JPUA 1JJOA 1EZVH 2X6BA 2C04A 2GA0A 1OZ0A 2UUCO 2CH7A 2DOSA 3CCEV 3L70H 3S3XA 3ZCCA 3K3WA 3AK3A 1I5XA 1MNDA 3BA9A 2UXXA 2CTRA 3CJHB 3SNHA 4R50A 1ZZPA 1TWGA 1FJGO 5JRAA 1D5AA 2EIJB 4F4BA 4LH6A 1YHQV 3UKMA 1JMWA 3EG9A 1VF6C 3EFFK 4L87A 2RN9A 1KQSU 1R3JC 4CSAC 3AQBA 3LNMB 1N36O 3LAYA 4K1OA 3JD4A 4YK5A 4J42A 5JJJB 3RVZA 3KCXA 4FWVA 2QWPB 3P3PA 1ZLZA 1NQTA 1FFXB 1S72V 4ONSA 3TK1A 4QPJA 5B66Z 5IYZB 5CA1A 2A69F 4RUFA 2DYSC 2Z5UA 4YJ2B 4NTYA 4LDKA 2OEVA 1GM7A 4LLEA 3UMKA 2KW3C 3BRCA 4X62B 4PD4F 2WLNA 1EM1A 5L0IA 1Q86W 1O3UA 2OCCC 3K1IC 1NZEA 1FJGB 2KQ9A 2H8AA 3FYEB 1XILA 4JI8O 4JCHA 1IBMO 4DVZA 2UUBO 4FMTA 3F5TA 3CX5F 2O9XA 2ZR3A 4PDVA 3TJTA 4FVMA 2YLGA 2QWQB 2ZNIA 2QNLA 4OIPF 5KYWB 1OXBA 4JI8B 4BPMA 4OXSA 4RD9A 3E8FA 3N2GB 1Q0DA 1SKVA 4XDLA 2W6JG 2KG7B 2L81A 3C8ZA 1ST6A 4JRZA 3FAVA 4U5BE 4MTFA 2J45A 4IYHA 2B9ZA 1KB9F 2NLJC 1YITV 1E84A 1VQPV 3NMJA 4X89A 1AJPA 1U6HA 4G7OF 3MHHC 1PCXA 3RGBA 3FMSA 3A0HZ 1CGOA 5F28E 1WP8A 4HE8D 1GK9A 1K5SA 3OWTA 4FLVA 2A9HA 4UVBA 1M2VA 1VF5B 2ILMA 2GSMB 1XMOB 4DV1B 3MHSC 3TETA 1P49A 1NU1H 3C7JA 1MZFA 5L3FA 1NTMH 3CHXA 4XEFA 4X1IB 2OOCA 4FX5A 2YDEA 1QVXA 4DV4O 3SXZA 1NKDA 1KBHA 2DYRB 3RYIA 4DJ9A 3K5MA 3P3NA 3DE9A 3LDEA 4XQ1A 4DR7B 1K4DC 1FXKA 3EGXA 2DYSB 3J80N 3JAKB 2B0HA 2WVQA 4XBFA 4CDYA 2PBEA 1SRYA 2FB5A 3KMIA 1FKAO 3BY6A 1T01A 3HKCB 3FAVB 3NYLA 1MNGA 5CBFA 5IDJA 5TJ5E 2GFHA 1SA0B 1E83A 2CGEA 1AI7A 3NKDA 1DF5A 1HMOA 5B3SC 4CH4A 4C7OA 4LWSB 3N2GA 4BR6A 1BMFG 4WJ0A 3CC2V 3B77A 2CGOA 5KUMA 2IM9A 1NVPB 3BFRA 4IL6Z 4PHZA 2XLOA 3WFVA 4HZ3A 1XDCA 5H6RA 3VQXA 4D7SA 4DR1B 4J9YB 2XASA 1OKKD 4FZ0A 1XEQA 2HSBA 1BR4A 3M79A 4I7ZB 1XNQO 5D92A 1VMGA 3N27A 4UCRA 3H1HH 4PDLA 3DI5A 5DLJA 1Z23A 2G3KA 4LR3A 4N06A 4C3EA 4GZRB 3PN1A 1JR9A 2GDSA 2R7RA 4O4IB 3PHF2 1AVMA 2IU0A 4O6NA 4BW5A 3CMEV 2WZLA 3DXRA 1O9GA 2WLHA 4CS8C 1IXMA 1FAFA 4LF5B 3K03A 1Y74A 4LCUC 4H0LB 2YEVA 3DAGA 2V4DA 5IWAO 2RSEB 3I55V 4TV9B 5KYNA 2BCCH 1WWPA 3ZN0A 2YC0A 3CRQA 3B8NA 1QR9A 1ZU5A 4EBJA 1PNKA 3ZIAG 5BMVA 2HFEC 2RD9A 5LP6C 2IXNA 2L9JA 4CH6A 3QVYA 3JAKA 2WLIA 4AHCA 3CEXA 1E86A 3CCUV 5KYUA 4IT5A 2WVOA 2D3OW 2ADQB 3AGTA 3JSZA 3K5LA 5JJEB 4DOZA 3B29A 2HUJA 1C17M 2GV9A 1XWJA 1GM9A 3BAAA 3GWLA 2J9WA 4QE9A 3I5PA 3TXSA 4LF8B 3RYCA 3RYLA 1HR0B 1MOFA 1IBMB 4YWQA 3MAQA 3L9DA 3ZBHA 1IBKO 5GONA 4I55B 3DXJF 3ZMSA 4GYTA 2KJGA 4B3TB 3C8GB 2X51A 3EVKA 3ZSUA 4IGGA 4Z9HA 4FZ1A 2Q9LA 1JPJA 2XUMA 2ADPA 3O9OA 4JEBA 3ABKC 1H2NA 4BJ5C 3SXYA 5B1OA 1R3IC 1AUEA 3QO8A 1T9KA 1EZJA 1VP7A 5D5QA 4G7HF 2RCVA 3S9OA 3ZRXA 5KMGB 3CCRV 3Q7GA 4TQDA 1VEWA 4Q4ZF 1IURA 5KA5A 3CMAV 1ZUQA 1SQVH 3W8IA 4JYBA 1Z7Qc 4PELA 3UO3A 4Q5SF 1L7CA 1MMDA 4YXWG 3MYFA 2ZR2A 4B3TO 4HEAJ 3I4UA 5T1DB 2YL3A 2P22C 4NXNO 1P7GA 4ZOLA 2OIGA 3ZMZA 1HW2A 3RYFB 3LEVA 3IQ5A 1ZWIC 4N4WA 2C03A 1Y6XA 4I4TA 1HP8A 4GX1A 1N33O 4LF7B 2HJ3A 3D3IA 2CK3G 4PFOA 3ETQA 3K0GA 5FCLA 4E18A 3M99B 2ITDC 2VQFO 3L72H 1AJNA 3QW0A 4YN0B 5KX5B 3FFQA 3U3FA 5EGYA 3ABLC 1NR1A 3LUTB 3SPGA 3EZHA 3CCVV 2VC9A 3ZX6A 1ORQC 4CBCA 3STLC 2G3VA 2JGDA 1R6TA 2VQFB 2R7OA 4P9PA 1Q82W 4JI0B 1UJWB 2DI3A 3SJQC 4PJ0Z 1H2LA 2Y39A 3DJUB 2V7QG 1LUWA 2DWDC 1QVFU 2YSUB 4J7JA 1H9GA 1TVKA 4U5HA 1LS1A 4X65B 2DW4A 1VK5A 3RF3A 1BDJB 3X2QB 4DW1A 4K8XA 2EPLX 5BXZA 4JI7O 1M6TA 1K3EA 4AE4B 4YJ3A 2JJ1G 4FLYA 4UUJC 1BQZA 3BPZA 3QO5A 4D4NA 1ROPA 3R65A 2LW7A 3FX7A 2WSSG 2Y0IA 1JR8A 3VQVA 1OR3A 256BA 3AK2A 2R9IA 3ZMTA 4JI0O 2OTLV 4IB4A 1PPJH 4B3SB 1TWHA 4MVUA 1OCOB 5FNVA 3SXKA 1WA8A 1CPQA 4G78A 3JCUZ 1LNQA 5LA6B 2VS0A 2E74B 1IXBA 4KL1A 2D4UA 5LMUO 1N0JA 2ZDIA 4JPRA 2Q3TA 4O4LA 5HV9A 2KSDA 5LYJA 3KZIZ 2HLDG 5KAIZ 1M93A 1IZ3A 1PNMA 1GMGA 3CSXA 4GUNA 3K33A 3T4DA 4U5FE 2WLJA 3JYCA 3OFNG 2ARHA 5H5NA 3OR7C 4GT1A 1A41A 1SZXA 4DBQA 5EHHA 5LMNB 4AE4A 2GUZB 4EFEA 3G4SV 3H2VA 3LNNA 3JARB 1JJ2U 3T1YO 2R9AA 1B06A 1JOYA 2QKCA 3VRCA 5EC1C 3DJNB 5DS6A 4KXRA 2ODMA 3SJCC 1HR0O 3G67A 1E1QG 3FDQA 1QLNA 3G6EV 2J0WA 1WB8A 4CSAA 3QMKA 3LSUA 5CB4A 3E83A 4QPKA 2ZE6A 3RT3C 4EWCA 3WB0A 3X2QC 1N36B 4U5EE 4FLTA 5J2UB 1QBZA 1QVGU 1KMIZ 3GB7C 4WFBV 1YYXA 5AGFA 3UO2A 3QVNA 1IVSA 4B3RB 4UB8Z 4DV6B 1RPRA 2CUGA 1NJIW 1ZVZA 4I1OB 4WF9V 3G71V 4DXWA 1PV3A 5DM6V 2HS5A 3JYHA 4JIOA 2XL4A 2PI4A 4XTKA 2Z15A 3U2LA 3V5ZA 2J46A 4WBNB 4YY3O 1TWAA 5JCOA 1WPXA 2YI8A 1XHZA 3O39A 1Q0FA 2ZE7A 4MTGA 1SF8A 4WCEV 4FESA 1B3QA 2P4VA 1XL6A 2UUBB 5COMA 2E3CA 4YL0A 2W6IG 2PI5A 3ASNC 3IAYA 3TGUH 4B08A 4LF8O 2OG2A 1QKRA 2LFSA 4NKGB 3D8CA 3O65A 2ZKOA 4LLCA 1GAXA 4DV6O 1N4CA 2Y0PA 4I5SA 3EHBB 4X1YB 1FD9A 4P9OA 3OAAG 1FFTC 2EIMC 5A6BD 4GKJO 3Q7LA 1XMOO 5CBGA 1R1BA 1G4YB 1LR1A 1QNMA 1ZHYA 1YSCA 2QM7A 2EZPA 3BRJA 4J9ZB 3L8JA 3K58A 2XL8A 2TMVP 1Q5OA 3JARA 4U7OA 1QQ3A 1VQLV 1VQ9V 3T1HB 5EBWC 1VQ5V 4JI1B 3DSQA 4GX2A 1PD0A 3H9VA 1OCRB 5JJNB 3U8VA 2XNDG 3FHDA 4WBNA 3W2WA 4NB5A 4NTXA 4MVQA 4K0KO 2E76B 2AZ0A 1VYIA 2HJFC 2KSFA 4JI3B 2F4VB 4Q20A 1DF4A 1SQBH 5C93A 1LM3B 2IBZH 3VQYA 2A68F 3RVYA 1B68A 5LP6B 4PFPA 2V3CC 2UXDO 5KYYB 1EN4A 5J2UA 2YS8A 5JT4A 4KNWA 1YEWA 4JI6O 3AG4C 1VQ4V 2YWAA 4LFBO 2AP3A 3K04A 3QF7A 2Y3DA 2GBOA 4CS8A 4LF7O 3Q6MA 2W0XA 1Q81W 1ZHZA 3CXHF 2IJKA 3R66A 3JAWB 4FK5C 2Y69B 1BT8A 1Q0GA 4E0HA 1K5QA 3AG3B 3K9AA 1ZYRF 1DOWA 1CPYA 1XNQB 2R02A 4UV9A 3GWKC 3CQZA 1T5OA 2CDQA 2DE0X 1YJWV 2OCCB 2QWOB 2WZFA 1K9MW 4DR5B 3ABKB 3OA1A 5L3GA 3ITFA 4YIOA 2ASRA 1GRJA 2LO1A 1LVKA 1WAZA 4DR4B 1NFNA 3IC7A 2XHBA 4I0XB 1G6UA 4MW8A 3AG7A 2XXAB 1ENVA 2EIMB 1HWYA 3HPLC 1K97A 4CH3A 4AILC 1VQNV 2R7UA 3T6BA 1ORJA 3ETEA 1S5HC 2P67A 1YYJA 3HTKC 4E2LA 2XM4A 1H9TA 4HNAB 5CBHA 3Q4HB 4QE7A 4G28B 1R6KA 1PD3A 1Q8IA 1MQVA 1J5EO 4WFAV 2PX3A 4BJ6A 4G27B 4P2ZA 1H6GA 3CCJV 2IW5A 2WLIB 1TUBA 3W7TA 1SYQA 2YL0A 1I94B 4Z9JA 5BMVB 4EIYA 3OMNB 1BS3A 1Z5WA 2VB6A 4N23A 3BABA 3M1CB 1S76D 3UR3C 5COFA 4PJNA 3RQGA 4IRUA 5JWPA 1Q0KA 1ZL8B 3DKAA 2Y3GA 4F4LA 1MMMA 1IDSA 4J41A 1R4TA 4GKKO 3L75H 2H7OA 4A4AA 3DXRB 3JD2A 3HNJA 4PK4A 4ER9A 4L6RA 4QIWF 2J7PA 2EIKC 2YIBD 1MMNA 2PFDA 2OIEA 2Q0AA 3W7SA 1VTMP 3V7OA 4CC5A 4X64B 2R03A 3O10A 4P9FA 3ZDLA 2N05A 3S90A 1S7ZA 4BJ6C 3CWBH 3C8GA 2NR5A 1GM5A 2P5OA 1OCCC 4BWAA 1D1AA 1A32A 4GX5A 2JVDA 3M7MX 3KH2A 2EULA 4BEMJ 3GM2A 3U0CA 4R7CA 1CXZB 1AI4A 4CS7A 3JD3A 4JASA 3H65A 2ZCEA 2W9YA 3HLZA 1N33B 4C3BA 5JQGA 3ZRSA 1H8EG 3S29A 1NLXA 4JZAA 4AQYO 4H44B 4NTAA 3OR6C 5BR8O 4JI5O 4X88A 1YAUO 5EYPA 2VWJA 4O6YA 4MVMA 4X20B 1IBLB 1BR2A 4DV4B 3O6XA 1ZL8A 2D5RB 2OT5A 2ZINA 2WA4A 3JASA 4KNVA 4I50B 1NTZH 2A1DD 1WGWA 2PNOA 1X4TA 4JGSA 3MYIA 2WL8A 1ZX3A 2WLKA 3RWRD 2J9BA 1HE9A 5FLXN 4PACA 2DYRC 2X0CA 1JFFB 2JIZG 5LGNA 3JD0A 1I5YA 2JGDB 3NDBB 5IJ9B 3OGCC 3VQWA 4LACB 2IJHA 4FM2A 1QU7A 4C7OB 1W2BU 3MX3A 3B0UX 1EA8A 4PI0A 1E85A 1FXVA 2C2AA 1TKNA 1S3JA 5B3SB 1QPUA 4IIJB 4I4TB 1N32B 5K0IA 1EN5A 3CJHA 3G80A 3JALB 1PL4A 1YZAA 3JYYA 3KYIA 1J95A 3AG2B 3ML0A 2IXMA 3JRMO 1OCZC 2PX0A 1S77D 4CDAA 2YLDA 1WPBA 2ZIOA 1YVIA 3L0IA 1U0BB 2VRZA 1BHAA 1M4UA 4OD4A 5LHGA 3FB6C 1SQQH 2P6JA 1W0JG 3HB3B 1S05A 5H6QA 3E9VA 4KUMA 1SZIA 1KTMA 2JD3A 4B3MB 3ZTMA 1CGME 3DE8A 1GN3A 2M64A 4I50A 2ZT9B 5GW7A 2J7PD 2OKUA 2VCAA 1RP3B 2XAGA 3OMAB 5D5PA 2LIGA 4R8CA 5BUOA 5T3TA 4LF6B 1YIJV 3MFNA 3IFXA 4Z1MG 1JPXA 3WB1A 3EFOA 4DV1O 5GONB 4DV3B 2IOQA 5KYYA 4IWBA 2NG1A 2PYLA 4JV5B 1OW8A 2HG5C 4HYOA 1THZA 1MNEA 2Q0OC 2UUHA 1RKEB 1FPOA 3SPJA 3B4SA 4O4LB 1UFIA 3CPWU 1SETA 5BQGA 2H8PC 2KNHA 1N0NA 4XPYA 3W8HA 1GS9A 3JALA 3GWOA 1A7EA 1F4NA 1H2MA 4EB6A 4OX9O 1M5IA 4TWKA 3M4CA 2NSGA 2WB7A 4EBBA 3EQLF 4X1KB 3JTLO 3RKOF 2R7VA 1YLMA 1QLEB 1PKXA 1LE2A 5IY5B 1AI6A 1M9NA 4MSWC 1N34B 4K8ZA 2W4MA 1AJQA 5CB4B 1HNWO 2G38A 1BR1A 1D0ZA 4MVZA 3A2FA 3CC7V 4NXMB 2CNWD 4ZHQA 3PCVA 2P4KA 3VOUA 5ITZB 3K9SA 1O5HA 1HW1A 2FTKA 3ZJZA 2JJ2G 3VYWA 1GTOA 1M57C 1TVKB 4J7ZA 5BY1A 5K1PA 4U5CE 4F6RB 4R32A 4D6TH 5JSLA 1CPRA 2VCCA 3LEOA 2F95B 2L6GA 3JD1A 3HR0A 5KYXB 5EBLC 4BIOA 4KP4A 3KKYA 1O9HA 1T6QA 1NU7D 4IARA 3U2MA 3SP1A 5J9PC 5JLIA 3SXMA 3ABMB 2VH3A 2KK1A 4U7NA 4FAPB 1LI7A 3HKKA 5EC2C 1Y4MA 2XAFA 3STZC 5JH7A 1UPGA 1K73W 3DZAA 3U5SA 2R7WA 2XRHA 2Y48A 4DUYB 1AEPA 1IW7F 5CIVA 4X1KA 1VQ8V 2HHHB 2IXPA 3CSKA 3L73H 1LPEA 5IYBO 5COGA 3OGIB 1NT2B 4EB6B 2J8WA 3C90A 5D91A 2IH3C 2QTOA 3ZMUA 5E3AA 1QR8A 4JURI 2ATKC 4ZI7B 2P61A 3U8PA 4N6HA 1XNRB 3B8MA 3QO7A 3FAPB 2BOBC 1LUVA 3SR2C 3T4ZA 2OQMA 3H01A 1WATA 2PY5A 4NVPA 2XLWA 4FPPA 2EILC 4WGYA 4PA4A 2UUAO 3OTOB 3AGUA 1V55B 4N6CA 2UXCO 1K33A 3WAQA 2DQ0A 3I5DA 4X1YA 3EGDB 4JKVA 2HHHO 5L0CA 3K1IA 5IYZA 2LK4A 4NTBA 2ZXWB 5DQTA 4Z2WA 3NYMA 1KP2A 1AR4A 5JP7A 3U9MA 3OM3B 1AILA 4JZGA 4YT5A 3EJNA 2PTMA 1BGYH 4LFBB 3F5WC 1WASA 3DGEA 2BSKB 4CS2A 4XEKA 3NMIA 5A6KA 2BC5A 1TGOA 1WA8B 1Q0MA 4O2BB 1QZXA 4I9WA 2NUPA 4MTOA 4MT8A 1DK1A 2FFHA 4LF9O 2R70A 4JI6B 3V5YA 5JUAA 3J06A 2CE4A 4O7GA 3UM7A 1BE3H 4DBRA 4O79A 5LYJB 2EZOA 4UCUA 2AHYA 3US6A 3HKBA 1OCCB 5BZBA 4LF6O 2A79B 2LFFA 2MK3A 1VQKV 4CJOA 3HKDA 2EINB 4ASUG 1LE4A 2IM8A 4FM0A 5FPRA 4CIHA 2CTQA 3K06A 4PA3A 4UVAA 3CP1A 4H4KC 3E35A 2XXAA 2YLIA 2L6HA 4I0XA 2R7XA 4U3FH 2RQ6A 4J7YA 3O55A 1AI5A 1WJZA 2EJ7A 5CA0B 3SPIA 5IJ0B 4YT8A 1MSWD 1YA9A 2YIAA 2X6CA 5LXTA 4J32B 2X7RB 2EILB 2Q9BA 3WU2Z 3F7YC 3R2PA 3RYHA 3TJ6A 3U10A 1M56B 3FB5C 1TR2A 3H2UA 4GX0A 3K79A 3NRHA 3VAYA 1VB5A 4YHHB 4IAOA 4BJ1A 4JI7B 3AOUA 1P84F 2ZXWC 4O6MA 5JS5A 2UXNA 5DS4A 2YI9A 4UFZA 1F23A 2LJ2A 4DV0B 3B71A 3CRRA 4ZOLB 4FLXA 3LS1A 4TSFG 4BIZA 4ICGA 4DYLA 4CX9A 2Z3YA 4JV5O 2EBOA 1RSOB 2OTJV 2Q9AA 3RIPA 4O4JB 4LWSA 1NBBA 1JCHA 1F7YA 2HZ8A 3WB2A 1US6A 1TAEA 1ORYA 2XAJA 4E7ZA 2LQGA 3C8GD 4I1MA 4DR3O 5CI9A 1T6UA 2R72A 4QJFB 3C62A 3LS0A 2GDCA 4YY3B 2HJMA 3F47A 3V5XA 3RYFA 3U11A 2EPOA 3AG3C 4YHHO 1FXKB 4DR6B 4OX9B 4JW1A 2IJJA 1E2XA 3CRMA 1KKCA 4GKKB 3P32A 1V74B 2HVKC 4AX2A 4JTDB 2EINC 5B1AC 1XZQA 3AK1A 4OIOF 4WGZA 3KCYA 2B1GA 4PI2A 2BE5F 3MBGA 3E22A 2CTWA 1KECA 4J30B 3W7UA 2B1IA 2QY9A 4LF4B 4HBNA 3SDLA 2DJVA 1Z63A 4O4IA 3LJBA 5CA0A 3W2VA 2Q69A 2R7QA 4RUEA 1RJ9B 3T1YB 1F51A 3UQ8A 4X66O 4PDRA 4QGPA 1M90W 2JRIA 2E5LB 4X65O 4P9TA 1GH6A 1KKDA 3KPHA 1AR5A 1RM1C 3FB7C 2KG7A 4ZBMA 5IYDO 1TQGA 3CRAA 1S5LZ 3E8GA 1IZMA 5H9CA 2XLHA 3QW1A 5CI8A 5KYUB 3ZQVA 3OEEG 2M6YA 1D5NA 1A7DA 3JZ0A 3T6GB 2R7SA 4FJCC 2MWQA 3VF0A 4EHPA 4LH7A 3ICXA 1A0BA 1YJGA 4OD5A 1L0NH 4U3JB 5CN0A 1YZBA 2EPKX 5LHIA 3U0ZA 1N32O 1SMYF 3K5OA 1J8MF 3N2KB 4JF3A 2AVKA 1N1CA 4PR9A 2OJQA 3IQTA 4Z9IA 2QDOA 5DN6G 5CMUA 1KUQA 5DS5A 3CRCA 3E8HA 4KI2A 1KC8W 5T3WA 3TJ5A 2K9PA 5KMGA 4FLWA 4Q6GA 1Z3IX 2HJDA 5B5EZ 2HKVA 2PYJA 1PV0A 4FM1A 1HNXO 1W2WA 1W59A 3RYCB 2NNUA 4NCQA 4YL1A 2OU6A 1SS3A 5GPGB 5KX5A 2QTVA 3BCCH 1Q90D 3BVOA 5LOVB 1WTYA 5HFMA 3DC5A 1S5JA 1SA0A 3H1KH 1VMAA 3APQA 1I5NA 1VLSA 1WN0A 4CBEA 4PV1B 3CZ6A 2VWKA 2H7BA 1T5EA 4JI4O 1TUBB 1VF7A 5L3BA 2ICWG 4UVCA 4DO2A 2W45A 4JC7A 2Y3BA 4AL0A 1PNLA 3CCSV 3IEEA 3CCLV 2WVNA 4PJLA 4X0RA 1ZTEA 1EN6A 1K34A 5L3CA 4U9DA 4OPHA 5LMUB 2UXDB 2F22A 3K1HA 4BEJA 2ZXOA 1ZHWA 2LQTA 3I56V 4JYCA 4K7BA 1KU9A 2QE9A 3WODF 2QJ1A 5K1XA 4NC3A 1V4AA 1EI7A 5L3DA 4DR2B 3ABLB 4LERA 2ETNA 3N2ZB 2QTSA 1MG1A 4CS9A 1K92A 3N2KA 2JDIG 1APCA 2L7AA 4JTAB 1HDJA 2YEVB 1QSPA 4PA6A 3MD0A 4DR3B 4NY3A 2VASA 1KP3A 2XS8A 4BJ5A 1OXKA 3KYJA 5FPOA 3SYCA 3THOA 1VF6A 4DV2O 1JPNA 4A2NB 4EKWA 3IC9A 1JFFA 3BHPA 2ZNJA 2HVJC 4N21A 4DR5O 3DAFA 5L3EA 4RAIA 4UV8A 1PL0A 3C63A 1HNZO 4G2KA 4E17A 5L3VA 2K1EA 5JVEA 2UUIA 3JASB 5AG2A 5IT9N 3LESA 2KGOA 1JRAA 2UXBO 3K08A 5CA3A 2Q4PA 4AQYB 1RPOA 2LP7A 2P1AA 1VQMV 4JVSA 2ZIMA 3TOMA 2YIDA 3NR7A 1G8MA 1NFOA 1Z6AA 3QTCA 2J9UA 3EHNA 2HV6A 3A0RA 4XPXA 2BOCC 4B7KA 1H7IA 4HAMA 1RSOA 2OJED 5B3IA 3WG7C 4HNAA 4CS3A 3JCZA 4UCVA 3N24A 3J7AU 2OCHA 3U9JA 3ZRWB 4FFBA 2X0LA 1E79G 3ZN1A 4ZKIA 2DQ3A 3S3WA 3GANA 1K4CC 5KUKA 2DB4A 4K3AA 1IBLO 3OUSA 3DM9B 4OIQF 1OR2A 1DTOA 1GN6A 3RYIB 4E4EA 3EXAA 1D2DA 3TXQA 5EIBC 3TQOA 3PMRA 1Z5ZA 1ZW3A 3HNIA 2RMKB 1URFA 3J81N 4K0DA 3CYOA 3LLIA 5F5FA 2YZSA 4LC1A 4O4HB 2QM4A 1GN2A 2AZ2A 4TUYA 5JCOC 1HE1A 2B0JA 1BL8A 1OW6A 4O2AB 2X6AA 2JS3A 4WFHA 2GAQA 1SF9A 2JK5C 2HR3A 3JATB 4C3DA 1NG1A 4YJWA 1TWCA 4DR4O 4FLUA 3ZG1A 2DN9A 3GWNA 1G4WR 1XQ8A 2Q73A 4GQHA 2NPUA 1BBHA 3AG1B 4H13B 1XI1A 1MABG 2E75B 4CIPA 1U97A 2M4EA 5KHGA 4NTFA 2EJRA 2QE7G 2IXOA 3WHNA 3NKEA 2AXTZ 4ZIBA 5E2QA 4IHJA 2R05A 4K35A 4JCZA 1FXKC 1LI5A 4O2BA 3G4XA 2AWCA 3MDSA 4PJJA 2PF4E 1J5EB 1FFXA 4BW9A 2JS5A 1G1XB 3K57A 1DGSA 4LNUB 4P30A 3I5QA 4XWJA 4BIUA 1NH2D 3ABUA 4DV5B 4BAYA 4JI1O 2ZE5A 4RQFA 1HY5A 1OJHA 1KYOF 1P4RA 4H33A 4U9EA 1NH2B 3OW2U 1KNYA 1OQCA 3M4BA 5E33A 1Q6IA 5EYPB 3ZS8C 1BSMA 2IU3A 5AC4A 4XPWA 3CXCU 2IYLD 2WPDG 2ZDIC 3SEOA 2CDYA 2JEXA 4UCOA 4GLXA 1K04A 4IAQA 5LGTA 2G62A 5F2VO 2J0XA 1ZAUA 3FYIB 4O4JA 4R6ZA 2UUCB 3EG9B 3ZIBA 4RO2A 1N34O 2UU9B 2KQXA 4JI2O 2Q7RA 2YIBA 3D3QA 1VQ6V 5DECA 3NYJA 5IWAB 1U89A 1HMDA 5FL7G 2Q7GA 5IY5C 3OD4A 1COWG 2YXYA 4DR2O 4LBEC 2YL7A 2Y4UA 1TA8A 3DC6A 3ZWIA 1SZTA 5KHHA 3E89A 4TV8A 4FIPC 3AG4B 1XMQO 1I94O 1YTFD 1C02A 2A0UA 2L35A 4OGQB 4B3SO 5JH7B 5B1NA 5A6JA 1EBOA 3JSNA 3AG2C 2LGWA 2JX0A 1VQOV 1XMQB 3T9OA 3E22B 2RJZA 1LS4A 5L0FA 1XL4A 1SESA 2QLAA 3M15A 4CC6A 4W4KA 3OEHG 3C3SA 3SJBC 3TULA 2VQEB 4B7EA 1CEZA 3A0BZ 2Q9CA 1R5ID 2QM8A 1OW7A 3OE7G 4LNUA 2UXBB 4JJGA 4LDQA 3H1IH 2XLMA 2IBFA 3ATPA 4UCTA 3IJ4A 3VM6A 4NXMO 3FVYA 4QDLA 3L74H 5LMNO 3AQCA 3GEHA 4I3MA 1P7BA 4BJTA 3OTFA 5DEDA 4CJGA 1L0LH 2JEUA 3L71H 2XL6A 4DK0A 1OHHG 3H1LH 2XTAA 3RN4A 3D36A 3TCUA 5LGUA 1V54C 1QCEA 1WN7A 3IGAC 1M1KW 3QZCA 3SYOA 1NI8A 2N74A 3UT5A 1M2OA 4X66B 1H2KA 2LD6A 5EZYB 3ASOC 3GEEA 3GM3A 1Q6UA 4DUYO 1DOVA 4E7SA 1R3LC 4DV7O 4JYYA 3SGIA 5FZTA 1YARO 3DMDA 4LF4O 4JEAA 2OEXA 4JAUA 1VYKA 4J10A 3FAJA 2EIJC 2WLLB 2UXCB 4JZ2A 4LF5O 1UFBA 2IH1C 5CA1B 2DGJA 4JYAB 5LXTB 2LCHA 1DLBA 4I44A 2CNWA 4OINF 4K0KB 1QLEC 2QUPA 2FKXA 1X59A 3B2EE 1ZU4A 2L6LA 2V1DA 2XOKG 4JAVA 2AWYA 5A6AA 3OTOO 3T2MA 3FOPA 1GN4A 2XLDA 4DV7B 3UT5B 4XLNF 5KAFZ 2F93B 2CW0F 3RBZA 1JX9A 2FGYA 2WA3A 3JSEO 1AR1B 3HKBB 5L0DA 5LP6A 1VIBA 3LNRA 1JMKC 4HFKB 4DV3O 4JYAO 4JI5B 3SPCA 3ABMC 4AK9A 4OIRF 5A69A 2LP4A 3K5NA 1Q43A 3HKEB 2NSFA 3D36C 1EQ1A 4HFFB 5A6BA 1CP9A 1HW7A 2BL2A 3PJSK 2P7TC 1FFHA 5E3CA 3S27A 3ZHTA 3ZMVA 4D4XA 4JTCB 4LFAB 1SQPH 2CAZC 2ZQMA 1AB3A 1G4US 2Y3HA 1GGQA 5L3QA 3EH1A 5F5HA 4C7UA 3W4YA 2I8BA 1TUEB 4RWUA 3SYQA 1NU9C 4O2AA 3B09A 4JI3O 2F4VO 1RFYA 1FYJA 1R73A 4JI4B 2XAQA 1M56C 3P30A 2XLEA 2LSEA 1RCPA 3DWWA 5ITZA 5EBMC 2GUZA 3FD9A 2LFDA 1FMWA 2WAMA 1C03A 3SYPA 4UXNA 4ULWA 1XREA 1XBLA 2JGUA 3ECSA 3A11A 1HNWB 4EEQA 3SJAC 4MTXA 1Q3EA 2AGAA 4F6RA 4AL1A 4XDKA 3T4RA 2EIKB 5C8YA 1OCRC 1K8AW 4X20A 1RM1B 2P0NA 2EPMX 2P90A 2QR4A 4LFCB 4ULVA 4QNHB 4FLZA 3ABTA 3IPMO 3B9QA 1AROP 4LP8A 4B6IA 3LSSA 4CZZA 4MVOA 5B1BB 4LF9B 1ZHXA 1F1MA 3DD7A 3RH3A 1VOMA 1EFRG 2ZXRA 4MW3A 4DV2B 2Q8VA 3RW0A 3ZHRA 2BTQA 4KHPB 5DVWA 1H38A 1K7DA 2FMLA 3ZRVA 2H94A 1FAPB 3F7VC 2YRFA 1H2GA 2YUAA 1FNTc 4I9QA 4B3RO 2YXHA 2ZM6O 4U5DE 4TOIA 4JJFA 1I0HA 3VBBA 2WWWA 3ZHQA 3POVA 4DR6O 3EGXB 1KD1W 1D0XA 2Y4TA 1R3KC 1Y76A 2A3QA 4DUZB 3ZHUA 2Q68A 4J7TA 4LDRA 2A6HF 3ZVRA 2OWOA 1RJ9A 5KHJA 2HFIA 3U3BA 3G6BA 1FFTB 4F6EA 4DRJB 3E2EA 3S0XA 2HP8A 2YL1A 1YJ9V 4UDVA 2R7TA 5TISZ 1GO3F 1NS1A 2HKOA 5HFLA 1JA8A
chains in the Genus database with same CATH topology
4FX5A 1YTFB 1Q7YW 1NKDA 3W7SA 2QTVA 2Q6AA 2QA4V 2DYRB 3V7OA 5HFMA 1D1CA 1VMAA 3LDEA 1K4DC 1FXKA 3EGXA 2DYSB 4DBRA 1S7ZA 3E70C 2WVQA 4XBFA 4BJ6C 4CBEA 1SRYA 1L1FA 3CZ6A 2H7BA 5LHHA 3KMIA 2B5UA 1OCCC 3BY6A 1D1AA 4YT4A 3NYLA 5L3BA 4GX5A 4UVCA 4DO2A 5CBFA 5IDJA 1VQ7V 2GFHA 2W45A 2Y3BA 1PNLA 3CCSV 3IEEA 3KH2A 2CGEA 1AI7A 3NKDA 3CCLV 2WVNA 1DF5A 3MLGA 4R7CA 5B3SC 4PJLA 4X0RA 5HSWA 4C7OA 1AI4A 2W4BA 3KKBA 4CS7A 4WJ0A 1BMFG 3JD3A 4JASA 3CC2V 3H65A 1K34A 3B77A 5L3CA 2W9YA 3HLZA 4C3BA 2PP4A 4MQ9F 3ZRSA 1H8EG 3K1HA 3S29A 4BEJA 2WZGA 2ITCC 2ZXOA 2Y69C 1ZHWA 3DTUB 4JYCA 4MVRA 5KUMA 3I56V 1NVPB 4K7BA 4JZAA 3WODF 3OR6C 4X88A 5L3DA 3WFVA 4HZ3A 4CSAC 3ABLB 4MVMA 5H6RA 1OKKD 1WGWA 4J9YB 2XASA 3N2ZB 4LERA 4O6YA 1MG1A 1BR4A 4CS9A 1K92A 1BR2A 3UGOA 3O6XA 5D92A 4W8KA 2D5RB 2OT5A 2JDIG 5DLJA 4PDLA 4JTAB 1Z23A 3DM5A 2G3KA 4KNVA 2YEVB 4N06A 4C3EA 4PA6A 3MD0A 2A1DD 2R7RA 4I1OB 3K7DA 4JGSA 2WL8A 4NY3A 2VASA 1KP3A 2WLKA 3PHF2 4BJ5A 2IU0A 4O6NA 2DYRC 4BW5A 3B0VC 3SYCA 1JPNA 4A2NB 3CMEV 4EKWA 2WLLA 2JIZG 2WZLA 5LGNA 3JD0A 4N21A 1I5YA 2HVJC 3DAFA 4J30B 4XTKA 5L3EA 2WLHA 4RAIA 3OGCC 3NDBB 4LACB 4UV8A 2IJHA 4CS8C 1IXMA 1PL0A 3QNEA 3K03A 4G2KA 5L3VA 3OMIB 4LCUC 2K1EA 4ZLCA 2YEVA 3DAGA 4C7OB 1FTSA 1W2BU 3MX3A 3B0UX 3W7XA 5DQZA 3I55V 5KYNA 2M7WA 3LESA 3ZN0A 1FXVA 2AHZA 2C2AA 1S3JA 1TKNA 2KGOA 2P7VA 1S0VA 3B8NA 1QR9A 3K08A 5CA3A 1ZU5A 5B3SB 1PNKA 1KU2A 3ZIAG 1NBMG 3L34A 1RPOA 2HFEC 2LP7A 2IXNA 2L9JA 1VQMV 4JVSA 2DWEC 2WLIA 3CCUV 5KYUA 1J95A 2WVOA 1G8MA 3AG2B 2D3OW 3ML0A 3EHMA 2IXMA 1V54B 1Z6AA 2IYLD 3JSZA 3OEOA 1OCZC 4DOZA 4PA9A 2J9UA 3EHNA 2HV6A 1GM9A 3A0RA 1S77D 1WLEA 2BOCC 2PX0A 1NR7A 2J9WA 4HAMA 4QE9A 3WG7C 3I5PA 3L0IA 3RYLA 3SPHA 1BHAA 4OD4A 1MOFA 3JCZA 5LHGA 3FB6C 2P6JA 4DVYP 1W0JG 4WFGA 3ASOB 3N24A 4YWQA 3HB3B 3ZRWB 5H6QA 3GODA 2X0LA 3E9VA 3LLKA 1E79G 4KUMA 1SZIA 4TT3G 3ZN1A 4ZKIA 2DQ3A 3ZMSA 2JD3A 2KJGA 1M2VB 3DXJF 3GANA 4GYTA 4RDAA 1K4CC 2X51A 5KUKA 4QI2A 3ZSUA 1LKXA 5GW7A 1JPJA 3OUSA 2J7PD 1Y66A 3DM9B 4OIQF 1DTOA 2XAGA 3ABKC 4M63A 4P6IC 3OMAB 1R6NA 4R8CA 4BJ5C 4X8AA 5BUOA 5T3TA 2E87A 1YIJV 5B1OA 3IFXA 1R3IC 1JPXA 4Z1MG 3EFOA 3PMRA 3QO8A 1Z5ZA 1EZJA 4K0DA 3CYOA 4G7HF 3LLIA 3EPVA 2IOQA 3ZRXA 1ZHTA 3KG2A 5KYYA 3CCRV 2GHYA 2NG1A 2YZSA 4LC1A 3Q7GA 4IWBA 4Q4ZF 5KA5A 1B6QA 4CS9C 3CMAV 3CC4V 2HG5C 4HYOA 1THZA 1MNEA 3JCUQ 3W8IA 4JYBA 3SPJA 2B0JA 1BL8A 4PELA 4KBLA 4U5GA 4Q5SF 2P6VA 3X1OA 1MMDA 2X6AA 3CPWU 4YXWG 1SETA 2J9VA 2ZR2A 4WFHA 3AG1C 4HEAJ 2H8PC 2KNHA 3I4UA 3W7WA 3LDDA 5T1DB 2JK5C 2HR3A 5KA6A 1G8XA 3W8HA 3Q6NA 1NG1A 4YJWA 4C3DA 3ZMZA 1YJNV 1TWCA 3LEVA 3ZG1A 1OCZB 2XSEA 3GWOA 1ZWIC 2C03A 4GX1A 1F4NA 4PFOA 3AG1B 2CK3G 3D3IA 3S28A 1F4MA 3K0GA 5FCLA 1MMGA 1MABG 4TWKA 3M99B 2ITDC 2M4EA 2WB7A 3BEHA 4EBBA 1AJNA 3EQLF 2EJRA 4YN0B 2QE7G 3RKOF 2IXOA 3TD7A 2R7VA 3NKEA 4ANJA 5EGYA 1QLEB 1PKXA 1NR1A 3ABLC 3LUTB 3SPGA 1AI6A 1M9NA 5IY5B 1FMVA 4MSWC 3CCVV 2NUPB 5E2QA 1FXKC 1ORQC 4CBCA 3STLC 1BHBA 2W4MA 4PJJA 5KYWA 1AJQA 2G3VA 3EZHA 2PF4E 2IJIA 2R7OA 1BR1A 4P9PA 1Q82W 1D0ZA 1UJWB 4MVZA 3SJQC 2Y39A 2QEXV 3CC7V 2CNWD 1E1RG 3DJUB 4P30A 2V7QG 4Q7CA 3VOUA 3I5QA 3KL4A 1O5HA 4XWJA 2A0LA 4BIUA 1NH2D 3ABUA 3RH3A 2DWDC 2FTKA 1QVFU 3ZJZA 2JJ2G 2YSUB 1GTOA 1M57C 4BAYA 3VYWA 4WFFA 1FXHA 2YHSA 1LS1A 4U5HA 4OIOF 4U5CE 4RQFA 2DW4A 1VK5A 5KYXB 3JD1A 3X2QB 5EBLC 4PJMA 1P4RA 1K3EA 4KP4A 4AE4B 4H33A 1NH2B 3OW2U 1NU7D 2JJ1G 3SP1A 5J9PC 3LSQA 5E33A 3ABMB 4G7ZF 2VH3A 3AEIA 4U7NA 2IU3A 4UUJC 5EK0A 3QO5A 4BG0A 3NG1A 1ROPA 3R65A 3CXCU 1Y4MA 1GM8A 2XAFA 2WPDG 2ZDIC 5EC2C 3STZC 2WSSG 2JEXA 3CCQV 1K73W 2XRHA 3DZAA 2Y48A 3F46A 2NUTA 3SEOA 4XLPF 1IW7F 5LGTA 2G62A 1VQ8V 2IXPA 3CSKA 2J0XA 2R9IA 3ZMTA 5IYBO 3FYIB 2OTLV 4R6ZA 3EG9B 2LFRA 3ZIBA 5D91A 4MVSA 1JVMA 4RO2A 2IH3C 2QTOA 4MVUA 3ZMUA 1OCOB 1TWHA 5E3AA 1QR8A 3EZIA 4JURI 3T6JA 4KFMA 3K66A 2ATKC 2MYSA 1VQ6V 5B1BC 3NYJA 1LNQA 3B8MA 3N0TA 5FL7G 5IY5C 1J8YF 3QO7A 4XDJA 1COWG 2ZDIA 4LBEC 1PD1A 2BOBC 1OCOC 4JPRA 2Q3TA 3T4ZA 3ZC4A 3H01A 1SZTA 2HV7A 1H8HG 3E89A 2HLDG 3AG4B 4FIPC 4FPPA 2EILC 1YTFD 4PA4A 1PNMA 1O87A 1GMGA 2R9RB 1V55B 3LDCA 4ZLDA 1K33A 5B1NA 3K33A 2DQ0A 2F43G 3T4DA 4U5FE 3FKSG 2ZXPA 3EGDB 2WLJA 1EBOA 2W0FC 3AG2C 3JYCA 3OFNG 1MMAA 2ZPAA 1VQOV 3EFOB 4GEHA 3OR7C 2XAHA 4GT1A 1YI2V 4DBQA 2Q67A 4RBNA 2ZXWB 1XL4A 1SESA 5EHHA 4AE4A 5DQTA 3NYMA 3G4SV 1KP2A 2QKSA 3WG7B 1JJ2U 3OEHG 3OM3B 4GCZA 4YT5A 3EJNA 1SERA 1JOYA 5IYCO 5EC1C 3SZRA 1CEZA 2Q9CA 3F5WC 3DJNB 3HJCA 3DGEA 2A6EF 2QM8A 5DS6A 1JQ0A 5E1AC 3OE7G 3B0PA 1E1QG 3FDQA 4JJGA 1QLNA 3G6EV 2J0WA 3ZRWA 4CSAA 3QMKA 4MNDA 3E83A 4QPKA 3EGDA 3FVYA 4QDLA 4U5EE 3X2QC 1QZXA 3K6BA 4QI0A 4I9WA 4EWCA 1QBZA 3OUFA 4MTOA 1QVGU 2NUPA 4MT8A 3AQCA 2FFHA 4I3MA 1P7BA 2ZD9A 3GB7C 4WFBV 3UMIA 4BJTA 3RFYA 4O7GA 1RPRA 2JEUA 1NJIW 1OKKA 4PA7A 1OHHG 3UM7A 2V26A 4WF9V 3G71V 4DXWA 3JYHA 5DM6V 2EZOA 2NUTB 1N8RW 2AHYA 2PI4A 2XL4A 2Z15A 1OCCB 3D36A 3TCUA 2A79B 5BZBA 1V54C 2MK3A 5LGUA 3E86A 1VQKV 2J46A 4YT2A 1QCEA 2H7VC 3IGAC 1M1KW 3FB8C 2EINB 4ASUG 1D1BA 1TWAA 3JRTA 3QZCA 1WPXA 3SYOA 3UNGC 3O39A 1M2OA 4CIHA 4MTGA 1D0YA 1SF8A 3K06A 4WCEV 1V55C 3ASOC 4PA3A 4UVAA 3CP1A 4H4KC 4FESA 4E7SA 3E35A 1R3LC 2XXAA 1XL6A 4O79A 3SYAA 2R7XA 2KB1A 3DMDA 2W6IG 3CCMV 2PI5A 3ASNC 4JAUA 1VYKA 1W0KG 3FAJA 2OG2A 1FS0G 2LFSA 3NXSA 1AI5A 2EIJC 2WLLB 4IJJA 3SPIA 4LLCA 1M57B 4YT8A 1GKFA 5B1AB 2IH1C 1MSWD 2X6CA 2DGJA 4J32B 3E8BA 2X7RB 4PDMA 4I5SA 2EILB 2Q9BA 3EHBB 2WLMA 3F7YC 1DLBA 4WFEA 3ASNB 3EH2A 4P9OA 3OAAG 1M56B 2CNWA 4I44A 1FFTC 4OINF 2EIMC 1QLEC 3Q7LA 4MS2A 3FB5C 1TR2A 5CBGA 4G0HA 5LBQA 4KC9A 1G4YB 1ZU4A 4GX0A 2XOKG 2V1DA 3K79A 1ZHYA 3NRHA 3VAYA 4JAVA 1YSCA 2QM7A 2EZPA 4IAOA 4BJ1A 4J9ZB 3T1CA 2ZXWC 3ETDA 3T2MA 4U7OA 4O6MA 3SYNA 2UXNA 4RQEA 5DS4A 1VQLV 1VQ9V 1F23A 5EBWC 1VQ5V 4GX2A 3LS1A 4XLNF 3K0DA 1PD0A 3UMHA 1OCRB 2CW0F 3RBZA 1JX9A 2XNDG 4TSFG 2FGYA 4BIZA 3FHDA 3ETGA 4H37A 2Z3YA 1NVPD 2EBOA 2OTJV 4MVQA 2Q9AA 1AR1B 3CD6V 3RIPA 3W2WA 1VYIA 3JT1A 2HJFC 3LNRA 4HFKB 1JCHA 4Q20A 1DF4A 3SPCA 2X6BA 2XAJA 3ABMC 5C93A 1OZ0A 2C04A 4OIRF 4I1MA 4AK9A 4E7ZA 2A68F 3RVYA 4PFPA 3CCEV 2V3CC 5KYYB 5CI9A 4QJFB 3ZCCA 3LS0A 3K3WA 4HFFB 1I5XA 1MNDA 1CP9A 4KNWA 2UXXA 3PJSK 2P7TC 1FFHA 3AG4C 1VQ4V 3F47A 5E3CA 3S27A 3SNHA 3ZMVA 4R50A 3K04A 4JTCB 3AG3C 1TWGA 2Y3DA 4CS8A 1FXKB 2ZQMA 4JW1A 2IJJA 3Q6MA 1Q81W 2EIJB 1ZHZA 2Y3HA 5L3QA 2IJKA 3P32A 3EH1A 5F5HA 4FK5C 2I8BA 1TUEB 2Y69B 4F4BA 1NU9C 3SYQA 2HVKC 4AX2A 1YHQV 3UKMA 5F5FA 4JTDB 3EG9A 3EFFK 4L87A 2EINC 5B1AC 1R73A 1K5QA 1R3JC 2XAQA 3AG3B 1KQSU 3AQBA 1M56C 3K9AA 3LNMB 3P30A 2LSEA 1ZYRF 3LAYA 5EBMC 2B1GA 1CPYA 3JD4A 1FMWA 4UV9A 3RVZA 2BE5F 4FWVA 2WAMA 3CQZA 1NQTA 2CDQA 1KECA 1S72V 3TK1A 4QPJA 2OCCB 2B1IA 3SYPA 3W7UA 1YJWV 2QY9A 1K9MW 2WZFA 4UXNA 2A69F 3ABKB 4RUFA 2DYSC 4ULWA 2Z5UA 1Z63A 3OA1A 3LJBA 5L3GA 3ITFA 3W2VA 1GM7A 2Q69A 2R7QA 3ECSA 4LLEA 2KW3C 4RUEA 1RJ9B 3UMKA 2WLNA 4MTXA 1Q86W 1LVKA 2OCCC 1F51A 4XDKA 3T4RA 3IC7A 2EIKB 3K1IC 1NZEA 1OCRC 4PDRA 2KQ9A 1K8AW 4MW8A 1RM1B 2XXAB 3FYEB 1ENVA 2P90A 1M90W 4JCHA 2EIMB 5KYXA 1HWYA 4DVZA 3HPLC 1K97A 4FMTA 2O9XA 1VQNV 2ZR3A 4PDVA 4QNHB 3T6BA 2R7UA 3ABTA 3ETEA 1S5HC 2P67A 3B9QA 1KKDA 3HTKC 4OIPF 4E2LA 1AROP 4LP8A 3FB7C 1RM1C 4B6IA 5KYWB 3LSSA 4CZZA 5CBHA 4MVOA 5B1BB 1ZHXA 4ZBMA 3DD7A 4QE7A 5IYDO 4OXSA 4G28B 1R6KA 1EFRG 1PD3A 3E8FA 4MW3A 1VOMA 2ZXRA 4RD9A 3RW0A 4XDLA 2W6JG 3E8GA 1IZMA 4WFAV 5H9CA 2L81A 1ST6A 2PX3A 1H38A 5DVWA 4BJ6A 1K7DA 4G27B 4P2ZA 3ZRVA 2H94A 3CCJV 3F7VC 5CI8A 4U5BE 2IW5A 2WLIB 4MTFA 1H2GA 2J45A 5KYUB 3UGPA 2NLJC 1YITV 3W7TA 3OEEG 1VQPV 4X89A 1AJPA 4U5DE 4G7OF 2R7WA 3MHHC 1PCXA 4JJFA 3VBBA 2WWWA 4FJCC 2MWQA 3POVA 2R7SA 3OMNB 3EGXB 2VB6A 1KD1W 1D0XA 4N23A 1R3KC 4OD5A 3M1CB 1S76D 3UR3C 5CN0A 2Q68A 4PJNA 4IRUA 5LHIA 4HE8D 1SMYF 1GK9A 1J8MF 2A6HF 1K5SA 4JF3A 1RJ9A 3OWTA 3ZVRA 2A9HA 1N1CA 2Y3GA 4F4LA 1FFTB 4UVBA 5DN6G 1M2VA 5CMUA 5DS5A 2GSMB 2H7OA 3E8HA 3E2EA 1KC8W 4KI2A 5T3WA 3MHSC 3JD2A 3S0XA 4PK4A 3TETA 1Z3IX 5L3FA 1W2WA 4QIWF 1YJ9V 2J7PA 2R7TA 2EIKC 1MMNA 2NNUA 1GO3F 2PFDA 2HKOA 5HFLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T4Z A;  2HJF C;  2Q6A A;  3E89 A;  3OUS A;  2EIL C;  3ABK C;  4PA4 A;  3SPC A;  2X6B A;  3ABM C;  3LDE A;  2R9R B;  4R8C A;  1K4D C;  4X8A A;  3LDC A;  3RVY A;  3IFX A;  3T4D A;  1R3I C;  2WLJ A;  2W0F C;  3JYC A;  2P7T C;  3AG2 C;  3AG4 C;  3PJS K;  3OR7 C;  4R50 A;  1OCC C;  3K04 A;  3AG3 C;  4JTC B;  3KG2 A;  2Q67 A;  1XL4 A;  4GX5 A;  5CBF A;  2QKS A;  2HG5 C;  4HYO A;  3SYQ A;  2HVK C;  3UKM A;  4R7C A;  5B3S C;  4JTD B;  3EFF K;  2EIN C;  5B1A C;  3SPJ A;  1BL8 A;  5EC1 C;  1R3J C;  3F5W C;  1M56 C;  2X6A A;  3LNM B;  3ZRS A;  4WFH A;  5E1A C;  3AG1 C;  5EBM C;  2H8P C;  3LDD A;  2ITC C;  2Y69 C;  2JK5 C;  4MVR A;  5KUM A;  3RVZ A;  3OR6 C;  4X88 A;  3SYP A;  3E83 A;  1ZWI C;  4HZ3 A;  4MVM A;  4RUF A;  2DYS C;  4GX1 A;  4J9Y B;  3X2Q C;  4I9W A;  3K0G A;  2Q69 A;  3OUF A;  4MTO A;  4RUE A;  4TWK A;  1P7B A;  2ITD C;  2ZD9 A;  3GB7 C;  2WLN A;  3BEH A;  4PDL A;  4JTA B;  2OCC C;  4PA7 A;  4XDK A;  3UM7 A;  4DXW A;  1OCR C;  4PDR A;  3ABL C;  3LUT B;  2AHY A;  4PA6 A;  4MW8 A;  3SPG A;  3TCU A;  5BZB A;  2A79 B;  4MSW C;  1V54 C;  3E86 A;  1ORQ C;  2WLK A;  3STL C;  4CBC A;  3IGA C;  2DYR C;  3FB8 C;  3HPL C;  3SYC A;  4BW5 A;  3SYO A;  4P9P A;  4PDV A;  4QNH B;  4EKW A;  4MVZ A;  2WLL A;  3SJQ C;  1S5H C;  1KKD A;  4MTG A;  2HVJ C;  4LP8 A;  3FB7 C;  3K06 A;  2WLH A;  4P30 A;  1V55 C;  3ASO C;  3OGC C;  2A0L A;  4PA3 A;  4RAI A;  4MVO A;  3VOU A;  2DWD C;  5CBH A;  3K03 A;  1R3L C;  3ZJZ A;  1XL6 A;  1M57 C;  4ZBM A;  4QE7 A;  4LCU C;  2K1E A;  4G28 B;  3E8F A;  4OXS A;  4WFF A;  2YEV A;  4MW3 A;  3SYA A;  2KB1 A;  3RW0 A;  4XDL A;  3E8G A;  3ASN C;  5EBL C;  2AHZ A;  4G27 B;  4P2Z A;  3F7V C;  4H33 A;  4MTF A;  2WLI B;  2EIJ C;  2WLL B;  3K08 A;  3SPI A;  2NLJ C;  5J9P C;  2IH1 C;  2X6C A;  2HFE C;  4X89 A;  3E8B A;  4PDM A;  2WLM A;  3F7Y C;  4UUJ C;  4WFE A;  5EK0 A;  3R65 A;  4P9O A;  5EC2 C;  3STZ C;  2DWE C;  2WLI A;  1FFT C;  2EIM C;  1QLE C;  1R3K C;  1J95 A;  4MS2 A;  3FB5 C;  3WG7 C;  5CBG A;  2Q68 A;  1G4Y B;  1OCZ C;  4GX0 A;  4PA9 A;  4R6Z A;  2A9H A;  2BOC C;  4J9Z B;  4F4L A;  4MVS A;  1JVM A;  4QE9 A;  2IH3 C;  2QTO A;  2ZXW C;  4MVU A;  4RO2 A;  3T1C A;  3SPH A;  3T2M A;  3FB6 C;  4KFM A;  3E8H A;  2ATK C;  4WFG A;  5EBW C;  4GX2 A;  5B1B C;  3TET A;  1LNQ A;  3K0D A;  3RBZ A;  5IY5 C;  4XDJ A;  2EIK C;  4H37 A;  4LBE C;  1K4C C;  2BOB C;  1OCO C;  4MVQ A;  5KUK A; 
#chains in the Genus database with same CATH topology
 1K40 A;  2Q00 A;  1YTF B;  3APO A;  1Q7Y W;  5KHI A;  2Q6A A;  2QA4 V;  4U3J A;  1D1C A;  2Z0A A;  3ZHS A;  1WP7 A;  1Z5V A;  5J2T B;  3E70 C;  4E0I A;  3GVM A;  4L8J A;  1L1F A;  5LHH A;  2B5U A;  3L8I A;  4YT4 A;  1VQ7 V;  1SR2 A;  5FNV B;  3MLG A;  5HSW A;  1NSG B;  2ZE8 A;  5LOV A;  2XS1 A;  3QG5 A;  2W4B A;  3KKB A;  3QTH A;  3ZQY A;  4TUY B;  1LIH A;  2PP4 A;  4MQ9 F;  2YIC A;  5JVD A;  2WZG A;  2ITC C;  2E5L O;  2Y69 C;  3DTU B;  4MVR A;  1YVW A;  2N04 A;  5AC5 A;  2UUA B;  1HNX B;  1TFK B;  2FAP B;  3CS5 A;  1VLT A;  3UGO A;  4W8K A;  2I15 A;  1T6I A;  4GYC B;  2GWW A;  2HMQ A;  3AJM A;  3DM5 A;  1GQA A;  3H1J H;  2NN4 A;  1WNS A;  2PUS A;  2MHR A;  3K7D A;  5E79 Z;  3RYH B;  3ZTZ A;  1SQX H;  2XM0 A;  5IJ9 A;  4I55 A;  3B0V C;  4X62 O;  4LFA O;  2WLL A;  5JVD B;  1SQF A;  3QNE A;  3OMI B;  2A0B A;  4ZLC A;  1IX9 A;  1ZW2 A;  3TK0 A;  3Q4H A;  1XNR O;  1FTS A;  1I7F A;  3W7X A;  1BQ0 A;  1VAR A;  5DQZ A;  2M7W A;  2AHZ A;  2XLV A;  2P7V A;  1S0V A;  3CAX A;  4NXN B;  3FXH A;  3NMK A;  1KU2 A;  1NBM G;  1MSD A;  1AVO B;  3L34 A;  4UB6 Z;  4X9Q A;  4W8P A;  4IIJ A;  4NTW A;  1A7V A;  5J2T A;  1PM9 A;  2DWE C;  4EFB A;  3EHM A;  3M8A A;  1V54 B;  3OEO A;  1RXQ A;  2QWN B;  4PA9 A;  4NYK A;  5KLV H;  1WLE A;  4DRI B;  1NR7 A;  1OV9 A;  4X1I A;  5LL6 Y;  1UG7 A;  2FL4 A;  1MA1 A;  4DRH B;  5GTH Z;  2QGN A;  4UCS A;  3S84 A;  3SPH A;  3G4Z A;  1MZE A;  4DVY P;  1EKY A;  1FR0 A;  4WFG A;  3ASO B;  3HKC A;  3GOD A;  3LLK A;  1Q6H A;  4TT3 G;  3C18 A;  1M2V B;  4RDA A;  1NZ6 A;  4QI2 A;  1U96 A;  2BTO A;  5C8Y B;  1LKX A;  3T1H O;  1NTK H;  2F1M A;  1Y66 A;  3G50 A;  4M63 A;  2F23 A;  4P6I C;  1R6N A;  4X8A A;  1QQC A;  2E87 A;  2YQY A;  2GTS A;  1PP9 H;  4OPA A;  2VQE O;  3B40 A;  2ETS A;  3EPV A;  4FFB B;  1ZHT A;  3KG2 A;  5IJ0 A;  1G5Z A;  2GHY A;  1RKC A;  4B3M O;  1XZP A;  1B6Q A;  2CYD A;  4CS9 C;  4WAB A;  3CC4 V;  2BTQ B;  3JCU Q;  5GTI Z;  2KKW A;  2PGG A;  3UCS C;  4U5G A;  1Y4C A;  4KBL A;  2P6V A;  3X1O A;  4DR1 O;  2J9V A;  3AG1 C;  5BQI A;  3W7W A;  3LDD A;  4A5U B;  5LA6 A;  5KA6 A;  1G8X A;  1JOG A;  3Q6N A;  3TOL A;  1YJN V;  2YXL A;  3OT7 A;  1OCZ B;  1XHX A;  4X64 O;  2XSE A;  3GOR A;  4H54 A;  4JE9 A;  4TQF A;  4DRX B;  3S28 A;  4D7T A;  1F4M A;  3HNK A;  3K59 A;  1MMG A;  1HNZ B;  3BEH A;  1I4Z A;  3TD7 A;  3ZED A;  4ANJ A;  1FMV A;  1YDI A;  2NUP B;  1Y74 B;  1YCI A;  1BHB A;  5KYW A;  2FYU H;  1TFO B;  1ORS C;  2IJI A;  1XOU A;  2QSA A;  2QEX V;  1E1R G;  4Q7C A;  3KL4 A;  1I4Y A;  3UGP A;  5KYX A;  2A0L A;  2Q4F A;  3GEI A;  3CB2 A;  1L3P A;  2Q7E A;  2OYQ A;  4WFF A;  1FXH A;  5BR8 B;  2YHS A;  3GM1 A;  1IBK B;  1AP6 A;  2AU5 A;  4PJM A;  2AW9 A;  5EIB D;  2VCB A;  1Y76 B;  1XUQ A;  5A9G A;  4EBK A;  4YJ2 A;  3LSQ A;  4G7Z F;  1CGN A;  3AEI A;  5EK0 A;  4BG0 A;  1Y67 A;  3NG1 A;  1GM8 A;  3CCQ V;  2NUT A;  4W4L A;  4XLP F;  3F46 A;  1L8D A;  3FOO A;  5BQH A;  2CTP A;  3RQF A;  1YZC A;  3JSL A;  1K05 A;  1I08 A;  4CH5 A;  2LFR A;  4DRX A;  4MVS A;  1JVM A;  2YVK A;  2HMZ A;  3EZI A;  3T6J A;  4KFM A;  3K66 A;  3JAM N;  2MYS A;  1YDX A;  1BCC H;  5B1B C;  2YKZ A;  3JAT A;  5KHK A;  3N0T A;  3IQ6 A;  2BE3 A;  1J8Y F;  3PDM P;  4XDJ A;  1RMV A;  2QKA A;  2L6F A;  1PD1 A;  1OCO C;  4GKJ B;  3HKE A;  3IHU A;  3ZC4 A;  2HV7 A;  2CCY A;  1H8H G;  4CS4 A;  2Q7H A;  2F66 C;  1O87 A;  1WOL A;  2QWR B;  2R9R B;  3LDC A;  4XEV A;  4ZLD A;  2F43 G;  3FKS G;  2ZXP A;  1MMA A;  2W0F C;  2ZPA A;  4GEH A;  3EFO B;  4J11 A;  2XAH A;  1YI2 V;  1JAF A;  1H2S B;  2Q67 A;  4RBN A;  2EX3 A;  2D2C B;  3C3T A;  2RDC A;  2QKS A;  2BSK A;  2HEP A;  3WG7 B;  2Q5Z A;  2XT9 A;  3A8T A;  4TV8 B;  4GCZ A;  3IQC A;  1SER A;  1SC5 B;  5IYC O;  3SZR A;  1WB7 A;  3HJC A;  4Z1V A;  2A6E F;  4DR7 O;  4ABM A;  2EPN A;  1JQ0 A;  5E1A C;  2UU9 O;  4DW0 A;  3L1M A;  3B0P A;  3BA8 A;  4EUK B;  2A7W A;  3ZRW A;  3CEI A;  4MND A;  1V9P A;  3HKD B;  2GTA A;  3EGD A;  4J80 A;  4QI0 A;  4FFK A;  3K6B A;  2RNB A;  3OUF A;  4JAA A;  4IYI A;  2CH7 B;  2ZD9 A;  3UMI A;  3RQE A;  3RFY A;  4LFC O;  1OKK A;  4PA7 A;  2KYH A;  2V26 A;  2H3O A;  2NUT B;  1N8R W;  2O57 A;  3E86 A;  4YT2 A;  5IE9 A;  2H7V C;  3R7C A;  4JI2 B;  3FB8 C;  1D1B A;  3UNG C;  3JRT A;  2PZS A;  3RFR A;  1D0Y A;  1B04 A;  1V55 C;  4TV9 A;  4J7K A;  4NQF A;  1Z2G A;  3SYA A;  1Y6D A;  2KB1 A;  1RKE A;  4DK1 A;  3HNL A;  3CCM V;  5L0H A;  2A06 H;  1W0K G;  1ZSP A;  4O4H A;  5L0J A;  1FS0 G;  3NXS A;  4IJJ A;  1YA7 O;  1M57 B;  4DV0 O;  1GKF A;  1YF2 A;  5B1A B;  3E8B A;  4PDM A;  4CDV A;  2WLM A;  4YL3 A;  4WFE A;  3ASN B;  1QHT A;  2LGQ A;  4IHJ B;  3EH2 A;  4YJ3 B;  2MW2 B;  4MS2 A;  4DV5 O;  4G0H A;  5LBQ A;  4KC9 A;  2R25 A;  2ZM6 B;  2LW1 A;  3CE2 A;  3T1C A;  3ETD A;  5L0G A;  5EZY A;  3JAW A;  4ZHQ B;  4NR1 A;  4RQE A;  3SYN A;  4DUZ O;  1YXB A;  1BZ4 A;  5A2Q N;  1SQG A;  2DMX A;  2HSQ A;  3K0D A;  3UMH A;  4ZI7 A;  4YIP A;  2CGN A;  4KHP O;  1BZK A;  3ETG A;  3A9C A;  4H37 A;  5JQG B;  1NVP D;  3CD6 V;  3JT1 A;  3QVZ A;  2KC3 A;  1AP5 A;  5H2F Z;  4AI8 A;  2P06 A;  3ZHV A;  2JPU A;  1JJO A;  1EZV H;  2X6B A;  2C04 A;  2GA0 A;  1OZ0 A;  2UUC O;  2CH7 A;  2DOS A;  3CCE V;  3L70 H;  3S3X A;  3ZCC A;  3K3W A;  3AK3 A;  1I5X A;  1MND A;  3BA9 A;  2UXX A;  2CTR A;  3CJH B;  3SNH A;  4R50 A;  1ZZP A;  1TWG A;  1FJG O;  5JRA A;  1D5A A;  2EIJ B;  4F4B A;  4LH6 A;  1YHQ V;  3UKM A;  1JMW A;  3EG9 A;  1VF6 C;  3EFF K;  4L87 A;  2RN9 A;  1KQS U;  1R3J C;  4CSA C;  3AQB A;  3LNM B;  1N36 O;  3LAY A;  4K1O A;  3JD4 A;  4YK5 A;  4J42 A;  5JJJ B;  3RVZ A;  3KCX A;  4FWV A;  2QWP B;  3P3P A;  1ZLZ A;  1NQT A;  1FFX B;  1S72 V;  4ONS A;  3TK1 A;  4QPJ A;  5B66 Z;  5IYZ B;  5CA1 A;  2A69 F;  4RUF A;  2DYS C;  2Z5U A;  4YJ2 B;  4NTY A;  4LDK A;  2OEV A;  1GM7 A;  4LLE A;  3UMK A;  2KW3 C;  3BRC A;  4X62 B;  4PD4 F;  2WLN A;  1EM1 A;  5L0I A;  1Q86 W;  1O3U A;  2OCC C;  3K1I C;  1NZE A;  1FJG B;  2KQ9 A;  2H8A A;  3FYE B;  1XIL A;  4JI8 O;  4JCH A;  1IBM O;  4DVZ A;  2UUB O;  4FMT A;  3F5T A;  3CX5 F;  2O9X A;  2ZR3 A;  4PDV A;  3TJT A;  4FVM A;  2YLG A;  2QWQ B;  2ZNI A;  2QNL A;  4OIP F;  5KYW B;  1OXB A;  4JI8 B;  4BPM A;  4OXS A;  4RD9 A;  3E8F A;  3N2G B;  1Q0D A;  1SKV A;  4XDL A;  2W6J G;  2KG7 B;  2L81 A;  3C8Z A;  1ST6 A;  4JRZ A;  3FAV A;  4U5B E;  4MTF A;  2J45 A;  4IYH A;  2B9Z A;  1KB9 F;  2NLJ C;  1YIT V;  1E84 A;  1VQP V;  3NMJ A;  4X89 A;  1AJP A;  1U6H A;  4G7O F;  3MHH C;  1PCX A;  3RGB A;  3FMS A;  3A0H Z;  1CGO A;  5F28 E;  1WP8 A;  4HE8 D;  1GK9 A;  1K5S A;  3OWT A;  4FLV A;  2A9H A;  4UVB A;  1M2V A;  1VF5 B;  2ILM A;  2GSM B;  1XMO B;  4DV1 B;  3MHS C;  3TET A;  1P49 A;  1NU1 H;  3C7J A;  1MZF A;  5L3F A;  1NTM H;  3CHX A;  4XEF A;  4X1I B;  2OOC A;  4FX5 A;  2YDE A;  1QVX A;  4DV4 O;  3SXZ A;  1NKD A;  1KBH A;  2DYR B;  3RYI A;  4DJ9 A;  3K5M A;  3P3N A;  3DE9 A;  3LDE A;  4XQ1 A;  4DR7 B;  1K4D C;  1FXK A;  3EGX A;  2DYS B;  3J80 N;  3JAK B;  2B0H A;  2WVQ A;  4XBF A;  4CDY A;  2PBE A;  1SRY A;  2FB5 A;  3KMI A;  1FKA O;  3BY6 A;  1T01 A;  3HKC B;  3FAV B;  3NYL A;  1MNG A;  5CBF A;  5IDJ A;  5TJ5 E;  2GFH A;  1SA0 B;  1E83 A;  2CGE A;  1AI7 A;  3NKD A;  1DF5 A;  1HMO A;  5B3S C;  4CH4 A;  4C7O A;  4LWS B;  3N2G A;  4BR6 A;  1BMF G;  4WJ0 A;  3CC2 V;  3B77 A;  2CGO A;  5KUM A;  2IM9 A;  1NVP B;  3BFR A;  4IL6 Z;  4PHZ A;  2XLO A;  3WFV A;  4HZ3 A;  1XDC A;  5H6R A;  3VQX A;  4D7S A;  4DR1 B;  4J9Y B;  2XAS A;  1OKK D;  4FZ0 A;  1XEQ A;  2HSB A;  1BR4 A;  3M79 A;  4I7Z B;  1XNQ O;  5D92 A;  1VMG A;  3N27 A;  4UCR A;  3H1H H;  4PDL A;  3DI5 A;  5DLJ A;  1Z23 A;  2G3K A;  4LR3 A;  4N06 A;  4C3E A;  4GZR B;  3PN1 A;  1JR9 A;  2GDS A;  2R7R A;  4O4I B;  3PHF 2;  1AVM A;  2IU0 A;  4O6N A;  4BW5 A;  3CME V;  2WZL A;  3DXR A;  1O9G A;  2WLH A;  4CS8 C;  1IXM A;  1FAF A;  4LF5 B;  3K03 A;  1Y74 A;  4LCU C;  4H0L B;  2YEV A;  3DAG A;  2V4D A;  5IWA O;  2RSE B;  3I55 V;  4TV9 B;  5KYN A;  2BCC H;  1WWP A;  3ZN0 A;  2YC0 A;  3CRQ A;  3B8N A;  1QR9 A;  1ZU5 A;  4EBJ A;  1PNK A;  3ZIA G;  5BMV A;  2HFE C;  2RD9 A;  5LP6 C;  2IXN A;  2L9J A;  4CH6 A;  3QVY A;  3JAK A;  2WLI A;  4AHC A;  3CEX A;  1E86 A;  3CCU V;  5KYU A;  4IT5 A;  2WVO A;  2D3O W;  2ADQ B;  3AGT A;  3JSZ A;  3K5L A;  5JJE B;  4DOZ A;  3B29 A;  2HUJ A;  1C17 M;  2GV9 A;  1XWJ A;  1GM9 A;  3BAA A;  3GWL A;  2J9W A;  4QE9 A;  3I5P A;  3TXS A;  4LF8 B;  3RYC A;  3RYL A;  1HR0 B;  1MOF A;  1IBM B;  4YWQ A;  3MAQ A;  3L9D A;  3ZBH A;  1IBK O;  5GON A;  4I55 B;  3DXJ F;  3ZMS A;  4GYT A;  2KJG A;  4B3T B;  3C8G B;  2X51 A;  3EVK A;  3ZSU A;  4IGG A;  4Z9H A;  4FZ1 A;  2Q9L A;  1JPJ A;  2XUM A;  2ADP A;  3O9O A;  4JEB A;  3ABK C;  1H2N A;  4BJ5 C;  3SXY A;  5B1O A;  1R3I C;  1AUE A;  3QO8 A;  1T9K A;  1EZJ A;  1VP7 A;  5D5Q A;  4G7H F;  2RCV A;  3S9O A;  3ZRX A;  5KMG B;  3CCR V;  3Q7G A;  4TQD A;  1VEW A;  4Q4Z F;  1IUR A;  5KA5 A;  3CMA V;  1ZUQ A;  1SQV H;  3W8I A;  4JYB A;  1Z7Q c;  4PEL A;  3UO3 A;  4Q5S F;  1L7C A;  1MMD A;  4YXW G;  3MYF A;  2ZR2 A;  4B3T O;  4HEA J;  3I4U A;  5T1D B;  2YL3 A;  2P22 C;  4NXN O;  1P7G A;  4ZOL A;  2OIG A;  3ZMZ A;  1HW2 A;  3RYF B;  3LEV A;  3IQ5 A;  1ZWI C;  4N4W A;  2C03 A;  1Y6X A;  4I4T A;  1HP8 A;  4GX1 A;  1N33 O;  4LF7 B;  2HJ3 A;  3D3I A;  2CK3 G;  4PFO A;  3ETQ A;  3K0G A;  5FCL A;  4E18 A;  3M99 B;  2ITD C;  2VQF O;  3L72 H;  1AJN A;  3QW0 A;  4YN0 B;  5KX5 B;  3FFQ A;  3U3F A;  5EGY A;  3ABL C;  1NR1 A;  3LUT B;  3SPG A;  3EZH A;  3CCV V;  2VC9 A;  3ZX6 A;  1ORQ C;  4CBC A;  3STL C;  2G3V A;  2JGD A;  1R6T A;  2VQF B;  2R7O A;  4P9P A;  1Q82 W;  4JI0 B;  1UJW B;  2DI3 A;  3SJQ C;  4PJ0 Z;  1H2L A;  2Y39 A;  3DJU B;  2V7Q G;  1LUW A;  2DWD C;  1QVF U;  2YSU B;  4J7J A;  1H9G A;  1TVK A;  4U5H A;  1LS1 A;  4X65 B;  2DW4 A;  1VK5 A;  3RF3 A;  1BDJ B;  3X2Q B;  4DW1 A;  4K8X A;  2EPL X;  5BXZ A;  4JI7 O;  1M6T A;  1K3E A;  4AE4 B;  4YJ3 A;  2JJ1 G;  4FLY A;  4UUJ C;  1BQZ A;  3BPZ A;  3QO5 A;  4D4N A;  1ROP A;  3R65 A;  2LW7 A;  3FX7 A;  2WSS G;  2Y0I A;  1JR8 A;  3VQV A;  1OR3 A;  256B A;  3AK2 A;  2R9I A;  3ZMT A;  4JI0 O;  2OTL V;  4IB4 A;  1PPJ H;  4B3S B;  1TWH A;  4MVU A;  1OCO B;  5FNV A;  3SXK A;  1WA8 A;  1CPQ A;  4G78 A;  3JCU Z;  1LNQ A;  5LA6 B;  2VS0 A;  2E74 B;  1IXB A;  4KL1 A;  2D4U A;  5LMU O;  1N0J A;  2ZDI A;  4JPR A;  2Q3T A;  4O4L A;  5HV9 A;  2KSD A;  5LYJ A;  3KZI Z;  2HLD G;  5KAI Z;  1M93 A;  1IZ3 A;  1PNM A;  1GMG A;  3CSX A;  4GUN A;  3K33 A;  3T4D A;  4U5F E;  2WLJ A;  3JYC A;  3OFN G;  2ARH A;  5H5N A;  3OR7 C;  4GT1 A;  1A41 A;  1SZX A;  4DBQ A;  5EHH A;  5LMN B;  4AE4 A;  2GUZ B;  4EFE A;  3G4S V;  3H2V A;  3LNN A;  3JAR B;  1JJ2 U;  3T1Y O;  2R9A A;  1B06 A;  1JOY A;  2QKC A;  3VRC A;  5EC1 C;  3DJN B;  5DS6 A;  4KXR A;  2ODM A;  3SJC C;  1HR0 O;  3G67 A;  1E1Q G;  3FDQ A;  1QLN A;  3G6E V;  2J0W A;  1WB8 A;  4CSA A;  3QMK A;  3LSU A;  5CB4 A;  3E83 A;  4QPK A;  2ZE6 A;  3RT3 C;  4EWC A;  3WB0 A;  3X2Q C;  1N36 B;  4U5E E;  4FLT A;  5J2U B;  1QBZ A;  1QVG U;  1KMI Z;  3GB7 C;  4WFB V;  1YYX A;  5AGF A;  3UO2 A;  3QVN A;  1IVS A;  4B3R B;  4UB8 Z;  4DV6 B;  1RPR A;  2CUG A;  1NJI W;  1ZVZ A;  4I1O B;  4WF9 V;  3G71 V;  4DXW A;  1PV3 A;  5DM6 V;  2HS5 A;  3JYH A;  4JIO A;  2XL4 A;  2PI4 A;  4XTK A;  2Z15 A;  3U2L A;  3V5Z A;  2J46 A;  4WBN B;  4YY3 O;  1TWA A;  5JCO A;  1WPX A;  2YI8 A;  1XHZ A;  3O39 A;  1Q0F A;  2ZE7 A;  4MTG A;  1SF8 A;  4WCE V;  4FES A;  1B3Q A;  2P4V A;  1XL6 A;  2UUB B;  5COM A;  2E3C A;  4YL0 A;  2W6I G;  2PI5 A;  3ASN C;  3IAY A;  3TGU H;  4B08 A;  4LF8 O;  2OG2 A;  1QKR A;  2LFS A;  4NKG B;  3D8C A;  3O65 A;  2ZKO A;  4LLC A;  1GAX A;  4DV6 O;  1N4C A;  2Y0P A;  4I5S A;  3EHB B;  4X1Y B;  1FD9 A;  4P9O A;  3OAA G;  1FFT C;  2EIM C;  5A6B D;  4GKJ O;  3Q7L A;  1XMO O;  5CBG A;  1R1B A;  1G4Y B;  1LR1 A;  1QNM A;  1ZHY A;  1YSC A;  2QM7 A;  2EZP A;  3BRJ A;  4J9Z B;  3L8J A;  3K58 A;  2XL8 A;  2TMV P;  1Q5O A;  3JAR A;  4U7O A;  1QQ3 A;  1VQL V;  1VQ9 V;  3T1H B;  5EBW C;  1VQ5 V;  4JI1 B;  3DSQ A;  4GX2 A;  1PD0 A;  3H9V A;  1OCR B;  5JJN B;  3U8V A;  2XND G;  3FHD A;  4WBN A;  3W2W A;  4NB5 A;  4NTX A;  4MVQ A;  4K0K O;  2E76 B;  2AZ0 A;  1VYI A;  2HJF C;  2KSF A;  4JI3 B;  2F4V B;  4Q20 A;  1DF4 A;  1SQB H;  5C93 A;  1LM3 B;  2IBZ H;  3VQY A;  2A68 F;  3RVY A;  1B68 A;  5LP6 B;  4PFP A;  2V3C C;  2UXD O;  5KYY B;  1EN4 A;  5J2U A;  2YS8 A;  5JT4 A;  4KNW A;  1YEW A;  4JI6 O;  3AG4 C;  1VQ4 V;  2YWA A;  4LFB O;  2AP3 A;  3K04 A;  3QF7 A;  2Y3D A;  2GBO A;  4CS8 A;  4LF7 O;  3Q6M A;  2W0X A;  1Q81 W;  1ZHZ A;  3CXH F;  2IJK A;  3R66 A;  3JAW B;  4FK5 C;  2Y69 B;  1BT8 A;  1Q0G A;  4E0H A;  1K5Q A;  3AG3 B;  3K9A A;  1ZYR F;  1DOW A;  1CPY A;  1XNQ B;  2R02 A;  4UV9 A;  3GWK C;  3CQZ A;  1T5O A;  2CDQ A;  2DE0 X;  1YJW V;  2OCC B;  2QWO B;  2WZF A;  1K9M W;  4DR5 B;  3ABK B;  3OA1 A;  5L3G A;  3ITF A;  4YIO A;  2ASR A;  1GRJ A;  2LO1 A;  1LVK A;  1WAZ A;  4DR4 B;  1NFN A;  3IC7 A;  2XHB A;  4I0X B;  1G6U A;  4MW8 A;  3AG7 A;  2XXA B;  1ENV A;  2EIM B;  1HWY A;  3HPL C;  1K97 A;  4CH3 A;  4AIL C;  1VQN V;  2R7U A;  3T6B A;  1ORJ A;  3ETE A;  1S5H C;  2P67 A;  1YYJ A;  3HTK C;  4E2L A;  2XM4 A;  1H9T A;  4HNA B;  5CBH A;  3Q4H B;  4QE7 A;  4G28 B;  1R6K A;  1PD3 A;  1Q8I A;  1MQV A;  1J5E O;  4WFA V;  2PX3 A;  4BJ6 A;  4G27 B;  4P2Z A;  1H6G A;  3CCJ V;  2IW5 A;  2WLI B;  1TUB A;  3W7T A;  1SYQ A;  2YL0 A;  1I94 B;  4Z9J A;  5BMV B;  4EIY A;  3OMN B;  1BS3 A;  1Z5W A;  2VB6 A;  4N23 A;  3BAB A;  3M1C B;  1S76 D;  3UR3 C;  5COF A;  4PJN A;  3RQG A;  4IRU A;  5JWP A;  1Q0K A;  1ZL8 B;  3DKA A;  2Y3G A;  4F4L A;  1MMM A;  1IDS A;  4J41 A;  1R4T A;  4GKK O;  3L75 H;  2H7O A;  4A4A A;  3DXR B;  3JD2 A;  3HNJ A;  4PK4 A;  4ER9 A;  4L6R A;  4QIW F;  2J7P A;  2EIK C;  2YIB D;  1MMN A;  2PFD A;  2OIE A;  2Q0A A;  3W7S A;  1VTM P;  3V7O A;  4CC5 A;  4X64 B;  2R03 A;  3O10 A;  4P9F A;  3ZDL A;  2N05 A;  3S90 A;  1S7Z A;  4BJ6 C;  3CWB H;  3C8G A;  2NR5 A;  1GM5 A;  2P5O A;  1OCC C;  4BWA A;  1D1A A;  1A32 A;  4GX5 A;  2JVD A;  3M7M X;  3KH2 A;  2EUL A;  4BEM J;  3GM2 A;  3U0C A;  4R7C A;  1CXZ B;  1AI4 A;  4CS7 A;  3JD3 A;  4JAS A;  3H65 A;  2ZCE A;  2W9Y A;  3HLZ A;  1N33 B;  4C3B A;  5JQG A;  3ZRS A;  1H8E G;  3S29 A;  1NLX A;  4JZA A;  4AQY O;  4H44 B;  4NTA A;  3OR6 C;  5BR8 O;  4JI5 O;  4X88 A;  1YAU O;  5EYP A;  2VWJ A;  4O6Y A;  4MVM A;  4X20 B;  1IBL B;  1BR2 A;  4DV4 B;  3O6X A;  1ZL8 A;  2D5R B;  2OT5 A;  2ZIN A;  2WA4 A;  3JAS A;  4KNV A;  4I50 B;  1NTZ H;  2A1D D;  1WGW A;  2PNO A;  1X4T A;  4JGS A;  3MYI A;  2WL8 A;  1ZX3 A;  2WLK A;  3RWR D;  2J9B A;  1HE9 A;  5FLX N;  4PAC A;  2DYR C;  2X0C A;  1JFF B;  2JIZ G;  5LGN A;  3JD0 A;  1I5Y A;  2JGD B;  3NDB B;  5IJ9 B;  3OGC C;  3VQW A;  4LAC B;  2IJH A;  4FM2 A;  1QU7 A;  4C7O B;  1W2B U;  3MX3 A;  3B0U X;  1EA8 A;  4PI0 A;  1E85 A;  1FXV A;  2C2A A;  1TKN A;  1S3J A;  5B3S B;  1QPU A;  4IIJ B;  4I4T B;  1N32 B;  5K0I A;  1EN5 A;  3CJH A;  3G80 A;  3JAL B;  1PL4 A;  1YZA A;  3JYY A;  3KYI A;  1J95 A;  3AG2 B;  3ML0 A;  2IXM A;  3JRM O;  1OCZ C;  2PX0 A;  1S77 D;  4CDA A;  2YLD A;  1WPB A;  2ZIO A;  1YVI A;  3L0I A;  1U0B B;  2VRZ A;  1BHA A;  1M4U A;  4OD4 A;  5LHG A;  3FB6 C;  1SQQ H;  2P6J A;  1W0J G;  3HB3 B;  1S05 A;  5H6Q A;  3E9V A;  4KUM A;  1SZI A;  1KTM A;  2JD3 A;  4B3M B;  3ZTM A;  1CGM E;  3DE8 A;  1GN3 A;  2M64 A;  4I50 A;  2ZT9 B;  5GW7 A;  2J7P D;  2OKU A;  2VCA A;  1RP3 B;  2XAG A;  3OMA B;  5D5P A;  2LIG A;  4R8C A;  5BUO A;  5T3T A;  4LF6 B;  1YIJ V;  3MFN A;  3IFX A;  4Z1M G;  1JPX A;  3WB1 A;  3EFO A;  4DV1 O;  5GON B;  4DV3 B;  2IOQ A;  5KYY A;  4IWB A;  2NG1 A;  2PYL A;  4JV5 B;  1OW8 A;  2HG5 C;  4HYO A;  1THZ A;  1MNE A;  2Q0O C;  2UUH A;  1RKE B;  1FPO A;  3SPJ A;  3B4S A;  4O4L B;  1UFI A;  3CPW U;  1SET A;  5BQG A;  2H8P C;  2KNH A;  1N0N A;  4XPY A;  3W8H A;  1GS9 A;  3JAL A;  3GWO A;  1A7E A;  1F4N A;  1H2M A;  4EB6 A;  4OX9 O;  1M5I A;  4TWK A;  3M4C A;  2NSG A;  2WB7 A;  4EBB A;  3EQL F;  4X1K B;  3JTL O;  3RKO F;  2R7V A;  1YLM A;  1QLE B;  1PKX A;  1LE2 A;  5IY5 B;  1AI6 A;  1M9N A;  4MSW C;  1N34 B;  4K8Z A;  2W4M A;  1AJQ A;  5CB4 B;  1HNW O;  2G38 A;  1BR1 A;  1D0Z A;  4MVZ A;  3A2F A;  3CC7 V;  4NXM B;  2CNW D;  4ZHQ A;  3PCV A;  2P4K A;  3VOU A;  5ITZ B;  3K9S A;  1O5H A;  1HW1 A;  2FTK A;  3ZJZ A;  2JJ2 G;  3VYW A;  1GTO A;  1M57 C;  1TVK B;  4J7Z A;  5BY1 A;  5K1P A;  4U5C E;  4F6R B;  4R32 A;  4D6T H;  5JSL A;  1CPR A;  2VCC A;  3LEO A;  2F95 B;  2L6G A;  3JD1 A;  3HR0 A;  5KYX B;  5EBL C;  4BIO A;  4KP4 A;  3KKY A;  1O9H A;  1T6Q A;  1NU7 D;  4IAR A;  3U2M A;  3SP1 A;  5J9P C;  5JLI A;  3SXM A;  3ABM B;  2VH3 A;  2KK1 A;  4U7N A;  4FAP B;  1LI7 A;  3HKK A;  5EC2 C;  1Y4M A;  2XAF A;  3STZ C;  5JH7 A;  1UPG A;  1K73 W;  3DZA A;  3U5S A;  2R7W A;  2XRH A;  2Y48 A;  4DUY B;  1AEP A;  1IW7 F;  5CIV A;  4X1K A;  1VQ8 V;  2HHH B;  2IXP A;  3CSK A;  3L73 H;  1LPE A;  5IYB O;  5COG A;  3OGI B;  1NT2 B;  4EB6 B;  2J8W A;  3C90 A;  5D91 A;  2IH3 C;  2QTO A;  3ZMU A;  5E3A A;  1QR8 A;  4JUR I;  2ATK C;  4ZI7 B;  2P61 A;  3U8P A;  4N6H A;  1XNR B;  3B8M A;  3QO7 A;  3FAP B;  2BOB C;  1LUV A;  3SR2 C;  3T4Z A;  2OQM A;  3H01 A;  1WAT A;  2PY5 A;  4NVP A;  2XLW A;  4FPP A;  2EIL C;  4WGY A;  4PA4 A;  2UUA O;  3OTO B;  3AGU A;  1V55 B;  4N6C A;  2UXC O;  1K33 A;  3WAQ A;  2DQ0 A;  3I5D A;  4X1Y A;  3EGD B;  4JKV A;  2HHH O;  5L0C A;  3K1I A;  5IYZ A;  2LK4 A;  4NTB A;  2ZXW B;  5DQT A;  4Z2W A;  3NYM A;  1KP2 A;  1AR4 A;  5JP7 A;  3U9M A;  3OM3 B;  1AIL A;  4JZG A;  4YT5 A;  3EJN A;  2PTM A;  1BGY H;  4LFB B;  3F5W C;  1WAS A;  3DGE A;  2BSK B;  4CS2 A;  4XEK A;  3NMI A;  5A6K A;  2BC5 A;  1TGO A;  1WA8 B;  1Q0M A;  4O2B B;  1QZX A;  4I9W A;  2NUP A;  4MTO A;  4MT8 A;  1DK1 A;  2FFH A;  4LF9 O;  2R70 A;  4JI6 B;  3V5Y A;  5JUA A;  3J06 A;  2CE4 A;  4O7G A;  3UM7 A;  1BE3 H;  4DBR A;  4O79 A;  5LYJ B;  2EZO A;  4UCU A;  2AHY A;  3US6 A;  3HKB A;  1OCC B;  5BZB A;  4LF6 O;  2A79 B;  2LFF A;  2MK3 A;  1VQK V;  4CJO A;  3HKD A;  2EIN B;  4ASU G;  1LE4 A;  2IM8 A;  4FM0 A;  5FPR A;  4CIH A;  2CTQ A;  3K06 A;  4PA3 A;  4UVA A;  3CP1 A;  4H4K C;  3E35 A;  2XXA A;  2YLI A;  2L6H A;  4I0X A;  2R7X A;  4U3F H;  2RQ6 A;  4J7Y A;  3O55 A;  1AI5 A;  1WJZ A;  2EJ7 A;  5CA0 B;  3SPI A;  5IJ0 B;  4YT8 A;  1MSW D;  1YA9 A;  2YIA A;  2X6C A;  5LXT A;  4J32 B;  2X7R B;  2EIL B;  2Q9B A;  3WU2 Z;  3F7Y C;  3R2P A;  3RYH A;  3TJ6 A;  3U10 A;  1M56 B;  3FB5 C;  1TR2 A;  3H2U A;  4GX0 A;  3K79 A;  3NRH A;  3VAY A;  1VB5 A;  4YHH B;  4IAO A;  4BJ1 A;  4JI7 B;  3AOU A;  1P84 F;  2ZXW C;  4O6M A;  5JS5 A;  2UXN A;  5DS4 A;  2YI9 A;  4UFZ A;  1F23 A;  2LJ2 A;  4DV0 B;  3B71 A;  3CRR A;  4ZOL B;  4FLX A;  3LS1 A;  4TSF G;  4BIZ A;  4ICG A;  4DYL A;  4CX9 A;  2Z3Y A;  4JV5 O;  2EBO A;  1RSO B;  2OTJ V;  2Q9A A;  3RIP A;  4O4J B;  4LWS A;  1NBB A;  1JCH A;  1F7Y A;  2HZ8 A;  3WB2 A;  1US6 A;  1TAE A;  1ORY A;  2XAJ A;  4E7Z A;  2LQG A;  3C8G D;  4I1M A;  4DR3 O;  5CI9 A;  1T6U A;  2R72 A;  4QJF B;  3C62 A;  3LS0 A;  2GDC A;  4YY3 B;  2HJM A;  3F47 A;  3V5X A;  3RYF A;  3U11 A;  2EPO A;  3AG3 C;  4YHH O;  1FXK B;  4DR6 B;  4OX9 B;  4JW1 A;  2IJJ A;  1E2X A;  3CRM A;  1KKC A;  4GKK B;  3P32 A;  1V74 B;  2HVK C;  4AX2 A;  4JTD B;  2EIN C;  5B1A C;  1XZQ A;  3AK1 A;  4OIO F;  4WGZ A;  3KCY A;  2B1G A;  4PI2 A;  2BE5 F;  3MBG A;  3E22 A;  2CTW A;  1KEC A;  4J30 B;  3W7U A;  2B1I A;  2QY9 A;  4LF4 B;  4HBN A;  3SDL A;  2DJV A;  1Z63 A;  4O4I A;  3LJB A;  5CA0 A;  3W2V A;  2Q69 A;  2R7Q A;  4RUE A;  1RJ9 B;  3T1Y B;  1F51 A;  3UQ8 A;  4X66 O;  4PDR A;  4QGP A;  1M90 W;  2JRI A;  2E5L B;  4X65 O;  4P9T A;  1GH6 A;  1KKD A;  3KPH A;  1AR5 A;  1RM1 C;  3FB7 C;  2KG7 A;  4ZBM A;  5IYD O;  1TQG A;  3CRA A;  1S5L Z;  3E8G A;  1IZM A;  5H9C A;  2XLH A;  3QW1 A;  5CI8 A;  5KYU B;  3ZQV A;  3OEE G;  2M6Y A;  1D5N A;  1A7D A;  3JZ0 A;  3T6G B;  2R7S A;  4FJC C;  2MWQ A;  3VF0 A;  4EHP A;  4LH7 A;  3ICX A;  1A0B A;  1YJG A;  4OD5 A;  1L0N H;  4U3J B;  5CN0 A;  1YZB A;  2EPK X;  5LHI A;  3U0Z A;  1N32 O;  1SMY F;  3K5O A;  1J8M F;  3N2K B;  4JF3 A;  2AVK A;  1N1C A;  4PR9 A;  2OJQ A;  3IQT A;  4Z9I A;  2QDO A;  5DN6 G;  5CMU A;  1KUQ A;  5DS5 A;  3CRC A;  3E8H A;  4KI2 A;  1KC8 W;  5T3W A;  3TJ5 A;  2K9P A;  5KMG A;  4FLW A;  4Q6G A;  1Z3I X;  2HJD A;  5B5E Z;  2HKV A;  2PYJ A;  1PV0 A;  4FM1 A;  1HNX O;  1W2W A;  1W59 A;  3RYC B;  2NNU A;  4NCQ A;  4YL1 A;  2OU6 A;  1SS3 A;  5GPG B;  5KX5 A;  2QTV A;  3BCC H;  1Q90 D;  3BVO A;  5LOV B;  1WTY A;  5HFM A;  3DC5 A;  1S5J A;  1SA0 A;  3H1K H;  1VMA A;  3APQ A;  1I5N A;  1VLS A;  1WN0 A;  4CBE A;  4PV1 B;  3CZ6 A;  2VWK A;  2H7B A;  1T5E A;  4JI4 O;  1TUB B;  1VF7 A;  5L3B A;  2ICW G;  4UVC A;  4DO2 A;  2W45 A;  4JC7 A;  2Y3B A;  4AL0 A;  1PNL A;  3CCS V;  3IEE A;  3CCL V;  2WVN A;  4PJL A;  4X0R A;  1ZTE A;  1EN6 A;  1K34 A;  5L3C A;  4U9D A;  4OPH A;  5LMU B;  2UXD B;  2F22 A;  3K1H A;  4BEJ A;  2ZXO A;  1ZHW A;  2LQT A;  3I56 V;  4JYC A;  4K7B A;  1KU9 A;  2QE9 A;  3WOD F;  2QJ1 A;  5K1X A;  4NC3 A;  1V4A A;  1EI7 A;  5L3D A;  4DR2 B;  3ABL B;  4LER A;  2ETN A;  3N2Z B;  2QTS A;  1MG1 A;  4CS9 A;  1K92 A;  3N2K A;  2JDI G;  1APC A;  2L7A A;  4JTA B;  1HDJ A;  2YEV B;  1QSP A;  4PA6 A;  3MD0 A;  4DR3 B;  4NY3 A;  2VAS A;  1KP3 A;  2XS8 A;  4BJ5 A;  1OXK A;  3KYJ A;  5FPO A;  3SYC A;  3THO A;  1VF6 A;  4DV2 O;  1JPN A;  4A2N B;  4EKW A;  3IC9 A;  1JFF A;  3BHP A;  2ZNJ A;  2HVJ C;  4N21 A;  4DR5 O;  3DAF A;  5L3E A;  4RAI A;  4UV8 A;  1PL0 A;  3C63 A;  1HNZ O;  4G2K A;  4E17 A;  5L3V A;  2K1E A;  5JVE A;  2UUI A;  3JAS B;  5AG2 A;  5IT9 N;  3LES A;  2KGO A;  1JRA A;  2UXB O;  3K08 A;  5CA3 A;  2Q4P A;  4AQY B;  1RPO A;  2LP7 A;  2P1A A;  1VQM V;  4JVS A;  2ZIM A;  3TOM A;  2YID A;  3NR7 A;  1G8M A;  1NFO A;  1Z6A A;  3QTC A;  2J9U A;  3EHN A;  2HV6 A;  3A0R A;  4XPX A;  2BOC C;  4B7K A;  1H7I A;  4HAM A;  1RSO A;  2OJE D;  5B3I A;  3WG7 C;  4HNA A;  4CS3 A;  3JCZ A;  4UCV A;  3N24 A;  3J7A U;  2OCH A;  3U9J A;  3ZRW B;  4FFB A;  2X0L A;  1E79 G;  3ZN1 A;  4ZKI A;  2DQ3 A;  3S3W A;  3GAN A;  1K4C C;  5KUK A;  2DB4 A;  4K3A A;  1IBL O;  3OUS A;  3DM9 B;  4OIQ F;  1OR2 A;  1DTO A;  1GN6 A;  3RYI B;  4E4E A;  3EXA A;  1D2D A;  3TXQ A;  5EIB C;  3TQO A;  3PMR A;  1Z5Z A;  1ZW3 A;  3HNI A;  2RMK B;  1URF A;  3J81 N;  4K0D A;  3CYO A;  3LLI A;  5F5F A;  2YZS A;  4LC1 A;  4O4H B;  2QM4 A;  1GN2 A;  2AZ2 A;  4TUY A;  5JCO C;  1HE1 A;  2B0J A;  1BL8 A;  1OW6 A;  4O2A B;  2X6A A;  2JS3 A;  4WFH A;  2GAQ A;  1SF9 A;  2JK5 C;  2HR3 A;  3JAT B;  4C3D A;  1NG1 A;  4YJW A;  1TWC A;  4DR4 O;  4FLU A;  3ZG1 A;  2DN9 A;  3GWN A;  1G4W R;  1XQ8 A;  2Q73 A;  4GQH A;  2NPU A;  1BBH A;  3AG1 B;  4H13 B;  1XI1 A;  1MAB G;  2E75 B;  4CIP A;  1U97 A;  2M4E A;  5KHG A;  4NTF A;  2EJR A;  2QE7 G;  2IXO A;  3WHN A;  3NKE A;  2AXT Z;  4ZIB A;  5E2Q A;  4IHJ A;  2R05 A;  4K35 A;  4JCZ A;  1FXK C;  1LI5 A;  4O2B A;  3G4X A;  2AWC A;  3MDS A;  4PJJ A;  2PF4 E;  1J5E B;  1FFX A;  4BW9 A;  2JS5 A;  1G1X B;  3K57 A;  1DGS A;  4LNU B;  4P30 A;  3I5Q A;  4XWJ A;  4BIU A;  1NH2 D;  3ABU A;  4DV5 B;  4BAY A;  4JI1 O;  2ZE5 A;  4RQF A;  1HY5 A;  1OJH A;  1KYO F;  1P4R A;  4H33 A;  4U9E A;  1NH2 B;  3OW2 U;  1KNY A;  1OQC A;  3M4B A;  5E33 A;  1Q6I A;  5EYP B;  3ZS8 C;  1BSM A;  2IU3 A;  5AC4 A;  4XPW A;  3CXC U;  2IYL D;  2WPD G;  2ZDI C;  3SEO A;  2CDY A;  2JEX A;  4UCO A;  4GLX A;  1K04 A;  4IAQ A;  5LGT A;  2G62 A;  5F2V O;  2J0X A;  1ZAU A;  3FYI B;  4O4J A;  4R6Z A;  2UUC B;  3EG9 B;  3ZIB A;  4RO2 A;  1N34 O;  2UU9 B;  2KQX A;  4JI2 O;  2Q7R A;  2YIB A;  3D3Q A;  1VQ6 V;  5DEC A;  3NYJ A;  5IWA B;  1U89 A;  1HMD A;  5FL7 G;  2Q7G A;  5IY5 C;  3OD4 A;  1COW G;  2YXY A;  4DR2 O;  4LBE C;  2YL7 A;  2Y4U A;  1TA8 A;  3DC6 A;  3ZWI A;  1SZT A;  5KHH A;  3E89 A;  4TV8 A;  4FIP C;  3AG4 B;  1XMQ O;  1I94 O;  1YTF D;  1C02 A;  2A0U A;  2L35 A;  4OGQ B;  4B3S O;  5JH7 B;  5B1N A;  5A6J A;  1EBO A;  3JSN A;  3AG2 C;  2LGW A;  2JX0 A;  1VQO V;  1XMQ B;  3T9O A;  3E22 B;  2RJZ A;  1LS4 A;  5L0F A;  1XL4 A;  1SES A;  2QLA A;  3M15 A;  4CC6 A;  4W4K A;  3OEH G;  3C3S A;  3SJB C;  3TUL A;  2VQE B;  4B7E A;  1CEZ A;  3A0B Z;  2Q9C A;  1R5I D;  2QM8 A;  1OW7 A;  3OE7 G;  4LNU A;  2UXB B;  4JJG A;  4LDQ A;  3H1I H;  2XLM A;  2IBF A;  3ATP A;  4UCT A;  3IJ4 A;  3VM6 A;  4NXM O;  3FVY A;  4QDL A;  3L74 H;  5LMN O;  3AQC A;  3GEH A;  4I3M A;  1P7B A;  4BJT A;  3OTF A;  5DED A;  4CJG A;  1L0L H;  2JEU A;  3L71 H;  2XL6 A;  4DK0 A;  1OHH G;  3H1L H;  2XTA A;  3RN4 A;  3D36 A;  3TCU A;  5LGU A;  1V54 C;  1QCE A;  1WN7 A;  3IGA C;  1M1K W;  3QZC A;  3SYO A;  1NI8 A;  2N74 A;  3UT5 A;  1M2O A;  4X66 B;  1H2K A;  2LD6 A;  5EZY B;  3ASO C;  3GEE A;  3GM3 A;  1Q6U A;  4DUY O;  1DOV A;  4E7S A;  1R3L C;  4DV7 O;  4JYY A;  3SGI A;  5FZT A;  1YAR O;  3DMD A;  4LF4 O;  4JEA A;  2OEX A;  4JAU A;  1VYK A;  4J10 A;  3FAJ A;  2EIJ C;  2WLL B;  2UXC B;  4JZ2 A;  4LF5 O;  1UFB A;  2IH1 C;  5CA1 B;  2DGJ A;  4JYA B;  5LXT B;  2LCH A;  1DLB A;  4I44 A;  2CNW A;  4OIN F;  4K0K B;  1QLE C;  2QUP A;  2FKX A;  1X59 A;  3B2E E;  1ZU4 A;  2L6L A;  2V1D A;  2XOK G;  4JAV A;  2AWY A;  5A6A A;  3OTO O;  3T2M A;  3FOP A;  1GN4 A;  2XLD A;  4DV7 B;  3UT5 B;  4XLN F;  5KAF Z;  2F93 B;  2CW0 F;  3RBZ A;  1JX9 A;  2FGY A;  2WA3 A;  3JSE O;  1AR1 B;  3HKB B;  5L0D A;  5LP6 A;  1VIB A;  3LNR A;  1JMK C;  4HFK B;  4DV3 O;  4JYA O;  4JI5 B;  3SPC A;  3ABM C;  4AK9 A;  4OIR F;  5A69 A;  2LP4 A;  3K5N A;  1Q43 A;  3HKE B;  2NSF A;  3D36 C;  1EQ1 A;  4HFF B;  5A6B A;  1CP9 A;  1HW7 A;  2BL2 A;  3PJS K;  2P7T C;  1FFH A;  5E3C A;  3S27 A;  3ZHT A;  3ZMV A;  4D4X A;  4JTC B;  4LFA B;  1SQP H;  2CAZ C;  2ZQM A;  1AB3 A;  1G4U S;  2Y3H A;  1GGQ A;  5L3Q A;  3EH1 A;  5F5H A;  4C7U A;  3W4Y A;  2I8B A;  1TUE B;  4RWU A;  3SYQ A;  1NU9 C;  4O2A A;  3B09 A;  4JI3 O;  2F4V O;  1RFY A;  1FYJ A;  1R73 A;  4JI4 B;  2XAQ A;  1M56 C;  3P30 A;  2XLE A;  2LSE A;  1RCP A;  3DWW A;  5ITZ A;  5EBM C;  2GUZ A;  3FD9 A;  2LFD A;  1FMW A;  2WAM A;  1C03 A;  3SYP A;  4UXN A;  4ULW A;  1XRE A;  1XBL A;  2JGU A;  3ECS A;  3A11 A;  1HNW B;  4EEQ A;  3SJA C;  4MTX A;  1Q3E A;  2AGA A;  4F6R A;  4AL1 A;  4XDK A;  3T4R A;  2EIK B;  5C8Y A;  1OCR C;  1K8A W;  4X20 A;  1RM1 B;  2P0N A;  2EPM X;  2P90 A;  2QR4 A;  4LFC B;  4ULV A;  4QNH B;  4FLZ A;  3ABT A;  3IPM O;  3B9Q A;  1ARO P;  4LP8 A;  4B6I A;  3LSS A;  4CZZ A;  4MVO A;  5B1B B;  4LF9 B;  1ZHX A;  1F1M A;  3DD7 A;  3RH3 A;  1VOM A;  1EFR G;  2ZXR A;  4MW3 A;  4DV2 B;  2Q8V A;  3RW0 A;  3ZHR A;  2BTQ A;  4KHP B;  5DVW A;  1H38 A;  1K7D A;  2FML A;  3ZRV A;  2H94 A;  1FAP B;  3F7V C;  2YRF A;  1H2G A;  2YUA A;  1FNT c;  4I9Q A;  4B3R O;  2YXH A;  2ZM6 O;  4U5D E;  4TOI A;  4JJF A;  1I0H A;  3VBB A;  2WWW A;  3ZHQ A;  3POV A;  4DR6 O;  3EGX B;  1KD1 W;  1D0X A;  2Y4T A;  1R3K C;  1Y76 A;  2A3Q A;  4DUZ B;  3ZHU A;  2Q68 A;  4J7T A;  4LDR A;  2A6H F;  3ZVR A;  2OWO A;  1RJ9 A;  5KHJ A;  2HFI A;  3U3B A;  3G6B A;  1FFT B;  4F6E A;  4DRJ B;  3E2E A;  3S0X A;  2HP8 A;  2YL1 A;  1YJ9 V;  4UDV A;  2R7T A;  5TIS Z;  1GO3 F;  1NS1 A;  2HKO A;  5HFL A;  1JA8 A; 
#chains in the Genus database with same CATH homology
 4FX5 A;  1YTF B;  1Q7Y W;  1NKD A;  3W7S A;  2QTV A;  2Q6A A;  2QA4 V;  2DYR B;  3V7O A;  5HFM A;  1D1C A;  1VMA A;  3LDE A;  1K4D C;  1FXK A;  3EGX A;  2DYS B;  4DBR A;  1S7Z A;  3E70 C;  2WVQ A;  4XBF A;  4BJ6 C;  4CBE A;  1SRY A;  1L1F A;  3CZ6 A;  2H7B A;  5LHH A;  3KMI A;  2B5U A;  1OCC C;  3BY6 A;  1D1A A;  4YT4 A;  3NYL A;  5L3B A;  4GX5 A;  4UVC A;  4DO2 A;  5CBF A;  5IDJ A;  1VQ7 V;  2GFH A;  2W45 A;  2Y3B A;  1PNL A;  3CCS V;  3IEE A;  3KH2 A;  2CGE A;  1AI7 A;  3NKD A;  3CCL V;  2WVN A;  1DF5 A;  3MLG A;  4R7C A;  5B3S C;  4PJL A;  4X0R A;  5HSW A;  4C7O A;  1AI4 A;  2W4B A;  3KKB A;  4CS7 A;  4WJ0 A;  1BMF G;  3JD3 A;  4JAS A;  3CC2 V;  3H65 A;  1K34 A;  3B77 A;  5L3C A;  2W9Y A;  3HLZ A;  4C3B A;  2PP4 A;  4MQ9 F;  3ZRS A;  1H8E G;  3K1H A;  3S29 A;  4BEJ A;  2WZG A;  2ITC C;  2ZXO A;  2Y69 C;  1ZHW A;  3DTU B;  4JYC A;  4MVR A;  5KUM A;  3I56 V;  1NVP B;  4K7B A;  4JZA A;  3WOD F;  3OR6 C;  4X88 A;  5L3D A;  3WFV A;  4HZ3 A;  4CSA C;  3ABL B;  4MVM A;  5H6R A;  1OKK D;  1WGW A;  4J9Y B;  2XAS A;  3N2Z B;  4LER A;  4O6Y A;  1MG1 A;  1BR4 A;  4CS9 A;  1K92 A;  1BR2 A;  3UGO A;  3O6X A;  5D92 A;  4W8K A;  2D5R B;  2OT5 A;  2JDI G;  5DLJ A;  4PDL A;  4JTA B;  1Z23 A;  3DM5 A;  2G3K A;  4KNV A;  2YEV B;  4N06 A;  4C3E A;  4PA6 A;  3MD0 A;  2A1D D;  2R7R A;  4I1O B;  3K7D A;  4JGS A;  2WL8 A;  4NY3 A;  2VAS A;  1KP3 A;  2WLK A;  3PHF 2;  4BJ5 A;  2IU0 A;  4O6N A;  2DYR C;  4BW5 A;  3B0V C;  3SYC A;  1JPN A;  4A2N B;  3CME V;  4EKW A;  2WLL A;  2JIZ G;  2WZL A;  5LGN A;  3JD0 A;  4N21 A;  1I5Y A;  2HVJ C;  3DAF A;  4J30 B;  4XTK A;  5L3E A;  2WLH A;  4RAI A;  3OGC C;  3NDB B;  4LAC B;  4UV8 A;  2IJH A;  4CS8 C;  1IXM A;  1PL0 A;  3QNE A;  3K03 A;  4G2K A;  5L3V A;  3OMI B;  4LCU C;  2K1E A;  4ZLC A;  2YEV A;  3DAG A;  4C7O B;  1FTS A;  1W2B U;  3MX3 A;  3B0U X;  3W7X A;  5DQZ A;  3I55 V;  5KYN A;  2M7W A;  3LES A;  3ZN0 A;  1FXV A;  2AHZ A;  2C2A A;  1S3J A;  1TKN A;  2KGO A;  2P7V A;  1S0V A;  3B8N A;  1QR9 A;  3K08 A;  5CA3 A;  1ZU5 A;  5B3S B;  1PNK A;  1KU2 A;  3ZIA G;  1NBM G;  3L34 A;  1RPO A;  2HFE C;  2LP7 A;  2IXN A;  2L9J A;  1VQM V;  4JVS A;  2DWE C;  2WLI A;  3CCU V;  5KYU A;  1J95 A;  2WVO A;  1G8M A;  3AG2 B;  2D3O W;  3ML0 A;  3EHM A;  2IXM A;  1V54 B;  1Z6A A;  2IYL D;  3JSZ A;  3OEO A;  1OCZ C;  4DOZ A;  4PA9 A;  2J9U A;  3EHN A;  2HV6 A;  1GM9 A;  3A0R A;  1S77 D;  1WLE A;  2BOC C;  2PX0 A;  1NR7 A;  2J9W A;  4HAM A;  4QE9 A;  3WG7 C;  3I5P A;  3L0I A;  3RYL A;  3SPH A;  1BHA A;  4OD4 A;  1MOF A;  3JCZ A;  5LHG A;  3FB6 C;  2P6J A;  4DVY P;  1W0J G;  4WFG A;  3ASO B;  3N24 A;  4YWQ A;  3HB3 B;  3ZRW B;  5H6Q A;  3GOD A;  2X0L A;  3E9V A;  3LLK A;  1E79 G;  4KUM A;  1SZI A;  4TT3 G;  3ZN1 A;  4ZKI A;  2DQ3 A;  3ZMS A;  2JD3 A;  2KJG A;  1M2V B;  3DXJ F;  3GAN A;  4GYT A;  4RDA A;  1K4C C;  2X51 A;  5KUK A;  4QI2 A;  3ZSU A;  1LKX A;  5GW7 A;  1JPJ A;  3OUS A;  2J7P D;  1Y66 A;  3DM9 B;  4OIQ F;  1DTO A;  2XAG A;  3ABK C;  4M63 A;  4P6I C;  3OMA B;  1R6N A;  4R8C A;  4BJ5 C;  4X8A A;  5BUO A;  5T3T A;  2E87 A;  1YIJ V;  5B1O A;  3IFX A;  1R3I C;  1JPX A;  4Z1M G;  3EFO A;  3PMR A;  3QO8 A;  1Z5Z A;  1EZJ A;  4K0D A;  3CYO A;  4G7H F;  3LLI A;  3EPV A;  2IOQ A;  3ZRX A;  1ZHT A;  3KG2 A;  5KYY A;  3CCR V;  2GHY A;  2NG1 A;  2YZS A;  4LC1 A;  3Q7G A;  4IWB A;  4Q4Z F;  5KA5 A;  1B6Q A;  4CS9 C;  3CMA V;  3CC4 V;  2HG5 C;  4HYO A;  1THZ A;  1MNE A;  3JCU Q;  3W8I A;  4JYB A;  3SPJ A;  2B0J A;  1BL8 A;  4PEL A;  4KBL A;  4U5G A;  4Q5S F;  2P6V A;  3X1O A;  1MMD A;  2X6A A;  3CPW U;  4YXW G;  1SET A;  2J9V A;  2ZR2 A;  4WFH A;  3AG1 C;  4HEA J;  2H8P C;  2KNH A;  3I4U A;  3W7W A;  3LDD A;  5T1D B;  2JK5 C;  2HR3 A;  5KA6 A;  1G8X A;  3W8H A;  3Q6N A;  1NG1 A;  4YJW A;  4C3D A;  3ZMZ A;  1YJN V;  1TWC A;  3LEV A;  3ZG1 A;  1OCZ B;  2XSE A;  3GWO A;  1ZWI C;  2C03 A;  4GX1 A;  1F4N A;  4PFO A;  3AG1 B;  2CK3 G;  3D3I A;  3S28 A;  1F4M A;  3K0G A;  5FCL A;  1MMG A;  1MAB G;  4TWK A;  3M99 B;  2ITD C;  2M4E A;  2WB7 A;  3BEH A;  4EBB A;  1AJN A;  3EQL F;  2EJR A;  4YN0 B;  2QE7 G;  3RKO F;  2IXO A;  3TD7 A;  2R7V A;  3NKE A;  4ANJ A;  5EGY A;  1QLE B;  1PKX A;  1NR1 A;  3ABL C;  3LUT B;  3SPG A;  1AI6 A;  1M9N A;  5IY5 B;  1FMV A;  4MSW C;  3CCV V;  2NUP B;  5E2Q A;  1FXK C;  1ORQ C;  4CBC A;  3STL C;  1BHB A;  2W4M A;  4PJJ A;  5KYW A;  1AJQ A;  2G3V A;  3EZH A;  2PF4 E;  2IJI A;  2R7O A;  1BR1 A;  4P9P A;  1Q82 W;  1D0Z A;  1UJW B;  4MVZ A;  3SJQ C;  2Y39 A;  2QEX V;  3CC7 V;  2CNW D;  1E1R G;  3DJU B;  4P30 A;  2V7Q G;  4Q7C A;  3VOU A;  3I5Q A;  3KL4 A;  1O5H A;  4XWJ A;  2A0L A;  4BIU A;  1NH2 D;  3ABU A;  3RH3 A;  2DWD C;  2FTK A;  1QVF U;  3ZJZ A;  2JJ2 G;  2YSU B;  1GTO A;  1M57 C;  4BAY A;  3VYW A;  4WFF A;  1FXH A;  2YHS A;  1LS1 A;  4U5H A;  4OIO F;  4U5C E;  4RQF A;  2DW4 A;  1VK5 A;  5KYX B;  3JD1 A;  3X2Q B;  5EBL C;  4PJM A;  1P4R A;  1K3E A;  4KP4 A;  4AE4 B;  4H33 A;  1NH2 B;  3OW2 U;  1NU7 D;  2JJ1 G;  3SP1 A;  5J9P C;  3LSQ A;  5E33 A;  3ABM B;  4G7Z F;  2VH3 A;  3AEI A;  4U7N A;  2IU3 A;  4UUJ C;  5EK0 A;  3QO5 A;  4BG0 A;  3NG1 A;  1ROP A;  3R65 A;  3CXC U;  1Y4M A;  1GM8 A;  2XAF A;  2WPD G;  2ZDI C;  5EC2 C;  3STZ C;  2WSS G;  2JEX A;  3CCQ V;  1K73 W;  2XRH A;  3DZA A;  2Y48 A;  3F46 A;  2NUT A;  3SEO A;  4XLP F;  1IW7 F;  5LGT A;  2G62 A;  1VQ8 V;  2IXP A;  3CSK A;  2J0X A;  2R9I A;  3ZMT A;  5IYB O;  3FYI B;  2OTL V;  4R6Z A;  3EG9 B;  2LFR A;  3ZIB A;  5D91 A;  4MVS A;  1JVM A;  4RO2 A;  2IH3 C;  2QTO A;  4MVU A;  3ZMU A;  1OCO B;  1TWH A;  5E3A A;  1QR8 A;  3EZI A;  4JUR I;  3T6J A;  4KFM A;  3K66 A;  2ATK C;  2MYS A;  1VQ6 V;  5B1B C;  3NYJ A;  1LNQ A;  3B8M A;  3N0T A;  5FL7 G;  5IY5 C;  1J8Y F;  3QO7 A;  4XDJ A;  1COW G;  2ZDI A;  4LBE C;  1PD1 A;  2BOB C;  1OCO C;  4JPR A;  2Q3T A;  3T4Z A;  3ZC4 A;  3H01 A;  1SZT A;  2HV7 A;  1H8H G;  3E89 A;  2HLD G;  3AG4 B;  4FIP C;  4FPP A;  2EIL C;  1YTF D;  4PA4 A;  1PNM A;  1O87 A;  1GMG A;  2R9R B;  1V55 B;  3LDC A;  4ZLD A;  1K33 A;  5B1N A;  3K33 A;  2DQ0 A;  2F43 G;  3T4D A;  4U5F E;  3FKS G;  2ZXP A;  3EGD B;  2WLJ A;  1EBO A;  2W0F C;  3AG2 C;  3JYC A;  3OFN G;  1MMA A;  2ZPA A;  1VQO V;  3EFO B;  4GEH A;  3OR7 C;  2XAH A;  4GT1 A;  1YI2 V;  4DBQ A;  2Q67 A;  4RBN A;  2ZXW B;  1XL4 A;  1SES A;  5EHH A;  4AE4 A;  5DQT A;  3NYM A;  3G4S V;  1KP2 A;  2QKS A;  3WG7 B;  1JJ2 U;  3OEH G;  3OM3 B;  4GCZ A;  4YT5 A;  3EJN A;  1SER A;  1JOY A;  5IYC O;  5EC1 C;  3SZR A;  1CEZ A;  2Q9C A;  3F5W C;  3DJN B;  3HJC A;  3DGE A;  2A6E F;  2QM8 A;  5DS6 A;  1JQ0 A;  5E1A C;  3OE7 G;  3B0P A;  1E1Q G;  3FDQ A;  4JJG A;  1QLN A;  3G6E V;  2J0W A;  3ZRW A;  4CSA A;  3QMK A;  4MND A;  3E83 A;  4QPK A;  3EGD A;  3FVY A;  4QDL A;  4U5E E;  3X2Q C;  1QZX A;  3K6B A;  4QI0 A;  4I9W A;  4EWC A;  1QBZ A;  3OUF A;  4MTO A;  1QVG U;  2NUP A;  4MT8 A;  3AQC A;  2FFH A;  4I3M A;  1P7B A;  2ZD9 A;  3GB7 C;  4WFB V;  3UMI A;  4BJT A;  3RFY A;  4O7G A;  1RPR A;  2JEU A;  1NJI W;  1OKK A;  4PA7 A;  1OHH G;  3UM7 A;  2V26 A;  4WF9 V;  3G71 V;  4DXW A;  3JYH A;  5DM6 V;  2EZO A;  2NUT B;  1N8R W;  2AHY A;  2PI4 A;  2XL4 A;  2Z15 A;  1OCC B;  3D36 A;  3TCU A;  2A79 B;  5BZB A;  1V54 C;  2MK3 A;  5LGU A;  3E86 A;  1VQK V;  2J46 A;  4YT2 A;  1QCE A;  2H7V C;  3IGA C;  1M1K W;  3FB8 C;  2EIN B;  4ASU G;  1D1B A;  1TWA A;  3JRT A;  3QZC A;  1WPX A;  3SYO A;  3UNG C;  3O39 A;  1M2O A;  4CIH A;  4MTG A;  1D0Y A;  1SF8 A;  3K06 A;  4WCE V;  1V55 C;  3ASO C;  4PA3 A;  4UVA A;  3CP1 A;  4H4K C;  4FES A;  4E7S A;  3E35 A;  1R3L C;  2XXA A;  1XL6 A;  4O79 A;  3SYA A;  2R7X A;  2KB1 A;  3DMD A;  2W6I G;  3CCM V;  2PI5 A;  3ASN C;  4JAU A;  1VYK A;  1W0K G;  3FAJ A;  2OG2 A;  1FS0 G;  2LFS A;  3NXS A;  1AI5 A;  2EIJ C;  2WLL B;  4IJJ A;  3SPI A;  4LLC A;  1M57 B;  4YT8 A;  1GKF A;  5B1A B;  2IH1 C;  1MSW D;  2X6C A;  2DGJ A;  4J32 B;  3E8B A;  2X7R B;  4PDM A;  4I5S A;  2EIL B;  2Q9B A;  3EHB B;  2WLM A;  3F7Y C;  1DLB A;  4WFE A;  3ASN B;  3EH2 A;  4P9O A;  3OAA G;  1M56 B;  2CNW A;  4I44 A;  1FFT C;  4OIN F;  2EIM C;  1QLE C;  3Q7L A;  4MS2 A;  3FB5 C;  1TR2 A;  5CBG A;  4G0H A;  5LBQ A;  4KC9 A;  1G4Y B;  1ZU4 A;  4GX0 A;  2XOK G;  2V1D A;  3K79 A;  1ZHY A;  3NRH A;  3VAY A;  4JAV A;  1YSC A;  2QM7 A;  2EZP A;  4IAO A;  4BJ1 A;  4J9Z B;  3T1C A;  2ZXW C;  3ETD A;  3T2M A;  4U7O A;  4O6M A;  3SYN A;  2UXN A;  4RQE A;  5DS4 A;  1VQL V;  1VQ9 V;  1F23 A;  5EBW C;  1VQ5 V;  4GX2 A;  3LS1 A;  4XLN F;  3K0D A;  1PD0 A;  3UMH A;  1OCR B;  2CW0 F;  3RBZ A;  1JX9 A;  2XND G;  4TSF G;  2FGY A;  4BIZ A;  3FHD A;  3ETG A;  4H37 A;  2Z3Y A;  1NVP D;  2EBO A;  2OTJ V;  4MVQ A;  2Q9A A;  1AR1 B;  3CD6 V;  3RIP A;  3W2W A;  1VYI A;  3JT1 A;  2HJF C;  3LNR A;  4HFK B;  1JCH A;  4Q20 A;  1DF4 A;  3SPC A;  2X6B A;  2XAJ A;  3ABM C;  5C93 A;  1OZ0 A;  2C04 A;  4OIR F;  4I1M A;  4AK9 A;  4E7Z A;  2A68 F;  3RVY A;  4PFP A;  3CCE V;  2V3C C;  5KYY B;  5CI9 A;  4QJF B;  3ZCC A;  3LS0 A;  3K3W A;  4HFF B;  1I5X A;  1MND A;  1CP9 A;  4KNW A;  2UXX A;  3PJS K;  2P7T C;  1FFH A;  3AG4 C;  1VQ4 V;  3F47 A;  5E3C A;  3S27 A;  3SNH A;  3ZMV A;  4R50 A;  3K04 A;  4JTC B;  3AG3 C;  1TWG A;  2Y3D A;  4CS8 A;  1FXK B;  2ZQM A;  4JW1 A;  2IJJ A;  3Q6M A;  1Q81 W;  2EIJ B;  1ZHZ A;  2Y3H A;  5L3Q A;  2IJK A;  3P32 A;  3EH1 A;  5F5H A;  4FK5 C;  2I8B A;  1TUE B;  2Y69 B;  4F4B A;  1NU9 C;  3SYQ A;  2HVK C;  4AX2 A;  1YHQ V;  3UKM A;  5F5F A;  4JTD B;  3EG9 A;  3EFF K;  4L87 A;  2EIN C;  5B1A C;  1R73 A;  1K5Q A;  1R3J C;  2XAQ A;  3AG3 B;  1KQS U;  3AQB A;  1M56 C;  3K9A A;  3LNM B;  3P30 A;  2LSE A;  1ZYR F;  3LAY A;  5EBM C;  2B1G A;  1CPY A;  3JD4 A;  1FMW A;  4UV9 A;  3RVZ A;  2BE5 F;  4FWV A;  2WAM A;  3CQZ A;  1NQT A;  2CDQ A;  1KEC A;  1S72 V;  3TK1 A;  4QPJ A;  2OCC B;  2B1I A;  3SYP A;  3W7U A;  1YJW V;  2QY9 A;  1K9M W;  2WZF A;  4UXN A;  2A69 F;  3ABK B;  4RUF A;  2DYS C;  4ULW A;  2Z5U A;  1Z63 A;  3OA1 A;  3LJB A;  5L3G A;  3ITF A;  3W2V A;  1GM7 A;  2Q69 A;  2R7Q A;  3ECS A;  4LLE A;  2KW3 C;  4RUE A;  1RJ9 B;  3UMK A;  2WLN A;  4MTX A;  1Q86 W;  1LVK A;  2OCC C;  1F51 A;  4XDK A;  3T4R A;  3IC7 A;  2EIK B;  3K1I C;  1NZE A;  1OCR C;  4PDR A;  2KQ9 A;  1K8A W;  4MW8 A;  1RM1 B;  2XXA B;  3FYE B;  1ENV A;  2P90 A;  1M90 W;  4JCH A;  2EIM B;  5KYX A;  1HWY A;  4DVZ A;  3HPL C;  1K97 A;  4FMT A;  2O9X A;  1VQN V;  2ZR3 A;  4PDV A;  4QNH B;  3T6B A;  2R7U A;  3ABT A;  3ETE A;  1S5H C;  2P67 A;  3B9Q A;  1KKD A;  3HTK C;  4OIP F;  4E2L A;  1ARO P;  4LP8 A;  3FB7 C;  1RM1 C;  4B6I A;  5KYW B;  3LSS A;  4CZZ A;  5CBH A;  4MVO A;  5B1B B;  1ZHX A;  4ZBM A;  3DD7 A;  4QE7 A;  5IYD O;  4OXS A;  4G28 B;  1R6K A;  1EFR G;  1PD3 A;  3E8F A;  4MW3 A;  1VOM A;  2ZXR A;  4RD9 A;  3RW0 A;  4XDL A;  2W6J G;  3E8G A;  1IZM A;  4WFA V;  5H9C A;  2L81 A;  1ST6 A;  2PX3 A;  1H38 A;  5DVW A;  4BJ6 A;  1K7D A;  4G27 B;  4P2Z A;  3ZRV A;  2H94 A;  3CCJ V;  3F7V C;  5CI8 A;  4U5B E;  2IW5 A;  2WLI B;  4MTF A;  1H2G A;  2J45 A;  5KYU B;  3UGP A;  2NLJ C;  1YIT V;  3W7T A;  3OEE G;  1VQP V;  4X89 A;  1AJP A;  4U5D E;  4G7O F;  2R7W A;  3MHH C;  1PCX A;  4JJF A;  3VBB A;  2WWW A;  4FJC C;  2MWQ A;  3POV A;  2R7S A;  3OMN B;  3EGX B;  2VB6 A;  1KD1 W;  1D0X A;  4N23 A;  1R3K C;  4OD5 A;  3M1C B;  1S76 D;  3UR3 C;  5CN0 A;  2Q68 A;  4PJN A;  4IRU A;  5LHI A;  4HE8 D;  1SMY F;  1GK9 A;  1J8M F;  2A6H F;  1K5S A;  4JF3 A;  1RJ9 A;  3OWT A;  3ZVR A;  2A9H A;  1N1C A;  2Y3G A;  4F4L A;  1FFT B;  4UVB A;  5DN6 G;  1M2V A;  5CMU A;  5DS5 A;  2GSM B;  2H7O A;  3E8H A;  3E2E A;  1KC8 W;  4KI2 A;  5T3W A;  3MHS C;  3JD2 A;  3S0X A;  4PK4 A;  3TET A;  1Z3I X;  5L3F A;  1W2W A;  4QIW F;  1YJ9 V;  2J7P A;  2R7T A;  2EIK C;  1MMN A;  2NNU A;  1GO3 F;  2PFD A;  2HKO A;  5HFL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...