2J9BA

The crystal structure of cytochrome c' from rubrivivax gelatinosus at 1.5 a resolution and ph 6.3
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
127
structure length
127
Chain Sequence
QFQKPGDAIEYRQSAFTLIANHFGRVAAMAQGKAPFDAKVAAENIALVSTLSKLPLTAFGPGTDKGHGTEAKPAVWSDAAGFKAAADKFAAAVDKLDAAGKTGDFAQIKAAVGETGGACKGCHDKFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title High resolution crystal structure of Rubrivivax gelatinosus cytochrome c'.
pubmed doi rcsb
molecule tags Electron transport
total genus 50
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2j9bA00
3TOMA 2XM0A 4IAQA 5JT4A 4CDVA 2YLGA 3QVZA 4CJGA 1JAFA 4D4XA 3VRCA 4N4WA 1CGOA 3L1MA 2CCYA 4WGZA 256BA 2J9BA 2YL7A 3FOPA 4U9EA 4CJOA 3HNIA 5JSLA 3IQ5A 3M4CA 5JRAA 1NBBA 4CX9A 3QW0A 5JLIA 4WGYA 1QPUA 2YLDA 1CPRA 1MQVA 2XLHA 3TOLA 1M6TA 4JE9A 3DE8A 3M15A 2XLWA 3M4BA 4D4NA 5JUAA 2YL3A 3ZQVA 4CIPA 2YL0A 2XL6A 2XLVA 3ZQYA 4IB4A 3U8PA 4NC3A 1S05A 4L6RA 4N6HA 3ZTZA 1YZAA 1QQ3A 3QW1A 1A7VA 2YL1A 4CDYA 4JKVA 3IQ6A 2J8WA 4EIYA 3NMJA 4JEAA 4CDAA 2YLIA 3C62A 4JEBA 3FOOA 1E85A 1YYJA 2QLAA 1YYXA 2BC5A 3HNLA 5AGFA 2YKZA 3DE9A 3NMKA 2XL8A 3HNJA 5JS5A 3HNKA 1E83A 2XLMA 4IARA 3ZWIA 3NMIA 5JVEA 3QVYA 1LM3B 1E86A 3ZTMA 3M79A 1APCA 2XM4A 1EKYA 1BBHA 1RCPA 4ULVA 4ER9A 2XLEA 5B3IA 4U9DA 2XLOA 1CGNA 2XLDA 1CPQA 1YZCA 1GQAA 1E84A 3C63A 5JP7A
chains in the Genus database with same CATH superfamily
4JW1A 4EBBA 1VLSA 2KSFA 3I4UA 4KNWA 4CS7A 2ZXOA 3QVZA 1JAFA 2HZ8A 1U0BB 3W8IA 3DAFA 2A0UA 4JC7A 2OEVA 4N4WA 2HFIA 2X0CA 2EPNA 3CQZA 1VOMA 3TULA 2R7UA 2KK1A 3VF0A 1TWCA 3JZ0A 4I1MA 3G50A 1LS4A 4K0DA 1D1CA 1SMYF 2JPUA 4PJMA 3UR3C 4OIOF 4MS2A 1VB5A 3IQCA 4G78A 1H7IA 2J9BA 2MHRA 3ZC4A 1XZQA 4BEJA 1M56C 4U9EA 1NFNA 3HNIA 3K7DA 2H7OA 3W2WA 4MTOA 4P6IC 2TMVP 5A6KA 3UMKA 2EPOA 1OCZC 2A6EF 5B3SC 2CNWA 3B0VC 1MMAA 3GM3A 1FFHA 4XTKA 2CNWD 4AX2A 1MQVA 1D1AA 2I15A 3MYFA 1LPEA 3KPHA 4JE9A 3M15A 4HEAJ 5KYNA 1EA8A 2R7RA 3NG1A 1IW7F 3M4BA 1VMAA 2WL8A 2XL4A 4C3BA 3O10A 2YL3A 4CBEA 1H9TA 3EFOB 3EGDA 3OA1A 2DYSC 2LCHA 4MVUA 1FR0A 4JRZA 4AL1A 2PP4A 3AJMA 1Q0DA 4Q5SF 4LDKA 3RQFA 4BJTA 2XLVA 4XEKA 2WVNA 3JRTA 1PD0A 4XPXA 2EPLX 2NSFA 1C02A 3W2VA 3WG7C 1NU7D 4AK9A 2C03A 1Z63A 1SZIA 1MNDA 1S05A 1T9KA 3EQLF 3LLIA 3FDQA 4LDQA 5FZTA 4N6HA 4PACA 2Q4FA 4DVYP 3EZHA 1QQ3A 3QW1A 2ZXWC 2YL1A 3UMIA 4JKVA 4MW8A 3DI5A 1D0YA 1YA7O 3PDMP 3W8HA 3S27A 2W9YA 3NMJA 4JEAA 4C3EA 4EIYA 3SZRA 4CS8A 3S9OA 4KBLA 2NUTB 1YVIA 2Q9BA 2YRFA 2YVKA 3ITFA 4JEBA 4PFPA 2L6HA 3FOOA 3TQOA 2Y3GA 5T1DB 4ZLCA 2QTVA 4I44A 5EHHA 1QLEC 1KTMA 3HNLA 4NY3A 2LK4A 2WVOA 3US6A 2OCCC 3RF3A 1G4US 2EPMX 4YL0A 5BQIA 3A11A 4I3MA 3L34A 2P6VA 3SXYA 3EH1A 3LUTB 3HNJA 3G4ZA 3HNKA 5JS5A 1E83A 2XXAB 3K1IA 3U2LA 4JJFA 3AG2C 3DMDA 4E18A 5JVEA 2IXOA 3NYMA 1C03A 2WZLA 1UG7A 3QVYA 1LM3B 2AWCA 3LS0A 3VM6A 5GPGB 1GGQA 3NKDA 2HUJA 3EFOA 3TJ5A 3KMIA 4EBKA 2J9UA 4A4AA 3ZSUA 4JCZA 1T6UA 4YT5A 1BBHA 2H7BA 1RCPA 2I8BA 3VYWA 2XLEA 4U9DA 3DM5A 2XLDA 3DAGA 4C7OB 1Z3IX 1BR2A 3LNRA 5COMA 5KYXB 2B0JA 3U9MA 3TK0A 3ASOC 1W2WA 4U5DE 1OCCC 1MMNA 2CGEA 1LE4A 2VCCA 4O79A 3SYNA 2W4MA 4ANJA 5BUOA 2EINC 1WOLA 1J8YF 3AOUA 1FTSA 4CDVA 1ZZPA 4MTGA 4D4XA 4CJGA 3KYJA 2BE5F 3O39A 1L7CA 2MWQA 2QNLA 1LVKA 2KJGA 3ABMC 5KYUB 1WASA 1NU9C 1CGOA 4RBNA 5F5FA 5E3AA 3GEEA 3V5XA 3WODF 3N0TA 1TWGA 5DS6A 4YT8A 2P61A 2KNHA 3EG9B 2IBFA 3EGXB 5L0HA 4LACB 2VC9A 4R32A 4BG0A 3EZIA 1YLMA 4MW3A 3S90A 4CSAA 3FOPA 1VLTA 2IOQA 1VYIA 1D0XA 1WGWA 4Z9IA 3C8GB 2GWWA 3M4CA 4PR9A 1D0ZA 4DBRA 3GORA 1NG1A 2X51A 4JTDB 4WGYA 3UNGC 1JOGA 2XXAA 2YWAA 3KL4A 3L8JA 4K7BA 1BR4A 4MVZA 4G7ZF 3NRHA 1OXKA 4DRHB 3JYHA 3TOLA 1M6TA 2Q3TA 1Y6DA 4YN0B 2ZPAA 4JURI 1LI7A 3GWLA 2ETSA 4G0HA 4KC9A 2LSEA 4D4NA 3GEIA 5CIVA 4ULWA 1RMVA 3R2PA 2FFHA 2OG2A 2CYDA 1ORJA 2J9VA 2Q9AA 2W45A 4EHPA 2D5RB 3RYLA 4E7SA 2VASA 3SXMA 2HV6A 5T3TA 3T9OA 1Q0MA 3E70C 3NKEA 1O3UA 3O55A 4A2NB 3SP1A 1K04A 4MTFA 4J7YA 2EIMC 3ZIBA 4CS9A 2R05A 4IRUA 2FGYA 1HMOA 3ZQYA 3DWWA 2R7SA 1XZPA 4NC3A 1D1BA 2ASRA 2IXNA 2Q00A 5F28E 2DB4A 2E87A 1K40A 4E0IA 3ZTZA 3QMKA 1VTMP 3J06A 3K33A 4DRJB 3O6XA 2G3KA 1JR8A 1A7VA 3K1HA 3AG4C 1G4WR 1WN0A 2HKVA 3A9CA 3FAPB 2J7PA 3EG9A 2YEVA 3IQ6A 1Z5ZA 2KC3A 3T6GB 4G7OF 2J7PD 1A7DA 1QVXA 3ZVRA 3DKAA 1AVOB 2M64A 1OQCA 1LKXA 2R9RB 3CSKA 3K1IC 4EBJA 3S28A 2NUPA 3E9VA 4YT2A 1TWAA 2ICWG 5COGA 5AGFA 2AU5A 4F4BA 2YKZA 3DE9A 4XPYA 2L6FA 1VYKA 4GEHA 1FNTc 4QI2A 3B29A 4BPMA 1RKEB 4AE4B 3JRMO 5FCLA 1V55C 2P7VA 2AVKA 2A68F 3H65A 1J8MF 3NYJA 1PV3A 1ORYA 3RKOF 3AG1C 3RQEA 1FAPB 3U0CA 3POVA 1I4ZA 4W8KA 3DJUB 3M79A 4YWQA 3EPVA 5L0GA 1EI7A 2LIGA 3PMRA 4BJ6A 1NLXA 2B0HA 2NSGA 2OU6A 1RKCA 3AGTA 3EH2A 3H2UA 3R7CA 1U6HA 1KNYA 3U5SA 3ASNC 3X2QC 4LLEA 4DJ9A 4DRIB 5L0DA 1EKYA 2R02A 2CDQA 4Q7CA 2OKUA 4EWCA 3GANA 4PJLA 5B3IA 2XLOA 1CGNA 3FMSA 2PNOA 1HMDA 3Q7LA 2A6HF 3DXJF 1GQAA 1ZHXA 3EHMA 1AUEA 3B0UX 1E84A 2R7XA 3RQGA 2EILC 1OW7A 1JRAA 1A7EA 2PBEA 3TD7A 5L3QA 1LI5A 1QKRA 1Z6AA 2XM0A 4I1OB 1K05A 2JX0A 2LFDA 3EHNA 3LJBA 4IAQA 4JIOA 3ZDLA 4LERA 1TR2A 2PX3A 4RD9A 3SNHA 5A6JA 5KYYB 3RVZA 3C18A 5JLIA 1TFKB 3IEEA 4CSAC 4XWJA 1B68A 3OEOA 1G5ZA 3VRCA 1HY5A 2DI3A 1FMWA 3LEOA 4U5FE 5DQTA 3AG3C 1SF8A 4C3DA 2R7QA 3S84A 2Y3BA 1Q0FA 2PFDA 3X1OA 4O7GA 3L1MA 1OKKA 1ST6A 1ZYRF 2CCYA 2QUPA 2GDCA 3IHUA 5KYWB 3IPMO 2R7VA 4OD4A 4QI0A 256BA 5HV9A 4KNVA 3EJNA 4X0RA 3ABLC 1OR3A 3CZ6A 5F5HA 1JPJA 4N06A 2AP3A 1ZU5A 1M57C 1NZEA 1RKEA 3IQ5A 4AE4A 1NBBA 4CX9A 1LS1A 1EQ1A 1VK5A 2J0XA 3QW0A 2AWYA 1ZU4A 3GEHA 3BEHA 2LFFA 4MVSA 3N2ZB 1SR2A 2DYRC 1BR1A 4H54A 3LLKA 1QPUA 2QY9A 2RSEB 2WZGA 4NTAA 2YLDA 3LAYA 4BJ5A 4BEMJ 1FMVA 4O6YA 4XLNF 3DJNB 4CS9C 2OJED 4NQFA 3V5ZA 3MLGA 1KU2A 3HTKC 4K1OA 2OJQA 4NTFA 3HKKA 3QTHA 4MVRA 2R7OA 1A41A 2L7AA 5L3VA 2JD3A 5EGYA 1ZHZA 4MVMA 1TFOB 4OINF 2GAQA 4B6IA 1JMWA 2LD6A 2NUTA 3JSEO 2YL0A 2VCBA 3GWNA 1BZ4A 1NFOA 1WWPA 1YJGA 2MYSA 4U5HA 2J45A 3SEOA 2H8AA 4O6NA 4AL0A 4Q4ZF 2ZXPA 4IB4A 3LS1A 1LIHA 3OWTA 3KYIA 1LE2A 5A6BA 3GODA 2OQMA 4L6RA 4JVSA 5KYYA 1Y4CA 4U5EE 1YAUO 4OIRF 5A6BD 3KH2A 1OW8A 1DOVA 1OCOC 4IGGA 3U3FA 5AC4A 3PCVA 3RFYA 5HSWA 2Y39A 4HE8D 3I5PA 5TJ5E 4CDYA 2VCAA 3UGPA 1I5NA 1MMDA 1R5ID 4JTCB 4M63A 2R7WA 1JPNA 4N6CA 4CDAA 5DLJA 2GFHA 5E2QA 1QSPA 2HJMA 1OXBA 2YLIA 3C62A 1ZHTA 3KKBA 4LLCA 2A0BA 2P0NA 2YHSA 3CEXA 3EGDB 3T6JA 5DS4A 5A6AA 1ORSC 2HSBA 2QLAA 3Q7GA 4C7OA 2BC5A 4XEFA 2OEXA 2D4UA 4GYTA 4J7TA 4MNDA 4YL3A 5IY5C 5KYXA 3BRJA 3NMKA 4BJ6C 1YDIA 5B1BC 2VB6A 1T6QA 3MX3A 2XL8A 4CIHA 2NPUA 3K6BA 4JZAA 4PFOA 4CS8C 3LEVA 3U9JA 3DZAA 2HJ3A 2WZFA 3K66A 2Z15A 4ONSA 1R4TA 5D92A 5KYUA 3UMHA 3ZWIA 3T4RA 1Q0KA 3DM9B 2L9JA 4OIPF 4YL1A 2L6GA 4JCHA 4E0HA 2C04A 3PHF2 3ZTMA 3IQTA 4DVZA 3GM2A 3VAYA 2EIJC 1UFBA 3EGXA 2XRHA 3FAJA 5L0JA 4YK5A 2XM4A 3Q6MA 5L0CA 2V3CC 5D91A 1T5OA 3DD7A 4ULVA 3T6BA 4ER9A 1OW6A 2KQ9A 2Q9CA 2LQGA 2QE9A 3C8GA 4E17A 1YZCA 3C8GD 4P9FA 1Q0GA 3B71A 5E3CA 3TOMA 5A69A 2NG1A 4RDAA 3M1CB 5JT4A 4YT4A 2UUHA 2YLGA 1PCXA 1GS9A 3NYLA 5T3WA 4FESA 4G7HF 2KW3C 5CI9A 4BJ1A 1T6IA 2RD9A 1C17M 1TWHA 2Y69C 1Z7Qc 4XQ1A 4ZLDA 2HS5A 2IXMA 4EUKB 4BJ5C 2UUIA 3WAQA 1M2OA 3MBGA 1TQGA 3W4YA 4IJJA 3G4XA 4WGZA 2FAPB 2KYHA 4Z9JA 3JTLO 4DOZA 4GQHA 3S0XA 4IAOA 2CW0F 1SYQA 2EPKX 3AQCA 2YL7A 3AQBA 2HMQA 4CJOA 2WB7A 2J46A 1M2VB 5JSLA 2V26A 2R03A 5JRAA 1OCRC 1ZW2A 5DVWA 4FAPB 4E7ZA 3LNMB 5CI8A 4EKWA 3ATPA 1WTYA 1O87A 3ECSA 1CGME 2EIKC 4MVOA 3HJCA 1CPRA 3LESA 4DXWA 1H9GA 1RJ9B 5L0IA 2XLHA 3C7JA 3I5QA 1ZW3A 4NTBA 3GM1A 1QZXA 3JCUQ 3DE8A 2DGJA 1NSGB 2XLWA 1S7ZA 1PD1A 3Q6NA 3L8IA 1YA9A 4U5CE 3V5YA 3FHDA 5JUAA 5DS5A 4HFFB 5COFA 4H4KC 2IXPA 2WVQA 3NDBB 3ZQVA 3AGUA 1T01A 1O5HA 2M4EA 4W8PA 3U8VA 1HE1A 4NCQA 4CIPA 2XL6A 5B1AC 1DOWA 1OKKD 2YQYA 1N1CA 2G62A 2IYLD 2W4BA 5K0IA 3S29A 4LDRA 4OIQF 1HW1A 3N24A 2YZSA 2A69F 4J32B 5E33A 4PJNA 2XS1A 1AEPA 4P9TA 1BDJB 2R7TA 2O9XA 3U8PA 1E2XA 1YARO 1MNEA 4J30B 1GM5A 2P1AA 3H2VA 2Y3DA 5L0FA 4MVQA 1H6GA 2A1DD 2ZXRA 3JT1A 4IWBA 1YZAA 1Z23A 3UGOA 2ZD9A 1U89A 4JJGA 1WATA 4XEVA 2XSEA 2F22A 2J8WA 4YJWA 3B9QA 3L0IA 3RH3A 1HW2A 1L3PA 2GA0A 3F47A 4DBQA 1IZMA 3CAXA 4QDLA 2PF4E 5DQZA 1RXQA 1V74B 3RVYA 2LP4A 4MQ9F 1YYJA 2OOCA 1M2VA 1V54C 1YYXA 2L81A 3JSZA 1E85A 2J9WA 3TJ6A 5BQGA 3B0PA 4O6MA 1V4AA 2BL2A 2XS8A 2PX0A 4U5GA 3F46A 1RJ9A 2IM8A 4UDVA 4U5BE 3RW0A 5EK0A 2XLMA 3HLZA 3MFNA 4HFKB 3NMIA 1FFTC 1OR2A 4IARA 5BQHA 3SXKA 4XLPF 3WHNA 1I4YA 1E86A 1TKNA 1F1MA 2Q7RA 2J0WA 4Z9HA 1ZHWA 3U2MA 3SXZA 3U3BA 5KYWA 2HMZA 1APCA 1ZVZA 4FX5A 4PJJA 1HE9A 1MMGA 2KGOA 4OD5A 3FXHA 4WJ0A 3V7OA 2R25A 1G8XA 2HSQA 3FVYA 3JYYA 3QZCA 1XWJA 4FWVA 3ZG1A 5AC5A 3MYIA 2H7VC 2NUPB 2Y3HA 4WABA 2VH3A 3RIPA 4KI2A 1CPQA 1A0BA 4PK4A 3ABKC 4JTAB 4XPWA 1ZHYA 3C63A 2G3VA 5JP7A 2HV7A 3C8ZA
chains in the Genus database with same CATH topology
3TOMA 2XM0A 4IAQA 5JT4A 4CDVA 2YLGA 3QVZA 4CJGA 1JAFA 4D4XA 3VRCA 4N4WA 1CGOA 3L1MA 2CCYA 4WGZA 256BA 2J9BA 2YL7A 3FOPA 4U9EA 4CJOA 3HNIA 5JSLA 3IQ5A 3M4CA 5JRAA 1NBBA 4CX9A 3QW0A 5JLIA 4WGYA 1QPUA 2YLDA 1CPRA 1MQVA 2XLHA 3TOLA 1M6TA 4JE9A 3DE8A 3M15A 2XLWA 3M4BA 4D4NA 5JUAA 2YL3A 3ZQVA 4CIPA 2YL0A 2XL6A 2XLVA 3ZQYA 4IB4A 3U8PA 4NC3A 1S05A 4L6RA 4N6HA 3ZTZA 1YZAA 1QQ3A 3QW1A 1A7VA 2YL1A 4CDYA 4JKVA 3IQ6A 2J8WA 4EIYA 3NMJA 4JEAA 4CDAA 2YLIA 3C62A 4JEBA 3FOOA 1E85A 1YYJA 2QLAA 1YYXA 2BC5A 3HNLA 5AGFA 2YKZA 3DE9A 3NMKA 2XL8A 3HNJA 5JS5A 3HNKA 1E83A 2XLMA 4IARA 3ZWIA 3NMIA 5JVEA 3QVYA 1LM3B 1E86A 3ZTMA 3M79A 1APCA 2XM4A 1EKYA 1BBHA 1RCPA 4ULVA 4ER9A 2XLEA 5B3IA 4U9DA 2XLOA 1CGNA 2XLDA 1CPQA 1YZCA 1GQAA 1E84A 3C63A 5JP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TOM A;  2XM0 A;  4IAQ A;  5JT4 A;  4CDV A;  2YLG A;  3QVZ A;  4CJG A;  1JAF A;  4D4X A;  3VRC A;  4N4W A;  1CGO A;  3L1M A;  2CCY A;  4WGZ A;  256B A;  2J9B A;  2YL7 A;  3FOP A;  4U9E A;  4CJO A;  3HNI A;  5JSL A;  3IQ5 A;  3M4C A;  5JRA A;  1NBB A;  4CX9 A;  3QW0 A;  5JLI A;  4WGY A;  1QPU A;  2YLD A;  1CPR A;  1MQV A;  2XLH A;  3TOL A;  1M6T A;  4JE9 A;  3DE8 A;  3M15 A;  2XLW A;  3M4B A;  4D4N A;  5JUA A;  2YL3 A;  3ZQV A;  4CIP A;  2YL0 A;  2XL6 A;  2XLV A;  3ZQY A;  4IB4 A;  3U8P A;  4NC3 A;  1S05 A;  4L6R A;  4N6H A;  3ZTZ A;  1YZA A;  1QQ3 A;  3QW1 A;  1A7V A;  2YL1 A;  4CDY A;  4JKV A;  3IQ6 A;  2J8W A;  4EIY A;  3NMJ A;  4JEA A;  4CDA A;  2YLI A;  3C62 A;  4JEB A;  3FOO A;  1E85 A;  1YYJ A;  2QLA A;  1YYX A;  2BC5 A;  3HNL A;  5AGF A;  2YKZ A;  3DE9 A;  3NMK A;  2XL8 A;  3HNJ A;  5JS5 A;  3HNK A;  1E83 A;  2XLM A;  4IAR A;  3ZWI A;  3NMI A;  5JVE A;  3QVY A;  1LM3 B;  1E86 A;  3ZTM A;  3M79 A;  1APC A;  2XM4 A;  1EKY A;  1BBH A;  1RCP A;  4ULV A;  4ER9 A;  2XLE A;  5B3I A;  4U9D A;  2XLO A;  1CGN A;  2XLD A;  1CPQ A;  1YZC A;  1GQA A;  1E84 A;  3C63 A;  5JP7 A; 
#chains in the Genus database with same CATH topology
 4JW1 A;  4EBB A;  1VLS A;  2KSF A;  3I4U A;  4KNW A;  4CS7 A;  2ZXO A;  3QVZ A;  1JAF A;  2HZ8 A;  1U0B B;  3W8I A;  3DAF A;  2A0U A;  4JC7 A;  2OEV A;  4N4W A;  2HFI A;  2X0C A;  2EPN A;  3CQZ A;  1VOM A;  3TUL A;  2R7U A;  2KK1 A;  3VF0 A;  1TWC A;  3JZ0 A;  4I1M A;  3G50 A;  1LS4 A;  4K0D A;  1D1C A;  1SMY F;  2JPU A;  4PJM A;  3UR3 C;  4OIO F;  4MS2 A;  1VB5 A;  3IQC A;  4G78 A;  1H7I A;  2J9B A;  2MHR A;  3ZC4 A;  1XZQ A;  4BEJ A;  1M56 C;  4U9E A;  1NFN A;  3HNI A;  3K7D A;  2H7O A;  3W2W A;  4MTO A;  4P6I C;  2TMV P;  5A6K A;  3UMK A;  2EPO A;  1OCZ C;  2A6E F;  5B3S C;  2CNW A;  3B0V C;  1MMA A;  3GM3 A;  1FFH A;  4XTK A;  2CNW D;  4AX2 A;  1MQV A;  1D1A A;  2I15 A;  3MYF A;  1LPE A;  3KPH A;  4JE9 A;  3M15 A;  4HEA J;  5KYN A;  1EA8 A;  2R7R A;  3NG1 A;  1IW7 F;  3M4B A;  1VMA A;  2WL8 A;  2XL4 A;  4C3B A;  3O10 A;  2YL3 A;  4CBE A;  1H9T A;  3EFO B;  3EGD A;  3OA1 A;  2DYS C;  2LCH A;  4MVU A;  1FR0 A;  4JRZ A;  4AL1 A;  2PP4 A;  3AJM A;  1Q0D A;  4Q5S F;  4LDK A;  3RQF A;  4BJT A;  2XLV A;  4XEK A;  2WVN A;  3JRT A;  1PD0 A;  4XPX A;  2EPL X;  2NSF A;  1C02 A;  3W2V A;  3WG7 C;  1NU7 D;  4AK9 A;  2C03 A;  1Z63 A;  1SZI A;  1MND A;  1S05 A;  1T9K A;  3EQL F;  3LLI A;  3FDQ A;  4LDQ A;  5FZT A;  4N6H A;  4PAC A;  2Q4F A;  4DVY P;  3EZH A;  1QQ3 A;  3QW1 A;  2ZXW C;  2YL1 A;  3UMI A;  4JKV A;  4MW8 A;  3DI5 A;  1D0Y A;  1YA7 O;  3PDM P;  3W8H A;  3S27 A;  2W9Y A;  3NMJ A;  4JEA A;  4C3E A;  4EIY A;  3SZR A;  4CS8 A;  3S9O A;  4KBL A;  2NUT B;  1YVI A;  2Q9B A;  2YRF A;  2YVK A;  3ITF A;  4JEB A;  4PFP A;  2L6H A;  3FOO A;  3TQO A;  2Y3G A;  5T1D B;  4ZLC A;  2QTV A;  4I44 A;  5EHH A;  1QLE C;  1KTM A;  3HNL A;  4NY3 A;  2LK4 A;  2WVO A;  3US6 A;  2OCC C;  3RF3 A;  1G4U S;  2EPM X;  4YL0 A;  5BQI A;  3A11 A;  4I3M A;  3L34 A;  2P6V A;  3SXY A;  3EH1 A;  3LUT B;  3HNJ A;  3G4Z A;  3HNK A;  5JS5 A;  1E83 A;  2XXA B;  3K1I A;  3U2L A;  4JJF A;  3AG2 C;  3DMD A;  4E18 A;  5JVE A;  2IXO A;  3NYM A;  1C03 A;  2WZL A;  1UG7 A;  3QVY A;  1LM3 B;  2AWC A;  3LS0 A;  3VM6 A;  5GPG B;  1GGQ A;  3NKD A;  2HUJ A;  3EFO A;  3TJ5 A;  3KMI A;  4EBK A;  2J9U A;  4A4A A;  3ZSU A;  4JCZ A;  1T6U A;  4YT5 A;  1BBH A;  2H7B A;  1RCP A;  2I8B A;  3VYW A;  2XLE A;  4U9D A;  3DM5 A;  2XLD A;  3DAG A;  4C7O B;  1Z3I X;  1BR2 A;  3LNR A;  5COM A;  5KYX B;  2B0J A;  3U9M A;  3TK0 A;  3ASO C;  1W2W A;  4U5D E;  1OCC C;  1MMN A;  2CGE A;  1LE4 A;  2VCC A;  4O79 A;  3SYN A;  2W4M A;  4ANJ A;  5BUO A;  2EIN C;  1WOL A;  1J8Y F;  3AOU A;  1FTS A;  4CDV A;  1ZZP A;  4MTG A;  4D4X A;  4CJG A;  3KYJ A;  2BE5 F;  3O39 A;  1L7C A;  2MWQ A;  2QNL A;  1LVK A;  2KJG A;  3ABM C;  5KYU B;  1WAS A;  1NU9 C;  1CGO A;  4RBN A;  5F5F A;  5E3A A;  3GEE A;  3V5X A;  3WOD F;  3N0T A;  1TWG A;  5DS6 A;  4YT8 A;  2P61 A;  2KNH A;  3EG9 B;  2IBF A;  3EGX B;  5L0H A;  4LAC B;  2VC9 A;  4R32 A;  4BG0 A;  3EZI A;  1YLM A;  4MW3 A;  3S90 A;  4CSA A;  3FOP A;  1VLT A;  2IOQ A;  1VYI A;  1D0X A;  1WGW A;  4Z9I A;  3C8G B;  2GWW A;  3M4C A;  4PR9 A;  1D0Z A;  4DBR A;  3GOR A;  1NG1 A;  2X51 A;  4JTD B;  4WGY A;  3UNG C;  1JOG A;  2XXA A;  2YWA A;  3KL4 A;  3L8J A;  4K7B A;  1BR4 A;  4MVZ A;  4G7Z F;  3NRH A;  1OXK A;  4DRH B;  3JYH A;  3TOL A;  1M6T A;  2Q3T A;  1Y6D A;  4YN0 B;  2ZPA A;  4JUR I;  1LI7 A;  3GWL A;  2ETS A;  4G0H A;  4KC9 A;  2LSE A;  4D4N A;  3GEI A;  5CIV A;  4ULW A;  1RMV A;  3R2P A;  2FFH A;  2OG2 A;  2CYD A;  1ORJ A;  2J9V A;  2Q9A A;  2W45 A;  4EHP A;  2D5R B;  3RYL A;  4E7S A;  2VAS A;  3SXM A;  2HV6 A;  5T3T A;  3T9O A;  1Q0M A;  3E70 C;  3NKE A;  1O3U A;  3O55 A;  4A2N B;  3SP1 A;  1K04 A;  4MTF A;  4J7Y A;  2EIM C;  3ZIB A;  4CS9 A;  2R05 A;  4IRU A;  2FGY A;  1HMO A;  3ZQY A;  3DWW A;  2R7S A;  1XZP A;  4NC3 A;  1D1B A;  2ASR A;  2IXN A;  2Q00 A;  5F28 E;  2DB4 A;  2E87 A;  1K40 A;  4E0I A;  3ZTZ A;  3QMK A;  1VTM P;  3J06 A;  3K33 A;  4DRJ B;  3O6X A;  2G3K A;  1JR8 A;  1A7V A;  3K1H A;  3AG4 C;  1G4W R;  1WN0 A;  2HKV A;  3A9C A;  3FAP B;  2J7P A;  3EG9 A;  2YEV A;  3IQ6 A;  1Z5Z A;  2KC3 A;  3T6G B;  4G7O F;  2J7P D;  1A7D A;  1QVX A;  3ZVR A;  3DKA A;  1AVO B;  2M64 A;  1OQC A;  1LKX A;  2R9R B;  3CSK A;  3K1I C;  4EBJ A;  3S28 A;  2NUP A;  3E9V A;  4YT2 A;  1TWA A;  2ICW G;  5COG A;  5AGF A;  2AU5 A;  4F4B A;  2YKZ A;  3DE9 A;  4XPY A;  2L6F A;  1VYK A;  4GEH A;  1FNT c;  4QI2 A;  3B29 A;  4BPM A;  1RKE B;  4AE4 B;  3JRM O;  5FCL A;  1V55 C;  2P7V A;  2AVK A;  2A68 F;  3H65 A;  1J8M F;  3NYJ A;  1PV3 A;  1ORY A;  3RKO F;  3AG1 C;  3RQE A;  1FAP B;  3U0C A;  3POV A;  1I4Z A;  4W8K A;  3DJU B;  3M79 A;  4YWQ A;  3EPV A;  5L0G A;  1EI7 A;  2LIG A;  3PMR A;  4BJ6 A;  1NLX A;  2B0H A;  2NSG A;  2OU6 A;  1RKC A;  3AGT A;  3EH2 A;  3H2U A;  3R7C A;  1U6H A;  1KNY A;  3U5S A;  3ASN C;  3X2Q C;  4LLE A;  4DJ9 A;  4DRI B;  5L0D A;  1EKY A;  2R02 A;  2CDQ A;  4Q7C A;  2OKU A;  4EWC A;  3GAN A;  4PJL A;  5B3I A;  2XLO A;  1CGN A;  3FMS A;  2PNO A;  1HMD A;  3Q7L A;  2A6H F;  3DXJ F;  1GQA A;  1ZHX A;  3EHM A;  1AUE A;  3B0U X;  1E84 A;  2R7X A;  3RQG A;  2EIL C;  1OW7 A;  1JRA A;  1A7E A;  2PBE A;  3TD7 A;  5L3Q A;  1LI5 A;  1QKR A;  1Z6A A;  2XM0 A;  4I1O B;  1K05 A;  2JX0 A;  2LFD A;  3EHN A;  3LJB A;  4IAQ A;  4JIO A;  3ZDL A;  4LER A;  1TR2 A;  2PX3 A;  4RD9 A;  3SNH A;  5A6J A;  5KYY B;  3RVZ A;  3C18 A;  5JLI A;  1TFK B;  3IEE A;  4CSA C;  4XWJ A;  1B68 A;  3OEO A;  1G5Z A;  3VRC A;  1HY5 A;  2DI3 A;  1FMW A;  3LEO A;  4U5F E;  5DQT A;  3AG3 C;  1SF8 A;  4C3D A;  2R7Q A;  3S84 A;  2Y3B A;  1Q0F A;  2PFD A;  3X1O A;  4O7G A;  3L1M A;  1OKK A;  1ST6 A;  1ZYR F;  2CCY A;  2QUP A;  2GDC A;  3IHU A;  5KYW B;  3IPM O;  2R7V A;  4OD4 A;  4QI0 A;  256B A;  5HV9 A;  4KNV A;  3EJN A;  4X0R A;  3ABL C;  1OR3 A;  3CZ6 A;  5F5H A;  1JPJ A;  4N06 A;  2AP3 A;  1ZU5 A;  1M57 C;  1NZE A;  1RKE A;  3IQ5 A;  4AE4 A;  1NBB A;  4CX9 A;  1LS1 A;  1EQ1 A;  1VK5 A;  2J0X A;  3QW0 A;  2AWY A;  1ZU4 A;  3GEH A;  3BEH A;  2LFF A;  4MVS A;  3N2Z B;  1SR2 A;  2DYR C;  1BR1 A;  4H54 A;  3LLK A;  1QPU A;  2QY9 A;  2RSE B;  2WZG A;  4NTA A;  2YLD A;  3LAY A;  4BJ5 A;  4BEM J;  1FMV A;  4O6Y A;  4XLN F;  3DJN B;  4CS9 C;  2OJE D;  4NQF A;  3V5Z A;  3MLG A;  1KU2 A;  3HTK C;  4K1O A;  2OJQ A;  4NTF A;  3HKK A;  3QTH A;  4MVR A;  2R7O A;  1A41 A;  2L7A A;  5L3V A;  2JD3 A;  5EGY A;  1ZHZ A;  4MVM A;  1TFO B;  4OIN F;  2GAQ A;  4B6I A;  1JMW A;  2LD6 A;  2NUT A;  3JSE O;  2YL0 A;  2VCB A;  3GWN A;  1BZ4 A;  1NFO A;  1WWP A;  1YJG A;  2MYS A;  4U5H A;  2J45 A;  3SEO A;  2H8A A;  4O6N A;  4AL0 A;  4Q4Z F;  2ZXP A;  4IB4 A;  3LS1 A;  1LIH A;  3OWT A;  3KYI A;  1LE2 A;  5A6B A;  3GOD A;  2OQM A;  4L6R A;  4JVS A;  5KYY A;  1Y4C A;  4U5E E;  1YAU O;  4OIR F;  5A6B D;  3KH2 A;  1OW8 A;  1DOV A;  1OCO C;  4IGG A;  3U3F A;  5AC4 A;  3PCV A;  3RFY A;  5HSW A;  2Y39 A;  4HE8 D;  3I5P A;  5TJ5 E;  4CDY A;  2VCA A;  3UGP A;  1I5N A;  1MMD A;  1R5I D;  4JTC B;  4M63 A;  2R7W A;  1JPN A;  4N6C A;  4CDA A;  5DLJ A;  2GFH A;  5E2Q A;  1QSP A;  2HJM A;  1OXB A;  2YLI A;  3C62 A;  1ZHT A;  3KKB A;  4LLC A;  2A0B A;  2P0N A;  2YHS A;  3CEX A;  3EGD B;  3T6J A;  5DS4 A;  5A6A A;  1ORS C;  2HSB A;  2QLA A;  3Q7G A;  4C7O A;  2BC5 A;  4XEF A;  2OEX A;  2D4U A;  4GYT A;  4J7T A;  4MND A;  4YL3 A;  5IY5 C;  5KYX A;  3BRJ A;  3NMK A;  4BJ6 C;  1YDI A;  5B1B C;  2VB6 A;  1T6Q A;  3MX3 A;  2XL8 A;  4CIH A;  2NPU A;  3K6B A;  4JZA A;  4PFO A;  4CS8 C;  3LEV A;  3U9J A;  3DZA A;  2HJ3 A;  2WZF A;  3K66 A;  2Z15 A;  4ONS A;  1R4T A;  5D92 A;  5KYU A;  3UMH A;  3ZWI A;  3T4R A;  1Q0K A;  3DM9 B;  2L9J A;  4OIP F;  4YL1 A;  2L6G A;  4JCH A;  4E0H A;  2C04 A;  3PHF 2;  3ZTM A;  3IQT A;  4DVZ A;  3GM2 A;  3VAY A;  2EIJ C;  1UFB A;  3EGX A;  2XRH A;  3FAJ A;  5L0J A;  4YK5 A;  2XM4 A;  3Q6M A;  5L0C A;  2V3C C;  5D91 A;  1T5O A;  3DD7 A;  4ULV A;  3T6B A;  4ER9 A;  1OW6 A;  2KQ9 A;  2Q9C A;  2LQG A;  2QE9 A;  3C8G A;  4E17 A;  1YZC A;  3C8G D;  4P9F A;  1Q0G A;  3B71 A;  5E3C A;  3TOM A;  5A69 A;  2NG1 A;  4RDA A;  3M1C B;  5JT4 A;  4YT4 A;  2UUH A;  2YLG A;  1PCX A;  1GS9 A;  3NYL A;  5T3W A;  4FES A;  4G7H F;  2KW3 C;  5CI9 A;  4BJ1 A;  1T6I A;  2RD9 A;  1C17 M;  1TWH A;  2Y69 C;  1Z7Q c;  4XQ1 A;  4ZLD A;  2HS5 A;  2IXM A;  4EUK B;  4BJ5 C;  2UUI A;  3WAQ A;  1M2O A;  3MBG A;  1TQG A;  3W4Y A;  4IJJ A;  3G4X A;  4WGZ A;  2FAP B;  2KYH A;  4Z9J A;  3JTL O;  4DOZ A;  4GQH A;  3S0X A;  4IAO A;  2CW0 F;  1SYQ A;  2EPK X;  3AQC A;  2YL7 A;  3AQB A;  2HMQ A;  4CJO A;  2WB7 A;  2J46 A;  1M2V B;  5JSL A;  2V26 A;  2R03 A;  5JRA A;  1OCR C;  1ZW2 A;  5DVW A;  4FAP B;  4E7Z A;  3LNM B;  5CI8 A;  4EKW A;  3ATP A;  1WTY A;  1O87 A;  3ECS A;  1CGM E;  2EIK C;  4MVO A;  3HJC A;  1CPR A;  3LES A;  4DXW A;  1H9G A;  1RJ9 B;  5L0I A;  2XLH A;  3C7J A;  3I5Q A;  1ZW3 A;  4NTB A;  3GM1 A;  1QZX A;  3JCU Q;  3DE8 A;  2DGJ A;  1NSG B;  2XLW A;  1S7Z A;  1PD1 A;  3Q6N A;  3L8I A;  1YA9 A;  4U5C E;  3V5Y A;  3FHD A;  5JUA A;  5DS5 A;  4HFF B;  5COF A;  4H4K C;  2IXP A;  2WVQ A;  3NDB B;  3ZQV A;  3AGU A;  1T01 A;  1O5H A;  2M4E A;  4W8P A;  3U8V A;  1HE1 A;  4NCQ A;  4CIP A;  2XL6 A;  5B1A C;  1DOW A;  1OKK D;  2YQY A;  1N1C A;  2G62 A;  2IYL D;  2W4B A;  5K0I A;  3S29 A;  4LDR A;  4OIQ F;  1HW1 A;  3N24 A;  2YZS A;  2A69 F;  4J32 B;  5E33 A;  4PJN A;  2XS1 A;  1AEP A;  4P9T A;  1BDJ B;  2R7T A;  2O9X A;  3U8P A;  1E2X A;  1YAR O;  1MNE A;  4J30 B;  1GM5 A;  2P1A A;  3H2V A;  2Y3D A;  5L0F A;  4MVQ A;  1H6G A;  2A1D D;  2ZXR A;  3JT1 A;  4IWB A;  1YZA A;  1Z23 A;  3UGO A;  2ZD9 A;  1U89 A;  4JJG A;  1WAT A;  4XEV A;  2XSE A;  2F22 A;  2J8W A;  4YJW A;  3B9Q A;  3L0I A;  3RH3 A;  1HW2 A;  1L3P A;  2GA0 A;  3F47 A;  4DBQ A;  1IZM A;  3CAX A;  4QDL A;  2PF4 E;  5DQZ A;  1RXQ A;  1V74 B;  3RVY A;  2LP4 A;  4MQ9 F;  1YYJ A;  2OOC A;  1M2V A;  1V54 C;  1YYX A;  2L81 A;  3JSZ A;  1E85 A;  2J9W A;  3TJ6 A;  5BQG A;  3B0P A;  4O6M A;  1V4A A;  2BL2 A;  2XS8 A;  2PX0 A;  4U5G A;  3F46 A;  1RJ9 A;  2IM8 A;  4UDV A;  4U5B E;  3RW0 A;  5EK0 A;  2XLM A;  3HLZ A;  3MFN A;  4HFK B;  3NMI A;  1FFT C;  1OR2 A;  4IAR A;  5BQH A;  3SXK A;  4XLP F;  3WHN A;  1I4Y A;  1E86 A;  1TKN A;  1F1M A;  2Q7R A;  2J0W A;  4Z9H A;  1ZHW A;  3U2M A;  3SXZ A;  3U3B A;  5KYW A;  2HMZ A;  1APC A;  1ZVZ A;  4FX5 A;  4PJJ A;  1HE9 A;  1MMG A;  2KGO A;  4OD5 A;  3FXH A;  4WJ0 A;  3V7O A;  2R25 A;  1G8X A;  2HSQ A;  3FVY A;  3JYY A;  3QZC A;  1XWJ A;  4FWV A;  3ZG1 A;  5AC5 A;  3MYI A;  2H7V C;  2NUP B;  2Y3H A;  4WAB A;  2VH3 A;  3RIP A;  4KI2 A;  1CPQ A;  1A0B A;  4PK4 A;  3ABK C;  4JTA B;  4XPW A;  1ZHY A;  3C63 A;  2G3V A;  5JP7 A;  2HV7 A;  3C8Z A; 
#chains in the Genus database with same CATH homology
 3TOM A;  2XM0 A;  4IAQ A;  5JT4 A;  4CDV A;  2YLG A;  3QVZ A;  4CJG A;  1JAF A;  4D4X A;  3VRC A;  4N4W A;  1CGO A;  3L1M A;  2CCY A;  4WGZ A;  256B A;  2J9B A;  2YL7 A;  3FOP A;  4U9E A;  4CJO A;  3HNI A;  5JSL A;  3IQ5 A;  3M4C A;  5JRA A;  1NBB A;  4CX9 A;  3QW0 A;  5JLI A;  4WGY A;  1QPU A;  2YLD A;  1CPR A;  1MQV A;  2XLH A;  3TOL A;  1M6T A;  4JE9 A;  3DE8 A;  3M15 A;  2XLW A;  3M4B A;  4D4N A;  5JUA A;  2YL3 A;  3ZQV A;  4CIP A;  2YL0 A;  2XL6 A;  2XLV A;  3ZQY A;  4IB4 A;  3U8P A;  4NC3 A;  1S05 A;  4L6R A;  4N6H A;  3ZTZ A;  1YZA A;  1QQ3 A;  3QW1 A;  1A7V A;  2YL1 A;  4CDY A;  4JKV A;  3IQ6 A;  2J8W A;  4EIY A;  3NMJ A;  4JEA A;  4CDA A;  2YLI A;  3C62 A;  4JEB A;  3FOO A;  1E85 A;  1YYJ A;  2QLA A;  1YYX A;  2BC5 A;  3HNL A;  5AGF A;  2YKZ A;  3DE9 A;  3NMK A;  2XL8 A;  3HNJ A;  5JS5 A;  3HNK A;  1E83 A;  2XLM A;  4IAR A;  3ZWI A;  3NMI A;  5JVE A;  3QVY A;  1LM3 B;  1E86 A;  3ZTM A;  3M79 A;  1APC A;  2XM4 A;  1EKY A;  1BBH A;  1RCP A;  4ULV A;  4ER9 A;  2XLE A;  5B3I A;  4U9D A;  2XLO A;  1CGN A;  2XLD A;  1CPQ A;  1YZC A;  1GQA A;  1E84 A;  3C63 A;  5JP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...