2J9BA

The crystal structure of cytochrome c' from rubrivivax gelatinosus at 1.5 a resolution and ph 6.3
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
127
structure length
127
Chain Sequence
QFQKPGDAIEYRQSAFTLIANHFGRVAAMAQGKAPFDAKVAAENIALVSTLSKLPLTAFGPGTDKGHGTEAKPAVWSDAAGFKAAADKFAAAVDKLDAAGKTGDFAQIKAAVGETGGACKGCHDKFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CYTOCHROME C'
publication title High resolution crystal structure of Rubrivivax gelatinosus cytochrome c'.
pubmed doi rcsb
total genus 50
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2j9bA00
2YLIA 4CX9A 4N4WA 2XL8A 3TOMA 2CCYA 1LM3B 4N6HA 1NBBA 4IARA 3C62A 4L6RA 5JT4A 2QLAA 4CDYA 5JSLA 3HNLA 4CJGA 3FOOA 3ZTMA 2XLOA 4CIPA 3NMJA 1M6TA 3C63A 1EKYA 5JUAA 4NC3A 1YZAA 3U8PA 4D4XA 1RCPA 2XLHA 3ZTZA 3VRCA 4EIYA 4CDVA 1MQVA 2YKZA 4IAQA 1A7VA 2YL7A 3DE9A 5JS5A 1QQ3A 2YLDA 3M4CA 3HNIA 5JLIA 2XLEA 3DE8A 1APCA 4ER9A 3L1MA 1YZCA 3TOLA 1YYJA 4WGYA 2XLVA 4D4NA 3QW0A 4ULVA 1BBHA 2YL3A 3QVZA 1E86A 2XLDA 3ZQYA 1YYXA 3IQ5A 1CPQA 3ZQVA 2BC5A 5B3IA 2XLMA 4CJOA 4U9EA 1E83A 1QPUA 3QVYA 4JE9A 2XL6A 3M79A 256BA 3IQ6A 5AGFA 4JKVA 1E84A 2YLGA 4JEAA 3ZWIA 3M4BA 1S05A 5JRAA 5JP7A 3HNJA 3FOPA 2J8WA 3NMIA 2XM4A 2YL0A 1JAFA 1CGNA 4IB4A 2YL1A 5JVEA 3M15A 3HNKA 4U9DA 1CGOA 3QW1A 4CDAA 2J9BA 1E85A 1GQAA 2XM0A 4WGZA 2XLWA 1CPRA 3NMKA 4JEBA
chains in the Genus database with same CATH superfamily
1T6QA 3CEXA 4CX9A 1ZHZA 2A6HF 2XL8A 4K0DA 1TFOB 4L6RA 3RIPA 3TD7A 1Q0MA 2A0UA 2NSGA 4EUKB 1LI7A 1KU2A 4CDYA 2JX0A 1VK5A 1YARO 4X0RA 2V3CC 5T1DB 2NG1A 3LS0A 4IGGA 1R5ID 3KPHA 2KYHA 5BQIA 4CIPA 5HSWA 1F1MA 1D0YA 1D0ZA 3NMJA 1PD1A 3ZVRA 4NC3A 1HW1A 4BEMJ 2X0CA 2WZGA 2P1AA 4AX2A 3G4ZA 3HKKA 1RCPA 2LCHA 5D91A 3VRCA 2HMQA 3E9VA 2QUPA 3V5YA 4BJ5A 2NUPB 1A41A 3AQCA 2R7OA 1U0BB 1FFHA 3L8JA 3Q6NA 2OJQA 4CDVA 1MNEA 1D1BA 2DGJA 3W4YA 4XPWA 2CW0F 1U89A 3I5PA 4PJMA 4WABA 1V4AA 2KC3A 1BR1A 2ZPAA 3VF0A 3JT1A 3RKOF 4GYTA 4RD9A 3SXZA 3GEIA 1FMVA 2DYSC 1PV3A 3TQOA 1HMOA 2ZXWC 3EZHA 4LLCA 4PACA 5JS5A 1K05A 1J8YF 1VMAA 2OKUA 3PDMP 4P9TA 2YLDA 3DWWA 3M4CA 1VLTA 4OIRF 3UGPA 1GS9A 3K1IC 2XLEA 3FAPB 4XEVA 1NFOA 3CAXA 2GWWA 3O39A 1MNDA 5CIVA 3L1MA 3US6A 4EBKA 4K1OA 4DBRA 3Q6MA 4LDRA 4B6IA 3X2QC 1PD0A 2XLVA 1ZHTA 2WZFA 1HY5A 3EG9A 1OW7A 4MVSA 4XQ1A 4DVZA 2R7SA 4H4KC 4Q4ZF 2Y39A 4JRZA 3AGUA 3S9OA 4EIYA 2L6GA 3Q7GA 1T6UA 4PJJA 4R32A 3AQBA 3AJMA 4YT8A 2NSFA 4Z9IA 2KQ9A 1DOWA 2LSEA 3ASOC 4MVQA 1D0XA 2HZ8A 1U6HA 3ZQVA 4JIOA 2LFDA 1Z5ZA 3EQLF 1E83A 1WWPA 2BE5F 1QPUA 3DJNB 3JRTA 4JE9A 4XEKA 4PJLA 3POVA 3N24A 2V26A 1EA8A 2XL6A 3UGOA 5AGFA 1XWJA 4W8PA 2AWCA 4CBEA 4KI2A 1E84A 1M2VA 4PFPA 2Q00A 5JRAA 1V74B 5JP7A 2CNWA 2VCBA 3NRHA 3U0CA 4PFOA 2J8WA 1SMYF 3EHMA 1JAFA 2HMZA 3QTHA 3U8VA 3EPVA 4IB4A 2MWQA 2OQMA 3SP1A 4C3BA 2IBFA 2R02A 4LDQA 3L34A 5L0GA 2EPNA 4XEFA 1D1CA 3I4UA 3UMKA 1L7CA 1YVIA 1JR8A 4DRJB 3HNKA 3LAYA 2LIGA 3UMHA 1TWGA 1I4YA 3B29A 4JVSA 3QW1A 4YK5A 3ZG1A 1FMWA 4CS8A 3T9OA 3PMRA 2DYRC 4BJTA 5L3VA 4OIPF 3U2LA 1Z7Qc 1H7IA 4HE8D 4A2NB 4DRIB 1CPRA 1OKKA 4OIQF 1NG1A 2G62A 1O87A 1G4WR 1WOLA 2DI3A 3MYIA 5DS6A 5COFA 3S0XA 3NMKA 2PP4A 5B3SC 1ZW3A 1LE4A 3DAGA 1VLSA 1TWHA 2WVQA 2ZXPA 2MHRA 3IEEA 4N4WA 3ABMC 1SR2A 2CGEA 1Q0FA 1NBBA 1UFBA 2EPKX 2CNWD 1ZU4A 2KJGA 4N6HA 3TULA 4CS9C 2QNLA 1KNYA 5A6AA 5JSLA 2Q9CA 4I44A 3O55A 4QI2A 1H9GA 3O10A 1A7EA 5EHHA 2X51A 4AL0A 5A69A 5F5FA 1UG7A 1C03A 3EG9B 2KK1A 2R9RB 1HE1A 3C63A 4EBBA 1H6GA 4BJ6C 2OG2A 3DZAA 3RFYA 4EWCA 1YZAA 1Q0GA 3DI5A 3U8PA 2OEVA 2R7RA 3EJNA 3LS1A 2O9XA 5F5HA 1OCZC 3C8GA 2FAPB 2J9WA 2ZXRA 2XLHA 1FNTc 1YA9A 1W2WA 4XLPF 2YWAA 1WGWA 3RVZA 4MQ9F 1M57C 3FVYA 3WODF 2EPOA 4KC9A 1MQVA 1OKKD 2J45A 4KNVA 2YKZA 3U2MA 3VYWA 3RQEA 4HFFB 4XPXA 3SXYA 1YDIA 1TQGA 5T3TA 3DM5A 4EKWA 3T6JA 3VM6A 2IXNA 3W2WA 3ZC4A 1M2VB 1CGME 3N0TA 3O6XA 1ZHXA 1WN0A 2KW3C 3ZDLA 2WZLA 4NTBA 5E3AA 2NUTB 3HNIA 2XXAA 3DE8A 1S7ZA 2ZXOA 1APCA 1NZEA 5DS5A 3ASNC 4G7ZF 4EHPA 3S84A 2J0XA 2PX0A 4O6YA 4QDLA 1Y4CA 3C8ZA 1AVOB 4K7BA 4WGYA 2BL2A 4YJWA 4ZLCA 1SF8A 1YLMA 3DD7A 3LEOA 3U9MA 3S27A 3ZIBA 5DQZA 3C8GD 1E86A 4GQHA 5FCLA 1VYKA 5KYUA 3FDQA 4ANJA 4JW1A 4HFKB 2GAQA 3W8HA 1JRAA 3SEOA 2OU6A 3FHDA 2J7PA 1VB5A 2P0NA 4XWJA 3UNGC 5A6BA 1Z63A 1RMVA 2H7OA 4FX5A 1MMNA 3M79A 2LP4A 256BA 1XZQA 1QKRA 5AC5A 5IY5C 1HMDA 2R7XA 3NKEA 4Z9HA 3T4RA 1ZW2A 3HNJA 3FOPA 3QZCA 1RXQA 2GFHA 3JYYA 1NLXA 2L6FA 2XSEA 3H65A 2VB6A 1Q0KA 1IZMA 2A1DD 2XL4A 3I5QA 4A4AA 1CGNA 3NG1A 4MVRA 4E0IA 2R7VA 3U9JA 4XLNF 5L0JA 4W8KA 3RYLA 3NYJA 3C8GB 2YZSA 2YL1A 4YT5A 2Q9AA 1OR2A 2H7BA 5COGA 3UMIA 4XPYA 2WVNA 3GODA 4AL1A 3WG7C 2A69F 5KYXA 2CYDA 4YT2A 2H7VC 4O7GA 1OCRC 4M63A 4E7ZA 1LS1A 5B1AC 4CDAA 2J9BA 3V5XA 4NQFA 4YL1A 3HLZA 2J9VA 1TWAA 2IOQA 2G3VA 3EZIA 3FAJA 2R7QA 1ZZPA 4O79A 5KYYA 2EIJC 4BJ1A 2JD3A 1R4TA 3PCVA 5A6BD 1OW8A 4PJNA 4CSAC 5CI8A 1VYIA 3JYHA 1JPNA 2XS8A 3GORA 4JTAB 2XXAB 2Y3DA 4MTOA 1PCXA 2PFDA 3IQTA 2CCYA 1LM3B 3DAFA 1MMDA 3F47A 4OINF 2YRFA 1LS4A 1Z6AA 3C62A 4U5DE 3RVYA 3S28A 3WAQA 2TMVP 1NSGB 2QLAA 2QY9A 1N1CA 4LDKA 2VC9A 1OXBA 3DKAA 3IHUA 4CJGA 3ATPA 2HUJA 1ZYRF 3FOOA 2XLOA 4IWBA 1ST6A 3ZTMA 1C02A 2FGYA 2HFIA 2UUIA 4JZAA 1NFNA 1M6TA 3AG4C 2G3KA 5JUAA 2Q3TA 3GEEA 5KYUB 3JSZA 1OXKA 4CIHA 4JTCB 3B0PA 2IXPA 2HV7A 3KH2A 3SYNA 3SXMA 4G0HA 3B0VC 3ABKC 4MVOA 2LQGA 4H54A 4YL0A 5F28E 1G4US 1ORJA 3TJ6A 2OEXA 4MW8A 1D1AA 3LJBA 3JZ0A 3RH3A 4IAQA 2OJED 4JURI 1JPJA 1Y6DA 1LI5A 1A7VA 4BJ5C 3DE9A 2RSEB 4QI0A 3DJUB 5E3CA 4ZLDA 5DS4A 3AG2C 1TFKB 3K1IA 3C18A 5D92A 1WASA 3MYFA 2FFHA 1QQ3A 2L81A 3IQCA 5L0CA 5L0DA 4G7OF 2R05A 3SXKA 2R7TA 4YT4A 2AP3A 3MLGA 4MNDA 3SNHA 4OD5A 4KNWA 2PBEA 3CZ6A 4ER9A 4FWVA 4PR9A 2Y3HA 1AEPA 4IRUA 3KKBA 2Y69C 5KYNA 2KGOA 4Z9JA 4ULWA 5KYXB 5L0IA 4D4NA 1O3UA 4P6IC 1NU9C 1ORSC 1T9KA 2WL8A 2YL3A 3LEVA 4N6CA 4DVYP 4JC7A 4JJFA 4LACB 1I5NA 1Z3IX 2RD9A 3EGXA 3UR3C 1RJ9A 4JJGA 4PK4A 4CS7A 5KYYB 4LLEA 3C7JA 2L6HA 2PF4E 1YYXA 2YVKA 1K40A 4MVMA 1OQCA 2HV6A 4E17A 3IQ5A 3T6BA 3G50A 2L9JA 1Q0DA 1CPQA 1LVKA 2A0BA 1QVXA 3LESA 1BDJB 3V7OA 4I1MA 1T01A 3H2UA 5BQGA 2XLMA 3L0IA 2WB7A 2A68F 3F46A 4U9EA 2Q7RA 2R03A 3QVYA 4WJ0A 3R7CA 1GGQA 2NPUA 2YHSA 4OIOF 1YA7O 3K7DA 5COMA 3GWNA 1T5OA 4JKVA 3E70C 3KL4A 2YLGA 5AC4A 4JEAA 4JCHA 3M4BA 1QZXA 1L3PA 2P6VA 2YQYA 2ZD9A 4NTFA 4E0HA 3X1OA 4U5EE 5KYWA 2MYSA 1V55C 3V5ZA 2YEVA 3ITFA 3JRMO 1TR2A 1RKCA 2XM4A 1BZ4A 2HSQA 4J7TA 4UDVA 3TJ5A 1Z23A 2VH3A 4J32B 4FESA 1KTMA 2E87A 3KYIA 4I3MA 2AU5A 3EH2A 3FMSA 2VCCA 3OA1A 4U5GA 3B0UX 5A6KA 1C17M 4U9DA 3LUTB 4I1OB 1J8MF 3LNMB 4ONSA 1K04A 3HJCA 3T6GB 1SYQA 1QLEC 4LERA 2AWYA 3WHNA 4IJJA 5HV9A 2UUHA 4DOZA 1M2OA 3U3BA 1WATA 2XLWA 4MVUA 4MS2A 4P9FA 5K0IA 3LLIA 4CS8C 2JPUA 2IM8A 2IXMA 3R2PA 5GPGB 2R7UA 2D5RB 1LKXA 4CS9A 1BR2A 4MVZA 3RQGA 4AK9A 2HS5A 2Q4FA 2YLIA 1M56C 3TOMA 4O6NA 4OD4A 2F22A 3EGDA 2ASRA 5B1BC 4Q7CA 4IARA 3OWTA 3GANA 2EPMX 3BEHA 1TKNA 3QMKA 4NTAA 2I15A 3RW0A 5JT4A 4G7HF 5L0FA 5DLJA 2A6EF 2LFFA 3HNLA 4BJ6A 1LIHA 5TJ5E 5DVWA 1T6IA 3NKDA 2R7WA 3NDBB 4N06A 2J46A 4HEAJ 5DQTA 2GA0A 2ETSA 2HSBA 1ZHWA 2L7AA 1E2XA 3SZRA 2VCAA 4Q5SF 1EKYA 3EGXB 1RJ9B 1H9TA 2Q9BA 5FZTA 4BEJA 3KMIA 3DXJF 4D4XA 1WTYA 3TK0A 4GEHA 3LLKA 1RKEA 3HTKC 3EFOA 2J7PD 3MFNA 2I8BA 3ZTZA 1YJGA 1A0BA 1I4ZA 2W4BA 4E18A 2LD6A 3B71A 3MX3A 2EILC 2W45A 1ZVZA 2B0HA 3GEHA 5EK0A 4C7OA 3DM9B 5BQHA 2J0WA 1G5ZA 3A9CA 4YL3A 4MTGA 2YL7A 4DXWA 1LPEA 4U5BE 5L0HA 2QE9A 2IYLD 2PNOA 1JMWA 3EHNA 3Q7LA 1DOVA 3RQFA 4F4BA 2XRHA 3CQZA 1IW7F 3K6BA 4JCZA 1FAPB 1SZIA 3B9QA 3GWLA 5KYWB 1QSPA 2EPLX 4C3DA 4AE4A 2C03A 3AGTA 1G8XA 2PX3A 5JLIA 2AVKA 4G78A 3N2ZB 1VOMA 4BPMA 3DMDA 5BUOA 3NYMA 2HJ3A 3ZSUA 1YZCA 1XZPA 4J30B 1YYJA 3TOLA 3JSEO 4DRHB 2KSFA 3RF3A 1JOGA 1BR4A 3K1HA 4C3EA 3OEOA 3QW0A 3K33A 1BBHA 4ULVA 2P61A 2NUTA 3QVZA 3A11A 2XLDA 3JCUQ 5B3IA 2C04A 1OCOC 2M4EA 3K66A 3U3FA 1OR3A 3ZQYA 1OCCC 2D4UA 1MMAA 3AG1C 1MMGA 3J06A 1O5HA 5EGYA 4O6MA 3GM2A 4IAOA 2Y3GA 1FR0A 2W9YA 3GM3A 4NY3A 2BC5A 4DJ9A 3S29A 2NUPA 3W2VA 3LNRA 4CJOA 3ABLC 5E2QA 2IXOA 2XS1A 2B0JA 3EGDB 3BRJA 2CDQA 1TWCA 2EIMC 1HW2A 3KYJA 4EBJA 5A6JA 1NU7D 3IQ6A 1ORYA 5T3WA 4U5HA 1OW6A 1VTMP 1AUEA 2ICWG 2LK4A 4MW3A 3ZWIA 4XTKA 1S05A 5L3QA 1GM5A 2H8AA 2DB4A 4JTDB 1ZHYA 3VAYA 2P7VA 3FXHA 3G4XA 4RBNA 5CI9A 4KBLA 3U5SA 1HE9A 2OCCC 3GM1A 2HJMA 3NMIA 2YL0A 3AOUA 3PHF2 3EH1A 1FTSA 3W8IA 4DBQA 1B68A 4U5CE 3S90A 1LE2A 4MTFA 4RDAA 4FAPB 1YAUO 2Y3BA 4YWQA 1EI7A 5JVEA 1RKEB 1V54C 3EFOB 3JTLO 3M1CB 1EQ1A 3M15A 4NCQA 2OOCA 3CSKA 2EIKC 4YN0B 1FFTC 5E33A 1CGOA 4C7OB 2M64A 4E7SA 2WVOA 2EINC 4CSAA 3NYLA 3ECSA 1E85A 2VASA 3L8IA 1GQAA 2W4MA 2J9UA 2XM0A 4WGZA 2Z15A 2GDCA 2R25A 1A7DA 3MBGA 4J7YA 3IPMO 4U5FE 2HKVA 4AE4B 3AG3C 2QTVA 3H2VA 4JEBA 1ZU5A 2KNHA 4BG0A
chains in the Genus database with same CATH topology
2YLIA 4CX9A 4N4WA 2XL8A 3TOMA 2CCYA 1LM3B 4N6HA 1NBBA 4IARA 3C62A 4L6RA 5JT4A 2QLAA 4CDYA 5JSLA 3HNLA 4CJGA 3FOOA 3ZTMA 2XLOA 4CIPA 3NMJA 1M6TA 3C63A 1EKYA 5JUAA 4NC3A 1YZAA 3U8PA 4D4XA 1RCPA 2XLHA 3ZTZA 3VRCA 4EIYA 4CDVA 1MQVA 2YKZA 4IAQA 1A7VA 2YL7A 3DE9A 5JS5A 1QQ3A 2YLDA 3M4CA 3HNIA 5JLIA 2XLEA 3DE8A 1APCA 4ER9A 3L1MA 1YZCA 3TOLA 1YYJA 4WGYA 2XLVA 4D4NA 3QW0A 4ULVA 1BBHA 2YL3A 3QVZA 1E86A 2XLDA 3ZQYA 1YYXA 3IQ5A 1CPQA 3ZQVA 2BC5A 5B3IA 2XLMA 4CJOA 4U9EA 1E83A 1QPUA 3QVYA 4JE9A 2XL6A 3M79A 256BA 3IQ6A 5AGFA 4JKVA 1E84A 2YLGA 4JEAA 3ZWIA 3M4BA 1S05A 5JRAA 5JP7A 3HNJA 3FOPA 2J8WA 3NMIA 2XM4A 2YL0A 1JAFA 1CGNA 4IB4A 2YL1A 5JVEA 3M15A 3HNKA 4U9DA 1CGOA 3QW1A 4CDAA 2J9BA 1E85A 1GQAA 2XM0A 4WGZA 2XLWA 1CPRA 3NMKA 4JEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YLI A;  4CX9 A;  4N4W A;  2XL8 A;  3TOM A;  2CCY A;  1LM3 B;  4N6H A;  1NBB A;  4IAR A;  3C62 A;  4L6R A;  5JT4 A;  2QLA A;  4CDY A;  5JSL A;  3HNL A;  4CJG A;  3FOO A;  3ZTM A;  2XLO A;  4CIP A;  3NMJ A;  1M6T A;  3C63 A;  1EKY A;  5JUA A;  4NC3 A;  1YZA A;  3U8P A;  4D4X A;  1RCP A;  2XLH A;  3ZTZ A;  3VRC A;  4EIY A;  4CDV A;  1MQV A;  2YKZ A;  4IAQ A;  1A7V A;  2YL7 A;  3DE9 A;  5JS5 A;  1QQ3 A;  2YLD A;  3M4C A;  3HNI A;  5JLI A;  2XLE A;  3DE8 A;  1APC A;  4ER9 A;  3L1M A;  1YZC A;  3TOL A;  1YYJ A;  4WGY A;  2XLV A;  4D4N A;  3QW0 A;  4ULV A;  1BBH A;  2YL3 A;  3QVZ A;  1E86 A;  2XLD A;  3ZQY A;  1YYX A;  3IQ5 A;  1CPQ A;  3ZQV A;  2BC5 A;  5B3I A;  2XLM A;  4CJO A;  4U9E A;  1E83 A;  1QPU A;  3QVY A;  4JE9 A;  2XL6 A;  3M79 A;  256B A;  3IQ6 A;  5AGF A;  4JKV A;  1E84 A;  2YLG A;  4JEA A;  3ZWI A;  3M4B A;  1S05 A;  5JRA A;  5JP7 A;  3HNJ A;  3FOP A;  2J8W A;  3NMI A;  2XM4 A;  2YL0 A;  1JAF A;  1CGN A;  4IB4 A;  2YL1 A;  5JVE A;  3M15 A;  3HNK A;  4U9D A;  1CGO A;  3QW1 A;  4CDA A;  2J9B A;  1E85 A;  1GQA A;  2XM0 A;  4WGZ A;  2XLW A;  1CPR A;  3NMK A;  4JEB A; 
#chains in the Genus database with same CATH topology
 1T6Q A;  3CEX A;  4CX9 A;  1ZHZ A;  2A6H F;  2XL8 A;  4K0D A;  1TFO B;  4L6R A;  3RIP A;  3TD7 A;  1Q0M A;  2A0U A;  2NSG A;  4EUK B;  1LI7 A;  1KU2 A;  4CDY A;  2JX0 A;  1VK5 A;  1YAR O;  4X0R A;  2V3C C;  5T1D B;  2NG1 A;  3LS0 A;  4IGG A;  1R5I D;  3KPH A;  2KYH A;  5BQI A;  4CIP A;  5HSW A;  1F1M A;  1D0Y A;  1D0Z A;  3NMJ A;  1PD1 A;  3ZVR A;  4NC3 A;  1HW1 A;  4BEM J;  2X0C A;  2WZG A;  2P1A A;  4AX2 A;  3G4Z A;  3HKK A;  1RCP A;  2LCH A;  5D91 A;  3VRC A;  2HMQ A;  3E9V A;  2QUP A;  3V5Y A;  4BJ5 A;  2NUP B;  1A41 A;  3AQC A;  2R7O A;  1U0B B;  1FFH A;  3L8J A;  3Q6N A;  2OJQ A;  4CDV A;  1MNE A;  1D1B A;  2DGJ A;  3W4Y A;  4XPW A;  2CW0 F;  1U89 A;  3I5P A;  4PJM A;  4WAB A;  1V4A A;  2KC3 A;  1BR1 A;  2ZPA A;  3VF0 A;  3JT1 A;  3RKO F;  4GYT A;  4RD9 A;  3SXZ A;  3GEI A;  1FMV A;  2DYS C;  1PV3 A;  3TQO A;  1HMO A;  2ZXW C;  3EZH A;  4LLC A;  4PAC A;  5JS5 A;  1K05 A;  1J8Y F;  1VMA A;  2OKU A;  3PDM P;  4P9T A;  2YLD A;  3DWW A;  3M4C A;  1VLT A;  4OIR F;  3UGP A;  1GS9 A;  3K1I C;  2XLE A;  3FAP B;  4XEV A;  1NFO A;  3CAX A;  2GWW A;  3O39 A;  1MND A;  5CIV A;  3L1M A;  3US6 A;  4EBK A;  4K1O A;  4DBR A;  3Q6M A;  4LDR A;  4B6I A;  3X2Q C;  1PD0 A;  2XLV A;  1ZHT A;  2WZF A;  1HY5 A;  3EG9 A;  1OW7 A;  4MVS A;  4XQ1 A;  4DVZ A;  2R7S A;  4H4K C;  4Q4Z F;  2Y39 A;  4JRZ A;  3AGU A;  3S9O A;  4EIY A;  2L6G A;  3Q7G A;  1T6U A;  4PJJ A;  4R32 A;  3AQB A;  3AJM A;  4YT8 A;  2NSF A;  4Z9I A;  2KQ9 A;  1DOW A;  2LSE A;  3ASO C;  4MVQ A;  1D0X A;  2HZ8 A;  1U6H A;  3ZQV A;  4JIO A;  2LFD A;  1Z5Z A;  3EQL F;  1E83 A;  1WWP A;  2BE5 F;  1QPU A;  3DJN B;  3JRT A;  4JE9 A;  4XEK A;  4PJL A;  3POV A;  3N24 A;  2V26 A;  1EA8 A;  2XL6 A;  3UGO A;  5AGF A;  1XWJ A;  4W8P A;  2AWC A;  4CBE A;  4KI2 A;  1E84 A;  1M2V A;  4PFP A;  2Q00 A;  5JRA A;  1V74 B;  5JP7 A;  2CNW A;  2VCB A;  3NRH A;  3U0C A;  4PFO A;  2J8W A;  1SMY F;  3EHM A;  1JAF A;  2HMZ A;  3QTH A;  3U8V A;  3EPV A;  4IB4 A;  2MWQ A;  2OQM A;  3SP1 A;  4C3B A;  2IBF A;  2R02 A;  4LDQ A;  3L34 A;  5L0G A;  2EPN A;  4XEF A;  1D1C A;  3I4U A;  3UMK A;  1L7C A;  1YVI A;  1JR8 A;  4DRJ B;  3HNK A;  3LAY A;  2LIG A;  3UMH A;  1TWG A;  1I4Y A;  3B29 A;  4JVS A;  3QW1 A;  4YK5 A;  3ZG1 A;  1FMW A;  4CS8 A;  3T9O A;  3PMR A;  2DYR C;  4BJT A;  5L3V A;  4OIP F;  3U2L A;  1Z7Q c;  1H7I A;  4HE8 D;  4A2N B;  4DRI B;  1CPR A;  1OKK A;  4OIQ F;  1NG1 A;  2G62 A;  1O87 A;  1G4W R;  1WOL A;  2DI3 A;  3MYI A;  5DS6 A;  5COF A;  3S0X A;  3NMK A;  2PP4 A;  5B3S C;  1ZW3 A;  1LE4 A;  3DAG A;  1VLS A;  1TWH A;  2WVQ A;  2ZXP A;  2MHR A;  3IEE A;  4N4W A;  3ABM C;  1SR2 A;  2CGE A;  1Q0F A;  1NBB A;  1UFB A;  2EPK X;  2CNW D;  1ZU4 A;  2KJG A;  4N6H A;  3TUL A;  4CS9 C;  2QNL A;  1KNY A;  5A6A A;  5JSL A;  2Q9C A;  4I44 A;  3O55 A;  4QI2 A;  1H9G A;  3O10 A;  1A7E A;  5EHH A;  2X51 A;  4AL0 A;  5A69 A;  5F5F A;  1UG7 A;  1C03 A;  3EG9 B;  2KK1 A;  2R9R B;  1HE1 A;  3C63 A;  4EBB A;  1H6G A;  4BJ6 C;  2OG2 A;  3DZA A;  3RFY A;  4EWC A;  1YZA A;  1Q0G A;  3DI5 A;  3U8P A;  2OEV A;  2R7R A;  3EJN A;  3LS1 A;  2O9X A;  5F5H A;  1OCZ C;  3C8G A;  2FAP B;  2J9W A;  2ZXR A;  2XLH A;  1FNT c;  1YA9 A;  1W2W A;  4XLP F;  2YWA A;  1WGW A;  3RVZ A;  4MQ9 F;  1M57 C;  3FVY A;  3WOD F;  2EPO A;  4KC9 A;  1MQV A;  1OKK D;  2J45 A;  4KNV A;  2YKZ A;  3U2M A;  3VYW A;  3RQE A;  4HFF B;  4XPX A;  3SXY A;  1YDI A;  1TQG A;  5T3T A;  3DM5 A;  4EKW A;  3T6J A;  3VM6 A;  2IXN A;  3W2W A;  3ZC4 A;  1M2V B;  1CGM E;  3N0T A;  3O6X A;  1ZHX A;  1WN0 A;  2KW3 C;  3ZDL A;  2WZL A;  4NTB A;  5E3A A;  2NUT B;  3HNI A;  2XXA A;  3DE8 A;  1S7Z A;  2ZXO A;  1APC A;  1NZE A;  5DS5 A;  3ASN C;  4G7Z F;  4EHP A;  3S84 A;  2J0X A;  2PX0 A;  4O6Y A;  4QDL A;  1Y4C A;  3C8Z A;  1AVO B;  4K7B A;  4WGY A;  2BL2 A;  4YJW A;  4ZLC A;  1SF8 A;  1YLM A;  3DD7 A;  3LEO A;  3U9M A;  3S27 A;  3ZIB A;  5DQZ A;  3C8G D;  1E86 A;  4GQH A;  5FCL A;  1VYK A;  5KYU A;  3FDQ A;  4ANJ A;  4JW1 A;  4HFK B;  2GAQ A;  3W8H A;  1JRA A;  3SEO A;  2OU6 A;  3FHD A;  2J7P A;  1VB5 A;  2P0N A;  4XWJ A;  3UNG C;  5A6B A;  1Z63 A;  1RMV A;  2H7O A;  4FX5 A;  1MMN A;  3M79 A;  2LP4 A;  256B A;  1XZQ A;  1QKR A;  5AC5 A;  5IY5 C;  1HMD A;  2R7X A;  3NKE A;  4Z9H A;  3T4R A;  1ZW2 A;  3HNJ A;  3FOP A;  3QZC A;  1RXQ A;  2GFH A;  3JYY A;  1NLX A;  2L6F A;  2XSE A;  3H65 A;  2VB6 A;  1Q0K A;  1IZM A;  2A1D D;  2XL4 A;  3I5Q A;  4A4A A;  1CGN A;  3NG1 A;  4MVR A;  4E0I A;  2R7V A;  3U9J A;  4XLN F;  5L0J A;  4W8K A;  3RYL A;  3NYJ A;  3C8G B;  2YZS A;  2YL1 A;  4YT5 A;  2Q9A A;  1OR2 A;  2H7B A;  5COG A;  3UMI A;  4XPY A;  2WVN A;  3GOD A;  4AL1 A;  3WG7 C;  2A69 F;  5KYX A;  2CYD A;  4YT2 A;  2H7V C;  4O7G A;  1OCR C;  4M63 A;  4E7Z A;  1LS1 A;  5B1A C;  4CDA A;  2J9B A;  3V5X A;  4NQF A;  4YL1 A;  3HLZ A;  2J9V A;  1TWA A;  2IOQ A;  2G3V A;  3EZI A;  3FAJ A;  2R7Q A;  1ZZP A;  4O79 A;  5KYY A;  2EIJ C;  4BJ1 A;  2JD3 A;  1R4T A;  3PCV A;  5A6B D;  1OW8 A;  4PJN A;  4CSA C;  5CI8 A;  1VYI A;  3JYH A;  1JPN A;  2XS8 A;  3GOR A;  4JTA B;  2XXA B;  2Y3D A;  4MTO A;  1PCX A;  2PFD A;  3IQT A;  2CCY A;  1LM3 B;  3DAF A;  1MMD A;  3F47 A;  4OIN F;  2YRF A;  1LS4 A;  1Z6A A;  3C62 A;  4U5D E;  3RVY A;  3S28 A;  3WAQ A;  2TMV P;  1NSG B;  2QLA A;  2QY9 A;  1N1C A;  4LDK A;  2VC9 A;  1OXB A;  3DKA A;  3IHU A;  4CJG A;  3ATP A;  2HUJ A;  1ZYR F;  3FOO A;  2XLO A;  4IWB A;  1ST6 A;  3ZTM A;  1C02 A;  2FGY A;  2HFI A;  2UUI A;  4JZA A;  1NFN A;  1M6T A;  3AG4 C;  2G3K A;  5JUA A;  2Q3T A;  3GEE A;  5KYU B;  3JSZ A;  1OXK A;  4CIH A;  4JTC B;  3B0P A;  2IXP A;  2HV7 A;  3KH2 A;  3SYN A;  3SXM A;  4G0H A;  3B0V C;  3ABK C;  4MVO A;  2LQG A;  4H54 A;  4YL0 A;  5F28 E;  1G4U S;  1ORJ A;  3TJ6 A;  2OEX A;  4MW8 A;  1D1A A;  3LJB A;  3JZ0 A;  3RH3 A;  4IAQ A;  2OJE D;  4JUR I;  1JPJ A;  1Y6D A;  1LI5 A;  1A7V A;  4BJ5 C;  3DE9 A;  2RSE B;  4QI0 A;  3DJU B;  5E3C A;  4ZLD A;  5DS4 A;  3AG2 C;  1TFK B;  3K1I A;  3C18 A;  5D92 A;  1WAS A;  3MYF A;  2FFH A;  1QQ3 A;  2L81 A;  3IQC A;  5L0C A;  5L0D A;  4G7O F;  2R05 A;  3SXK A;  2R7T A;  4YT4 A;  2AP3 A;  3MLG A;  4MND A;  3SNH A;  4OD5 A;  4KNW A;  2PBE A;  3CZ6 A;  4ER9 A;  4FWV A;  4PR9 A;  2Y3H A;  1AEP A;  4IRU A;  3KKB A;  2Y69 C;  5KYN A;  2KGO A;  4Z9J A;  4ULW A;  5KYX B;  5L0I A;  4D4N A;  1O3U A;  4P6I C;  1NU9 C;  1ORS C;  1T9K A;  2WL8 A;  2YL3 A;  3LEV A;  4N6C A;  4DVY P;  4JC7 A;  4JJF A;  4LAC B;  1I5N A;  1Z3I X;  2RD9 A;  3EGX A;  3UR3 C;  1RJ9 A;  4JJG A;  4PK4 A;  4CS7 A;  5KYY B;  4LLE A;  3C7J A;  2L6H A;  2PF4 E;  1YYX A;  2YVK A;  1K40 A;  4MVM A;  1OQC A;  2HV6 A;  4E17 A;  3IQ5 A;  3T6B A;  3G50 A;  2L9J A;  1Q0D A;  1CPQ A;  1LVK A;  2A0B A;  1QVX A;  3LES A;  1BDJ B;  3V7O A;  4I1M A;  1T01 A;  3H2U A;  5BQG A;  2XLM A;  3L0I A;  2WB7 A;  2A68 F;  3F46 A;  4U9E A;  2Q7R A;  2R03 A;  3QVY A;  4WJ0 A;  3R7C A;  1GGQ A;  2NPU A;  2YHS A;  4OIO F;  1YA7 O;  3K7D A;  5COM A;  3GWN A;  1T5O A;  4JKV A;  3E70 C;  3KL4 A;  2YLG A;  5AC4 A;  4JEA A;  4JCH A;  3M4B A;  1QZX A;  1L3P A;  2P6V A;  2YQY A;  2ZD9 A;  4NTF A;  4E0H A;  3X1O A;  4U5E E;  5KYW A;  2MYS A;  1V55 C;  3V5Z A;  2YEV A;  3ITF A;  3JRM O;  1TR2 A;  1RKC A;  2XM4 A;  1BZ4 A;  2HSQ A;  4J7T A;  4UDV A;  3TJ5 A;  1Z23 A;  2VH3 A;  4J32 B;  4FES A;  1KTM A;  2E87 A;  3KYI A;  4I3M A;  2AU5 A;  3EH2 A;  3FMS A;  2VCC A;  3OA1 A;  4U5G A;  3B0U X;  5A6K A;  1C17 M;  4U9D A;  3LUT B;  4I1O B;  1J8M F;  3LNM B;  4ONS A;  1K04 A;  3HJC A;  3T6G B;  1SYQ A;  1QLE C;  4LER A;  2AWY A;  3WHN A;  4IJJ A;  5HV9 A;  2UUH A;  4DOZ A;  1M2O A;  3U3B A;  1WAT A;  2XLW A;  4MVU A;  4MS2 A;  4P9F A;  5K0I A;  3LLI A;  4CS8 C;  2JPU A;  2IM8 A;  2IXM A;  3R2P A;  5GPG B;  2R7U A;  2D5R B;  1LKX A;  4CS9 A;  1BR2 A;  4MVZ A;  3RQG A;  4AK9 A;  2HS5 A;  2Q4F A;  2YLI A;  1M56 C;  3TOM A;  4O6N A;  4OD4 A;  2F22 A;  3EGD A;  2ASR A;  5B1B C;  4Q7C A;  4IAR A;  3OWT A;  3GAN A;  2EPM X;  3BEH A;  1TKN A;  3QMK A;  4NTA A;  2I15 A;  3RW0 A;  5JT4 A;  4G7H F;  5L0F A;  5DLJ A;  2A6E F;  2LFF A;  3HNL A;  4BJ6 A;  1LIH A;  5TJ5 E;  5DVW A;  1T6I A;  3NKD A;  2R7W A;  3NDB B;  4N06 A;  2J46 A;  4HEA J;  5DQT A;  2GA0 A;  2ETS A;  2HSB A;  1ZHW A;  2L7A A;  1E2X A;  3SZR A;  2VCA A;  4Q5S F;  1EKY A;  3EGX B;  1RJ9 B;  1H9T A;  2Q9B A;  5FZT A;  4BEJ A;  3KMI A;  3DXJ F;  4D4X A;  1WTY A;  3TK0 A;  4GEH A;  3LLK A;  1RKE A;  3HTK C;  3EFO A;  2J7P D;  3MFN A;  2I8B A;  3ZTZ A;  1YJG A;  1A0B A;  1I4Z A;  2W4B A;  4E18 A;  2LD6 A;  3B71 A;  3MX3 A;  2EIL C;  2W45 A;  1ZVZ A;  2B0H A;  3GEH A;  5EK0 A;  4C7O A;  3DM9 B;  5BQH A;  2J0W A;  1G5Z A;  3A9C A;  4YL3 A;  4MTG A;  2YL7 A;  4DXW A;  1LPE A;  4U5B E;  5L0H A;  2QE9 A;  2IYL D;  2PNO A;  1JMW A;  3EHN A;  3Q7L A;  1DOV A;  3RQF A;  4F4B A;  2XRH A;  3CQZ A;  1IW7 F;  3K6B A;  4JCZ A;  1FAP B;  1SZI A;  3B9Q A;  3GWL A;  5KYW B;  1QSP A;  2EPL X;  4C3D A;  4AE4 A;  2C03 A;  3AGT A;  1G8X A;  2PX3 A;  5JLI A;  2AVK A;  4G78 A;  3N2Z B;  1VOM A;  4BPM A;  3DMD A;  5BUO A;  3NYM A;  2HJ3 A;  3ZSU A;  1YZC A;  1XZP A;  4J30 B;  1YYJ A;  3TOL A;  3JSE O;  4DRH B;  2KSF A;  3RF3 A;  1JOG A;  1BR4 A;  3K1H A;  4C3E A;  3OEO A;  3QW0 A;  3K33 A;  1BBH A;  4ULV A;  2P61 A;  2NUT A;  3QVZ A;  3A11 A;  2XLD A;  3JCU Q;  5B3I A;  2C04 A;  1OCO C;  2M4E A;  3K66 A;  3U3F A;  1OR3 A;  3ZQY A;  1OCC C;  2D4U A;  1MMA A;  3AG1 C;  1MMG A;  3J06 A;  1O5H A;  5EGY A;  4O6M A;  3GM2 A;  4IAO A;  2Y3G A;  1FR0 A;  2W9Y A;  3GM3 A;  4NY3 A;  2BC5 A;  4DJ9 A;  3S29 A;  2NUP A;  3W2V A;  3LNR A;  4CJO A;  3ABL C;  5E2Q A;  2IXO A;  2XS1 A;  2B0J A;  3EGD B;  3BRJ A;  2CDQ A;  1TWC A;  2EIM C;  1HW2 A;  3KYJ A;  4EBJ A;  5A6J A;  1NU7 D;  3IQ6 A;  1ORY A;  5T3W A;  4U5H A;  1OW6 A;  1VTM P;  1AUE A;  2ICW G;  2LK4 A;  4MW3 A;  3ZWI A;  4XTK A;  1S05 A;  5L3Q A;  1GM5 A;  2H8A A;  2DB4 A;  4JTD B;  1ZHY A;  3VAY A;  2P7V A;  3FXH A;  3G4X A;  4RBN A;  5CI9 A;  4KBL A;  3U5S A;  1HE9 A;  2OCC C;  3GM1 A;  2HJM A;  3NMI A;  2YL0 A;  3AOU A;  3PHF 2;  3EH1 A;  1FTS A;  3W8I A;  4DBQ A;  1B68 A;  4U5C E;  3S90 A;  1LE2 A;  4MTF A;  4RDA A;  4FAP B;  1YAU O;  2Y3B A;  4YWQ A;  1EI7 A;  5JVE A;  1RKE B;  1V54 C;  3EFO B;  3JTL O;  3M1C B;  1EQ1 A;  3M15 A;  4NCQ A;  2OOC A;  3CSK A;  2EIK C;  4YN0 B;  1FFT C;  5E33 A;  1CGO A;  4C7O B;  2M64 A;  4E7S A;  2WVO A;  2EIN C;  4CSA A;  3NYL A;  3ECS A;  1E85 A;  2VAS A;  3L8I A;  1GQA A;  2W4M A;  2J9U A;  2XM0 A;  4WGZ A;  2Z15 A;  2GDC A;  2R25 A;  1A7D A;  3MBG A;  4J7Y A;  3IPM O;  4U5F E;  2HKV A;  4AE4 B;  3AG3 C;  2QTV A;  3H2V A;  4JEB A;  1ZU5 A;  2KNH A;  4BG0 A; 
#chains in the Genus database with same CATH homology
 2YLI A;  4CX9 A;  4N4W A;  2XL8 A;  3TOM A;  2CCY A;  1LM3 B;  4N6H A;  1NBB A;  4IAR A;  3C62 A;  4L6R A;  5JT4 A;  2QLA A;  4CDY A;  5JSL A;  3HNL A;  4CJG A;  3FOO A;  3ZTM A;  2XLO A;  4CIP A;  3NMJ A;  1M6T A;  3C63 A;  1EKY A;  5JUA A;  4NC3 A;  1YZA A;  3U8P A;  4D4X A;  1RCP A;  2XLH A;  3ZTZ A;  3VRC A;  4EIY A;  4CDV A;  1MQV A;  2YKZ A;  4IAQ A;  1A7V A;  2YL7 A;  3DE9 A;  5JS5 A;  1QQ3 A;  2YLD A;  3M4C A;  3HNI A;  5JLI A;  2XLE A;  3DE8 A;  1APC A;  4ER9 A;  3L1M A;  1YZC A;  3TOL A;  1YYJ A;  4WGY A;  2XLV A;  4D4N A;  3QW0 A;  4ULV A;  1BBH A;  2YL3 A;  3QVZ A;  1E86 A;  2XLD A;  3ZQY A;  1YYX A;  3IQ5 A;  1CPQ A;  3ZQV A;  2BC5 A;  5B3I A;  2XLM A;  4CJO A;  4U9E A;  1E83 A;  1QPU A;  3QVY A;  4JE9 A;  2XL6 A;  3M79 A;  256B A;  3IQ6 A;  5AGF A;  4JKV A;  1E84 A;  2YLG A;  4JEA A;  3ZWI A;  3M4B A;  1S05 A;  5JRA A;  5JP7 A;  3HNJ A;  3FOP A;  2J8W A;  3NMI A;  2XM4 A;  2YL0 A;  1JAF A;  1CGN A;  4IB4 A;  2YL1 A;  5JVE A;  3M15 A;  3HNK A;  4U9D A;  1CGO A;  3QW1 A;  4CDA A;  2J9B A;  1E85 A;  1GQA A;  2XM0 A;  4WGZ A;  2XLW A;  1CPR A;  3NMK A;  4JEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...