2J9BA

The crystal structure of cytochrome c' from rubrivivax gelatinosus at 1.5 a resolution and ph 6.3
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
127
structure length
127
Chain Sequence
QFQKPGDAIEYRQSAFTLIANHFGRVAAMAQGKAPFDAKVAAENIALVSTLSKLPLTAFGPGTDKGHGTEAKPAVWSDAAGFKAAADKFAAAVDKLDAAGKTGDFAQIKAAVGETGGACKGCHDKFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution crystal structure of Rubrivivax gelatinosus cytochrome c'.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords CYTOCHROME C'
total genus 50
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2j9bA00
2XL8A 3M79A 3M4BA 2XM4A 1E83A 1GQAA 1CPQA 3HNKA 5JS5A 2YKZA 1CGOA 2XL6A 4U9DA 3M4CA 3TOMA 4CX9A 3HNJA 1A7VA 4U9EA 4CDYA 4NC3A 1EKYA 4ULVA 4CJOA 5JRAA 3IQ6A 2CCYA 2BC5A 3C63A 3ZTMA 2XLMA 2YL1A 1QQ3A 3QVZA 1JAFA 3QW0A 3HNIA 3ZQVA 4JEBA 3VRCA 4L6RA 1CGNA 4D4XA 4CDVA 3NMKA 3U8PA 3IQ5A 4JKVA 3C62A 4CIPA 1YZAA 3FOOA 2XLVA 2XLHA 5JLIA 4WGYA 3FOPA 4D4NA 4CDAA 3QVYA 2J8WA 1QPUA 3HNLA 4CJGA 4IARA 3ZTZA 1MQVA 3L1MA 5JUAA 1S05A 1YZCA 1E85A 1LM3B 1APCA 5AGFA 3NMJA 3NMIA 4IB4A 4JEAA 3QW1A 5JP7A 1M6TA 1YYXA 2YL3A 2J9BA 4WGZA 2YLDA 1YYJA 5JT4A 4N6HA 4N4WA 3DE8A 3ZWIA 1E84A 256BA 5JVEA 2QLAA 4ER9A 2YLGA 5B3IA 1BBHA 1CPRA 3ZQYA 4JE9A 2XM0A 4IAQA 2YL0A 2XLOA 2YL7A 5JSLA 2XLDA 4EIYA 2XLEA 3M15A 2YLIA 3DE9A 1E86A 1NBBA 3TOLA 2XLWA 1RCPA
chains in the Genus database with same CATH superfamily
3HJCA 3B0UX 1SZIA 1JPJA 3GM2A 1WASA 5KYYB 4QDLA 1OW7A 3FAJA 4BEMJ 4XWJA 2KJGA 3M4BA 3QTHA 1S7ZA 2EPKX 1NSGB 2FAPB 2VCBA 4G78A 4JTDB 3LLIA 5E3CA 2KQ9A 3T6JA 4A2NB 1OCCC 2OCCC 1GQAA 1WN0A 3L8IA 4BJ6C 4C3EA 5KYXB 3PDMP 3KL4A 4PK4A 5KYXA 1FAPB 3HNKA 3I5QA 1J8MF 3E9VA 4E18A 1ORSC 2YKZA 2ICWG 1RKEB 1CGOA 2LCHA 2Y3BA 5B1AC 4AL0A 1SYQA 2NUTA 2IOQA 3M4CA 1V4AA 1JMWA 3MYIA 3H2VA 3HNJA 3VYWA 2J9WA 4DVZA 1G8XA 1FFTC 4NC3A 3RH3A 4DRJB 5DS4A 5A6AA 2XXAA 1D1BA 5E3AA 2R7QA 5JRAA 4Q5SF 4U5DE 2Y39A 4U5HA 1SR2A 3O6XA 3FVYA 2Q3TA 3FAPB 3K7DA 2PBEA 3L34A 3EHNA 3IPMO 3SXMA 2YL1A 3EJNA 3K66A 2L81A 1A41A 1HMOA 3EZIA 3QVZA 4PJLA 1IZMA 1JAFA 3JYYA 1MMDA 4U5GA 1YA7O 2OJQA 3EH1A 2YZSA 3EFOA 3H65A 1C17M 2MYSA 2D5RB 3EZHA 3HNIA 2RSEB 4WJ0A 2EIMC 4FAPB 3UR3C 4EBJA 1ORYA 1CGNA 4GEHA 3QZCA 3DAGA 3LNRA 1LPEA 1KNYA 3RQGA 3U9MA 5CIVA 2WVNA 1NG1A 3B71A 3JYHA 1NU7D 1U6HA 2NG1A 2X0CA 1Q0GA 3U8PA 2R03A 2UUHA 3SP1A 3T6GB 4Z9JA 1HW1A 2J7PA 4JRZA 1WATA 4M63A 4OINF 4CIPA 2O9XA 2TMVP 2R7TA 3FOOA 4XPYA 1FMWA 2VC9A 5JLIA 4MNDA 4WGYA 4YL3A 3PCVA 1N1CA 1J8YF 2UUIA 3QVYA 4MS2A 4BEJA 4D4NA 3B29A 4U5BE 1JR8A 1QPUA 4F4BA 3HNLA 5L0IA 4NTBA 1RJ9B 4CJGA 4IARA 1OQCA 1LI5A 2AVKA 1D1AA 3ECSA 4OIRF 2BL2A 2NSFA 1F1MA 2ZXWC 4IRUA 4O6NA 5COGA 3CZ6A 4MVUA 1APCA 4DXWA 3NMJA 1Z5ZA 4U5EE 1L3PA 2AU5A 3B9QA 1R5ID 4EUKB 1WTYA 5FZTA 3RKOF 4MVZA 2JX0A 3DI5A 4AE4B 1VB5A 2I15A 1M6TA 1Y4CA 1YYXA 3LESA 3W2WA 3CEXA 4Q7CA 2J9BA 1M56C 2OG2A 1YVIA 5DS5A 3LS1A 4A4AA 1Q0MA 4HE8D 2PP4A 4MVQA 2YLDA 5A6BD 4JJGA 3U8VA 3WODF 4C3BA 5JT4A 2JD3A 2H7VC 4N4WA 5COFA 5F5HA 4EBKA 4ZLDA 3A9CA 3GANA 1T5OA 1NU9C 4JVSA 3S29A 2NUPB 4NCQA 4G7HF 3U3FA 2YLGA 1Y6DA 3DJNB 1OKKA 4NY3A 3IQCA 1OCOC 3LAYA 2LFDA 2Y3DA 1HE9A 4JCZA 4CS9A 4IAQA 2OEXA 2R7OA 1OCRC 2XLOA 3EHMA 3EFOB 1A7EA 3ASOC 2XSEA 3KPHA 4XEKA 3C8GA 3S0XA 4NTAA 3GWNA 3W8IA 4I1MA 1OR2A 5KYUA 3RVYA 4BG0A 2PFDA 1Z63A 2XS8A 1NBBA 1K04A 2YEVA 3V7OA 3F46A 4E17A 2Y69C 2M4EA 3SYNA 3T4RA 4GYTA 5L0JA 1T6QA 2DYRC 2XL8A 2Z15A 3M79A 3RF3A 1HY5A 2WZFA 4E0HA 1R4TA 1HE1A 2J45A 1MMGA 1EA8A 1ZU4A 2OKUA 2EPNA 1I5NA 1RKCA 1E2XA 1G4US 2Q00A 3E70C 3RYLA 3S27A 5AC4A 2CGEA 2CNWA 4JW1A 2PNOA 2J9UA 3RVZA 3VM6A 4U9DA 4ANJA 3JSZA 2Q9AA 4IAOA 4B6IA 2A0UA 5D92A 4H4KC 1AVOB 3TJ5A 4C7OA 4ULVA 3GEHA 4K1OA 2Q9CA 4O79A 2OJED 5KYWB 2A68F 1V55C 1TQGA 3AGUA 4XTKA 3B0VC 1CGME 2OEVA 3TK0A 4YT2A 2XLMA 3GM1A 2V3CC 1QQ3A 2L7AA 1OW6A 3KKBA 2R25A 3ZVRA 4EHPA 1T01A 3QW0A 3DWWA 4G0HA 2HFIA 3LLKA 3EH2A 3WG7C 2FFHA 2KGOA 2R02A 3AG1C 3NYMA 2HV7A 5D91A 2R7VA 5HSWA 3BEHA 2AWCA 4OD4A 1VYKA 2KW3C 4D4XA 4CDVA 2W45A 3U2LA 1JPNA 3AQBA 4MQ9F 3RW0A 4IGGA 5DQZA 4OIQF 1OCZC 1C03A 4PACA 3C62A 3KH2A 2BE5F 1H6GA 1ZHYA 3FMSA 2XL4A 1ST6A 5KYWA 1RMVA 1K05A 2XLHA 2A69F 1T6IA 4IJJA 4JCHA 1ZU5A 4CDAA 3K1IA 2LK4A 2LP4A 2LIGA 1ZW3A 2P61A 3AOUA 2EILC 1BR4A 1V74B 3AQCA 3EGDB 4U5CE 3SXYA 5HV9A 4HEAJ 2WB7A 1LVKA 4HFFB 3SZRA 3G4ZA 3GEIA 1ZZPA 4OD5A 1O87A 2EPMX 2J46A 3POVA 3AG2C 3ABLC 3N2ZB 1LM3B 2NUTB 2RD9A 1ZW2A 3NMIA 4LDKA 1RKEA 2HJMA 4IB4A 3U2MA 1KU2A 1W2WA 4XPWA 1TR2A 4KNWA 2W9YA 3CSKA 3QW1A 5KYYA 3IQTA 1Z3IX 3PMRA 2QUPA 1M2VB 3EPVA 3GWLA 2W4BA 5EGYA 3MFNA 3UMHA 2R7XA 2I8BA 2HJ3A 2VB6A 3ZC4A 2B0JA 2QNLA 4N6CA 1YYJA 4N06A 1ZVZA 1LKXA 2J7PD 3EGDA 5CI8A 4DBRA 2D4UA 3AGTA 2C03A 2ETSA 3ZWIA 256BA 2P7VA 4LDQA 2R05A 1FR0A 2J9VA 5KYNA 1OR3A 1O5HA 4PJJA 2R7WA 3QMKA 4EKWA 1G4WR 2HSQA 4MVRA 2HMZA 4J7TA 2HUJA 3ZQYA 5A6KA 4QI2A 1NLXA 2YQYA 4JE9A 5K0IA 1K40A 1DOVA 1B68A 4UDVA 2YWAA 1JRAA 2YL0A 2YL7A 3M15A 1UG7A 3K1IC 4BJ5C 2YLIA 3DM9B 4R32A 4YN0B 4I3MA 4LLEA 1E86A 4CSAA 1SF8A 1G5ZA 3UMKA 3V5YA 1NFOA 1M2OA 2P6VA 4JURI 3HTKC 5B3SC 3S90A 3K6BA 2GDCA 1VMAA 3LJBA 2XXAB 1OXKA 2DB4A 2OOCA 2F22A 2ZXPA 2CNWD 4AE4A 3WAQA 4KC9A 2HKVA 3O39A 2J0WA 5T1DB 4I44A 3IEEA 1Z7Qc 2AWYA 3K33A 3OA1A 5JS5A 5FCLA 1BZ4A 2EINC 2WL8A 4XEFA 2YRFA 4CS8A 3DM5A 5L0GA 3NDBB 1BR2A 4X0RA 4YT4A 4KNVA 3TOMA 3RQEA 3W2VA 4CX9A 3KYIA 4P6IC 4U9EA 1D0ZA 4CJOA 3C8GD 3IQ6A 4JTAB 3A11A 3DKAA 3NKDA 1MMNA 3C63A 4CS9C 5GPGB 4KI2A 2Y3HA 5COMA 4G7OF 3LS0A 4DRHB 2W4MA 1XZQA 3OWTA 1C02A 4DBQA 1HW2A 2YHSA 2ZXRA 3CAXA 5BQIA 2IXPA 2J0XA 3AG4C 3DXJF 4U5FE 3ZQVA 1XZPA 3K1HA 4JEBA 3LUTB 3VRCA 4L6RA 5BQGA 1A0BA 2Q4FA 5L0CA 4ONSA 1Q0KA 4K7BA 3R2PA 3IQ5A 2LD6A 4XEVA 3GM3A 1H9TA 3O55A 1H7IA 2X51A 4FESA 5DQTA 2A1DD 2G3VA 2KYHA 2VCCA 2H7OA 3EQLF 3M1CB 4GQHA 3C18A 1IW7F 3W4YA 1Z6AA 4Z9HA 5F5FA 2HZ8A 2YVKA 3SEOA 1TWCA 3RFYA 5L0FA 4YT5A 1M2VA 1RXQA 2J8WA 3G4XA 4FWVA 4LLCA 4MVMA 4E7ZA 1EI7A 2IXMA 1VK5A 2VASA 3SXKA 1KTMA 3TD7A 3ZTZA 1MQVA 2M64A 3KMIA 1ZHZA 3L1MA 3L8JA 5DS6A 2A6HF 4JZAA 5JUAA 1QKRA 1S05A 1YZCA 2B0HA 1E85A 2VCAA 3JT1A 4O7GA 2PF4E 3B0PA 3EGXB 5E33A 4JJFA 2WZLA 3DD7A 1H9GA 4EWCA 5JP7A 1AEPA 2IXNA 4XPXA 4PJMA 4E0IA 2EPLX 3AJMA 4FX5A 3UGPA 2MHRA 3N0TA 1PD0A 2GFHA 2A0BA 3S84A 2OU6A 1OXBA 4WGZA 3RQFA 3MLGA 1GS9A 1XWJA 4MTFA 1LI7A 4RBNA 3NG1A 3GEEA 4LDRA 4W8KA 1E84A 3DJUB 5KYUB 3U9JA 5JVEA 4J30B 4RDAA 2P0NA 5L3QA 3BRJA 4IWBA 3DMDA 4ER9A 3ASNC 3MYFA 4P9TA 5E2QA 5B3IA 3JRMO 2Y3GA 1D0XA 2NUPA 2PX3A 1BBHA 1LS4A 5B1BC 4K0DA 1T6UA 1I4YA 2XM0A 3I5PA 4DOZA 5BQHA 2NPUA 2IM8A 1WWPA 1FFHA 3LEOA 3T9OA 4P9FA 1YDIA 2XLEA 4YL0A 1FNTc 4LERA 5EK0A 2QY9A 4DJ9A 4Q4ZF 4EBBA 5L3VA 1YJGA 2ZXOA 3TJ6A 2HV6A 3TOLA 3ZDLA 3EGXA 1YA9A 2AP3A 1FTSA 1VLSA 1ZHWA 1V54C 2HMQA 2G62A 2KSFA 3KYJA 4AK9A 4CBEA 3ABMC 2XM4A 1MNDA 3R7CA 4RD9A 4LACB 4BJ6A 5A69A 1A7DA 4J32B 4JTCB 2QTVA 4NTFA 1CPQA 1E83A 2IBFA 1D1CA 3V5XA 1PD1A 1T9KA 1TWAA 2DYSC 5T3TA 1RJ9A 1JOGA 1ZHXA 2KK1A 5AC5A 1L7CA 2V26A 2GAQA 4YL1A 2HSBA 3FDQA 2XL6A 3C8GB 3ABKC 3AG3C 3JZ0A 1WOLA 2L6FA 2ZPAA 4O6MA 2CYDA 4JIOA 3U5SA 1QVXA 1A7VA 2Q9BA 3DAFA 3WHNA 1I4ZA 3W8HA 4CDYA 1ZYRF 3SXZA 4OIOF 3LEVA 4C7OB 1EKYA 3GORA 2QE9A 2EIJC 2CCYA 1EQ1A 2BC5A 1LE4A 1AUEA 5F28E 3S9OA 3US6A 5EHHA 3S28A 1BR1A 2R9RB 1BDJB 2XRHA 3ZTMA 1D0YA 1QLEC 3ZSUA 1Z23A 2GA0A 2LFFA 5DLJA 1ORJA 3U3BA 4PR9A 1U89A 3EG9B 3LNMB 5DVWA 1LIHA 2HS5A 3X1OA 1OKKD 3EG9A 2NSGA 3CQZA 3MX3A 5CI9A 2GWWA 4ZLCA 5IY5C 4CSAC 2CW0F 2DI3A 4XQ1A 1UFBA 4ULWA 3ITFA 2E87A 4NQFA 3NMKA 3T6BA 2CDQA 3HLZA 1TWGA 3JRTA 4C3DA 3PHF2 2KNHA 3C7JA 4JKVA 2Q7RA 3Q7GA 2WVQA 4QI0A 4WABA 3OEOA 1O3UA 4MVOA 2L6HA 5A6BA 1YZAA 3MBGA 2XLVA 5A6JA 1PV3A 2WZGA 4DRIB 3JTLO 2DGJA 3FHDA 3FOPA 3NKEA 3JSEO 3RIPA 4I1OB 2MWQA 1QZXA 3L0IA 3U0CA 2IYLD 1NFNA 4O6YA 4MW3A 4KBLA 3V5ZA 1LE2A 1TFKB 4PFPA 1Q0FA 3SNHA 4XLNF 1ZHTA 2VH3A 4DVYP 1U0BB 3VF0A 4E7SA 5AGFA 3UNGC 2XS1A 1NZEA 4BJ1A 4HFKB 1M57C 1VTMP 2ASRA 4JEAA 4YJWA 2L6GA 1FMVA 3ATPA 3C8ZA 2R7UA 4YK5A 3UMIA 4CIHA 3HKKA 2EIKC 2LQGA 3DZAA 5L0DA 2LSEA 3G50A 3NYJA 1WGWA 1YARO 2YL3A 3VAYA 2EPOA 5L0HA 4PFOA 1MNEA 3JCUQ 1GM5A 2H7BA 2A6EF 2OQMA 2JPUA 2R7SA 1MMAA 4PJNA 4MTOA 4YT8A 4YWQA 4N6HA 5TJ5E 3F47A 5T3WA 1VYIA 1SMYF 4G7ZF 4MTGA 3DE8A 2IXOA 2FGYA 3H2UA 2R7RA 4CS8C 1PCXA 1DOWA 3FXHA 3O10A 4BPMA 3TULA 4XLPF 2QLAA 3TQOA 5BUOA 3J06A 2G3KA 1Q0DA 1VOMA 3N24A 2L9JA 1TWHA 4W8PA 1LS1A 1YLMA 2WVOA 3Q6MA 4MVSA 1HMDA 1CPRA 2ZD9A 4H54A 4MW8A 4OIPF 1QSPA 4J7YA 3GODA 2H8AA 3I4UA 1GGQA 3UGOA 1VLTA 3ZG1A 4CS7A 2C04A 4AL1A 5JSLA 2PX0A 2KC3A 4JC7A 2XLDA 4EIYA 1OW8A 3Q6NA 3NRHA 1TFOB 4Z9IA 1YAUO 3DE9A 3ZIBA 4BJ5A 3X2QC 1TKNA 2P1AA 4BJTA 4AX2A 3Q7LA 3NYLA 2XLWA 1RCPA 3IHUA
chains in the Genus database with same CATH topology
2XL8A 3M79A 3M4BA 2XM4A 1E83A 1GQAA 1CPQA 3HNKA 5JS5A 2YKZA 1CGOA 2XL6A 4U9DA 3M4CA 3TOMA 4CX9A 3HNJA 1A7VA 4U9EA 4CDYA 4NC3A 1EKYA 4ULVA 4CJOA 5JRAA 3IQ6A 2CCYA 2BC5A 3C63A 3ZTMA 2XLMA 2YL1A 1QQ3A 3QVZA 1JAFA 3QW0A 3HNIA 3ZQVA 4JEBA 3VRCA 4L6RA 1CGNA 4D4XA 4CDVA 3NMKA 3U8PA 3IQ5A 4JKVA 3C62A 4CIPA 1YZAA 3FOOA 2XLVA 2XLHA 5JLIA 4WGYA 3FOPA 4D4NA 4CDAA 3QVYA 2J8WA 1QPUA 3HNLA 4CJGA 4IARA 3ZTZA 1MQVA 3L1MA 5JUAA 1S05A 1YZCA 1E85A 1LM3B 1APCA 5AGFA 3NMJA 3NMIA 4IB4A 4JEAA 3QW1A 5JP7A 1M6TA 1YYXA 2YL3A 2J9BA 4WGZA 2YLDA 1YYJA 5JT4A 4N6HA 4N4WA 3DE8A 3ZWIA 1E84A 256BA 5JVEA 2QLAA 4ER9A 2YLGA 5B3IA 1BBHA 1CPRA 3ZQYA 4JE9A 2XM0A 4IAQA 2YL0A 2XLOA 2YL7A 5JSLA 2XLDA 4EIYA 2XLEA 3M15A 2YLIA 3DE9A 1E86A 1NBBA 3TOLA 2XLWA 1RCPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XL8 A;  3M79 A;  3M4B A;  2XM4 A;  1E83 A;  1GQA A;  1CPQ A;  3HNK A;  5JS5 A;  2YKZ A;  1CGO A;  2XL6 A;  4U9D A;  3M4C A;  3TOM A;  4CX9 A;  3HNJ A;  1A7V A;  4U9E A;  4CDY A;  4NC3 A;  1EKY A;  4ULV A;  4CJO A;  5JRA A;  3IQ6 A;  2CCY A;  2BC5 A;  3C63 A;  3ZTM A;  2XLM A;  2YL1 A;  1QQ3 A;  3QVZ A;  1JAF A;  3QW0 A;  3HNI A;  3ZQV A;  4JEB A;  3VRC A;  4L6R A;  1CGN A;  4D4X A;  4CDV A;  3NMK A;  3U8P A;  3IQ5 A;  4JKV A;  3C62 A;  4CIP A;  1YZA A;  3FOO A;  2XLV A;  2XLH A;  5JLI A;  4WGY A;  3FOP A;  4D4N A;  4CDA A;  3QVY A;  2J8W A;  1QPU A;  3HNL A;  4CJG A;  4IAR A;  3ZTZ A;  1MQV A;  3L1M A;  5JUA A;  1S05 A;  1YZC A;  1E85 A;  1LM3 B;  1APC A;  5AGF A;  3NMJ A;  3NMI A;  4IB4 A;  4JEA A;  3QW1 A;  5JP7 A;  1M6T A;  1YYX A;  2YL3 A;  2J9B A;  4WGZ A;  2YLD A;  1YYJ A;  5JT4 A;  4N6H A;  4N4W A;  3DE8 A;  3ZWI A;  1E84 A;  256B A;  5JVE A;  2QLA A;  4ER9 A;  2YLG A;  5B3I A;  1BBH A;  1CPR A;  3ZQY A;  4JE9 A;  2XM0 A;  4IAQ A;  2YL0 A;  2XLO A;  2YL7 A;  5JSL A;  2XLD A;  4EIY A;  2XLE A;  3M15 A;  2YLI A;  3DE9 A;  1E86 A;  1NBB A;  3TOL A;  2XLW A;  1RCP A; 
#chains in the Genus database with same CATH topology
 3HJC A;  3B0U X;  1SZI A;  1JPJ A;  3GM2 A;  1WAS A;  5KYY B;  4QDL A;  1OW7 A;  3FAJ A;  4BEM J;  4XWJ A;  2KJG A;  3M4B A;  3QTH A;  1S7Z A;  2EPK X;  1NSG B;  2FAP B;  2VCB A;  4G78 A;  4JTD B;  3LLI A;  5E3C A;  2KQ9 A;  3T6J A;  4A2N B;  1OCC C;  2OCC C;  1GQA A;  1WN0 A;  3L8I A;  4BJ6 C;  4C3E A;  5KYX B;  3PDM P;  3KL4 A;  4PK4 A;  5KYX A;  1FAP B;  3HNK A;  3I5Q A;  1J8M F;  3E9V A;  4E18 A;  1ORS C;  2YKZ A;  2ICW G;  1RKE B;  1CGO A;  2LCH A;  2Y3B A;  5B1A C;  4AL0 A;  1SYQ A;  2NUT A;  2IOQ A;  3M4C A;  1V4A A;  1JMW A;  3MYI A;  3H2V A;  3HNJ A;  3VYW A;  2J9W A;  4DVZ A;  1G8X A;  1FFT C;  4NC3 A;  3RH3 A;  4DRJ B;  5DS4 A;  5A6A A;  2XXA A;  1D1B A;  5E3A A;  2R7Q A;  5JRA A;  4Q5S F;  4U5D E;  2Y39 A;  4U5H A;  1SR2 A;  3O6X A;  3FVY A;  2Q3T A;  3FAP B;  3K7D A;  2PBE A;  3L34 A;  3EHN A;  3IPM O;  3SXM A;  2YL1 A;  3EJN A;  3K66 A;  2L81 A;  1A41 A;  1HMO A;  3EZI A;  3QVZ A;  4PJL A;  1IZM A;  1JAF A;  3JYY A;  1MMD A;  4U5G A;  1YA7 O;  2OJQ A;  3EH1 A;  2YZS A;  3EFO A;  3H65 A;  1C17 M;  2MYS A;  2D5R B;  3EZH A;  3HNI A;  2RSE B;  4WJ0 A;  2EIM C;  4FAP B;  3UR3 C;  4EBJ A;  1ORY A;  1CGN A;  4GEH A;  3QZC A;  3DAG A;  3LNR A;  1LPE A;  1KNY A;  3RQG A;  3U9M A;  5CIV A;  2WVN A;  1NG1 A;  3B71 A;  3JYH A;  1NU7 D;  1U6H A;  2NG1 A;  2X0C A;  1Q0G A;  3U8P A;  2R03 A;  2UUH A;  3SP1 A;  3T6G B;  4Z9J A;  1HW1 A;  2J7P A;  4JRZ A;  1WAT A;  4M63 A;  4OIN F;  4CIP A;  2O9X A;  2TMV P;  2R7T A;  3FOO A;  4XPY A;  1FMW A;  2VC9 A;  5JLI A;  4MND A;  4WGY A;  4YL3 A;  3PCV A;  1N1C A;  1J8Y F;  2UUI A;  3QVY A;  4MS2 A;  4BEJ A;  4D4N A;  3B29 A;  4U5B E;  1JR8 A;  1QPU A;  4F4B A;  3HNL A;  5L0I A;  4NTB A;  1RJ9 B;  4CJG A;  4IAR A;  1OQC A;  1LI5 A;  2AVK A;  1D1A A;  3ECS A;  4OIR F;  2BL2 A;  2NSF A;  1F1M A;  2ZXW C;  4IRU A;  4O6N A;  5COG A;  3CZ6 A;  4MVU A;  1APC A;  4DXW A;  3NMJ A;  1Z5Z A;  4U5E E;  1L3P A;  2AU5 A;  3B9Q A;  1R5I D;  4EUK B;  1WTY A;  5FZT A;  3RKO F;  4MVZ A;  2JX0 A;  3DI5 A;  4AE4 B;  1VB5 A;  2I15 A;  1M6T A;  1Y4C A;  1YYX A;  3LES A;  3W2W A;  3CEX A;  4Q7C A;  2J9B A;  1M56 C;  2OG2 A;  1YVI A;  5DS5 A;  3LS1 A;  4A4A A;  1Q0M A;  4HE8 D;  2PP4 A;  4MVQ A;  2YLD A;  5A6B D;  4JJG A;  3U8V A;  3WOD F;  4C3B A;  5JT4 A;  2JD3 A;  2H7V C;  4N4W A;  5COF A;  5F5H A;  4EBK A;  4ZLD A;  3A9C A;  3GAN A;  1T5O A;  1NU9 C;  4JVS A;  3S29 A;  2NUP B;  4NCQ A;  4G7H F;  3U3F A;  2YLG A;  1Y6D A;  3DJN B;  1OKK A;  4NY3 A;  3IQC A;  1OCO C;  3LAY A;  2LFD A;  2Y3D A;  1HE9 A;  4JCZ A;  4CS9 A;  4IAQ A;  2OEX A;  2R7O A;  1OCR C;  2XLO A;  3EHM A;  3EFO B;  1A7E A;  3ASO C;  2XSE A;  3KPH A;  4XEK A;  3C8G A;  3S0X A;  4NTA A;  3GWN A;  3W8I A;  4I1M A;  1OR2 A;  5KYU A;  3RVY A;  4BG0 A;  2PFD A;  1Z63 A;  2XS8 A;  1NBB A;  1K04 A;  2YEV A;  3V7O A;  3F46 A;  4E17 A;  2Y69 C;  2M4E A;  3SYN A;  3T4R A;  4GYT A;  5L0J A;  1T6Q A;  2DYR C;  2XL8 A;  2Z15 A;  3M79 A;  3RF3 A;  1HY5 A;  2WZF A;  4E0H A;  1R4T A;  1HE1 A;  2J45 A;  1MMG A;  1EA8 A;  1ZU4 A;  2OKU A;  2EPN A;  1I5N A;  1RKC A;  1E2X A;  1G4U S;  2Q00 A;  3E70 C;  3RYL A;  3S27 A;  5AC4 A;  2CGE A;  2CNW A;  4JW1 A;  2PNO A;  2J9U A;  3RVZ A;  3VM6 A;  4U9D A;  4ANJ A;  3JSZ A;  2Q9A A;  4IAO A;  4B6I A;  2A0U A;  5D92 A;  4H4K C;  1AVO B;  3TJ5 A;  4C7O A;  4ULV A;  3GEH A;  4K1O A;  2Q9C A;  4O79 A;  2OJE D;  5KYW B;  2A68 F;  1V55 C;  1TQG A;  3AGU A;  4XTK A;  3B0V C;  1CGM E;  2OEV A;  3TK0 A;  4YT2 A;  2XLM A;  3GM1 A;  2V3C C;  1QQ3 A;  2L7A A;  1OW6 A;  3KKB A;  2R25 A;  3ZVR A;  4EHP A;  1T01 A;  3QW0 A;  3DWW A;  4G0H A;  2HFI A;  3LLK A;  3EH2 A;  3WG7 C;  2FFH A;  2KGO A;  2R02 A;  3AG1 C;  3NYM A;  2HV7 A;  5D91 A;  2R7V A;  5HSW A;  3BEH A;  2AWC A;  4OD4 A;  1VYK A;  2KW3 C;  4D4X A;  4CDV A;  2W45 A;  3U2L A;  1JPN A;  3AQB A;  4MQ9 F;  3RW0 A;  4IGG A;  5DQZ A;  4OIQ F;  1OCZ C;  1C03 A;  4PAC A;  3C62 A;  3KH2 A;  2BE5 F;  1H6G A;  1ZHY A;  3FMS A;  2XL4 A;  1ST6 A;  5KYW A;  1RMV A;  1K05 A;  2XLH A;  2A69 F;  1T6I A;  4IJJ A;  4JCH A;  1ZU5 A;  4CDA A;  3K1I A;  2LK4 A;  2LP4 A;  2LIG A;  1ZW3 A;  2P61 A;  3AOU A;  2EIL C;  1BR4 A;  1V74 B;  3AQC A;  3EGD B;  4U5C E;  3SXY A;  5HV9 A;  4HEA J;  2WB7 A;  1LVK A;  4HFF B;  3SZR A;  3G4Z A;  3GEI A;  1ZZP A;  4OD5 A;  1O87 A;  2EPM X;  2J46 A;  3POV A;  3AG2 C;  3ABL C;  3N2Z B;  1LM3 B;  2NUT B;  2RD9 A;  1ZW2 A;  3NMI A;  4LDK A;  1RKE A;  2HJM A;  4IB4 A;  3U2M A;  1KU2 A;  1W2W A;  4XPW A;  1TR2 A;  4KNW A;  2W9Y A;  3CSK A;  3QW1 A;  5KYY A;  3IQT A;  1Z3I X;  3PMR A;  2QUP A;  1M2V B;  3EPV A;  3GWL A;  2W4B A;  5EGY A;  3MFN A;  3UMH A;  2R7X A;  2I8B A;  2HJ3 A;  2VB6 A;  3ZC4 A;  2B0J A;  2QNL A;  4N6C A;  1YYJ A;  4N06 A;  1ZVZ A;  1LKX A;  2J7P D;  3EGD A;  5CI8 A;  4DBR A;  2D4U A;  3AGT A;  2C03 A;  2ETS A;  3ZWI A;  256B A;  2P7V A;  4LDQ A;  2R05 A;  1FR0 A;  2J9V A;  5KYN A;  1OR3 A;  1O5H A;  4PJJ A;  2R7W A;  3QMK A;  4EKW A;  1G4W R;  2HSQ A;  4MVR A;  2HMZ A;  4J7T A;  2HUJ A;  3ZQY A;  5A6K A;  4QI2 A;  1NLX A;  2YQY A;  4JE9 A;  5K0I A;  1K40 A;  1DOV A;  1B68 A;  4UDV A;  2YWA A;  1JRA A;  2YL0 A;  2YL7 A;  3M15 A;  1UG7 A;  3K1I C;  4BJ5 C;  2YLI A;  3DM9 B;  4R32 A;  4YN0 B;  4I3M A;  4LLE A;  1E86 A;  4CSA A;  1SF8 A;  1G5Z A;  3UMK A;  3V5Y A;  1NFO A;  1M2O A;  2P6V A;  4JUR I;  3HTK C;  5B3S C;  3S90 A;  3K6B A;  2GDC A;  1VMA A;  3LJB A;  2XXA B;  1OXK A;  2DB4 A;  2OOC A;  2F22 A;  2ZXP A;  2CNW D;  4AE4 A;  3WAQ A;  4KC9 A;  2HKV A;  3O39 A;  2J0W A;  5T1D B;  4I44 A;  3IEE A;  1Z7Q c;  2AWY A;  3K33 A;  3OA1 A;  5JS5 A;  5FCL A;  1BZ4 A;  2EIN C;  2WL8 A;  4XEF A;  2YRF A;  4CS8 A;  3DM5 A;  5L0G A;  3NDB B;  1BR2 A;  4X0R A;  4YT4 A;  4KNV A;  3TOM A;  3RQE A;  3W2V A;  4CX9 A;  3KYI A;  4P6I C;  4U9E A;  1D0Z A;  4CJO A;  3C8G D;  3IQ6 A;  4JTA B;  3A11 A;  3DKA A;  3NKD A;  1MMN A;  3C63 A;  4CS9 C;  5GPG B;  4KI2 A;  2Y3H A;  5COM A;  4G7O F;  3LS0 A;  4DRH B;  2W4M A;  1XZQ A;  3OWT A;  1C02 A;  4DBQ A;  1HW2 A;  2YHS A;  2ZXR A;  3CAX A;  5BQI A;  2IXP A;  2J0X A;  3AG4 C;  3DXJ F;  4U5F E;  3ZQV A;  1XZP A;  3K1H A;  4JEB A;  3LUT B;  3VRC A;  4L6R A;  5BQG A;  1A0B A;  2Q4F A;  5L0C A;  4ONS A;  1Q0K A;  4K7B A;  3R2P A;  3IQ5 A;  2LD6 A;  4XEV A;  3GM3 A;  1H9T A;  3O55 A;  1H7I A;  2X51 A;  4FES A;  5DQT A;  2A1D D;  2G3V A;  2KYH A;  2VCC A;  2H7O A;  3EQL F;  3M1C B;  4GQH A;  3C18 A;  1IW7 F;  3W4Y A;  1Z6A A;  4Z9H A;  5F5F A;  2HZ8 A;  2YVK A;  3SEO A;  1TWC A;  3RFY A;  5L0F A;  4YT5 A;  1M2V A;  1RXQ A;  2J8W A;  3G4X A;  4FWV A;  4LLC A;  4MVM A;  4E7Z A;  1EI7 A;  2IXM A;  1VK5 A;  2VAS A;  3SXK A;  1KTM A;  3TD7 A;  3ZTZ A;  1MQV A;  2M64 A;  3KMI A;  1ZHZ A;  3L1M A;  3L8J A;  5DS6 A;  2A6H F;  4JZA A;  5JUA A;  1QKR A;  1S05 A;  1YZC A;  2B0H A;  1E85 A;  2VCA A;  3JT1 A;  4O7G A;  2PF4 E;  3B0P A;  3EGX B;  5E33 A;  4JJF A;  2WZL A;  3DD7 A;  1H9G A;  4EWC A;  5JP7 A;  1AEP A;  2IXN A;  4XPX A;  4PJM A;  4E0I A;  2EPL X;  3AJM A;  4FX5 A;  3UGP A;  2MHR A;  3N0T A;  1PD0 A;  2GFH A;  2A0B A;  3S84 A;  2OU6 A;  1OXB A;  4WGZ A;  3RQF A;  3MLG A;  1GS9 A;  1XWJ A;  4MTF A;  1LI7 A;  4RBN A;  3NG1 A;  3GEE A;  4LDR A;  4W8K A;  1E84 A;  3DJU B;  5KYU B;  3U9J A;  5JVE A;  4J30 B;  4RDA A;  2P0N A;  5L3Q A;  3BRJ A;  4IWB A;  3DMD A;  4ER9 A;  3ASN C;  3MYF A;  4P9T A;  5E2Q A;  5B3I A;  3JRM O;  2Y3G A;  1D0X A;  2NUP A;  2PX3 A;  1BBH A;  1LS4 A;  5B1B C;  4K0D A;  1T6U A;  1I4Y A;  2XM0 A;  3I5P A;  4DOZ A;  5BQH A;  2NPU A;  2IM8 A;  1WWP A;  1FFH A;  3LEO A;  3T9O A;  4P9F A;  1YDI A;  2XLE A;  4YL0 A;  1FNT c;  4LER A;  5EK0 A;  2QY9 A;  4DJ9 A;  4Q4Z F;  4EBB A;  5L3V A;  1YJG A;  2ZXO A;  3TJ6 A;  2HV6 A;  3TOL A;  3ZDL A;  3EGX A;  1YA9 A;  2AP3 A;  1FTS A;  1VLS A;  1ZHW A;  1V54 C;  2HMQ A;  2G62 A;  2KSF A;  3KYJ A;  4AK9 A;  4CBE A;  3ABM C;  2XM4 A;  1MND A;  3R7C A;  4RD9 A;  4LAC B;  4BJ6 A;  5A69 A;  1A7D A;  4J32 B;  4JTC B;  2QTV A;  4NTF A;  1CPQ A;  1E83 A;  2IBF A;  1D1C A;  3V5X A;  1PD1 A;  1T9K A;  1TWA A;  2DYS C;  5T3T A;  1RJ9 A;  1JOG A;  1ZHX A;  2KK1 A;  5AC5 A;  1L7C A;  2V26 A;  2GAQ A;  4YL1 A;  2HSB A;  3FDQ A;  2XL6 A;  3C8G B;  3ABK C;  3AG3 C;  3JZ0 A;  1WOL A;  2L6F A;  2ZPA A;  4O6M A;  2CYD A;  4JIO A;  3U5S A;  1QVX A;  1A7V A;  2Q9B A;  3DAF A;  3WHN A;  1I4Z A;  3W8H A;  4CDY A;  1ZYR F;  3SXZ A;  4OIO F;  3LEV A;  4C7O B;  1EKY A;  3GOR A;  2QE9 A;  2EIJ C;  2CCY A;  1EQ1 A;  2BC5 A;  1LE4 A;  1AUE A;  5F28 E;  3S9O A;  3US6 A;  5EHH A;  3S28 A;  1BR1 A;  2R9R B;  1BDJ B;  2XRH A;  3ZTM A;  1D0Y A;  1QLE C;  3ZSU A;  1Z23 A;  2GA0 A;  2LFF A;  5DLJ A;  1ORJ A;  3U3B A;  4PR9 A;  1U89 A;  3EG9 B;  3LNM B;  5DVW A;  1LIH A;  2HS5 A;  3X1O A;  1OKK D;  3EG9 A;  2NSG A;  3CQZ A;  3MX3 A;  5CI9 A;  2GWW A;  4ZLC A;  5IY5 C;  4CSA C;  2CW0 F;  2DI3 A;  4XQ1 A;  1UFB A;  4ULW A;  3ITF A;  2E87 A;  4NQF A;  3NMK A;  3T6B A;  2CDQ A;  3HLZ A;  1TWG A;  3JRT A;  4C3D A;  3PHF 2;  2KNH A;  3C7J A;  4JKV A;  2Q7R A;  3Q7G A;  2WVQ A;  4QI0 A;  4WAB A;  3OEO A;  1O3U A;  4MVO A;  2L6H A;  5A6B A;  1YZA A;  3MBG A;  2XLV A;  5A6J A;  1PV3 A;  2WZG A;  4DRI B;  3JTL O;  2DGJ A;  3FHD A;  3FOP A;  3NKE A;  3JSE O;  3RIP A;  4I1O B;  2MWQ A;  1QZX A;  3L0I A;  3U0C A;  2IYL D;  1NFN A;  4O6Y A;  4MW3 A;  4KBL A;  3V5Z A;  1LE2 A;  1TFK B;  4PFP A;  1Q0F A;  3SNH A;  4XLN F;  1ZHT A;  2VH3 A;  4DVY P;  1U0B B;  3VF0 A;  4E7S A;  5AGF A;  3UNG C;  2XS1 A;  1NZE A;  4BJ1 A;  4HFK B;  1M57 C;  1VTM P;  2ASR A;  4JEA A;  4YJW A;  2L6G A;  1FMV A;  3ATP A;  3C8Z A;  2R7U A;  4YK5 A;  3UMI A;  4CIH A;  3HKK A;  2EIK C;  2LQG A;  3DZA A;  5L0D A;  2LSE A;  3G50 A;  3NYJ A;  1WGW A;  1YAR O;  2YL3 A;  3VAY A;  2EPO A;  5L0H A;  4PFO A;  1MNE A;  3JCU Q;  1GM5 A;  2H7B A;  2A6E F;  2OQM A;  2JPU A;  2R7S A;  1MMA A;  4PJN A;  4MTO A;  4YT8 A;  4YWQ A;  4N6H A;  5TJ5 E;  3F47 A;  5T3W A;  1VYI A;  1SMY F;  4G7Z F;  4MTG A;  3DE8 A;  2IXO A;  2FGY A;  3H2U A;  2R7R A;  4CS8 C;  1PCX A;  1DOW A;  3FXH A;  3O10 A;  4BPM A;  3TUL A;  4XLP F;  2QLA A;  3TQO A;  5BUO A;  3J06 A;  2G3K A;  1Q0D A;  1VOM A;  3N24 A;  2L9J A;  1TWH A;  4W8P A;  1LS1 A;  1YLM A;  2WVO A;  3Q6M A;  4MVS A;  1HMD A;  1CPR A;  2ZD9 A;  4H54 A;  4MW8 A;  4OIP F;  1QSP A;  4J7Y A;  3GOD A;  2H8A A;  3I4U A;  1GGQ A;  3UGO A;  1VLT A;  3ZG1 A;  4CS7 A;  2C04 A;  4AL1 A;  5JSL A;  2PX0 A;  2KC3 A;  4JC7 A;  2XLD A;  4EIY A;  1OW8 A;  3Q6N A;  3NRH A;  1TFO B;  4Z9I A;  1YAU O;  3DE9 A;  3ZIB A;  4BJ5 A;  3X2Q C;  1TKN A;  2P1A A;  4BJT A;  4AX2 A;  3Q7L A;  3NYL A;  2XLW A;  1RCP A;  3IHU A; 
#chains in the Genus database with same CATH homology
 2XL8 A;  3M79 A;  3M4B A;  2XM4 A;  1E83 A;  1GQA A;  1CPQ A;  3HNK A;  5JS5 A;  2YKZ A;  1CGO A;  2XL6 A;  4U9D A;  3M4C A;  3TOM A;  4CX9 A;  3HNJ A;  1A7V A;  4U9E A;  4CDY A;  4NC3 A;  1EKY A;  4ULV A;  4CJO A;  5JRA A;  3IQ6 A;  2CCY A;  2BC5 A;  3C63 A;  3ZTM A;  2XLM A;  2YL1 A;  1QQ3 A;  3QVZ A;  1JAF A;  3QW0 A;  3HNI A;  3ZQV A;  4JEB A;  3VRC A;  4L6R A;  1CGN A;  4D4X A;  4CDV A;  3NMK A;  3U8P A;  3IQ5 A;  4JKV A;  3C62 A;  4CIP A;  1YZA A;  3FOO A;  2XLV A;  2XLH A;  5JLI A;  4WGY A;  3FOP A;  4D4N A;  4CDA A;  3QVY A;  2J8W A;  1QPU A;  3HNL A;  4CJG A;  4IAR A;  3ZTZ A;  1MQV A;  3L1M A;  5JUA A;  1S05 A;  1YZC A;  1E85 A;  1LM3 B;  1APC A;  5AGF A;  3NMJ A;  3NMI A;  4IB4 A;  4JEA A;  3QW1 A;  5JP7 A;  1M6T A;  1YYX A;  2YL3 A;  2J9B A;  4WGZ A;  2YLD A;  1YYJ A;  5JT4 A;  4N6H A;  4N4W A;  3DE8 A;  3ZWI A;  1E84 A;  256B A;  5JVE A;  2QLA A;  4ER9 A;  2YLG A;  5B3I A;  1BBH A;  1CPR A;  3ZQY A;  4JE9 A;  2XM0 A;  4IAQ A;  2YL0 A;  2XLO A;  2YL7 A;  5JSL A;  2XLD A;  4EIY A;  2XLE A;  3M15 A;  2YLI A;  3DE9 A;  1E86 A;  1NBB A;  3TOL A;  2XLW A;  1RCP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...