1Q0MA

Crystal structure of ni-containing superoxide dismutase with ni-ligation corresponding to the state after full x-ray-induced reduction
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
117
structure length
117
Chain Sequence
HCDLPCGVYDPAQARIEAESVKAIQEKMAANDDLHFQIRATVIKEQRAELAKHHLDVLWSDYFKPPHFESYPELHTLVNEAVKALSAAKASTDPATGQKALDYIAQIDKIFWETKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Ni]
publication title Crystal structure of nickel-containing superoxide dismutase reveals another type of active site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 52
structure length 117
sequence length 117
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2003-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.400 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nickel-containing superoxide dismutase 1q0mA00
1T6IA 1Q0GA 4NCQA 3G4ZA 1Q0DA 1Q0FA 1T6UA 3G4XA 1T6QA 3G50A 1Q0KA 1Q0MA
chains in the Genus database with same CATH superfamily
2R9RB 5CI9A 2P61A 1ZHYA 1OCOC 4J7YA 4AK9A 4XEVA 1D1BA 1VYKA 2EILC 2WZLA 3KMIA 4JTDB 4AL0A 4EWCA 3NMIA 2VCCA 2YLIA 2IOQA 3UNGC 3UGOA 4OD4A 3QVYA 1FMWA 2ASRA 3EH2A 3MBGA 3S28A 2IBFA 2WL8A 4JVSA 2QNLA 2EPKX 2ZPAA 4ZLDA 1T6UA 5COMA 4EBJA 1WGWA 2QY9A 2L7AA 4ZLCA 1ORYA 3S90A 2CCYA 2EPNA 1NBBA 2IM8A 2XLOA 4BJ5A 1D0YA 5L3QA 4RD9A 3OEOA 3ASOC 3B71A 2LCHA 3F47A 5KYWB 3KYJA 2W4BA 2ZXWC 1NSGB 1U0BB 3ABLC 3CAXA 4CS7A 3EGDA 3LEVA 4ULWA 1RKEB 2KSFA 3ZSUA 1OW8A 3GM3A 4JC7A 2Q00A 4Z9IA 2FFHA 2C04A 3IPMO 4XPYA 1OKKA 1M2VA 1WN0A 4IARA 1RCPA 4NY3A 4C3BA 2HMQA 5DS6A 3FOOA 4PJJA 4C7OB 4BG0A 2R7QA 3C8GA 3LLKA 1K40A 3RH3A 1HE1A 1A7VA 1HMOA 2HSBA 4NTBA 3VYWA 3I5PA 1FFHA 3DZAA 5B3SC 1OCRC 3QW0A 1MQVA 4JW1A 1FAPB 2W4MA 2AU5A 1YZCA 2J9VA 4J32B 1Q0FA 4PJNA 4I1OB 4B6IA 2OU6A 1TR2A 3VRCA 1G8XA 5B1BC 1OW6A 3EGXA 4YL3A 3J06A 1T9KA 3VAYA 4FWVA 2OQMA 2XLDA 3UGPA 5KYUA 3RFYA 1E2XA 4L6RA 2UUHA 2H7OA 5CI8A 4BJ6A 4CX9A 2R7TA 2D4UA 2HJMA 2YQYA 1FFTC 2BC5A 3VM6A 1A0BA 2FAPB 4CDAA 3RQGA 5E3AA 4DVZA 4W8KA 1MMAA 4YN0B 2WVOA 4HE8D 5B3IA 4E17A 2CDQA 2Z15A 2XL4A 1EA8A 2BL2A 3O6XA 5EK0A 2KK1A 3JTLO 4DVYP 4Q5SF 3WAQA 3HLZA 2P7VA 2X51A 4WJ0A 3GEHA 1YA7O 1I5NA 3EG9A 4A4AA 3RQEA 5IY5C 1HW1A 2H7VC 1MMNA 2YHSA 3K1IA 4FAPB 4XLPF 3MLGA 1ST6A 3NYJA 4NQFA 1ZW3A 2XSEA 5L0FA 2Y3HA 1QVXA 1U89A 2HSQA 3DE9A 1I4ZA 1AUEA 3R2PA 4CS9C 2LD6A 3GEEA 2I8BA 4N6CA 5A6AA 3B0UX 2WVNA 3EFOA 3JSEO 1U6HA 1K04A 2R7WA 2QE9A 3LS1A 3RF3A 1QSPA 3LUTB 2R7VA 2HKVA 1TKNA 1RJ9B 3SXKA 4I1MA 3V5ZA 3NMKA 3I5QA 3RKOF 3EHMA 3ZQVA 2J7PA 3H65A 4CSAC 5L3VA 5KYXA 3MFNA 1JR8A 2LFFA 2XM4A 1NZEA 2YKZA 5L0GA 3DM9B 3O39A 3DI5A 3K6BA 3M4BA 4JRZA 5D92A 2A68F 3E9VA 4MVRA 1GS9A 2ZXPA 3U9JA 5EGYA 5EHHA 3K33A 4EUKB 3BRJA 5L0DA 4BEMJ 2XLWA 2L81A 3US6A 3M1CB 4JEAA 1SYQA 2ZXOA 5T3TA 1Q0KA 1B68A 5F28E 2VCAA 1J8MF 2WZGA 3HTKC 4MTFA 4OIQF 4E18A 4G7OF 2HV7A 2ZXRA 3DMDA 4JJGA 4ULVA 4JE9A 2A1DD 4IGGA 3X2QC 4K0DA 4EHPA 3W8HA 4PFOA 4MVOA 3L0IA 4MVUA 1OCZC 3G4XA 3JZ0A 2M4EA 1LI7A 2C03A 5COFA 2XM0A 2R7RA 5L0JA 2XXAA 4JTCB 2NUPB 4MVZA 1E85A 4OIOF 4HFKB 3AQCA 2NSGA 1YJGA 4WABA 2R7OA 4YT2A 4BJ1A 2YVKA 2R05A 2ETSA 4H54A 1TFOB 1D0XA 4LDKA 2G62A 3JCUQ 1IZMA 1M56C 4CIHA 1G4WR 2GAQA 1QQ3A 3NMJA 2CNWD 3JT1A 3Q6MA 2I15A 2PFDA 2G3VA 2M64A 3FVYA 3GM2A 4I44A 4U5GA 4G78A 3TD7A 1UFBA 1R5ID 1G4US 2J9UA 3K7DA 1YA9A 1YLMA 3U3FA 3TOMA 3AG3C 2AVKA 1LE4A 1D0ZA 1Y6DA 1OQCA 3LEOA 2JD3A 1CGME 3H2VA 1SR2A 3DE8A 4DOZA 1ZHXA 2EINC 3LS0A 2Q7RA 5A6JA 3NRHA 3L8JA 3SZRA 3M4CA 4MW8A 1ZU5A 1FR0A 3ZQYA 2OJQA 4NTAA 2R02A 3GORA 2PNOA 2Y3GA 3U5SA 2B0HA 3PDMP 1H6GA 1CGNA 1KU2A 1OW7A 2EPLX 2VB6A 4KBLA 2J45A 1V4AA 1VLTA 3IQTA 2JX0A 2NUTB 3O55A 4R32A 3RQFA 4CS8C 4EBBA 5KYUB 4DXWA 2XLEA 1NU7D 1M6TA 2Y3DA 1N1CA 1YZAA 4XTKA 1MNEA 4OIRF 4DJ9A 2WVQA 2QTVA 1ZZPA 3FXHA 3EPVA 1QPUA 4KNVA 3QZCA 3BEHA 3TULA 2GA0A 1YAUO 3EH1A 5DVWA 4U5BE 4E7SA 3RVZA 1JOGA 2A0BA 1E86A 3G4ZA 1VLSA 1YDIA 2MWQA 4JTAB 5F5HA 4E0HA 1DOWA 1IW7F 2J9BA 4YT8A 5A69A 2VH3A 2XRHA 5KYNA 3DKAA 1LPEA 4P9FA 4ANJA 4MVMA 2R7XA 2GWWA 3AGUA 5KYWA 4C7OA 1H7IA 3A11A 2OEXA 5DQTA 1HY5A 1E83A 2OOCA 3DM5A 1Q0GA 2KYHA 4H4KC 3S84A 4MQ9F 2AWYA 1T01A 1SF8A 3B29A 4CIPA 4CS9A 4O6NA 4JURI 4P9TA 2YL3A 2PF4E 3L34A 4U9DA 5B1AC 3RYLA 1KNYA 2PX0A 1Z6AA 4O7GA 5KYXB 1Z7Qc 3W8IA 4EKWA 3PMRA 3HKKA 4O6MA 1C03A 3DAFA 3OA1A 4A2NB 2D5RB 4BPMA 2W45A 5JS5A 4OD5A 3GWLA 3K1HA 1JPJA 1UG7A 1SZIA 2EIKC 5AC5A 3NDBB 1ZYRF 4CSAA 4DRJB 3ZDLA 2P1AA 4IJJA 2GFHA 1L7CA 1OXBA 2PX3A 3NKEA 4QI0A 2YRFA 3G50A 2NG1A 2QLAA 1RKEA 1O3UA 3T9OA 5T1DB 2LSEA 3QVZA 1VB5A 2HV6A 4AE4B 1NLXA 1VMAA 4DBQA 2HFIA 4KI2A 3CZ6A 3SEOA 3RVYA 2VASA 5A6BD 3ITFA 3T6BA 2EIJC 4NCQA 3JRTA 1C17M 4ER9A 3SXMA 2Q9BA 1V55C 1ZVZA 4IWBA 3LNMB 4JEBA 4U5CE 2F22A 3AG1C 2QUPA 4QI2A 3EJNA 3JYYA 4CBEA 4D4XA 2TMVP 1V54C 3TJ5A 1PD1A 3C8ZA 1BR4A 3B0VC 1H9TA 4NC3A 2L6GA 3SP1A 4BJ6C 1XZQA 3M15A 3U3BA 5K0IA 1Z5ZA 5CIVA 3MX3A 1VTMP 5L0CA 5KYYB 2XS8A 2IXPA 3LESA 1JMWA 4LLEA 2ICWG 1KTMA 1TWAA 1S7ZA 4LLCA 2DYSC 3ECSA 4YT4A 3POVA 1F1MA 3DD7A 3V5YA 1PD0A 1LKXA 3HNIA 4IRUA 4MNDA 3CEXA 2KC3A 2EIMC 4YL1A 1RKCA 1W2WA 3QMKA 3GODA 2IXMA 5AC4A 2H8AA 1ZW2A 1QKRA 5DQZA 3CSKA 4JJFA 5HV9A 4Q4ZF 4D4NA 1ZHTA 4XPXA 2V3CC 3NYLA 5TJ5E 3T6JA 3ATPA 1BDJB 1ZHWA 2NPUA 2Y69C 1A41A 4M63A 3PCVA 4MTOA 2HMZA 4DRHB 5A6KA 1Z63A 3O10A 1O87A 5DS4A 3GWNA 3V7OA 1M57C 4XWJA 3R7CA 3W4YA 3W2VA 3ZG1A 3L1MA 1MNDA 4U5HA 3ZIBA 5BUOA 2VCBA 3SYNA 2CNWA 1RMVA 1GGQA 4LERA 5D91A 2XXAB 5JP7A 2AP3A 2G3KA 3IHUA 2RSEB 3ABMC 3TOLA 2CYDA 2J9WA 3EGDB 3FDQA 1LVKA 3IQCA 3ASNC 1RJ9A 3DXJF 4EIYA 3EZHA 3U9MA 4O79A 4YK5A 2OKUA 2AWCA 5GPGB 3AGTA 1M2VB 1WASA 1WOLA 2OJED 2YEVA 4LDRA 4WGYA 1EQ1A 2Y3BA 2J8WA 3KPHA 4CS8A 4C3EA 1PV3A 3C8GB 2YWAA 3FHDA 1NG1A 3U2LA 3FAJA 1M2OA 2KNHA 4JKVA 3W2WA 2R03A 2R7SA 1BR1A 2J46A 2HS5A 2HUJA 4LDQA 3UMHA 4F4BA 2V26A 5JVEA 4JCHA 1MMDA 3FOPA 4FESA 4U5DE 4K1OA 5HSWA 4LACB 3DJNB 2B0JA 2LK4A 4J30B 2P6VA 1APCA 3EGXB 1HW2A 4HEAJ 3WODF 2NSFA 4Z9JA 5BQGA 4NTFA 2WZFA 1T5OA 5BQIA 3WHNA 4P6IC 3KKBA 2HJ3A 2L9JA 4MW3A 4WGZA 4XEFA 3ZWIA 2KJGA 3NKDA 1OCCC 4QDLA 1YYJA 2CW0F 3OWTA 1NFNA 1TQGA 3QTHA 4G0HA 1EI7A 1BBHA 1AEPA 2A6HF 1SMYF 1LIHA 2DI3A 1S05A 2MHRA 3EHNA 4IAOA 4YJWA 4IAQA 5JSLA 4GEHA 4OINF 3TQOA 3WG7C 1GM5A 2NUPA 3NG1A 2R7UA 3ZC4A 5JT4A 3S27A 5JRAA 3F46A 1FMVA 1NFOA 1D1AA 3EG9B 3RW0A 3JYHA 2IXOA 2DB4A 4RBNA 3FMSA 2J0WA 2Q9CA 4C3DA 1Y4CA 4OIPF 3ZVRA 3U2MA 1NU9C 2XLVA 3LLIA 1DOVA 1VOMA 2LFDA 1CPRA 1O5HA 2OCCC 3S0XA 1ORJA 4EBKA 3IEEA 5L0IA 2XL8A 1I4YA 3EFOB 3NYMA 4Z9HA 2ZD9A 4U5EE 1EKYA 3T4RA 2Q3TA 3S29A 1OKKD 4E0IA 3AG4C 2OEVA 4FX5A 4U5FE 2YL1A 4XPWA 4BJ5C 1E84A 3DWWA 2KGOA 1PCXA 3C8GD 3DJUB 1D1CA 3KH2A 3Q6NA 2R25A 4MTGA 1JPNA 5BQHA 1T6IA 4XQ1A 3DAGA 4YT5A 3C18A 3L8IA 3LJBA 4AX2A 1TWHA 3HNLA 1FNTc 2WB7A 1LM3B 3HJCA 3LAYA 3C7JA 2OG2A 4HFFB 1TFKB 2KW3C 4PR9A 3IQ6A 3AQBA 2LIGA 4KC9A 2NUTA 2IYLD 2YZSA 4U9EA 2A69F 5E33A 2X0CA 4CJGA 3B0PA 3U8PA 3MYIA 4XEKA 2UUIA 5FCLA 4W8PA 5A6BA 4MVSA 1ZHZA 3EQLF 2JPUA 4N06A 1AVOB 1MMGA 1QZXA 3SXZA 3C63A 4G7ZF 2MYSA 2DYRC 4GQHA 2E87A 2IXNA 3AOUA 1LI5A 5FZTA 5JUAA 5DS5A 3HNJA 4PACA 2DGJA 1TWCA 4KNWA 1CGOA 1RXQA 5F5FA 3ZTMA 3CQZA 3GANA 3FAPB 2O9XA 4YWQA 2Q4FA 5E3CA 1XZPA 5T3WA 1JAFA 2YL7A 4AL1A 2YLDA 3N0TA 5E2QA 4JIOA 2W9YA 3MYFA 1YVIA 3B9QA 2EPMX 1YARO 3LNRA 1FTSA 3KYIA 2A6EF 1GQAA 1JRAA 3M79A 4YL0A 4GYTA 5DLJA 4CDYA 1HMDA 4DBRA 1VYIA 3TK0A 1C02A 3ABKC 3KL4A 3SNHA 2YL0A 5COGA 3TJ6A 2BE5F 4CDVA 3E70C 2HZ8A 2J7PD 2VC9A 3K1IC 3N2ZB 4JCZA 4Q7CA 1Z3IX 2KQ9A 3X1OA 4UDVA 2FGYA 1T6QA 3SXYA 1LS1A 3T6GB 1OR2A 4XLNF 4RDAA 4BJTA 1QLEC 1LE2A 4X0RA 2GDCA 4PK4A 3V5XA 2L6HA 3JSZA 3A9CA 5AGFA 4E7ZA 2A0UA 2J0XA 4IB4A 1Z23A 1XWJA 3GEIA 3IQ5A 4MVQA 4N6HA 3EZIA 3I4UA 2PP4A 3RIPA 256BA 2LP4A 3H2UA 3K66A 3N24A 2LQGA 2P0NA 4AE4A 1Q0MA 2L6FA 1YYXA 2PBEA 3C62A 4JZAA 3VF0A 3HNKA 1R4TA 2H7BA 4MS2A 1H9GA 1G5ZA 3UMIA 3ZTZA 1WTYA 2XLHA 1HE9A 3PHF2 3GM1A 1CPQA 4PJMA 2RD9A 3U8VA 4I3MA 4CJOA 1BR2A 1J8YF 3JRMO 4BEJA 4G7HF 3Q7LA 1LS4A 4PJLA 3QW1A 2XLMA 1A7EA 3UMKA 1VK5A 5L0HA 3S9OA 2XL6A 3AG2C 1BZ4A 3U0CA 3Q7GA 1A7DA 4O6YA 1WATA 1K05A 1V74B 1WWPA 1L3PA 4DRIB 1OXKA 3UR3C 5KYYA 4K7BA 4N4WA 5JLIA 4PFPA 2EPOA 1OR3A 4ONSA 2CGEA 2Q9AA 2Y39A 1Q0DA 1ORSC 1ZU4A 1TWGA 2YLGA 3AJMA 2XS1A 4J7TA
chains in the Genus database with same CATH topology
1T6IA 1Q0GA 4NCQA 3G4ZA 1Q0DA 1Q0FA 1T6UA 3G4XA 1T6QA 3G50A 1Q0KA 1Q0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T6I A;  1Q0G A;  4NCQ A;  3G4Z A;  1Q0D A;  1Q0F A;  1T6U A;  3G4X A;  1T6Q A;  3G50 A;  1Q0K A;  1Q0M A; 
#chains in the Genus database with same CATH topology
 2R9R B;  5CI9 A;  2P61 A;  1ZHY A;  1OCO C;  4J7Y A;  4AK9 A;  4XEV A;  1D1B A;  1VYK A;  2EIL C;  2WZL A;  3KMI A;  4JTD B;  4AL0 A;  4EWC A;  3NMI A;  2VCC A;  2YLI A;  2IOQ A;  3UNG C;  3UGO A;  4OD4 A;  3QVY A;  1FMW A;  2ASR A;  3EH2 A;  3MBG A;  3S28 A;  2IBF A;  2WL8 A;  4JVS A;  2QNL A;  2EPK X;  2ZPA A;  4ZLD A;  1T6U A;  5COM A;  4EBJ A;  1WGW A;  2QY9 A;  2L7A A;  4ZLC A;  1ORY A;  3S90 A;  2CCY A;  2EPN A;  1NBB A;  2IM8 A;  2XLO A;  4BJ5 A;  1D0Y A;  5L3Q A;  4RD9 A;  3OEO A;  3ASO C;  3B71 A;  2LCH A;  3F47 A;  5KYW B;  3KYJ A;  2W4B A;  2ZXW C;  1NSG B;  1U0B B;  3ABL C;  3CAX A;  4CS7 A;  3EGD A;  3LEV A;  4ULW A;  1RKE B;  2KSF A;  3ZSU A;  1OW8 A;  3GM3 A;  4JC7 A;  2Q00 A;  4Z9I A;  2FFH A;  2C04 A;  3IPM O;  4XPY A;  1OKK A;  1M2V A;  1WN0 A;  4IAR A;  1RCP A;  4NY3 A;  4C3B A;  2HMQ A;  5DS6 A;  3FOO A;  4PJJ A;  4C7O B;  4BG0 A;  2R7Q A;  3C8G A;  3LLK A;  1K40 A;  3RH3 A;  1HE1 A;  1A7V A;  1HMO A;  2HSB A;  4NTB A;  3VYW A;  3I5P A;  1FFH A;  3DZA A;  5B3S C;  1OCR C;  3QW0 A;  1MQV A;  4JW1 A;  1FAP B;  2W4M A;  2AU5 A;  1YZC A;  2J9V A;  4J32 B;  1Q0F A;  4PJN A;  4I1O B;  4B6I A;  2OU6 A;  1TR2 A;  3VRC A;  1G8X A;  5B1B C;  1OW6 A;  3EGX A;  4YL3 A;  3J06 A;  1T9K A;  3VAY A;  4FWV A;  2OQM A;  2XLD A;  3UGP A;  5KYU A;  3RFY A;  1E2X A;  4L6R A;  2UUH A;  2H7O A;  5CI8 A;  4BJ6 A;  4CX9 A;  2R7T A;  2D4U A;  2HJM A;  2YQY A;  1FFT C;  2BC5 A;  3VM6 A;  1A0B A;  2FAP B;  4CDA A;  3RQG A;  5E3A A;  4DVZ A;  4W8K A;  1MMA A;  4YN0 B;  2WVO A;  4HE8 D;  5B3I A;  4E17 A;  2CDQ A;  2Z15 A;  2XL4 A;  1EA8 A;  2BL2 A;  3O6X A;  5EK0 A;  2KK1 A;  3JTL O;  4DVY P;  4Q5S F;  3WAQ A;  3HLZ A;  2P7V A;  2X51 A;  4WJ0 A;  3GEH A;  1YA7 O;  1I5N A;  3EG9 A;  4A4A A;  3RQE A;  5IY5 C;  1HW1 A;  2H7V C;  1MMN A;  2YHS A;  3K1I A;  4FAP B;  4XLP F;  3MLG A;  1ST6 A;  3NYJ A;  4NQF A;  1ZW3 A;  2XSE A;  5L0F A;  2Y3H A;  1QVX A;  1U89 A;  2HSQ A;  3DE9 A;  1I4Z A;  1AUE A;  3R2P A;  4CS9 C;  2LD6 A;  3GEE A;  2I8B A;  4N6C A;  5A6A A;  3B0U X;  2WVN A;  3EFO A;  3JSE O;  1U6H A;  1K04 A;  2R7W A;  2QE9 A;  3LS1 A;  3RF3 A;  1QSP A;  3LUT B;  2R7V A;  2HKV A;  1TKN A;  1RJ9 B;  3SXK A;  4I1M A;  3V5Z A;  3NMK A;  3I5Q A;  3RKO F;  3EHM A;  3ZQV A;  2J7P A;  3H65 A;  4CSA C;  5L3V A;  5KYX A;  3MFN A;  1JR8 A;  2LFF A;  2XM4 A;  1NZE A;  2YKZ A;  5L0G A;  3DM9 B;  3O39 A;  3DI5 A;  3K6B A;  3M4B A;  4JRZ A;  5D92 A;  2A68 F;  3E9V A;  4MVR A;  1GS9 A;  2ZXP A;  3U9J A;  5EGY A;  5EHH A;  3K33 A;  4EUK B;  3BRJ A;  5L0D A;  4BEM J;  2XLW A;  2L81 A;  3US6 A;  3M1C B;  4JEA A;  1SYQ A;  2ZXO A;  5T3T A;  1Q0K A;  1B68 A;  5F28 E;  2VCA A;  1J8M F;  2WZG A;  3HTK C;  4MTF A;  4OIQ F;  4E18 A;  4G7O F;  2HV7 A;  2ZXR A;  3DMD A;  4JJG A;  4ULV A;  4JE9 A;  2A1D D;  4IGG A;  3X2Q C;  4K0D A;  4EHP A;  3W8H A;  4PFO A;  4MVO A;  3L0I A;  4MVU A;  1OCZ C;  3G4X A;  3JZ0 A;  2M4E A;  1LI7 A;  2C03 A;  5COF A;  2XM0 A;  2R7R A;  5L0J A;  2XXA A;  4JTC B;  2NUP B;  4MVZ A;  1E85 A;  4OIO F;  4HFK B;  3AQC A;  2NSG A;  1YJG A;  4WAB A;  2R7O A;  4YT2 A;  4BJ1 A;  2YVK A;  2R05 A;  2ETS A;  4H54 A;  1TFO B;  1D0X A;  4LDK A;  2G62 A;  3JCU Q;  1IZM A;  1M56 C;  4CIH A;  1G4W R;  2GAQ A;  1QQ3 A;  3NMJ A;  2CNW D;  3JT1 A;  3Q6M A;  2I15 A;  2PFD A;  2G3V A;  2M64 A;  3FVY A;  3GM2 A;  4I44 A;  4U5G A;  4G78 A;  3TD7 A;  1UFB A;  1R5I D;  1G4U S;  2J9U A;  3K7D A;  1YA9 A;  1YLM A;  3U3F A;  3TOM A;  3AG3 C;  2AVK A;  1LE4 A;  1D0Z A;  1Y6D A;  1OQC A;  3LEO A;  2JD3 A;  1CGM E;  3H2V A;  1SR2 A;  3DE8 A;  4DOZ A;  1ZHX A;  2EIN C;  3LS0 A;  2Q7R A;  5A6J A;  3NRH A;  3L8J A;  3SZR A;  3M4C A;  4MW8 A;  1ZU5 A;  1FR0 A;  3ZQY A;  2OJQ A;  4NTA A;  2R02 A;  3GOR A;  2PNO A;  2Y3G A;  3U5S A;  2B0H A;  3PDM P;  1H6G A;  1CGN A;  1KU2 A;  1OW7 A;  2EPL X;  2VB6 A;  4KBL A;  2J45 A;  1V4A A;  1VLT A;  3IQT A;  2JX0 A;  2NUT B;  3O55 A;  4R32 A;  3RQF A;  4CS8 C;  4EBB A;  5KYU B;  4DXW A;  2XLE A;  1NU7 D;  1M6T A;  2Y3D A;  1N1C A;  1YZA A;  4XTK A;  1MNE A;  4OIR F;  4DJ9 A;  2WVQ A;  2QTV A;  1ZZP A;  3FXH A;  3EPV A;  1QPU A;  4KNV A;  3QZC A;  3BEH A;  3TUL A;  2GA0 A;  1YAU O;  3EH1 A;  5DVW A;  4U5B E;  4E7S A;  3RVZ A;  1JOG A;  2A0B A;  1E86 A;  3G4Z A;  1VLS A;  1YDI A;  2MWQ A;  4JTA B;  5F5H A;  4E0H A;  1DOW A;  1IW7 F;  2J9B A;  4YT8 A;  5A69 A;  2VH3 A;  2XRH A;  5KYN A;  3DKA A;  1LPE A;  4P9F A;  4ANJ A;  4MVM A;  2R7X A;  2GWW A;  3AGU A;  5KYW A;  4C7O A;  1H7I A;  3A11 A;  2OEX A;  5DQT A;  1HY5 A;  1E83 A;  2OOC A;  3DM5 A;  1Q0G A;  2KYH A;  4H4K C;  3S84 A;  4MQ9 F;  2AWY A;  1T01 A;  1SF8 A;  3B29 A;  4CIP A;  4CS9 A;  4O6N A;  4JUR I;  4P9T A;  2YL3 A;  2PF4 E;  3L34 A;  4U9D A;  5B1A C;  3RYL A;  1KNY A;  2PX0 A;  1Z6A A;  4O7G A;  5KYX B;  1Z7Q c;  3W8I A;  4EKW A;  3PMR A;  3HKK A;  4O6M A;  1C03 A;  3DAF A;  3OA1 A;  4A2N B;  2D5R B;  4BPM A;  2W45 A;  5JS5 A;  4OD5 A;  3GWL A;  3K1H A;  1JPJ A;  1UG7 A;  1SZI A;  2EIK C;  5AC5 A;  3NDB B;  1ZYR F;  4CSA A;  4DRJ B;  3ZDL A;  2P1A A;  4IJJ A;  2GFH A;  1L7C A;  1OXB A;  2PX3 A;  3NKE A;  4QI0 A;  2YRF A;  3G50 A;  2NG1 A;  2QLA A;  1RKE A;  1O3U A;  3T9O A;  5T1D B;  2LSE A;  3QVZ A;  1VB5 A;  2HV6 A;  4AE4 B;  1NLX A;  1VMA A;  4DBQ A;  2HFI A;  4KI2 A;  3CZ6 A;  3SEO A;  3RVY A;  2VAS A;  5A6B D;  3ITF A;  3T6B A;  2EIJ C;  4NCQ A;  3JRT A;  1C17 M;  4ER9 A;  3SXM A;  2Q9B A;  1V55 C;  1ZVZ A;  4IWB A;  3LNM B;  4JEB A;  4U5C E;  2F22 A;  3AG1 C;  2QUP A;  4QI2 A;  3EJN A;  3JYY A;  4CBE A;  4D4X A;  2TMV P;  1V54 C;  3TJ5 A;  1PD1 A;  3C8Z A;  1BR4 A;  3B0V C;  1H9T A;  4NC3 A;  2L6G A;  3SP1 A;  4BJ6 C;  1XZQ A;  3M15 A;  3U3B A;  5K0I A;  1Z5Z A;  5CIV A;  3MX3 A;  1VTM P;  5L0C A;  5KYY B;  2XS8 A;  2IXP A;  3LES A;  1JMW A;  4LLE A;  2ICW G;  1KTM A;  1TWA A;  1S7Z A;  4LLC A;  2DYS C;  3ECS A;  4YT4 A;  3POV A;  1F1M A;  3DD7 A;  3V5Y A;  1PD0 A;  1LKX A;  3HNI A;  4IRU A;  4MND A;  3CEX A;  2KC3 A;  2EIM C;  4YL1 A;  1RKC A;  1W2W A;  3QMK A;  3GOD A;  2IXM A;  5AC4 A;  2H8A A;  1ZW2 A;  1QKR A;  5DQZ A;  3CSK A;  4JJF A;  5HV9 A;  4Q4Z F;  4D4N A;  1ZHT A;  4XPX A;  2V3C C;  3NYL A;  5TJ5 E;  3T6J A;  3ATP A;  1BDJ B;  1ZHW A;  2NPU A;  2Y69 C;  1A41 A;  4M63 A;  3PCV A;  4MTO A;  2HMZ A;  4DRH B;  5A6K A;  1Z63 A;  3O10 A;  1O87 A;  5DS4 A;  3GWN A;  3V7O A;  1M57 C;  4XWJ A;  3R7C A;  3W4Y A;  3W2V A;  3ZG1 A;  3L1M A;  1MND A;  4U5H A;  3ZIB A;  5BUO A;  2VCB A;  3SYN A;  2CNW A;  1RMV A;  1GGQ A;  4LER A;  5D91 A;  2XXA B;  5JP7 A;  2AP3 A;  2G3K A;  3IHU A;  2RSE B;  3ABM C;  3TOL A;  2CYD A;  2J9W A;  3EGD B;  3FDQ A;  1LVK A;  3IQC A;  3ASN C;  1RJ9 A;  3DXJ F;  4EIY A;  3EZH A;  3U9M A;  4O79 A;  4YK5 A;  2OKU A;  2AWC A;  5GPG B;  3AGT A;  1M2V B;  1WAS A;  1WOL A;  2OJE D;  2YEV A;  4LDR A;  4WGY A;  1EQ1 A;  2Y3B A;  2J8W A;  3KPH A;  4CS8 A;  4C3E A;  1PV3 A;  3C8G B;  2YWA A;  3FHD A;  1NG1 A;  3U2L A;  3FAJ A;  1M2O A;  2KNH A;  4JKV A;  3W2W A;  2R03 A;  2R7S A;  1BR1 A;  2J46 A;  2HS5 A;  2HUJ A;  4LDQ A;  3UMH A;  4F4B A;  2V26 A;  5JVE A;  4JCH A;  1MMD A;  3FOP A;  4FES A;  4U5D E;  4K1O A;  5HSW A;  4LAC B;  3DJN B;  2B0J A;  2LK4 A;  4J30 B;  2P6V A;  1APC A;  3EGX B;  1HW2 A;  4HEA J;  3WOD F;  2NSF A;  4Z9J A;  5BQG A;  4NTF A;  2WZF A;  1T5O A;  5BQI A;  3WHN A;  4P6I C;  3KKB A;  2HJ3 A;  2L9J A;  4MW3 A;  4WGZ A;  4XEF A;  3ZWI A;  2KJG A;  3NKD A;  1OCC C;  4QDL A;  1YYJ A;  2CW0 F;  3OWT A;  1NFN A;  1TQG A;  3QTH A;  4G0H A;  1EI7 A;  1BBH A;  1AEP A;  2A6H F;  1SMY F;  1LIH A;  2DI3 A;  1S05 A;  2MHR A;  3EHN A;  4IAO A;  4YJW A;  4IAQ A;  5JSL A;  4GEH A;  4OIN F;  3TQO A;  3WG7 C;  1GM5 A;  2NUP A;  3NG1 A;  2R7U A;  3ZC4 A;  5JT4 A;  3S27 A;  5JRA A;  3F46 A;  1FMV A;  1NFO A;  1D1A A;  3EG9 B;  3RW0 A;  3JYH A;  2IXO A;  2DB4 A;  4RBN A;  3FMS A;  2J0W A;  2Q9C A;  4C3D A;  1Y4C A;  4OIP F;  3ZVR A;  3U2M A;  1NU9 C;  2XLV A;  3LLI A;  1DOV A;  1VOM A;  2LFD A;  1CPR A;  1O5H A;  2OCC C;  3S0X A;  1ORJ A;  4EBK A;  3IEE A;  5L0I A;  2XL8 A;  1I4Y A;  3EFO B;  3NYM A;  4Z9H A;  2ZD9 A;  4U5E E;  1EKY A;  3T4R A;  2Q3T A;  3S29 A;  1OKK D;  4E0I A;  3AG4 C;  2OEV A;  4FX5 A;  4U5F E;  2YL1 A;  4XPW A;  4BJ5 C;  1E84 A;  3DWW A;  2KGO A;  1PCX A;  3C8G D;  3DJU B;  1D1C A;  3KH2 A;  3Q6N A;  2R25 A;  4MTG A;  1JPN A;  5BQH A;  1T6I A;  4XQ1 A;  3DAG A;  4YT5 A;  3C18 A;  3L8I A;  3LJB A;  4AX2 A;  1TWH A;  3HNL A;  1FNT c;  2WB7 A;  1LM3 B;  3HJC A;  3LAY A;  3C7J A;  2OG2 A;  4HFF B;  1TFK B;  2KW3 C;  4PR9 A;  3IQ6 A;  3AQB A;  2LIG A;  4KC9 A;  2NUT A;  2IYL D;  2YZS A;  4U9E A;  2A69 F;  5E33 A;  2X0C A;  4CJG A;  3B0P A;  3U8P A;  3MYI A;  4XEK A;  2UUI A;  5FCL A;  4W8P A;  5A6B A;  4MVS A;  1ZHZ A;  3EQL F;  2JPU A;  4N06 A;  1AVO B;  1MMG A;  1QZX A;  3SXZ A;  3C63 A;  4G7Z F;  2MYS A;  2DYR C;  4GQH A;  2E87 A;  2IXN A;  3AOU A;  1LI5 A;  5FZT A;  5JUA A;  5DS5 A;  3HNJ A;  4PAC A;  2DGJ A;  1TWC A;  4KNW A;  1CGO A;  1RXQ A;  5F5F A;  3ZTM A;  3CQZ A;  3GAN A;  3FAP B;  2O9X A;  4YWQ A;  2Q4F A;  5E3C A;  1XZP A;  5T3W A;  1JAF A;  2YL7 A;  4AL1 A;  2YLD A;  3N0T A;  5E2Q A;  4JIO A;  2W9Y A;  3MYF A;  1YVI A;  3B9Q A;  2EPM X;  1YAR O;  3LNR A;  1FTS A;  3KYI A;  2A6E F;  1GQA A;  1JRA A;  3M79 A;  4YL0 A;  4GYT A;  5DLJ A;  4CDY A;  1HMD A;  4DBR A;  1VYI A;  3TK0 A;  1C02 A;  3ABK C;  3KL4 A;  3SNH A;  2YL0 A;  5COG A;  3TJ6 A;  2BE5 F;  4CDV A;  3E70 C;  2HZ8 A;  2J7P D;  2VC9 A;  3K1I C;  3N2Z B;  4JCZ A;  4Q7C A;  1Z3I X;  2KQ9 A;  3X1O A;  4UDV A;  2FGY A;  1T6Q A;  3SXY A;  1LS1 A;  3T6G B;  1OR2 A;  4XLN F;  4RDA A;  4BJT A;  1QLE C;  1LE2 A;  4X0R A;  2GDC A;  4PK4 A;  3V5X A;  2L6H A;  3JSZ A;  3A9C A;  5AGF A;  4E7Z A;  2A0U A;  2J0X A;  4IB4 A;  1Z23 A;  1XWJ A;  3GEI A;  3IQ5 A;  4MVQ A;  4N6H A;  3EZI A;  3I4U A;  2PP4 A;  3RIP A;  256B A;  2LP4 A;  3H2U A;  3K66 A;  3N24 A;  2LQG A;  2P0N A;  4AE4 A;  1Q0M A;  2L6F A;  1YYX A;  2PBE A;  3C62 A;  4JZA A;  3VF0 A;  3HNK A;  1R4T A;  2H7B A;  4MS2 A;  1H9G A;  1G5Z A;  3UMI A;  3ZTZ A;  1WTY A;  2XLH A;  1HE9 A;  3PHF 2;  3GM1 A;  1CPQ A;  4PJM A;  2RD9 A;  3U8V A;  4I3M A;  4CJO A;  1BR2 A;  1J8Y F;  3JRM O;  4BEJ A;  4G7H F;  3Q7L A;  1LS4 A;  4PJL A;  3QW1 A;  2XLM A;  1A7E A;  3UMK A;  1VK5 A;  5L0H A;  3S9O A;  2XL6 A;  3AG2 C;  1BZ4 A;  3U0C A;  3Q7G A;  1A7D A;  4O6Y A;  1WAT A;  1K05 A;  1V74 B;  1WWP A;  1L3P A;  4DRI B;  1OXK A;  3UR3 C;  5KYY A;  4K7B A;  4N4W A;  5JLI A;  4PFP A;  2EPO A;  1OR3 A;  4ONS A;  2CGE A;  2Q9A A;  2Y39 A;  1Q0D A;  1ORS C;  1ZU4 A;  1TWG A;  2YLG A;  3AJM A;  2XS1 A;  4J7T A; 
#chains in the Genus database with same CATH homology
 1T6I A;  1Q0G A;  4NCQ A;  3G4Z A;  1Q0D A;  1Q0F A;  1T6U A;  3G4X A;  1T6Q A;  3G50 A;  1Q0K A;  1Q0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...