1Q0MA

Crystal structure of ni-containing superoxide dismutase with ni-ligation corresponding to the state after full x-ray-induced reduction
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
117
structure length
117
Chain Sequence
HCDLPCGVYDPAQARIEAESVKAIQEKMAANDDLHFQIRATVIKEQRAELAKHHLDVLWSDYFKPPHFESYPELHTLVNEAVKALSAAKASTDPATGQKALDYIAQIDKIFWETKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of nickel-containing superoxide dismutase reveals another type of active site
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Ni]
total genus 52
structure length 117
sequence length 117
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2003-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.400 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nickel-containing superoxide dismutase 1q0mA00
3G4XA 1Q0KA 3G50A 1Q0DA 1T6UA 1T6IA 4NCQA 1T6QA 3G4ZA 1Q0GA 1Q0MA 1Q0FA
chains in the Genus database with same CATH superfamily
3FVYA 4OIQF 1OCZC 1W2WA 2XLOA 3DMDA 3FMSA 2NPUA 3UMIA 5JT4A 4R32A 2XLEA 2J0XA 4GEHA 2ZXOA 3UMKA 3EGXB 1MMDA 3DJNB 1JPNA 3SP1A 4MNDA 4O6MA 3U9MA 1D1AA 4LDKA 3FHDA 1SR2A 2GAQA 1QLEC 4LERA 4WGYA 3RVZA 1TQGA 3ZVRA 4YL1A 4GQHA 1G5ZA 2IBFA 2VB6A 2EPKX 1E2XA 2FFHA 1ST6A 4ANJA 1VTMP 4JE9A 3R2PA 3MFNA 3RF3A 3ZWIA 4AX2A 1VK5A 2YHSA 4C3DA 5D91A 2AU5A 4CS8C 4PACA 1D0YA 3F46A 2HJMA 3JT1A 4JJFA 2OEXA 5HSWA 2OOCA 1LKXA 3QW1A 1OCCC 3C7JA 2EIMC 4WGZA 3V7OA 1CPQA 2HMZA 5E3CA 3ZIBA 2XSEA 3NDBB 3K66A 3ABMC 1K04A 2NUTB 2NUPA 3JRMO 4BEJA 2BL2A 2J45A 2XRHA 2DI3A 4JTDB 4A4AA 2YL3A 4J7YA 1SF8A 4CIHA 3RYLA 5B3IA 5L0DA 3ZTMA 4B6IA 2HFIA 1FFTC 3SZRA 4BPMA 1Q0GA 5JUAA 4MVQA 4WJ0A 1WOLA 5BQIA 1SZIA 1VYKA 3BRJA 1HE9A 3TJ6A 4J32B 3J06A 2EIKC 3TD7A 4EBJA 3R7CA 4XPXA 1AUEA 3M4BA 1BZ4A 4Q7CA 2CDQA 2JD3A 3C62A 2AWCA 2E87A 4D4NA 2AWYA 2XXAB 5CI8A 2J7PA 4JCHA 3QTHA 4G78A 3NKEA 2D5RB 4CS8A 1TFOB 4PK4A 3U2MA 1RKEA 4IB4A 3I4UA 4DXWA 2LCHA 2OKUA 4C7OB 2R9RB 1T6QA 3O55A 3S27A 4GYTA 5B1BC 1FTSA 3AG4C 2DYSC 1CPRA 4K7BA 3EH1A 4IAQA 1OR3A 4RD9A 4QDLA 3S84A 1JR8A 3CEXA 1Z6AA 3EG9B 5KYUB 3ZDLA 3FAJA 1ZHZA 3FXHA 4IARA 4N6HA 1ZHTA 3MYFA 5L0GA 2PX3A 3EHMA 1CGOA 4MTOA 3NMKA 3DKAA 5KYNA 1O3UA 4ULWA 4BJ1A 1E86A 1T5OA 2OJED 5HV9A 3JCUQ 3N2ZB 2B0JA 4EKWA 5L0FA 1ZW2A 1JMWA 1YAUO 1H9TA 5T1DB 3DE9A 4QI2A 3I5PA 1G4US 3NMIA 3GM1A 4MVSA 2HUJA 1VB5A 5F5FA 4E0HA 3ZQVA 3CZ6A 1YZCA 1ZYRF 1RXQA 3EJNA 3MLGA 3DAFA 1OCOC 3PMRA 1Q0FA 3LESA 4RBNA 4YL3A 1GS9A 4HFFB 1ZHYA 3CQZA 3IQCA 2MYSA 2WZLA 2G62A 3KL4A 3LS0A 1S05A 1WTYA 2ICWG 2NUTA 3RQEA 4L6RA 4CIPA 1YARO 3Q6MA 1A7DA 4ER9A 4JW1A 4YN0B 3ZC4A 1KNYA 1V54C 5A6AA 3RFYA 1OW6A 3U3BA 1JAFA 2ETSA 3JYHA 3V5YA 2KK1A 2HJ3A 3POVA 2J9VA 3K1IC 4F4BA 4JC7A 3IHUA 5T3WA 2A0UA 4PJMA 1E85A 2UUHA 3MYIA 4XLNF 3C18A 2P6VA 4DRJB 1LM3B 3EQLF 1MNEA 2YQYA 4JURI 3HLZA 1VLSA 1KTMA 4BJ6A 3KPHA 5EK0A 4LACB 1QVXA 3L0IA 4PR9A 2Q9AA 1Z3IX 4FWVA 4NCQA 4P6IC 4I1OB 4KNWA 3WAQA 4DRHB 1IW7F 3EZIA 1DOVA 1D0ZA 2VCAA 3DM9B 1NSGB 2BC5A 3ITFA 1ORYA 2Q00A 5KYXB 1K05A 2V26A 5BQHA 5FZTA 4WABA 3GM3A 4RDAA 4XEVA 5CI9A 4OD4A 2CCYA 2J8WA 2LK4A 3KH2A 1HMOA 2AVKA 3K7DA 2OJQA 3HTKC 3C8GD 4XEFA 5L0CA 2YKZA 2LD6A 4IGGA 2YL7A 5DVWA 2P61A 1TWGA 3EFOB 1M2VA 3LNRA 3US6A 3C8GA 3LAYA 1ZW3A 4MVOA 5F28E 1OQCA 3B0VC 2XXAA 2GWWA 4MVRA 4BJ5C 1I4YA 1R5ID 2C03A 3RQFA 2L7AA 4DJ9A 1CGME 4PJNA 2B0HA 3AG2C 3NKDA 4JKVA 1EKYA 2RSEB 4P9FA 2R03A 1TFKB 3RVYA 2R7UA 3E9VA 4NTAA 1NFNA 4JTCB 1WGWA 2HS5A 3U5SA 1BDJB 1LI7A 3ECSA 4MS2A 1T6IA 3DD7A 3HNKA 3L8IA 1Z23A 2LFFA 2LQGA 4G7OF 5JLIA 2A6HF 3PCVA 4FESA 3O39A 2L6HA 3Q7LA 2H7VC 4QI0A 3X2QC 2H7OA 3RKOF 2YVKA 5BUOA 1E83A 3S0XA 3OWTA 2QLAA 1ZU5A 1G8XA 1A7VA 1N1CA 3U3FA 4JRZA 4IRUA 1YDIA 2A69F 3IEEA 1NBBA 1U89A 2HSBA 2XS1A 2I8BA 4U5BE 5IY5C 3TJ5A 2XL4A 1ORSC 1OXKA 4KNVA 1U6HA 4XPYA 1K40A 2IXNA 1LI5A 2EINC 2DB4A 2WZFA 1YA7O 2R7WA 3LNMB 5T3TA 5AC5A 1L3PA 3L1MA 2VCCA 3T6JA 2J9UA 4E7ZA 5KYWA 5JS5A 5CIVA 2F22A 4IJJA 2JX0A 2Y3DA 3FDQA 5EHHA 3AG3C 4JTAB 1XWJA 2WZGA 1NLXA 2A1DD 2CYDA 3H2VA 3OA1A 1L7CA 3W8HA 3S9OA 2QNLA 5GPGB 5FCLA 3AJMA 1YA9A 2CW0F 2NSFA 2J46A 1U0BB 5COMA 4KBLA 5KYWB 4Q5SF 4J7TA 1FMVA 2L9JA 4G0HA 3WG7C 2IXMA 4Z9HA 5K0IA 3F47A 1QSPA 2CGEA 4G7ZF 4JEAA 4H54A 1YZAA 4PFPA 2FGYA 1D1BA 3EGXA 3Q7GA 4NY3A 3U8PA 3SYNA 4HE8D 3S28A 2L6FA 3DJUB 256BA 2HMQA 4Z9JA 3W4YA 1XZQA 5COGA 2TMVP 4I1MA 5EGYA 2W4MA 2W45A 1T6UA 1RJ9A 2XLWA 2WB7A 4O6NA 3QVYA 3A9CA 1QKRA 1MMAA 1FMWA 1YLMA 4MW3A 1EA8A 4KC9A 1H9GA 5DS6A 1EQ1A 4U5FE 3T4RA 3H65A 1LIHA 2KW3C 2PFDA 3E70C 3IPMO 3UMHA 2KJGA 2NSGA 3V5XA 1Z63A 2HZ8A 3MX3A 3O10A 5L3VA 1VLTA 3N24A 1A0BA 1OR2A 1B68A 2VCBA 3VF0A 3M79A 4XEKA 2J0WA 1PD1A 3T9OA 1D0XA 2PNOA 3DZAA 4LDRA 2AP3A 3QZCA 4YT5A 3EG9A 1C03A 1DOWA 5B3SC 2YZSA 1RCPA 2RD9A 1Y4CA 3EFOA 4JEBA 4YT8A 3C8GB 1M56C 1YVIA 4YL0A 3TOMA 1TKNA 3U2LA 3SXMA 2EPMX 4YJWA 3AGUA 1FAPB 3W2VA 5JSLA 2O9XA 3ZTZA 2MHRA 3HNJA 2A6EF 4DBRA 5A6KA 3JTLO 4JIOA 3V5ZA 2XL6A 3ZQYA 2R7SA 3K1IA 3ABLC 4U5HA 2Q7RA 2PBEA 2YRFA 4PJLA 3SEOA 3HKKA 4BJ5A 3LEVA 4KI2A 1T01A 3T6BA 5BQGA 1SMYF 2KSFA 3SNHA 3EZHA 3LEOA 1O5HA 5F5HA 2VH3A 1CGNA 2X51A 2XM0A 2QTVA 3B0PA 2LP4A 3B29A 1V55C 2DGJA 1HE1A 3ASNC 1QPUA 3JSEO 2W4BA 2R02A 3NMJA 3W8IA 3BEHA 4W8KA 4DOZA 3B71A 3LLIA 1ZU4A 4XPWA 1KU2A 2QUPA 2Y69C 4PJJA 3AOUA 4LLCA 4G7HF 2W9YA 3AQCA 3I5QA 2Q3TA 2C04A 4XQ1A 1H6GA 4U5GA 5E3AA 4P9TA 2P0NA 2LFDA 2YEVA 1OW8A 1ZZPA 2G3KA 2R7QA 4JZAA 1RJ9B 4XTKA 4D4XA 2UUIA 3H2UA 3QW0A 2Q4FA 1M6TA 2KC3A 2YL0A 2ZXRA 3U9JA 3KYJA 4HFKB 1LVKA 1HMDA 4CX9A 5KYYB 4AE4B 1AEPA 4EBBA 3KMIA 5DQTA 4DBQA 1J8MF 4U5EE 1YYJA 3JSZA 3S29A 2Q9CA 2WVOA 5A69A 4MVZA 1M57C 2KNHA 3AQBA 3DI5A 3GANA 3N0TA 4YWQA 2GDCA 3CAXA 1I4ZA 3EGDA 3ZG1A 4K1OA 3K1HA 4BG0A 3DWWA 2IM8A 2Y39A 4E18A 2FAPB 4EHPA 1VYIA 4IAOA 2EPNA 3HNIA 3LS1A 2R7TA 4MQ9F 2BE5F 2KYHA 2Y3GA 2I15A 4HEAJ 1NZEA 2L81A 4CS9C 3ATPA 4C3EA 1M2VB 1JRAA 2WL8A 2J9WA 5L0IA 3KKBA 1UFBA 3C8ZA 1F1MA 4MVUA 4OINF 1NG1A 1UG7A 4BEMJ 4JVSA 2R7VA 1G4WR 1WATA 2EILC 1D1CA 1LE2A 1I5NA 1TWAA 2R05A 3Q6NA 1FR0A 2J7PD 1Z7Qc 1RKEB 2CNWA 2A68F 4EBKA 4C7OA 5DS5A 3SXKA 1JPJA 1V74B 1WWPA 1M2OA 4O6YA 5A6BD 2VC9A 1NFOA 2YLDA 3IQTA 3AG1C 1H7IA 2VASA 2PX0A 3GEHA 3LUTB 4YK5A 4CS7A 1NU9C 2M64A 3QMKA 1A41A 2GFHA 3A11A 4M63A 3G4ZA 2QY9A 4UDVA 4O7GA 1WN0A 2XLVA 3NYJA 4LLEA 5D92A 4A2NB 4X0RA 2WVNA 4FAPB 2R7OA 3K33A 3M15A 4E0IA 2NG1A 4MTFA 4N06A 3UNGC 1MNDA 2LSEA 1MQVA 3UR3C 5L0HA 2KQ9A 4N4WA 4J30B 2EPOA 2YL1A 3RH3A 4JJGA 3RQGA 1T9KA 3DE8A 2H7BA 3O6XA 1WASA 3SXZA 2YWAA 2ZD9A 2MWQA 1Q0MA 2A0BA 4CS9A 2IOQA 3DXJF 4YT2A 3FOOA 3G50A 3FOPA 4I3MA 4OIOF 2ZPAA 3LJBA 1TWCA 4W8PA 5E2QA 5JRAA 1FNTc 5DS4A 2ZXWC 3M4CA 3JRTA 4DVYP 2PP4A 4U5DE 3W2WA 2OQMA 2Y3HA 2XLHA 3EPVA 4XLPF 3PDMP 2R25A 1JOGA 1TR2A 1YJGA 3DM5A 1A7EA 4OD5A 4EUKB 4H4KC 5KYXA 5TJ5E 2V3CC 4Q4ZF 2EIJC 3GWNA 4XWJA 3M1CB 4K0DA 2GA0A 4ULVA 1BBHA 4MVMA 3T6GB 5KYYA 3PHF2 5AC4A 2EPLX 2XS8A 3WODF 3NRHA 3U0CA 4AL1A 1LE4A 3EGDB 1RMVA 3KYIA 4AL0A 2J9BA 3FAPB 1OKKA 1TWHA 3VAYA 3NYLA 1HW1A 2XM4A 1MMNA 4U9EA 1OKKD 3EHNA 3TK0A 1V4AA 5KYUA 3VYWA 1EI7A 1Q0DA 4CJOA 3GORA 1XZPA 3L8JA 4I44A 3DAGA 4PFOA 5AGFA 1AVOB 1O87A 1OCRC 3JYYA 4AE4A 1OW7A 1VMAA 4BJ6C 3S90A 2JPUA 2D4UA 1ZVZA 2IXOA 1Y6DA 2YLGA 5E33A 5DLJA 1LS1A 3GEEA 3QVZA 3C63A 4FX5A 4CDVA 1SYQA 4NTFA 1J8YF 3CSKA 2L6GA 4ONSA 5B1AC 1MMGA 2HV6A 1PD0A 1GQAA 1ZHXA 4U5CE 2OEVA 3GODA 3SXYA 1ZHWA 5COFA 4EIYA 2G3VA 3G4XA 4JCZA 3GM2A 5JP7A 3X1OA 3LLKA 1RKCA 4CSAA 1S7ZA 2CNWD 3GEIA 1FFHA 3MBGA 3ABKC 3NYMA 4E17A 3K6BA 4DVZA 2H8AA 3AGTA 2XL8A 4IWBA 4CDAA 1E84A 1C02A 2WVQA 4LDQA 2HSQA 4OIPF 3HJCA 4ZLDA 4MTGA 4ZLCA 2R7RA 3B0UX 2HKVA 2IXPA 1QZXA 2HV7A 2Z15A 3GWLA 4N6CA 3VRCA 4BJTA 4CDYA 1BR2A 4YT4A 1HY5A 3RW0A 2NUPB 3WHNA 1OXBA 5JVEA 3ASOC 1HW2A 4CSAC 2Q9BA 1YYXA 2X0CA 1BR1A 2DYRC 1PCXA 2OG2A 4Z9IA 4OIRF 4CJGA 4DRIB 3EH2A 2LIGA 5A6JA 3OEOA 1BR4A 4EWCA 2IYLD 4NTBA 2ZXPA 3VM6A 2P7VA 1ORJA 2ASRA 2Y3BA 2QE9A 4MW8A 3RIPA 1PV3A 3U8VA 4C3BA 1GGQA 2OCCC 1VOMA 3TQOA 1GM5A 3ZSUA 2PF4E 4E7SA 3NG1A 2R7XA 3UGOA 3UGPA 1IZMA 1QQ3A 2KGOA 4O79A 5A6BA 3IQ5A 4AK9A 5DQZA 3L34A 4CBEA 2M4EA 3JZ0A 1NU7D 4NQFA 1R4TA 1LPEA 2P1AA 2YLIA 3IQ6A 3TOLA 1Q0KA 1LS4A 4U9DA 1C17M 2OU6A 5L0JA 3TULA 3B9QA 2XLMA 1Z5ZA 3HNLA 5L3QA 1APCA 2XLDA 4NC3A
chains in the Genus database with same CATH topology
3G4XA 1Q0KA 3G50A 1Q0DA 1T6UA 1T6IA 4NCQA 1T6QA 3G4ZA 1Q0GA 1Q0MA 1Q0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4X A;  1Q0K A;  3G50 A;  1Q0D A;  1T6U A;  1T6I A;  4NCQ A;  1T6Q A;  3G4Z A;  1Q0G A;  1Q0M A;  1Q0F A; 
#chains in the Genus database with same CATH topology
 3FVY A;  4OIQ F;  1OCZ C;  1W2W A;  2XLO A;  3DMD A;  3FMS A;  2NPU A;  3UMI A;  5JT4 A;  4R32 A;  2XLE A;  2J0X A;  4GEH A;  2ZXO A;  3UMK A;  3EGX B;  1MMD A;  3DJN B;  1JPN A;  3SP1 A;  4MND A;  4O6M A;  3U9M A;  1D1A A;  4LDK A;  3FHD A;  1SR2 A;  2GAQ A;  1QLE C;  4LER A;  4WGY A;  3RVZ A;  1TQG A;  3ZVR A;  4YL1 A;  4GQH A;  1G5Z A;  2IBF A;  2VB6 A;  2EPK X;  1E2X A;  2FFH A;  1ST6 A;  4ANJ A;  1VTM P;  4JE9 A;  3R2P A;  3MFN A;  3RF3 A;  3ZWI A;  4AX2 A;  1VK5 A;  2YHS A;  4C3D A;  5D91 A;  2AU5 A;  4CS8 C;  4PAC A;  1D0Y A;  3F46 A;  2HJM A;  3JT1 A;  4JJF A;  2OEX A;  5HSW A;  2OOC A;  1LKX A;  3QW1 A;  1OCC C;  3C7J A;  2EIM C;  4WGZ A;  3V7O A;  1CPQ A;  2HMZ A;  5E3C A;  3ZIB A;  2XSE A;  3NDB B;  3K66 A;  3ABM C;  1K04 A;  2NUT B;  2NUP A;  3JRM O;  4BEJ A;  2BL2 A;  2J45 A;  2XRH A;  2DI3 A;  4JTD B;  4A4A A;  2YL3 A;  4J7Y A;  1SF8 A;  4CIH A;  3RYL A;  5B3I A;  5L0D A;  3ZTM A;  4B6I A;  2HFI A;  1FFT C;  3SZR A;  4BPM A;  1Q0G A;  5JUA A;  4MVQ A;  4WJ0 A;  1WOL A;  5BQI A;  1SZI A;  1VYK A;  3BRJ A;  1HE9 A;  3TJ6 A;  4J32 B;  3J06 A;  2EIK C;  3TD7 A;  4EBJ A;  3R7C A;  4XPX A;  1AUE A;  3M4B A;  1BZ4 A;  4Q7C A;  2CDQ A;  2JD3 A;  3C62 A;  2AWC A;  2E87 A;  4D4N A;  2AWY A;  2XXA B;  5CI8 A;  2J7P A;  4JCH A;  3QTH A;  4G78 A;  3NKE A;  2D5R B;  4CS8 A;  1TFO B;  4PK4 A;  3U2M A;  1RKE A;  4IB4 A;  3I4U A;  4DXW A;  2LCH A;  2OKU A;  4C7O B;  2R9R B;  1T6Q A;  3O55 A;  3S27 A;  4GYT A;  5B1B C;  1FTS A;  3AG4 C;  2DYS C;  1CPR A;  4K7B A;  3EH1 A;  4IAQ A;  1OR3 A;  4RD9 A;  4QDL A;  3S84 A;  1JR8 A;  3CEX A;  1Z6A A;  3EG9 B;  5KYU B;  3ZDL A;  3FAJ A;  1ZHZ A;  3FXH A;  4IAR A;  4N6H A;  1ZHT A;  3MYF A;  5L0G A;  2PX3 A;  3EHM A;  1CGO A;  4MTO A;  3NMK A;  3DKA A;  5KYN A;  1O3U A;  4ULW A;  4BJ1 A;  1E86 A;  1T5O A;  2OJE D;  5HV9 A;  3JCU Q;  3N2Z B;  2B0J A;  4EKW A;  5L0F A;  1ZW2 A;  1JMW A;  1YAU O;  1H9T A;  5T1D B;  3DE9 A;  4QI2 A;  3I5P A;  1G4U S;  3NMI A;  3GM1 A;  4MVS A;  2HUJ A;  1VB5 A;  5F5F A;  4E0H A;  3ZQV A;  3CZ6 A;  1YZC A;  1ZYR F;  1RXQ A;  3EJN A;  3MLG A;  3DAF A;  1OCO C;  3PMR A;  1Q0F A;  3LES A;  4RBN A;  4YL3 A;  1GS9 A;  4HFF B;  1ZHY A;  3CQZ A;  3IQC A;  2MYS A;  2WZL A;  2G62 A;  3KL4 A;  3LS0 A;  1S05 A;  1WTY A;  2ICW G;  2NUT A;  3RQE A;  4L6R A;  4CIP A;  1YAR O;  3Q6M A;  1A7D A;  4ER9 A;  4JW1 A;  4YN0 B;  3ZC4 A;  1KNY A;  1V54 C;  5A6A A;  3RFY A;  1OW6 A;  3U3B A;  1JAF A;  2ETS A;  3JYH A;  3V5Y A;  2KK1 A;  2HJ3 A;  3POV A;  2J9V A;  3K1I C;  4F4B A;  4JC7 A;  3IHU A;  5T3W A;  2A0U A;  4PJM A;  1E85 A;  2UUH A;  3MYI A;  4XLN F;  3C18 A;  2P6V A;  4DRJ B;  1LM3 B;  3EQL F;  1MNE A;  2YQY A;  4JUR I;  3HLZ A;  1VLS A;  1KTM A;  4BJ6 A;  3KPH A;  5EK0 A;  4LAC B;  1QVX A;  3L0I A;  4PR9 A;  2Q9A A;  1Z3I X;  4FWV A;  4NCQ A;  4P6I C;  4I1O B;  4KNW A;  3WAQ A;  4DRH B;  1IW7 F;  3EZI A;  1DOV A;  1D0Z A;  2VCA A;  3DM9 B;  1NSG B;  2BC5 A;  3ITF A;  1ORY A;  2Q00 A;  5KYX B;  1K05 A;  2V26 A;  5BQH A;  5FZT A;  4WAB A;  3GM3 A;  4RDA A;  4XEV A;  5CI9 A;  4OD4 A;  2CCY A;  2J8W A;  2LK4 A;  3KH2 A;  1HMO A;  2AVK A;  3K7D A;  2OJQ A;  3HTK C;  3C8G D;  4XEF A;  5L0C A;  2YKZ A;  2LD6 A;  4IGG A;  2YL7 A;  5DVW A;  2P61 A;  1TWG A;  3EFO B;  1M2V A;  3LNR A;  3US6 A;  3C8G A;  3LAY A;  1ZW3 A;  4MVO A;  5F28 E;  1OQC A;  3B0V C;  2XXA A;  2GWW A;  4MVR A;  4BJ5 C;  1I4Y A;  1R5I D;  2C03 A;  3RQF A;  2L7A A;  4DJ9 A;  1CGM E;  4PJN A;  2B0H A;  3AG2 C;  3NKD A;  4JKV A;  1EKY A;  2RSE B;  4P9F A;  2R03 A;  1TFK B;  3RVY A;  2R7U A;  3E9V A;  4NTA A;  1NFN A;  4JTC B;  1WGW A;  2HS5 A;  3U5S A;  1BDJ B;  1LI7 A;  3ECS A;  4MS2 A;  1T6I A;  3DD7 A;  3HNK A;  3L8I A;  1Z23 A;  2LFF A;  2LQG A;  4G7O F;  5JLI A;  2A6H F;  3PCV A;  4FES A;  3O39 A;  2L6H A;  3Q7L A;  2H7V C;  4QI0 A;  3X2Q C;  2H7O A;  3RKO F;  2YVK A;  5BUO A;  1E83 A;  3S0X A;  3OWT A;  2QLA A;  1ZU5 A;  1G8X A;  1A7V A;  1N1C A;  3U3F A;  4JRZ A;  4IRU A;  1YDI A;  2A69 F;  3IEE A;  1NBB A;  1U89 A;  2HSB A;  2XS1 A;  2I8B A;  4U5B E;  5IY5 C;  3TJ5 A;  2XL4 A;  1ORS C;  1OXK A;  4KNV A;  1U6H A;  4XPY A;  1K40 A;  2IXN A;  1LI5 A;  2EIN C;  2DB4 A;  2WZF A;  1YA7 O;  2R7W A;  3LNM B;  5T3T A;  5AC5 A;  1L3P A;  3L1M A;  2VCC A;  3T6J A;  2J9U A;  4E7Z A;  5KYW A;  5JS5 A;  5CIV A;  2F22 A;  4IJJ A;  2JX0 A;  2Y3D A;  3FDQ A;  5EHH A;  3AG3 C;  4JTA B;  1XWJ A;  2WZG A;  1NLX A;  2A1D D;  2CYD A;  3H2V A;  3OA1 A;  1L7C A;  3W8H A;  3S9O A;  2QNL A;  5GPG B;  5FCL A;  3AJM A;  1YA9 A;  2CW0 F;  2NSF A;  2J46 A;  1U0B B;  5COM A;  4KBL A;  5KYW B;  4Q5S F;  4J7T A;  1FMV A;  2L9J A;  4G0H A;  3WG7 C;  2IXM A;  4Z9H A;  5K0I A;  3F47 A;  1QSP A;  2CGE A;  4G7Z F;  4JEA A;  4H54 A;  1YZA A;  4PFP A;  2FGY A;  1D1B A;  3EGX A;  3Q7G A;  4NY3 A;  3U8P A;  3SYN A;  4HE8 D;  3S28 A;  2L6F A;  3DJU B;  256B A;  2HMQ A;  4Z9J A;  3W4Y A;  1XZQ A;  5COG A;  2TMV P;  4I1M A;  5EGY A;  2W4M A;  2W45 A;  1T6U A;  1RJ9 A;  2XLW A;  2WB7 A;  4O6N A;  3QVY A;  3A9C A;  1QKR A;  1MMA A;  1FMW A;  1YLM A;  4MW3 A;  1EA8 A;  4KC9 A;  1H9G A;  5DS6 A;  1EQ1 A;  4U5F E;  3T4R A;  3H65 A;  1LIH A;  2KW3 C;  2PFD A;  3E70 C;  3IPM O;  3UMH A;  2KJG A;  2NSG A;  3V5X A;  1Z63 A;  2HZ8 A;  3MX3 A;  3O10 A;  5L3V A;  1VLT A;  3N24 A;  1A0B A;  1OR2 A;  1B68 A;  2VCB A;  3VF0 A;  3M79 A;  4XEK A;  2J0W A;  1PD1 A;  3T9O A;  1D0X A;  2PNO A;  3DZA A;  4LDR A;  2AP3 A;  3QZC A;  4YT5 A;  3EG9 A;  1C03 A;  1DOW A;  5B3S C;  2YZS A;  1RCP A;  2RD9 A;  1Y4C A;  3EFO A;  4JEB A;  4YT8 A;  3C8G B;  1M56 C;  1YVI A;  4YL0 A;  3TOM A;  1TKN A;  3U2L A;  3SXM A;  2EPM X;  4YJW A;  3AGU A;  1FAP B;  3W2V A;  5JSL A;  2O9X A;  3ZTZ A;  2MHR A;  3HNJ A;  2A6E F;  4DBR A;  5A6K A;  3JTL O;  4JIO A;  3V5Z A;  2XL6 A;  3ZQY A;  2R7S A;  3K1I A;  3ABL C;  4U5H A;  2Q7R A;  2PBE A;  2YRF A;  4PJL A;  3SEO A;  3HKK A;  4BJ5 A;  3LEV A;  4KI2 A;  1T01 A;  3T6B A;  5BQG A;  1SMY F;  2KSF A;  3SNH A;  3EZH A;  3LEO A;  1O5H A;  5F5H A;  2VH3 A;  1CGN A;  2X51 A;  2XM0 A;  2QTV A;  3B0P A;  2LP4 A;  3B29 A;  1V55 C;  2DGJ A;  1HE1 A;  3ASN C;  1QPU A;  3JSE O;  2W4B A;  2R02 A;  3NMJ A;  3W8I A;  3BEH A;  4W8K A;  4DOZ A;  3B71 A;  3LLI A;  1ZU4 A;  4XPW A;  1KU2 A;  2QUP A;  2Y69 C;  4PJJ A;  3AOU A;  4LLC A;  4G7H F;  2W9Y A;  3AQC A;  3I5Q A;  2Q3T A;  2C04 A;  4XQ1 A;  1H6G A;  4U5G A;  5E3A A;  4P9T A;  2P0N A;  2LFD A;  2YEV A;  1OW8 A;  1ZZP A;  2G3K A;  2R7Q A;  4JZA A;  1RJ9 B;  4XTK A;  4D4X A;  2UUI A;  3H2U A;  3QW0 A;  2Q4F A;  1M6T A;  2KC3 A;  2YL0 A;  2ZXR A;  3U9J A;  3KYJ A;  4HFK B;  1LVK A;  1HMD A;  4CX9 A;  5KYY B;  4AE4 B;  1AEP A;  4EBB A;  3KMI A;  5DQT A;  4DBQ A;  1J8M F;  4U5E E;  1YYJ A;  3JSZ A;  3S29 A;  2Q9C A;  2WVO A;  5A69 A;  4MVZ A;  1M57 C;  2KNH A;  3AQB A;  3DI5 A;  3GAN A;  3N0T A;  4YWQ A;  2GDC A;  3CAX A;  1I4Z A;  3EGD A;  3ZG1 A;  4K1O A;  3K1H A;  4BG0 A;  3DWW A;  2IM8 A;  2Y39 A;  4E18 A;  2FAP B;  4EHP A;  1VYI A;  4IAO A;  2EPN A;  3HNI A;  3LS1 A;  2R7T A;  4MQ9 F;  2BE5 F;  2KYH A;  2Y3G A;  2I15 A;  4HEA J;  1NZE A;  2L81 A;  4CS9 C;  3ATP A;  4C3E A;  1M2V B;  1JRA A;  2WL8 A;  2J9W A;  5L0I A;  3KKB A;  1UFB A;  3C8Z A;  1F1M A;  4MVU A;  4OIN F;  1NG1 A;  1UG7 A;  4BEM J;  4JVS A;  2R7V A;  1G4W R;  1WAT A;  2EIL C;  1D1C A;  1LE2 A;  1I5N A;  1TWA A;  2R05 A;  3Q6N A;  1FR0 A;  2J7P D;  1Z7Q c;  1RKE B;  2CNW A;  2A68 F;  4EBK A;  4C7O A;  5DS5 A;  3SXK A;  1JPJ A;  1V74 B;  1WWP A;  1M2O A;  4O6Y A;  5A6B D;  2VC9 A;  1NFO A;  2YLD A;  3IQT A;  3AG1 C;  1H7I A;  2VAS A;  2PX0 A;  3GEH A;  3LUT B;  4YK5 A;  4CS7 A;  1NU9 C;  2M64 A;  3QMK A;  1A41 A;  2GFH A;  3A11 A;  4M63 A;  3G4Z A;  2QY9 A;  4UDV A;  4O7G A;  1WN0 A;  2XLV A;  3NYJ A;  4LLE A;  5D92 A;  4A2N B;  4X0R A;  2WVN A;  4FAP B;  2R7O A;  3K33 A;  3M15 A;  4E0I A;  2NG1 A;  4MTF A;  4N06 A;  3UNG C;  1MND A;  2LSE A;  1MQV A;  3UR3 C;  5L0H A;  2KQ9 A;  4N4W A;  4J30 B;  2EPO A;  2YL1 A;  3RH3 A;  4JJG A;  3RQG A;  1T9K A;  3DE8 A;  2H7B A;  3O6X A;  1WAS A;  3SXZ A;  2YWA A;  2ZD9 A;  2MWQ A;  1Q0M A;  2A0B A;  4CS9 A;  2IOQ A;  3DXJ F;  4YT2 A;  3FOO A;  3G50 A;  3FOP A;  4I3M A;  4OIO F;  2ZPA A;  3LJB A;  1TWC A;  4W8P A;  5E2Q A;  5JRA A;  1FNT c;  5DS4 A;  2ZXW C;  3M4C A;  3JRT A;  4DVY P;  2PP4 A;  4U5D E;  3W2W A;  2OQM A;  2Y3H A;  2XLH A;  3EPV A;  4XLP F;  3PDM P;  2R25 A;  1JOG A;  1TR2 A;  1YJG A;  3DM5 A;  1A7E A;  4OD5 A;  4EUK B;  4H4K C;  5KYX A;  5TJ5 E;  2V3C C;  4Q4Z F;  2EIJ C;  3GWN A;  4XWJ A;  3M1C B;  4K0D A;  2GA0 A;  4ULV A;  1BBH A;  4MVM A;  3T6G B;  5KYY A;  3PHF 2;  5AC4 A;  2EPL X;  2XS8 A;  3WOD F;  3NRH A;  3U0C A;  4AL1 A;  1LE4 A;  3EGD B;  1RMV A;  3KYI A;  4AL0 A;  2J9B A;  3FAP B;  1OKK A;  1TWH A;  3VAY A;  3NYL A;  1HW1 A;  2XM4 A;  1MMN A;  4U9E A;  1OKK D;  3EHN A;  3TK0 A;  1V4A A;  5KYU A;  3VYW A;  1EI7 A;  1Q0D A;  4CJO A;  3GOR A;  1XZP A;  3L8J A;  4I44 A;  3DAG A;  4PFO A;  5AGF A;  1AVO B;  1O87 A;  1OCR C;  3JYY A;  4AE4 A;  1OW7 A;  1VMA A;  4BJ6 C;  3S90 A;  2JPU A;  2D4U A;  1ZVZ A;  2IXO A;  1Y6D A;  2YLG A;  5E33 A;  5DLJ A;  1LS1 A;  3GEE A;  3QVZ A;  3C63 A;  4FX5 A;  4CDV A;  1SYQ A;  4NTF A;  1J8Y F;  3CSK A;  2L6G A;  4ONS A;  5B1A C;  1MMG A;  2HV6 A;  1PD0 A;  1GQA A;  1ZHX A;  4U5C E;  2OEV A;  3GOD A;  3SXY A;  1ZHW A;  5COF A;  4EIY A;  2G3V A;  3G4X A;  4JCZ A;  3GM2 A;  5JP7 A;  3X1O A;  3LLK A;  1RKC A;  4CSA A;  1S7Z A;  2CNW D;  3GEI A;  1FFH A;  3MBG A;  3ABK C;  3NYM A;  4E17 A;  3K6B A;  4DVZ A;  2H8A A;  3AGT A;  2XL8 A;  4IWB A;  4CDA A;  1E84 A;  1C02 A;  2WVQ A;  4LDQ A;  2HSQ A;  4OIP F;  3HJC A;  4ZLD A;  4MTG A;  4ZLC A;  2R7R A;  3B0U X;  2HKV A;  2IXP A;  1QZX A;  2HV7 A;  2Z15 A;  3GWL A;  4N6C A;  3VRC A;  4BJT A;  4CDY A;  1BR2 A;  4YT4 A;  1HY5 A;  3RW0 A;  2NUP B;  3WHN A;  1OXB A;  5JVE A;  3ASO C;  1HW2 A;  4CSA C;  2Q9B A;  1YYX A;  2X0C A;  1BR1 A;  2DYR C;  1PCX A;  2OG2 A;  4Z9I A;  4OIR F;  4CJG A;  4DRI B;  3EH2 A;  2LIG A;  5A6J A;  3OEO A;  1BR4 A;  4EWC A;  2IYL D;  4NTB A;  2ZXP A;  3VM6 A;  2P7V A;  1ORJ A;  2ASR A;  2Y3B A;  2QE9 A;  4MW8 A;  3RIP A;  1PV3 A;  3U8V A;  4C3B A;  1GGQ A;  2OCC C;  1VOM A;  3TQO A;  1GM5 A;  3ZSU A;  2PF4 E;  4E7S A;  3NG1 A;  2R7X A;  3UGO A;  3UGP A;  1IZM A;  1QQ3 A;  2KGO A;  4O79 A;  5A6B A;  3IQ5 A;  4AK9 A;  5DQZ A;  3L34 A;  4CBE A;  2M4E A;  3JZ0 A;  1NU7 D;  4NQF A;  1R4T A;  1LPE A;  2P1A A;  2YLI A;  3IQ6 A;  3TOL A;  1Q0K A;  1LS4 A;  4U9D A;  1C17 M;  2OU6 A;  5L0J A;  3TUL A;  3B9Q A;  2XLM A;  1Z5Z A;  3HNL A;  5L3Q A;  1APC A;  2XLD A;  4NC3 A; 
#chains in the Genus database with same CATH homology
 3G4X A;  1Q0K A;  3G50 A;  1Q0D A;  1T6U A;  1T6I A;  4NCQ A;  1T6Q A;  3G4Z A;  1Q0G A;  1Q0M A;  1Q0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...