1Q0MA

Crystal structure of ni-containing superoxide dismutase with ni-ligation corresponding to the state after full x-ray-induced reduction
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
117
structure length
117
Chain Sequence
HCDLPCGVYDPAQARIEAESVKAIQEKMAANDDLHFQIRATVIKEQRAELAKHHLDVLWSDYFKPPHFESYPELHTLVNEAVKALSAAKASTDPATGQKALDYIAQIDKIFWETKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Ni]
publication title Crystal structure of nickel-containing superoxide dismutase reveals another type of active site
pubmed doi rcsb
total genus 52
structure length 117
sequence length 117
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2003-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.400 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nickel-containing superoxide dismutase 1q0mA00
1Q0KA 1Q0MA 3G50A 1T6UA 1Q0DA 1T6QA 3G4ZA 4NCQA 1Q0FA 1T6IA 1Q0GA 3G4XA
chains in the Genus database with same CATH superfamily
2YVKA 2R05A 3VRCA 4CDVA 4JIOA 2YL7A 2QE9A 4JRZA 4ONSA 1I5NA 5AC5A 2VCAA 1LI5A 2A0BA 3S90A 1T9KA 2J8WA 3NDBB 2BC5A 3AQCA 1O87A 3V5YA 2B0JA 3SXYA 1AVOB 1OCRC 4MVRA 2PX0A 4YN0B 1ZHXA 2JD3A 2QTVA 5L0IA 3T6JA 3G4ZA 3LNMB 4C3DA 3KL4A 4I3MA 4IB4A 4XPWA 2W4MA 3H2UA 1TFKB 2LFDA 3O55A 3GEEA 4MTOA 3POVA 1U0BB 1D1AA 2DYSC 3EGDA 4E17A 5A69A 2PNOA 3EG9A 2XLMA 2R02A 5HV9A 1J8YF 2XS8A 4DVZA 1QPUA 3IPMO 3QW0A 2AP3A 2XM0A 3RIPA 5F5FA 2W9YA 1ZHZA 2EIKC 4MS2A 4IRUA 1ORSC 2NSFA 5L0JA 3G4XA 5CI8A 5KYWA 1WWPA 2BE5F 2L7AA 3EQLF 4PJMA 1RKCA 2J0XA 4OIRF 4R32A 2NUTA 3QVYA 4CDYA 3ASOC 2YZSA 1OW8A 3BEHA 3HKKA 2M64A 3GWLA 4I44A 3K6BA 4KC9A 3PDMP 1UG7A 4EBBA 1RMVA 4N4WA 3RQEA 4BJ6A 3TOMA 1D0ZA 2HMZA 1ORJA 2E87A 2EPLX 3FVYA 3TD7A 2YKZA 1HE9A 3DJUB 1JRAA 1Q0GA 2L6HA 4CX9A 3AOUA 4EBKA 1XWJA 4EUKB 1VLTA 4CIPA 1HW2A 1F1MA 1D1CA 1RKEB 2R9RB 3LS0A 3FOPA 3F47A 4O6MA 3EGDB 5JS5A 2J9UA 3SNHA 3OWTA 4KBLA 4G0HA 3AGTA 3EG9B 3GANA 5COFA 1Y4CA 3ZDLA 3EH1A 4GQHA 4FX5A 4YL0A 3X2QC 4C3EA 5BQHA 3K66A 5HSWA 2DGJA 5KYWB 5EHHA 3DAFA 4K7BA 3SP1A 4BJ5C 3VAYA 2OEXA 2XXAB 1KNYA 2NUTB 3T6GB 1FMWA 3U2LA 4M63A 3V5XA 5DS4A 3B0VC 3M15A 4DRJB 4DJ9A 1ZHTA 3VF0A 2VASA 2A68F 1G8XA 1TKNA 3U3BA 2FFHA 4FAPB 3NYLA 4BEMJ 2OOCA 2YLGA 3E70C 3GM1A 2R7VA 2UUIA 4G7ZF 4AX2A 4JVSA 3TJ6A 3TULA 2VCBA 2LK4A 1QKRA 4DBQA 3HTKC 3Q6NA 1APCA 3AG4C 3HLZA 2XLDA 1MQVA 5JT4A 2PX3A 3AQBA 4RD9A 2IXMA 5DVWA 3ABLC 3H65A 4BJTA 5K0IA 3FAJA 4E0HA 3LS1A 3LESA 2DB4A 3U9MA 2NPUA 2X0CA 4DRHB 3MYFA 2A0UA 1Q0KA 2JX0A 4J32B 2NSGA 2MWQA 2R7OA 3TOLA 3UNGC 1Y6DA 4E0IA 3ASNC 4MW8A 4XQ1A 4BJ5A 2HMQA 1L3PA 4E18A 3JTLO 3SEOA 3EHNA 2I15A 2LFFA 2RSEB 1WATA 3V5ZA 1G4US 1N1CA 1MMAA 1YYXA 2A1DD 4U5GA 1WGWA 2EPOA 3DE9A 4HE8D 1LS1A 4XPYA 5L0FA 4Q4ZF 4EHPA 1WN0A 4N6HA 4MTFA 2O9XA 2Q7RA 2V3CC 4KNVA 1L7CA 3DMDA 1SYQA 2WVOA 4BG0A 1MMDA 1ST6A 1QSPA 2KYHA 3LLIA 4CS9C 4U5BE 5BQIA 3ECSA 4O79A 1BZ4A 3J06A 1V55C 2R7QA 1WTYA 3C62A 4AE4A 1LM3B 2EINC 1C17M 2JPUA 2G62A 1FR0A 4LLCA 2EIMC 5T1DB 2H8AA 2Y69C 5E3CA 1LS4A 4OD5A 2QLAA 3BRJA 4XEKA 2PP4A 3L1MA 3WAQA 3JCUQ 2I8BA 1DOVA 4JC7A 1ZHWA 1JMWA 2NG1A 4H54A 5L0DA 1SF8A 5COMA 1Z3IX 3N2ZB 2A69F 1YARO 4LERA 2YLDA 1S7ZA 3KYIA 3O39A 5L3VA 1Z63A 4CSAA 4A2NB 1K05A 2J9WA 4Q7CA 3RVYA 3L0IA 2L6FA 3EPVA 2XLWA 3ABMC 3JSZA 4MVMA 1U6HA 2YLIA 1V74B 1M57C 4AE4B 2VB6A 2ASRA 2XLOA 2FGYA 1HE1A 4EKWA 5AC4A 1ZHYA 2QY9A 3DM5A 3ZQYA 5FZTA 3RYLA 4AK9A 1VK5A 1MNEA 3LAYA 4BJ6C 4CIHA 1EKYA 4DXWA 2IOQA 1YJGA 3NKDA 4Q5SF 4XLPF 4I1OB 5DQZA 3MBGA 4MNDA 5E2QA 1RKEA 3CZ6A 2Y3DA 1RCPA 1Z5ZA 4PR9A 5D91A 1QQ3A 3E9VA 1Q0FA 2IYLD 5DS5A 1I4YA 3NRHA 2R7RA 4XTKA 1AEPA 5L0GA 1IW7F 3Q7LA 2WVNA 5FCLA 4QI0A 1FFTC 1O5HA 2XRHA 5JVEA 4HFKB 4CJOA 1A7VA 2PF4E 1FFHA 2ETSA 1K40A 2HJMA 2KSFA 3O6XA 4MVOA 4C7OA 3NMKA 2XXAA 2VH3A 1JR8A 1NG1A 4O6NA 3A11A 5KYUA 5A6BA 1JPJA 4O7GA 1OW7A 5B1BC 1M6TA 3LUTB 2DYRC 2J9BA 5BUOA 2R03A 2H7BA 4X0RA 3NYMA 3U8VA 3FOOA 4QI2A 1TQGA 3TK0A 2KGOA 3EZHA 4BJ1A 2WVQA 1HW1A 1PCXA 5D92A 1BBHA 4JTCB 5JUAA 1LVKA 2L81A 2XLHA 3DAGA 1ZYRF 5KYNA 4J7TA 3B9QA 4OIQF 5E33A 3QVZA 3L34A 3F46A 5F28E 1KU2A 2HUJA 2LSEA 3QW1A 4YT2A 2X51A 2ZXOA 4JZAA 3LEVA 1FNTc 4LDKA 3B29A 4E7SA 3OA1A 1VTMP 2OJQA 4C7OB 4P6IC 4DRIB 1NU9C 1T6QA 1HY5A 4PACA 2IXOA 3HNLA 5KYUB 2WL8A 4RDAA 1D0YA 2ZD9A 4FWVA 1E86A 3AG1C 3W4YA 2P6VA 3X1OA 1SR2A 3DXJF 3O10A 4DBRA 2YQYA 3FDQA 1TWGA 1OXBA 2XL6A 3N24A 4XEFA 3SZRA 3ABKC 4YWQA 3S0XA 3UMHA 2LCHA 4CBEA 1E85A 5IY5C 1YYJA 1JAFA 4W8PA 1A0BA 2P0NA 3EZIA 4JJGA 3M4CA 3MYIA 4PJNA 4ULWA 1R4TA 1NFNA 5L0HA 1A7EA 3FMSA 1FTSA 1ZU4A 2KW3C 1YA7O 1V54C 2WB7A 2ICWG 3IQTA 3TQOA 1LE2A 3I4UA 3K1IA 3S29A 1YZCA 1YAUO 3M79A 1MMNA 3KPHA 4Z9JA 3U5SA 4U5HA 1OQCA 4MVZA 2EPNA 4NQFA 4YT4A 2H7VC 3ZWIA 3JYHA 3H2VA 4MW3A 4PJLA 2YHSA 3AG2C 3RH3A 4U9EA 2HV6A 2Q9CA 2XL8A 4NTAA 3T6BA 3B71A 4JJFA 3B0PA 3CQZA 4IAOA 3RQFA 2G3KA 4N6CA 4WABA 4D4XA 4CDAA 2UUHA 3NMJA 2HSQA 2CDQA 2J0WA 2YWAA 4CS7A 4ULVA 3U3FA 5L0CA 2R7WA 3GODA 4IAQA 1H9GA 2LQGA 3K7DA 2CW0F 2XL4A 4CSAC 1T5OA 3JRTA 1ZW2A 2FAPB 2R7XA 1KTMA 5A6AA 4JEAA 2HS5A 3M4BA 4KNWA 2MYSA 5F5HA 3A9CA 3W8IA 3MFNA 3WHNA 1YLMA 3GEIA 1C02A 1QZXA 3PCVA 2KC3A 2OEVA 3EH2A 3DKAA 4YT8A 1YA9A 3ZTMA 2CGEA 3ITFA 1TR2A 3SXZA 3RFYA 1C03A 1BR2A 2QNLA 4UDVA 1LPEA 3U8PA 2P61A 5DS6A 2J7PA 4LDQA 4LDRA 1SMYF 1W2WA 1M2VB 2PFDA 2M4EA 2XM4A 2OQMA 4FESA 4CS8A 1HMDA 2V26A 1E83A 1WASA 3KYJA 3V7OA 1JPNA 3KMIA 3LLKA 3NMIA 1UFBA 3HJCA 4JTAB 3WODF 3JRMO 2EPMX 3UMIA 2ZXPA 4NY3A 1ORYA 2IXPA 3KKBA 4IWBA 3RW0A 5A6BD 3ZIBA 4GYTA 5BQGA 5KYYB 1OXKA 4XPXA 1QVXA 4MVQA 3QZCA 3CEXA 3GEHA 5DLJA 4A4AA 3MX3A 3SXKA 2Z15A 1GS9A 1SZIA 1YDIA 2Y3GA 4BEJA 3JT1A 3US6A 3FHDA 3L8JA 4WGYA 3EJNA 2LIGA 3HNKA 1B68A 1VYKA 2OJED 3T4RA 3K1HA 4EBJA 3UR3C 3RF3A 4U5FE 1D0XA 2R7SA 1TWCA 3ZQVA 2R7UA 1QLEC 2VCCA 4PK4A 4IJJA 2HFIA 1I4ZA 2KJGA 3JYYA 4JCZA 2D4UA 2GWWA 4XEVA 4P9FA 3SXMA 1PV3A 2R7TA 5GPGB 2GAQA 3M1CB 2YL1A 5E3AA 1OR3A 1S05A 5B3IA 3C8GD 1TWHA 1YZAA 2Y3BA 2C04A 2OU6A 4KI2A 4AL1A 5CIVA 2H7OA 2EIJC 1OR2A 1XZQA 5KYXA 4OIPF 1MNDA 5JRAA 1LE4A 2Y39A 1V4AA 1AUEA 4JTDB 4P9TA 3GWNA 3T9OA 1OCOC 3ZG1A 3JSEO 5B3SC 2Q3TA 3PHF2 3W8HA 3EHMA 4PFPA 2CCYA 4ER9A 1OKKD 3AG3C 2J9VA 3IHUA 3W2VA 4I1MA 2XLEA 3EFOA 1GGQA 1A41A 4PJJA 2MHRA 1RXQA 3KH2A 4JW1A 2CYDA 1M56C 2KQ9A 3IQ6A 3S28A 1BR1A 2L6GA 1LI7A 4IARA 5COGA 5JP7A 5T3WA 4DOZA 1CGME 3GM2A 2LP4A 2NUPB 1IZMA 3I5PA 1G5ZA 4WJ0A 2Q9BA 2YL3A 4YK5A 3UGOA 2KNHA 3UMKA 4YL1A 2HJ3A 4OD4A 3GORA 2HV7A 1NSGB 3K1IC 4QDLA 2Q00A 4U9DA 3U0CA 2WZLA 2ZXRA 3NKEA 4DVYP 3UGPA 2AU5A 1ZVZA 2GA0A 2YRFA 3DD7A 5TJ5E 5EGYA 2XSEA 3C63A 5KYXB 3R2PA 2OG2A 2F22A 1A7DA 2VC9A 1VYIA 3FAPB 3Q6MA 4U5DE 1Z7Qc 1O3UA 1FMVA 3S27A 4EWCA 3LNRA 4HFFB 4MQ9F 3C8GA 4AL0A 1K04A 2OKUA 4U5CE 3PMRA 3EFOB 3MLGA 3ZSUA 3CSKA 1GM5A 4OINF 1OW6A 4W8KA 2YL0A 2Q4FA 1Z23A 2XLVA 4K1OA 5EK0A 4F4BA 2R25A 1LKXA 1T6UA 1U89A 3IEEA 3LJBA 1MMGA 3QTHA 4MVUA 3TJ5A 1JOGA 4E7ZA 3NG1A 1VMAA 3LEOA 2BL2A 1OKKA 1PD0A 3ATPA 3DI5A 4JE9A 2W45A 4U5EE 3Q7GA 3RKOF 3S9OA 4ANJA 3OEOA 5L3QA 2RD9A 4IGGA 2CNWD 1YVIA 4GEHA 2J7PD 1CGNA 2YEVA 1NU7D 2AVKA 3S84A 4BPMA 4RBNA 3B0UX 2P1AA 3C7JA 3IQCA 5T3TA 1NZEA 2IXNA 1EA8A 4D4NA 4XWJA 1Q0DA 5JLIA 1CPQA 3C8GB 4N06A 2PBEA 1HMOA 4NTFA 3DJNB 1OCCC 3RQGA 4CS8C 1M2VA 4G78A 1TFOB 2AWCA 3JZ0A 3L8IA 5DQTA 1EQ1A 4L6RA 1M2OA 4PFOA 1VLSA 1T6IA 3C8ZA 3VYWA 2DI3A 3W2WA 3K33A 4JEBA 2D5RB 1RJ9A 3HNJA 1BR4A 4J7YA 1XZPA 1Z6AA 4Z9HA 5KYYA 4C3BA 3DZAA 4XLNF 2Q9AA 1Q0MA 3C18A 2W4BA 3N0TA 1DOWA 1VOMA 3DM9B 2L9JA 1CPRA 1H7IA 1CGOA 2OCCC 3AGUA 3G50A 1PD1A 1EI7A 2LD6A 2ZPAA 3HNIA 4NC3A 1LIHA 2CNWA 3GM3A 4NTBA 1H6GA 256BA 1OCZC 3EGXA 1E84A 1TWAA 4K0DA 5CI9A 4JKVA 1D1BA 1FAPB 2C03A 5JSLA 2ZXWC 3SYNA 4YT5A 3WG7C 4ZLCA 1NFOA 1WOLA 3ZVRA 2HKVA 4G7OF 2G3VA 4G7HF 1ZU5A 4LLEA 3AJMA 2IBFA 1BDJB 1RJ9B 2WZFA 4CJGA 1E2XA 4J30B 5A6KA 1T01A 4JCHA 4MTGA 2WZGA 4YL3A 2Y3HA 1H9TA 2J45A 2HSBA 3ZTZA 1ZW3A 1GQAA 1NBBA 4NCQA 2EILC 2QUPA 4LACB 2B0HA 3RVZA 3IQ5A 4YJWA 4ZLDA 3NYJA 4EIYA 3U2MA 2EPKX 3CAXA 4Z9IA 2XS1A 3QMKA 5A6JA 1R5ID 2GDCA 2A6HF 2TMVP 3DWWA 4WGZA 3DE8A 4JURI 3VM6A 1VB5A 3EGXB 3ZC4A 2NUPA 5B1AC 2P7VA 2IM8A 5AGFA 1NLXA 1J8MF 1G4WR 3I5QA 4H4KC 2KK1A 1ZZPA 4MVSA 3U9JA 2J46A 3R7CA 4CS9A 4O6YA 4B6IA 2A6EF 2HZ8A 3FXHA 4HEAJ 2AWYA 2GFHA 4OIOF
chains in the Genus database with same CATH topology
1Q0KA 1Q0MA 3G50A 1T6UA 1Q0DA 1T6QA 3G4ZA 4NCQA 1Q0FA 1T6IA 1Q0GA 3G4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q0K A;  1Q0M A;  3G50 A;  1T6U A;  1Q0D A;  1T6Q A;  3G4Z A;  4NCQ A;  1Q0F A;  1T6I A;  1Q0G A;  3G4X A; 
#chains in the Genus database with same CATH topology
 2YVK A;  2R05 A;  3VRC A;  4CDV A;  4JIO A;  2YL7 A;  2QE9 A;  4JRZ A;  4ONS A;  1I5N A;  5AC5 A;  2VCA A;  1LI5 A;  2A0B A;  3S90 A;  1T9K A;  2J8W A;  3NDB B;  2BC5 A;  3AQC A;  1O87 A;  3V5Y A;  2B0J A;  3SXY A;  1AVO B;  1OCR C;  4MVR A;  2PX0 A;  4YN0 B;  1ZHX A;  2JD3 A;  2QTV A;  5L0I A;  3T6J A;  3G4Z A;  3LNM B;  4C3D A;  3KL4 A;  4I3M A;  4IB4 A;  4XPW A;  2W4M A;  3H2U A;  1TFK B;  2LFD A;  3O55 A;  3GEE A;  4MTO A;  3POV A;  1U0B B;  1D1A A;  2DYS C;  3EGD A;  4E17 A;  5A69 A;  2PNO A;  3EG9 A;  2XLM A;  2R02 A;  5HV9 A;  1J8Y F;  2XS8 A;  4DVZ A;  1QPU A;  3IPM O;  3QW0 A;  2AP3 A;  2XM0 A;  3RIP A;  5F5F A;  2W9Y A;  1ZHZ A;  2EIK C;  4MS2 A;  4IRU A;  1ORS C;  2NSF A;  5L0J A;  3G4X A;  5CI8 A;  5KYW A;  1WWP A;  2BE5 F;  2L7A A;  3EQL F;  4PJM A;  1RKC A;  2J0X A;  4OIR F;  4R32 A;  2NUT A;  3QVY A;  4CDY A;  3ASO C;  2YZS A;  1OW8 A;  3BEH A;  3HKK A;  2M64 A;  3GWL A;  4I44 A;  3K6B A;  4KC9 A;  3PDM P;  1UG7 A;  4EBB A;  1RMV A;  4N4W A;  3RQE A;  4BJ6 A;  3TOM A;  1D0Z A;  2HMZ A;  1ORJ A;  2E87 A;  2EPL X;  3FVY A;  3TD7 A;  2YKZ A;  1HE9 A;  3DJU B;  1JRA A;  1Q0G A;  2L6H A;  4CX9 A;  3AOU A;  4EBK A;  1XWJ A;  4EUK B;  1VLT A;  4CIP A;  1HW2 A;  1F1M A;  1D1C A;  1RKE B;  2R9R B;  3LS0 A;  3FOP A;  3F47 A;  4O6M A;  3EGD B;  5JS5 A;  2J9U A;  3SNH A;  3OWT A;  4KBL A;  4G0H A;  3AGT A;  3EG9 B;  3GAN A;  5COF A;  1Y4C A;  3ZDL A;  3EH1 A;  4GQH A;  4FX5 A;  4YL0 A;  3X2Q C;  4C3E A;  5BQH A;  3K66 A;  5HSW A;  2DGJ A;  5KYW B;  5EHH A;  3DAF A;  4K7B A;  3SP1 A;  4BJ5 C;  3VAY A;  2OEX A;  2XXA B;  1KNY A;  2NUT B;  3T6G B;  1FMW A;  3U2L A;  4M63 A;  3V5X A;  5DS4 A;  3B0V C;  3M15 A;  4DRJ B;  4DJ9 A;  1ZHT A;  3VF0 A;  2VAS A;  2A68 F;  1G8X A;  1TKN A;  3U3B A;  2FFH A;  4FAP B;  3NYL A;  4BEM J;  2OOC A;  2YLG A;  3E70 C;  3GM1 A;  2R7V A;  2UUI A;  4G7Z F;  4AX2 A;  4JVS A;  3TJ6 A;  3TUL A;  2VCB A;  2LK4 A;  1QKR A;  4DBQ A;  3HTK C;  3Q6N A;  1APC A;  3AG4 C;  3HLZ A;  2XLD A;  1MQV A;  5JT4 A;  2PX3 A;  3AQB A;  4RD9 A;  2IXM A;  5DVW A;  3ABL C;  3H65 A;  4BJT A;  5K0I A;  3FAJ A;  4E0H A;  3LS1 A;  3LES A;  2DB4 A;  3U9M A;  2NPU A;  2X0C A;  4DRH B;  3MYF A;  2A0U A;  1Q0K A;  2JX0 A;  4J32 B;  2NSG A;  2MWQ A;  2R7O A;  3TOL A;  3UNG C;  1Y6D A;  4E0I A;  3ASN C;  4MW8 A;  4XQ1 A;  4BJ5 A;  2HMQ A;  1L3P A;  4E18 A;  3JTL O;  3SEO A;  3EHN A;  2I15 A;  2LFF A;  2RSE B;  1WAT A;  3V5Z A;  1G4U S;  1N1C A;  1MMA A;  1YYX A;  2A1D D;  4U5G A;  1WGW A;  2EPO A;  3DE9 A;  4HE8 D;  1LS1 A;  4XPY A;  5L0F A;  4Q4Z F;  4EHP A;  1WN0 A;  4N6H A;  4MTF A;  2O9X A;  2Q7R A;  2V3C C;  4KNV A;  1L7C A;  3DMD A;  1SYQ A;  2WVO A;  4BG0 A;  1MMD A;  1ST6 A;  1QSP A;  2KYH A;  3LLI A;  4CS9 C;  4U5B E;  5BQI A;  3ECS A;  4O79 A;  1BZ4 A;  3J06 A;  1V55 C;  2R7Q A;  1WTY A;  3C62 A;  4AE4 A;  1LM3 B;  2EIN C;  1C17 M;  2JPU A;  2G62 A;  1FR0 A;  4LLC A;  2EIM C;  5T1D B;  2H8A A;  2Y69 C;  5E3C A;  1LS4 A;  4OD5 A;  2QLA A;  3BRJ A;  4XEK A;  2PP4 A;  3L1M A;  3WAQ A;  3JCU Q;  2I8B A;  1DOV A;  4JC7 A;  1ZHW A;  1JMW A;  2NG1 A;  4H54 A;  5L0D A;  1SF8 A;  5COM A;  1Z3I X;  3N2Z B;  2A69 F;  1YAR O;  4LER A;  2YLD A;  1S7Z A;  3KYI A;  3O39 A;  5L3V A;  1Z63 A;  4CSA A;  4A2N B;  1K05 A;  2J9W A;  4Q7C A;  3RVY A;  3L0I A;  2L6F A;  3EPV A;  2XLW A;  3ABM C;  3JSZ A;  4MVM A;  1U6H A;  2YLI A;  1V74 B;  1M57 C;  4AE4 B;  2VB6 A;  2ASR A;  2XLO A;  2FGY A;  1HE1 A;  4EKW A;  5AC4 A;  1ZHY A;  2QY9 A;  3DM5 A;  3ZQY A;  5FZT A;  3RYL A;  4AK9 A;  1VK5 A;  1MNE A;  3LAY A;  4BJ6 C;  4CIH A;  1EKY A;  4DXW A;  2IOQ A;  1YJG A;  3NKD A;  4Q5S F;  4XLP F;  4I1O B;  5DQZ A;  3MBG A;  4MND A;  5E2Q A;  1RKE A;  3CZ6 A;  2Y3D A;  1RCP A;  1Z5Z A;  4PR9 A;  5D91 A;  1QQ3 A;  3E9V A;  1Q0F A;  2IYL D;  5DS5 A;  1I4Y A;  3NRH A;  2R7R A;  4XTK A;  1AEP A;  5L0G A;  1IW7 F;  3Q7L A;  2WVN A;  5FCL A;  4QI0 A;  1FFT C;  1O5H A;  2XRH A;  5JVE A;  4HFK B;  4CJO A;  1A7V A;  2PF4 E;  1FFH A;  2ETS A;  1K40 A;  2HJM A;  2KSF A;  3O6X A;  4MVO A;  4C7O A;  3NMK A;  2XXA A;  2VH3 A;  1JR8 A;  1NG1 A;  4O6N A;  3A11 A;  5KYU A;  5A6B A;  1JPJ A;  4O7G A;  1OW7 A;  5B1B C;  1M6T A;  3LUT B;  2DYR C;  2J9B A;  5BUO A;  2R03 A;  2H7B A;  4X0R A;  3NYM A;  3U8V A;  3FOO A;  4QI2 A;  1TQG A;  3TK0 A;  2KGO A;  3EZH A;  4BJ1 A;  2WVQ A;  1HW1 A;  1PCX A;  5D92 A;  1BBH A;  4JTC B;  5JUA A;  1LVK A;  2L81 A;  2XLH A;  3DAG A;  1ZYR F;  5KYN A;  4J7T A;  3B9Q A;  4OIQ F;  5E33 A;  3QVZ A;  3L34 A;  3F46 A;  5F28 E;  1KU2 A;  2HUJ A;  2LSE A;  3QW1 A;  4YT2 A;  2X51 A;  2ZXO A;  4JZA A;  3LEV A;  1FNT c;  4LDK A;  3B29 A;  4E7S A;  3OA1 A;  1VTM P;  2OJQ A;  4C7O B;  4P6I C;  4DRI B;  1NU9 C;  1T6Q A;  1HY5 A;  4PAC A;  2IXO A;  3HNL A;  5KYU B;  2WL8 A;  4RDA A;  1D0Y A;  2ZD9 A;  4FWV A;  1E86 A;  3AG1 C;  3W4Y A;  2P6V A;  3X1O A;  1SR2 A;  3DXJ F;  3O10 A;  4DBR A;  2YQY A;  3FDQ A;  1TWG A;  1OXB A;  2XL6 A;  3N24 A;  4XEF A;  3SZR A;  3ABK C;  4YWQ A;  3S0X A;  3UMH A;  2LCH A;  4CBE A;  1E85 A;  5IY5 C;  1YYJ A;  1JAF A;  4W8P A;  1A0B A;  2P0N A;  3EZI A;  4JJG A;  3M4C A;  3MYI A;  4PJN A;  4ULW A;  1R4T A;  1NFN A;  5L0H A;  1A7E A;  3FMS A;  1FTS A;  1ZU4 A;  2KW3 C;  1YA7 O;  1V54 C;  2WB7 A;  2ICW G;  3IQT A;  3TQO A;  1LE2 A;  3I4U A;  3K1I A;  3S29 A;  1YZC A;  1YAU O;  3M79 A;  1MMN A;  3KPH A;  4Z9J A;  3U5S A;  4U5H A;  1OQC A;  4MVZ A;  2EPN A;  4NQF A;  4YT4 A;  2H7V C;  3ZWI A;  3JYH A;  3H2V A;  4MW3 A;  4PJL A;  2YHS A;  3AG2 C;  3RH3 A;  4U9E A;  2HV6 A;  2Q9C A;  2XL8 A;  4NTA A;  3T6B A;  3B71 A;  4JJF A;  3B0P A;  3CQZ A;  4IAO A;  3RQF A;  2G3K A;  4N6C A;  4WAB A;  4D4X A;  4CDA A;  2UUH A;  3NMJ A;  2HSQ A;  2CDQ A;  2J0W A;  2YWA A;  4CS7 A;  4ULV A;  3U3F A;  5L0C A;  2R7W A;  3GOD A;  4IAQ A;  1H9G A;  2LQG A;  3K7D A;  2CW0 F;  2XL4 A;  4CSA C;  1T5O A;  3JRT A;  1ZW2 A;  2FAP B;  2R7X A;  1KTM A;  5A6A A;  4JEA A;  2HS5 A;  3M4B A;  4KNW A;  2MYS A;  5F5H A;  3A9C A;  3W8I A;  3MFN A;  3WHN A;  1YLM A;  3GEI A;  1C02 A;  1QZX A;  3PCV A;  2KC3 A;  2OEV A;  3EH2 A;  3DKA A;  4YT8 A;  1YA9 A;  3ZTM A;  2CGE A;  3ITF A;  1TR2 A;  3SXZ A;  3RFY A;  1C03 A;  1BR2 A;  2QNL A;  4UDV A;  1LPE A;  3U8P A;  2P61 A;  5DS6 A;  2J7P A;  4LDQ A;  4LDR A;  1SMY F;  1W2W A;  1M2V B;  2PFD A;  2M4E A;  2XM4 A;  2OQM A;  4FES A;  4CS8 A;  1HMD A;  2V26 A;  1E83 A;  1WAS A;  3KYJ A;  3V7O A;  1JPN A;  3KMI A;  3LLK A;  3NMI A;  1UFB A;  3HJC A;  4JTA B;  3WOD F;  3JRM O;  2EPM X;  3UMI A;  2ZXP A;  4NY3 A;  1ORY A;  2IXP A;  3KKB A;  4IWB A;  3RW0 A;  5A6B D;  3ZIB A;  4GYT A;  5BQG A;  5KYY B;  1OXK A;  4XPX A;  1QVX A;  4MVQ A;  3QZC A;  3CEX A;  3GEH A;  5DLJ A;  4A4A A;  3MX3 A;  3SXK A;  2Z15 A;  1GS9 A;  1SZI A;  1YDI A;  2Y3G A;  4BEJ A;  3JT1 A;  3US6 A;  3FHD A;  3L8J A;  4WGY A;  3EJN A;  2LIG A;  3HNK A;  1B68 A;  1VYK A;  2OJE D;  3T4R A;  3K1H A;  4EBJ A;  3UR3 C;  3RF3 A;  4U5F E;  1D0X A;  2R7S A;  1TWC A;  3ZQV A;  2R7U A;  1QLE C;  2VCC A;  4PK4 A;  4IJJ A;  2HFI A;  1I4Z A;  2KJG A;  3JYY A;  4JCZ A;  2D4U A;  2GWW A;  4XEV A;  4P9F A;  3SXM A;  1PV3 A;  2R7T A;  5GPG B;  2GAQ A;  3M1C B;  2YL1 A;  5E3A A;  1OR3 A;  1S05 A;  5B3I A;  3C8G D;  1TWH A;  1YZA A;  2Y3B A;  2C04 A;  2OU6 A;  4KI2 A;  4AL1 A;  5CIV A;  2H7O A;  2EIJ C;  1OR2 A;  1XZQ A;  5KYX A;  4OIP F;  1MND A;  5JRA A;  1LE4 A;  2Y39 A;  1V4A A;  1AUE A;  4JTD B;  4P9T A;  3GWN A;  3T9O A;  1OCO C;  3ZG1 A;  3JSE O;  5B3S C;  2Q3T A;  3PHF 2;  3W8H A;  3EHM A;  4PFP A;  2CCY A;  4ER9 A;  1OKK D;  3AG3 C;  2J9V A;  3IHU A;  3W2V A;  4I1M A;  2XLE A;  3EFO A;  1GGQ A;  1A41 A;  4PJJ A;  2MHR A;  1RXQ A;  3KH2 A;  4JW1 A;  2CYD A;  1M56 C;  2KQ9 A;  3IQ6 A;  3S28 A;  1BR1 A;  2L6G A;  1LI7 A;  4IAR A;  5COG A;  5JP7 A;  5T3W A;  4DOZ A;  1CGM E;  3GM2 A;  2LP4 A;  2NUP B;  1IZM A;  3I5P A;  1G5Z A;  4WJ0 A;  2Q9B A;  2YL3 A;  4YK5 A;  3UGO A;  2KNH A;  3UMK A;  4YL1 A;  2HJ3 A;  4OD4 A;  3GOR A;  2HV7 A;  1NSG B;  3K1I C;  4QDL A;  2Q00 A;  4U9D A;  3U0C A;  2WZL A;  2ZXR A;  3NKE A;  4DVY P;  3UGP A;  2AU5 A;  1ZVZ A;  2GA0 A;  2YRF A;  3DD7 A;  5TJ5 E;  5EGY A;  2XSE A;  3C63 A;  5KYX B;  3R2P A;  2OG2 A;  2F22 A;  1A7D A;  2VC9 A;  1VYI A;  3FAP B;  3Q6M A;  4U5D E;  1Z7Q c;  1O3U A;  1FMV A;  3S27 A;  4EWC A;  3LNR A;  4HFF B;  4MQ9 F;  3C8G A;  4AL0 A;  1K04 A;  2OKU A;  4U5C E;  3PMR A;  3EFO B;  3MLG A;  3ZSU A;  3CSK A;  1GM5 A;  4OIN F;  1OW6 A;  4W8K A;  2YL0 A;  2Q4F A;  1Z23 A;  2XLV A;  4K1O A;  5EK0 A;  4F4B A;  2R25 A;  1LKX A;  1T6U A;  1U89 A;  3IEE A;  3LJB A;  1MMG A;  3QTH A;  4MVU A;  3TJ5 A;  1JOG A;  4E7Z A;  3NG1 A;  1VMA A;  3LEO A;  2BL2 A;  1OKK A;  1PD0 A;  3ATP A;  3DI5 A;  4JE9 A;  2W45 A;  4U5E E;  3Q7G A;  3RKO F;  3S9O A;  4ANJ A;  3OEO A;  5L3Q A;  2RD9 A;  4IGG A;  2CNW D;  1YVI A;  4GEH A;  2J7P D;  1CGN A;  2YEV A;  1NU7 D;  2AVK A;  3S84 A;  4BPM A;  4RBN A;  3B0U X;  2P1A A;  3C7J A;  3IQC A;  5T3T A;  1NZE A;  2IXN A;  1EA8 A;  4D4N A;  4XWJ A;  1Q0D A;  5JLI A;  1CPQ A;  3C8G B;  4N06 A;  2PBE A;  1HMO A;  4NTF A;  3DJN B;  1OCC C;  3RQG A;  4CS8 C;  1M2V A;  4G78 A;  1TFO B;  2AWC A;  3JZ0 A;  3L8I A;  5DQT A;  1EQ1 A;  4L6R A;  1M2O A;  4PFO A;  1VLS A;  1T6I A;  3C8Z A;  3VYW A;  2DI3 A;  3W2W A;  3K33 A;  4JEB A;  2D5R B;  1RJ9 A;  3HNJ A;  1BR4 A;  4J7Y A;  1XZP A;  1Z6A A;  4Z9H A;  5KYY A;  4C3B A;  3DZA A;  4XLN F;  2Q9A A;  1Q0M A;  3C18 A;  2W4B A;  3N0T A;  1DOW A;  1VOM A;  3DM9 B;  2L9J A;  1CPR A;  1H7I A;  1CGO A;  2OCC C;  3AGU A;  3G50 A;  1PD1 A;  1EI7 A;  2LD6 A;  2ZPA A;  3HNI A;  4NC3 A;  1LIH A;  2CNW A;  3GM3 A;  4NTB A;  1H6G A;  256B A;  1OCZ C;  3EGX A;  1E84 A;  1TWA A;  4K0D A;  5CI9 A;  4JKV A;  1D1B A;  1FAP B;  2C03 A;  5JSL A;  2ZXW C;  3SYN A;  4YT5 A;  3WG7 C;  4ZLC A;  1NFO A;  1WOL A;  3ZVR A;  2HKV A;  4G7O F;  2G3V A;  4G7H F;  1ZU5 A;  4LLE A;  3AJM A;  2IBF A;  1BDJ B;  1RJ9 B;  2WZF A;  4CJG A;  1E2X A;  4J30 B;  5A6K A;  1T01 A;  4JCH A;  4MTG A;  2WZG A;  4YL3 A;  2Y3H A;  1H9T A;  2J45 A;  2HSB A;  3ZTZ A;  1ZW3 A;  1GQA A;  1NBB A;  4NCQ A;  2EIL C;  2QUP A;  4LAC B;  2B0H A;  3RVZ A;  3IQ5 A;  4YJW A;  4ZLD A;  3NYJ A;  4EIY A;  3U2M A;  2EPK X;  3CAX A;  4Z9I A;  2XS1 A;  3QMK A;  5A6J A;  1R5I D;  2GDC A;  2A6H F;  2TMV P;  3DWW A;  4WGZ A;  3DE8 A;  4JUR I;  3VM6 A;  1VB5 A;  3EGX B;  3ZC4 A;  2NUP A;  5B1A C;  2P7V A;  2IM8 A;  5AGF A;  1NLX A;  1J8M F;  1G4W R;  3I5Q A;  4H4K C;  2KK1 A;  1ZZP A;  4MVS A;  3U9J A;  2J46 A;  3R7C A;  4CS9 A;  4O6Y A;  4B6I A;  2A6E F;  2HZ8 A;  3FXH A;  4HEA J;  2AWY A;  2GFH A;  4OIO F; 
#chains in the Genus database with same CATH homology
 1Q0K A;  1Q0M A;  3G50 A;  1T6U A;  1Q0D A;  1T6Q A;  3G4Z A;  4NCQ A;  1Q0F A;  1T6I A;  1Q0G A;  3G4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...