2KNHA

The solution structure of the etafh domain of aml1-eto complexed with heb peptide
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
103
Chain Sequence
b'GAMGSGARQLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARLAKQNPAQYLAQHEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein CBFA2T1
publication title Structure of the AML1-ETO eTAFH domain-HEB peptide complex and its contribution to AML1-ETO activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator
total genus 24
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2009-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07531 TAFH NHR1 homology to TAF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1110 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2knhA00
2P6VA 2KNHA 2PP4A 2H7BA
chains in the Genus database with same CATH superfamily
3U3BA 3M1CB 5L0HA 1VLTA 2Y3DA 4IB4A 4PJJA 2H7OA 2YZSA 2OOCA 4PR9A 3ASNC 3ZIBA 3NYMA 4YK5A 4GQHA 2WVOA 3G50A 1WTYA 2Q00A 3ZDLA 1WN0A 3U3FA 4MVRA 4EHPA 1KTMA 4I1OB 5COGA 2ZXRA 5L3QA 3RVYA 2Z15A 5KYYB 2KSFA 3U2MA 3PHF2 2AVKA 1YYJA 4G0HA 1D1AA 4JTAB 3UNGC 4WGZA 1NZEA 1TWAA 3ZTMA 5JRAA 3NMIA 1OCCC 3C8GA 2XL4A 2P1AA 3Q7GA 1RJ9B 4MS2A 1ORSC 3FOPA 2XL6A 2HSQA 3U2LA 4EWCA 4OIRF 4U9DA 3S27A 4CS7A 2Y3BA 1V4AA 1KNYA 2J9WA 3KL4A 1MNEA 5K0IA 2XLVA 2XS8A 5DS4A 1MMAA 3LS0A 5CIVA 1UFBA 3KYIA 5L0DA 1ORJA 3LUTB 5E33A 3VRCA 3M4CA 4BJ6A 2W9YA 4MTFA 2HSBA 1E83A 1I5NA 4OIPF 3JYYA 2AWYA 3JRTA 5B3IA 4DRHB 2EPOA 1YLMA 4CS8C 2EPKX 2ZXOA 2W4MA 3LEVA 1LIHA 1FTSA 1TFOB 2HJMA 1B68A 1Z3IX 4GEHA 1NBBA 3AG4C 1SMYF 4JTCB 2VASA 4IGGA 2Q9BA 3VAYA 3B29A 1RKEB 3T6BA 3PMRA 1CGNA 1RKCA 4CSAA 3LAYA 1VK5A 3C63A 3H2UA 3RFYA 5A6JA 3UGPA 3C62A 3LLKA 2OEVA 1D1CA 2GFHA 1APCA 2J9UA 3SXYA 4BEMJ 3AG3C 1TR2A 4KBLA 2Y3HA 2P0NA 1JPJA 4NQFA 5L0FA 3O39A 1XZQA 3DJUB 3KH2A 2CNWA 1JMWA 2KJGA 3LNRA 2EILC 4JEBA 4DBQA 4C7OB 4CS9C 2VC9A 2CDQA 2R7SA 4MTOA 3RYLA 3NKDA 2LFFA 4MNDA 2J7PA 2PNOA 1G4US 2X0CA 3X2QC 4O6MA 4XTKA 4FWVA 1YVIA 5BQGA 5KYXA 2DB4A 2YQYA 1W2WA 4BJ5A 2QE9A 4NC3A 3CQZA 4ER9A 4XQ1A 2YLGA 2C04A 2EPMX 3AG1C 1IW7F 2ZXPA 4MVUA 4U5GA 4YT2A 3E70C 3W2WA 1MMNA 1OCOC 2WZLA 3N2ZB 4CIPA 5E3AA 1OW7A 2NPUA 3C8GB 2UUHA 2GWWA 3K66A 1Q0FA 3SYNA 4OD5A 1WATA 5JS5A 3ZSUA 1G5ZA 1VMAA 3RH3A 3LESA 4AX2A 2NG1A 1OXKA 2L9JA 2XRHA 3ZVRA 2EPNA 1EKYA 3NMKA 4R32A 1OW6A 4H4KC 2VCAA 4RBNA 2D4UA 2W4BA 1Z7Qc 2WZGA 3UMKA 1OR3A 4MVMA 5T1DB 5E2QA 3DMDA 3VF0A 4OIQF 2HJ3A 2VB6A 3B9QA 5CI9A 4KC9A 1K40A 2LP4A 3UGOA 3HNLA 3Q7LA 1O5HA 5L0JA 4JURI 1YZAA 4JE9A 2L6GA 3RQEA 3S28A 2NUPA 3AQBA 2MWQA 1ZYRF 5B3SC 5DLJA 4JW1A 3G4ZA 4LDRA 2P6VA 2YL1A 4XEKA 1Q0MA 3QTHA 2PF4E 4I44A 2EPLX 3C18A 3W4YA 4DOZA 4LLCA 2J9VA 2JPUA 4MW8A 4FAPB 3SXMA 1ST6A 1A7DA 2R7UA 2AU5A 2XLHA 4PFOA 1EA8A 5IY5C 4PACA 1V54C 4DJ9A 4YL1A 4WGYA 1GM5A 4JJFA 3AOUA 3FMSA 1LKXA 4XWJA 1RKEA 4A2NB 1OQCA 1V55C 3DJNB 3F46A 3DXJF 1U89A 5A6BD 1L3PA 4LDKA 3C7JA 1YJGA 1DOVA 4O79A 1PD0A 3AG2C 2PFDA 4NCQA 3A9CA 4C3BA 2Q3TA 3S29A 2DGJA 4KNWA 2ZPAA 5JUAA 4YN0B 5KYXB 2OG2A 3N0TA 1YAUO 5L0GA 4C7OA 4ONSA 2G3VA 2NSFA 4XPWA 2QUPA 2YEVA 5F28E 4NY3A 5JVEA 3AQCA 1AUEA 3B0UX 5L3VA 3OA1A 5B1AC 5EHHA 1SZIA 4NTBA 1RXQA 3LLIA 3ABMC 3TULA 4B6IA 1H9GA 2EIMC 3QZCA 4P9FA 1D0ZA 1G4WR 2KK1A 4CDYA 1GQAA 4J32B 4RD9A 2VCCA 1SR2A 2IBFA 5BQIA 1OKKD 3L8IA 4D4NA 2LK4A 2L6FA 1HMOA 2ICWG 3HLZA 2GDCA 3K1IA 1ZHYA 3JZ0A 3IQ6A 2XLDA 2HUJA 3U5SA 1TWGA 4HEAJ 1Y4CA 4NTAA 2ZXWC 3V7OA 1FAPB 1Z6AA 3RIPA 2KGOA 2NUPB 1LI5A 3TD7A 4E7ZA 3HKKA 1FMVA 1O87A 1XZPA 4JTDB 5A6KA 2JD3A 4O6YA 2XLMA 3EGXA 4J30B 1JPNA 3SEOA 4CJGA 4ZLCA 5KYWA 1T9KA 3B0VC 2CGEA 5DS5A 3EQLF 1Q0DA 3GORA 1OCZC 1QSPA 4E7SA 4CX9A 3DE8A 2LQGA 1TKNA 2LD6A 3S90A 5T3WA 4BPMA 4FESA 2DYRC 4MVSA 2HMZA 4EIYA 3GEHA 1WOLA 3NYLA 1H7IA 3L0IA 3T6JA 4U5CE 3OWTA 4MTGA 2A1DD 5HSWA 2KNHA 4PJLA 1L7CA 1C02A 1HW1A 2R7WA 2XS1A 2AWCA 1SYQA 1QVXA 3BRJA 4J7YA 4U5HA 1DOWA 2XSEA 3C8GD 3HTKC 3JCUQ 1Q0GA 4PFPA 1OXBA 3L1MA 4QI2A 4Q4ZF 5COMA 1T6UA 2DI3A 1LS4A 1MMGA 3OEOA 1JRAA 3G4XA 2MYSA 3ABKC 3DI5A 3GWNA 3KMIA 4MVZA 3PDMP 1HW2A 1E86A 5EK0A 2L6HA 5BUOA 2HS5A 3ABLC 3M79A 3TJ5A 3L8JA 1ZHZA 3QW1A 1NU7D 4C3EA 3K7DA 3RF3A 3DAFA 3LEOA 1H6GA 3EJNA 3ASOC 4RDAA 3FVYA 4OINF 4YWQA 2R02A 3MLGA 1BDJB 3NRHA 4I3MA 3SNHA 1VB5A 3O10A 4FX5A 2PX0A 3V5YA 4HFFB 1J8YF 1FFHA 2B0HA 4F4BA 1NLXA 4IAOA 1A0BA 2WB7A 1PD1A 4JJGA 1NFNA 2LCHA 3PCVA 3X1OA 4CS9A 4BJ5C 2QLAA 4X0RA 2FAPB 1PCXA 2KQ9A 3DWWA 4BG0A 4QI0A 1TQGA 4AE4A 1K04A 1HE1A 2J45A 2LFDA 2VH3A 1M2OA 2A68F 2OU6A 4Q7CA 4O7GA 4E0HA 4KNVA 3W2VA 5JP7A 2KYHA 3GM3A 1VTMP 3VM6A 2R7RA 1CPRA 4K1OA 1O3UA 1Z23A 5E3CA 4EBKA 2W45A 2CNWD 2BL2A 4OIOF 1M6TA 1CPQA 2M64A 2IYLD 3HNIA 5JT4A 1GGQA 1M2VA 1RCPA 4JCHA 2J46A 1AVOB 2Y69C 3EGXB 4XPYA 3DAGA 3IEEA 2NUTA 3BEHA 5KYWB 2J7PD 3V5XA 3T6GB 1YDIA 4C3DA 3L34A 1SF8A 3GM2A 1LI7A 3ZQVA 2XM0A 1E2XA 5KYNA 3GM1A 4G7OF 2H7BA 3MYFA 4N4WA 4QDLA 1D0XA 2IXMA 4DBRA 3JRMO 3VYWA 2DYSC 4IRUA 2F22A 1F1MA 3NKEA 3RW0A 4ANJA 1I4ZA 2HMQA 3F47A 3NYJA 4BJTA 2P7VA 1EQ1A 1BR4A 2XLEA 1FFTC 3GANA 3K33A 5AC4A 3JSEO 3H65A 5GPGB 2FFHA 4AK9A 3V5ZA 3EPVA 5TJ5E 5BQHA 2A6EF 1JAFA 1GS9A 1LE4A 1VOMA 256BA 1YA7O 3I5PA 4LACB 4N6CA 2R9RB 2QTVA 3FHDA 4PJNA 3R7CA 4W8KA 5FCLA 3NDBB 2J0WA 2J8WA 2I15A 2EIJC 3GODA 5KYUA 5DQZA 3GWLA 3EG9A 3S9OA 3WHNA 3CEXA 3JYHA 4YL3A 1EI7A 2IM8A 1NG1A 1TWCA 2WZFA 3JTLO 4G78A 3IQ5A 3W8IA 1A7EA 4KI2A 1S7ZA 2Q4FA 1TWHA 3I5QA 4ULWA 1PV3A 1LM3B 3NMJA 4U5BE 4YT4A 2L81A 4U5DE 3I4UA 1IZMA 3ZWIA 2R7OA 1WGWA 4XLNF 2AP3A 5A69A 4EBBA 3QVZA 4CDVA 1ZU4A 3FAPB 3O55A 2GA0A 4JC7A 2HKVA 3KYJA 3SXKA 4AE4B 3FOOA 1E84A 3LJBA 1XWJA 2R7XA 2PBEA 2OEXA 1MNDA 2HZ8A 4HE8D 4H54A 2OJED 4DRJB 1VLSA 3QVYA 1ZVZA 3AGTA 2NSGA 1QPUA 3E9VA 1BR1A 3R2PA 3EHMA 4JRZA 1LS1A 3T4RA 3CAXA 4NTFA 3WODF 4UDVA 1CGME 1NU9C 4Z9JA 3EZHA 3US6A 2ASRA 2J0XA 3ECSA 1YARO 2G62A 2X51A 3B71A 3EGDA 2PP4A 1M2VB 3GEEA 4XLPF 2NUTB 4JIOA 5DVWA 1V74B 2VCBA 5D91A 1C03A 4BEJA 4YT8A 1BZ4A 3K1IC 1ZW3A 4CBEA 3LS1A 1K05A 1R4TA 2YL7A 4XEVA 2IXNA 2HV7A 2YLDA 3A11A 1ZHWA 5D92A 3UMIA 5AC5A 4L6RA 5B1BC 2H8AA 3CZ6A 1J8MF 2B0JA 4MVQA 2R05A 3POVA 1HMDA 3ZTZA 4J7TA 4BJ6C 3N24A 1OCRC 3DD7A 3IHUA 1WASA 3QW0A 4U5EE 4DRIB 3TJ6A 1HE9A 1QQ3A 2V26A 3EH1A 3M15A 5L0CA 3U9JA 2EINC 1T01A 1A41A 4Z9HA 3K1HA 1RMVA 1JR8A 2CYDA 5HV9A 1QZXA 2Q7RA 2XXAA 3UR3C 4GYTA 1QKRA 2MHRA 4MVOA 4XEFA 3MFNA 2Q9AA 2R7TA 3ZQYA 5AGFA 3EFOA 2XLOA 5T3TA 2C03A 2YLIA 5KYUB 1E85A 2FGYA 3EG9B 3U8VA 2XM4A 4CS8A 4CSAC 2IXPA 2A0UA 4E0IA 4DVZA 2GAQA 1Y6DA 2A0BA 3DZAA 3U9MA 2R25A 4DVYP 2V3CC 4Q5SF 2YRFA 3NG1A 4K0DA 3LNMB 2BC5A 1VYKA 1YZCA 2WVNA 3IQTA 3ITFA 2OCCC 1U6HA 4Z9IA 2LIGA 3MYIA 3RQGA 2LSEA 2Y3GA 5CI8A 3SZRA 3TOMA 2XL8A 1MQVA 4PJMA 4EKWA 4LLEA 4IJJA 1LPEA 1HY5A 5L0IA 5JSLA 5DS6A 5JLIA 2ETSA 4MQ9F 2PX3A 1WWPA 2ZD9A 1ZU5A 3KPHA 1JOGA 2R03A 2OQMA 4K7BA 4WABA 2QNLA 3Q6NA 2P61A 3JT1A 1H9TA 3WAQA 1UG7A 4DXWA 2D5RB 3EGDB 3IQCA 4PK4A 4E17A 4AL0A 4P9TA 3MX3A 2YL3A 2Q9CA 4IAQA 4MW3A 2KC3A 1YYXA 1N1CA 1QLEC 1TFKB 2I8BA 3TK0A 3TQOA 1C17M 3FAJA 1U0BB 2IXOA 1ZHTA 1MMDA 3EZIA 2OJQA 4LERA 3U8PA 1NFOA 4LDQA 2R7VA 4P6IC 1OW8A 2TMVP 3C8ZA 4CJOA 4O6NA 3MBGA 4BJ1A 2CW0F 3DE9A 5F5FA 3JSZA 3QMKA 2OKUA 2A6HF 3AJMA 3FDQA 4D4XA 3GEIA 2KW3C 4YT5A 4A4AA 4EBJA 5KYYA 1A7VA 1M57C 4JVSA 1Q0KA 4M63A 4U5FE 3HNKA 4N06A 3TOLA 3WG7C 1Z63A 1I4YA 1FMWA 2G3KA 4ZLDA 1AEPA 3EH2A 3SP1A 5EGYA 2A69F 2XXAB 2IOQA 1T6QA 1OR2A 1CGOA 1RJ9A 2YWAA 1FNTc 3J06A 1ORYA 2E87A 3AGUA 2J9BA 4JZAA 4CIHA 5A6BA 2UUIA 3EFOB 1R5ID 4EUKB 3CSKA 1BR2A 1ZZPA 3IPMO 3RKOF 1ZHXA 1M56C 4XPXA 2O9XA 3RQFA 2EIKC 3SXZA 1VYIA 3HNJA 2M4EA 3HJCA 2R7QA 2YHSA 4YL0A 2YKZA 3S84A 1LE2A 2RSEB 2WVQA 1NSGB 2RD9A 3M4BA 4YJWA 3ZG1A 3S0XA 3U0CA 2YVKA 4HFKB 4JKVA 3EHNA 2YL0A 4AL1A 4G7ZF 2Y39A 3K6BA 3ATPA 2H7VC 5A6AA 4I1MA 1BBHA 1G8XA 2HV6A 3DKAA 4IARA 4JEAA 5COFA 2BE5F 1S05A 2CCYA 3O6XA 4JCZA 1D0YA 1YA9A 4U9EA 4CDAA 1OKKA 3DM5A 2L7AA 1KU2A 2QY9A 4E18A 3T9OA 2XLWA 3Q6MA 1FR0A 4WJ0A 1D1BA 4G7HF 1T5OA 3B0PA 3DM9B 5FZTA 5F5HA 4IWBA 1ZW2A 3KKBA 4ULVA 2HFIA 1T6IA 2JX0A 3RVZA 3W8HA 5DQTA 3H2VA 4W8PA 3FXHA 4OD4A 3UMHA 1Z5ZA 1LVKA 2WL8A 4N6HA 3ZC4A
chains in the Genus database with same CATH topology
3M1CB 2Y3DA 4PJJA 2H7OA 2YZSA 3ZIBA 3ASNC 3NYMA 2WVOA 1LVKA 4I1OB 2ZXRA 5L3QA 2Z15A 5KYYB 3PHF2 4G0HA 3UNGC 1D1AA 1NZEA 1TWAA 1OCCC 2XL4A 3Q7GA 1RJ9B 4EWCA 4OIRF 3S27A 4CS7A 2Y3BA 2J9WA 3KL4A 1MNEA 5DS4A 1MMAA 3LS0A 5E33A 4BJ6A 2W9YA 4OIPF 3JRTA 4CS8C 2ZXOA 2W4MA 3LEVA 1FTSA 1Z3IX 4GEHA 3AG4C 3VAYA 1SMYF 2VASA 2Q9BA 3T6BA 3PMRA 4CSAA 3LAYA 1VK5A 3RFYA 3UGPA 3LLKA 1D1CA 2GFHA 2J9UA 3AG3C 1TR2A 4KBLA 2Y3HA 1JPJA 3O39A 3KH2A 3DJUB 2CNWA 2KJGA 3LNRA 4C7OB 2EILC 4DBQA 4CS9C 2CDQA 2R7SA 3RYLA 3NKDA 4MNDA 2J7PA 3X2QC 4O6MA 4XTKA 4FWVA 5KYXA 1W2WA 4BJ5A 3CQZA 2C04A 3AG1C 1IW7F 2ZXPA 4U5GA 4YT2A 3E70C 3W2WA 3N2ZB 1MMNA 1OCOC 2WZLA 5E3AA 3K66A 3SYNA 4OD5A 3ZSUA 3RH3A 1VMAA 3LESA 4AX2A 2NG1A 2XRHA 2L9JA 3ZVRA 4H4KC 4RBNA 2W4BA 2WZGA 3UMKA 5T1DB 5E2QA 3DMDA 4OIQF 2VB6A 3B9QA 5CI9A 4KC9A 3UGOA 3Q7LA 1O5HA 4JURI 3S28A 2NUPA 3AQBA 2MWQA 1ZYRF 5B3SC 5DLJA 4JW1A 2P6VA 2PF4E 4I44A 4DOZA 4LLCA 2J9VA 2R7UA 1ST6A 4PFOA 5IY5C 1V54C 4JJFA 1LKXA 4XWJA 4A2NB 1V55C 3DJNB 3F46A 3DXJF 4O79A 1PD0A 3AG2C 2PFDA 4C3BA 2Q3TA 3S29A 2DGJA 4KNWA 2ZPAA 4YN0B 5KYXB 2OG2A 3N0TA 4C7OA 2G3VA 2YEVA 4NY3A 3AQCA 3B0UX 5L3VA 3OA1A 5B1AC 5EHHA 1SZIA 3LLIA 3ABMC 4B6IA 2EIMC 3QZCA 1D0ZA 4J32B 4RD9A 1OKKD 3HLZA 1ZHYA 1TWGA 4HEAJ 2ZXWC 3V7OA 1Z6AA 3RIPA 2KGOA 2NUPB 3TD7A 4E7ZA 1FMVA 1O87A 2JD3A 4O6YA 3EGXA 4J30B 1JPNA 3SEOA 5KYWA 4ZLCA 3B0VC 5DS5A 2CGEA 3EQLF 1OCZC 4E7SA 1TKNA 5T3WA 4FESA 2DYRC 3NYLA 3T6JA 3L0IA 4U5CE 3OWTA 2A1DD 5HSWA 2KNHA 4PJLA 2R7WA 3SZRA 4U5HA 2XSEA 3HTKC 3JCUQ 4PFPA 4QI2A 4Q4ZF 1MMGA 3OEOA 2MYSA 3ABKC 3KMIA 5BUOA 3ABLC 1ZHZA 4C3EA 1NU7D 3K7DA 3DAFA 3EJNA 3ASOC 4RDAA 3FVYA 4OINF 4YWQA 3MLGA 3NRHA 4I3MA 3SNHA 4FX5A 2PX0A 4HFFB 1J8YF 1FFHA 4F4BA 4IAOA 2WB7A 1PD1A 4JJGA 3X1OA 4CS9A 4BJ5C 4X0RA 1PCXA 2KQ9A 4BG0A 4QI0A 4AE4A 2J45A 2VH3A 1M2OA 2A68F 4Q7CA 4O7GA 4KNVA 3W2VA 2R7RA 1Z23A 5E3CA 2W45A 2CNWD 4OIOF 2IYLD 1M2VA 4JCHA 2J46A 3EGXB 2Y69C 2NUTA 5KYWB 3DAGA 3IEEA 2J7PD 4C3DA 3L34A 1SF8A 5KYNA 2H7BA 4QDLA 1D0XA 2IXMA 4DBRA 3VYWA 2DYSC 4IRUA 4ANJA 3NKEA 3F47A 3NYJA 4BJTA 2P7VA 1BR4A 1FFTC 3GANA 3K33A 3H65A 2FFHA 4AK9A 3EPVA 2A6EF 1VOMA 3I5PA 4LACB 4PJNA 2QTVA 3FHDA 5FCLA 4W8KA 3NDBB 2J0WA 2EIJC 3GODA 5KYUA 5DQZA 3EG9A 3JYHA 2WZFA 1NG1A 1TWCA 3W8IA 4KI2A 1S7ZA 1TWHA 3I5QA 4ULWA 4U5BE 4YT4A 2L81A 4U5DE 3I4UA 1IZMA 2R7OA 1WGWA 4XLNF 4EBBA 1ZU4A 4AE4B 3LJBA 2R7XA 1MNDA 4HE8D 3E9VA 3T4RA 1BR1A 4G7OF 3EHMA 1LS1A 3WODF 1NU9C 3EZHA 2J0XA 3ECSA 2G62A 3EGDA 2X51A 2PP4A 1M2VB 4XLPF 2NUTB 5DVWA 5D91A 4BEJA 4YT8A 3K1IC 4CBEA 2IXNA 2HV7A 1ZHWA 5D92A 3UMIA 5B1BC 3CZ6A 1J8MF 2B0JA 3POVA 4BJ6C 3N24A 1OCRC 3DD7A 4U5EE 3EH1A 2V26A 2EINC 3K1HA 1QZXA 2XXAA 3UR3C 4GYTA 2Q9AA 2R7TA 3EFOA 5T3TA 2C03A 5KYUB 4CSAC 2FGYA 3EG9B 4CS8A 2IXPA 4DVZA 3DZAA 4DVYP 2V3CC 4Q5SF 3NG1A 4K0DA 1VYKA 2WVNA 3ITFA 2OCCC 2LSEA 2Y3GA 5CI8A 4PJMA 4LLEA 4IJJA 5DS6A 4MQ9F 2PX3A 1ZU5A 4K7BA 3Q6NA 3JT1A 2D5RB 3EGDB 4PK4A 3MX3A 2Q9CA 1N1CA 1QLEC 2I8BA 3FAJA 2IXOA 1ZHTA 1MMDA 3EZIA 2R7VA 4LERA 4P6IC 4O6NA 4BJ1A 5F5FA 2CW0F 3JSZA 3QMKA 2A6HF 3FDQA 4YT5A 2KW3C 5KYYA 1M57C 4JVSA 4M63A 4U5FE 4N06A 3WG7C 4ZLDA 1Z63A 1FMWA 2G3KA 3EH2A 3SP1A 5EGYA 2A69F 2XXAB 2IOQA 1RJ9A 2E87A 4JZAA 4CIHA 3EFOB 3CSKA 1BR2A 3RKOF 1ZHXA 1M56C 2O9XA 2EIKC 1VYIA 2M4EA 3HJCA 2R7QA 2YHSA 2WVQA 4YJWA 3ZG1A 3S0XA 4HFKB 3EHNA 4G7ZF 2Y39A 3K6BA 2H7VC 4I1MA 2HV6A 1G8XA 2BE5F 3O6XA 1D0YA 1OKKA 3DM5A 1KU2A 2QY9A 3Q6MA 4WJ0A 1D1BA 4G7HF 3B0PA 3DM9B 5F5HA 4IWBA 3KKBA 3W8HA 5DQTA 4OD4A 3UMHA 1Z5ZA 3LS1A 2WL8A 3ZC4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P6V A;  2KNH A;  2PP4 A;  2H7B A; 
#chains in the Genus database with same CATH topology
 3U3B A;  3M1C B;  5L0H A;  1VLT A;  2Y3D A;  4IB4 A;  4PJJ A;  2H7O A;  2YZS A;  2OOC A;  4PR9 A;  3ASN C;  3ZIB A;  3NYM A;  4YK5 A;  4GQH A;  2WVO A;  3G50 A;  1WTY A;  2Q00 A;  3ZDL A;  1WN0 A;  3U3F A;  4MVR A;  4EHP A;  1KTM A;  4I1O B;  5COG A;  2ZXR A;  5L3Q A;  3RVY A;  2Z15 A;  5KYY B;  2KSF A;  3U2M A;  3PHF 2;  2AVK A;  1YYJ A;  4G0H A;  1D1A A;  4JTA B;  3UNG C;  4WGZ A;  1NZE A;  1TWA A;  3ZTM A;  5JRA A;  3NMI A;  1OCC C;  3C8G A;  2XL4 A;  2P1A A;  3Q7G A;  1RJ9 B;  4MS2 A;  1ORS C;  3FOP A;  2XL6 A;  2HSQ A;  3U2L A;  4EWC A;  4OIR F;  4U9D A;  3S27 A;  4CS7 A;  2Y3B A;  1V4A A;  1KNY A;  2J9W A;  3KL4 A;  1MNE A;  5K0I A;  2XLV A;  2XS8 A;  5DS4 A;  1MMA A;  3LS0 A;  5CIV A;  1UFB A;  3KYI A;  5L0D A;  1ORJ A;  3LUT B;  5E33 A;  3VRC A;  3M4C A;  4BJ6 A;  2W9Y A;  4MTF A;  2HSB A;  1E83 A;  1I5N A;  4OIP F;  3JYY A;  2AWY A;  3JRT A;  5B3I A;  4DRH B;  2EPO A;  1YLM A;  4CS8 C;  2EPK X;  2ZXO A;  2W4M A;  3LEV A;  1LIH A;  1FTS A;  1TFO B;  2HJM A;  1B68 A;  1Z3I X;  4GEH A;  1NBB A;  3AG4 C;  1SMY F;  4JTC B;  2VAS A;  4IGG A;  2Q9B A;  3VAY A;  3B29 A;  1RKE B;  3T6B A;  3PMR A;  1CGN A;  1RKC A;  4CSA A;  3LAY A;  1VK5 A;  3C63 A;  3H2U A;  3RFY A;  5A6J A;  3UGP A;  3C62 A;  3LLK A;  2OEV A;  1D1C A;  2GFH A;  1APC A;  2J9U A;  3SXY A;  4BEM J;  3AG3 C;  1TR2 A;  4KBL A;  2Y3H A;  2P0N A;  1JPJ A;  4NQF A;  5L0F A;  3O39 A;  1XZQ A;  3DJU B;  3KH2 A;  2CNW A;  1JMW A;  2KJG A;  3LNR A;  2EIL C;  4JEB A;  4DBQ A;  4C7O B;  4CS9 C;  2VC9 A;  2CDQ A;  2R7S A;  4MTO A;  3RYL A;  3NKD A;  2LFF A;  4MND A;  2J7P A;  2PNO A;  1G4U S;  2X0C A;  3X2Q C;  4O6M A;  4XTK A;  4FWV A;  1YVI A;  5BQG A;  5KYX A;  2DB4 A;  2YQY A;  1W2W A;  4BJ5 A;  2QE9 A;  4NC3 A;  3CQZ A;  4ER9 A;  4XQ1 A;  2YLG A;  2C04 A;  2EPM X;  3AG1 C;  1IW7 F;  2ZXP A;  4MVU A;  4U5G A;  4YT2 A;  3E70 C;  3W2W A;  1MMN A;  1OCO C;  2WZL A;  3N2Z B;  4CIP A;  5E3A A;  1OW7 A;  2NPU A;  3C8G B;  2UUH A;  2GWW A;  3K66 A;  1Q0F A;  3SYN A;  4OD5 A;  1WAT A;  5JS5 A;  3ZSU A;  1G5Z A;  1VMA A;  3RH3 A;  3LES A;  4AX2 A;  2NG1 A;  1OXK A;  2L9J A;  2XRH A;  3ZVR A;  2EPN A;  1EKY A;  3NMK A;  4R32 A;  1OW6 A;  4H4K C;  2VCA A;  4RBN A;  2D4U A;  2W4B A;  1Z7Q c;  2WZG A;  3UMK A;  1OR3 A;  4MVM A;  5T1D B;  5E2Q A;  3DMD A;  3VF0 A;  4OIQ F;  2HJ3 A;  2VB6 A;  3B9Q A;  5CI9 A;  4KC9 A;  1K40 A;  2LP4 A;  3UGO A;  3HNL A;  3Q7L A;  1O5H A;  5L0J A;  4JUR I;  1YZA A;  4JE9 A;  2L6G A;  3RQE A;  3S28 A;  2NUP A;  3AQB A;  2MWQ A;  1ZYR F;  5B3S C;  5DLJ A;  4JW1 A;  3G4Z A;  4LDR A;  2P6V A;  2YL1 A;  4XEK A;  1Q0M A;  3QTH A;  2PF4 E;  4I44 A;  2EPL X;  3C18 A;  3W4Y A;  4DOZ A;  4LLC A;  2J9V A;  2JPU A;  4MW8 A;  4FAP B;  3SXM A;  1ST6 A;  1A7D A;  2R7U A;  2AU5 A;  2XLH A;  4PFO A;  1EA8 A;  5IY5 C;  4PAC A;  1V54 C;  4DJ9 A;  4YL1 A;  4WGY A;  1GM5 A;  4JJF A;  3AOU A;  3FMS A;  1LKX A;  4XWJ A;  1RKE A;  4A2N B;  1OQC A;  1V55 C;  3DJN B;  3F46 A;  3DXJ F;  1U89 A;  5A6B D;  1L3P A;  4LDK A;  3C7J A;  1YJG A;  1DOV A;  4O79 A;  1PD0 A;  3AG2 C;  2PFD A;  4NCQ A;  3A9C A;  4C3B A;  2Q3T A;  3S29 A;  2DGJ A;  4KNW A;  2ZPA A;  5JUA A;  4YN0 B;  5KYX B;  2OG2 A;  3N0T A;  1YAU O;  5L0G A;  4C7O A;  4ONS A;  2G3V A;  2NSF A;  4XPW A;  2QUP A;  2YEV A;  5F28 E;  4NY3 A;  5JVE A;  3AQC A;  1AUE A;  3B0U X;  5L3V A;  3OA1 A;  5B1A C;  5EHH A;  1SZI A;  4NTB A;  1RXQ A;  3LLI A;  3ABM C;  3TUL A;  4B6I A;  1H9G A;  2EIM C;  3QZC A;  4P9F A;  1D0Z A;  1G4W R;  2KK1 A;  4CDY A;  1GQA A;  4J32 B;  4RD9 A;  2VCC A;  1SR2 A;  2IBF A;  5BQI A;  1OKK D;  3L8I A;  4D4N A;  2LK4 A;  2L6F A;  1HMO A;  2ICW G;  3HLZ A;  2GDC A;  3K1I A;  1ZHY A;  3JZ0 A;  3IQ6 A;  2XLD A;  2HUJ A;  3U5S A;  1TWG A;  4HEA J;  1Y4C A;  4NTA A;  2ZXW C;  3V7O A;  1FAP B;  1Z6A A;  3RIP A;  2KGO A;  2NUP B;  1LI5 A;  3TD7 A;  4E7Z A;  3HKK A;  1FMV A;  1O87 A;  1XZP A;  4JTD B;  5A6K A;  2JD3 A;  4O6Y A;  2XLM A;  3EGX A;  4J30 B;  1JPN A;  3SEO A;  4CJG A;  4ZLC A;  5KYW A;  1T9K A;  3B0V C;  2CGE A;  5DS5 A;  3EQL F;  1Q0D A;  3GOR A;  1OCZ C;  1QSP A;  4E7S A;  4CX9 A;  3DE8 A;  2LQG A;  1TKN A;  2LD6 A;  3S90 A;  5T3W A;  4BPM A;  4FES A;  2DYR C;  4MVS A;  2HMZ A;  4EIY A;  3GEH A;  1WOL A;  3NYL A;  1H7I A;  3L0I A;  3T6J A;  4U5C E;  3OWT A;  4MTG A;  2A1D D;  5HSW A;  2KNH A;  4PJL A;  1L7C A;  1C02 A;  1HW1 A;  2R7W A;  2XS1 A;  2AWC A;  1SYQ A;  1QVX A;  3BRJ A;  4J7Y A;  4U5H A;  1DOW A;  2XSE A;  3C8G D;  3HTK C;  3JCU Q;  1Q0G A;  4PFP A;  1OXB A;  3L1M A;  4QI2 A;  4Q4Z F;  5COM A;  1T6U A;  2DI3 A;  1LS4 A;  1MMG A;  3OEO A;  1JRA A;  3G4X A;  2MYS A;  3ABK C;  3DI5 A;  3GWN A;  3KMI A;  4MVZ A;  3PDM P;  1HW2 A;  1E86 A;  5EK0 A;  2L6H A;  5BUO A;  2HS5 A;  3ABL C;  3M79 A;  3TJ5 A;  3L8J A;  1ZHZ A;  3QW1 A;  1NU7 D;  4C3E A;  3K7D A;  3RF3 A;  3DAF A;  3LEO A;  1H6G A;  3EJN A;  3ASO C;  4RDA A;  3FVY A;  4OIN F;  4YWQ A;  2R02 A;  3MLG A;  1BDJ B;  3NRH A;  4I3M A;  3SNH A;  1VB5 A;  3O10 A;  4FX5 A;  2PX0 A;  3V5Y A;  4HFF B;  1J8Y F;  1FFH A;  2B0H A;  4F4B A;  1NLX A;  4IAO A;  1A0B A;  2WB7 A;  1PD1 A;  4JJG A;  1NFN A;  2LCH A;  3PCV A;  3X1O A;  4CS9 A;  4BJ5 C;  2QLA A;  4X0R A;  2FAP B;  1PCX A;  2KQ9 A;  3DWW A;  4BG0 A;  4QI0 A;  1TQG A;  4AE4 A;  1K04 A;  1HE1 A;  2J45 A;  2LFD A;  2VH3 A;  1M2O A;  2A68 F;  2OU6 A;  4Q7C A;  4O7G A;  4E0H A;  4KNV A;  3W2V A;  5JP7 A;  2KYH A;  3GM3 A;  1VTM P;  3VM6 A;  2R7R A;  1CPR A;  4K1O A;  1O3U A;  1Z23 A;  5E3C A;  4EBK A;  2W45 A;  2CNW D;  2BL2 A;  4OIO F;  1M6T A;  1CPQ A;  2M64 A;  2IYL D;  3HNI A;  5JT4 A;  1GGQ A;  1M2V A;  1RCP A;  4JCH A;  2J46 A;  1AVO B;  2Y69 C;  3EGX B;  4XPY A;  3DAG A;  3IEE A;  2NUT A;  3BEH A;  5KYW B;  2J7P D;  3V5X A;  3T6G B;  1YDI A;  4C3D A;  3L34 A;  1SF8 A;  3GM2 A;  1LI7 A;  3ZQV A;  2XM0 A;  1E2X A;  5KYN A;  3GM1 A;  4G7O F;  2H7B A;  3MYF A;  4N4W A;  4QDL A;  1D0X A;  2IXM A;  4DBR A;  3JRM O;  3VYW A;  2DYS C;  4IRU A;  2F22 A;  1F1M A;  3NKE A;  3RW0 A;  4ANJ A;  1I4Z A;  2HMQ A;  3F47 A;  3NYJ A;  4BJT A;  2P7V A;  1EQ1 A;  1BR4 A;  2XLE A;  1FFT C;  3GAN A;  3K33 A;  5AC4 A;  3JSE O;  3H65 A;  5GPG B;  2FFH A;  4AK9 A;  3V5Z A;  3EPV A;  5TJ5 E;  5BQH A;  2A6E F;  1JAF A;  1GS9 A;  1LE4 A;  1VOM A;  256B A;  1YA7 O;  3I5P A;  4LAC B;  4N6C A;  2R9R B;  2QTV A;  3FHD A;  4PJN A;  3R7C A;  4W8K A;  5FCL A;  3NDB B;  2J0W A;  2J8W A;  2I15 A;  2EIJ C;  3GOD A;  5KYU A;  5DQZ A;  3GWL A;  3EG9 A;  3S9O A;  3WHN A;  3CEX A;  3JYH A;  4YL3 A;  1EI7 A;  2IM8 A;  1NG1 A;  1TWC A;  2WZF A;  3JTL O;  4G78 A;  3IQ5 A;  3W8I A;  1A7E A;  4KI2 A;  1S7Z A;  2Q4F A;  1TWH A;  3I5Q A;  4ULW A;  1PV3 A;  1LM3 B;  3NMJ A;  4U5B E;  4YT4 A;  2L81 A;  4U5D E;  3I4U A;  1IZM A;  3ZWI A;  2R7O A;  1WGW A;  4XLN F;  2AP3 A;  5A69 A;  4EBB A;  3QVZ A;  4CDV A;  1ZU4 A;  3FAP B;  3O55 A;  2GA0 A;  4JC7 A;  2HKV A;  3KYJ A;  3SXK A;  4AE4 B;  3FOO A;  1E84 A;  3LJB A;  1XWJ A;  2R7X A;  2PBE A;  2OEX A;  1MND A;  2HZ8 A;  4HE8 D;  4H54 A;  2OJE D;  4DRJ B;  1VLS A;  3QVY A;  1ZVZ A;  3AGT A;  2NSG A;  1QPU A;  3E9V A;  1BR1 A;  3R2P A;  3EHM A;  4JRZ A;  1LS1 A;  3T4R A;  3CAX A;  4NTF A;  3WOD F;  4UDV A;  1CGM E;  1NU9 C;  4Z9J A;  3EZH A;  3US6 A;  2ASR A;  2J0X A;  3ECS A;  1YAR O;  2G62 A;  2X51 A;  3B71 A;  3EGD A;  2PP4 A;  1M2V B;  3GEE A;  4XLP F;  2NUT B;  4JIO A;  5DVW A;  1V74 B;  2VCB A;  5D91 A;  1C03 A;  4BEJ A;  4YT8 A;  1BZ4 A;  3K1I C;  1ZW3 A;  4CBE A;  3LS1 A;  1K05 A;  1R4T A;  2YL7 A;  4XEV A;  2IXN A;  2HV7 A;  2YLD A;  3A11 A;  1ZHW A;  5D92 A;  3UMI A;  5AC5 A;  4L6R A;  5B1B C;  2H8A A;  3CZ6 A;  1J8M F;  2B0J A;  4MVQ A;  2R05 A;  3POV A;  1HMD A;  3ZTZ A;  4J7T A;  4BJ6 C;  3N24 A;  1OCR C;  3DD7 A;  3IHU A;  1WAS A;  3QW0 A;  4U5E E;  4DRI B;  3TJ6 A;  1HE9 A;  1QQ3 A;  2V26 A;  3EH1 A;  3M15 A;  5L0C A;  3U9J A;  2EIN C;  1T01 A;  1A41 A;  4Z9H A;  3K1H A;  1RMV A;  1JR8 A;  2CYD A;  5HV9 A;  1QZX A;  2Q7R A;  2XXA A;  3UR3 C;  4GYT A;  1QKR A;  2MHR A;  4MVO A;  4XEF A;  3MFN A;  2Q9A A;  2R7T A;  3ZQY A;  5AGF A;  3EFO A;  2XLO A;  5T3T A;  2C03 A;  2YLI A;  5KYU B;  1E85 A;  2FGY A;  3EG9 B;  3U8V A;  2XM4 A;  4CS8 A;  4CSA C;  2IXP A;  2A0U A;  4E0I A;  4DVZ A;  2GAQ A;  1Y6D A;  2A0B A;  3DZA A;  3U9M A;  2R25 A;  4DVY P;  2V3C C;  4Q5S F;  2YRF A;  3NG1 A;  4K0D A;  3LNM B;  2BC5 A;  1VYK A;  1YZC A;  2WVN A;  3IQT A;  3ITF A;  2OCC C;  1U6H A;  4Z9I A;  2LIG A;  3MYI A;  3RQG A;  2LSE A;  2Y3G A;  5CI8 A;  3SZR A;  3TOM A;  2XL8 A;  1MQV A;  4PJM A;  4EKW A;  4LLE A;  4IJJ A;  1LPE A;  1HY5 A;  5L0I A;  5JSL A;  5DS6 A;  5JLI A;  2ETS A;  4MQ9 F;  2PX3 A;  1WWP A;  2ZD9 A;  1ZU5 A;  3KPH A;  1JOG A;  2R03 A;  2OQM A;  4K7B A;  4WAB A;  2QNL A;  3Q6N A;  2P61 A;  3JT1 A;  1H9T A;  3WAQ A;  1UG7 A;  4DXW A;  2D5R B;  3EGD B;  3IQC A;  4PK4 A;  4E17 A;  4AL0 A;  4P9T A;  3MX3 A;  2YL3 A;  2Q9C A;  4IAQ A;  4MW3 A;  2KC3 A;  1YYX A;  1N1C A;  1QLE C;  1TFK B;  2I8B A;  3TK0 A;  3TQO A;  1C17 M;  3FAJ A;  1U0B B;  2IXO A;  1ZHT A;  1MMD A;  3EZI A;  2OJQ A;  4LER A;  3U8P A;  1NFO A;  4LDQ A;  2R7V A;  4P6I C;  1OW8 A;  2TMV P;  3C8Z A;  4CJO A;  4O6N A;  3MBG A;  4BJ1 A;  2CW0 F;  3DE9 A;  5F5F A;  3JSZ A;  3QMK A;  2OKU A;  2A6H F;  3AJM A;  3FDQ A;  4D4X A;  3GEI A;  2KW3 C;  4YT5 A;  4A4A A;  4EBJ A;  5KYY A;  1A7V A;  1M57 C;  4JVS A;  1Q0K A;  4M63 A;  4U5F E;  3HNK A;  4N06 A;  3TOL A;  3WG7 C;  1Z63 A;  1I4Y A;  1FMW A;  2G3K A;  4ZLD A;  1AEP A;  3EH2 A;  3SP1 A;  5EGY A;  2A69 F;  2XXA B;  2IOQ A;  1T6Q A;  1OR2 A;  1CGO A;  1RJ9 A;  2YWA A;  1FNT c;  3J06 A;  1ORY A;  2E87 A;  3AGU A;  2J9B A;  4JZA A;  4CIH A;  5A6B A;  2UUI A;  3EFO B;  1R5I D;  4EUK B;  3CSK A;  1BR2 A;  1ZZP A;  3IPM O;  3RKO F;  1ZHX A;  1M56 C;  4XPX A;  2O9X A;  3RQF A;  2EIK C;  3SXZ A;  1VYI A;  3HNJ A;  2M4E A;  3HJC A;  2R7Q A;  2YHS A;  4YL0 A;  2YKZ A;  3S84 A;  1LE2 A;  2RSE B;  2WVQ A;  1NSG B;  2RD9 A;  3M4B A;  4YJW A;  3ZG1 A;  3S0X A;  3U0C A;  2YVK A;  4HFK B;  4JKV A;  3EHN A;  2YL0 A;  4AL1 A;  4G7Z F;  2Y39 A;  3K6B A;  3ATP A;  2H7V C;  5A6A A;  4I1M A;  1BBH A;  1G8X A;  2HV6 A;  3DKA A;  4IAR A;  4JEA A;  5COF A;  2BE5 F;  1S05 A;  2CCY A;  3O6X A;  4JCZ A;  1D0Y A;  1YA9 A;  4U9E A;  4CDA A;  1OKK A;  3DM5 A;  2L7A A;  1KU2 A;  2QY9 A;  4E18 A;  3T9O A;  2XLW A;  3Q6M A;  1FR0 A;  4WJ0 A;  1D1B A;  4G7H F;  1T5O A;  3B0P A;  3DM9 B;  5FZT A;  5F5H A;  4IWB A;  1ZW2 A;  3KKB A;  4ULV A;  2HFI A;  1T6I A;  2JX0 A;  3RVZ A;  3W8H A;  5DQT A;  3H2V A;  4W8P A;  3FXH A;  4OD4 A;  3UMH A;  1Z5Z A;  1LVK A;  2WL8 A;  4N6H A;  3ZC4 A; 
#chains in the Genus database with same CATH homology
 3M1C B;  2Y3D A;  4PJJ A;  2H7O A;  2YZS A;  3ZIB A;  3ASN C;  3NYM A;  2WVO A;  1LVK A;  4I1O B;  2ZXR A;  5L3Q A;  2Z15 A;  5KYY B;  3PHF 2;  4G0H A;  3UNG C;  1D1A A;  1NZE A;  1TWA A;  1OCC C;  2XL4 A;  3Q7G A;  1RJ9 B;  4EWC A;  4OIR F;  3S27 A;  4CS7 A;  2Y3B A;  2J9W A;  3KL4 A;  1MNE A;  5DS4 A;  1MMA A;  3LS0 A;  5E33 A;  4BJ6 A;  2W9Y A;  4OIP F;  3JRT A;  4CS8 C;  2ZXO A;  2W4M A;  3LEV A;  1FTS A;  1Z3I X;  4GEH A;  3AG4 C;  3VAY A;  1SMY F;  2VAS A;  2Q9B A;  3T6B A;  3PMR A;  4CSA A;  3LAY A;  1VK5 A;  3RFY A;  3UGP A;  3LLK A;  1D1C A;  2GFH A;  2J9U A;  3AG3 C;  1TR2 A;  4KBL A;  2Y3H A;  1JPJ A;  3O39 A;  3KH2 A;  3DJU B;  2CNW A;  2KJG A;  3LNR A;  4C7O B;  2EIL C;  4DBQ A;  4CS9 C;  2CDQ A;  2R7S A;  3RYL A;  3NKD A;  4MND A;  2J7P A;  3X2Q C;  4O6M A;  4XTK A;  4FWV A;  5KYX A;  1W2W A;  4BJ5 A;  3CQZ A;  2C04 A;  3AG1 C;  1IW7 F;  2ZXP A;  4U5G A;  4YT2 A;  3E70 C;  3W2W A;  3N2Z B;  1MMN A;  1OCO C;  2WZL A;  5E3A A;  3K66 A;  3SYN A;  4OD5 A;  3ZSU A;  3RH3 A;  1VMA A;  3LES A;  4AX2 A;  2NG1 A;  2XRH A;  2L9J A;  3ZVR A;  4H4K C;  4RBN A;  2W4B A;  2WZG A;  3UMK A;  5T1D B;  5E2Q A;  3DMD A;  4OIQ F;  2VB6 A;  3B9Q A;  5CI9 A;  4KC9 A;  3UGO A;  3Q7L A;  1O5H A;  4JUR I;  3S28 A;  2NUP A;  3AQB A;  2MWQ A;  1ZYR F;  5B3S C;  5DLJ A;  4JW1 A;  2P6V A;  2PF4 E;  4I44 A;  4DOZ A;  4LLC A;  2J9V A;  2R7U A;  1ST6 A;  4PFO A;  5IY5 C;  1V54 C;  4JJF A;  1LKX A;  4XWJ A;  4A2N B;  1V55 C;  3DJN B;  3F46 A;  3DXJ F;  4O79 A;  1PD0 A;  3AG2 C;  2PFD A;  4C3B A;  2Q3T A;  3S29 A;  2DGJ A;  4KNW A;  2ZPA A;  4YN0 B;  5KYX B;  2OG2 A;  3N0T A;  4C7O A;  2G3V A;  2YEV A;  4NY3 A;  3AQC A;  3B0U X;  5L3V A;  3OA1 A;  5B1A C;  5EHH A;  1SZI A;  3LLI A;  3ABM C;  4B6I A;  2EIM C;  3QZC A;  1D0Z A;  4J32 B;  4RD9 A;  1OKK D;  3HLZ A;  1ZHY A;  1TWG A;  4HEA J;  2ZXW C;  3V7O A;  1Z6A A;  3RIP A;  2KGO A;  2NUP B;  3TD7 A;  4E7Z A;  1FMV A;  1O87 A;  2JD3 A;  4O6Y A;  3EGX A;  4J30 B;  1JPN A;  3SEO A;  5KYW A;  4ZLC A;  3B0V C;  5DS5 A;  2CGE A;  3EQL F;  1OCZ C;  4E7S A;  1TKN A;  5T3W A;  4FES A;  2DYR C;  3NYL A;  3T6J A;  3L0I A;  4U5C E;  3OWT A;  2A1D D;  5HSW A;  2KNH A;  4PJL A;  2R7W A;  3SZR A;  4U5H A;  2XSE A;  3HTK C;  3JCU Q;  4PFP A;  4QI2 A;  4Q4Z F;  1MMG A;  3OEO A;  2MYS A;  3ABK C;  3KMI A;  5BUO A;  3ABL C;  1ZHZ A;  4C3E A;  1NU7 D;  3K7D A;  3DAF A;  3EJN A;  3ASO C;  4RDA A;  3FVY A;  4OIN F;  4YWQ A;  3MLG A;  3NRH A;  4I3M A;  3SNH A;  4FX5 A;  2PX0 A;  4HFF B;  1J8Y F;  1FFH A;  4F4B A;  4IAO A;  2WB7 A;  1PD1 A;  4JJG A;  3X1O A;  4CS9 A;  4BJ5 C;  4X0R A;  1PCX A;  2KQ9 A;  4BG0 A;  4QI0 A;  4AE4 A;  2J45 A;  2VH3 A;  1M2O A;  2A68 F;  4Q7C A;  4O7G A;  4KNV A;  3W2V A;  2R7R A;  1Z23 A;  5E3C A;  2W45 A;  2CNW D;  4OIO F;  2IYL D;  1M2V A;  4JCH A;  2J46 A;  3EGX B;  2Y69 C;  2NUT A;  5KYW B;  3DAG A;  3IEE A;  2J7P D;  4C3D A;  3L34 A;  1SF8 A;  5KYN A;  2H7B A;  4QDL A;  1D0X A;  2IXM A;  4DBR A;  3VYW A;  2DYS C;  4IRU A;  4ANJ A;  3NKE A;  3F47 A;  3NYJ A;  4BJT A;  2P7V A;  1BR4 A;  1FFT C;  3GAN A;  3K33 A;  3H65 A;  2FFH A;  4AK9 A;  3EPV A;  2A6E F;  1VOM A;  3I5P A;  4LAC B;  4PJN A;  2QTV A;  3FHD A;  5FCL A;  4W8K A;  3NDB B;  2J0W A;  2EIJ C;  3GOD A;  5KYU A;  5DQZ A;  3EG9 A;  3JYH A;  2WZF A;  1NG1 A;  1TWC A;  3W8I A;  4KI2 A;  1S7Z A;  1TWH A;  3I5Q A;  4ULW A;  4U5B E;  4YT4 A;  2L81 A;  4U5D E;  3I4U A;  1IZM A;  2R7O A;  1WGW A;  4XLN F;  4EBB A;  1ZU4 A;  4AE4 B;  3LJB A;  2R7X A;  1MND A;  4HE8 D;  3E9V A;  3T4R A;  1BR1 A;  4G7O F;  3EHM A;  1LS1 A;  3WOD F;  1NU9 C;  3EZH A;  2J0X A;  3ECS A;  2G62 A;  3EGD A;  2X51 A;  2PP4 A;  1M2V B;  4XLP F;  2NUT B;  5DVW A;  5D91 A;  4BEJ A;  4YT8 A;  3K1I C;  4CBE A;  2IXN A;  2HV7 A;  1ZHW A;  5D92 A;  3UMI A;  5B1B C;  3CZ6 A;  1J8M F;  2B0J A;  3POV A;  4BJ6 C;  3N24 A;  1OCR C;  3DD7 A;  4U5E E;  3EH1 A;  2V26 A;  2EIN C;  3K1H A;  1QZX A;  2XXA A;  3UR3 C;  4GYT A;  2Q9A A;  2R7T A;  3EFO A;  5T3T A;  2C03 A;  5KYU B;  4CSA C;  2FGY A;  3EG9 B;  4CS8 A;  2IXP A;  4DVZ A;  3DZA A;  4DVY P;  2V3C C;  4Q5S F;  3NG1 A;  4K0D A;  1VYK A;  2WVN A;  3ITF A;  2OCC C;  2LSE A;  2Y3G A;  5CI8 A;  4PJM A;  4LLE A;  4IJJ A;  5DS6 A;  4MQ9 F;  2PX3 A;  1ZU5 A;  4K7B A;  3Q6N A;  3JT1 A;  2D5R B;  3EGD B;  4PK4 A;  3MX3 A;  2Q9C A;  1N1C A;  1QLE C;  2I8B A;  3FAJ A;  2IXO A;  1ZHT A;  1MMD A;  3EZI A;  2R7V A;  4LER A;  4P6I C;  4O6N A;  4BJ1 A;  5F5F A;  2CW0 F;  3JSZ A;  3QMK A;  2A6H F;  3FDQ A;  4YT5 A;  2KW3 C;  5KYY A;  1M57 C;  4JVS A;  4M63 A;  4U5F E;  4N06 A;  3WG7 C;  4ZLD A;  1Z63 A;  1FMW A;  2G3K A;  3EH2 A;  3SP1 A;  5EGY A;  2A69 F;  2XXA B;  2IOQ A;  1RJ9 A;  2E87 A;  4JZA A;  4CIH A;  3EFO B;  3CSK A;  1BR2 A;  3RKO F;  1ZHX A;  1M56 C;  2O9X A;  2EIK C;  1VYI A;  2M4E A;  3HJC A;  2R7Q A;  2YHS A;  2WVQ A;  4YJW A;  3ZG1 A;  3S0X A;  4HFK B;  3EHN A;  4G7Z F;  2Y39 A;  3K6B A;  2H7V C;  4I1M A;  2HV6 A;  1G8X A;  2BE5 F;  3O6X A;  1D0Y A;  1OKK A;  3DM5 A;  1KU2 A;  2QY9 A;  3Q6M A;  4WJ0 A;  1D1B A;  4G7H F;  3B0P A;  3DM9 B;  5F5H A;  4IWB A;  3KKB A;  3W8H A;  5DQT A;  4OD4 A;  3UMH A;  1Z5Z A;  3LS1 A;  2WL8 A;  3ZC4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...