2KNHA

The solution structure of the etafh domain of aml1-eto complexed with heb peptide
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
103
Chain Sequence
GAMGSGARQLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARLAKQNPAQYLAQHEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the AML1-ETO eTAFH domain-HEB peptide complex and its contribution to AML1-ETO activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator
molecule keywords Protein CBFA2T1
total genus 24
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2009-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07531 TAFH NHR1 homology to TAF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1110 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2knhA00
2P6VA 2KNHA 2H7BA 2PP4A
chains in the Genus database with same CATH superfamily
1HW1A 1K04A 3BRJA 1ZW2A 4R32A 1ZHWA 1YDIA 4JIOA 1WATA 2J8WA 3CZ6A 2IXNA 3Q7LA 4MTOA 1EI7A 1O87A 3HNLA 4U5DE 5F5FA 2OJQA 2UUIA 4XEKA 4IB4A 3VAYA 2AU5A 5A6KA 3HNJA 5AC4A 3AG1C 4PJLA 1Q0KA 4AE4B 1Q0MA 3AQCA 3RQFA 1TFOB 2QNLA 3TQOA 2R03A 2OKUA 4NTBA 1OCZC 2W4BA 2GA0A 4EIYA 2R7OA 3N24A 2XLWA 2YL0A 5TJ5E 1HW2A 3NDBB 1LE2A 3EFOB 4PACA 2H7VC 2OQMA 2LFDA 3HLZA 1OXKA 1SZIA 2LFFA 1A41A 1XWJA 4YT8A 3HNKA 1D1CA 1Q0FA 1OR3A 3JT1A 3S0XA 3SXKA 4QDLA 2VC9A 2YWAA 3BEHA 1D0ZA 3DXJF 1G5ZA 5IY5C 2VH3A 3L8IA 3GANA 3WODF 3MYIA 3NRHA 1PD0A 2JPUA 4ULWA 3WAQA 4BJ5C 3J06A 4MW3A 3QMKA 4O6MA 3GM3A 3MBGA 4JCZA 4MVMA 4QI2A 5JT4A 1U0BB 1TWAA 2RD9A 4CIHA 1LM3B 3ZG1A 2H7OA 4H54A 3A11A 5KYWB 3OEOA 3SEOA 1A7EA 3AGTA 4GQHA 3CSKA 2Q4FA 2CNWD 3DKAA 4YT4A 1LKXA 3W8HA 1E85A 5AGFA 3L0IA 4HFFB 3QVZA 3ASNC 3DM5A 1G4US 3U3FA 1V4AA 4CJOA 1KU2A 2J9BA 4OINF 3X2QC 5A6AA 1VLSA 2R7RA 4OIOF 4NC3A 1Y4CA 1WWPA 1CGME 4C7OA 3LS1A 4JW1A 2R7WA 4DBQA 3RVYA 1HE9A 2LCHA 2QUPA 3U5SA 3MYFA 4BG0A 3SXZA 5KYNA 4KI2A 2ASRA 3AGUA 4IARA 5GPGB 4JVSA 1ZYRF 2J9WA 1PCXA 3ZSUA 1T6IA 4F4BA 1LI5A 1Z6AA 2Y3GA 3Q6NA 4M63A 5DS6A 1H7IA 1T6UA 1VLTA 2LIGA 3IQ6A 4O6YA 1M2VA 1T5OA 4P9TA 1WN0A 2XM0A 2XLEA 3CAXA 3NMKA 3DM9B 2Z15A 3L1MA 4E7SA 256BA 3EFOA 3JYHA 3VM6A 5DLJA 3LESA 5A6JA 4MTFA 3TJ6A 3DD7A 3FOOA 3JZ0A 3FHDA 2CGEA 3GWNA 3JRTA 1R5ID 1ST6A 3GEIA 1YA9A 3EGDB 4LDRA 4N06A 3UMHA 4D4XA 1CPQA 4BEJA 4KC9A 1JRAA 1CPRA 2HS5A 5COFA 3U3BA 2HV7A 2OOCA 2DI3A 1D1BA 1BR2A 1DOWA 1ZHYA 3JSZA 1F1MA 3ZWIA 1GQAA 2HMQA 2KQ9A 2XL6A 3F46A 3EPVA 5JVEA 2FGYA 4U9DA 4BJ6C 2Y3HA 3E70C 1E84A 4JZAA 1CGNA 2XLMA 1RMVA 1M57C 1M2OA 2G62A 4U5EE 3GM1A 2V3CC 4LLEA 2R7QA 1I4ZA 2XRHA 1RKEB 4Q7CA 1UG7A 5E2QA 1AVOB 4YT5A 4WGYA 5EGYA 2IYLD 3S9OA 5T3WA 4GEHA 3FOPA 1C17M 1HE1A 2Q9BA 3A9CA 4JJGA 2ZXOA 3NYMA 3O10A 4O79A 3S27A 3IHUA 1RXQA 4XEVA 4AL1A 3I5QA 1EQ1A 4G7HF 3DJNB 1T9KA 3VYWA 1L7CA 3NMIA 1JPNA 3EH1A 2P6VA 1H9TA 1O3UA 1YYXA 1ZHTA 4MVQA 1HY5A 4MVZA 4PJMA 1WTYA 3K1HA 4CX9A 3M79A 3Q7GA 1H6GA 2B0JA 4CDVA 5DQTA 3ECSA 1MQVA 4BPMA 1QZXA 1B68A 2ETSA 4N6HA 1NSGB 2XM4A 1VB5A 3PHF2 2IBFA 1NU9C 4XQ1A 3LJBA 3GEHA 4NTAA 2ICWG 5KYWA 1QPUA 4EKWA 2W9YA 4J7YA 5L0DA 3RH3A 5AC5A 5A6BD 3PDMP 2HMZA 3W4YA 3G4ZA 5D92A 1SF8A 4E17A 4CSAA 3LNRA 4ANJA 1G4WR 4CBEA 4DJ9A 4XPYA 4E7ZA 3ABMC 1YLMA 3U9JA 2E87A 2KYHA 4XPWA 1A0BA 2V26A 5COMA 3DZAA 5DVWA 4D4NA 1WOLA 5COGA 2RSEB 4IAQA 2OU6A 2PP4A 2YQYA 3R7CA 4U9EA 1ZU4A 5KYXB 5KYUA 4BJ5A 1V54C 3H2VA 4QI0A 2YL7A 3LUTB 2IXPA 3JTLO 2WVNA 1U6HA 4DRJB 1BZ4A 4OIPF 2J9VA 2EIMC 2XLDA 4CIPA 2EINC 4CDAA 2A6EF 3U9MA 4EBBA 5B3SC 4BEMJ 2L7AA 2PF4E 4N6CA 1PD1A 3DWWA 4LDQA 1OW6A 2KC3A 5B1AC 3U8PA 2FAPB 4PJNA 2MWQA 2KK1A 1AEPA 1CGOA 1J8YF 3ABLC 3NKEA 1LIHA 2NUTB 4NY3A 4EHPA 1PV3A 5K0IA 2NG1A 4YL0A 5D91A 3ZVRA 4G7ZF 4EUKB 1FMWA 4LLCA 1VMAA 5E3CA 3T6BA 4OD4A 1MMAA 1ORYA 2TMVP 1SYQA 3MX3A 4K7BA 4I44A 4MQ9F 3IQTA 5BQGA 4NCQA 2YL1A 3EHMA 1MMDA 3S28A 1BDJB 1KTMA 4JTAB 1JMWA 4L6RA 5JP7A 3C63A 3K1IA 3O6XA 4HE8D 4G78A 1RKCA 1Z63A 5L0JA 1APCA 5B1BC 3KKBA 4LERA 2J9UA 5L0FA 1JPJA 2G3VA 2ZD9A 2ZXWC 3S84A 4MW8A 2WB7A 4JTDB 5DS4A 1BR4A 5L3VA 4P9FA 5FZTA 3B0PA 3OA1A 5KYYB 1KNYA 3SZRA 4A4AA 4PJJA 1T01A 1TQGA 3H65A 4C7OB 1RJ9B 2KSFA 5JRAA 2BE5F 1M2VB 2QLAA 3PCVA 3FVYA 3EGXA 3QVYA 4IGGA 1JOGA 4YN0B 3X1OA 5HSWA 1Y6DA 1UFBA 2MHRA 5E33A 3SXMA 4AL0A 4G7OF 1K05A 3ZIBA 4JEBA 1ZVZA 3T9OA 3F47A 2J46A 1OCOC 2R7UA 3B29A 1I4YA 3V5ZA 2I8BA 3L34A 3M4CA 4JEAA 4B6IA 1QSPA 1J8MF 3LNMB 1U89A 3Q6MA 3RVZA 4DVZA 4YT2A 4Q5SF 4O7GA 4BJ1A 3UR3C 2LK4A 4NTFA 4PFPA 4MNDA 1OW8A 3EGDA 5CI8A 1SR2A 3KMIA 3K33A 4G0HA 1YVIA 3M15A 3R2PA 2JD3A 3QW1A 4HEAJ 3TK0A 1W2WA 5L0GA 4U5HA 3N0TA 1M56C 3C7JA 1VYKA 3KYIA 1S05A 2R7VA 2WZFA 3RQEA 1G8XA 4E0IA 2R7TA 2AWCA 2QTVA 3TOMA 3VRCA 1NBBA 1QKRA 4X0RA 4I3MA 3TD7A 3T4RA 4Z9JA 1LVKA 3C18A 3TJ5A 2C03A 1OR2A 2DGJA 1V55C 4KBLA 1TR2A 2YLGA 2HKVA 2IXMA 5T3TA 2J7PD 3ZQVA 4FAPB 4CS7A 1TKNA 2CDQA 3C8ZA 2HJMA 2Q3TA 2M4EA 3IQ5A 4CS8C 5L0HA 1YZCA 2EIJC 4YL3A 4FWVA 3U2LA 2HSQA 1ORJA 1Z5ZA 2ZPAA 2YVKA 4JKVA 4JRZA 2XXAB 3NKDA 3OWTA 2R7XA 1LE4A 3I5PA 4KNWA 1BR1A 5CIVA 1VTMP 1EKYA 2LP4A 5A6BA 2EPLX 3ZTZA 3JRMO 1FR0A 3MLGA 5BUOA 5L3QA 1D0XA 1O5HA 2CW0F 3C8GB 1YZAA 3CQZA 3O39A 2Q00A 1FMVA 2YZSA 2NSFA 4AK9A 2HV6A 5DQZA 2A0BA 3ASOC 4DOZA 1JAFA 1ZU5A 5JSLA 5BQHA 2XL8A 2NUPA 2D5RB 1IW7F 2L9JA 1NFOA 2P1AA 1R4TA 4RD9A 2ZXRA 1XZQA 3RFYA 1QLEC 4K0DA 1ZW3A 3JYYA 1BBHA 1RKEA 4U5CE 3UMIA 2XL4A 4Z9IA 1YYJA 3DAFA 3WG7C 4LDKA 2A6HF 3IQCA 5B3IA 4U5GA 2IXOA 3C8GD 1HMOA 5E3AA 2OEVA 2H8AA 2CNWA 2KGOA 1OXBA 4CDYA 4ZLDA 2VASA 2PX0A 4WGZA 3SXYA 3RF3A 1MNDA 4EBJA 2MYSA 3ZTMA 3T6JA 1FTSA 4J32B 1A7DA 1SMYF 3B9QA 4XTKA 5BQIA 2HJ3A 3EZHA 2HUJA 2R9RB 3FMSA 5EK0A 2QE9A 1LS4A 3QTHA 4HFKB 1NG1A 5F5HA 2D4UA 3LLKA 1ZHZA 3UMKA 4FX5A 3KH2A 3WHNA 1ZHXA 2KNHA 2AVKA 4YK5A 2YEVA 3K7DA 2Y3DA 1E2XA 1RCPA 3US6A 3ABKC 3U0CA 2HSBA 1D0YA 3M1CB 1GGQA 1OCRC 2PBEA 1XZPA 1VYIA 1Z7Qc 5L0IA 1YAUO 4CS9A 1Z3IX 4OD5A 2XS8A 3FDQA 4CS9C 2YKZA 4MTGA 3EHNA 4U5BE 2A0UA 4XLNF 2Y3BA 3KYJA 2PX3A 2R25A 4MVRA 4ONSA 1Q0DA 1OKKA 4W8KA 3NYLA 3ZC4A 4C3BA 3GWLA 3DE8A 4RBNA 5KYXA 2CYDA 3FXHA 2YLDA 3TOLA 3E9VA 3PMRA 3DMDA 5DS5A 4O6NA 3K1IC 3L8JA 1ZZPA 2XLOA 3O55A 3V5YA 1H9GA 1WASA 4LACB 1YA7O 2H7BA 2L6FA 3HJCA 4E0HA 2Y39A 4NQFA 2WZLA 4XWJA 1ORSC 4EBKA 3EH2A 2EPKX 4DVYP 4IAOA 1NU7D 1VOMA 3RYLA 3B0VC 2VCAA 3GEEA 2P61A 2WL8A 2J0XA 4JCHA 2XS1A 3SNHA 4OIQF 1OW7A 2M64A 2Q9AA 2YRFA 4YJWA 4E18A 4JTCB 2WVOA 5JS5A 1MNEA 1TWCA 3C62A 2R7SA 3LAYA 4CSAC 1L3PA 1GM5A 3QZCA 2CCYA 4DBRA 3G4XA 2NPUA 1MMNA 2GDCA 2WZGA 3SYNA 4ER9A 1QVXA 1A7VA 3MFNA 2G3KA 4A2NB 2NUTA 5A69A 2DYRC 2R02A 3EZIA 1LPEA 4IRUA 3ZDLA 3AG2C 3M4BA 4U5FE 3G50A 2EPNA 2EILC 2KJGA 1NLXA 1QQ3A 4FESA 2C04A 1T6QA 5KYUB 3EGXB 1V74B 2EIKC 3KL4A 1DOVA 3LLIA 4J30B 1Q0GA 4KNVA 2LSEA 4IJJA 2W45A 1YARO 4MS2A 4C3DA 1HMDA 3DJUB 4XPXA 4OIRF 3UGPA 1VK5A 3NYJA 3B71A 2IM8A 1FAPB 2F22A 3UNGC 2Q9CA 3U2MA 2GFHA 1TWGA 4EWCA 1K40A 1N1CA 2O9XA 4AE4A 1WGWA 3ITFA 2XXAA 2XLHA 4N4WA 1Z23A 4I1OB 2YLIA 1FNTc 5JLIA 5T1DB 2Q7RA 2A68F 2ZXPA 1LS1A 2PFDA 4CS8A 1EA8A 2UUHA 4DRIB 4J7TA 4AX2A 2W4MA 4MVUA 2A69F 3NG1A 4JC7A 4MVOA 1D1AA 4JE9A 3T6GB 3I4UA 2J7PA 4RDAA 2AP3A 3KPHA 3LEVA 2HFIA 2XSEA 2LQGA 3GORA 2J0WA 3JSEO 3H2UA 3HTKC 4DRHB 2L6HA 3HKKA 4MVSA 3K6BA 1E83A 4DXWA 3V5XA 4PFOA 2P0NA 3AG3C 1YJGA 2X51A 5JUAA 3W2VA 4UDVA 3N2ZB 5L0CA 4XLPF 2HZ8A 3C8GA 1FFTC 3RIPA 3S29A 2EPMX 2L81A 4Z9HA 1NZEA 4WABA 3IEEA 3AQBA 3FAJA 1MMGA 1TWHA 5F28E 3RQGA 2L6GA 3EG9A 4IWBA 4YWQA 2JX0A 5CI9A 4PR9A 3JCUQ 2LD6A 4WJ0A 2GWWA 2X0CA 5FCLA 2OCCC 1C02A 3TULA 2BL2A 3ZQYA 2VCCA 2DYSC 2WVQA 3GM2A 3SP1A 3S90A 4C3EA 2IOQA 3UGOA 3V7OA 2R05A 4K1OA 2DB4A 3DAGA 1NFNA 3NMJA 2EPOA 2GAQA 2OG2A 2VB6A 2Y69C 3AOUA 3EG9B 3POVA 4JURI 2BC5A 2FFHA 4JJFA 3U8VA 1GS9A 1LI7A 2VCBA 2NUPB 1E86A 4ZLCA 4Q4ZF 3LS0A 1S7ZA 3FAPB 3EQLF 2J45A 1JR8A 1OKKD 2YL3A 1OQCA 1M6TA 2PNOA 3AG4C 4BJTA 1RJ9A 3DI5A 2OEXA 3EJNA 5HV9A 2QY9A 2A1DD 2NSGA 4W8PA 3RW0A 2AWYA 4PK4A 2XLVA 3ATPA 2P7VA 3W8IA 3LEOA 3QW0A 3GODA 3IPMO 1C03A 3VF0A 4BJ6A 4GYTA 4CJGA 1TFKB 3K66A 3RKOF 3B0UX 4XEFA 1FFHA 5KYYA 2OJED 5EHHA 2KW3C 3AJMA 4H4KC 4I1MA 4P6IC 1AUEA 3HNIA 1I5NA 1OCCC 2B0HA 4YL1A 3CEXA 2YHSA 3DE9A 1IZMA 2I15A 3W2WA 4ULVA
chains in the Genus database with same CATH topology
1ZHWA 5L3QA 3CZ6A 2IXNA 3Q7LA 4U5DE 1O87A 5F5FA 3VAYA 3AG1C 4PJLA 4AE4B 3AQCA 1OCZC 2W4BA 2R7OA 3N24A 3NDBB 3EFOB 2H7VC 3HLZA 1SZIA 4YT8A 1D1CA 3JT1A 3S0XA 4QDLA 3DXJF 1D0ZA 5IY5C 2VH3A 2V3CC 3GANA 3WODF 4BJ5C 3NRHA 1PD0A 4ULWA 3QMKA 4O6MA 4QI2A 1TWAA 4CIHA 3ZG1A 2H7OA 5KYWB 3OEOA 3SEOA 3CSKA 2CNWD 4YT4A 1LKXA 3W8HA 3L0IA 4HFFB 3ASNC 3DM5A 1KU2A 4OINF 3X2QC 2R7RA 4OIOF 4C7OA 3LS1A 4JW1A 2R7WA 4DBQA 4BG0A 4KI2A 5KYNA 4JVSA 1ZYRF 2J9WA 1PCXA 3ZSUA 4F4BA 3Q6NA 1Z6AA 2Y3GA 4M63A 5DS6A 4O6YA 1M2VA 3DM9B 2Z15A 4E7SA 3EFOA 3JYHA 5DLJA 3LESA 3DD7A 3FHDA 2CGEA 3JRTA 1ST6A 3EGDB 4N06A 3UMHA 4BEJA 4KC9A 2HV7A 1D1BA 1BR2A 1ZHYA 3JSZA 2KQ9A 3F46A 3EPVA 2FGYA 4BJ6C 2Y3HA 3E70C 4JZAA 1M57C 1M2OA 2G62A 4U5EE 4LLEA 2R7QA 5E2QA 2XRHA 4Q7CA 4YT5A 5EGYA 2IYLD 5T3WA 4GEHA 4JJGA 2Q9BA 5KYUB 2ZXOA 3NYMA 4O79A 3S27A 3I5QA 4G7HF 3DJNB 3VYWA 1JPNA 3EH1A 2P6VA 1ZHTA 4PJMA 3K1HA 3Q7GA 2B0JA 5DQTA 3ECSA 1QZXA 3PHF2 1NU9C 3LJBA 5KYWA 2W9YA 3RH3A 5D92A 1SF8A 4CSAA 3LNRA 4ANJA 4CBEA 4E7ZA 3ABMC 4CSAC 2E87A 5DVWA 2V26A 3DZAA 2PP4A 1ZU4A 5KYXB 5KYUA 4BJ5A 1V54C 4QI0A 2IXPA 2WVNA 4OIPF 2J9VA 2EIMC 2EINC 2A6EF 4EBBA 5B3SC 2PF4E 1PD1A 5B1AC 4PJNA 2MWQA 1J8YF 3ABLC 3NKEA 4NY3A 2NUTB 2NG1A 5D91A 3ZVRA 4G7ZF 1FMWA 4LLCA 1VMAA 5E3CA 3T6BA 4OD4A 1MMAA 3MX3A 4K7BA 4I44A 4MQ9F 3S28A 3EHMA 1MMDA 3O6XA 4HE8D 1Z63A 5B1BC 3KKBA 4LERA 2J9UA 1JPJA 2G3VA 2ZXWC 2WB7A 5DS4A 1BR4A 5L3VA 3B0PA 3OA1A 5KYYB 3SZRA 4PJJA 3H65A 4C7OB 1RJ9B 2BE5F 1M2VB 3FVYA 3EGXA 4YN0B 3X1OA 5HSWA 4G7OF 5E33A 3ZIBA 3F47A 2J46A 1OCOC 2R7UA 2I8BA 3L34A 4B6IA 1J8MF 3Q6MA 4DVZA 4YT2A 4Q5SF 4O7GA 4BJ1A 3UR3C 4PFPA 4MNDA 3EGDA 5CI8A 3KMIA 3K33A 4G0HA 2R7TA 4HEAJ 2JD3A 1W2WA 4U5HA 3N0TA 1M56C 1VYKA 2R7VA 2WZFA 1G8XA 2QTVA 4X0RA 4I3MA 3TD7A 3T4RA 1LVKA 2C03A 2DGJA 1V55C 4KBLA 1TR2A 2IXMA 5T3TA 2J7PD 4CS7A 1TKNA 2CDQA 2Q3TA 2M4EA 4CS8C 2EIJC 4FWVA 1Z5ZA 2ZPAA 2XXAB 3NKDA 3OWTA 2R7XA 3I5PA 4KNWA 1BR1A 3MLGA 5BUOA 1D0XA 1O5HA 2CW0F 3CQZA 4BJTA 3O39A 1FMVA 2YZSA 4AK9A 2HV6A 5DQZA 3ASOC 4DOZA 1ZU5A 2NUPA 2D5RB 1IW7F 2L9JA 4RD9A 2ZXRA 3RFYA 1QLEC 4K0DA 4U5CE 3UMIA 2XL4A 3DAFA 3WG7C 2A6HF 4U5GA 2IXOA 5E3AA 2CNWA 2KGOA 4ZLDA 2VASA 2PX0A 1MNDA 2MYSA 3T6JA 1FTSA 4J32B 1SMYF 4XTKA 3B9QA 3EZHA 4HFKB 1NG1A 5F5HA 1ZHZA 3UMKA 4FX5A 3KH2A 1ZHXA 2KNHA 2YEVA 3K7DA 2Y3DA 3ABKC 3M1CB 1D0YA 1OCRC 1VYIA 4CS9A 1Z3IX 4OD5A 3FDQA 4CS9C 4U5BE 3EHNA 4XLNF 2Y3BA 2PX3A 1OKKA 4W8KA 3NYLA 3ZC4A 4C3BA 5KYXA 4RBNA 3E9VA 3PMRA 3DMDA 5DS5A 4O6NA 3K1IC 4LACB 2H7BA 3HJCA 2Y39A 2WZLA 4XWJA 3EH2A 4DVYP 4IAOA 1NU7D 1VOMA 3RYLA 3B0VC 2WL8A 2J0XA 4JCHA 3SNHA 4OIQF 2Q9AA 4YJWA 2WVOA 1MNEA 1TWCA 2R7SA 3LAYA 3QZCA 4DBRA 2WZGA 1MMNA 3SYNA 4A2NB 2G3KA 2NUTA 2DYRC 4IRUA 3EZIA 3AG2C 4U5FE 2EILC 2KJGA 4FESA 2C04A 3EGXB 3KL4A 2EIKC 3LLIA 4J30B 4KNVA 2LSEA 4IJJA 2W45A 4C3DA 3DJUB 4OIRF 3UGPA 1VK5A 3NYJA 3UNGC 4EWCA 2Q9CA 2GFHA 1TWGA 1N1CA 2O9XA 4AE4A 1WGWA 3ITFA 2XXAA 1Z23A 4I1OB 5T1DB 2A68F 2ZXPA 1LS1A 2PFDA 4CS8A 4AX2A 2W4MA 2A69F 3NG1A 1D1AA 3I4UA 2J7PA 4RDAA 3LEVA 2XSEA 2J0WA 3HTKC 3K6BA 4PFOA 3AG3C 2X51A 3W2VA 3N2ZB 4XLPF 1FFTC 3RIPA 3S29A 2L81A 1NZEA 3IEEA 3AQBA 3FAJA 1MMGA 1TWHA 3EG9A 4IWBA 4YWQA 5CI9A 3JCUQ 4WJ0A 5FCLA 2OCCC 2DYSC 2WVQA 3SP1A 4C3EA 2IOQA 3UGOA 3V7OA 3DAGA 2Y69C 2VB6A 2OG2A 3EG9B 3POVA 4JURI 2FFHA 4JJFA 2NUPB 4ZLCA 4Q4ZF 3LS0A 1S7ZA 3EQLF 2J45A 1OKKD 3AG4C 1RJ9A 3EJNA 2QY9A 2A1DD 4PK4A 3W8IA 2P7VA 3GODA 4BJ6A 4GYTA 3K66A 3RKOF 3B0UX 5KYYA 1FFHA 5EHHA 2KW3C 4H4KC 4I1MA 4P6IC 1OCCC 2YHSA 3LLKA 1IZMA 3W2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P6V A;  2KNH A;  2H7B A;  2PP4 A; 
#chains in the Genus database with same CATH topology
 1HW1 A;  1K04 A;  3BRJ A;  1ZW2 A;  4R32 A;  1ZHW A;  1YDI A;  4JIO A;  1WAT A;  2J8W A;  3CZ6 A;  2IXN A;  3Q7L A;  4MTO A;  1EI7 A;  1O87 A;  3HNL A;  4U5D E;  5F5F A;  2OJQ A;  2UUI A;  4XEK A;  4IB4 A;  3VAY A;  2AU5 A;  5A6K A;  3HNJ A;  5AC4 A;  3AG1 C;  4PJL A;  1Q0K A;  4AE4 B;  1Q0M A;  3AQC A;  3RQF A;  1TFO B;  2QNL A;  3TQO A;  2R03 A;  2OKU A;  4NTB A;  1OCZ C;  2W4B A;  2GA0 A;  4EIY A;  2R7O A;  3N24 A;  2XLW A;  2YL0 A;  5TJ5 E;  1HW2 A;  3NDB B;  1LE2 A;  3EFO B;  4PAC A;  2H7V C;  2OQM A;  2LFD A;  3HLZ A;  1OXK A;  1SZI A;  2LFF A;  1A41 A;  1XWJ A;  4YT8 A;  3HNK A;  1D1C A;  1Q0F A;  1OR3 A;  3JT1 A;  3S0X A;  3SXK A;  4QDL A;  2VC9 A;  2YWA A;  3BEH A;  1D0Z A;  3DXJ F;  1G5Z A;  5IY5 C;  2VH3 A;  3L8I A;  3GAN A;  3WOD F;  3MYI A;  3NRH A;  1PD0 A;  2JPU A;  4ULW A;  3WAQ A;  4BJ5 C;  3J06 A;  4MW3 A;  3QMK A;  4O6M A;  3GM3 A;  3MBG A;  4JCZ A;  4MVM A;  4QI2 A;  5JT4 A;  1U0B B;  1TWA A;  2RD9 A;  4CIH A;  1LM3 B;  3ZG1 A;  2H7O A;  4H54 A;  3A11 A;  5KYW B;  3OEO A;  3SEO A;  1A7E A;  3AGT A;  4GQH A;  3CSK A;  2Q4F A;  2CNW D;  3DKA A;  4YT4 A;  1LKX A;  3W8H A;  1E85 A;  5AGF A;  3L0I A;  4HFF B;  3QVZ A;  3ASN C;  3DM5 A;  1G4U S;  3U3F A;  1V4A A;  4CJO A;  1KU2 A;  2J9B A;  4OIN F;  3X2Q C;  5A6A A;  1VLS A;  2R7R A;  4OIO F;  4NC3 A;  1Y4C A;  1WWP A;  1CGM E;  4C7O A;  3LS1 A;  4JW1 A;  2R7W A;  4DBQ A;  3RVY A;  1HE9 A;  2LCH A;  2QUP A;  3U5S A;  3MYF A;  4BG0 A;  3SXZ A;  5KYN A;  4KI2 A;  2ASR A;  3AGU A;  4IAR A;  5GPG B;  4JVS A;  1ZYR F;  2J9W A;  1PCX A;  3ZSU A;  1T6I A;  4F4B A;  1LI5 A;  1Z6A A;  2Y3G A;  3Q6N A;  4M63 A;  5DS6 A;  1H7I A;  1T6U A;  1VLT A;  2LIG A;  3IQ6 A;  4O6Y A;  1M2V A;  1T5O A;  4P9T A;  1WN0 A;  2XM0 A;  2XLE A;  3CAX A;  3NMK A;  3DM9 B;  2Z15 A;  3L1M A;  4E7S A;  256B A;  3EFO A;  3JYH A;  3VM6 A;  5DLJ A;  3LES A;  5A6J A;  4MTF A;  3TJ6 A;  3DD7 A;  3FOO A;  3JZ0 A;  3FHD A;  2CGE A;  3GWN A;  3JRT A;  1R5I D;  1ST6 A;  3GEI A;  1YA9 A;  3EGD B;  4LDR A;  4N06 A;  3UMH A;  4D4X A;  1CPQ A;  4BEJ A;  4KC9 A;  1JRA A;  1CPR A;  2HS5 A;  5COF A;  3U3B A;  2HV7 A;  2OOC A;  2DI3 A;  1D1B A;  1BR2 A;  1DOW A;  1ZHY A;  3JSZ A;  1F1M A;  3ZWI A;  1GQA A;  2HMQ A;  2KQ9 A;  2XL6 A;  3F46 A;  3EPV A;  5JVE A;  2FGY A;  4U9D A;  4BJ6 C;  2Y3H A;  3E70 C;  1E84 A;  4JZA A;  1CGN A;  2XLM A;  1RMV A;  1M57 C;  1M2O A;  2G62 A;  4U5E E;  3GM1 A;  2V3C C;  4LLE A;  2R7Q A;  1I4Z A;  2XRH A;  1RKE B;  4Q7C A;  1UG7 A;  5E2Q A;  1AVO B;  4YT5 A;  4WGY A;  5EGY A;  2IYL D;  3S9O A;  5T3W A;  4GEH A;  3FOP A;  1C17 M;  1HE1 A;  2Q9B A;  3A9C A;  4JJG A;  2ZXO A;  3NYM A;  3O10 A;  4O79 A;  3S27 A;  3IHU A;  1RXQ A;  4XEV A;  4AL1 A;  3I5Q A;  1EQ1 A;  4G7H F;  3DJN B;  1T9K A;  3VYW A;  1L7C A;  3NMI A;  1JPN A;  3EH1 A;  2P6V A;  1H9T A;  1O3U A;  1YYX A;  1ZHT A;  4MVQ A;  1HY5 A;  4MVZ A;  4PJM A;  1WTY A;  3K1H A;  4CX9 A;  3M79 A;  3Q7G A;  1H6G A;  2B0J A;  4CDV A;  5DQT A;  3ECS A;  1MQV A;  4BPM A;  1QZX A;  1B68 A;  2ETS A;  4N6H A;  1NSG B;  2XM4 A;  1VB5 A;  3PHF 2;  2IBF A;  1NU9 C;  4XQ1 A;  3LJB A;  3GEH A;  4NTA A;  2ICW G;  5KYW A;  1QPU A;  4EKW A;  2W9Y A;  4J7Y A;  5L0D A;  3RH3 A;  5AC5 A;  5A6B D;  3PDM P;  2HMZ A;  3W4Y A;  3G4Z A;  5D92 A;  1SF8 A;  4E17 A;  4CSA A;  3LNR A;  4ANJ A;  1G4W R;  4CBE A;  4DJ9 A;  4XPY A;  4E7Z A;  3ABM C;  1YLM A;  3U9J A;  2E87 A;  2KYH A;  4XPW A;  1A0B A;  2V26 A;  5COM A;  3DZA A;  5DVW A;  4D4N A;  1WOL A;  5COG A;  2RSE B;  4IAQ A;  2OU6 A;  2PP4 A;  2YQY A;  3R7C A;  4U9E A;  1ZU4 A;  5KYX B;  5KYU A;  4BJ5 A;  1V54 C;  3H2V A;  4QI0 A;  2YL7 A;  3LUT B;  2IXP A;  3JTL O;  2WVN A;  1U6H A;  4DRJ B;  1BZ4 A;  4OIP F;  2J9V A;  2EIM C;  2XLD A;  4CIP A;  2EIN C;  4CDA A;  2A6E F;  3U9M A;  4EBB A;  5B3S C;  4BEM J;  2L7A A;  2PF4 E;  4N6C A;  1PD1 A;  3DWW A;  4LDQ A;  1OW6 A;  2KC3 A;  5B1A C;  3U8P A;  2FAP B;  4PJN A;  2MWQ A;  2KK1 A;  1AEP A;  1CGO A;  1J8Y F;  3ABL C;  3NKE A;  1LIH A;  2NUT B;  4NY3 A;  4EHP A;  1PV3 A;  5K0I A;  2NG1 A;  4YL0 A;  5D91 A;  3ZVR A;  4G7Z F;  4EUK B;  1FMW A;  4LLC A;  1VMA A;  5E3C A;  3T6B A;  4OD4 A;  1MMA A;  1ORY A;  2TMV P;  1SYQ A;  3MX3 A;  4K7B A;  4I44 A;  4MQ9 F;  3IQT A;  5BQG A;  4NCQ A;  2YL1 A;  3EHM A;  1MMD A;  3S28 A;  1BDJ B;  1KTM A;  4JTA B;  1JMW A;  4L6R A;  5JP7 A;  3C63 A;  3K1I A;  3O6X A;  4HE8 D;  4G78 A;  1RKC A;  1Z63 A;  5L0J A;  1APC A;  5B1B C;  3KKB A;  4LER A;  2J9U A;  5L0F A;  1JPJ A;  2G3V A;  2ZD9 A;  2ZXW C;  3S84 A;  4MW8 A;  2WB7 A;  4JTD B;  5DS4 A;  1BR4 A;  5L3V A;  4P9F A;  5FZT A;  3B0P A;  3OA1 A;  5KYY B;  1KNY A;  3SZR A;  4A4A A;  4PJJ A;  1T01 A;  1TQG A;  3H65 A;  4C7O B;  1RJ9 B;  2KSF A;  5JRA A;  2BE5 F;  1M2V B;  2QLA A;  3PCV A;  3FVY A;  3EGX A;  3QVY A;  4IGG A;  1JOG A;  4YN0 B;  3X1O A;  5HSW A;  1Y6D A;  1UFB A;  2MHR A;  5E33 A;  3SXM A;  4AL0 A;  4G7O F;  1K05 A;  3ZIB A;  4JEB A;  1ZVZ A;  3T9O A;  3F47 A;  2J46 A;  1OCO C;  2R7U A;  3B29 A;  1I4Y A;  3V5Z A;  2I8B A;  3L34 A;  3M4C A;  4JEA A;  4B6I A;  1QSP A;  1J8M F;  3LNM B;  1U89 A;  3Q6M A;  3RVZ A;  4DVZ A;  4YT2 A;  4Q5S F;  4O7G A;  4BJ1 A;  3UR3 C;  2LK4 A;  4NTF A;  4PFP A;  4MND A;  1OW8 A;  3EGD A;  5CI8 A;  1SR2 A;  3KMI A;  3K33 A;  4G0H A;  1YVI A;  3M15 A;  3R2P A;  2JD3 A;  3QW1 A;  4HEA J;  3TK0 A;  1W2W A;  5L0G A;  4U5H A;  3N0T A;  1M56 C;  3C7J A;  1VYK A;  3KYI A;  1S05 A;  2R7V A;  2WZF A;  3RQE A;  1G8X A;  4E0I A;  2R7T A;  2AWC A;  2QTV A;  3TOM A;  3VRC A;  1NBB A;  1QKR A;  4X0R A;  4I3M A;  3TD7 A;  3T4R A;  4Z9J A;  1LVK A;  3C18 A;  3TJ5 A;  2C03 A;  1OR2 A;  2DGJ A;  1V55 C;  4KBL A;  1TR2 A;  2YLG A;  2HKV A;  2IXM A;  5T3T A;  2J7P D;  3ZQV A;  4FAP B;  4CS7 A;  1TKN A;  2CDQ A;  3C8Z A;  2HJM A;  2Q3T A;  2M4E A;  3IQ5 A;  4CS8 C;  5L0H A;  1YZC A;  2EIJ C;  4YL3 A;  4FWV A;  3U2L A;  2HSQ A;  1ORJ A;  1Z5Z A;  2ZPA A;  2YVK A;  4JKV A;  4JRZ A;  2XXA B;  3NKD A;  3OWT A;  2R7X A;  1LE4 A;  3I5P A;  4KNW A;  1BR1 A;  5CIV A;  1VTM P;  1EKY A;  2LP4 A;  5A6B A;  2EPL X;  3ZTZ A;  3JRM O;  1FR0 A;  3MLG A;  5BUO A;  5L3Q A;  1D0X A;  1O5H A;  2CW0 F;  3C8G B;  1YZA A;  3CQZ A;  3O39 A;  2Q00 A;  1FMV A;  2YZS A;  2NSF A;  4AK9 A;  2HV6 A;  5DQZ A;  2A0B A;  3ASO C;  4DOZ A;  1JAF A;  1ZU5 A;  5JSL A;  5BQH A;  2XL8 A;  2NUP A;  2D5R B;  1IW7 F;  2L9J A;  1NFO A;  2P1A A;  1R4T A;  4RD9 A;  2ZXR A;  1XZQ A;  3RFY A;  1QLE C;  4K0D A;  1ZW3 A;  3JYY A;  1BBH A;  1RKE A;  4U5C E;  3UMI A;  2XL4 A;  4Z9I A;  1YYJ A;  3DAF A;  3WG7 C;  4LDK A;  2A6H F;  3IQC A;  5B3I A;  4U5G A;  2IXO A;  3C8G D;  1HMO A;  5E3A A;  2OEV A;  2H8A A;  2CNW A;  2KGO A;  1OXB A;  4CDY A;  4ZLD A;  2VAS A;  2PX0 A;  4WGZ A;  3SXY A;  3RF3 A;  1MND A;  4EBJ A;  2MYS A;  3ZTM A;  3T6J A;  1FTS A;  4J32 B;  1A7D A;  1SMY F;  3B9Q A;  4XTK A;  5BQI A;  2HJ3 A;  3EZH A;  2HUJ A;  2R9R B;  3FMS A;  5EK0 A;  2QE9 A;  1LS4 A;  3QTH A;  4HFK B;  1NG1 A;  5F5H A;  2D4U A;  3LLK A;  1ZHZ A;  3UMK A;  4FX5 A;  3KH2 A;  3WHN A;  1ZHX A;  2KNH A;  2AVK A;  4YK5 A;  2YEV A;  3K7D A;  2Y3D A;  1E2X A;  1RCP A;  3US6 A;  3ABK C;  3U0C A;  2HSB A;  1D0Y A;  3M1C B;  1GGQ A;  1OCR C;  2PBE A;  1XZP A;  1VYI A;  1Z7Q c;  5L0I A;  1YAU O;  4CS9 A;  1Z3I X;  4OD5 A;  2XS8 A;  3FDQ A;  4CS9 C;  2YKZ A;  4MTG A;  3EHN A;  4U5B E;  2A0U A;  4XLN F;  2Y3B A;  3KYJ A;  2PX3 A;  2R25 A;  4MVR A;  4ONS A;  1Q0D A;  1OKK A;  4W8K A;  3NYL A;  3ZC4 A;  4C3B A;  3GWL A;  3DE8 A;  4RBN A;  5KYX A;  2CYD A;  3FXH A;  2YLD A;  3TOL A;  3E9V A;  3PMR A;  3DMD A;  5DS5 A;  4O6N A;  3K1I C;  3L8J A;  1ZZP A;  2XLO A;  3O55 A;  3V5Y A;  1H9G A;  1WAS A;  4LAC B;  1YA7 O;  2H7B A;  2L6F A;  3HJC A;  4E0H A;  2Y39 A;  4NQF A;  2WZL A;  4XWJ A;  1ORS C;  4EBK A;  3EH2 A;  2EPK X;  4DVY P;  4IAO A;  1NU7 D;  1VOM A;  3RYL A;  3B0V C;  2VCA A;  3GEE A;  2P61 A;  2WL8 A;  2J0X A;  4JCH A;  2XS1 A;  3SNH A;  4OIQ F;  1OW7 A;  2M64 A;  2Q9A A;  2YRF A;  4YJW A;  4E18 A;  4JTC B;  2WVO A;  5JS5 A;  1MNE A;  1TWC A;  3C62 A;  2R7S A;  3LAY A;  4CSA C;  1L3P A;  1GM5 A;  3QZC A;  2CCY A;  4DBR A;  3G4X A;  2NPU A;  1MMN A;  2GDC A;  2WZG A;  3SYN A;  4ER9 A;  1QVX A;  1A7V A;  3MFN A;  2G3K A;  4A2N B;  2NUT A;  5A69 A;  2DYR C;  2R02 A;  3EZI A;  1LPE A;  4IRU A;  3ZDL A;  3AG2 C;  3M4B A;  4U5F E;  3G50 A;  2EPN A;  2EIL C;  2KJG A;  1NLX A;  1QQ3 A;  4FES A;  2C04 A;  1T6Q A;  5KYU B;  3EGX B;  1V74 B;  2EIK C;  3KL4 A;  1DOV A;  3LLI A;  4J30 B;  1Q0G A;  4KNV A;  2LSE A;  4IJJ A;  2W45 A;  1YAR O;  4MS2 A;  4C3D A;  1HMD A;  3DJU B;  4XPX A;  4OIR F;  3UGP A;  1VK5 A;  3NYJ A;  3B71 A;  2IM8 A;  1FAP B;  2F22 A;  3UNG C;  2Q9C A;  3U2M A;  2GFH A;  1TWG A;  4EWC A;  1K40 A;  1N1C A;  2O9X A;  4AE4 A;  1WGW A;  3ITF A;  2XXA A;  2XLH A;  4N4W A;  1Z23 A;  4I1O B;  2YLI A;  1FNT c;  5JLI A;  5T1D B;  2Q7R A;  2A68 F;  2ZXP A;  1LS1 A;  2PFD A;  4CS8 A;  1EA8 A;  2UUH A;  4DRI B;  4J7T A;  4AX2 A;  2W4M A;  4MVU A;  2A69 F;  3NG1 A;  4JC7 A;  4MVO A;  1D1A A;  4JE9 A;  3T6G B;  3I4U A;  2J7P A;  4RDA A;  2AP3 A;  3KPH A;  3LEV A;  2HFI A;  2XSE A;  2LQG A;  3GOR A;  2J0W A;  3JSE O;  3H2U A;  3HTK C;  4DRH B;  2L6H A;  3HKK A;  4MVS A;  3K6B A;  1E83 A;  4DXW A;  3V5X A;  4PFO A;  2P0N A;  3AG3 C;  1YJG A;  2X51 A;  5JUA A;  3W2V A;  4UDV A;  3N2Z B;  5L0C A;  4XLP F;  2HZ8 A;  3C8G A;  1FFT C;  3RIP A;  3S29 A;  2EPM X;  2L81 A;  4Z9H A;  1NZE A;  4WAB A;  3IEE A;  3AQB A;  3FAJ A;  1MMG A;  1TWH A;  5F28 E;  3RQG A;  2L6G A;  3EG9 A;  4IWB A;  4YWQ A;  2JX0 A;  5CI9 A;  4PR9 A;  3JCU Q;  2LD6 A;  4WJ0 A;  2GWW A;  2X0C A;  5FCL A;  2OCC C;  1C02 A;  3TUL A;  2BL2 A;  3ZQY A;  2VCC A;  2DYS C;  2WVQ A;  3GM2 A;  3SP1 A;  3S90 A;  4C3E A;  2IOQ A;  3UGO A;  3V7O A;  2R05 A;  4K1O A;  2DB4 A;  3DAG A;  1NFN A;  3NMJ A;  2EPO A;  2GAQ A;  2OG2 A;  2VB6 A;  2Y69 C;  3AOU A;  3EG9 B;  3POV A;  4JUR I;  2BC5 A;  2FFH A;  4JJF A;  3U8V A;  1GS9 A;  1LI7 A;  2VCB A;  2NUP B;  1E86 A;  4ZLC A;  4Q4Z F;  3LS0 A;  1S7Z A;  3FAP B;  3EQL F;  2J45 A;  1JR8 A;  1OKK D;  2YL3 A;  1OQC A;  1M6T A;  2PNO A;  3AG4 C;  4BJT A;  1RJ9 A;  3DI5 A;  2OEX A;  3EJN A;  5HV9 A;  2QY9 A;  2A1D D;  2NSG A;  4W8P A;  3RW0 A;  2AWY A;  4PK4 A;  2XLV A;  3ATP A;  2P7V A;  3W8I A;  3LEO A;  3QW0 A;  3GOD A;  3IPM O;  1C03 A;  3VF0 A;  4BJ6 A;  4GYT A;  4CJG A;  1TFK B;  3K66 A;  3RKO F;  3B0U X;  4XEF A;  1FFH A;  5KYY A;  2OJE D;  5EHH A;  2KW3 C;  3AJM A;  4H4K C;  4I1M A;  4P6I C;  1AUE A;  3HNI A;  1I5N A;  1OCC C;  2B0H A;  4YL1 A;  3CEX A;  2YHS A;  3DE9 A;  1IZM A;  2I15 A;  3W2W A;  4ULV A; 
#chains in the Genus database with same CATH homology
 1ZHW A;  5L3Q A;  3CZ6 A;  2IXN A;  3Q7L A;  4U5D E;  1O87 A;  5F5F A;  3VAY A;  3AG1 C;  4PJL A;  4AE4 B;  3AQC A;  1OCZ C;  2W4B A;  2R7O A;  3N24 A;  3NDB B;  3EFO B;  2H7V C;  3HLZ A;  1SZI A;  4YT8 A;  1D1C A;  3JT1 A;  3S0X A;  4QDL A;  3DXJ F;  1D0Z A;  5IY5 C;  2VH3 A;  2V3C C;  3GAN A;  3WOD F;  4BJ5 C;  3NRH A;  1PD0 A;  4ULW A;  3QMK A;  4O6M A;  4QI2 A;  1TWA A;  4CIH A;  3ZG1 A;  2H7O A;  5KYW B;  3OEO A;  3SEO A;  3CSK A;  2CNW D;  4YT4 A;  1LKX A;  3W8H A;  3L0I A;  4HFF B;  3ASN C;  3DM5 A;  1KU2 A;  4OIN F;  3X2Q C;  2R7R A;  4OIO F;  4C7O A;  3LS1 A;  4JW1 A;  2R7W A;  4DBQ A;  4BG0 A;  4KI2 A;  5KYN A;  4JVS A;  1ZYR F;  2J9W A;  1PCX A;  3ZSU A;  4F4B A;  3Q6N A;  1Z6A A;  2Y3G A;  4M63 A;  5DS6 A;  4O6Y A;  1M2V A;  3DM9 B;  2Z15 A;  4E7S A;  3EFO A;  3JYH A;  5DLJ A;  3LES A;  3DD7 A;  3FHD A;  2CGE A;  3JRT A;  1ST6 A;  3EGD B;  4N06 A;  3UMH A;  4BEJ A;  4KC9 A;  2HV7 A;  1D1B A;  1BR2 A;  1ZHY A;  3JSZ A;  2KQ9 A;  3F46 A;  3EPV A;  2FGY A;  4BJ6 C;  2Y3H A;  3E70 C;  4JZA A;  1M57 C;  1M2O A;  2G62 A;  4U5E E;  4LLE A;  2R7Q A;  5E2Q A;  2XRH A;  4Q7C A;  4YT5 A;  5EGY A;  2IYL D;  5T3W A;  4GEH A;  4JJG A;  2Q9B A;  5KYU B;  2ZXO A;  3NYM A;  4O79 A;  3S27 A;  3I5Q A;  4G7H F;  3DJN B;  3VYW A;  1JPN A;  3EH1 A;  2P6V A;  1ZHT A;  4PJM A;  3K1H A;  3Q7G A;  2B0J A;  5DQT A;  3ECS A;  1QZX A;  3PHF 2;  1NU9 C;  3LJB A;  5KYW A;  2W9Y A;  3RH3 A;  5D92 A;  1SF8 A;  4CSA A;  3LNR A;  4ANJ A;  4CBE A;  4E7Z A;  3ABM C;  4CSA C;  2E87 A;  5DVW A;  2V26 A;  3DZA A;  2PP4 A;  1ZU4 A;  5KYX B;  5KYU A;  4BJ5 A;  1V54 C;  4QI0 A;  2IXP A;  2WVN A;  4OIP F;  2J9V A;  2EIM C;  2EIN C;  2A6E F;  4EBB A;  5B3S C;  2PF4 E;  1PD1 A;  5B1A C;  4PJN A;  2MWQ A;  1J8Y F;  3ABL C;  3NKE A;  4NY3 A;  2NUT B;  2NG1 A;  5D91 A;  3ZVR A;  4G7Z F;  1FMW A;  4LLC A;  1VMA A;  5E3C A;  3T6B A;  4OD4 A;  1MMA A;  3MX3 A;  4K7B A;  4I44 A;  4MQ9 F;  3S28 A;  3EHM A;  1MMD A;  3O6X A;  4HE8 D;  1Z63 A;  5B1B C;  3KKB A;  4LER A;  2J9U A;  1JPJ A;  2G3V A;  2ZXW C;  2WB7 A;  5DS4 A;  1BR4 A;  5L3V A;  3B0P A;  3OA1 A;  5KYY B;  3SZR A;  4PJJ A;  3H65 A;  4C7O B;  1RJ9 B;  2BE5 F;  1M2V B;  3FVY A;  3EGX A;  4YN0 B;  3X1O A;  5HSW A;  4G7O F;  5E33 A;  3ZIB A;  3F47 A;  2J46 A;  1OCO C;  2R7U A;  2I8B A;  3L34 A;  4B6I A;  1J8M F;  3Q6M A;  4DVZ A;  4YT2 A;  4Q5S F;  4O7G A;  4BJ1 A;  3UR3 C;  4PFP A;  4MND A;  3EGD A;  5CI8 A;  3KMI A;  3K33 A;  4G0H A;  2R7T A;  4HEA J;  2JD3 A;  1W2W A;  4U5H A;  3N0T A;  1M56 C;  1VYK A;  2R7V A;  2WZF A;  1G8X A;  2QTV A;  4X0R A;  4I3M A;  3TD7 A;  3T4R A;  1LVK A;  2C03 A;  2DGJ A;  1V55 C;  4KBL A;  1TR2 A;  2IXM A;  5T3T A;  2J7P D;  4CS7 A;  1TKN A;  2CDQ A;  2Q3T A;  2M4E A;  4CS8 C;  2EIJ C;  4FWV A;  1Z5Z A;  2ZPA A;  2XXA B;  3NKD A;  3OWT A;  2R7X A;  3I5P A;  4KNW A;  1BR1 A;  3MLG A;  5BUO A;  1D0X A;  1O5H A;  2CW0 F;  3CQZ A;  4BJT A;  3O39 A;  1FMV A;  2YZS A;  4AK9 A;  2HV6 A;  5DQZ A;  3ASO C;  4DOZ A;  1ZU5 A;  2NUP A;  2D5R B;  1IW7 F;  2L9J A;  4RD9 A;  2ZXR A;  3RFY A;  1QLE C;  4K0D A;  4U5C E;  3UMI A;  2XL4 A;  3DAF A;  3WG7 C;  2A6H F;  4U5G A;  2IXO A;  5E3A A;  2CNW A;  2KGO A;  4ZLD A;  2VAS A;  2PX0 A;  1MND A;  2MYS A;  3T6J A;  1FTS A;  4J32 B;  1SMY F;  4XTK A;  3B9Q A;  3EZH A;  4HFK B;  1NG1 A;  5F5H A;  1ZHZ A;  3UMK A;  4FX5 A;  3KH2 A;  1ZHX A;  2KNH A;  2YEV A;  3K7D A;  2Y3D A;  3ABK C;  3M1C B;  1D0Y A;  1OCR C;  1VYI A;  4CS9 A;  1Z3I X;  4OD5 A;  3FDQ A;  4CS9 C;  4U5B E;  3EHN A;  4XLN F;  2Y3B A;  2PX3 A;  1OKK A;  4W8K A;  3NYL A;  3ZC4 A;  4C3B A;  5KYX A;  4RBN A;  3E9V A;  3PMR A;  3DMD A;  5DS5 A;  4O6N A;  3K1I C;  4LAC B;  2H7B A;  3HJC A;  2Y39 A;  2WZL A;  4XWJ A;  3EH2 A;  4DVY P;  4IAO A;  1NU7 D;  1VOM A;  3RYL A;  3B0V C;  2WL8 A;  2J0X A;  4JCH A;  3SNH A;  4OIQ F;  2Q9A A;  4YJW A;  2WVO A;  1MNE A;  1TWC A;  2R7S A;  3LAY A;  3QZC A;  4DBR A;  2WZG A;  1MMN A;  3SYN A;  4A2N B;  2G3K A;  2NUT A;  2DYR C;  4IRU A;  3EZI A;  3AG2 C;  4U5F E;  2EIL C;  2KJG A;  4FES A;  2C04 A;  3EGX B;  3KL4 A;  2EIK C;  3LLI A;  4J30 B;  4KNV A;  2LSE A;  4IJJ A;  2W45 A;  4C3D A;  3DJU B;  4OIR F;  3UGP A;  1VK5 A;  3NYJ A;  3UNG C;  4EWC A;  2Q9C A;  2GFH A;  1TWG A;  1N1C A;  2O9X A;  4AE4 A;  1WGW A;  3ITF A;  2XXA A;  1Z23 A;  4I1O B;  5T1D B;  2A68 F;  2ZXP A;  1LS1 A;  2PFD A;  4CS8 A;  4AX2 A;  2W4M A;  2A69 F;  3NG1 A;  1D1A A;  3I4U A;  2J7P A;  4RDA A;  3LEV A;  2XSE A;  2J0W A;  3HTK C;  3K6B A;  4PFO A;  3AG3 C;  2X51 A;  3W2V A;  3N2Z B;  4XLP F;  1FFT C;  3RIP A;  3S29 A;  2L81 A;  1NZE A;  3IEE A;  3AQB A;  3FAJ A;  1MMG A;  1TWH A;  3EG9 A;  4IWB A;  4YWQ A;  5CI9 A;  3JCU Q;  4WJ0 A;  5FCL A;  2OCC C;  2DYS C;  2WVQ A;  3SP1 A;  4C3E A;  2IOQ A;  3UGO A;  3V7O A;  3DAG A;  2Y69 C;  2VB6 A;  2OG2 A;  3EG9 B;  3POV A;  4JUR I;  2FFH A;  4JJF A;  2NUP B;  4ZLC A;  4Q4Z F;  3LS0 A;  1S7Z A;  3EQL F;  2J45 A;  1OKK D;  3AG4 C;  1RJ9 A;  3EJN A;  2QY9 A;  2A1D D;  4PK4 A;  3W8I A;  2P7V A;  3GOD A;  4BJ6 A;  4GYT A;  3K66 A;  3RKO F;  3B0U X;  5KYY A;  1FFH A;  5EHH A;  2KW3 C;  4H4K C;  4I1M A;  4P6I C;  1OCC C;  2YHS A;  3LLK A;  1IZM A;  3W2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...