2KNHA

The solution structure of the etafh domain of aml1-eto complexed with heb peptide
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
103
Chain Sequence
GAMGSGARQLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARLAKQNPAQYLAQHEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription regulator
molecule keywords Protein CBFA2T1
publication title Structure of the AML1-ETO eTAFH domain-HEB peptide complex and its contribution to AML1-ETO activity.
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2009-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07531 TAFH NHR1 homology to TAF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1110 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2knhA00
2P6VA 2PP4A 2KNHA 2H7BA
chains in the Genus database with same CATH superfamily
1AEPA 1RKEB 1OR2A 3U2MA 1LKXA 1G8XA 2J8WA 2KSFA 3AQBA 5COMA 3SYNA 3I4UA 2YVKA 2LQGA 1TKNA 3JSZA 3AGTA 2QNLA 1T6IA 5COFA 4N6CA 3SXMA 4ZLCA 3UGPA 4OIPF 3EH1A 4CSAC 3L8IA 1YDIA 2EPNA 4LACB 3ZTZA 4EBKA 2R7TA 1E86A 3DXJF 3FHDA 4DVYP 3NDBB 1EQ1A 1TFOB 3G4ZA 2ZXPA 4MW8A 5B3SC 1YVIA 1OCZC 4DVZA 4BEJA 1FAPB 3FAPB 2NG1A 3U3BA 3VM6A 4CX9A 3RQEA 1EA8A 1MMAA 2XM0A 2Q9BA 1CGNA 2HUJA 4YJWA 3KH2A 2RD9A 4E17A 3S29A 1K04A 4U5FE 3FOPA 1K40A 1SR2A 1YYJA 4Q5SF 1JPJA 2HJMA 3JCUQ 4IB4A 4BJ5C 5K0IA 1Q0MA 1YZCA 3V5XA 1ZHZA 3EFOA 3S0XA 2EIJC 2R9RB 3AGUA 2XS1A 3VRCA 3ABLC 1G4US 1Z63A 1H9TA 2H8AA 5L0CA 2J7PA 4P9TA 4G0HA 3WODF 5JP7A 4NTBA 1E2XA 2C04A 3NKDA 4G78A 1WTYA 3E9VA 3NG1A 3RQFA 4CSAA 2VC9A 3B0UX 2CDQA 256BA 2X51A 1OKKD 3PMRA 4FX5A 5L3QA 5COGA 3EFOB 4J30B 4ZLDA 1AVOB 1H6GA 2XLWA 1ORJA 4LDQA 2Y69C 3U5SA 3V5YA 4CJOA 4AK9A 2PP4A 2R7SA 3DI5A 1D1CA 1H9GA 2WB7A 4HE8D 1BZ4A 1U6HA 3L0IA 3U2LA 2Y3DA 2IYLD 3ASOC 3EHNA 5DQZA 1QZXA 3M4BA 4BJ5A 2EILC 1V55C 1D0ZA 3EQLF 2QLAA 3OA1A 2W9YA 1Q0KA 2QTVA 4OD4A 2XL8A 4NTFA 4BEMJ 3WAQA 1K05A 2YLGA 3RKOF 3GM1A 3LS0A 5E3AA 3J06A 1Z5ZA 3GEEA 5FCLA 1FFTC 1HMDA 4U5HA 2WVQA 3T4RA 3LJBA 3C63A 1VLSA 2R7XA 3TD7A 3U8PA 2L6GA 3JRMO 2V26A 1LM3B 2B0JA 2IOQA 5F28E 1V74B 3VYWA 1D1AA 3JRTA 1DOWA 1KTMA 2RSEB 5TJ5E 4I3MA 1MMNA 2Q4FA 3H65A 1BBHA 2HV6A 4EBBA 5L0GA 4MVSA 4I1OB 1YARO 4JVSA 4JW1A 1G5ZA 4K1OA 1KU2A 5A69A 3DD7A 5L0HA 5KYUA 3C62A 4NTAA 2EIMC 3KMIA 3QTHA 5E33A 2R7RA 3FMSA 4MVOA 1ZVZA 2YKZA 3IQ5A 4L6RA 4NC3A 4XWJA 1ZU4A 4U5DE 1CPQA 2NUPA 3DM5A 3Q7GA 4HFKB 1L7CA 2VH3A 4Z9JA 5B3IA 3SXKA 1APCA 3U9MA 4YL1A 1CGME 4AE4A 3IQCA 4YT8A 3N24A 1UFBA 1WOLA 1LI5A 1C17M 3SXYA 1WASA 4P6IC 4CBEA 4U5CE 1OXBA 3S84A 1OXKA 5EGYA 3B0VC 1O5HA 1A7DA 1NBBA 3LUTB 2XLEA 5E2QA 5A6JA 3JZ0A 1I4ZA 2JX0A 2HMQA 3CAXA 3M4CA 4W8PA 2YL3A 4DOZA 2PX0A 1A41A 2J9WA 3IQ6A 1VOMA 4M63A 2ASRA 1MNEA 2KGOA 1ZW2A 3C8GA 2DI3A 1LE4A 2HJ3A 2KYHA 3I5PA 3K33A 4ER9A 3H2VA 5E3CA 2TMVP 1D1BA 4U9DA 2I8BA 2IXMA 1GQAA 1ZHWA 2LIGA 3GEIA 4XQ1A 2ZPAA 3S28A 4CS9A 3UR3C 2GDCA 2UUIA 1LIHA 1M6TA 1NFNA 1FNTc 4OINF 1LS4A 5L0JA 3EGDB 1LI7A 4OIQF 2IXOA 2ETSA 2OJED 2YL1A 3ABKC 3HNKA 2X0CA 2BE5F 3ZVRA 1PV3A 5BQHA 3EG9A 1SYQA 2Q9CA 2PFDA 4XPYA 3W2WA 1F1MA 4MS2A 4E0HA 2VB6A 2XRHA 5B1AC 4IWBA 1PD0A 3KYIA 1OW7A 2XS8A 2D5RB 3C18A 1NG1A 2G3VA 2HS5A 3CZ6A 4IRUA 3LEVA 2YLDA 3V7OA 1JRAA 2XL6A 3EZHA 3SZRA 1Y4CA 2WZGA 4CS7A 1TWGA 3U8VA 3EG9B 4JTCB 2CGEA 4J7TA 5JT4A 2CW0F 3M1CB 1XZQA 2XLOA 2OEVA 2XLDA 3MFNA 2J45A 1YLMA 5KYYB 2HV7A 3KYJA 4ONSA 3DZAA 4H4KC 3DJNB 2AU5A 3F46A 5AGFA 1S05A 4CDYA 3K1HA 2EPKX 5BQIA 1GS9A 3T9OA 2EPLX 1XWJA 2HMZA 2VCAA 2MWQA 3QZCA 4IAOA 3ZG1A 4JKVA 3K6BA 4N4WA 2F22A 4NY3A 1T6QA 5D91A 2A6HF 2GAQA 2R02A 3TJ5A 3ZTMA 2GWWA 4ULVA 5DLJA 1RJ9A 2A6EF 2KNHA 2NUTA 1OR3A 1ORSC 3GANA 2J0WA 3AG1C 4LDKA 5EK0A 4E7SA 5DS4A 3IQTA 4K7BA 4PFOA 3VF0A 1I4YA 1C02A 4O6NA 4O6MA 4A2NB 4YT4A 5KYXA 2XXAA 2IBFA 4C7OA 2G3KA 2DGJA 3BRJA 5CIVA 3CSKA 4BJ1A 4DRJB 3HJCA 4U5EE 1Q0GA 2J9UA 1A0BA 3IPMO 3MBGA 1RKCA 3ASNC 2LK4A 3ZQVA 1JOGA 3ZQYA 4UDVA 4PACA 4C3BA 2PF4E 2D4UA 4LDRA 1RXQA 2PBEA 3Q6MA 3FDQA 4CDAA 4IJJA 2XLMA 3DMDA 2A68F 3CEXA 1VLTA 1VMAA 2R7VA 4HEAJ 3ECSA 2BL2A 5HV9A 3TULA 2OOCA 3PDMP 2M4EA 1VYKA 3B71A 3LNMB 4EIYA 3LAYA 1A7EA 4IGGA 4RDAA 1BR4A 2EIKC 4LLCA 1QLEC 2W45A 3U0CA 3MYFA 1CPRA 1W2WA 1QPUA 2YRFA 1NU7D 1R4TA 1LVKA 2WL8A 3O10A 2IXNA 2Y3HA 1SZIA 3U9JA 2J9VA 4D4NA 3NKEA 2LSEA 2Y3BA 1C03A 2DYRC 1VK5A 1YZAA 3NMJA 2J46A 4O7GA 5L0DA 1N1CA 4KC9A 2HZ8A 3RVYA 1FMWA 3ZDLA 2LFDA 2XL4A 1YAUO 1HY5A 3HNIA 3C8GD 1IZMA 4P9FA 3RVZA 2FGYA 2KW3C 2MHRA 3ABMC 3TJ6A 3SEOA 4D4XA 2R25A 4JTAB 2VCBA 2ZD9A 4JC7A 4O79A 3TOLA 1OQCA 1O87A 2KJGA 3UMHA 4OD5A 5A6BA 3AG3C 2IXPA 2P7VA 5D92A 1TWCA 2EINC 3K66A 4CIHA 3K1IC 4JCZA 1FFHA 2E87A 4W8KA 2ZXRA 2GFHA 1MMGA 1PCXA 2Y39A 4Z9IA 4JTDB 2FAPB 2H7OA 1TQGA 2DYSC 3DJUB 5T1DB 1B68A 1VYIA 3B29A 2ZXWC 4JRZA 4MNDA 1E83A 5KYWA 1WGWA 1FMVA 4MVRA 1UG7A 1NZEA 3DAFA 2OCCC 4GYTA 5B1BC 3QW0A 1GM5A 3ATPA 3UMKA 1MMDA 3AG4C 3NYLA 1QSPA 2Q7RA 2WZLA 1OCCC 1OCOC 2XM4A 3AQCA 4LERA 4MQ9F 4Z9HA 2R7UA 5KYUB 3PCVA 3L1MA 3SNHA 3TQOA 2OEXA 4CDVA 3ITFA 3FXHA 2EPOA 4LLEA 1YJGA 4CJGA 2HKVA 4G7OF 4KNWA 3RF3A 2NUPB 3K1IA 2OKUA 3SXZA 2OJQA 4PJNA 4G7ZF 4CS8A 4AE4B 1MNDA 4MTOA 2ZXOA 2R03A 3X1OA 2LP4A 4MTFA 4QI0A 3O39A 1T5OA 2QE9A 3HNLA 2CNWA 4XLNF 3N2ZB 4CIPA 4PJMA 4C3DA 1WWPA 1Q0FA 1HW1A 4XPWA 3S90A 4I44A 5F5FA 2L7AA 3C8ZA 4PR9A 1TWHA 2UUHA 1Q0DA 3C8GB 4N06A 4DBRA 2Z15A 1EKYA 1R5ID 2J7PD 2AWYA 1T01A 2YZSA 4FWVA 4PK4A 3ZSUA 2J9BA 4YL3A 3U3FA 1CGOA 4F4BA 2QUPA 4JIOA 2OQMA 1NLXA 3DKAA 3UNGC 2ICWG 2EPMX 3C7JA 3AOUA 3RFYA 3T6GB 1RMVA 1LS1A 3BEHA 4WABA 1M2VA 2H7VC 4EKWA 1YYXA 1G4WR 1ZZPA 1ZHYA 1ORYA 2A0BA 2XLHA 3MX3A 4R32A 2HFIA 2I15A 4E7ZA 5CI9A 4EWCA 4J7YA 1JR8A 4XTKA 3TOMA 4DJ9A 1HW2A 5JS5A 2VASA 3E70C 2R7WA 1RKEA 3UGOA 3EPVA 1TFKB 4BJ6C 1LE2A 2MYSA 2KQ9A 2Y3GA 1J8YF 4BPMA 3PHF2 1AUEA 2M64A 4YK5A 4DRIB 2YLIA 2L9JA 1ST6A 3ZWIA 2LFFA 3S27A 3T6JA 2CYDA 2WZFA 5JLIA 1D0YA 4XEVA 1L3PA 4JE9A 4DBQA 3GWLA 4JEBA 4YL0A 3M15A 3HKKA 3LLIA 2NSFA 3RW0A 4MTGA 4EHPA 2DB4A 2HSBA 3N0TA 4XPXA 5L3VA 2AVKA 5A6BD 2W4MA 1TWAA 3A11A 1JPNA 1D0XA 4FESA 4WJ0A 5FZTA 4YT5A 4CS9C 1MQVA 3DE8A 4QI2A 3O55A 3OWTA 4DXWA 5HSWA 1J8MF 1T6UA 3HTKC 2VCCA 3MLGA 3CQZA 1NFOA 2G62A 2L6FA 2V3CC 1RJ9B 2NUTB 3DM9B 3FVYA 3NMKA 3W2VA 1E84A 1BR1A 1NU9C 4BJ6A 3G4XA 2JPUA 4I1MA 3QVZA 3RQGA 4OIOF 5AC5A 5KYXB 2XXAB 1PD1A 4C7OB 4RD9A 2A0UA 3RH3A 3LS1A 1QVXA 5DS5A 2YL7A 3T6BA 1TR2A 3TK0A 3M79A 4B6IA 2J0XA 1V4AA 3B0PA 3AJMA 3W4YA 1M57C 2BC5A 2A69F 4U5GA 5EHHA 3GWNA 4JJGA 3ZIBA 2WVNA 1S7ZA 3S9OA 4E18A 3W8HA 4MVMA 4AL1A 3MYIA 1HE9A 1Z3IX 5DQTA 3LEOA 3LNRA 3O6XA 3Q7LA 3L8JA 3I5QA 1ZW3A 3HLZA 3NYMA 3EH2A 4X0RA 3W8IA 1BR2A 3K7DA 3DWWA 1ZHXA 5L0IA 2KC3A 3KKBA 3R7CA 4Q4ZF 3UMIA 5T3TA 1Z6AA 3NRHA 5GPGB 5BUOA 3QW1A 2YWAA 1ZU5A 1YA9A 1HMOA 4ANJA 2JD3A 4JCHA 4RBNA 4E0IA 3NYJA 1SMYF 3JTLO 2NPUA 4N6HA 3V5ZA 2P0NA 4PFPA 4K0DA 2CNWD 2QY9A 1XZPA 4KI2A 3JSEO 1NSGB 1O3UA 3DE9A 1JMWA 1V54C 2P1AA 4PJJA 3GM3A 4CS8C 3IHUA 4OIRF 1WATA 3IEEA 3EHMA 4EBJA 4YN0B 5IY5C 4U5BE 1U89A 3B9QA 3G50A 4J32B 2PNOA 3ZC4A 3F47A 3KL4A 2NSGA 2H7BA 2YQYA 4JEAA 1H7IA 1OCRC 1QQ3A 2XSEA 3QVYA 1ZHTA 3GEHA 4IARA 3LESA 1BDJB 1GGQA 4BG0A 2LD6A 3EGXA 4HFFB 1FR0A 5BQGA 1LPEA 3LLKA 1M56C 4JZAA 1VTMP 3VAYA 2HSQA 1EI7A 3JYHA 2FFHA 2YHSA 5F5HA 1M2OA 2AP3A 4DRHB 5DS6A 3FOOA 1ZYRF 1T9KA 3EJNA 4MVUA 5T3WA 2B0HA 2OG2A 2C03A 3KPHA 5A6AA 5KYWB 3Q6NA 4C3EA 1DOVA 1OKKA 2Q9AA 4MVQA 1RCPA 2R05A 4IAQA 3JYYA 3US6A 4A4AA 3EGXB 2Q3TA 4AX2A 1OW8A 3DAGA 3A9CA 2LCHA 4H54A 3X2QC 1A7VA 1VB5A 3SP1A 1IW7F 2KK1A 4XEFA 5JUAA 4G7HF 2P61A 4NCQA 3NMIA 4U9EA 4BJTA 3GODA 4KBLA 2L6HA 3OEOA 1SF8A 2YEVA 4GEHA 4O6YA 3WHNA 5JVEA 4NQFA 4YT2A 3GM2A 3POVA 3RIPA 1YA7O 3EGDA 5AC4A 2OU6A 5CI8A 1Y6DA 4WGZA 4WGYA 5JSLA 3WG7C 3AG2C 3QMKA 4XEKA 4AL0A 1I5NA 2R7QA 5DVWA 1U0BB 3JT1A 2WVOA 1KNYA 4QDLA 5A6KA 2O9XA 3EZIA 3H2UA 4KNVA 1E85A 2W4BA 2CCYA 2Q00A 1Z7Qc 1QKRA 2PX3A 3GORA 1JAFA 1FTSA 4ULWA 3RYLA 5L0FA 1OW6A 3FAJA 4GQHA 4JURI 4PJLA 1Z23A 1M2VB 3HNJA 5JRAA 2AWCA 4MW3A 2GA0A 3L34A 2A1DD 1HE1A 2IM8A 4JJFA 4FAPB 4XLPF 4EUKB 5KYYA 4Q7CA 4YWQA 2P6VA 2L81A 2YL0A 2XLVA 3R2PA 1WN0A 5KYNA 4MVZA 2R7OA
chains in the Genus database with same CATH topology
1LKXA 1G8XA 3SYNA 3AQBA 3VYWA 2R7SA 3I4UA 3JSZA 5DLJA 1TKNA 4ZLCA 3UGPA 4OIPF 3EH1A 4CSAC 4LACB 2R7TA 3DXJF 3FHDA 4DVYP 3NDBB 2ZXPA 5B3SC 4DVZA 1OCZC 4BEJA 2NG1A 1MMAA 2Q9BA 4YJWA 3KH2A 3S29A 4U5FE 4Q5SF 1JPJA 3JCUQ 4BJ5C 1ZHZA 3EFOA 3S0XA 2EIJC 3ABLC 1Z63A 2J7PA 4G0HA 3WODF 3NKDA 2C04A 3E9VA 3NG1A 4CSAA 3B0UX 2CDQA 2X51A 1OKKD 3PMRA 4FX5A 5L3QA 3EFOB 4J30B 4ZLDA 2Y69C 4AK9A 2PP4A 1D1CA 2WB7A 4HE8D 3L0IA 2Y3DA 2IYLD 3ASOC 3EHNA 5DQZA 1QZXA 4BJ5A 2EILC 1V55C 1D0ZA 3EQLF 3OA1A 2W9YA 4OD4A 2QTVA 3RKOF 3LS0A 5E3AA 1Z5ZA 5FCLA 1FFTC 4U5HA 3T4RA 2WVQA 3LJBA 2R7XA 3TD7A 2V26A 2B0JA 2IOQA 1D1AA 3JRTA 4I3MA 1MMNA 3H65A 2HV6A 4EBBA 4I1OB 4JVSA 4JW1A 1KU2A 3DD7A 5KYUA 2EIMC 3KMIA 5E33A 2R7RA 4XWJA 1ZU4A 4U5DE 2NUPA 3DM5A 3Q7GA 4HFKB 2VH3A 4AE4A 4YT8A 3N24A 4CBEA 4P6IC 4U5CE 5EGYA 3B0VC 1O5HA 5E2QA 4DOZA 2PX0A 2J9WA 4M63A 1VOMA 3NKEA 1MNEA 2KGOA 3I5PA 3K33A 5E3CA 1D1BA 3S28A 2I8BA 2IXMA 4G7HF 1ZHWA 4CS9A 2ZPAA 3UR3C 4OINF 3EGDB 4OIQF 2IXOA 3ABKC 3ZVRA 2BE5F 3EG9A 2Q9CA 2PFDA 3W2WA 2VB6A 2XRHA 5B1AC 4IWBA 1PD0A 2D5RB 1NG1A 2G3VA 4IRUA 3CZ6A 3V7OA 3LEVA 3EZHA 3SZRA 2WZGA 4CS7A 1TWGA 3EG9B 2CGEA 2CW0F 3M1CB 2J45A 5KYYB 2HV7A 3DZAA 4H4KC 3DJNB 3F46A 3K1HA 3QZCA 4IAOA 2MWQA 3ZG1A 3K6BA 4NY3A 5D91A 2A6HF 1RJ9A 2A6EF 2KNHA 2NUTA 3GANA 2J0WA 3AG1C 4E7SA 5DS4A 4YT4A 4K7BA 4PFOA 4A2NB 4O6NA 4O6MA 5KYXA 2XXAA 4C7OA 2G3KA 2DGJA 3CSKA 4BJ1A 3HJCA 4U5EE 2J9UA 4C3BA 2PF4E 3Q6MA 3FDQA 4IJJA 3DMDA 2A68F 1VMAA 2R7VA 4HEAJ 3ECSA 2M4EA 1VYKA 3LAYA 4RDAA 1BR4A 2EIKC 4LLCA 1QLEC 2W45A 1W2WA 1NU7D 2WL8A 1LVKA 2IXNA 2Y3HA 1SZIA 2J9VA 2LSEA 2Y3BA 2DYRC 1VK5A 4O7GA 2J46A 1N1CA 4KC9A 1FMWA 2XL4A 3ZIBA 1IZMA 2FGYA 2KW3C 3ABMC 3SEOA 4O79A 1O87A 2KJGA 3UMHA 4OD5A 3AG3C 2IXPA 2P7VA 5D92A 1TWCA 2EINC 3K66A 4CIHA 3K1IC 1FFHA 2E87A 4W8KA 2ZXRA 2GFHA 1MMGA 1PCXA 2Y39A 2H7OA 3DJUB 2DYSC 5T1DB 1VYIA 2ZXWC 4MNDA 5KYWA 1WGWA 1FMVA 1NZEA 3DAFA 2OCCC 4GYTA 5B1BC 3UMKA 1MMDA 3AG4C 3NYLA 2WZLA 1OCCC 1OCOC 3AQCA 4LERA 4MQ9F 2R7UA 5KYUB 3SNHA 3ITFA 4LLEA 4G7OF 4KNWA 2NUPB 4PJNA 4G7ZF 4CS8A 4AE4B 1MNDA 2ZXOA 3X1OA 4QI0A 3O39A 4XLNF 2CNWA 3N2ZB 4PJMA 4C3DA 4I44A 5F5FA 1TWHA 4N06A 4DBRA 2Z15A 2J7PD 2YZSA 4FWVA 3ZSUA 4PK4A 4F4BA 3UNGC 3RFYA 1LS1A 1M2VA 2H7VC 1ZHYA 3MX3A 4E7ZA 5CI9A 4EWCA 4XTKA 2VASA 3E70C 2R7WA 3UGOA 3EPVA 3PHF2 4BJ6C 2MYSA 2Y3GA 2KQ9A 1J8YF 2L9JA 1ST6A 3S27A 3T6JA 2WZFA 1D0YA 4DBQA 3LLIA 3N0TA 5L3VA 2W4MA 1TWAA 1JPNA 1D0XA 4FESA 4WJ0A 4CS9C 4YT5A 4QI2A 3OWTA 5HSWA 1J8MF 3HTKC 3MLGA 2V3CC 3CQZA 2G62A 1RJ9B 2NUTB 3DM9B 3FVYA 3W2VA 1BR1A 1NU9C 4BJ6A 4I1MA 4OIOF 5KYXB 2XXAB 1PD1A 4C7OB 4RD9A 3RH3A 3LS1A 5DS5A 4B6IA 3T6BA 1TR2A 2J0XA 3B0PA 1M57C 2A69F 4U5GA 5EHHA 4JJGA 2WVNA 1S7ZA 3W8HA 1Z3IX 5DQTA 3O6XA 3LNRA 3Q7LA 4X0RA 3SP1A 3I5QA 3W8IA 3HLZA 3NYMA 3EH2A 1BR2A 3K7DA 1ZHXA 3KKBA 4Q4ZF 3UMIA 5T3TA 1Z6AA 3NRHA 5BUOA 1ZU5A 4ANJA 2JD3A 4JCHA 4RBNA 3NYJA 1SMYF 4PFPA 4K0DA 2CNWD 2QY9A 4KI2A 1V54C 4PJJA 4CS8C 4OIRF 3IEEA 3EHMA 5IY5C 4YN0B 4U5BE 3B9QA 4J32B 3ZC4A 3F47A 3KL4A 2R7OA 2H7BA 2XSEA 1OCRC 5CI8A 1ZHTA 4BG0A 3LESA 3EGXA 4HFFB 3LLKA 1M56C 4JZAA 3VAYA 3JYHA 2FFHA 2YHSA 5F5HA 1M2OA 5DS6A 5T3WA 1ZYRF 3EJNA 2OG2A 2C03A 5KYWB 3Q6NA 4C3EA 1OKKA 2Q9AA 3EGXB 2Q3TA 4AX2A 3DAGA 3X2QC 1IW7F 4BJTA 3GODA 4KBLA 3OEOA 1SF8A 2YEVA 4GEHA 4O6YA 3POVA 4YT2A 3RIPA 3EGDA 3WG7C 3AG2C 3QMKA 2R7QA 5DVWA 3JT1A 2WVOA 4QDLA 2O9XA 3EZIA 4KNVA 2W4BA 2PX3A 4ULWA 1FTSA 3RYLA 3FAJA 4JURI 4PJLA 1Z23A 1M2VB 3L34A 2A1DD 4JJFA 4XLPF 5KYYA 4Q7CA 4YWQA 2P6VA 2L81A 5KYNA 3ASNC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P6V A;  2PP4 A;  2KNH A;  2H7B A; 
#chains in the Genus database with same CATH topology
 1AEP A;  1RKE B;  1OR2 A;  3U2M A;  1LKX A;  1G8X A;  2J8W A;  2KSF A;  3AQB A;  5COM A;  3SYN A;  3I4U A;  2YVK A;  2LQG A;  1TKN A;  3JSZ A;  3AGT A;  2QNL A;  1T6I A;  5COF A;  4N6C A;  3SXM A;  4ZLC A;  3UGP A;  4OIP F;  3EH1 A;  4CSA C;  3L8I A;  1YDI A;  2EPN A;  4LAC B;  3ZTZ A;  4EBK A;  2R7T A;  1E86 A;  3DXJ F;  3FHD A;  4DVY P;  3NDB B;  1EQ1 A;  1TFO B;  3G4Z A;  2ZXP A;  4MW8 A;  5B3S C;  1YVI A;  1OCZ C;  4DVZ A;  4BEJ A;  1FAP B;  3FAP B;  2NG1 A;  3U3B A;  3VM6 A;  4CX9 A;  3RQE A;  1EA8 A;  1MMA A;  2XM0 A;  2Q9B A;  1CGN A;  2HUJ A;  4YJW A;  3KH2 A;  2RD9 A;  4E17 A;  3S29 A;  1K04 A;  4U5F E;  3FOP A;  1K40 A;  1SR2 A;  1YYJ A;  4Q5S F;  1JPJ A;  2HJM A;  3JCU Q;  4IB4 A;  4BJ5 C;  5K0I A;  1Q0M A;  1YZC A;  3V5X A;  1ZHZ A;  3EFO A;  3S0X A;  2EIJ C;  2R9R B;  3AGU A;  2XS1 A;  3VRC A;  3ABL C;  1G4U S;  1Z63 A;  1H9T A;  2H8A A;  5L0C A;  2J7P A;  4P9T A;  4G0H A;  3WOD F;  5JP7 A;  4NTB A;  1E2X A;  2C04 A;  3NKD A;  4G78 A;  1WTY A;  3E9V A;  3NG1 A;  3RQF A;  4CSA A;  2VC9 A;  3B0U X;  2CDQ A;  256B A;  2X51 A;  1OKK D;  3PMR A;  4FX5 A;  5L3Q A;  5COG A;  3EFO B;  4J30 B;  4ZLD A;  1AVO B;  1H6G A;  2XLW A;  1ORJ A;  4LDQ A;  2Y69 C;  3U5S A;  3V5Y A;  4CJO A;  4AK9 A;  2PP4 A;  2R7S A;  3DI5 A;  1D1C A;  1H9G A;  2WB7 A;  4HE8 D;  1BZ4 A;  1U6H A;  3L0I A;  3U2L A;  2Y3D A;  2IYL D;  3ASO C;  3EHN A;  5DQZ A;  1QZX A;  3M4B A;  4BJ5 A;  2EIL C;  1V55 C;  1D0Z A;  3EQL F;  2QLA A;  3OA1 A;  2W9Y A;  1Q0K A;  2QTV A;  4OD4 A;  2XL8 A;  4NTF A;  4BEM J;  3WAQ A;  1K05 A;  2YLG A;  3RKO F;  3GM1 A;  3LS0 A;  5E3A A;  3J06 A;  1Z5Z A;  3GEE A;  5FCL A;  1FFT C;  1HMD A;  4U5H A;  2WVQ A;  3T4R A;  3LJB A;  3C63 A;  1VLS A;  2R7X A;  3TD7 A;  3U8P A;  2L6G A;  3JRM O;  2V26 A;  1LM3 B;  2B0J A;  2IOQ A;  5F28 E;  1V74 B;  3VYW A;  1D1A A;  3JRT A;  1DOW A;  1KTM A;  2RSE B;  5TJ5 E;  4I3M A;  1MMN A;  2Q4F A;  3H65 A;  1BBH A;  2HV6 A;  4EBB A;  5L0G A;  4MVS A;  4I1O B;  1YAR O;  4JVS A;  4JW1 A;  1G5Z A;  4K1O A;  1KU2 A;  5A69 A;  3DD7 A;  5L0H A;  5KYU A;  3C62 A;  4NTA A;  2EIM C;  3KMI A;  3QTH A;  5E33 A;  2R7R A;  3FMS A;  4MVO A;  1ZVZ A;  2YKZ A;  3IQ5 A;  4L6R A;  4NC3 A;  4XWJ A;  1ZU4 A;  4U5D E;  1CPQ A;  2NUP A;  3DM5 A;  3Q7G A;  4HFK B;  1L7C A;  2VH3 A;  4Z9J A;  5B3I A;  3SXK A;  1APC A;  3U9M A;  4YL1 A;  1CGM E;  4AE4 A;  3IQC A;  4YT8 A;  3N24 A;  1UFB A;  1WOL A;  1LI5 A;  1C17 M;  3SXY A;  1WAS A;  4P6I C;  4CBE A;  4U5C E;  1OXB A;  3S84 A;  1OXK A;  5EGY A;  3B0V C;  1O5H A;  1A7D A;  1NBB A;  3LUT B;  2XLE A;  5E2Q A;  5A6J A;  3JZ0 A;  1I4Z A;  2JX0 A;  2HMQ A;  3CAX A;  3M4C A;  4W8P A;  2YL3 A;  4DOZ A;  2PX0 A;  1A41 A;  2J9W A;  3IQ6 A;  1VOM A;  4M63 A;  2ASR A;  1MNE A;  2KGO A;  1ZW2 A;  3C8G A;  2DI3 A;  1LE4 A;  2HJ3 A;  2KYH A;  3I5P A;  3K33 A;  4ER9 A;  3H2V A;  5E3C A;  2TMV P;  1D1B A;  4U9D A;  2I8B A;  2IXM A;  1GQA A;  1ZHW A;  2LIG A;  3GEI A;  4XQ1 A;  2ZPA A;  3S28 A;  4CS9 A;  3UR3 C;  2GDC A;  2UUI A;  1LIH A;  1M6T A;  1NFN A;  1FNT c;  4OIN F;  1LS4 A;  5L0J A;  3EGD B;  1LI7 A;  4OIQ F;  2IXO A;  2ETS A;  2OJE D;  2YL1 A;  3ABK C;  3HNK A;  2X0C A;  2BE5 F;  3ZVR A;  1PV3 A;  5BQH A;  3EG9 A;  1SYQ A;  2Q9C A;  2PFD A;  4XPY A;  3W2W A;  1F1M A;  4MS2 A;  4E0H A;  2VB6 A;  2XRH A;  5B1A C;  4IWB A;  1PD0 A;  3KYI A;  1OW7 A;  2XS8 A;  2D5R B;  3C18 A;  1NG1 A;  2G3V A;  2HS5 A;  3CZ6 A;  4IRU A;  3LEV A;  2YLD A;  3V7O A;  1JRA A;  2XL6 A;  3EZH A;  3SZR A;  1Y4C A;  2WZG A;  4CS7 A;  1TWG A;  3U8V A;  3EG9 B;  4JTC B;  2CGE A;  4J7T A;  5JT4 A;  2CW0 F;  3M1C B;  1XZQ A;  2XLO A;  2OEV A;  2XLD A;  3MFN A;  2J45 A;  1YLM A;  5KYY B;  2HV7 A;  3KYJ A;  4ONS A;  3DZA A;  4H4K C;  3DJN B;  2AU5 A;  3F46 A;  5AGF A;  1S05 A;  4CDY A;  3K1H A;  2EPK X;  5BQI A;  1GS9 A;  3T9O A;  2EPL X;  1XWJ A;  2HMZ A;  2VCA A;  2MWQ A;  3QZC A;  4IAO A;  3ZG1 A;  4JKV A;  3K6B A;  4N4W A;  2F22 A;  4NY3 A;  1T6Q A;  5D91 A;  2A6H F;  2GAQ A;  2R02 A;  3TJ5 A;  3ZTM A;  2GWW A;  4ULV A;  5DLJ A;  1RJ9 A;  2A6E F;  2KNH A;  2NUT A;  1OR3 A;  1ORS C;  3GAN A;  2J0W A;  3AG1 C;  4LDK A;  5EK0 A;  4E7S A;  5DS4 A;  3IQT A;  4K7B A;  4PFO A;  3VF0 A;  1I4Y A;  1C02 A;  4O6N A;  4O6M A;  4A2N B;  4YT4 A;  5KYX A;  2XXA A;  2IBF A;  4C7O A;  2G3K A;  2DGJ A;  3BRJ A;  5CIV A;  3CSK A;  4BJ1 A;  4DRJ B;  3HJC A;  4U5E E;  1Q0G A;  2J9U A;  1A0B A;  3IPM O;  3MBG A;  1RKC A;  3ASN C;  2LK4 A;  3ZQV A;  1JOG A;  3ZQY A;  4UDV A;  4PAC A;  4C3B A;  2PF4 E;  2D4U A;  4LDR A;  1RXQ A;  2PBE A;  3Q6M A;  3FDQ A;  4CDA A;  4IJJ A;  2XLM A;  3DMD A;  2A68 F;  3CEX A;  1VLT A;  1VMA A;  2R7V A;  4HEA J;  3ECS A;  2BL2 A;  5HV9 A;  3TUL A;  2OOC A;  3PDM P;  2M4E A;  1VYK A;  3B71 A;  3LNM B;  4EIY A;  3LAY A;  1A7E A;  4IGG A;  4RDA A;  1BR4 A;  2EIK C;  4LLC A;  1QLE C;  2W45 A;  3U0C A;  3MYF A;  1CPR A;  1W2W A;  1QPU A;  2YRF A;  1NU7 D;  1R4T A;  1LVK A;  2WL8 A;  3O10 A;  2IXN A;  2Y3H A;  1SZI A;  3U9J A;  2J9V A;  4D4N A;  3NKE A;  2LSE A;  2Y3B A;  1C03 A;  2DYR C;  1VK5 A;  1YZA A;  3NMJ A;  2J46 A;  4O7G A;  5L0D A;  1N1C A;  4KC9 A;  2HZ8 A;  3RVY A;  1FMW A;  3ZDL A;  2LFD A;  2XL4 A;  1YAU O;  1HY5 A;  3HNI A;  3C8G D;  1IZM A;  4P9F A;  3RVZ A;  2FGY A;  2KW3 C;  2MHR A;  3ABM C;  3TJ6 A;  3SEO A;  4D4X A;  2R25 A;  4JTA B;  2VCB A;  2ZD9 A;  4JC7 A;  4O79 A;  3TOL A;  1OQC A;  1O87 A;  2KJG A;  3UMH A;  4OD5 A;  5A6B A;  3AG3 C;  2IXP A;  2P7V A;  5D92 A;  1TWC A;  2EIN C;  3K66 A;  4CIH A;  3K1I C;  4JCZ A;  1FFH A;  2E87 A;  4W8K A;  2ZXR A;  2GFH A;  1MMG A;  1PCX A;  2Y39 A;  4Z9I A;  4JTD B;  2FAP B;  2H7O A;  1TQG A;  2DYS C;  3DJU B;  5T1D B;  1B68 A;  1VYI A;  3B29 A;  2ZXW C;  4JRZ A;  4MND A;  1E83 A;  5KYW A;  1WGW A;  1FMV A;  4MVR A;  1UG7 A;  1NZE A;  3DAF A;  2OCC C;  4GYT A;  5B1B C;  3QW0 A;  1GM5 A;  3ATP A;  3UMK A;  1MMD A;  3AG4 C;  3NYL A;  1QSP A;  2Q7R A;  2WZL A;  1OCC C;  1OCO C;  2XM4 A;  3AQC A;  4LER A;  4MQ9 F;  4Z9H A;  2R7U A;  5KYU B;  3PCV A;  3L1M A;  3SNH A;  3TQO A;  2OEX A;  4CDV A;  3ITF A;  3FXH A;  2EPO A;  4LLE A;  1YJG A;  4CJG A;  2HKV A;  4G7O F;  4KNW A;  3RF3 A;  2NUP B;  3K1I A;  2OKU A;  3SXZ A;  2OJQ A;  4PJN A;  4G7Z F;  4CS8 A;  4AE4 B;  1MND A;  4MTO A;  2ZXO A;  2R03 A;  3X1O A;  2LP4 A;  4MTF A;  4QI0 A;  3O39 A;  1T5O A;  2QE9 A;  3HNL A;  2CNW A;  4XLN F;  3N2Z B;  4CIP A;  4PJM A;  4C3D A;  1WWP A;  1Q0F A;  1HW1 A;  4XPW A;  3S90 A;  4I44 A;  5F5F A;  2L7A A;  3C8Z A;  4PR9 A;  1TWH A;  2UUH A;  1Q0D A;  3C8G B;  4N06 A;  4DBR A;  2Z15 A;  1EKY A;  1R5I D;  2J7P D;  2AWY A;  1T01 A;  2YZS A;  4FWV A;  4PK4 A;  3ZSU A;  2J9B A;  4YL3 A;  3U3F A;  1CGO A;  4F4B A;  2QUP A;  4JIO A;  2OQM A;  1NLX A;  3DKA A;  3UNG C;  2ICW G;  2EPM X;  3C7J A;  3AOU A;  3RFY A;  3T6G B;  1RMV A;  1LS1 A;  3BEH A;  4WAB A;  1M2V A;  2H7V C;  4EKW A;  1YYX A;  1G4W R;  1ZZP A;  1ZHY A;  1ORY A;  2A0B A;  2XLH A;  3MX3 A;  4R32 A;  2HFI A;  2I15 A;  4E7Z A;  5CI9 A;  4EWC A;  4J7Y A;  1JR8 A;  4XTK A;  3TOM A;  4DJ9 A;  1HW2 A;  5JS5 A;  2VAS A;  3E70 C;  2R7W A;  1RKE A;  3UGO A;  3EPV A;  1TFK B;  4BJ6 C;  1LE2 A;  2MYS A;  2KQ9 A;  2Y3G A;  1J8Y F;  4BPM A;  3PHF 2;  1AUE A;  2M64 A;  4YK5 A;  4DRI B;  2YLI A;  2L9J A;  1ST6 A;  3ZWI A;  2LFF A;  3S27 A;  3T6J A;  2CYD A;  2WZF A;  5JLI A;  1D0Y A;  4XEV A;  1L3P A;  4JE9 A;  4DBQ A;  3GWL A;  4JEB A;  4YL0 A;  3M15 A;  3HKK A;  3LLI A;  2NSF A;  3RW0 A;  4MTG A;  4EHP A;  2DB4 A;  2HSB A;  3N0T A;  4XPX A;  5L3V A;  2AVK A;  5A6B D;  2W4M A;  1TWA A;  3A11 A;  1JPN A;  1D0X A;  4FES A;  4WJ0 A;  5FZT A;  4YT5 A;  4CS9 C;  1MQV A;  3DE8 A;  4QI2 A;  3O55 A;  3OWT A;  4DXW A;  5HSW A;  1J8M F;  1T6U A;  3HTK C;  2VCC A;  3MLG A;  3CQZ A;  1NFO A;  2G62 A;  2L6F A;  2V3C C;  1RJ9 B;  2NUT B;  3DM9 B;  3FVY A;  3NMK A;  3W2V A;  1E84 A;  1BR1 A;  1NU9 C;  4BJ6 A;  3G4X A;  2JPU A;  4I1M A;  3QVZ A;  3RQG A;  4OIO F;  5AC5 A;  5KYX B;  2XXA B;  1PD1 A;  4C7O B;  4RD9 A;  2A0U A;  3RH3 A;  3LS1 A;  1QVX A;  5DS5 A;  2YL7 A;  3T6B A;  1TR2 A;  3TK0 A;  3M79 A;  4B6I A;  2J0X A;  1V4A A;  3B0P A;  3AJM A;  3W4Y A;  1M57 C;  2BC5 A;  2A69 F;  4U5G A;  5EHH A;  3GWN A;  4JJG A;  3ZIB A;  2WVN A;  1S7Z A;  3S9O A;  4E18 A;  3W8H A;  4MVM A;  4AL1 A;  3MYI A;  1HE9 A;  1Z3I X;  5DQT A;  3LEO A;  3LNR A;  3O6X A;  3Q7L A;  3L8J A;  3I5Q A;  1ZW3 A;  3HLZ A;  3NYM A;  3EH2 A;  4X0R A;  3W8I A;  1BR2 A;  3K7D A;  3DWW A;  1ZHX A;  5L0I A;  2KC3 A;  3KKB A;  3R7C A;  4Q4Z F;  3UMI A;  5T3T A;  1Z6A A;  3NRH A;  5GPG B;  5BUO A;  3QW1 A;  2YWA A;  1ZU5 A;  1YA9 A;  1HMO A;  4ANJ A;  2JD3 A;  4JCH A;  4RBN A;  4E0I A;  3NYJ A;  1SMY F;  3JTL O;  2NPU A;  4N6H A;  3V5Z A;  2P0N A;  4PFP A;  4K0D A;  2CNW D;  2QY9 A;  1XZP A;  4KI2 A;  3JSE O;  1NSG B;  1O3U A;  3DE9 A;  1JMW A;  1V54 C;  2P1A A;  4PJJ A;  3GM3 A;  4CS8 C;  3IHU A;  4OIR F;  1WAT A;  3IEE A;  3EHM A;  4EBJ A;  4YN0 B;  5IY5 C;  4U5B E;  1U89 A;  3B9Q A;  3G50 A;  4J32 B;  2PNO A;  3ZC4 A;  3F47 A;  3KL4 A;  2NSG A;  2H7B A;  2YQY A;  4JEA A;  1H7I A;  1OCR C;  1QQ3 A;  2XSE A;  3QVY A;  1ZHT A;  3GEH A;  4IAR A;  3LES A;  1BDJ B;  1GGQ A;  4BG0 A;  2LD6 A;  3EGX A;  4HFF B;  1FR0 A;  5BQG A;  1LPE A;  3LLK A;  1M56 C;  4JZA A;  1VTM P;  3VAY A;  2HSQ A;  1EI7 A;  3JYH A;  2FFH A;  2YHS A;  5F5H A;  1M2O A;  2AP3 A;  4DRH B;  5DS6 A;  3FOO A;  1ZYR F;  1T9K A;  3EJN A;  4MVU A;  5T3W A;  2B0H A;  2OG2 A;  2C03 A;  3KPH A;  5A6A A;  5KYW B;  3Q6N A;  4C3E A;  1DOV A;  1OKK A;  2Q9A A;  4MVQ A;  1RCP A;  2R05 A;  4IAQ A;  3JYY A;  3US6 A;  4A4A A;  3EGX B;  2Q3T A;  4AX2 A;  1OW8 A;  3DAG A;  3A9C A;  2LCH A;  4H54 A;  3X2Q C;  1A7V A;  1VB5 A;  3SP1 A;  1IW7 F;  2KK1 A;  4XEF A;  5JUA A;  4G7H F;  2P61 A;  4NCQ A;  3NMI A;  4U9E A;  4BJT A;  3GOD A;  4KBL A;  2L6H A;  3OEO A;  1SF8 A;  2YEV A;  4GEH A;  4O6Y A;  3WHN A;  5JVE A;  4NQF A;  4YT2 A;  3GM2 A;  3POV A;  3RIP A;  1YA7 O;  3EGD A;  5AC4 A;  2OU6 A;  5CI8 A;  1Y6D A;  4WGZ A;  4WGY A;  5JSL A;  3WG7 C;  3AG2 C;  3QMK A;  4XEK A;  4AL0 A;  1I5N A;  2R7Q A;  5DVW A;  1U0B B;  3JT1 A;  2WVO A;  1KNY A;  4QDL A;  5A6K A;  2O9X A;  3EZI A;  3H2U A;  4KNV A;  1E85 A;  2W4B A;  2CCY A;  2Q00 A;  1Z7Q c;  1QKR A;  2PX3 A;  3GOR A;  1JAF A;  1FTS A;  4ULW A;  3RYL A;  5L0F A;  1OW6 A;  3FAJ A;  4GQH A;  4JUR I;  4PJL A;  1Z23 A;  1M2V B;  3HNJ A;  5JRA A;  2AWC A;  4MW3 A;  2GA0 A;  3L34 A;  2A1D D;  1HE1 A;  2IM8 A;  4JJF A;  4FAP B;  4XLP F;  4EUK B;  5KYY A;  4Q7C A;  4YWQ A;  2P6V A;  2L81 A;  2YL0 A;  2XLV A;  3R2P A;  1WN0 A;  5KYN A;  4MVZ A;  2R7O A; 
#chains in the Genus database with same CATH homology
 1LKX A;  1G8X A;  3SYN A;  3AQB A;  3VYW A;  2R7S A;  3I4U A;  3JSZ A;  5DLJ A;  1TKN A;  4ZLC A;  3UGP A;  4OIP F;  3EH1 A;  4CSA C;  4LAC B;  2R7T A;  3DXJ F;  3FHD A;  4DVY P;  3NDB B;  2ZXP A;  5B3S C;  4DVZ A;  1OCZ C;  4BEJ A;  2NG1 A;  1MMA A;  2Q9B A;  4YJW A;  3KH2 A;  3S29 A;  4U5F E;  4Q5S F;  1JPJ A;  3JCU Q;  4BJ5 C;  1ZHZ A;  3EFO A;  3S0X A;  2EIJ C;  3ABL C;  1Z63 A;  2J7P A;  4G0H A;  3WOD F;  3NKD A;  2C04 A;  3E9V A;  3NG1 A;  4CSA A;  3B0U X;  2CDQ A;  2X51 A;  1OKK D;  3PMR A;  4FX5 A;  5L3Q A;  3EFO B;  4J30 B;  4ZLD A;  2Y69 C;  4AK9 A;  2PP4 A;  1D1C A;  2WB7 A;  4HE8 D;  3L0I A;  2Y3D A;  2IYL D;  3ASO C;  3EHN A;  5DQZ A;  1QZX A;  4BJ5 A;  2EIL C;  1V55 C;  1D0Z A;  3EQL F;  3OA1 A;  2W9Y A;  4OD4 A;  2QTV A;  3RKO F;  3LS0 A;  5E3A A;  1Z5Z A;  5FCL A;  1FFT C;  4U5H A;  3T4R A;  2WVQ A;  3LJB A;  2R7X A;  3TD7 A;  2V26 A;  2B0J A;  2IOQ A;  1D1A A;  3JRT A;  4I3M A;  1MMN A;  3H65 A;  2HV6 A;  4EBB A;  4I1O B;  4JVS A;  4JW1 A;  1KU2 A;  3DD7 A;  5KYU A;  2EIM C;  3KMI A;  5E33 A;  2R7R A;  4XWJ A;  1ZU4 A;  4U5D E;  2NUP A;  3DM5 A;  3Q7G A;  4HFK B;  2VH3 A;  4AE4 A;  4YT8 A;  3N24 A;  4CBE A;  4P6I C;  4U5C E;  5EGY A;  3B0V C;  1O5H A;  5E2Q A;  4DOZ A;  2PX0 A;  2J9W A;  4M63 A;  1VOM A;  3NKE A;  1MNE A;  2KGO A;  3I5P A;  3K33 A;  5E3C A;  1D1B A;  3S28 A;  2I8B A;  2IXM A;  4G7H F;  1ZHW A;  4CS9 A;  2ZPA A;  3UR3 C;  4OIN F;  3EGD B;  4OIQ F;  2IXO A;  3ABK C;  3ZVR A;  2BE5 F;  3EG9 A;  2Q9C A;  2PFD A;  3W2W A;  2VB6 A;  2XRH A;  5B1A C;  4IWB A;  1PD0 A;  2D5R B;  1NG1 A;  2G3V A;  4IRU A;  3CZ6 A;  3V7O A;  3LEV A;  3EZH A;  3SZR A;  2WZG A;  4CS7 A;  1TWG A;  3EG9 B;  2CGE A;  2CW0 F;  3M1C B;  2J45 A;  5KYY B;  2HV7 A;  3DZA A;  4H4K C;  3DJN B;  3F46 A;  3K1H A;  3QZC A;  4IAO A;  2MWQ A;  3ZG1 A;  3K6B A;  4NY3 A;  5D91 A;  2A6H F;  1RJ9 A;  2A6E F;  2KNH A;  2NUT A;  3GAN A;  2J0W A;  3AG1 C;  4E7S A;  5DS4 A;  4YT4 A;  4K7B A;  4PFO A;  4A2N B;  4O6N A;  4O6M A;  5KYX A;  2XXA A;  4C7O A;  2G3K A;  2DGJ A;  3CSK A;  4BJ1 A;  3HJC A;  4U5E E;  2J9U A;  4C3B A;  2PF4 E;  3Q6M A;  3FDQ A;  4IJJ A;  3DMD A;  2A68 F;  1VMA A;  2R7V A;  4HEA J;  3ECS A;  2M4E A;  1VYK A;  3LAY A;  4RDA A;  1BR4 A;  2EIK C;  4LLC A;  1QLE C;  2W45 A;  1W2W A;  1NU7 D;  2WL8 A;  1LVK A;  2IXN A;  2Y3H A;  1SZI A;  2J9V A;  2LSE A;  2Y3B A;  2DYR C;  1VK5 A;  4O7G A;  2J46 A;  1N1C A;  4KC9 A;  1FMW A;  2XL4 A;  3ZIB A;  1IZM A;  2FGY A;  2KW3 C;  3ABM C;  3SEO A;  4O79 A;  1O87 A;  2KJG A;  3UMH A;  4OD5 A;  3AG3 C;  2IXP A;  2P7V A;  5D92 A;  1TWC A;  2EIN C;  3K66 A;  4CIH A;  3K1I C;  1FFH A;  2E87 A;  4W8K A;  2ZXR A;  2GFH A;  1MMG A;  1PCX A;  2Y39 A;  2H7O A;  3DJU B;  2DYS C;  5T1D B;  1VYI A;  2ZXW C;  4MND A;  5KYW A;  1WGW A;  1FMV A;  1NZE A;  3DAF A;  2OCC C;  4GYT A;  5B1B C;  3UMK A;  1MMD A;  3AG4 C;  3NYL A;  2WZL A;  1OCC C;  1OCO C;  3AQC A;  4LER A;  4MQ9 F;  2R7U A;  5KYU B;  3SNH A;  3ITF A;  4LLE A;  4G7O F;  4KNW A;  2NUP B;  4PJN A;  4G7Z F;  4CS8 A;  4AE4 B;  1MND A;  2ZXO A;  3X1O A;  4QI0 A;  3O39 A;  4XLN F;  2CNW A;  3N2Z B;  4PJM A;  4C3D A;  4I44 A;  5F5F A;  1TWH A;  4N06 A;  4DBR A;  2Z15 A;  2J7P D;  2YZS A;  4FWV A;  3ZSU A;  4PK4 A;  4F4B A;  3UNG C;  3RFY A;  1LS1 A;  1M2V A;  2H7V C;  1ZHY A;  3MX3 A;  4E7Z A;  5CI9 A;  4EWC A;  4XTK A;  2VAS A;  3E70 C;  2R7W A;  3UGO A;  3EPV A;  3PHF 2;  4BJ6 C;  2MYS A;  2Y3G A;  2KQ9 A;  1J8Y F;  2L9J A;  1ST6 A;  3S27 A;  3T6J A;  2WZF A;  1D0Y A;  4DBQ A;  3LLI A;  3N0T A;  5L3V A;  2W4M A;  1TWA A;  1JPN A;  1D0X A;  4FES A;  4WJ0 A;  4CS9 C;  4YT5 A;  4QI2 A;  3OWT A;  5HSW A;  1J8M F;  3HTK C;  3MLG A;  2V3C C;  3CQZ A;  2G62 A;  1RJ9 B;  2NUT B;  3DM9 B;  3FVY A;  3W2V A;  1BR1 A;  1NU9 C;  4BJ6 A;  4I1M A;  4OIO F;  5KYX B;  2XXA B;  1PD1 A;  4C7O B;  4RD9 A;  3RH3 A;  3LS1 A;  5DS5 A;  4B6I A;  3T6B A;  1TR2 A;  2J0X A;  3B0P A;  1M57 C;  2A69 F;  4U5G A;  5EHH A;  4JJG A;  2WVN A;  1S7Z A;  3W8H A;  1Z3I X;  5DQT A;  3O6X A;  3LNR A;  3Q7L A;  4X0R A;  3SP1 A;  3I5Q A;  3W8I A;  3HLZ A;  3NYM A;  3EH2 A;  1BR2 A;  3K7D A;  1ZHX A;  3KKB A;  4Q4Z F;  3UMI A;  5T3T A;  1Z6A A;  3NRH A;  5BUO A;  1ZU5 A;  4ANJ A;  2JD3 A;  4JCH A;  4RBN A;  3NYJ A;  1SMY F;  4PFP A;  4K0D A;  2CNW D;  2QY9 A;  4KI2 A;  1V54 C;  4PJJ A;  4CS8 C;  4OIR F;  3IEE A;  3EHM A;  5IY5 C;  4YN0 B;  4U5B E;  3B9Q A;  4J32 B;  3ZC4 A;  3F47 A;  3KL4 A;  2R7O A;  2H7B A;  2XSE A;  1OCR C;  5CI8 A;  1ZHT A;  4BG0 A;  3LES A;  3EGX A;  4HFF B;  3LLK A;  1M56 C;  4JZA A;  3VAY A;  3JYH A;  2FFH A;  2YHS A;  5F5H A;  1M2O A;  5DS6 A;  5T3W A;  1ZYR F;  3EJN A;  2OG2 A;  2C03 A;  5KYW B;  3Q6N A;  4C3E A;  1OKK A;  2Q9A A;  3EGX B;  2Q3T A;  4AX2 A;  3DAG A;  3X2Q C;  1IW7 F;  4BJT A;  3GOD A;  4KBL A;  3OEO A;  1SF8 A;  2YEV A;  4GEH A;  4O6Y A;  3POV A;  4YT2 A;  3RIP A;  3EGD A;  3WG7 C;  3AG2 C;  3QMK A;  2R7Q A;  5DVW A;  3JT1 A;  2WVO A;  4QDL A;  2O9X A;  3EZI A;  4KNV A;  2W4B A;  2PX3 A;  4ULW A;  1FTS A;  3RYL A;  3FAJ A;  4JUR I;  4PJL A;  1Z23 A;  1M2V B;  3L34 A;  2A1D D;  4JJF A;  4XLP F;  5KYY A;  4Q7C A;  4YWQ A;  2P6V A;  2L81 A;  5KYN A;  3ASN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...