2KNHA

The solution structure of the etafh domain of aml1-eto complexed with heb peptide
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
103
Chain Sequence
b'GAMGSGARQLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARLAKQNPAQYLAQHEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein CBFA2T1
molecule tags Transcription regulator
source organism Homo sapiens
publication title Structure of the AML1-ETO eTAFH domain-HEB peptide complex and its contribution to AML1-ETO activity.
pubmed doi rcsb
total genus 24
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2009-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07531 TAFH NHR1 homology to TAF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1110 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2knhA00
2KNHA 2H7BA 2PP4A 2P6VA
chains in the Genus database with same CATH superfamily
1LPEA 2IYLD 3M4CA 3AG3C 3K1HA 2M64A 2Q9CA 3FOPA 2DB4A 1VMAA 2H7VC 3IQTA 3IQ6A 4JEAA 3T9OA 3W2VA 3JYHA 5FZTA 3U2LA 2I15A 3Q7LA 1O5HA 3WHNA 1ZU4A 3RH3A 1RJ9A 2NUTA 5E2QA 2YKZA 2YL0A 3SXZA 2ZPAA 4MVMA 2MYSA 4O6YA 2BC5A 1R4TA 3AG1C 3MBGA 1TR2A 3EGDB 2LSEA 3G50A 3IQCA 2VCBA 4YL0A 3RVZA 3U3BA 1O87A 5FCLA 4I1OB 2Q4FA 2PNOA 1H9GA 1WOLA 1ZHWA 3T4RA 2RSEB 4WGYA 4CSAC 1Q0KA 3H2UA 5E33A 3ABLC 1LM3B 2PX3A 1HY5A 1TWHA 2G3VA 4ONSA 4UDVA 3F46A 5DQZA 2OEXA 3AOUA 1TFOB 4QDLA 4JCZA 3BEHA 2EPNA 2JX0A 3DWWA 1MMAA 1O3UA 2F22A 2W4MA 3EFOB 3JSZA 2HJMA 5CI8A 3EZHA 2XS1A 2Q3TA 1E85A 1GQAA 1NBBA 1A7EA 3ZIBA 3LNRA 3U0CA 2XL4A 2GDCA 2R03A 5L0GA 1ZYRF 1OR3A 3NMKA 2RD9A 1NU7D 4MVRA 2LFDA 2NSFA 3EQLF 2EPLX 4JW1A 4NQFA 1QZXA 1Q0DA 1PD1A 3NDBB 1U89A 3M1CB 4GQHA 5F28E 1RKEA 4AX2A 4DXWA 1Y6DA 2IM8A 3SXMA 1L3PA 2L6FA 2YL3A 4QI2A 2HMQA 2YLDA 4HE8D 1OQCA 1K05A 3ZG1A 4G7HF 2A6HF 2R7RA 2R7XA 3MLGA 3TJ6A 2LCHA 4D4XA 1Z63A 2XLMA 5EK0A 3GANA 2ZXOA 2XM4A 2OJED 2LP4A 1MMGA 1SR2A 1TQGA 2PBEA 1YLMA 2XSEA 1APCA 3FAJA 3K6BA 2C03A 2NSGA 3NKEA 1LS1A 3QTHA 2GFHA 2W9YA 2Y39A 3K66A 4I3MA 1C03A 1BR2A 2LK4A 4LDRA 4ANJA 5T3WA 5EGYA 2P61A 2IXMA 2ZXPA 3W4YA 1E86A 3MYFA 4O7GA 1E83A 1RMVA 3HJCA 3UGOA 2CDQA 1JRAA 4MVZA 3Q7GA 3TOMA 1YDIA 1M6TA 2YL1A 4BEMJ 1G4US 2WVQA 4BJ6C 4E0HA 1D0YA 4J7YA 1VK5A 3HLZA 5JP7A 1ORYA 3GEHA 4XLNF 2A0BA 4JCHA 2HJ3A 2FAPB 4GEHA 2I8BA 4XPYA 5AGFA 4LACB 3FDQA 4N4WA 2Y3BA 3LEVA 1NZEA 3B9QA 4U5CE 2IXPA 1V74B 3LS1A 1K40A 2KGOA 1AVOB 4WGZA 2KK1A 3HNKA 4K1OA 3PMRA 1JR8A 3DM9B 2PFDA 3IPMO 3L8IA 2G3KA 2FFHA 1M56C 1LI7A 2DYRC 2KW3C 2XM0A 4P6IC 2H8AA 4RDAA 4C7OA 3I5PA 4U9EA 1S7ZA 1VB5A 4Q7CA 4U5BE 2M4EA 2KSFA 2LQGA 2OQMA 3NG1A 3C62A 4O6MA 2YHSA 1JPNA 4HFKB 3FMSA 2HFIA 3X1OA 2OEVA 5D92A 4E7ZA 1QLEC 4C3DA 3A9CA 3ASNC 3JRMO 1LI5A 3B0PA 2J0XA 4XEKA 4CJGA 3W8IA 4OD5A 2ASRA 4YJWA 2WZFA 1H7IA 1J8YF 1CPRA 3DAFA 3V5YA 5L0DA 1FMVA 5L0CA 1TFKB 2KJGA 1PD0A 1J8MF 2HMZA 3H65A 4OIOF 1TWAA 2A69F 3NMIA 1OW6A 3BRJA 2KNHA 3KKBA 2PP4A 2EPOA 2J0WA 1NG1A 2G62A 2W45A 4PJMA 3US6A 4NTAA 2ZD9A 4F4BA 3C8ZA 3GM1A 3JT1A 1JOGA 3AGTA 2YEVA 4MTGA 1QSPA 1OKKA 2Y3HA 1YVIA 2WZGA 1T6QA 3ABMC 1MNEA 4JKVA 1BR4A 3R2PA 2LD6A 3RQFA 2H7BA 1L7CA 1VLTA 1ZZPA 4FAPB 1VOMA 3X2QC 2AWYA 5KYXA 4OIPF 1D0ZA 3AG4C 3ZWIA 4U5DE 1K04A 1C02A 1YJGA 3O6XA 2VC9A 2W4BA 1MQVA 1YYXA 5EHHA 2VCCA 4GYTA 4IAQA 3V5XA 1D0XA 3QW1A 4BEJA 4HFFB 4H54A 3ZQVA 2OJQA 4QI0A 4EUKB 1WATA 4CDYA 3S28A 3TULA 2R7OA 3CQZA 2B0JA 4PR9A 1LE4A 5F5HA 1YYJA 3VYWA 3ZC4A 2HSQA 3DKAA 1I5NA 1JMWA 4P9TA 4LDKA 5A6AA 2HUJA 1N1CA 1NLXA 3TD7A 3NMJA 3UMIA 4NTFA 5L0IA 1M57C 1TWCA 5B1BC 1V4AA 4LERA 4WABA 1T6UA 2CNWA 4JZAA 5L0HA 2KQ9A 3CEXA 3B0VC 2HS5A 4EKWA 3KPHA 4OINF 5BQIA 5A69A 4AK9A 1ZW3A 3DM5A 3TJ5A 1GGQA 4CS8A 3ECSA 1S05A 5JS5A 1TKNA 1YZCA 4O79A 4X0RA 2YZSA 3UGPA 5GPGB 1BZ4A 2VB6A 1ZU5A 4CIHA 2UUIA 3A11A 3M4BA 3K1IC 1V54C 3EZIA 4M63A 1A41A 1VYKA 4IGGA 5COGA 1WGWA 3VF0A 3B71A 1LE2A 3M79A 3SEOA 4CS9C 4ZLCA 4G7OF 3LESA 4N6CA 3CAXA 3SP1A 1XZQA 3OEOA 3LEOA 3FXHA 3KYJA 3O10A 3DMDA 1VLSA 3ZTMA 4C3EA 4Q4ZF 4D4NA 4CJOA 2HSBA 2C04A 2EIJC 3JSEO 1XZPA 2Q00A 2V3CC 1KU2A 4MW8A 5D91A 5L0FA 4H4KC 2YVKA 3EFOA 3HNJA 3LLIA 3ZSUA 3FAPB 1DOWA 4BJTA 1SMYF 3SXKA 3SZRA 2JPUA 4AE4B 3DI5A 2EPMX 4MNDA 3U2MA 2YQYA 4N6HA 4OD4A 4EBKA 2H7OA 2EPKX 2EIKC 2R05A 1A0BA 3U3FA 1Q0GA 2MWQA 4DVZA 3E9VA 2L6HA 2VASA 1AEPA 4MVQA 4DBRA 2XXAB 1VYIA 4BJ6A 1JAFA 5A6BD 2QTVA 3EHNA 1Z6AA 5JT4A 3LJBA 2XXAA 5BUOA 4A4AA 3NYJA 3ZQYA 1RJ9B 2NUTB 3JYYA 3K1IA 1QPUA 3H2VA 1FMWA 5KYNA 1H9TA 4U5EE 3EG9B 3N24A 1RKCA 5HV9A 3N2ZB 4JTCB 2XLVA 3L1MA 4IARA 4MVSA 3EGDA 4YL1A 3VAYA 2P7VA 3J06A 3DE9A 1UG7A 2R7UA 3GEIA 3MFNA 4CBEA 5KYWA 3EH2A 4PJJA 1Z23A 4I1MA 5JRAA 1DOVA 5CI9A 5CIVA 5F5FA 1E84A 4XQ1A 5KYYB 1V55C 4E18A 2EIMC 5KYWB 3GEEA 4JVSA 4CDAA 2EILC 2V26A 3W2WA 2IOQA 2BE5F 3L34A 1XWJA 2WB7A 3AQCA 3S29A 4BG0A 2DYSC 4YN0B 2CYDA 4K0DA 4MQ9F 4E17A 4JJGA 5DS6A 2LFFA 2P0NA 4XWJA 2CCYA 5BQGA 3UMKA 1H6GA 2A6EF 4YT2A 5HSWA 5L0JA 1OCOC 256BA 3W8HA 3EH1A 4NC3A 4XEVA 4CDVA 4Z9JA 1ORJA 4MVOA 1HW1A 3KMIA 4NTBA 1ZW2A 1T6IA 2OCCC 3K33A 4RBNA 1SF8A 5DVWA 3U8PA 4JIOA 5E3CA 3RQEA 4CS8C 3AQBA 2J45A 1SZIA 4JURI 1LS4A 1ORSC 3DJUB 3LS0A 1G5ZA 3C8GD 2AP3A 2CW0F 2Y69C 3G4XA 2YL7A 4ULWA 2CNWD 2NG1A 3WODF 4YT4A 5DS4A 3ZDLA 4EBBA 1D1BA 4LLEA 3LAYA 4JEBA 4E7SA 4JJFA 3QVZA 4EBJA 2OG2A 3IHUA 4IJJA 4XPXA 4XPWA 3VRCA 1QKRA 5JLIA 4C7OB 4K7BA 2GAQA 3JTLO 4KNVA 4W8KA 1CGOA 3O55A 3TK0A 3U9MA 5JUAA 4JC7A 3E70C 5TJ5E 3ZVRA 1ZHTA 4U5HA 2B0HA 2GWWA 1OW8A 2XLWA 4YWQA 3NKDA 1CGME 3GM2A 4WJ0A 1OCCC 1Z3IX 5JSLA 1ZHZA 2R7SA 1KTMA 4I44A 1MMNA 2GA0A 4XEFA 3EGXB 5B3SC 4YK5A 5T3TA 1YARO 1F1MA 2VCAA 3KYIA 3RQGA 1FAPB 5AC4A 2XLEA 2J46A 4DBQA 3EPVA 3Q6MA 4PACA 1BBHA 1OKKD 1YAUO 2A0UA 4NY3A 4G7ZF 1LIHA 2J9WA 4DVYP 2R7TA 1EQ1A 1U0BB 1EKYA 1FFHA 3JZ0A 3UMHA 3C18A 1M2VB 2R25A 4EWCA 4JTDB 1FNTc 4OIQF 1CPQA 1Q0FA 3N0TA 4O6NA 2TMVP 2J7PD 3M15A 3C8GA 5B1AC 1Z7Qc 1PV3A 3GODA 2QNLA 1G4WR 1WTYA 1GM5A 3RVYA 4J32B 4R32A 1Z5ZA 4FWVA 5KYUA 2R7QA 5A6KA 2AWCA 5JVEA 2J9VA 2L9JA 2R9RB 2P1AA 1A7DA 1SYQA 2XL6A 1WASA 3HTKC 3NRHA 4C3BA 3ZTZA 5KYUB 3DAGA 4Q5SF 4YL3A 1R5ID 2WVOA 1M2OA 4J30B 3WG7C 4ZLDA 1OCRC 4LLCA 3QZCA 1W2WA 1OR2A 2A1DD 4MVUA 1T01A 2J7PA 3EGXA 2YLGA 1C17M 4CS7A 1HE9A 3T6GB 2HV7A 2HV6A 4PJNA 3IEEA 3O39A 4FESA 2IBFA 4W8PA 3K7DA 2J9UA 5BQHA 1HMOA 4JE9A 2L81A 1YA7O 3F47A 2WZLA 3G4ZA 3POVA 4OIRF 3AJMA 2WVNA 3RYLA 4BPMA 1HE1A 2DI3A 1HMDA 1RKEB 3KL4A 3GWLA 3JCUQ 1I4ZA 3OA1A 1RCPA 4PFOA 5COFA 3S84A 3Q6NA 4IWBA 1UFBA 2AU5A 3EHMA 4JTAB 1M2VA 3ABKC 3KH2A 3QW0A 4B6IA 3C7JA 3LNMB 4LDQA 2YLIA 3T6BA 1WN0A 3C8GB 3EJNA 1Y4CA 3LUTB 4YT8A 2Y3DA 3LLKA 1E2XA 2QY9A 2D5RB 2LIGA 3DXJF 3S27A 2XS8A 3DZAA 3IQ5A 3NYMA 4XTKA 3T6JA 4BJ1A 4XLPF 3TOLA 2EINC 5DLJA 2MHRA 5AC5A 1FTSA 2KYHA 2R02A 2Q9AA 4EHPA 2IXNA 1FFTC 4MS2A 2AVKA 1ZHYA 3ATPA 3C63A 4BJ5C 1T5OA 4ULVA 1Q0MA 3S0XA 5B3IA 2DGJA 4G0HA 1GS9A 2OKUA 1A7VA 3I5QA 1QQ3A 1YZAA 4NCQA 2UUHA 1RXQA 3SNHA 2ETSA 3U8VA 1HW2A 3SXYA 3GWNA 3AGUA 3U9JA 2XLHA 1EI7A 2XLOA 4IAOA 1NU9C 5E3AA 3UNGC 4P9FA 2QUPA 1LVKA 2ZXRA 5L3VA 3RW0A 4AL0A 3FVYA 2WL8A 1AUEA 4MTFA 4U5GA 3HNLA 1PCXA 1OXKA 1FR0A 1IZMA 3GORA 3UR3C 2FGYA 4PJLA 2Q7RA 2OU6A 3RF3A 3I4UA 2D4UA 1BR1A 3DD7A 4JRZA 3R7CA 2VH3A 5L3QA 1B68A 4A2NB 4AL1A 2QE9A 5IY5C 2XL8A 2NPUA 4HEAJ 2R7VA 4L6RA 3FOOA 4G78A 2NUPB 3JRTA 3L8JA 1D1CA 4N06A 2L6GA 1U6HA 3AG2C 3ASOC 3RIPA 4DOZA 3CSKA 2J8WA 1EA8A 4FX5A 2Z15A 4MW3A 2R7WA 3U5SA 1VTMP 2X51A 2Q9BA 4BJ5A 3S9OA 1NSGB 2CGEA 3DE8A 2OOCA 4J7TA 4KC9A 1TWGA 2J9BA 2L7AA 3S90A 4YT5A 4MTOA 3OWTA 4KBLA 4CIPA 1ST6A 3PCVA 3RKOF 2Y3GA 3ITFA 1G8XA 1OXBA 3CZ6A 4IB4A 2PF4E 2YRFA 4Z9HA 4AE4A 4DRIB 3GM3A 1T9KA 3HNIA 2E87A 3HKKA 2HKVA 1KNYA 1NFNA 1LKXA 3V5ZA 1MNDA 4CX9A 1D1AA 3DJNB 3FHDA 1OW7A 2QLAA 1BDJB 4E0IA 1CGNA 2BL2A 5KYXB 5DQTA 4PFPA 2KC3A 2HZ8A 3RFYA 3TQOA 2X0CA 4KNWA 1WWPA 5K0IA 3EG9A 3SYNA 3PDMP 1ZHXA 3MX3A 4EIYA 2NUPA 3PHF2 2PX0A 3B29A 5T1DB 5COMA 2ZXWC 3WAQA 5DS5A 1NFOA 2YWAA 1MMDA 4U9DA 4Z9IA 3V7OA 5A6BA 4CSAA 4RD9A 2XRHA 4U5FE 5KYYA 3B0UX 3NYLA 2A68F 3QMKA 3L0IA 4DJ9A 4PK4A 4DRHB 2JD3A 4DRJB 1OCZC 4KI2A 2P6VA 1JPJA 1IW7F 1I4YA 2O9XA 3VM6A 1YA9A 3QVYA 4IRUA 4ER9A 1ZVZA 4CS9A 5A6JA 2ICWG 2XLDA 3MYIA 2IXOA 1QVXA
chains in the Genus database with same CATH topology
2IYLD 3AG3C 3K1HA 2Q9CA 1VMAA 2H7VC 3W2VA 3JYHA 3Q7LA 1O5HA 1ZU4A 3RH3A 1RJ9A 2NUTA 5E2QA 2ZPAA 2MYSA 4O6YA 2R7VA 3AG1C 2V3CC 1TR2A 3EGDB 2LSEA 1O87A 5FCLA 4I1OB 1ZHWA 3T4RA 4CSAC 5E33A 3ABLC 2PX3A 1TWHA 2G3VA 3F46A 5DQZA 4QDLA 1MMAA 2W4MA 3EFOB 3JSZA 5CI8A 3EZHA 2Q3TA 3ZIBA 3LNRA 2XL4A 1ZYRF 1NU7D 3EQLF 4JW1A 1QZXA 1PD1A 3NDBB 3M1CB 4AX2A 4QI2A 4HE8D 3ZG1A 4G7HF 2A6HF 2R7RA 2R7XA 3MLGA 1Z63A 3GANA 2ZXOA 1MMGA 2XSEA 3FAJA 3K6BA 2C03A 3NKEA 1LS1A 2GFHA 2W9YA 2Y39A 3K66A 4I3MA 1BR2A 4ANJA 5T3WA 5EGYA 2IXMA 2ZXPA 4O7GA 3HJCA 3UGOA 2CDQA 3Q7GA 4BJ6C 2WVQA 1D0YA 1VK5A 3HLZA 4XLNF 4JCHA 4GEHA 2I8BA 4LACB 3FDQA 2Y3BA 3LEVA 1NZEA 3B9QA 4U5CE 2IXPA 3LS1A 2KGOA 3PMRA 3DM9B 2PFDA 2G3KA 2FFHA 1M56C 2DYRC 2KW3C 4P6IC 4RDAA 3I5PA 1S7ZA 4Q7CA 4U5BE 2M4EA 3NG1A 4O6MA 2YHSA 4HFKB 1JPNA 3X1OA 5D92A 4E7ZA 1QLEC 4C3DA 3ASNC 3B0PA 2J0XA 3W8IA 4OD5A 4YJWA 2WZFA 1J8YF 3DAFA 1FMVA 2KJGA 1PD0A 1J8MF 3H65A 4OIOF 1TWAA 2A69F 2KNHA 3KKBA 2PP4A 2J0WA 1NG1A 2G62A 2W45A 4PJMA 4F4BA 3JT1A 2YEVA 1OKKA 2Y3HA 2WZGA 3ABMC 1MNEA 1BR4A 2H7BA 1VOMA 3X2QC 5KYXA 4OIPF 1D0ZA 3AG4C 4U5DE 3O6XA 2W4BA 5EHHA 4GYTA 1D0XA 4BEJA 4HFFB 4QI0A 3S28A 2R7OA 3CQZA 2B0JA 5F5HA 3ZC4A 3VYWA 1N1CA 3TD7A 3UMIA 1M57C 1TWCA 5B1BC 4LERA 2CNWA 4JZAA 2KQ9A 3B0VC 4OINF 4AK9A 3DM5A 4CS8A 3ECSA 1TKNA 4O79A 4X0RA 2YZSA 3UGPA 2VB6A 1ZU5A 4CIHA 3K1IC 1V54C 3EZIA 4M63A 1VYKA 1WGWA 4CS9C 4ZLCA 3SEOA 4G7OF 3LESA 3SP1A 3OEOA 3DMDA 4C3EA 4Q4ZF 2C04A 2EIJC 1KU2A 5D91A 4H4KC 3EFOA 3LLIA 3ZSUA 4BJTA 4EBBA 1SMYF 3SZRA 4AE4B 4MNDA 4OD4A 2H7OA 2EIKC 2MWQA 4DVZA 3E9VA 2VASA 4DBRA 2XXAB 1VYIA 4BJ6A 2QTVA 3EHNA 1Z6AA 3LJBA 2XXAA 5BUOA 3NYJA 1RJ9B 2NUTB 1FMWA 5KYNA 4U5EE 3EG9B 3N24A 3N2ZB 3VAYA 3EGDA 2P7VA 2R7UA 4CBEA 5KYWA 3EH2A 4PJJA 1Z23A 4I1MA 5F5FA 5CI9A 5KYYB 1V55C 5KYWB 2EIMC 4JVSA 2EILC 2V26A 3W2WA 2IOQA 2BE5F 3L34A 3S29A 2WB7A 3AQCA 4BG0A 2DYSC 4YN0B 4K0DA 4MQ9F 4JJGA 5DS6A 4XWJA 4YT2A 3UMKA 2A6EF 5HSWA 1OCOC 3W8HA 3EH1A 3KMIA 4RBNA 2OCCC 3K33A 1SF8A 5DVWA 4CS8C 5E3CA 3AQBA 2J45A 1SZIA 4JURI 3DJUB 3LS0A 2CW0F 2Y69C 3WODF 4ULWA 2CNWD 2NG1A 4YT4A 5DS4A 1D1BA 4LLEA 3LAYA 4E7SA 4JJFA 2OG2A 4IJJA 4C7OB 4K7BA 4KNVA 4W8KA 3E70C 3ZVRA 1ZHTA 4U5HA 4YWQA 3NKDA 4WJ0A 1OCCC 1Z3IX 2R7SA 1ZHZA 4I44A 1MMNA 3EGXB 5B3SC 5T3TA 2J46A 4DBQA 3EPVA 3Q6MA 1OKKD 4NY3A 4G7ZF 2J9WA 4DVYP 2R7TA 1FFHA 3UMHA 1M2VB 4EWCA 4OIQF 3N0TA 4O6NA 2J7PD 5B1AC 3GODA 4J32B 1Z5ZA 4FWVA 5KYUA 2R7QA 2J9VA 2L9JA 3NRHA 5KYUB 4Q5SF 3HTKC 4C3BA 3DAGA 4ZLDA 3WG7C 2WVOA 1M2OA 4J30B 1OCRC 4LLCA 3QZCA 1W2WA 2A1DD 2J7PA 3EGXA 4CS7A 2HV7A 2HV6A 4PJNA 3IEEA 4FESA 3O39A 3K7DA 2J9UA 2L81A 3F47A 2WZLA 3POVA 4OIRF 3RYLA 2WVNA 3KL4A 4PFOA 3JCUQ 3OA1A 3Q6NA 4IWBA 3EHMA 1M2VA 3ABKC 3KH2A 4B6IA 3T6BA 3EJNA 4YT8A 2Y3DA 3LLKA 2QY9A 2D5RB 3DXJF 3S27A 4XTKA 3DZAA 3NYMA 4XLPF 3T6JA 4BJ1A 2EINC 5DLJA 1FTSA 2Q9AA 2IXNA 1FFTC 1ZHYA 4BJ5C 3S0XA 2DGJA 4G0HA 3I5QA 3SNHA 4IAOA 1NU9C 5E3AA 3UNGC 2ZXRA 1LVKA 5L3VA 3FVYA 2WL8A 4U5GA 1PCXA 1IZMA 3UR3C 2FGYA 4PJLA 3I4UA 1BR1A 3DD7A 2VH3A 5L3QA 4A2NB 5IY5C 4HEAJ 2NUPB 3JRTA 4N06A 1D1CA 3RIPA 3AG2C 3ASOC 4DOZA 3CSKA 4FX5A 2Z15A 2R7WA 2X51A 2Q9BA 4BJ5A 2CGEA 4KC9A 1TWGA 4YT5A 3OWTA 4KBLA 1ST6A 3RKOF 2Y3GA 3ITFA 1G8XA 4AE4A 3CZ6A 2PF4E 2E87A 1LKXA 1MNDA 1D1AA 3DJNB 3FHDA 5KYXB 5DQTA 4PFPA 3RFYA 4KNWA 3EG9A 3SYNA 1ZHXA 3MX3A 2NUPA 3PHF2 2PX0A 5T1DB 5DS5A 2ZXWC 4C7OA 4CSAA 1MMDA 3V7OA 4RD9A 2XRHA 4U5FE 5KYYA 3B0UX 3NYLA 3QMKA 2A68F 3L0IA 4PK4A 2JD3A 1OCZC 4KI2A 2P6VA 1JPJA 1IW7F 2O9XA 4IRUA 4CS9A 2IXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KNH A;  2H7B A;  2PP4 A;  2P6V A; 
#chains in the Genus database with same CATH topology
 1LPE A;  2IYL D;  3M4C A;  3AG3 C;  3K1H A;  2M64 A;  2Q9C A;  3FOP A;  2DB4 A;  1VMA A;  2H7V C;  3IQT A;  3IQ6 A;  4JEA A;  3T9O A;  3W2V A;  3JYH A;  5FZT A;  3U2L A;  2I15 A;  3Q7L A;  1O5H A;  3WHN A;  1ZU4 A;  3RH3 A;  1RJ9 A;  2NUT A;  5E2Q A;  2YKZ A;  2YL0 A;  3SXZ A;  2ZPA A;  4MVM A;  2MYS A;  4O6Y A;  2BC5 A;  1R4T A;  3AG1 C;  3MBG A;  1TR2 A;  3EGD B;  2LSE A;  3G50 A;  3IQC A;  2VCB A;  4YL0 A;  3RVZ A;  3U3B A;  1O87 A;  5FCL A;  4I1O B;  2Q4F A;  2PNO A;  1H9G A;  1WOL A;  1ZHW A;  3T4R A;  2RSE B;  4WGY A;  4CSA C;  1Q0K A;  3H2U A;  5E33 A;  3ABL C;  1LM3 B;  2PX3 A;  1HY5 A;  1TWH A;  2G3V A;  4ONS A;  4UDV A;  3F46 A;  5DQZ A;  2OEX A;  3AOU A;  1TFO B;  4QDL A;  4JCZ A;  3BEH A;  2EPN A;  2JX0 A;  3DWW A;  1MMA A;  1O3U A;  2F22 A;  2W4M A;  3EFO B;  3JSZ A;  2HJM A;  5CI8 A;  3EZH A;  2XS1 A;  2Q3T A;  1E85 A;  1GQA A;  1NBB A;  1A7E A;  3ZIB A;  3LNR A;  3U0C A;  2XL4 A;  2GDC A;  2R03 A;  5L0G A;  1ZYR F;  1OR3 A;  3NMK A;  2RD9 A;  1NU7 D;  4MVR A;  2LFD A;  2NSF A;  3EQL F;  2EPL X;  4JW1 A;  4NQF A;  1QZX A;  1Q0D A;  1PD1 A;  3NDB B;  1U89 A;  3M1C B;  4GQH A;  5F28 E;  1RKE A;  4AX2 A;  4DXW A;  1Y6D A;  2IM8 A;  3SXM A;  1L3P A;  2L6F A;  2YL3 A;  4QI2 A;  2HMQ A;  2YLD A;  4HE8 D;  1OQC A;  1K05 A;  3ZG1 A;  4G7H F;  2A6H F;  2R7R A;  2R7X A;  3MLG A;  3TJ6 A;  2LCH A;  4D4X A;  1Z63 A;  2XLM A;  5EK0 A;  3GAN A;  2ZXO A;  2XM4 A;  2OJE D;  2LP4 A;  1MMG A;  1SR2 A;  1TQG A;  2PBE A;  1YLM A;  2XSE A;  1APC A;  3FAJ A;  3K6B A;  2C03 A;  2NSG A;  3NKE A;  1LS1 A;  3QTH A;  2GFH A;  2W9Y A;  2Y39 A;  3K66 A;  4I3M A;  1C03 A;  1BR2 A;  2LK4 A;  4LDR A;  4ANJ A;  5T3W A;  5EGY A;  2P61 A;  2IXM A;  2ZXP A;  3W4Y A;  1E86 A;  3MYF A;  4O7G A;  1E83 A;  1RMV A;  3HJC A;  3UGO A;  2CDQ A;  1JRA A;  4MVZ A;  3Q7G A;  3TOM A;  1YDI A;  1M6T A;  2YL1 A;  4BEM J;  1G4U S;  2WVQ A;  4BJ6 C;  4E0H A;  1D0Y A;  4J7Y A;  1VK5 A;  3HLZ A;  5JP7 A;  1ORY A;  3GEH A;  4XLN F;  2A0B A;  4JCH A;  2HJ3 A;  2FAP B;  4GEH A;  2I8B A;  4XPY A;  5AGF A;  4LAC B;  3FDQ A;  4N4W A;  2Y3B A;  3LEV A;  1NZE A;  3B9Q A;  4U5C E;  2IXP A;  1V74 B;  3LS1 A;  1K40 A;  2KGO A;  1AVO B;  4WGZ A;  2KK1 A;  3HNK A;  4K1O A;  3PMR A;  1JR8 A;  3DM9 B;  2PFD A;  3IPM O;  3L8I A;  2G3K A;  2FFH A;  1M56 C;  1LI7 A;  2DYR C;  2KW3 C;  2XM0 A;  4P6I C;  2H8A A;  4RDA A;  4C7O A;  3I5P A;  4U9E A;  1S7Z A;  1VB5 A;  4Q7C A;  4U5B E;  2M4E A;  2KSF A;  2LQG A;  2OQM A;  3NG1 A;  3C62 A;  4O6M A;  2YHS A;  1JPN A;  4HFK B;  3FMS A;  2HFI A;  3X1O A;  2OEV A;  5D92 A;  4E7Z A;  1QLE C;  4C3D A;  3A9C A;  3ASN C;  3JRM O;  1LI5 A;  3B0P A;  2J0X A;  4XEK A;  4CJG A;  3W8I A;  4OD5 A;  2ASR A;  4YJW A;  2WZF A;  1H7I A;  1J8Y F;  1CPR A;  3DAF A;  3V5Y A;  5L0D A;  1FMV A;  5L0C A;  1TFK B;  2KJG A;  1PD0 A;  1J8M F;  2HMZ A;  3H65 A;  4OIO F;  1TWA A;  2A69 F;  3NMI A;  1OW6 A;  3BRJ A;  2KNH A;  3KKB A;  2PP4 A;  2EPO A;  2J0W A;  1NG1 A;  2G62 A;  2W45 A;  4PJM A;  3US6 A;  4NTA A;  2ZD9 A;  4F4B A;  3C8Z A;  3GM1 A;  3JT1 A;  1JOG A;  3AGT A;  2YEV A;  4MTG A;  1QSP A;  1OKK A;  2Y3H A;  1YVI A;  2WZG A;  1T6Q A;  3ABM C;  1MNE A;  4JKV A;  1BR4 A;  3R2P A;  2LD6 A;  3RQF A;  2H7B A;  1L7C A;  1VLT A;  1ZZP A;  4FAP B;  1VOM A;  3X2Q C;  2AWY A;  5KYX A;  4OIP F;  1D0Z A;  3AG4 C;  3ZWI A;  4U5D E;  1K04 A;  1C02 A;  1YJG A;  3O6X A;  2VC9 A;  2W4B A;  1MQV A;  1YYX A;  5EHH A;  2VCC A;  4GYT A;  4IAQ A;  3V5X A;  1D0X A;  3QW1 A;  4BEJ A;  4HFF B;  4H54 A;  3ZQV A;  2OJQ A;  4QI0 A;  4EUK B;  1WAT A;  4CDY A;  3S28 A;  3TUL A;  2R7O A;  3CQZ A;  2B0J A;  4PR9 A;  1LE4 A;  5F5H A;  1YYJ A;  3VYW A;  3ZC4 A;  2HSQ A;  3DKA A;  1I5N A;  1JMW A;  4P9T A;  4LDK A;  5A6A A;  2HUJ A;  1N1C A;  1NLX A;  3TD7 A;  3NMJ A;  3UMI A;  4NTF A;  5L0I A;  1M57 C;  1TWC A;  5B1B C;  1V4A A;  4LER A;  4WAB A;  1T6U A;  2CNW A;  4JZA A;  5L0H A;  2KQ9 A;  3CEX A;  3B0V C;  2HS5 A;  4EKW A;  3KPH A;  4OIN F;  5BQI A;  5A69 A;  4AK9 A;  1ZW3 A;  3DM5 A;  3TJ5 A;  1GGQ A;  4CS8 A;  3ECS A;  1S05 A;  5JS5 A;  1TKN A;  1YZC A;  4O79 A;  4X0R A;  2YZS A;  3UGP A;  5GPG B;  1BZ4 A;  2VB6 A;  1ZU5 A;  4CIH A;  2UUI A;  3A11 A;  3M4B A;  3K1I C;  1V54 C;  3EZI A;  4M63 A;  1A41 A;  1VYK A;  4IGG A;  5COG A;  1WGW A;  3VF0 A;  3B71 A;  1LE2 A;  3M79 A;  3SEO A;  4CS9 C;  4ZLC A;  4G7O F;  3LES A;  4N6C A;  3CAX A;  3SP1 A;  1XZQ A;  3OEO A;  3LEO A;  3FXH A;  3KYJ A;  3O10 A;  3DMD A;  1VLS A;  3ZTM A;  4C3E A;  4Q4Z F;  4D4N A;  4CJO A;  2HSB A;  2C04 A;  2EIJ C;  3JSE O;  1XZP A;  2Q00 A;  2V3C C;  1KU2 A;  4MW8 A;  5D91 A;  5L0F A;  4H4K C;  2YVK A;  3EFO A;  3HNJ A;  3LLI A;  3ZSU A;  3FAP B;  1DOW A;  4BJT A;  1SMY F;  3SXK A;  3SZR A;  2JPU A;  4AE4 B;  3DI5 A;  2EPM X;  4MND A;  3U2M A;  2YQY A;  4N6H A;  4OD4 A;  4EBK A;  2H7O A;  2EPK X;  2EIK C;  2R05 A;  1A0B A;  3U3F A;  1Q0G A;  2MWQ A;  4DVZ A;  3E9V A;  2L6H A;  2VAS A;  1AEP A;  4MVQ A;  4DBR A;  2XXA B;  1VYI A;  4BJ6 A;  1JAF A;  5A6B D;  2QTV A;  3EHN A;  1Z6A A;  5JT4 A;  3LJB A;  2XXA A;  5BUO A;  4A4A A;  3NYJ A;  3ZQY A;  1RJ9 B;  2NUT B;  3JYY A;  3K1I A;  1QPU A;  3H2V A;  1FMW A;  5KYN A;  1H9T A;  4U5E E;  3EG9 B;  3N24 A;  1RKC A;  5HV9 A;  3N2Z B;  4JTC B;  2XLV A;  3L1M A;  4IAR A;  4MVS A;  3EGD A;  4YL1 A;  3VAY A;  2P7V A;  3J06 A;  3DE9 A;  1UG7 A;  2R7U A;  3GEI A;  3MFN A;  4CBE A;  5KYW A;  3EH2 A;  4PJJ A;  1Z23 A;  4I1M A;  5JRA A;  1DOV A;  5CI9 A;  5CIV A;  5F5F A;  1E84 A;  4XQ1 A;  5KYY B;  1V55 C;  4E18 A;  2EIM C;  5KYW B;  3GEE A;  4JVS A;  4CDA A;  2EIL C;  2V26 A;  3W2W A;  2IOQ A;  2BE5 F;  3L34 A;  1XWJ A;  2WB7 A;  3AQC A;  3S29 A;  4BG0 A;  2DYS C;  4YN0 B;  2CYD A;  4K0D A;  4MQ9 F;  4E17 A;  4JJG A;  5DS6 A;  2LFF A;  2P0N A;  4XWJ A;  2CCY A;  5BQG A;  3UMK A;  1H6G A;  2A6E F;  4YT2 A;  5HSW A;  5L0J A;  1OCO C;  256B A;  3W8H A;  3EH1 A;  4NC3 A;  4XEV A;  4CDV A;  4Z9J A;  1ORJ A;  4MVO A;  1HW1 A;  3KMI A;  4NTB A;  1ZW2 A;  1T6I A;  2OCC C;  3K33 A;  4RBN A;  1SF8 A;  5DVW A;  3U8P A;  4JIO A;  5E3C A;  3RQE A;  4CS8 C;  3AQB A;  2J45 A;  1SZI A;  4JUR I;  1LS4 A;  1ORS C;  3DJU B;  3LS0 A;  1G5Z A;  3C8G D;  2AP3 A;  2CW0 F;  2Y69 C;  3G4X A;  2YL7 A;  4ULW A;  2CNW D;  2NG1 A;  3WOD F;  4YT4 A;  5DS4 A;  3ZDL A;  4EBB A;  1D1B A;  4LLE A;  3LAY A;  4JEB A;  4E7S A;  4JJF A;  3QVZ A;  4EBJ A;  2OG2 A;  3IHU A;  4IJJ A;  4XPX A;  4XPW A;  3VRC A;  1QKR A;  5JLI A;  4C7O B;  4K7B A;  2GAQ A;  3JTL O;  4KNV A;  4W8K A;  1CGO A;  3O55 A;  3TK0 A;  3U9M A;  5JUA A;  4JC7 A;  3E70 C;  5TJ5 E;  3ZVR A;  1ZHT A;  4U5H A;  2B0H A;  2GWW A;  1OW8 A;  2XLW A;  4YWQ A;  3NKD A;  1CGM E;  3GM2 A;  4WJ0 A;  1OCC C;  1Z3I X;  5JSL A;  1ZHZ A;  2R7S A;  1KTM A;  4I44 A;  1MMN A;  2GA0 A;  4XEF A;  3EGX B;  5B3S C;  4YK5 A;  5T3T A;  1YAR O;  1F1M A;  2VCA A;  3KYI A;  3RQG A;  1FAP B;  5AC4 A;  2XLE A;  2J46 A;  4DBQ A;  3EPV A;  3Q6M A;  4PAC A;  1BBH A;  1OKK D;  1YAU O;  2A0U A;  4NY3 A;  4G7Z F;  1LIH A;  2J9W A;  4DVY P;  2R7T A;  1EQ1 A;  1U0B B;  1EKY A;  1FFH A;  3JZ0 A;  3UMH A;  3C18 A;  1M2V B;  2R25 A;  4EWC A;  4JTD B;  1FNT c;  4OIQ F;  1CPQ A;  1Q0F A;  3N0T A;  4O6N A;  2TMV P;  2J7P D;  3M15 A;  3C8G A;  5B1A C;  1Z7Q c;  1PV3 A;  3GOD A;  2QNL A;  1G4W R;  1WTY A;  1GM5 A;  3RVY A;  4J32 B;  4R32 A;  1Z5Z A;  4FWV A;  5KYU A;  2R7Q A;  5A6K A;  2AWC A;  5JVE A;  2J9V A;  2L9J A;  2R9R B;  2P1A A;  1A7D A;  1SYQ A;  2XL6 A;  1WAS A;  3HTK C;  3NRH A;  4C3B A;  3ZTZ A;  5KYU B;  3DAG A;  4Q5S F;  4YL3 A;  1R5I D;  2WVO A;  1M2O A;  4J30 B;  3WG7 C;  4ZLD A;  1OCR C;  4LLC A;  3QZC A;  1W2W A;  1OR2 A;  2A1D D;  4MVU A;  1T01 A;  2J7P A;  3EGX A;  2YLG A;  1C17 M;  4CS7 A;  1HE9 A;  3T6G B;  2HV7 A;  2HV6 A;  4PJN A;  3IEE A;  3O39 A;  4FES A;  2IBF A;  4W8P A;  3K7D A;  2J9U A;  5BQH A;  1HMO A;  4JE9 A;  2L81 A;  1YA7 O;  3F47 A;  2WZL A;  3G4Z A;  3POV A;  4OIR F;  3AJM A;  2WVN A;  3RYL A;  4BPM A;  1HE1 A;  2DI3 A;  1HMD A;  1RKE B;  3KL4 A;  3GWL A;  3JCU Q;  1I4Z A;  3OA1 A;  1RCP A;  4PFO A;  5COF A;  3S84 A;  3Q6N A;  4IWB A;  1UFB A;  2AU5 A;  3EHM A;  4JTA B;  1M2V A;  3ABK C;  3KH2 A;  3QW0 A;  4B6I A;  3C7J A;  3LNM B;  4LDQ A;  2YLI A;  3T6B A;  1WN0 A;  3C8G B;  3EJN A;  1Y4C A;  3LUT B;  4YT8 A;  2Y3D A;  3LLK A;  1E2X A;  2QY9 A;  2D5R B;  2LIG A;  3DXJ F;  3S27 A;  2XS8 A;  3DZA A;  3IQ5 A;  3NYM A;  4XTK A;  3T6J A;  4BJ1 A;  4XLP F;  3TOL A;  2EIN C;  5DLJ A;  2MHR A;  5AC5 A;  1FTS A;  2KYH A;  2R02 A;  2Q9A A;  4EHP A;  2IXN A;  1FFT C;  4MS2 A;  2AVK A;  1ZHY A;  3ATP A;  3C63 A;  4BJ5 C;  1T5O A;  4ULV A;  1Q0M A;  3S0X A;  5B3I A;  2DGJ A;  4G0H A;  1GS9 A;  2OKU A;  1A7V A;  3I5Q A;  1QQ3 A;  1YZA A;  4NCQ A;  2UUH A;  1RXQ A;  3SNH A;  2ETS A;  3U8V A;  1HW2 A;  3SXY A;  3GWN A;  3AGU A;  3U9J A;  2XLH A;  1EI7 A;  2XLO A;  4IAO A;  1NU9 C;  5E3A A;  3UNG C;  4P9F A;  2QUP A;  1LVK A;  2ZXR A;  5L3V A;  3RW0 A;  4AL0 A;  3FVY A;  2WL8 A;  1AUE A;  4MTF A;  4U5G A;  3HNL A;  1PCX A;  1OXK A;  1FR0 A;  1IZM A;  3GOR A;  3UR3 C;  2FGY A;  4PJL A;  2Q7R A;  2OU6 A;  3RF3 A;  3I4U A;  2D4U A;  1BR1 A;  3DD7 A;  4JRZ A;  3R7C A;  2VH3 A;  5L3Q A;  1B68 A;  4A2N B;  4AL1 A;  2QE9 A;  5IY5 C;  2XL8 A;  2NPU A;  4HEA J;  2R7V A;  4L6R A;  3FOO A;  4G78 A;  2NUP B;  3JRT A;  3L8J A;  1D1C A;  4N06 A;  2L6G A;  1U6H A;  3AG2 C;  3ASO C;  3RIP A;  4DOZ A;  3CSK A;  2J8W A;  1EA8 A;  4FX5 A;  2Z15 A;  4MW3 A;  2R7W A;  3U5S A;  1VTM P;  2X51 A;  2Q9B A;  4BJ5 A;  3S9O A;  1NSG B;  2CGE A;  3DE8 A;  2OOC A;  4J7T A;  4KC9 A;  1TWG A;  2J9B A;  2L7A A;  3S90 A;  4YT5 A;  4MTO A;  3OWT A;  4KBL A;  4CIP A;  1ST6 A;  3PCV A;  3RKO F;  2Y3G A;  3ITF A;  1G8X A;  1OXB A;  3CZ6 A;  4IB4 A;  2PF4 E;  2YRF A;  4Z9H A;  4AE4 A;  4DRI B;  3GM3 A;  1T9K A;  3HNI A;  2E87 A;  3HKK A;  2HKV A;  1KNY A;  1NFN A;  1LKX A;  3V5Z A;  1MND A;  4CX9 A;  1D1A A;  3DJN B;  3FHD A;  1OW7 A;  2QLA A;  1BDJ B;  4E0I A;  1CGN A;  2BL2 A;  5KYX B;  5DQT A;  4PFP A;  2KC3 A;  2HZ8 A;  3RFY A;  3TQO A;  2X0C A;  4KNW A;  1WWP A;  5K0I A;  3EG9 A;  3SYN A;  3PDM P;  1ZHX A;  3MX3 A;  4EIY A;  2NUP A;  3PHF 2;  2PX0 A;  3B29 A;  5T1D B;  5COM A;  2ZXW C;  3WAQ A;  5DS5 A;  1NFO A;  2YWA A;  1MMD A;  4U9D A;  4Z9I A;  3V7O A;  5A6B A;  4CSA A;  4RD9 A;  2XRH A;  4U5F E;  5KYY A;  3B0U X;  3NYL A;  2A68 F;  3QMK A;  3L0I A;  4DJ9 A;  4PK4 A;  4DRH B;  2JD3 A;  4DRJ B;  1OCZ C;  4KI2 A;  2P6V A;  1JPJ A;  1IW7 F;  1I4Y A;  2O9X A;  3VM6 A;  1YA9 A;  3QVY A;  4IRU A;  4ER9 A;  1ZVZ A;  4CS9 A;  5A6J A;  2ICW G;  2XLD A;  3MYI A;  2IXO A;  1QVX A; 
#chains in the Genus database with same CATH homology
 2IYL D;  3AG3 C;  3K1H A;  2Q9C A;  1VMA A;  2H7V C;  3W2V A;  3JYH A;  3Q7L A;  1O5H A;  1ZU4 A;  3RH3 A;  1RJ9 A;  2NUT A;  5E2Q A;  2ZPA A;  2MYS A;  4O6Y A;  2R7V A;  3AG1 C;  2V3C C;  1TR2 A;  3EGD B;  2LSE A;  1O87 A;  5FCL A;  4I1O B;  1ZHW A;  3T4R A;  4CSA C;  5E33 A;  3ABL C;  2PX3 A;  1TWH A;  2G3V A;  3F46 A;  5DQZ A;  4QDL A;  1MMA A;  2W4M A;  3EFO B;  3JSZ A;  5CI8 A;  3EZH A;  2Q3T A;  3ZIB A;  3LNR A;  2XL4 A;  1ZYR F;  1NU7 D;  3EQL F;  4JW1 A;  1QZX A;  1PD1 A;  3NDB B;  3M1C B;  4AX2 A;  4QI2 A;  4HE8 D;  3ZG1 A;  4G7H F;  2A6H F;  2R7R A;  2R7X A;  3MLG A;  1Z63 A;  3GAN A;  2ZXO A;  1MMG A;  2XSE A;  3FAJ A;  3K6B A;  2C03 A;  3NKE A;  1LS1 A;  2GFH A;  2W9Y A;  2Y39 A;  3K66 A;  4I3M A;  1BR2 A;  4ANJ A;  5T3W A;  5EGY A;  2IXM A;  2ZXP A;  4O7G A;  3HJC A;  3UGO A;  2CDQ A;  3Q7G A;  4BJ6 C;  2WVQ A;  1D0Y A;  1VK5 A;  3HLZ A;  4XLN F;  4JCH A;  4GEH A;  2I8B A;  4LAC B;  3FDQ A;  2Y3B A;  3LEV A;  1NZE A;  3B9Q A;  4U5C E;  2IXP A;  3LS1 A;  2KGO A;  3PMR A;  3DM9 B;  2PFD A;  2G3K A;  2FFH A;  1M56 C;  2DYR C;  2KW3 C;  4P6I C;  4RDA A;  3I5P A;  1S7Z A;  4Q7C A;  4U5B E;  2M4E A;  3NG1 A;  4O6M A;  2YHS A;  4HFK B;  1JPN A;  3X1O A;  5D92 A;  4E7Z A;  1QLE C;  4C3D A;  3ASN C;  3B0P A;  2J0X A;  3W8I A;  4OD5 A;  4YJW A;  2WZF A;  1J8Y F;  3DAF A;  1FMV A;  2KJG A;  1PD0 A;  1J8M F;  3H65 A;  4OIO F;  1TWA A;  2A69 F;  2KNH A;  3KKB A;  2PP4 A;  2J0W A;  1NG1 A;  2G62 A;  2W45 A;  4PJM A;  4F4B A;  3JT1 A;  2YEV A;  1OKK A;  2Y3H A;  2WZG A;  3ABM C;  1MNE A;  1BR4 A;  2H7B A;  1VOM A;  3X2Q C;  5KYX A;  4OIP F;  1D0Z A;  3AG4 C;  4U5D E;  3O6X A;  2W4B A;  5EHH A;  4GYT A;  1D0X A;  4BEJ A;  4HFF B;  4QI0 A;  3S28 A;  2R7O A;  3CQZ A;  2B0J A;  5F5H A;  3ZC4 A;  3VYW A;  1N1C A;  3TD7 A;  3UMI A;  1M57 C;  1TWC A;  5B1B C;  4LER A;  2CNW A;  4JZA A;  2KQ9 A;  3B0V C;  4OIN F;  4AK9 A;  3DM5 A;  4CS8 A;  3ECS A;  1TKN A;  4O79 A;  4X0R A;  2YZS A;  3UGP A;  2VB6 A;  1ZU5 A;  4CIH A;  3K1I C;  1V54 C;  3EZI A;  4M63 A;  1VYK A;  1WGW A;  4CS9 C;  4ZLC A;  3SEO A;  4G7O F;  3LES A;  3SP1 A;  3OEO A;  3DMD A;  4C3E A;  4Q4Z F;  2C04 A;  2EIJ C;  1KU2 A;  5D91 A;  4H4K C;  3EFO A;  3LLI A;  3ZSU A;  4BJT A;  4EBB A;  1SMY F;  3SZR A;  4AE4 B;  4MND A;  4OD4 A;  2H7O A;  2EIK C;  2MWQ A;  4DVZ A;  3E9V A;  2VAS A;  4DBR A;  2XXA B;  1VYI A;  4BJ6 A;  2QTV A;  3EHN A;  1Z6A A;  3LJB A;  2XXA A;  5BUO A;  3NYJ A;  1RJ9 B;  2NUT B;  1FMW A;  5KYN A;  4U5E E;  3EG9 B;  3N24 A;  3N2Z B;  3VAY A;  3EGD A;  2P7V A;  2R7U A;  4CBE A;  5KYW A;  3EH2 A;  4PJJ A;  1Z23 A;  4I1M A;  5F5F A;  5CI9 A;  5KYY B;  1V55 C;  5KYW B;  2EIM C;  4JVS A;  2EIL C;  2V26 A;  3W2W A;  2IOQ A;  2BE5 F;  3L34 A;  3S29 A;  2WB7 A;  3AQC A;  4BG0 A;  2DYS C;  4YN0 B;  4K0D A;  4MQ9 F;  4JJG A;  5DS6 A;  4XWJ A;  4YT2 A;  3UMK A;  2A6E F;  5HSW A;  1OCO C;  3W8H A;  3EH1 A;  3KMI A;  4RBN A;  2OCC C;  3K33 A;  1SF8 A;  5DVW A;  4CS8 C;  5E3C A;  3AQB A;  2J45 A;  1SZI A;  4JUR I;  3DJU B;  3LS0 A;  2CW0 F;  2Y69 C;  3WOD F;  4ULW A;  2CNW D;  2NG1 A;  4YT4 A;  5DS4 A;  1D1B A;  4LLE A;  3LAY A;  4E7S A;  4JJF A;  2OG2 A;  4IJJ A;  4C7O B;  4K7B A;  4KNV A;  4W8K A;  3E70 C;  3ZVR A;  1ZHT A;  4U5H A;  4YWQ A;  3NKD A;  4WJ0 A;  1OCC C;  1Z3I X;  2R7S A;  1ZHZ A;  4I44 A;  1MMN A;  3EGX B;  5B3S C;  5T3T A;  2J46 A;  4DBQ A;  3EPV A;  3Q6M A;  1OKK D;  4NY3 A;  4G7Z F;  2J9W A;  4DVY P;  2R7T A;  1FFH A;  3UMH A;  1M2V B;  4EWC A;  4OIQ F;  3N0T A;  4O6N A;  2J7P D;  5B1A C;  3GOD A;  4J32 B;  1Z5Z A;  4FWV A;  5KYU A;  2R7Q A;  2J9V A;  2L9J A;  3NRH A;  5KYU B;  4Q5S F;  3HTK C;  4C3B A;  3DAG A;  4ZLD A;  3WG7 C;  2WVO A;  1M2O A;  4J30 B;  1OCR C;  4LLC A;  3QZC A;  1W2W A;  2A1D D;  2J7P A;  3EGX A;  4CS7 A;  2HV7 A;  2HV6 A;  4PJN A;  3IEE A;  4FES A;  3O39 A;  3K7D A;  2J9U A;  2L81 A;  3F47 A;  2WZL A;  3POV A;  4OIR F;  3RYL A;  2WVN A;  3KL4 A;  4PFO A;  3JCU Q;  3OA1 A;  3Q6N A;  4IWB A;  3EHM A;  1M2V A;  3ABK C;  3KH2 A;  4B6I A;  3T6B A;  3EJN A;  4YT8 A;  2Y3D A;  3LLK A;  2QY9 A;  2D5R B;  3DXJ F;  3S27 A;  4XTK A;  3DZA A;  3NYM A;  4XLP F;  3T6J A;  4BJ1 A;  2EIN C;  5DLJ A;  1FTS A;  2Q9A A;  2IXN A;  1FFT C;  1ZHY A;  4BJ5 C;  3S0X A;  2DGJ A;  4G0H A;  3I5Q A;  3SNH A;  4IAO A;  1NU9 C;  5E3A A;  3UNG C;  2ZXR A;  1LVK A;  5L3V A;  3FVY A;  2WL8 A;  4U5G A;  1PCX A;  1IZM A;  3UR3 C;  2FGY A;  4PJL A;  3I4U A;  1BR1 A;  3DD7 A;  2VH3 A;  5L3Q A;  4A2N B;  5IY5 C;  4HEA J;  2NUP B;  3JRT A;  4N06 A;  1D1C A;  3RIP A;  3AG2 C;  3ASO C;  4DOZ A;  3CSK A;  4FX5 A;  2Z15 A;  2R7W A;  2X51 A;  2Q9B A;  4BJ5 A;  2CGE A;  4KC9 A;  1TWG A;  4YT5 A;  3OWT A;  4KBL A;  1ST6 A;  3RKO F;  2Y3G A;  3ITF A;  1G8X A;  4AE4 A;  3CZ6 A;  2PF4 E;  2E87 A;  1LKX A;  1MND A;  1D1A A;  3DJN B;  3FHD A;  5KYX B;  5DQT A;  4PFP A;  3RFY A;  4KNW A;  3EG9 A;  3SYN A;  1ZHX A;  3MX3 A;  2NUP A;  3PHF 2;  2PX0 A;  5T1D B;  5DS5 A;  2ZXW C;  4C7O A;  4CSA A;  1MMD A;  3V7O A;  4RD9 A;  2XRH A;  4U5F E;  5KYY A;  3B0U X;  3NYL A;  3QMK A;  2A68 F;  3L0I A;  4PK4 A;  2JD3 A;  1OCZ C;  4KI2 A;  2P6V A;  1JPJ A;  1IW7 F;  2O9X A;  4IRU A;  4CS9 A;  2IXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...