2KNHA

The solution structure of the etafh domain of aml1-eto complexed with heb peptide
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
103
Chain Sequence
GAMGSGARQLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARLAKQNPAQYLAQHEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein CBFA2T1
publication title Structure of the AML1-ETO eTAFH domain-HEB peptide complex and its contribution to AML1-ETO activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator
total genus 24
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2009-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07531 TAFH NHR1 homology to TAF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1110 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2knhA00
2KNHA 2PP4A 2P6VA 2H7BA
chains in the Genus database with same CATH superfamily
1H9TA 3HKKA 3LEVA 3Q7GA 1YZAA 5A6JA 3VF0A 5JS5A 1OCRC 1YLMA 1V4AA 2LP4A 3LEOA 3T6BA 4JCHA 1U0BB 4BJTA 2CNWD 4MVSA 1M6TA 1RCPA 5DS5A 2FAPB 3L34A 1A7VA 2KYHA 3LNRA 2KQ9A 3ZQVA 2PF4E 2A0UA 4W8PA 2Q9BA 2R7WA 1TWGA 1VYIA 2GWWA 2P7VA 5E3AA 1OKKA 1XWJA 4DRHB 4FWVA 3B0VC 4LERA 1V54C 2F22A 1D1CA 1ORYA 2A1DD 1A7EA 1OXBA 1OQCA 2LD6A 3JYYA 3DAFA 4G7ZF 2R7SA 3EQLF 2L6GA 3EHNA 2GA0A 4JRZA 3LS1A 2P1AA 2HV7A 4MW8A 5IY5C 1I4YA 2W4MA 2R03A 5KYUB 1LE4A 1NG1A 2VCAA 2XLEA 3R7CA 3S28A 4U9EA 2AVKA 1NSGB 1YJGA 1CGME 3NG1A 4ULVA 4CSAA 4F4BA 3DM5A 5T3WA 1SZIA 1BDJB 1K05A 2B0JA 2J0WA 2KW3C 5E33A 2HSBA 3VAYA 3EFOB 1HMDA 1RJ9A 2YHSA 5JVEA 1O5HA 1ZHXA 2HMZA 2J7PA 2YWAA 4EBJA 1ZZPA 2L6HA 3OA1A 1OKKD 1GGQA 3K1IC 3NKDA 2OCCC 1ZHZA 2QE9A 4RD9A 1Y6DA 3S9OA 2FGYA 2WZFA 2KJGA 3DJNB 2BC5A 3A11A 2V26A 2NPUA 1ZU4A 3DE9A 3NYLA 3GORA 2X51A 4AL0A 5KYYB 1G5ZA 3S84A 2RSEB 2HMQA 3K66A 1QKRA 2UUIA 5KYUA 2Q7RA 3V5XA 1MMDA 5DQZA 5B1BC 3FAPB 1M2VB 4JURI 1QSPA 2OKUA 2G3VA 1LIHA 2QUPA 4MVUA 3V5YA 3EFOA 4XPXA 2J7PD 2OG2A 1I5NA 1WGWA 1QZXA 1YA7O 2HUJA 3W8IA 2Q9AA 3B29A 3AG2C 3IHUA 1E86A 3LNMB 5CI8A 4CS7A 3J06A 4WGZA 5KYYA 4IWBA 4PJNA 5L0IA 2EPOA 1LI7A 3IPMO 1GS9A 2DYSC 2XRHA 3EH2A 2LQGA 3UMKA 5DVWA 4O79A 1QQ3A 2P6VA 3SYNA 1G8XA 2XM0A 5F5FA 1WN0A 1AVOB 1T6IA 4U5CE 4WJ0A 1ZHYA 2WVNA 3Q6MA 3T6GB 1F1MA 3A9CA 3PHF2 2L7AA 2PBEA 2EIMC 3HNJA 4LDKA 1YARO 3RYLA 4AK9A 2JX0A 1Z7Qc 2OJED 3GM3A 3RIPA 4BJ6C 4JE9A 4MTFA 2R05A 2J8WA 3C63A 1JR8A 3TD7A 3JTLO 2YQYA 3SXZA 3MBGA 1WWPA 4NY3A 5L3VA 2ZXPA 3GM1A 3LESA 4ANJA 3QVZA 1TWAA 4CIHA 3S0XA 5AC5A 3RF3A 2GFHA 3QVYA 4BG0A 3UGOA 1JPJA 4ZLCA 4DRJB 1LM3B 4ULWA 1VTMP 4QDLA 4U5GA 3LJBA 2MYSA 2CCYA 3WHNA 1FFHA 1LS1A 4IAQA 2L9JA 3GEHA 2YEVA 2J9UA 1HE1A 3MLGA 4I44A 5KYNA 3CSKA 1I4ZA 4XPYA 1LS4A 2G62A 3KL4A 5L0CA 1HMOA 5FZTA 5JUAA 2OEVA 4OIPF 2YRFA 1SR2A 2O9XA 2UUHA 1OW8A 2MHRA 2R25A 3HNIA 4PFOA 5JSLA 2YL7A 1T6QA 1QVXA 4K1OA 4J7YA 1OCCC 2XLOA 256BA 2EPMX 4GEHA 3DJUB 2YL3A 3MFNA 2J0XA 4PJMA 4U5HA 1Q0MA 2E87A 4ZLDA 5COMA 4MNDA 5T1DB 3U2LA 1D1AA 2C04A 4CS8A 1T6UA 3PCVA 2CGEA 4DBRA 5A6AA 1A41A 2J9BA 3S90A 4IRUA 4E0IA 1EI7A 2LFFA 4E17A 3EGXB 4YT8A 1HE9A 5HSWA 3C8GB 2ICWG 2H7VC 3FHDA 1TWHA 3F46A 2HSQA 2VASA 2ZD9A 2EPKX 4DJ9A 1FMWA 1BBHA 2WL8A 4N06A 2ZXRA 4FX5A 3ASNC 3GM2A 2GDCA 4JC7A 3SEOA 3RQGA 1Q0GA 4CS9A 1ORJA 4CSAC 2R02A 2IXOA 3G4ZA 1TFKB 3B9QA 4JEBA 1OCOC 3FOOA 4LLEA 5CI9A 2P61A 3AGTA 5DS6A 3G50A 2Q4FA 4P9TA 4A2NB 4NTFA 4D4NA 2R7XA 1PD1A 3DM9B 3AQCA 3BRJA 1WASA 1ZW2A 2JD3A 4IB4A 3GWLA 1OCZC 3EGXA 4O6MA 3IQCA 3U9MA 2H8AA 3C8GA 1BZ4A 5L0JA 3I5QA 1QPUA 1YDIA 5L0HA 4J32B 4X0RA 1DOVA 2Y3GA 5EK0A 4O6YA 4A4AA 2DGJA 4KBLA 5L3QA 2PFDA 2Q9CA 2XSEA 3N0TA 1CPRA 4NC3A 2OOCA 3E70C 2YL1A 5T3TA 3U0CA 1YYXA 3LS0A 3W8HA 1C02A 3QZCA 4MVRA 4NTAA 5BQIA 4G7OF 1GQAA 4JTAB 1WTYA 3AG4C 5COFA 3RH3A 3V7OA 3NMKA 3ITFA 2IOQA 2YL0A 3ZQYA 1O3UA 1VLTA 2I8BA 2YKZA 3DD7A 4DRIB 2HKVA 3WAQA 1VMAA 3HTKC 4HFKB 1WOLA 3NRHA 4NTBA 1C03A 2DYRC 3C8GD 4OINF 1TR2A 4OIOF 3FOPA 3NDBB 2PX3A 3AG1C 3B71A 1E85A 4CJOA 2H7BA 2X0CA 4BJ1A 3IQ6A 3K33A 4PJJA 3EH1A 3AOUA 1JOGA 3ZWIA 5KYWB 4KI2A 2EPLX 4JVSA 1PD0A 3RW0A 3VRCA 1S7ZA 1ZHWA 3US6A 1ST6A 1BR4A 1FR0A 4LDQA 1AUEA 2PNOA 4U9DA 2NUPB 3RQEA 4YN0B 4E7ZA 2Q3TA 2XLHA 4BJ5C 4WABA 3B0PA 2FFHA 3KYJA 3KYIA 2HJMA 1Q0FA 2RD9A 3RKOF 4U5BE 4G7HF 2J45A 4N4WA 4BEJA 3KKBA 1Z5ZA 2PX0A 2YLIA 1PV3A 1D0ZA 3UMHA 4CDAA 1LPEA 1BR1A 2OEXA 1MQVA 4N6HA 4U5EE 1SF8A 5KYWA 2XLDA 3T6JA 4FESA 1HW1A 4NQFA 2KNHA 4PACA 1JPNA 2YLGA 1S05A 1SYQA 2WVOA 3W2VA 2HV6A 4JCZA 5F5HA 1NFOA 1Z3IX 2L81A 1M2VA 2NUPA 2ZPAA 4W8KA 3GEIA 3ZG1A 3GEEA 3MX3A 4OIRF 1OW7A 3VM6A 3U2MA 4EIYA 5EHHA 4C7OB 1ZYRF 1OR3A 3M4CA 5E3CA 3SZRA 4L6RA 3PMRA 3ASOC 5AC4A 3TJ6A 4OIQF 4EWCA 1T5OA 4K7BA 3QMKA 1OW6A 4JJGA 3M15A 1UG7A 1H6GA 5JLIA 1GM5A 2Y39A 1TKNA 3T4RA 4CS8C 4HFFB 5L0FA 4PK4A 3U5SA 3JRTA 5L0GA 3C7JA 4O7GA 3DZAA 3LLIA 3JYHA 2WZLA 3L0IA 4YL0A 3CAXA 3BEHA 3DMDA 3S27A 1U6HA 2JPUA 2R9RB 4C7OA 4E7SA 2XL8A 2EIKC 3PDMP 4YL3A 5K0IA 3GWNA 3T9OA 2CYDA 2ETSA 4CS9C 4IGGA 3ATPA 4KC9A 3O10A 2M4EA 2HJ3A 1M2OA 3V5ZA 3FXHA 3HNKA 4O6NA 4Z9HA 1E83A 1OXKA 3HJCA 1E84A 1Q0DA 3F47A 3CQZA 2A69F 1TQGA 1ZW3A 4IJJA 4I1MA 1LKXA 3ABKC 2VCCA 4OD4A 4YK5A 2I15A 2LSEA 3FAJA 1FNTc 4HE8D 1EKYA 3C18A 1MNDA 4MVZA 5GPGB 2R7TA 4GYTA 3ABLC 4XTKA 3RFYA 3RVZA 5JT4A 1RKEB 3SP1A 1HW2A 4M63A 1O87A 3TQOA 3RQFA 3N2ZB 4JKVA 4ER9A 2Y69C 3K1HA 5DLJA 4P9FA 1Z23A 2LIGA 3C62A 4LACB 4BEMJ 3AJMA 3EZIA 3L1MA 2PP4A 1G4WR 1RXQA 3NYJA 4MQ9F 2IM8A 2QNLA 4N6CA 5COGA 4BPMA 3LUTB 1WATA 2EINC 3ZIBA 1K04A 3H2UA 3N24A 1JAFA 1MMGA 4LLCA 3UNGC 2R7VA 4GQHA 1FFTC 1K40A 1A0BA 1YVIA 3TULA 5JP7A 1VK5A 5KYXB 1XZQA 4EHPA 1APCA 2VC9A 2WB7A 2D5RB 2XLVA 4J7TA 3O39A 2Y3BA 2CW0F 1KTMA 5AGFA 1KU2A 2XS8A 4MS2A 4R32A 5A6KA 4Q5SF 3M1CB 4ONSA 1IW7F 3AG3C 4JJFA 2LK4A 1NBBA 3U9JA 2W4BA 5A69A 2A68F 4MTGA 3LAYA 2QY9A 4Z9JA 4QI0A 3ABMC 2H7OA 2KGOA 2IYLD 2A6HF 4H4KC 2BE5F 3U3FA 3H2VA 2KK1A 4OD5A 2GAQA 4AE4B 4DVYP 4NCQA 4CJGA 4DBQA 3K6BA 2XXAB 1U89A 2XLMA 4JZAA 3POVA 3KH2A 5KYXA 1D0YA 2KC3A 2AWYA 5E2QA 1LE2A 2CDQA 2J46A 3EJNA 1RJ9B 2Y3HA 4XWJA 2NG1A 3UR3C 4C3DA 1Z63A 3KPHA 3W4YA 3SXYA 2LCHA 5DQTA 4CX9A 4CIPA 1JRAA 1AEPA 1T01A 2M64A 3JCUQ 3U8PA 1XZPA 5BQHA 3ZTZA 1KNYA 2VB6A 3HLZA 3NYMA 3EG9B 2BL2A 4E18A 4EBKA 4Q4ZF 1RKCA 1VYKA 4YL1A 3I4UA 3UMIA 2HS5A 4YJWA 4AE4A 2WZGA 3O6XA 2EIJC 2V3CC 1UFBA 4K0DA 1ZHTA 3EPVA 5D91A 5FCLA 2XXAA 2XLWA 1RMVA 5F28E 1DOWA 3FMSA 1J8YF 1VOMA 1N1CA 3K7DA 4EKWA 5TJ5E 1NFNA 3QW0A 4LDRA 1CGOA 2Z15A 2XS1A 5B3IA 2DI3A 3JSZA 3O55A 5A6BA 3FDQA 2R7RA 5D92A 2IXNA 2OJQA 1M56C 1D0XA 3EG9A 5L0DA 2L6FA 2YVKA 4PJLA 4XEKA 1FMVA 1Y4CA 4D4XA 2QLAA 1TFOB 4MW3A 4DOZA 1BR2A 1H9GA 1ZVZA 4E0HA 4FAPB 3NKEA 3QTHA 3AQBA 3E9VA 4MVOA 3JRMO 2DB4A 1V55C 4U5DE 1MNEA 2AWCA 1IZMA 3OWTA 3MYIA 4XEVA 4IARA 2VCBA 3DI5A 3I5PA 5CIVA 1HY5A 2A0BA 1L7CA 3G4XA 4RBNA 3GODA 2ZXOA 3VYWA 4G78A 3TOMA 2B0HA 2OU6A 5A6BD 3TOLA 4C3BA 4JTDB 2R7QA 1YYJA 3SNHA 1B68A 1CGNA 3HNLA 3K1IA 3JZ0A 3U8VA 4AX2A 1ZU5A 2J9VA 3WG7C 2EPNA 1FTSA 4RDAA 3NMIA 3GANA 2D4UA 4EUKB 4JEAA 4XPWA 4J30B 3IQTA 4YT5A 3UGPA 1NLXA 1H7IA 3DWWA 1YAUO 3ECSA 3L8JA 1TWCA 2KSFA 3MYFA 3U3BA 1YZCA 2Q00A 1NZEA 3JSEO 3M79A 2HFIA 3QW1A 2XL6A 4Z9IA 4P6IC 3EZHA 3Q7LA 3X1OA 4BJ5A 2AU5A 1VB5A 4WGYA 4EBBA 4KNWA 4CDVA 3WODF 4MTOA 2W9YA 1VLSA 3ZVRA 5BQGA 5B3SC 2ZXWC 4QI2A 2J9WA 4C3EA 1L3PA 4YT4A 1V74B 3AGUA 2QTVA 3ZC4A 1FAPB 2NUTB 2IXMA 1NU9C 4AL1A 2HZ8A 2YZSA 3TK0A 1SMYF 3JT1A 3H65A 4KNVA 4CBEA 4YT2A 3EGDB 2XM4A 4U5FE 5JRAA 4Q7CA 2VH3A 3IEEA 2MWQA 1CPQA 3FVYA 3ZSUA 3CZ6A 2G3KA 4UDVA 3B0UX 1A7DA 3W2WA 3KMIA 3Q6NA 3M4BA 1D1BA 4H54A 3SXMA 4DXWA 2R7OA 2EILC 1MMAA 3DKAA 3RVYA 4JW1A 2IXPA 1LI5A 4I3MA 3ZDLA 1QLEC 3L8IA 3S29A 2C03A 1M57C 3CEXA 4BJ6A 1W2WA 4DVZA 5HV9A 1NU7D 3C8ZA 3DE8A 5DS4A 2NUTA 1JMWA 1Z6AA 4HEAJ 4MVMA 2TMVP 1T9KA 4B6IA 3LLKA 4I1OB 3EGDA 4XEFA 3R2PA 2R7UA 2NSFA 3DXJF 2CNWA 2NSGA 2XL4A 1R4TA 3SXKA 1C17M 2AP3A 3X2QC 1EA8A 2IBFA 2P0NA 2LFDA 1Q0KA 2OQMA 1G4US 1RKEA 3EHMA 4XLPF 5BUOA 4XLNF 4PFPA 1J8MF 3NMJA 2W45A 1E2XA 3TJ5A 2YLDA 1LVKA 2A6EF 3DAGA 3IQ5A 1OR2A 3OEOA 4IAOA 4JIOA 1PCXA 2Y3DA 4MVQA 3ZTMA 1R5ID 4YWQA 1YA9A 5B1AC 2ASRA 4JTCB 1EQ1A 4G0HA 4CDYA 1ORSC 1MMNA 4PR9A 5EGYA 2WVQA 4XQ1A
chains in the Genus database with same CATH topology
3LEVA 3Q7GA 1OCRC 3T6BA 4JCHA 4BJTA 2CNWD 5DS5A 3L34A 3LNRA 2KQ9A 2PF4E 2R7WA 2Q9BA 1TWGA 1VYIA 2P7VA 5E3AA 3B0VC 1OKKA 4FWVA 4LERA 1V54C 1D1CA 2A1DD 3DAFA 4G7ZF 2R7SA 3EQLF 3EHNA 5IY5C 3LS1A 2HV7A 4OIPF 5KYUB 2W4MA 1NG1A 3S28A 3NG1A 4CSAA 4F4BA 3DM5A 5T3WA 1SZIA 5E33A 2B0JA 2J0WA 2KW3C 3VAYA 3EFOB 1RJ9A 2YHSA 1O5HA 1ZHXA 2J7PA 3OA1A 1OKKD 3K1IC 3NKDA 2OCCC 1ZHZA 4RD9A 4QI2A 2FGYA 2WZFA 2KJGA 3DJNB 2V26A 3NYLA 1ZU4A 5KYYB 2X51A 3K66A 5KYUA 1MMDA 5DQZA 5B1BC 4JURI 1M2VB 2G3VA 3EFOA 2J7PD 2OG2A 1WGWA 1QZXA 3W8IA 2Q9AA 3AG2C 5CI8A 4CS7A 5KYYA 4IWBA 4PJNA 2DYSC 2XRHA 3EH2A 3UMKA 5DVWA 4O79A 3SYNA 2P6VA 5F5FA 1G8XA 4U5CE 4WJ0A 1ZHYA 2WVNA 3Q6MA 3PHF2 2EIMC 3RYLA 4AK9A 4BJ6C 3RIPA 3TD7A 4NY3A 5L3VA 2ZXPA 3LESA 4ANJA 1TWAA 4CIHA 3S0XA 2GFHA 4BG0A 3UGOA 1JPJA 4ZLCA 4ULWA 4QDLA 4U5GA 3LJBA 2MYSA 1FFHA 1LS1A 2L9JA 3MLGA 2YEVA 2J9UA 4I44A 5KYNA 3CSKA 2G62A 3KL4A 2O9XA 4PFOA 1OCCC 4GEHA 3DJUB 2J0XA 4PJMA 4U5HA 2E87A 4ZLDA 4MNDA 5T1DB 1D1AA 2C04A 4CS8A 2CGEA 4DBRA 4IRUA 3EGXB 4YT8A 5HSWA 2H7VC 3FHDA 1TWHA 3F46A 2VASA 1FMWA 2WL8A 4N06A 2ZXRA 4FX5A 3ASNC 3SEOA 4CS9A 4CSAC 2IXOA 3B9QA 1OCOC 5DS6A 4LLEA 5CI9A 4A2NB 2R7XA 1PD1A 3DM9B 3AQCA 2JD3A 1OCZC 3EGXA 4O6MA 3I5QA 4J32B 4X0RA 2Y3GA 4O6YA 2DGJA 4KBLA 5L3QA 2PFDA 2Q9CA 2XSEA 3N0TA 5T3TA 3E70C 3LS0A 3W8HA 3QZCA 4G7OF 3AG4C 3RH3A 3V7OA 3ITFA 2IOQA 3DD7A 2I8BA 1VMAA 3HTKC 4HFKB 3NRHA 2DYRC 4OINF 1TR2A 4OIOF 3NDBB 2PX3A 3AG1C 2H7BA 4BJ1A 3K33A 4PJJA 3EH1A 5KYWB 4KI2A 4JVSA 1PD0A 1S7ZA 1ZHWA 1ST6A 1BR4A 2NUPB 4YN0B 4E7ZA 2Q3TA 4BJ5C 3B0PA 2FFHA 3RKOF 4U5BE 4G7HF 2J45A 4BEJA 3KKBA 1Z5ZA 2PX0A 1D0ZA 3UMHA 1BR1A 4U5EE 1SF8A 5KYWA 3T6JA 4FESA 2KNHA 1JPNA 3W2VA 2WVOA 2HV6A 5F5HA 1Z3IX 2L81A 1M2VA 2NUPA 2ZPAA 4W8KA 3ZG1A 5EHHA 4OIRF 3MX3A 4C7OB 1ZYRF 5E3CA 3SZRA 3PMRA 3ASOC 4OIQF 4EWCA 4K7BA 3QMKA 4JJGA 2Y39A 1TKNA 3T4RA 4CS8C 4HFFB 4PK4A 3JRTA 4O7GA 3DZAA 3LLIA 3JYHA 2WZLA 3L0IA 3DMDA 3S27A 4C7OA 4E7SA 2EIKC 4CS9C 4KC9A 2M4EA 1M2OA 4O6NA 3HJCA 3CQZA 3F47A 2A69F 4IJJA 4I1MA 1LKXA 3ABKC 4OD4A 2LSEA 3FAJA 4HE8D 1MNDA 2R7TA 4GYTA 3ABLC 4XTKA 3RFYA 3SP1A 4M63A 1O87A 3N2ZB 2Y69C 3K1HA 5DLJA 1Z23A 4LACB 3EZIA 2PP4A 3NYJA 4MQ9F 2EINC 3ZIBA 3N24A 4LLCA 1MMGA 3UNGC 2R7VA 1FFTC 1VK5A 5KYXB 2WB7A 2D5RB 3O39A 2Y3BA 2CW0F 4Q5SF 1KU2A 3M1CB 1IW7F 3AG3C 4JJFA 2W4BA 2A68F 3LAYA 2QY9A 4QI0A 3ABMC 2H7OA 2KGOA 2IYLD 2A6HF 4H4KC 2BE5F 4OD5A 4AE4B 4DVYP 4DBQA 3K6BA 2XXAB 4JZAA 3POVA 3KH2A 5KYXA 1D0YA 5E2QA 4XWJA 2CDQA 2J46A 3EJNA 1RJ9B 2Y3HA 3UR3C 2NG1A 4C3DA 1Z63A 5DQTA 3JCUQ 4Q4ZF 2VB6A 3HLZA 3NYMA 3EG9B 1VYKA 3I4UA 3UMIA 4YJWA 4AE4A 2WZGA 3O6XA 2EIJC 2V3CC 4K0DA 1ZHTA 3EPVA 5D91A 5FCLA 2XXAA 1J8YF 1VOMA 1N1CA 3K7DA 2Z15A 3JSZA 3FDQA 2R7RA 5D92A 2IXNA 1M56C 1D0XA 3EG9A 4PJLA 1FMVA 4DOZA 1BR2A 3NKEA 3AQBA 3E9VA 1V55C 4U5DE 1MNEA 1IZMA 3OWTA 3I5PA 4RBNA 3GODA 2ZXOA 3VYWA 4C3BA 2R7QA 3SNHA 4AX2A 1ZU5A 2J9VA 3WG7C 1FTSA 4RDAA 3GANA 4J30B 3UGPA 4YT5A 3ECSA 1TWCA 1NZEA 4P6IC 3EZHA 3Q7LA 3X1OA 4BJ5A 4EBBA 4KNWA 3WODF 2W9YA 3ZVRA 5B3SC 2ZXWC 2J9WA 4C3EA 4YT4A 2QTVA 3ZC4A 2NUTB 2IXMA 1NU9C 2YZSA 1SMYF 3JT1A 3H65A 4KNVA 4CBEA 4YT2A 3EGDB 4U5FE 4Q7CA 2VH3A 3IEEA 2MWQA 3ZSUA 3FVYA 3CZ6A 2G3KA 3B0UX 3W2WA 3KMIA 3Q6NA 1D1BA 2R7OA 2EILC 1MMAA 4JW1A 2IXPA 4I3MA 1QLEC 3S29A 4BJ6A 2C03A 1M57C 4DVZA 1W2WA 1NU7D 5DS4A 2NUTA 4HEAJ 1Z6AA 4B6IA 3LLKA 4I1OB 3EGDA 2R7UA 3DXJF 2CNWA 2XL4A 3X2QC 3EHMA 5BUOA 4XLNF 4PFPA 1J8MF 2W45A 1LVKA 2A6EF 3DAGA 4XLPF 3OEOA 4IAOA 1PCXA 2Y3DA 4YWQA 5B1AC 4G0HA 1MMNA 5EGYA 2WVQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KNH A;  2PP4 A;  2P6V A;  2H7B A; 
#chains in the Genus database with same CATH topology
 1H9T A;  3HKK A;  3LEV A;  3Q7G A;  1YZA A;  5A6J A;  3VF0 A;  5JS5 A;  1OCR C;  1YLM A;  1V4A A;  2LP4 A;  3LEO A;  3T6B A;  4JCH A;  1U0B B;  4BJT A;  2CNW D;  4MVS A;  1M6T A;  1RCP A;  5DS5 A;  2FAP B;  3L34 A;  1A7V A;  2KYH A;  3LNR A;  2KQ9 A;  3ZQV A;  2PF4 E;  2A0U A;  4W8P A;  2Q9B A;  2R7W A;  1TWG A;  1VYI A;  2GWW A;  2P7V A;  5E3A A;  1OKK A;  1XWJ A;  4DRH B;  4FWV A;  3B0V C;  4LER A;  1V54 C;  2F22 A;  1D1C A;  1ORY A;  2A1D D;  1A7E A;  1OXB A;  1OQC A;  2LD6 A;  3JYY A;  3DAF A;  4G7Z F;  2R7S A;  3EQL F;  2L6G A;  3EHN A;  2GA0 A;  4JRZ A;  3LS1 A;  2P1A A;  2HV7 A;  4MW8 A;  5IY5 C;  1I4Y A;  2W4M A;  2R03 A;  5KYU B;  1LE4 A;  1NG1 A;  2VCA A;  2XLE A;  3R7C A;  3S28 A;  4U9E A;  2AVK A;  1NSG B;  1YJG A;  1CGM E;  3NG1 A;  4ULV A;  4CSA A;  4F4B A;  3DM5 A;  5T3W A;  1SZI A;  1BDJ B;  1K05 A;  2B0J A;  2J0W A;  2KW3 C;  5E33 A;  2HSB A;  3VAY A;  3EFO B;  1HMD A;  1RJ9 A;  2YHS A;  5JVE A;  1O5H A;  1ZHX A;  2HMZ A;  2J7P A;  2YWA A;  4EBJ A;  1ZZP A;  2L6H A;  3OA1 A;  1OKK D;  1GGQ A;  3K1I C;  3NKD A;  2OCC C;  1ZHZ A;  2QE9 A;  4RD9 A;  1Y6D A;  3S9O A;  2FGY A;  2WZF A;  2KJG A;  3DJN B;  2BC5 A;  3A11 A;  2V26 A;  2NPU A;  1ZU4 A;  3DE9 A;  3NYL A;  3GOR A;  2X51 A;  4AL0 A;  5KYY B;  1G5Z A;  3S84 A;  2RSE B;  2HMQ A;  3K66 A;  1QKR A;  2UUI A;  5KYU A;  2Q7R A;  3V5X A;  1MMD A;  5DQZ A;  5B1B C;  3FAP B;  1M2V B;  4JUR I;  1QSP A;  2OKU A;  2G3V A;  1LIH A;  2QUP A;  4MVU A;  3V5Y A;  3EFO A;  4XPX A;  2J7P D;  2OG2 A;  1I5N A;  1WGW A;  1QZX A;  1YA7 O;  2HUJ A;  3W8I A;  2Q9A A;  3B29 A;  3AG2 C;  3IHU A;  1E86 A;  3LNM B;  5CI8 A;  4CS7 A;  3J06 A;  4WGZ A;  5KYY A;  4IWB A;  4PJN A;  5L0I A;  2EPO A;  1LI7 A;  3IPM O;  1GS9 A;  2DYS C;  2XRH A;  3EH2 A;  2LQG A;  3UMK A;  5DVW A;  4O79 A;  1QQ3 A;  2P6V A;  3SYN A;  1G8X A;  2XM0 A;  5F5F A;  1WN0 A;  1AVO B;  1T6I A;  4U5C E;  4WJ0 A;  1ZHY A;  2WVN A;  3Q6M A;  3T6G B;  1F1M A;  3A9C A;  3PHF 2;  2L7A A;  2PBE A;  2EIM C;  3HNJ A;  4LDK A;  1YAR O;  3RYL A;  4AK9 A;  2JX0 A;  1Z7Q c;  2OJE D;  3GM3 A;  3RIP A;  4BJ6 C;  4JE9 A;  4MTF A;  2R05 A;  2J8W A;  3C63 A;  1JR8 A;  3TD7 A;  3JTL O;  2YQY A;  3SXZ A;  3MBG A;  1WWP A;  4NY3 A;  5L3V A;  2ZXP A;  3GM1 A;  3LES A;  4ANJ A;  3QVZ A;  1TWA A;  4CIH A;  3S0X A;  5AC5 A;  3RF3 A;  2GFH A;  3QVY A;  4BG0 A;  3UGO A;  1JPJ A;  4ZLC A;  4DRJ B;  1LM3 B;  4ULW A;  1VTM P;  4QDL A;  4U5G A;  3LJB A;  2MYS A;  2CCY A;  3WHN A;  1FFH A;  1LS1 A;  4IAQ A;  2L9J A;  3GEH A;  2YEV A;  2J9U A;  1HE1 A;  3MLG A;  4I44 A;  5KYN A;  3CSK A;  1I4Z A;  4XPY A;  1LS4 A;  2G62 A;  3KL4 A;  5L0C A;  1HMO A;  5FZT A;  5JUA A;  2OEV A;  4OIP F;  2YRF A;  1SR2 A;  2O9X A;  2UUH A;  1OW8 A;  2MHR A;  2R25 A;  3HNI A;  4PFO A;  5JSL A;  2YL7 A;  1T6Q A;  1QVX A;  4K1O A;  4J7Y A;  1OCC C;  2XLO A;  256B A;  2EPM X;  4GEH A;  3DJU B;  2YL3 A;  3MFN A;  2J0X A;  4PJM A;  4U5H A;  1Q0M A;  2E87 A;  4ZLD A;  5COM A;  4MND A;  5T1D B;  3U2L A;  1D1A A;  2C04 A;  4CS8 A;  1T6U A;  3PCV A;  2CGE A;  4DBR A;  5A6A A;  1A41 A;  2J9B A;  3S90 A;  4IRU A;  4E0I A;  1EI7 A;  2LFF A;  4E17 A;  3EGX B;  4YT8 A;  1HE9 A;  5HSW A;  3C8G B;  2ICW G;  2H7V C;  3FHD A;  1TWH A;  3F46 A;  2HSQ A;  2VAS A;  2ZD9 A;  2EPK X;  4DJ9 A;  1FMW A;  1BBH A;  2WL8 A;  4N06 A;  2ZXR A;  4FX5 A;  3ASN C;  3GM2 A;  2GDC A;  4JC7 A;  3SEO A;  3RQG A;  1Q0G A;  4CS9 A;  1ORJ A;  4CSA C;  2R02 A;  2IXO A;  3G4Z A;  1TFK B;  3B9Q A;  4JEB A;  1OCO C;  3FOO A;  4LLE A;  5CI9 A;  2P61 A;  3AGT A;  5DS6 A;  3G50 A;  2Q4F A;  4P9T A;  4A2N B;  4NTF A;  4D4N A;  2R7X A;  1PD1 A;  3DM9 B;  3AQC A;  3BRJ A;  1WAS A;  1ZW2 A;  2JD3 A;  4IB4 A;  3GWL A;  1OCZ C;  3EGX A;  4O6M A;  3IQC A;  3U9M A;  2H8A A;  3C8G A;  1BZ4 A;  5L0J A;  3I5Q A;  1QPU A;  1YDI A;  5L0H A;  4J32 B;  4X0R A;  1DOV A;  2Y3G A;  5EK0 A;  4O6Y A;  4A4A A;  2DGJ A;  4KBL A;  5L3Q A;  2PFD A;  2Q9C A;  2XSE A;  3N0T A;  1CPR A;  4NC3 A;  2OOC A;  3E70 C;  2YL1 A;  5T3T A;  3U0C A;  1YYX A;  3LS0 A;  3W8H A;  1C02 A;  3QZC A;  4MVR A;  4NTA A;  5BQI A;  4G7O F;  1GQA A;  4JTA B;  1WTY A;  3AG4 C;  5COF A;  3RH3 A;  3V7O A;  3NMK A;  3ITF A;  2IOQ A;  2YL0 A;  3ZQY A;  1O3U A;  1VLT A;  2I8B A;  2YKZ A;  3DD7 A;  4DRI B;  2HKV A;  3WAQ A;  1VMA A;  3HTK C;  4HFK B;  1WOL A;  3NRH A;  4NTB A;  1C03 A;  2DYR C;  3C8G D;  4OIN F;  1TR2 A;  4OIO F;  3FOP A;  3NDB B;  2PX3 A;  3AG1 C;  3B71 A;  1E85 A;  4CJO A;  2H7B A;  2X0C A;  4BJ1 A;  3IQ6 A;  3K33 A;  4PJJ A;  3EH1 A;  3AOU A;  1JOG A;  3ZWI A;  5KYW B;  4KI2 A;  2EPL X;  4JVS A;  1PD0 A;  3RW0 A;  3VRC A;  1S7Z A;  1ZHW A;  3US6 A;  1ST6 A;  1BR4 A;  1FR0 A;  4LDQ A;  1AUE A;  2PNO A;  4U9D A;  2NUP B;  3RQE A;  4YN0 B;  4E7Z A;  2Q3T A;  2XLH A;  4BJ5 C;  4WAB A;  3B0P A;  2FFH A;  3KYJ A;  3KYI A;  2HJM A;  1Q0F A;  2RD9 A;  3RKO F;  4U5B E;  4G7H F;  2J45 A;  4N4W A;  4BEJ A;  3KKB A;  1Z5Z A;  2PX0 A;  2YLI A;  1PV3 A;  1D0Z A;  3UMH A;  4CDA A;  1LPE A;  1BR1 A;  2OEX A;  1MQV A;  4N6H A;  4U5E E;  1SF8 A;  5KYW A;  2XLD A;  3T6J A;  4FES A;  1HW1 A;  4NQF A;  2KNH A;  4PAC A;  1JPN A;  2YLG A;  1S05 A;  1SYQ A;  2WVO A;  3W2V A;  2HV6 A;  4JCZ A;  5F5H A;  1NFO A;  1Z3I X;  2L81 A;  1M2V A;  2NUP A;  2ZPA A;  4W8K A;  3GEI A;  3ZG1 A;  3GEE A;  3MX3 A;  4OIR F;  1OW7 A;  3VM6 A;  3U2M A;  4EIY A;  5EHH A;  4C7O B;  1ZYR F;  1OR3 A;  3M4C A;  5E3C A;  3SZR A;  4L6R A;  3PMR A;  3ASO C;  5AC4 A;  3TJ6 A;  4OIQ F;  4EWC A;  1T5O A;  4K7B A;  3QMK A;  1OW6 A;  4JJG A;  3M15 A;  1UG7 A;  1H6G A;  5JLI A;  1GM5 A;  2Y39 A;  1TKN A;  3T4R A;  4CS8 C;  4HFF B;  5L0F A;  4PK4 A;  3U5S A;  3JRT A;  5L0G A;  3C7J A;  4O7G A;  3DZA A;  3LLI A;  3JYH A;  2WZL A;  3L0I A;  4YL0 A;  3CAX A;  3BEH A;  3DMD A;  3S27 A;  1U6H A;  2JPU A;  2R9R B;  4C7O A;  4E7S A;  2XL8 A;  2EIK C;  3PDM P;  4YL3 A;  5K0I A;  3GWN A;  3T9O A;  2CYD A;  2ETS A;  4CS9 C;  4IGG A;  3ATP A;  4KC9 A;  3O10 A;  2M4E A;  2HJ3 A;  1M2O A;  3V5Z A;  3FXH A;  3HNK A;  4O6N A;  4Z9H A;  1E83 A;  1OXK A;  3HJC A;  1E84 A;  1Q0D A;  3F47 A;  3CQZ A;  2A69 F;  1TQG A;  1ZW3 A;  4IJJ A;  4I1M A;  1LKX A;  3ABK C;  2VCC A;  4OD4 A;  4YK5 A;  2I15 A;  2LSE A;  3FAJ A;  1FNT c;  4HE8 D;  1EKY A;  3C18 A;  1MND A;  4MVZ A;  5GPG B;  2R7T A;  4GYT A;  3ABL C;  4XTK A;  3RFY A;  3RVZ A;  5JT4 A;  1RKE B;  3SP1 A;  1HW2 A;  4M63 A;  1O87 A;  3TQO A;  3RQF A;  3N2Z B;  4JKV A;  4ER9 A;  2Y69 C;  3K1H A;  5DLJ A;  4P9F A;  1Z23 A;  2LIG A;  3C62 A;  4LAC B;  4BEM J;  3AJM A;  3EZI A;  3L1M A;  2PP4 A;  1G4W R;  1RXQ A;  3NYJ A;  4MQ9 F;  2IM8 A;  2QNL A;  4N6C A;  5COG A;  4BPM A;  3LUT B;  1WAT A;  2EIN C;  3ZIB A;  1K04 A;  3H2U A;  3N24 A;  1JAF A;  1MMG A;  4LLC A;  3UNG C;  2R7V A;  4GQH A;  1FFT C;  1K40 A;  1A0B A;  1YVI A;  3TUL A;  5JP7 A;  1VK5 A;  5KYX B;  1XZQ A;  4EHP A;  1APC A;  2VC9 A;  2WB7 A;  2D5R B;  2XLV A;  4J7T A;  3O39 A;  2Y3B A;  2CW0 F;  1KTM A;  5AGF A;  1KU2 A;  2XS8 A;  4MS2 A;  4R32 A;  5A6K A;  4Q5S F;  3M1C B;  4ONS A;  1IW7 F;  3AG3 C;  4JJF A;  2LK4 A;  1NBB A;  3U9J A;  2W4B A;  5A69 A;  2A68 F;  4MTG A;  3LAY A;  2QY9 A;  4Z9J A;  4QI0 A;  3ABM C;  2H7O A;  2KGO A;  2IYL D;  2A6H F;  4H4K C;  2BE5 F;  3U3F A;  3H2V A;  2KK1 A;  4OD5 A;  2GAQ A;  4AE4 B;  4DVY P;  4NCQ A;  4CJG A;  4DBQ A;  3K6B A;  2XXA B;  1U89 A;  2XLM A;  4JZA A;  3POV A;  3KH2 A;  5KYX A;  1D0Y A;  2KC3 A;  2AWY A;  5E2Q A;  1LE2 A;  2CDQ A;  2J46 A;  3EJN A;  1RJ9 B;  2Y3H A;  4XWJ A;  2NG1 A;  3UR3 C;  4C3D A;  1Z63 A;  3KPH A;  3W4Y A;  3SXY A;  2LCH A;  5DQT A;  4CX9 A;  4CIP A;  1JRA A;  1AEP A;  1T01 A;  2M64 A;  3JCU Q;  3U8P A;  1XZP A;  5BQH A;  3ZTZ A;  1KNY A;  2VB6 A;  3HLZ A;  3NYM A;  3EG9 B;  2BL2 A;  4E18 A;  4EBK A;  4Q4Z F;  1RKC A;  1VYK A;  4YL1 A;  3I4U A;  3UMI A;  2HS5 A;  4YJW A;  4AE4 A;  2WZG A;  3O6X A;  2EIJ C;  2V3C C;  1UFB A;  4K0D A;  1ZHT A;  3EPV A;  5D91 A;  5FCL A;  2XXA A;  2XLW A;  1RMV A;  5F28 E;  1DOW A;  3FMS A;  1J8Y F;  1VOM A;  1N1C A;  3K7D A;  4EKW A;  5TJ5 E;  1NFN A;  3QW0 A;  4LDR A;  1CGO A;  2Z15 A;  2XS1 A;  5B3I A;  2DI3 A;  3JSZ A;  3O55 A;  5A6B A;  3FDQ A;  2R7R A;  5D92 A;  2IXN A;  2OJQ A;  1M56 C;  1D0X A;  3EG9 A;  5L0D A;  2L6F A;  2YVK A;  4PJL A;  4XEK A;  1FMV A;  1Y4C A;  4D4X A;  2QLA A;  1TFO B;  4MW3 A;  4DOZ A;  1BR2 A;  1H9G A;  1ZVZ A;  4E0H A;  4FAP B;  3NKE A;  3QTH A;  3AQB A;  3E9V A;  4MVO A;  3JRM O;  2DB4 A;  1V55 C;  4U5D E;  1MNE A;  2AWC A;  1IZM A;  3OWT A;  3MYI A;  4XEV A;  4IAR A;  2VCB A;  3DI5 A;  3I5P A;  5CIV A;  1HY5 A;  2A0B A;  1L7C A;  3G4X A;  4RBN A;  3GOD A;  2ZXO A;  3VYW A;  4G78 A;  3TOM A;  2B0H A;  2OU6 A;  5A6B D;  3TOL A;  4C3B A;  4JTD B;  2R7Q A;  1YYJ A;  3SNH A;  1B68 A;  1CGN A;  3HNL A;  3K1I A;  3JZ0 A;  3U8V A;  4AX2 A;  1ZU5 A;  2J9V A;  3WG7 C;  2EPN A;  1FTS A;  4RDA A;  3NMI A;  3GAN A;  2D4U A;  4EUK B;  4JEA A;  4XPW A;  4J30 B;  3IQT A;  4YT5 A;  3UGP A;  1NLX A;  1H7I A;  3DWW A;  1YAU O;  3ECS A;  3L8J A;  1TWC A;  2KSF A;  3MYF A;  3U3B A;  1YZC A;  2Q00 A;  1NZE A;  3JSE O;  3M79 A;  2HFI A;  3QW1 A;  2XL6 A;  4Z9I A;  4P6I C;  3EZH A;  3Q7L A;  3X1O A;  4BJ5 A;  2AU5 A;  1VB5 A;  4WGY A;  4EBB A;  4KNW A;  4CDV A;  3WOD F;  4MTO A;  2W9Y A;  1VLS A;  3ZVR A;  5BQG A;  5B3S C;  2ZXW C;  4QI2 A;  2J9W A;  4C3E A;  1L3P A;  4YT4 A;  1V74 B;  3AGU A;  2QTV A;  3ZC4 A;  1FAP B;  2NUT B;  2IXM A;  1NU9 C;  4AL1 A;  2HZ8 A;  2YZS A;  3TK0 A;  1SMY F;  3JT1 A;  3H65 A;  4KNV A;  4CBE A;  4YT2 A;  3EGD B;  2XM4 A;  4U5F E;  5JRA A;  4Q7C A;  2VH3 A;  3IEE A;  2MWQ A;  1CPQ A;  3FVY A;  3ZSU A;  3CZ6 A;  2G3K A;  4UDV A;  3B0U X;  1A7D A;  3W2W A;  3KMI A;  3Q6N A;  3M4B A;  1D1B A;  4H54 A;  3SXM A;  4DXW A;  2R7O A;  2EIL C;  1MMA A;  3DKA A;  3RVY A;  4JW1 A;  2IXP A;  1LI5 A;  4I3M A;  3ZDL A;  1QLE C;  3L8I A;  3S29 A;  2C03 A;  1M57 C;  3CEX A;  4BJ6 A;  1W2W A;  4DVZ A;  5HV9 A;  1NU7 D;  3C8Z A;  3DE8 A;  5DS4 A;  2NUT A;  1JMW A;  1Z6A A;  4HEA J;  4MVM A;  2TMV P;  1T9K A;  4B6I A;  3LLK A;  4I1O B;  3EGD A;  4XEF A;  3R2P A;  2R7U A;  2NSF A;  3DXJ F;  2CNW A;  2NSG A;  2XL4 A;  1R4T A;  3SXK A;  1C17 M;  2AP3 A;  3X2Q C;  1EA8 A;  2IBF A;  2P0N A;  2LFD A;  1Q0K A;  2OQM A;  1G4U S;  1RKE A;  3EHM A;  4XLP F;  5BUO A;  4XLN F;  4PFP A;  1J8M F;  3NMJ A;  2W45 A;  1E2X A;  3TJ5 A;  2YLD A;  1LVK A;  2A6E F;  3DAG A;  3IQ5 A;  1OR2 A;  3OEO A;  4IAO A;  4JIO A;  1PCX A;  2Y3D A;  4MVQ A;  3ZTM A;  1R5I D;  4YWQ A;  1YA9 A;  5B1A C;  2ASR A;  4JTC B;  1EQ1 A;  4G0H A;  4CDY A;  1ORS C;  1MMN A;  4PR9 A;  5EGY A;  2WVQ A;  4XQ1 A; 
#chains in the Genus database with same CATH homology
 3LEV A;  3Q7G A;  1OCR C;  3T6B A;  4JCH A;  4BJT A;  2CNW D;  5DS5 A;  3L34 A;  3LNR A;  2KQ9 A;  2PF4 E;  2R7W A;  2Q9B A;  1TWG A;  1VYI A;  2P7V A;  5E3A A;  3B0V C;  1OKK A;  4FWV A;  4LER A;  1V54 C;  1D1C A;  2A1D D;  3DAF A;  4G7Z F;  2R7S A;  3EQL F;  3EHN A;  5IY5 C;  3LS1 A;  2HV7 A;  4OIP F;  5KYU B;  2W4M A;  1NG1 A;  3S28 A;  3NG1 A;  4CSA A;  4F4B A;  3DM5 A;  5T3W A;  1SZI A;  5E33 A;  2B0J A;  2J0W A;  2KW3 C;  3VAY A;  3EFO B;  1RJ9 A;  2YHS A;  1O5H A;  1ZHX A;  2J7P A;  3OA1 A;  1OKK D;  3K1I C;  3NKD A;  2OCC C;  1ZHZ A;  4RD9 A;  4QI2 A;  2FGY A;  2WZF A;  2KJG A;  3DJN B;  2V26 A;  3NYL A;  1ZU4 A;  5KYY B;  2X51 A;  3K66 A;  5KYU A;  1MMD A;  5DQZ A;  5B1B C;  4JUR I;  1M2V B;  2G3V A;  3EFO A;  2J7P D;  2OG2 A;  1WGW A;  1QZX A;  3W8I A;  2Q9A A;  3AG2 C;  5CI8 A;  4CS7 A;  5KYY A;  4IWB A;  4PJN A;  2DYS C;  2XRH A;  3EH2 A;  3UMK A;  5DVW A;  4O79 A;  3SYN A;  2P6V A;  5F5F A;  1G8X A;  4U5C E;  4WJ0 A;  1ZHY A;  2WVN A;  3Q6M A;  3PHF 2;  2EIM C;  3RYL A;  4AK9 A;  4BJ6 C;  3RIP A;  3TD7 A;  4NY3 A;  5L3V A;  2ZXP A;  3LES A;  4ANJ A;  1TWA A;  4CIH A;  3S0X A;  2GFH A;  4BG0 A;  3UGO A;  1JPJ A;  4ZLC A;  4ULW A;  4QDL A;  4U5G A;  3LJB A;  2MYS A;  1FFH A;  1LS1 A;  2L9J A;  3MLG A;  2YEV A;  2J9U A;  4I44 A;  5KYN A;  3CSK A;  2G62 A;  3KL4 A;  2O9X A;  4PFO A;  1OCC C;  4GEH A;  3DJU B;  2J0X A;  4PJM A;  4U5H A;  2E87 A;  4ZLD A;  4MND A;  5T1D B;  1D1A A;  2C04 A;  4CS8 A;  2CGE A;  4DBR A;  4IRU A;  3EGX B;  4YT8 A;  5HSW A;  2H7V C;  3FHD A;  1TWH A;  3F46 A;  2VAS A;  1FMW A;  2WL8 A;  4N06 A;  2ZXR A;  4FX5 A;  3ASN C;  3SEO A;  4CS9 A;  4CSA C;  2IXO A;  3B9Q A;  1OCO C;  5DS6 A;  4LLE A;  5CI9 A;  4A2N B;  2R7X A;  1PD1 A;  3DM9 B;  3AQC A;  2JD3 A;  1OCZ C;  3EGX A;  4O6M A;  3I5Q A;  4J32 B;  4X0R A;  2Y3G A;  4O6Y A;  2DGJ A;  4KBL A;  5L3Q A;  2PFD A;  2Q9C A;  2XSE A;  3N0T A;  5T3T A;  3E70 C;  3LS0 A;  3W8H A;  3QZC A;  4G7O F;  3AG4 C;  3RH3 A;  3V7O A;  3ITF A;  2IOQ A;  3DD7 A;  2I8B A;  1VMA A;  3HTK C;  4HFK B;  3NRH A;  2DYR C;  4OIN F;  1TR2 A;  4OIO F;  3NDB B;  2PX3 A;  3AG1 C;  2H7B A;  4BJ1 A;  3K33 A;  4PJJ A;  3EH1 A;  5KYW B;  4KI2 A;  4JVS A;  1PD0 A;  1S7Z A;  1ZHW A;  1ST6 A;  1BR4 A;  2NUP B;  4YN0 B;  4E7Z A;  2Q3T A;  4BJ5 C;  3B0P A;  2FFH A;  3RKO F;  4U5B E;  4G7H F;  2J45 A;  4BEJ A;  3KKB A;  1Z5Z A;  2PX0 A;  1D0Z A;  3UMH A;  1BR1 A;  4U5E E;  1SF8 A;  5KYW A;  3T6J A;  4FES A;  2KNH A;  1JPN A;  3W2V A;  2WVO A;  2HV6 A;  5F5H A;  1Z3I X;  2L81 A;  1M2V A;  2NUP A;  2ZPA A;  4W8K A;  3ZG1 A;  5EHH A;  4OIR F;  3MX3 A;  4C7O B;  1ZYR F;  5E3C A;  3SZR A;  3PMR A;  3ASO C;  4OIQ F;  4EWC A;  4K7B A;  3QMK A;  4JJG A;  2Y39 A;  1TKN A;  3T4R A;  4CS8 C;  4HFF B;  4PK4 A;  3JRT A;  4O7G A;  3DZA A;  3LLI A;  3JYH A;  2WZL A;  3L0I A;  3DMD A;  3S27 A;  4C7O A;  4E7S A;  2EIK C;  4CS9 C;  4KC9 A;  2M4E A;  1M2O A;  4O6N A;  3HJC A;  3CQZ A;  3F47 A;  2A69 F;  4IJJ A;  4I1M A;  1LKX A;  3ABK C;  4OD4 A;  2LSE A;  3FAJ A;  4HE8 D;  1MND A;  2R7T A;  4GYT A;  3ABL C;  4XTK A;  3RFY A;  3SP1 A;  4M63 A;  1O87 A;  3N2Z B;  2Y69 C;  3K1H A;  5DLJ A;  1Z23 A;  4LAC B;  3EZI A;  2PP4 A;  3NYJ A;  4MQ9 F;  2EIN C;  3ZIB A;  3N24 A;  4LLC A;  1MMG A;  3UNG C;  2R7V A;  1FFT C;  1VK5 A;  5KYX B;  2WB7 A;  2D5R B;  3O39 A;  2Y3B A;  2CW0 F;  4Q5S F;  1KU2 A;  3M1C B;  1IW7 F;  3AG3 C;  4JJF A;  2W4B A;  2A68 F;  3LAY A;  2QY9 A;  4QI0 A;  3ABM C;  2H7O A;  2KGO A;  2IYL D;  2A6H F;  4H4K C;  2BE5 F;  4OD5 A;  4AE4 B;  4DVY P;  4DBQ A;  3K6B A;  2XXA B;  4JZA A;  3POV A;  3KH2 A;  5KYX A;  1D0Y A;  5E2Q A;  4XWJ A;  2CDQ A;  2J46 A;  3EJN A;  1RJ9 B;  2Y3H A;  3UR3 C;  2NG1 A;  4C3D A;  1Z63 A;  5DQT A;  3JCU Q;  4Q4Z F;  2VB6 A;  3HLZ A;  3NYM A;  3EG9 B;  1VYK A;  3I4U A;  3UMI A;  4YJW A;  4AE4 A;  2WZG A;  3O6X A;  2EIJ C;  2V3C C;  4K0D A;  1ZHT A;  3EPV A;  5D91 A;  5FCL A;  2XXA A;  1J8Y F;  1VOM A;  1N1C A;  3K7D A;  2Z15 A;  3JSZ A;  3FDQ A;  2R7R A;  5D92 A;  2IXN A;  1M56 C;  1D0X A;  3EG9 A;  4PJL A;  1FMV A;  4DOZ A;  1BR2 A;  3NKE A;  3AQB A;  3E9V A;  1V55 C;  4U5D E;  1MNE A;  1IZM A;  3OWT A;  3I5P A;  4RBN A;  3GOD A;  2ZXO A;  3VYW A;  4C3B A;  2R7Q A;  3SNH A;  4AX2 A;  1ZU5 A;  2J9V A;  3WG7 C;  1FTS A;  4RDA A;  3GAN A;  4J30 B;  3UGP A;  4YT5 A;  3ECS A;  1TWC A;  1NZE A;  4P6I C;  3EZH A;  3Q7L A;  3X1O A;  4BJ5 A;  4EBB A;  4KNW A;  3WOD F;  2W9Y A;  3ZVR A;  5B3S C;  2ZXW C;  2J9W A;  4C3E A;  4YT4 A;  2QTV A;  3ZC4 A;  2NUT B;  2IXM A;  1NU9 C;  2YZS A;  1SMY F;  3JT1 A;  3H65 A;  4KNV A;  4CBE A;  4YT2 A;  3EGD B;  4U5F E;  4Q7C A;  2VH3 A;  3IEE A;  2MWQ A;  3ZSU A;  3FVY A;  3CZ6 A;  2G3K A;  3B0U X;  3W2W A;  3KMI A;  3Q6N A;  1D1B A;  2R7O A;  2EIL C;  1MMA A;  4JW1 A;  2IXP A;  4I3M A;  1QLE C;  3S29 A;  4BJ6 A;  2C03 A;  1M57 C;  4DVZ A;  1W2W A;  1NU7 D;  5DS4 A;  2NUT A;  4HEA J;  1Z6A A;  4B6I A;  3LLK A;  4I1O B;  3EGD A;  2R7U A;  3DXJ F;  2CNW A;  2XL4 A;  3X2Q C;  3EHM A;  5BUO A;  4XLN F;  4PFP A;  1J8M F;  2W45 A;  1LVK A;  2A6E F;  3DAG A;  4XLP F;  3OEO A;  4IAO A;  1PCX A;  2Y3D A;  4YWQ A;  5B1A C;  4G0H A;  1MMN A;  5EGY A;  2WVQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...