2OJED

Mycoplasma arthritidis-derived mitogen complexed with class ii mhc molecule hla-dr1/ha complex in the presence of edta
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
214
structure length
214
Chain Sequence
SMKLRVENPKKAQKHFVQNLNNVVFTNKELEDIYNLSNKEETKEVLKLFKLKVNQFYRHAFGIVNDYNGLLEYKEIFNMMFLKLSVVFDTQRKEANNVEQIKRNIAILDEIMAKADNDLSYFISQNKNFQELWDKAVKLTKEMKIKLKGQKLDLRDGEVAINKVRELFGSDKNVKELWWFRSLLVKGVYLIKRYYEGDIELKTTSDFAKAVFED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Zinc induces dimerization of the class II major histocompatibility complex molecule that leads to cooperative binding to a superantigen.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain prec
total genus 81
structure length 214
sequence length 214
chains with identical sequence H
ec nomenclature
pdb deposition date 2007-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF09245 MA-Mit Mycoplasma arthritidis-derived mitogen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.530 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A mam-mhc complex, Chain D, Domain 2 2ojeD02
1.20.120.390 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hla class ii histocompatibility antigen, dr alpha chain. Chain D, domain 1 2ojeD01
1R5ID 3KPHA 2OJED 2ICWG
chains in the Genus database with same CATH superfamily
3S14J 3F46A 3PNYA 5BQHA 5HS8A 3FOPA 3CCSI 1XWJA 2NPUA 2CNWD 4YFKF 2DLLA 1U8BA 1AVOB 1J0RA 3EUHA 4XKVA 1JKQC 2WB1N 4D7NA 5HODA 3M4OJ 1HE9A 1KNYA 2OOCA 5D92A 1XDUA 4EJTA 5LHGA 2LY2A 3MMYB 2ZKZA 5H6RA 2EFPA 2DK8A 5KYXB 5HDKA 2KZGA 4OD4A 1OCOH 3S1QJ 2XB5A 4I99C 3KYLA 1YIJI 5JR3A 4NDLA 1R6RA 4RM2A 1USTA 4KICA 1FFTC 4HEA2 5KCMA 4C2MJ 3J06A 2UUHA 4U5FE 2ETSA 5JRAA 2R05A 3A11A 1FY7A 2D1HA 2V9KA 3K7AJ 5M3MJ 2MC3A 4NBQA 2WV0A 3U8PA 2G3VA 2EPFA 3B29A 4GYTA 5J47A 2HWVA 2AP3A 4XKWA 2XKOA 1BW5A 2WC2A 2RNJA 2XRLA 4JX6A 2CRGA 1KQ0A 1ZHTA 1FSEA 3MKWB 3FHDA 2EINH 2GWRA 2HI3A 4FTHA 3ZMTA 1T33A 2CW8A 5LHIA 2FMYA 3VYRB 2JJ7A 3HC7A 4M6VA 5EG0B 1ZREA 3CESA 3CCMI 4NQFA 4RLQA 1E17A 5TGTA 3IH2A 2Q4FA 3CMAI 4E7IA 1JT6A 2F5EA 2RQPA 4O6MA 2XASA 3CUQC 1RKEA 1F4KA 3LA3A 2EH3A 1K04A 3JSEO 5A6BD 2J8WA 4CCOA 3L9FA 3D5SC 3IP4B 1ERDA 2OBPA 3ZR8X 1OCRC 1IV6A 1FTTA 1M1EB 4U5BE 1HF0A 2L4AA 1Z5ZA 3GUDA 2JA2A 2DTRA 2VPLA 3JRDA 1DQUA 3HGGA 1YA7O 2LFFA 4RGSA 4O79A 4QTRA 3A01A 2GA1A 4UDVA 4WXCA 4MEXF 3T6JA 1PUFB 4XEFA 4L18B 4DOZA 2QSHX 1KTMA 1JMWA 2VIXA 4DNCA 1A04A 3HRSA 3HNKA 1EA8A 4BG0A 3T8TA 4E7HA 5E8GA 2K02A 3P5JA 2R7XA 4ZZLA 5IP6A 2MC4A 2KFDA 4BXUA 2M4EA 3U0CA 3AG4H 3MCZA 2MD5A 4MNUA 4X0RA 3TO6A 1P7JA 4Y13A 4YG2F 1I50J 2BY0A 2GOXB 2AQFA 2EIMH 3ASNC 1BZ4A 5JLIA 2DA4A 4ESBA 4L5IA 1Q0MA 2WVOA 3QPHA 2L2OA 3LL7A 1LEAA 3BR1A 4N6HA 2OKUA 3TBIA 3HG9A 3W2VA 3J81Z 3HNLA 1QNTA 2XAFA 5D8KB 2EWNA 1UB9A 2JMWA 2ZMEB 5L3GA 2GXBA 5A6KA 2CCYA 4XPXA 1LE4A 4CYCB 2IPQX 2ADUA 1TBXA 2LF7A 4Q47A 4A3CJ 4QI0A 1IN5A 2R7DA 3ISPA 3OWTA 4MTEA 3EUAA 3TDUC 2GFHA 2CQ7A 2W82A 3BZKA 2R7WA 3OIPA 2R7SA 3SZGA 2YU3A 2X6WA 4M71A 3S2WA 3V7RA 4A0YA 4GFBA 3OIOA 3RQIA 1VQ9I 3RDIA 2D2WA 4XIDA 2J0WA 2R7UA 2ZXWC 5KYUB 3BR5A 3ATPA 4A3FJ 3BG7A 3GM2A 5E79C 3ELKA 2VBWA 3BR0A 3SYNA 2WAFA 3FOOA 3LSKA 4MTFA 4B8XA 2E2JJ 3RQ4A 4B09A 1UELB 4G78A 1FYLA 2PEXA 5H2FC 1HMOA 3RYPA 5E2QA 4M72A 4G8XA 4G7ZF 1N75A 1SD7A 1XMXA 3S32A 1YHQI 2CDQA 3ITFA 3W2AA 4DGWB 3TP3A 1FAPB 3FMQA 1R1TA 2F6CA 2L01A 2PG4A 3HSFA 5AONA 2HJMA 1Y1WJ 1JKOC 1J8YF 1JJ8C 2KIUA 4OOIA 1OJLA 1U5TB 1EKYA 5LGNA 5FLXZ 2Z3YA 4DQ2A 4U5CE 2DO7A 3ABKH 2P0NA 4UXNA 4LD5A 2R4GA 4DYRA 2DN0A 2KKOA 3PSFA 3J7YJ 4A3KJ 2Z2SB 1R4NB 1OXKA 4C3HJ 3S27A 3QAHA 1NK2P 4JE9A 3AFHA 1VQLI 4LG0A 3OYNA 5ILVA 4AIHA 2P7VB 1VB5A 3LSIA 1PCXA 2RV8A 1T5OA 1ULYA 1OFCX 1FSHA 2KIQA 1ACIA 2L54A 1FLIA 1MJ9A 1QHHD 5EGOA 2VCBA 3GZNB 2HV7A 2EV5A 2XAHA 3E6CC 1VZ0A 2HGCA 3S2HJ 3OOUA 4HSTA 2YLGA 5D5UB 3BJ6A 3T9OA 3S3MA 4FCYA 1TWFJ 3CZ6A 3DQVC 2HS5A 1W7PB 1RESA 2GBYA 2K9SA 2ZXRA 3ABMC 2OQMA 1S7EA 1ZLJA 2OC6A 2P8TA 2ESHA 2W7NA 3TK0A 2VE8A 4ESJA 1VQKI 4CDAA 2HOEA 5LLQA 1QVXA 3H0GJ 4ZH4F 3LLIA 1X19A 3E1SA 1WJDA 3B0PA 2YX4A 3BTCA 3HIFA 2DYSC 2H6BA 5CKTA 3FISA 4A93J 2MH9A 3NAUA 4M6YA 2EJRA 4J00A 2H7OA 3FAJA 3HPGA 2Y3DA 4NTBA 1UZCA 2MH2A 3IKTA 5JSLA 3O55A 3FXQA 4XRSG 1ZHYA 1Y1VJ 1RKEB 2LIGA 3FXHA 2OCCH 2BHZA 3QYFA 2BL2A 1Z6AA 4J7TA 3V5YA 4ENMA 4KA4A 3NMIA 2E1NA 3R4KA 3FXRA 2VUMJ 3MLGA 2X85A 5BUOA 1MBGA 2DA7A 5EG0A 3R0JA 1EA3A 1W5TA 1QZYA 2LKPA 2MGQA 2VXZA 3BPVA 2XF7A 1IN7A 2Y3HA 4L0YB 2AXLA 2R03A 2ZBKA 2O03A 3BCAA 5J40A 3RYRA 3SFZA 3HKZA 1FEXA 3SDBA 3CC4I 5F5HA 3FXUA 2GOMA 4I6ZA 2IS2A 2DDAA 3GODA 3RVYA 1YE9A 4EBJA 1STZA 3QOPA 4G7HF 1HKQA 5A6BA 3F8CA 2ZMEA 4KISA 4LK1F 1RKWA 3S8PA 3FM5A 3WGHA 1YLFA 3ZMDA 3H0DA 4ZLDA 3DKXA 2H27A 5E3MA 1MBEA 2DDBA 2GQQA 5DEQA 3W3CA 1OR2A 3U9JA 4EIYA 1XZPA 3SZRA 1BI1A 1RUOA 5DDGA 1O3SA 4A3DJ 3ZQ7A 1ZW2A 1D5VA 1B8IA 4K7BA 1XGSA 3CP2A 1CGOA 3GTPJ 2ELKA 3GTOJ 2VJJA 1JRAA 2G62A 4YN0B 4I09A 3IH4A 1RRJA 1TT5B 2ZFWA 3WU0A 2FA5A 1RUNA 1APCA 3OYKA 3OY9A 2E2IJ 1BJAA 3J7AY 1W36C 1AOYA 1MZBA 3IKVA 4CYDA 1MD0A 3SEOA 1YA9A 2Q1ZB 5EGYA 4XR6A 5CJ9A 3OR2C 3MN2A 1PUFA 3M8EA 1K05A 3KETA 3WAQA 4YL0A 1K79A 1EI7A 1K83J 2EQRA 3D5RC 5JVTA 1R9TJ 3I4MJ 2E1MB 3WG7C 3ZIBA 3VWBA 1XN7A 4NUBA 1X4PA 5D6FA 1MDMB 2LFDA 1C0WA 2J9VA 4RBNA 5L0JA 2QKLB 3BQYA 2L3DA 3N2ZB 2YQYA 4IRHA 3B02A 1NU7D 4KUMA 2E34A 1ORKA 2VC0A 2VOPA 1R4MB 1DGRM 3S1MJ 5CVRA 3VF0A 4MS2A 4JEAA 5CQEA 1WJEA 3JSOA 1MW7A 3M15A 2A61A 1MMDA 3F22A 4IAQA 3N0TA 3PCVA 2CV1A 4BEJA 2P5LC 2K9MA 1XC5A 2OTLI 4BU2A 2AHQA 1YLMA 3CQZJ 3DJNB 4X1EA 3VYWA 5M5XJ 3M07A 1E86A 4FHTA 1U78A 1KQ8A 2HVRA 2XAJA 5LEKA 3VB2A 5DCMB 3I9V2 2EILC 5EDNA 2PF4E 1NFNA 4ZYAA 2DJNA 3PFIA 4FX0A 3OS2A 2FU4A 4XLCA 4XLHA 3MZHA 3IUOA 1Z05A 3KYIA 4C3IJ 2HV6A 5JVEA 1ORSC 1X1AA 3D5LA 2XS8A 2X1CA 3AG3H 1OR7C 4BPMA 3A01B 4XQ1A 4IEJA 3KEQA 1D8JA 1KU7A 3QYBA 1T9KA 3LSTA 2R5ZA 4HDVA 1EKEA 2Q7RA 3PSIA 2V7FA 4P9UA 4OMYA 1TFKB 1ZN2A 3GM3A 2YPRA 5L0HA 2HXOA 2M0CA 5TJ5E 3TGNA 3QYEA 1XZQA 1Y0UA 2HKOA 3VRCA 2DFFA 3LMMA 1YS7A 2WB1A 4I01A 4B47A 3EGXB 4FX5A 2P5VA 2BOLA 2L6HA 3DD7A 1ZAOA 3FVYA 1HQCA 2BEOA 4F3QA 5L3FA 4YK5A 1FMVA 2XGEA 3VDXA 2CMPA 2IRFG 2R5YB 4ONSA 5FROA 2XL8A 4RB1A 4L9VA 1KGSA 2R7QA 2LKSA 1IN6A 2EFNA 2ME0A 1XDSA 3K6GA 3Q6MA 2W45A 3U9GA 4DBRA 3V42A 2WAQN 1Z0XA 3DTEA 4XMYA 3BRJA 4A6EA 4KITB 1IUYA 1BI0A 1MJBA 2R7OA 2XL4A 4KC9A 5HSWA 1W36D 3IHUA 1QQIA 2CU7A 3R7CA 4E18A 2P61A 1I39A 4XM3A 3RTRA 1XPXA 5GPCA 1EF4A 2K3PA 2ASRA 4HBLA 2NXNB 3B71A 3KP2A 3DWLE 5T1DB 3BROA 1OR3A 5JHFA 1UG0A 4IOCF 2ZC2A 2E71A 2OZUA 3DJUB 3HTUA 3JRGA 4LG0B 2DOAA 4A69C 2QSGX 2QZ8A 3WTWC 1ON1A 1SVOA 1Y39A 3N4MA 2NUTB 2IGKA 2Y9ZA 2Q00A 2YR2A 1KQ9A 2BXYA 4ZDLA 1S8NA 5E8IA 3CCVI 4CHUA 2VODA 1SD4A 1HY5A 3J7ZI 4CDVA 1U6HA 3IC7A 4YJWA 2FRHA 4BDYA 1VMAA 1M56C 2Q9BA 1FOXA 2F4IA 2V26A 2IYLD 1HA8A 4JJFA 4F4BA 4IHTA 1I6HJ 4BS9A 5E18F 3LJBA 1TTYA 1KONA 1BDJB 2GA0A 3M9AA 3JCUQ 2HYFA 5KVRA 1IDZA 2PNOA 4XPYA 4N9HA 1E3OC 3EG9B 1TW3A 3VYTB 1V5GA 2Q9AA 3E70C 3TEDA 1OMIA 2L0KA 3R60A 1ITYA 1IF1A 2NS8A 4MVQA 3K4NA 3L2UA 3LQRA 2DPUA 1VOMA 3KIOA 3KEYA 3KP4A 3AG2C 1K4SA 3L8JA 4W8PA 1CF7A 3BG5A 2LBFB 3LNRA 4B4CA 5D6EA 2X9DA 3Q0WA 3ULQB 3OYHA 3LNQA 4HDUA 4NHJA 1WGWA 3H3VK 3ROUA 3Q5FA 4KNYA 3WTUC 5IY5C 3U2LA 3LOCA 4OU0A 3VPRA 2YL1A 4ULVA 1V55H 4HNUA 4XKCA 3DU5A 1Q1VA 1XGNA 1ST6A 3GW2A 2PLYA 5FKLA 1X3UA 4PFOA 3PO2J 3K10A 2ID3A 3CCUI 2QBYB 1D0XA 4LITA 1T0FA 3BJOA 2XV4S 2KK1A 3KLOA 1HSJA 3KX2A 1T8IA 3CLQA 4B3AA 1HLVA 4XICA 3FMRA 2DFIA 2KDZA 1MJAA 1UAAA 2FUG2 3EZIA 3ZQQA 1YIOA 2QUFA 3MKZA 4AL0A 5BQIA 1HC8A 2HNHA 1EV7A 3DPTA 1GVDA 4ENJA 4WJ0A 4MIMA 1WWPA 1U9OA 5IY5H 3IRRA 3WGGA 3KH2A 1JUSA 4OWRB 1QU3A 1B1BA 2DT5A 4UUSB 1LDJA 2TDXA 4MEYF 1OKKA 3I4UA 4CS9A 3GEZA 4CCNA 3BT9A 1JKPC 5F0FA 5FKMA 3JSPA 3CUQA 1Q0GA 3GFMA 1TWCJ 4KN4X 2A6HF 2R7FA 3H9JA 2ZXHA 5KK1A 1IXRC 3M1CB 1FYMA 1U8RA 1B68A 4GGGA 3CF2A 3U1KA 5AIQA 4M9ZA 2F5DA 4NC3A 2COBA 2EZKA 4BDZA 3FHZA 1POGA 1YS6A 2BY1A 3K2AA 4JYKA 1ZG5A 4I0AA 4L9TA 3G4SI 1RKTA 5BOXA 1IN8A 1K78B 4AIJA 2XM4A 2VPRA 3A0HC 4JX5A 5DQZA 2XHKA 4LLNA 1BIBA 3LSMA 3S2DJ 3JRBA 2E5NA 1F36A 3Q7GA 1G3WA 3HHGA 3I55I 2D5VA 1QQ3A 4JJGA 1RJ9B 4IQ4A 1B9NA 4LB6B 1G59A 1DOWA 1SD6A 5ILUA 3UNGC 3SZPA 4BXFA 2DJIA 2E36A 4MW8A 1ZHXA 3ZMUA 2DMUA 2WY8Q 4HQMA 3S3OA 3L00A 5BPIA 4RM3A 3NARA 2V4JC 4JCHA 4YT2A 4YWQA 3BPXA 3SNHA 1SC7A 3JTHA 2DI3A 3QRFF 2J0XA 2YZSA 4WABA 1VI0A 2J5PA 4XEKA 1MBKA 1O3QA 1O5HA 5FFZA 2X0CA 4HF1A 2Y0SN 1SFUA 5DS5A 3IQ6A 2VONA 2NVQJ 5D4RA 3ZDLA 3DMDA 1U3EM 1WTYA 2NOGA 2W00A 3SZTA 1EH6A 4BQOA 1ZH5A 4UHTA 1O3UA 3LWFA 4PJLA 3U9MA 3WTTC 2NUPA 2K4JA 5DCFA 4ZDPA 4JX4A 2DFEA 1G4DA 3EGDB 1TWAA 1FBUA 3ECOA 3ERED 3EFOB 3QPLA 5L0DA 2AXTC 1BR4A 3WGIA 2XSEA 3KZZA 4ZTJA 5F5FA 4FESA 4D5FA 4MNDA 3ZN1A 4WK8F 4FX4A 4Z9JA 2M34A 1H9GA 2KMUA 2EZLA 3BR6A 4U7BA 1LNWA 2OAZA 3WTSC 1VQ6I 5B3SH 1QZXA 3IWFA 2XLVA 3M79A 3G71I 2FQ3A 2WZLA 3IQTA 1UJ8A 5ERIA 4QIWN 3OL3A 3VAYA 2QLZA 4Y33A 4CCKA 3PIPF 3ABMH 4M74A 3DAGA 1AKHA 4XONA 3DLLF 3CDHA 3LEVA 3V8KA 2A5YB 1VQNI 2LLKA 5T3TA 2OQGA 4ESFA 2VKDA 4A5MA 3AG3C 3E0JB 1B72B 2O5RA 3GANA 2HZ8A 4JQFA 1F1ZA 4U87A 4BJ1A 3HOSA 5EZHA 3R61A 1HKSA 3PIOF 3F6OA 4MTOA 1RIOH 3S16J 3CO7C 5T3WA 2EILH 4AK9A 2ICWG 2V1XA 4A4AA 2HTSA 2CYYA 2QQ8A 1G3SA 2HMZA 4DVYP 1Z77A 4XLEA 1TQGA 4NTAA 2KT0A 4L5JA 3PMRA 4MLOA 5FLMJ 2JA6J 4N0BA 4HE8D 5M5YJ 1Z1DA 3W8HA 3S84A 4MVSA 3L09A 1A0BA 2CUZA 3QWLA 4LFUA 3T5XA 5J4VA 2H6CA 2XLDA 4IWBA 2QKMB 3ZC4A 1AHDP 4E0HA 1T01A 1NH3A 1PD1A 3A4CA 2C6YA 2JWTA 3LAPA 2LSOA 3F8FA 4RAZA 5CVUA 1SF8A 2L6GA 2FEZA 3TW6A 1S29A 2YEVA 4YEJA 1R23A 2KJBA 1YW8A 4BUPA 1LI5A 2OV7A 2XKPA 1XGOA 1LDDA 1BOBA 1WJBA 3GLLA 5LHHA 2OQRA 1V54C 3NRHA 1U0BB 3CMEI 1X3ZB 4BBRJ 2HDDA 5K7ZA 4H0EA 4JTAB 3ONQA 1FOYA 3H65A 2HSQA 2EFQA 3GXOA 3MAJA 3V4GA 5IYCJ 2XIGA 1J5YA 3PUFA 4BGDA 1J75A 1U6GA 4G7OF 5C4XJ 4MHGA 1FTSA 3LFKA 1YZAA 2ELHA 3I4NJ 2BBYA 2WAQA 1V74B 4E6KG 4AU7A 1BW6A 4FASD 3GX4X 4JKVA 3LSPA 5IYDJ 3G4XA 3OYJA 5CPRB 2Y48A 4W97A 1RKCA 5ICGA 3GTKJ 2LREA 3DKYA 5HLHA 4JTDB 4UNOA 3L1PA 4Z6YA 1UFBA 4HYEA 1A7VA 1R7JA 2L9RA 1QZZA 3OIQA 2HKVA 2FD5A 4NCQA 1VK5A 3GZ5A 4XKBA 3T6GB 3MD2A 4BJ6C 2NSFA 2HUJA 1OCCC 4BAYA 4HV5A 4BEHA 3K66A 2YUSA 1QVTA 9ANTA 2JA5J 3IAM2 2E5ZA 2K3FA 1J09A 2EPLX 4UVAA 3DPLC 1HW1A 1CGPA 1WATA 3OEOA 4XORA 5DD8A 5HLTA 4DJ9A 2EV0A 1LB2A 1NZEA 1ORYA 4IHWA 1J2XA 3I5PA 2ZXIA 2L4MA 3MQ0A 2XROA 3AKZA 5L0GA 4B6IA 4LGWA 2EA4A 4G9YA 1ZYRF 3RZDJ 4A3LJ 4M3DA 1W2WA 2XGCA 4U5EE 2OJED 4C3DA 5FZTA 3G3ZA 4LMYA 5FKNA 2F5VA 5KAFC 2MG4A 1CPQA 2NUPB 2RREA 1IO2A 4RB3C 5BS6A 3IL2A 1CGME 4RAFA 3BQZA 1RMVA 4AX2A 5JUAA 1E85A 1RCPA 2XUBA 4IKFA 3HXLA 4E70A 2J7PA 2XLWA 2XLEA 1R71A 3C8GA 4PACA 2KYHA 3CCJI 3S1RJ 1QKRA 3CD6I 5JP7A 3LA2A 3KMIA 2MBFA 3TOMA 3QPTA 2HPIA 3PNVA 3KZIC 2AWCA 4AL1A 4MVMA 1Z3IX 4Y4RA 1X1BA 1R58A 3JRAA 5KYXA 2VCCA 4PGHA 1FZPB 5F27A 2X6OA 3QP5A 2H7BA 1IW7F 2B0LA 1A7EA 5FLXK 4XN3A 4IRGA 2XLHA 2BW3A 2KLOA 4XQFA 3DKAA 3SEQA 2OEXA 4QSHA 5B3IA 2HQNA 4JOMA 4D5CA 4E7KA 1RJ9A 5LRRA 3FK6A 2MSYA 5COMA 3O3KA 4CDGA 2CQNA 1ZRDA 2L9SA 5EJCA 1YO5C 5BNGA 3S17J 2J9UA 1XSXA 1XX5A 1RETA 4LLGF 2DQLA 4XBFA 3OYLA 2GAQA 2NVUB 4MVZA 1E84A 2M45A 1X4OA 2HYJA 3C2GA 3Q9SA 3RIPA 3FXMA 4RGUA 4QI2A 3HSEA 2H1KA 3X2QH 2E1MC 2XRNA 3K1IA 2CUFA 4KIBA 1OLTA 3ZTZA 4TV7A 2JT1A 2Y3GA 4XTKA 1BA5A 3G1LA 2VKEA 5DYMA 3EG9A 2DA6A 3CJNA 1X1CA 1SFEA 3I59B 3KPHA 3M1CA 5H20A 4U5DE 1A31A 1IXCA 2VQLA 2JPBA 3ZN0A 4U5HA 1ZRFA 1VQ7I 2XS1A 4U9DA 3W6KB 4BJ5A 2KC3A 2K4BA 5TJJA 1YAUO 2XVCA 3L8IA 3W8IA 2JVHA 4YRVA 3GWZA 4B48A 1TT0A 1JUPA 1ETXA 2JK3A 4NB5A 3UKGA 2VN2A 4KDPA 3V5XA 2D1VA 2O8KA 2M2EA 4K1OA 3JAMZ 2GA2A 4CA0A 5A2QZ 2H7VC 2Y39A 1W0TA 2OU6A 3MFKA 2HR3A 2B63J 4JP0A 4LG3A 3W2WA 4HLYA 4E7JA 4GQHA 2EPOA 4RAYA 4ZC3A 4MFEA 5B66C 5ICCA 5M5WJ 2EFOA 1SFOJ 5GAGJ 2W1OA 1ZLKA 3AGUA 2K40A 2KZVA 2R7ZJ 3HOUJ 3PL8A 2QBYA 1Y6IA 2LOOA 4IHXA 2A6TA 4A3IJ 2LK2A 4CDYA 4J30B 5B3SC 2F4OB 4XRFA 2QLAA 3ZPLA 4CS9C 1IGNA 1MNMC 3RKYA 1OKKD 2EPKX 1EQ1A 3C62A 3AG1H 4CZCA 1AWCA 1IN4A 1WHUA 3HTKC 3T8RA 2VKVA 4UB8C 3OYDA 4YIFA 1V4RA 2DMPA 4HOBA 3FXOA 2O9XA 4I02A 3RF3A 2HZDA 4HLXA 1ETWA 3GTQJ 3OYCA 3PQJA 3DM5A 1R4TA 3GF2A 1R00A 1MQVA 2IM8A 3L0IA 2ETHA 3Q6NA 2YRFA 5F1JA 1E3PA 1X58A 3ECHA 1L3LA 1BC7C 3LEOA 3M1EA 4LACB 2NSGA 2KRHA 1ZKGA 3ZG1A 3ZMZA 4CICA 5FKKA 2EIJC 5BPDA 4MVOA 1PUEE 1XTAA 1VLSA 4XOTA 4A2NB 1LUJB 1EH8A 2E19A 3WTVC 3ABUA 3M8FA 4DRHB 2CW0F 3K4BA 2IXPA 4G0HA 2DYRC 1XMAA 2XAGA 3LESA 5K5RA 2COMA 2P5KA 5C3EJ 1I3QJ 3WHCA 3L2QA 2VE9A 1I4ZA 1VYKA 3MYFA 3F3XA 4N4OB 2E1CA 4EKWA 2VL8A 2VBXA 3HRUA 2CO5A 1O4XA 4I1MA 2CWEA 1ENHA 2FXAA 2Q8KA 4F91B 4Q5SF 1KYZA 2LTPA 1L3PA 1YYVA 2K7LA 2IGNA 2H8AA 1BIAA 3GO5A 4Y52J 2NAZA 3ZP5A 4KYWA 5L3CA 1VLTA 3HNJA 4MW3A 4KI2A 5HNHA 1H89C 2AWYA 2CFOA 3AL0C 2W4BA 3E5QA 3MZYA 2Z9OA 3VODA 2HSBA 2L9JA 2W4MA 3JRCA 3DAFA 1HBXG 2CGEA 3N97A 1KA8A 5L3DA 2EZHA 2QQAA 5HOOA 1GV2A 2ISYA 3GFJA 3K1HA 3NMJA 3PM1A 2A69F 2HMQA 4K2EA 4S04A 3ZQIA 3JYYA 4HV6A 4XLNF 4DYCA 2XM0A 1SAXA 2WA0A 3CLOA 4C3EA 2HZTA 3DBLB 3EETA 2OUMA 4G12A 2IGMA 4E7ZA 4PDKA 3KCCA 1LI7A 1CF7B 4XLAA 1M2VA 2H1LA 3O6BB 4N9IA 1QPMA 2Z1DA 4IZZA 3GBGA 5M3FJ 3W6VA 3KYCB 3H1CA 1VQOI 3BTIA 1GXQA 4RA2A 5CIVA 2O3FA 5L0IA 2ZNZA 1WSUA 2VBZA 2HYGD 2LY1A 5JFRA 1VQMI 1T6QA 1J7KA 3DZAA 2BY2A 4ZJZA 3CQZA 5JS5A 4JW1A 1I1GA 3NQOA 4IL6C 3DE8A 3PJRA 1LIHA 2PI0A 3H2UA 4WXDA 2K27A 4H4KC 2LRDA 5DUKA 4UB6C 3L2VA 2CNWA 2ZJPF 4J32B 5COGA 4DW6A 1V55C 3I64A 4UUSA 3ERMA 2NRAC 3CSKA 1S7OA 4C9YA 3I3LA 5GP9A 2HVSA 5AGFA 1S7ZA 4E17A 3QPSA 5L3BA 4MVRA 4E7LA 5L3QA 3CCEI 1GLNA 4DIQA 1B8IB 4U9EA 3NMKA 4LOCA 2A1DD 1EH7A 5B5EC 3SP1A 2IA0A 3FDYA 2M7AA 2VJIA 3H92A 1W5CC 1MSFC 4MQ9F 1H9TA 4FE7A 4JBAA 1JGSA 4BQAA 5LGTA 1SFKA 4IXAA 1QSPA 2M3AA 4XSZF 2IBFA 5KYYA 3OSFA 3L34A 2MLGA 3I59A 3VEPA 4ETSA 2PMZN 2X48A 2OPTA 5C44J 1Z67A 1HE1A 3HNIA 3S29A 1I6XA 4U7DA 1NU9C 3ZWIA 1R5GA 1M57C 2RAEA 3K70D 4IHVA 1FFHA 2A6EF 3F23A 4KBLA 3A03A 1LFBA 2ZCWA 2E60A 5EEHA 1C17M 4Q4ZF 2IA2A 3E5XA 1NLXA 1ZW3A 3JSZA 4MTDA 5IPAA 4XN0A 3OL4A 4Y15A 4BQQA 4D7MA 2JX0A 5E20A 2W9YA 3U21A 4HFFB 3CF5F 3E6DA 1K4TA 2EIKH 1JOGA 1VNDA 2PMUA 3C7JA 1UG7A 2DOFA 5HS7A 4FISA 3GFIA 2WBMA 3KZYA 1ETYA 4R1HA 4PR9A 3SYTA 1M2VB 4MGRA 1LVKA 3TQNA 4LDKA 5HDNA 1SMYF 3IRQA 4WGYA 4UUVA 3EGXA 3UMIA 2DYRH 1X1PA 2DU9A 3FKJA 1VQ4I 2HKXA 3G2BA 2CQKA 5E3CA 3WTYC 1P6RA 2X51A 3K7DA 1O7FA 4ENKA 4GO1A 1IAWA 3EYIA 1YRNA 4HZFA 3NYLA 1BJZA 2H09A 3OR1C 1WGXA 2ACJA 3TJ6A 1WH7A 1ZHWA 3IQCA 4EGZA 1BBYA 2G7HA 1MSEC 2O8XA 2X6YA 4ZDOA 2CG4A 2HQRA 4C30A 1WI9A 3RPQA 2Y69C 3C8GB 5E1ZB 4N4NB 3OS1A 1HW5A 2RDPA 4UV8A 2OCCC 2EA2A 1FNTc 1YVIA 3A1YA 3P9IA 1A7DA 2XAQA 2A68F 5BMZA 1IZ1A 4F93B 5B1AH 5ICEA 1ZQ3P 2PBEA 3RZOJ 4ZZDA 3UGPA 2XPUA 3NEUA 2MYSA 2DYSH 1YZCA 3RIRA 2STTA 2IW5A 2JQ7A 4OD5A 3O39A 2XSJC 4JURI 3DFGA 2LD5A 2PX0A 1I3AA 3TKYA 2QSFX 2YLDA 3C8GD 4O6YA 3OYGA 3S28A 1FP1D 2R25A 2BE5F 1LEBA 2CV2A 3K1IC 4W1UA 3CCYA 3OS0A 5EEAA 4J01A 5DUIA 3B9QA 4X6AJ 1LQ1A 2CYDA 3I56I 1TWHA 2KISA 3CC2I 3FDQA 1MKMA 1FR0A 5CLSA 3O8HA 4B1RA 3IEEA 3ASOC 4M63A 3D0SA 3K9TA 4H54A 4IAOA 5BQGA 3UGOA 4BY1J 3JR9A 1HXDA 2BXZA 4OIPF 3ZVRA 1NG6A 2BY3A 2B9SA 3KP6A 2KSFA 1JR8A 2L81A 2ZJRF 2WB7A 2FJ1A 4LLCA 4ULWA 4XWJA 5DQTA 2JSCA 3GTLJ 4EMSA 2C04A 1JKRC 3M4BA 2BHYA 4LB5A 1KU9A 2DA1A 4KIFA 2JA7J 3AGTA 3ZTMA 1NSGB 5GPGB 3Q0UA 5LFAA 1KU2A 3BZ6A 2F4MB 1D1BA 5CI8A 3WE2A 1R49A 1H6GA 1P7IA 1A6QA 1YQAA 2K9QA 3HKZN 2DPDA 4IPAA 4E0IA 1OYWA 2YU9J 4PJJA 1FNNA 1RXQA 3L1MA 5L0CA 1BM9A 5EYRA 5JLWA 4BE2A 4PGGA 1S6LA 2J9WA 2FE3A 2ME6A 3LSHA 1T95A 3S1NJ 3SFIA 4L5EA 5F0HA 4CH7A 2IJLA 3CDLA 2PX9A 4AM3A 2LQGA 5DCMA 4JZAA 5CVJA 3RQFA 1WKMA 3HM5A 5IYBJ 1RR8C 5CVIA 1SD5A 4YIRX 1Y0NA 1FBQA 1XB4A 3OYEA 1S9HA 2H94A 2KHMA 2PFBA 4M6XA 3T1BA 3TP0A 1FTZA 3QVYA 2V3CC 3BTLA 5GADJ 1MH4A 4PJMA 2PN6A 3COAC 1HDDC 4S0HB 3H35A 3HHHA 4LDRA 2W85A 2VKHA 2MFZA 2Y2ZA 5E1WA 3ZMSA 3IV5A 2AU5A 2LK4A 1W4MA 2P6VA 2A05A 2IOQA 2YS9A 2X1EA 2H8WA 4A0XA 3JCUC 3ZQGA 3KE2A 3M3YJ 3U2RA 4I44A 3PFYA 4IO9F 3BCBA 1W1WE 4BHPA 4K0DA 2Y0MA 3ABLC 3DP7A 4DZPA 3GVAA 1LFPA 1WJAA 1WVRA 3U1DA 3H3UA 4GDFA 5FD6A 3R0AA 3L2RA 2KIFA 1ZG1A 3S90A 2PQ8A 3V8LA 1DOVA 1ZHZA 4RGRA 1AEPA 2D5RB 2EIMC 4WX9A 2PBIA 4O5VA 5CYVA 2XB0X 1YTYA 3FM3A 2A3SA 1S5LC 2CSOA 2IVMA 3KYDB 1YI2I 3WE3A 3K4JA 2DMQA 2Y0SA 1YITI 1A35A 2HFIA 2K9LA 2E1OA 2GM4A 3J80K 3P9CA 1Z91A 2MD0A 1N25A 2L9VA 2WZGA 3BP8A 3U2MA 2BVMA 1JI8A 5EK0A 1T6SA 1GQAA 1OYYA 3SJMA 2YLIA 4XK4A 1AU7A 3H36A 1FPQA 3MYIA 4AVZA 2XDVA 3T0YA 3SXZA 4FWVA 3E3VA 4DJAA 1FX7A 2LD6A 2P0WA 3DEUA 4EM1A 1NHAA 2FOWA 4WGZA 1ETQA 4A2UA 4JC7A 5JI6A 4EVIA 4BNCA 1FT9A 1B9MA 4E7SA 4IF4A 1ZGWA 2JPUA 1VF9A 1Z3YA 1T6IA 3LFUA 5DS4A 1T38A 3FWEA 4G94A 3JRMO 3TD7A 1YFHA 3DF8A 2QENA 4RB2C 5A6JA 3K4CA 1JTYA 2VCAA 3E97A 5F6FA 1E83A 3HRTA 4WXHA 3RSNA 3IH3A 1ZG3A 2CH0A 1GDTA 5DS9A 3RPUA 2P1AA 3KEOA 3NWSA 1QO0D 1TWHJ 2LP0A 3EQLF 3RPUD 4CSWA 1G5ZA 4J7YA 4PZJA 1I5NA 2LCHA 4AE4A 3JYHA 1T98A 3H5NA 2IT0A 3WTXC 3CJRB 2R5YA 4AIKA 1VTNC 1H0MA 1VQPI 1H7IA 4A3MJ 3SDGA 1MGTA 3ABLH 2VOOA 1LJ9A 1TQPA 4EV0A 1DPRA 2ECCA 4KMUX 3CCLI 2YVKA 3MX3A 3TOLA 1TR2A 2DGJA 1WQ2A 3EHNA 4L6RA 5L3VA 1PD0A 3OSGA 4I3MA 4ENNA 1BBHA 1P4WA 1OXBA 1RNLA 5KYUA 5ILSA 1LS4A 1OCOC 3K4KA 1G3TA 3I0TA 4P9TA 4U0YA 4ON0A 4KMFA 4KNWA 2ZXJA 3CJTB 4I2OA 4BE0A 4CXFA 3B0UX 2RNGA 3HLZA 2VJ5A 3ABKC 1ETVA 4L9JA 3BY6A 5E3LA 3A02A 3ML6A 4R79A 2ZJQF 2KJGA 3RYLA 1L0OC 1QPUA 3TULA 1XMKA 2HTJA 4HF0A 1QHGA 1X2MA 2P81A 3OV8A 1G8XA 5HLGA 1A5JA 4O7GA 2VH3A 4CJGA 2QVOA 4NNJA 2LC2A 3AOUA 1YJGA 4U0VA 5AC4A 2KP6A 3LA7A 3B6CA 3TW7A 5IP7J 5J8CA 1G3YA 4JRZA 4FQGA 1KYWA 1LVAA 2W4SA 3R2PA 5J1YA 4HA8A 2NVYJ 3BOQA 2UZKA 2VLAA 1ZU5A 2R0QC 2ZXWH 3SEZA 4RAGA 5HV9A 4KNVA 1GUUA 3J81K 3G1OA 2HOAA 3U3BA 1YRNB 2I15A 2HOTA 5KHDA 5LEJA 2H8RA 2JN6A 3RW0A 2BV6A 2ZJ2A 2V1UA 5E3OA 4N4WA 2GWWA 1T08B 2JZYA 2W48A 2VI6A 3MBGA 4PJ0C 2P6SA 3GEEA 5COFA 2AO9A 1IJWC 4HX8A 2LG4A 2E7XA 3QVZA 3DEWA 4V2FA 4A3EJ 3H3ZA 4YL3A 3LAJA 1K7AA 3E6MA 4II2A 2ZFUA 1YYJA 4II3A 3JRHA 1ORJA 3N05A 4GXOA 4BQNA 2LF8A 1Y56A 3T6BA 4AYBA 2ZXOA 3BG6A 2MABA 2E87A 3DXJF 1PP7U 3F8MA 3ASNH 4HRIA 3UMHA 2CS3A 4EATA 2O0YA 5HDGA 2ZO4A 3ZQCA 1UFMA 3BEHA 2FQ4A 5IOZA 4Q48A 3CMMA 1H8AC 3WODF 5F08A 3IQ5A 3VOEA 1Q0KA 2IP2A 4HEAJ 3ZQYA 2KRCA 3ZQHA 3B73A 5B1AC 2QGUA 1IZMA 3EUHC 2Q2EB 2VJ4A 3NYMA 4HX4A 5DVWA 1B6AA 1ZELA 2EBIA 5FB2A 1ZGAA 3V7OA 5B1BH 4XOPA 4V2GA 1X3WB 2PJRB 3BJAA 3CC7I 2M8EA 2NVTJ 4LIVA 2YL0A 4M3BA 1DPUA 1PJRA 2R93J 4EWCA 2L7ZA 1G6NA 1H88C 1PYVA 2KGOA 3GTGJ 2QYOA 4KIGA 2Q0OA 1VYIA 1ETKA 3LNMB 3KFWX 1OCRH 4BKXA 5JHUA 3HOZJ 1M2OA 2LP4A 3I71A 2ID6A 1T0FC 2XL6A 2MWQA 3Q7LA 4CGZA 2CGPA 1U9NA 4IJAA 2FBHA 4BL0B 3K1NA 4CS7A 3J80Z 1FOKA 2FBKA 1QBJA 2BGCA 1N77A 1TWCA 4EQQA 1YX5A 5EF6A 3LSGA 4X0GA 1D5YA 4RD9A 2L9NA 3Q3SA 4HNVA 5GTHC 4WCGA 3FF5A 3SXMA 4M3FA 3HOYJ 4JCZA 3ZCOA 2PX3A 5IOYA 3RFYA 5IP9J 5F64A 1J9IA 5TRDA 4QPQA 3GWLA 3DM9B 5IT9K 1WJ5A 2PP4A 3RJPA 4P55A 3KP7A 3BDDA 1Z9CA 2J7PD 3G4ZA 1O3TA 4OIOF 1SAUA 4YIIA 1GHCA 2JTVA 4QDLA 5J4YA 1PV3A 4BEMJ 3K4LA 2M8GX 4QWQA 5CVVA 4XLPF 2J9BA 3W4YA 1V5EA 2JRTA 4O6JA 5F04A 3AAFA 3RQEA 2K86A 3EHMA 2KNHA 1REPC 1U0JA 1SVMA 3G1MA 2I5UA 1MMSA 4CJOA 5CI9A 3REOA 3S93A 4IGGA 3FBIB 3K0LA 4WWCA 4BJ6A 2FNAA 4BY7J 3BTJA 1ZR4A 1XGMA 3EH1A 4I0BA 3HEFA 4Z2YA 3J7AO 1FYKA 1ZZPA 3HUGB 5ICFA 3C3WA 3KL4A 5LBQA 1ETOA 2ZSIB 5D8LB 3VM6A 1ZARA 4M73A 4HSRA 2B0JA 3C63A 4LK0F 5TISC 1FP2A 4D4NA 2O6GE 3S3NA 2Z5UA 2NS7A 3AJMA 1L7CA 3AG2H 2STWA 3EZHA 1X1DA 4U0WA 3I5QA 2LVSA 2G9WA 3I58A 3FMSA 3X1OA 4I7HA 2HEOA 2GXGA 3KKBA 1MIJA 2M30A 4RMNA 1FC3A 2L7MP 3W6JB 4C2TA 5HNFA 3CDIA 1BI3A 1WPKA 2MW8A 1G4US 2K85A 1Z7Qc 1JXSA 3TJ5A 3OA1A 2Z16A 256BA 4CCLA 4Y3OA 1V4AA 2WZFA 4P1WA 2XLOA 3QTHA 2DQRA 4ITVA 1WZ2A 4NC8A 1TWAJ 2FX0A 1TL8A 1SR2A 3MKYB 2HOSA 5EZGA 2VT3A 3I4PA 4F7ZA 5JLXA 2EB7A 3POVA 3LS0A 1MH3A 3JZ0A 3K1PA 2UV1A 3DV8A 3TL4X 3TMOA 4ZYEA 1UG2A 1K61A 1FMWA 2XRHA 3NG1A 1BR2A 3WHBA 4EJUA 4PFPA 3F72A 1QZEA 3L2WA 4PUSA 3FX3A 4NC6A 3QZCA 3C18A 2L6FA 3GYHX 4G6DA 2VT2A 1OW6A 4NY3A 4BH9A 2KPMA 1FWZA 5AC5A 1S3JA 2Y30A 5L3EA 3HL2A 4IJJA 4ZLCA 1B72A 3LQQA 5CQGA 1LPQA 2F48A 1HW2A 1IG7A 3I5UA 2DT6A 4MTGA 4LLLA 1IRXA 2JRMA 4IX7A 1NG1A 5F1RA 3DPUA 4HAMA 2LFBA 1OR7A 1F43A 4CCJA 4LDQA 3LUTB 2Z99A 1IUFA 3E6BA 5J8FA 3VYUB 1OCTC 5J6XA 1U89A 4BBSJ 2DA3A 3IWZA 3HOXJ 4RS8A 3JTGA 3VYSB 4BHBA 3CAXA 3FAPB 1SYQA 1K6OA 2ZSHB 2CFXA 1LDKB 2JSPA 3R6SA 2NS0A 1KU3A 3SQNA 1UHWA 1TQMA 2MLKA 4KN7X 2QA4I 4YT5A 3LSJA 5D5WB 4NQWA 4O3MA 1EJ9A 2FGYA 3DE9A 3U5SA 1QVUA 4MFDA 2EIJH 5DD4A 2RC4A 4EUKB 1BN5A 1ON2A 4AUXA 3DTIA 3LLKA 2Y9YA 1C03A 4I1OB 4Q7CA 2KRFA 5LGUA 4D9JA 5HVQC 1I4YA 2XAUA 1JE8A 1Q0DA 3PO3J 4ZYGA 1YX3A 3F47A 4YL1A 3VSKA 2QQ9A 4NC7A 4KT5C 4CCMA 2V6EA 3H9QA 4A3JJ 5FD5A 2PFDA 4QPOA 2TMVP 3RKXA 2GDCA 4F52A 2E7WA 1T39A 3E7LA 3BC8A 2UXNA 3HOTA 2FMLA 2XGXA 2PMZA 3HSRA 4HG2A 1DUXC 4EJWA 2CUEA 1IC8A 1VQ8I 2DAOA 3CMYA 2RGVA 3CCQI 5J1RA 2KDOA 3TQOA 2IS1A 3HZJA 2XC7A 1HCRA 3U8VA 2QQBA 2DA5A 2XF5A 3FKIJ 3QODA 3QU3A 4MQVA 2L7KA 4B3XA 3BR3A 3M7GA 2IA1A 4IHSA 1Y6DA 4XLFA 2BVLA 4ANJA 4A6DA 2WY7Q 5FRNA 4YT8A 2QM3A 1VTMP 3JRTA 2KQ9A 2YHSA 5FRMA 4D1QA 5DM7F 2BW3B 3SHFA 2HXIA 1Y8QB 2M0MA 2V1NA 4HPQA 4DXWA 5KYWB 3BWGA 2O61A 3HOWJ 1XSDA 3F8NA 1A6IA 4CIPA 2ISZA 3GMEA 2DCEA 3ZGKA 1W7PA 2M87A 3X2QC 3DBRB 2WADA 3MKLA 2FSWA 2R5ZB 1LFUP 3I53A 1GXPA 3H2VA 2M4GA 2XPWA 4FETA 3V7SA 1PVEA 5KAIC 1P9QC 2DBBA 6PAXA 1SVLA 4HNTA 4ZYHA 2CQXA 5IT9Z 2Q9CA 2I8BA 4RGXA 4P6IC 4N06A 1DU6A 2J45A 1M6TA 2DT7B 2GIVA 2ZXPA 2P7VA 3WHNA 5A6AA 2YWAA 3GCMA 4UVCA 5C4JJ 3WG7H 3FXJA 3FXKA 3SXYA 1QRYA 4G6TB 2M9HA 1LE8B 3U3FA 4JTCB 5F0CA 1LS1A 3RKWA 3JT1A 3RH3A 2V79A 4EM0B 2C03A 3ZOBA 2G7UA 3MVPA 3DCFA 4LJZF 3EJNA 2HVQA 2ESNA 1MNEA 5K5QA 1D3YA 3B6AA 3Q0VA 1RR7A 3ZQVA 1B4AA 1IDYA 1D0YA 1SANA 4CIHA 3G6EI 1OW7A 3PUBA 1NTCA 3DEEA 2A5WA 3M8JA 5J1UA 1OKRA 3LSRA 2LDUA 3HYIA 1JGGA 4EJVA 2R7VA 2J46A 3K70C 3AG4C 2OCEA 5DLJA 2ZNYA 1I27A 3H9GA 1VFCA 3HOVJ 4UY8I 4OIRF 3ABTA 3F21A 1X2NA 3JW4A 1WCMJ 2L02A 1MMAA 2XLMA 3CEXA 2ZD9A 1SFXA 2V6CA 4UUTA 2JA8J 4A3BJ 1GVJA 3US6A 1BC8C 1S7AA 2TCTA 3PQKA 1GGQA 5K5OA 3NYJA 2QWWA 2Y3BA 2FNPA 3EYYA 4IB4A 1RC9A 2P7CB 4XEVA 2UWMA 1P92A 1OCZH 3GEHA 3UMKA 1P4XA 2M7BA 4CSAC 3BG9A 4P5OA 3OMYA 2EPMX 5KYYB 4OAYA 4B43A 2CW7A 1Y8RB 1TQIA 4DYQA 5A69A 2YX7A 2KL4A 4O6NA 3NDBB 1OCCH 1O57A 5H6QA 1JJ6C 1TNTA 1FIPA 2L7FP 2DMTA 3QOEA 5B1BC 3CP8A 5DTDA 4D0PA 4E4HA 3C2BA 2VC1A 3QQAA 3P7NA 4G6QA 2QUPA 5A2QK 5F28E 1Z6TA 2AS5F 2AVKA 3E5UA 2NUTA 1I1SA 1U2WA 4PCQA 2XXAB 4RBOA 3V5ZA 1V3FA 4F92B 2AQEA 2NG1A 1LKXA 2WVNA 4EM2A 2O9LA 4Z9HA 1CQTA 4GCVA 3I54A 2E2HJ 1DDNA 3F6VA 2M64A 2EINC 5D91A 4DRIB 4DRJB 3PNTA 3DI5A 3F9KA 2OEVA 1A41A 4YELA 4OAZA 2WV1A 5K0IA 4CS8C 5J3LA 2HU9A 2HPMA 1HMDA 1P2FA 4XL9A 1ZVZA 3DTKA 2RKHA 1XCVA 4LERA 4A0ZA 1CGNA 1MBJA 2R02A 3C2HA 1XS9A 3AQBA 3MFNA 2XSDC 5FFXA 5KYWA 2ZB9A 4BHCA 5KYNA 1MNDA 3PHF2 2GAUA 2GLOA 2MA3A 4CS8A 1Z63A 3FHNA 1MMNA 2M4KA 5JVGF 1E2XA 4LIUA 3OYFA 4I76A 1TW2A 2X1DA 1GS9A 2WWYA 2DOEA 4IVNA 3L7WA 4BJTA 1HOMA 4EBBA 4N6CA 2GIZA 1JPNA 1WH5A 2K5CA 4XPWA 2QF7A 3O2PE 3K4MA 4JEBA 1V54H 1K78A 4CSAA 4XRSA 1V5FA 4BACA 3QMKA 2VB6A 3K69A 3L2CA 2FBIA 4YFXF 2NNNA 2BYVE 1YJ9I 1JPJA 4M9SA 4BE1A 1HKTA 4UVBA 2OJQA 1OCPA 2IS4A 2WAEA 2UUIA 4EBKA 2KJCA 2NVXJ 2EV6A 4OIQF 2OA4A 1ZR2A 4AC0A 3NWTA 4AE4B 3AL0B 1WN0A 1R5HA 5BQTA 4Y7NJ 1MBHA 3NKDA 1NBBA 3BLYA 4PSWA 2NNYA 2UXXA 2VQHA 1SZIA 2LR8A 1BR1A 2QCOA 2Z33A 2YSRA 3EPVA 5D5XB 1R36A 1S05A 3FXLA 1TFOB 3BZCA 1FJLA 2YL3A 1FIAA 3OYIA 3CCRI 4C2UA 3HB9A 1W0UA 3ZMVA 3LAYA 4XRMA 2VQGA 4QLCU 3CTAA 4HW0A 4CUGA 3OOPA 1JHHA 4OMZA 4YFNF 2OD5A 3WU2C 1F1MA 2LYCA 4EGYA 1A36A 3QW1A 2EFWA 3CUOA 1ZHFA 3JREA 1OQCA 3RQGA 2PJRA 5ED4A 4ER9A 3O8GA 1J8MF 1WRJA 2A0BA 4U88A 1GT0C 1Z23A 4M3GA 2WVQA 1E0EA 4BXXJ 4PSXA 3ZRGA 3GWNA 2JUCA 4HFKB 1NFOA 3DWWA 2VBYA 4EEFG 4L0ZB 3UR3C 4BEHB 2DA2A 1TC3C 2X4HA 4S05A 3EDPA 3M4CA 3ZSUA 3HRMA 1Z6RA 2JPCA 3K1MA 4HQEA 2W57A 1DGWY 1XCBA 2KW3C 4KFCA 4BYYA 1TNSA 3HTSB 3ECSA 2MHRA 3C8ZA 1W7PD 3N24A 1R22A 4ABZA 3HKKA 2JD3A 3WU1B 5L0FA 3FK7A 2Y69H 2E35A 3HJCA 3EPZA 3TOAA 1O3RA 3VFZA 4M9XA 3GZ6A 2G3KA 3K2ZA 1YARO 2F5CA 2IAIA 3HDDA 3T4RA 4CZZA 4JK1X 2YKZA 3O6XA 1OCZC 2JUGA 4CYCA 1OISA 2QNLA 4CO8A 4RB0A 1ZRCA 1D8KA 3EFOA 2Z15A 3SXKA 1APLC 1ZGJA 1BOAA 1G4WR 3EGDA 2RVCA 1DP7P 2R9RB 4MVUA 3QW0A 2XXAA 2WTEA 4UV9A 2FF4A 4EJOA 2RQQA 3D1NI 4NQWB 2V9VA 1F5TA 5E17F 3DBHB 2A0UA 1P4AA 1ONVA 1HDPA 4A12A 2EPNA 1HSTA 3KP3A 2DW4A 2R3SA 3EUKL 1J59A 4IRIA 2I8DA 1UMQA 2PMHA 2TRTA 1DP3A 3ESWB 4GYIA 4BJ5C 1OPCA 3S15J 4ZTFA 2GZWA 5E33A 4C7OB 2EIKC 1CPRA 2YL7A 3K6BA 4Y17A 4IQJA 2R7TA 2G0EA 1Q0FA 1OYIA 1SMTA 3OYBA 1USSA 1YW9A 4XNFA 1ZTRA 5LRSA 2DB4A 1C02A 4EHPA 1IV8A 1T6UA 1IXSB 3PDMP 2JVGA 4D4XA 4FE4A 2F22A 4A5NA 3CO6C 5EEGA 4IHYA 1WASA 3RVZA 1RI7A 1PP8F 2CUJA 3BR2A 4ASNA 2CJJA 2B0HA 4B44A 4U5GA 2RD9A 3KYJA 4AIDA 2ELJA 2LKXA 4IRUA 1BL0A 2VQCA 3FZVA 1QGPA 4DBQA 3VSLA 2KQRA 3HJEA 1FOWA 4KJZA 4A3GJ 4DVZA 2Y31A 2X6XA 4AWXB 4NTFA 1IRGA 1GM5A 2GXAA 1VQ5I 1UHSA 2EK5A 4GEHA 4XSXF 4AYBN 1JUMA 4L9NA 5LD2C 2ZMEC 1WJCA 2W24A 3TDZC 1AKHB 5E3AA 1MMGA 4IOAF 3LS1A 1Y4CA 4I98B 1IRZA 3JRFA 1WJFA 3V8JA 2HFHA 2FOKA 4J19A 1WOLA 3IPMO 3K33A 3OYMA 1JTXA 4RDUA 1TWGJ 1QPIA 3F8BA 3ZQLA 3CJQB 2NYXA 1S72I 1UCRA 4FT8A 4HX7A 1PDNC 4AVPA 1Q1HA 2DXIA 5GTIC 1KZHA 1LE8A 3Q9VA 1IRFA 1AA7A 3WG9A 3GLXA 1YG2A 2IBDA 2IEKA 2A07F 1I5ZA 2M1BA 1Z7UA 1TZLA 3CUQB 2IXNA 3HGYA 2PJPA 2LNBA 3JTLO 4YT4A 1WFXA 1WI3A 2DTZA 2OF7A 3FBNB 4RDAA 3QU6A 5HLIA 4C3JJ 1ODDA 2L5QA 5EGOB 2ZPAA 1XD7A 1WWXA 1D1CA 2LY9A 3HBLA 2HQAA 4OINF 3A2KA 3GTJJ 1O87A 2VC9A 3S9OA 5HS9A 1D1AA 5FGMA 1LE2A 3RKOF 3IAS2 4RLFA 2F2EA 3KLNA 2DFHA 3EH2A 1SEUA 3JRIA 5K1YA 2CQQA 2NOJB 1JAFA 1OW8A 4FAPB 3ASOH 3NRVA 5FJ8J 2FAPB 1TLHB 3A9CA 1U5TA 4P96A 2IXSA 2Y75A 5JT4A 2BZTA 2DK5A 4GYGA 1FBSA 2LSEA 1Z21A 2D4UA 4V19K 1OQYA 3TO7A 4DZJA 1B59A 1RPWA 2UUZA 1ZK8A 5K7HA 4W8KA 3S0XA 2F5FA 2IXMA 2VASA 1YJNI 4R32A 4PJNA 3B0VC 2QEXI 4P9FA 1JT0A 1LPEA 1QA6A 1N1CA 1U5TC 1JHFA 2XF6A 5AIPA 4WF2A 2CV0A 2Q3TA 1Z7LA 1TKNA 3RCOA 3DLAA 3ZXSA 2HDWA 5FO5A 3HPHA 1XSVA 3WTZA 1E3HA 5GAHJ 3C1DA 2W25A 1AUEA 3H5RA 3OYAA 1T2KA 3GM1A 3BG3A 3ZQFA 1R1VA 3MWMA 4LLEA 1K6YA 4KT6A 4M3EA 2P6TA 2QY9A 1T56A 2XGDA 2FFHA 4Z9IA 2IGOA 3GEIA 2B7EA 2OU2A 4MO7A 2R7RA 2HDCA 5FCLA 4C7OA 2LMDA 4HF2A 1YYXA 1XG1A 2DODA 1N78A 1O7LA 1YOVB 5DM6F 1DU0A 2K9NA 3GFLA 2HJ3A 1NG7A 1W5SA 2DMNA 3DKWA 2QE9A 2RN7A 1G2HA 1R1UA 1TWGA 2P4WA 1LM3B 3KP5A 1RZ4A 4F55A 1NK3P 4CBEA 2O7OA 5GAEJ 2ECBA 3JAMK 2EZIA 5KNLA 4JVSA 2N8GA 2V9PA 3V7CA 4ZYDA 1QLEC 3H5AA 3NKEA 1D0ZA 2R92J 1F9NA 3FIWA 2I10A 2WL8A 5D4SA 2HQ5A 2J5OA 1YJWI 2OTJI 3A0BC 3DU6A 4PK4A 5DS6A 3E9VA 3MEXA 3O10A 3GTMJ 1K40A 4IARA 5FLVA 1MBFA 5DV5A 4JIOA 2M5WA 2LH9A 5D5VB 2W84A 2Q2EA 3AG1C 3TOBA 3G73A 2IS6A 2QTVA 3F0CA 5K7FA 1UHMA 2BC5A 1YW7A 2RSEB 3HUGA 3MZ8A 3P9KA 1Z3XA 2X0LA 2IXOA 2L7AA 2D45A 2OZ6A 4GRIA 1GV5A 2LBFA 3G50A 5FKOA 1YDIA 5GPAA 1BI2A 2V1DA 5EHHA 1R5ID 4C3BA 2OG2A 2KIMA 3TO9A 3QP6A 3RI4A 4CX9A 1MDMA 3RKQA 1TP4A 5E1XA 2VXDA 2XPVA 5E3NA 4R8HA 3AQCA 4AD9A 3GORA 5IT3A 1ZU4A
chains in the Genus database with same CATH topology
1R5ID 3KPHA 2OJED 2ICWG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R5I D;  3KPH A;  2OJE D;  2ICW G; 
#chains in the Genus database with same CATH topology
 3S14 J;  3F46 A;  3PNY A;  5BQH A;  5HS8 A;  3FOP A;  3CCS I;  1XWJ A;  2NPU A;  2CNW D;  4YFK F;  2DLL A;  1U8B A;  1AVO B;  1J0R A;  3EUH A;  4XKV A;  1JKQ C;  2WB1 N;  4D7N A;  5HOD A;  3M4O J;  1HE9 A;  1KNY A;  2OOC A;  5D92 A;  1XDU A;  4EJT A;  5LHG A;  2LY2 A;  3MMY B;  2ZKZ A;  5H6R A;  2EFP A;  2DK8 A;  5KYX B;  5HDK A;  2KZG A;  4OD4 A;  1OCO H;  3S1Q J;  2XB5 A;  4I99 C;  3KYL A;  1YIJ I;  5JR3 A;  4NDL A;  1R6R A;  4RM2 A;  1UST A;  4KIC A;  1FFT C;  4HEA 2;  5KCM A;  4C2M J;  3J06 A;  2UUH A;  4U5F E;  2ETS A;  5JRA A;  2R05 A;  3A11 A;  1FY7 A;  2D1H A;  2V9K A;  3K7A J;  5M3M J;  2MC3 A;  4NBQ A;  2WV0 A;  3U8P A;  2G3V A;  2EPF A;  3B29 A;  4GYT A;  5J47 A;  2HWV A;  2AP3 A;  4XKW A;  2XKO A;  1BW5 A;  2WC2 A;  2RNJ A;  2XRL A;  4JX6 A;  2CRG A;  1KQ0 A;  1ZHT A;  1FSE A;  3MKW B;  3FHD A;  2EIN H;  2GWR A;  2HI3 A;  4FTH A;  3ZMT A;  1T33 A;  2CW8 A;  5LHI A;  2FMY A;  3VYR B;  2JJ7 A;  3HC7 A;  4M6V A;  5EG0 B;  1ZRE A;  3CES A;  3CCM I;  4NQF A;  4RLQ A;  1E17 A;  5TGT A;  3IH2 A;  2Q4F A;  3CMA I;  4E7I A;  1JT6 A;  2F5E A;  2RQP A;  4O6M A;  2XAS A;  3CUQ C;  1RKE A;  1F4K A;  3LA3 A;  2EH3 A;  1K04 A;  3JSE O;  5A6B D;  2J8W A;  4CCO A;  3L9F A;  3D5S C;  3IP4 B;  1ERD A;  2OBP A;  3ZR8 X;  1OCR C;  1IV6 A;  1FTT A;  1M1E B;  4U5B E;  1HF0 A;  2L4A A;  1Z5Z A;  3GUD A;  2JA2 A;  2DTR A;  2VPL A;  3JRD A;  1DQU A;  3HGG A;  1YA7 O;  2LFF A;  4RGS A;  4O79 A;  4QTR A;  3A01 A;  2GA1 A;  4UDV A;  4WXC A;  4MEX F;  3T6J A;  1PUF B;  4XEF A;  4L18 B;  4DOZ A;  2QSH X;  1KTM A;  1JMW A;  2VIX A;  4DNC A;  1A04 A;  3HRS A;  3HNK A;  1EA8 A;  4BG0 A;  3T8T A;  4E7H A;  5E8G A;  2K02 A;  3P5J A;  2R7X A;  4ZZL A;  5IP6 A;  2MC4 A;  2KFD A;  4BXU A;  2M4E A;  3U0C A;  3AG4 H;  3MCZ A;  2MD5 A;  4MNU A;  4X0R A;  3TO6 A;  1P7J A;  4Y13 A;  4YG2 F;  1I50 J;  2BY0 A;  2GOX B;  2AQF A;  2EIM H;  3ASN C;  1BZ4 A;  5JLI A;  2DA4 A;  4ESB A;  4L5I A;  1Q0M A;  2WVO A;  3QPH A;  2L2O A;  3LL7 A;  1LEA A;  3BR1 A;  4N6H A;  2OKU A;  3TBI A;  3HG9 A;  3W2V A;  3J81 Z;  3HNL A;  1QNT A;  2XAF A;  5D8K B;  2EWN A;  1UB9 A;  2JMW A;  2ZME B;  5L3G A;  2GXB A;  5A6K A;  2CCY A;  4XPX A;  1LE4 A;  4CYC B;  2IPQ X;  2ADU A;  1TBX A;  2LF7 A;  4Q47 A;  4A3C J;  4QI0 A;  1IN5 A;  2R7D A;  3ISP A;  3OWT A;  4MTE A;  3EUA A;  3TDU C;  2GFH A;  2CQ7 A;  2W82 A;  3BZK A;  2R7W A;  3OIP A;  2R7S A;  3SZG A;  2YU3 A;  2X6W A;  4M71 A;  3S2W A;  3V7R A;  4A0Y A;  4GFB A;  3OIO A;  3RQI A;  1VQ9 I;  3RDI A;  2D2W A;  4XID A;  2J0W A;  2R7U A;  2ZXW C;  5KYU B;  3BR5 A;  3ATP A;  4A3F J;  3BG7 A;  3GM2 A;  5E79 C;  3ELK A;  2VBW A;  3BR0 A;  3SYN A;  2WAF A;  3FOO A;  3LSK A;  4MTF A;  4B8X A;  2E2J J;  3RQ4 A;  4B09 A;  1UEL B;  4G78 A;  1FYL A;  2PEX A;  5H2F C;  1HMO A;  3RYP A;  5E2Q A;  4M72 A;  4G8X A;  4G7Z F;  1N75 A;  1SD7 A;  1XMX A;  3S32 A;  1YHQ I;  2CDQ A;  3ITF A;  3W2A A;  4DGW B;  3TP3 A;  1FAP B;  3FMQ A;  1R1T A;  2F6C A;  2L01 A;  2PG4 A;  3HSF A;  5AON A;  2HJM A;  1Y1W J;  1JKO C;  1J8Y F;  1JJ8 C;  2KIU A;  4OOI A;  1OJL A;  1U5T B;  1EKY A;  5LGN A;  5FLX Z;  2Z3Y A;  4DQ2 A;  4U5C E;  2DO7 A;  3ABK H;  2P0N A;  4UXN A;  4LD5 A;  2R4G A;  4DYR A;  2DN0 A;  2KKO A;  3PSF A;  3J7Y J;  4A3K J;  2Z2S B;  1R4N B;  1OXK A;  4C3H J;  3S27 A;  3QAH A;  1NK2 P;  4JE9 A;  3AFH A;  1VQL I;  4LG0 A;  3OYN A;  5ILV A;  4AIH A;  2P7V B;  1VB5 A;  3LSI A;  1PCX A;  2RV8 A;  1T5O A;  1ULY A;  1OFC X;  1FSH A;  2KIQ A;  1ACI A;  2L54 A;  1FLI A;  1MJ9 A;  1QHH D;  5EGO A;  2VCB A;  3GZN B;  2HV7 A;  2EV5 A;  2XAH A;  3E6C C;  1VZ0 A;  2HGC A;  3S2H J;  3OOU A;  4HST A;  2YLG A;  5D5U B;  3BJ6 A;  3T9O A;  3S3M A;  4FCY A;  1TWF J;  3CZ6 A;  3DQV C;  2HS5 A;  1W7P B;  1RES A;  2GBY A;  2K9S A;  2ZXR A;  3ABM C;  2OQM A;  1S7E A;  1ZLJ A;  2OC6 A;  2P8T A;  2ESH A;  2W7N A;  3TK0 A;  2VE8 A;  4ESJ A;  1VQK I;  4CDA A;  2HOE A;  5LLQ A;  1QVX A;  3H0G J;  4ZH4 F;  3LLI A;  1X19 A;  3E1S A;  1WJD A;  3B0P A;  2YX4 A;  3BTC A;  3HIF A;  2DYS C;  2H6B A;  5CKT A;  3FIS A;  4A93 J;  2MH9 A;  3NAU A;  4M6Y A;  2EJR A;  4J00 A;  2H7O A;  3FAJ A;  3HPG A;  2Y3D A;  4NTB A;  1UZC A;  2MH2 A;  3IKT A;  5JSL A;  3O55 A;  3FXQ A;  4XRS G;  1ZHY A;  1Y1V J;  1RKE B;  2LIG A;  3FXH A;  2OCC H;  2BHZ A;  3QYF A;  2BL2 A;  1Z6A A;  4J7T A;  3V5Y A;  4ENM A;  4KA4 A;  3NMI A;  2E1N A;  3R4K A;  3FXR A;  2VUM J;  3MLG A;  2X85 A;  5BUO A;  1MBG A;  2DA7 A;  5EG0 A;  3R0J A;  1EA3 A;  1W5T A;  1QZY A;  2LKP A;  2MGQ A;  2VXZ A;  3BPV A;  2XF7 A;  1IN7 A;  2Y3H A;  4L0Y B;  2AXL A;  2R03 A;  2ZBK A;  2O03 A;  3BCA A;  5J40 A;  3RYR A;  3SFZ A;  3HKZ A;  1FEX A;  3SDB A;  3CC4 I;  5F5H A;  3FXU A;  2GOM A;  4I6Z A;  2IS2 A;  2DDA A;  3GOD A;  3RVY A;  1YE9 A;  4EBJ A;  1STZ A;  3QOP A;  4G7H F;  1HKQ A;  5A6B A;  3F8C A;  2ZME A;  4KIS A;  4LK1 F;  1RKW A;  3S8P A;  3FM5 A;  3WGH A;  1YLF A;  3ZMD A;  3H0D A;  4ZLD A;  3DKX A;  2H27 A;  5E3M A;  1MBE A;  2DDB A;  2GQQ A;  5DEQ A;  3W3C A;  1OR2 A;  3U9J A;  4EIY A;  1XZP A;  3SZR A;  1BI1 A;  1RUO A;  5DDG A;  1O3S A;  4A3D J;  3ZQ7 A;  1ZW2 A;  1D5V A;  1B8I A;  4K7B A;  1XGS A;  3CP2 A;  1CGO A;  3GTP J;  2ELK A;  3GTO J;  2VJJ A;  1JRA A;  2G62 A;  4YN0 B;  4I09 A;  3IH4 A;  1RRJ A;  1TT5 B;  2ZFW A;  3WU0 A;  2FA5 A;  1RUN A;  1APC A;  3OYK A;  3OY9 A;  2E2I J;  1BJA A;  3J7A Y;  1W36 C;  1AOY A;  1MZB A;  3IKV A;  4CYD A;  1MD0 A;  3SEO A;  1YA9 A;  2Q1Z B;  5EGY A;  4XR6 A;  5CJ9 A;  3OR2 C;  3MN2 A;  1PUF A;  3M8E A;  1K05 A;  3KET A;  3WAQ A;  4YL0 A;  1K79 A;  1EI7 A;  1K83 J;  2EQR A;  3D5R C;  5JVT A;  1R9T J;  3I4M J;  2E1M B;  3WG7 C;  3ZIB A;  3VWB A;  1XN7 A;  4NUB A;  1X4P A;  5D6F A;  1MDM B;  2LFD A;  1C0W A;  2J9V A;  4RBN A;  5L0J A;  2QKL B;  3BQY A;  2L3D A;  3N2Z B;  2YQY A;  4IRH A;  3B02 A;  1NU7 D;  4KUM A;  2E34 A;  1ORK A;  2VC0 A;  2VOP A;  1R4M B;  1DGR M;  3S1M J;  5CVR A;  3VF0 A;  4MS2 A;  4JEA A;  5CQE A;  1WJE A;  3JSO A;  1MW7 A;  3M15 A;  2A61 A;  1MMD A;  3F22 A;  4IAQ A;  3N0T A;  3PCV A;  2CV1 A;  4BEJ A;  2P5L C;  2K9M A;  1XC5 A;  2OTL I;  4BU2 A;  2AHQ A;  1YLM A;  3CQZ J;  3DJN B;  4X1E A;  3VYW A;  5M5X J;  3M07 A;  1E86 A;  4FHT A;  1U78 A;  1KQ8 A;  2HVR A;  2XAJ A;  5LEK A;  3VB2 A;  5DCM B;  3I9V 2;  2EIL C;  5EDN A;  2PF4 E;  1NFN A;  4ZYA A;  2DJN A;  3PFI A;  4FX0 A;  3OS2 A;  2FU4 A;  4XLC A;  4XLH A;  3MZH A;  3IUO A;  1Z05 A;  3KYI A;  4C3I J;  2HV6 A;  5JVE A;  1ORS C;  1X1A A;  3D5L A;  2XS8 A;  2X1C A;  3AG3 H;  1OR7 C;  4BPM A;  3A01 B;  4XQ1 A;  4IEJ A;  3KEQ A;  1D8J A;  1KU7 A;  3QYB A;  1T9K A;  3LST A;  2R5Z A;  4HDV A;  1EKE A;  2Q7R A;  3PSI A;  2V7F A;  4P9U A;  4OMY A;  1TFK B;  1ZN2 A;  3GM3 A;  2YPR A;  5L0H A;  2HXO A;  2M0C A;  5TJ5 E;  3TGN A;  3QYE A;  1XZQ A;  1Y0U A;  2HKO A;  3VRC A;  2DFF A;  3LMM A;  1YS7 A;  2WB1 A;  4I01 A;  4B47 A;  3EGX B;  4FX5 A;  2P5V A;  2BOL A;  2L6H A;  3DD7 A;  1ZAO A;  3FVY A;  1HQC A;  2BEO A;  4F3Q A;  5L3F A;  4YK5 A;  1FMV A;  2XGE A;  3VDX A;  2CMP A;  2IRF G;  2R5Y B;  4ONS A;  5FRO A;  2XL8 A;  4RB1 A;  4L9V A;  1KGS A;  2R7Q A;  2LKS A;  1IN6 A;  2EFN A;  2ME0 A;  1XDS A;  3K6G A;  3Q6M A;  2W45 A;  3U9G A;  4DBR A;  3V42 A;  2WAQ N;  1Z0X A;  3DTE A;  4XMY A;  3BRJ A;  4A6E A;  4KIT B;  1IUY A;  1BI0 A;  1MJB A;  2R7O A;  2XL4 A;  4KC9 A;  5HSW A;  1W36 D;  3IHU A;  1QQI A;  2CU7 A;  3R7C A;  4E18 A;  2P61 A;  1I39 A;  4XM3 A;  3RTR A;  1XPX A;  5GPC A;  1EF4 A;  2K3P A;  2ASR A;  4HBL A;  2NXN B;  3B71 A;  3KP2 A;  3DWL E;  5T1D B;  3BRO A;  1OR3 A;  5JHF A;  1UG0 A;  4IOC F;  2ZC2 A;  2E71 A;  2OZU A;  3DJU B;  3HTU A;  3JRG A;  4LG0 B;  2DOA A;  4A69 C;  2QSG X;  2QZ8 A;  3WTW C;  1ON1 A;  1SVO A;  1Y39 A;  3N4M A;  2NUT B;  2IGK A;  2Y9Z A;  2Q00 A;  2YR2 A;  1KQ9 A;  2BXY A;  4ZDL A;  1S8N A;  5E8I A;  3CCV I;  4CHU A;  2VOD A;  1SD4 A;  1HY5 A;  3J7Z I;  4CDV A;  1U6H A;  3IC7 A;  4YJW A;  2FRH A;  4BDY A;  1VMA A;  1M56 C;  2Q9B A;  1FOX A;  2F4I A;  2V26 A;  2IYL D;  1HA8 A;  4JJF A;  4F4B A;  4IHT A;  1I6H J;  4BS9 A;  5E18 F;  3LJB A;  1TTY A;  1KON A;  1BDJ B;  2GA0 A;  3M9A A;  3JCU Q;  2HYF A;  5KVR A;  1IDZ A;  2PNO A;  4XPY A;  4N9H A;  1E3O C;  3EG9 B;  1TW3 A;  3VYT B;  1V5G A;  2Q9A A;  3E70 C;  3TED A;  1OMI A;  2L0K A;  3R60 A;  1ITY A;  1IF1 A;  2NS8 A;  4MVQ A;  3K4N A;  3L2U A;  3LQR A;  2DPU A;  1VOM A;  3KIO A;  3KEY A;  3KP4 A;  3AG2 C;  1K4S A;  3L8J A;  4W8P A;  1CF7 A;  3BG5 A;  2LBF B;  3LNR A;  4B4C A;  5D6E A;  2X9D A;  3Q0W A;  3ULQ B;  3OYH A;  3LNQ A;  4HDU A;  4NHJ A;  1WGW A;  3H3V K;  3ROU A;  3Q5F A;  4KNY A;  3WTU C;  5IY5 C;  3U2L A;  3LOC A;  4OU0 A;  3VPR A;  2YL1 A;  4ULV A;  1V55 H;  4HNU A;  4XKC A;  3DU5 A;  1Q1V A;  1XGN A;  1ST6 A;  3GW2 A;  2PLY A;  5FKL A;  1X3U A;  4PFO A;  3PO2 J;  3K10 A;  2ID3 A;  3CCU I;  2QBY B;  1D0X A;  4LIT A;  1T0F A;  3BJO A;  2XV4 S;  2KK1 A;  3KLO A;  1HSJ A;  3KX2 A;  1T8I A;  3CLQ A;  4B3A A;  1HLV A;  4XIC A;  3FMR A;  2DFI A;  2KDZ A;  1MJA A;  1UAA A;  2FUG 2;  3EZI A;  3ZQQ A;  1YIO A;  2QUF A;  3MKZ A;  4AL0 A;  5BQI A;  1HC8 A;  2HNH A;  1EV7 A;  3DPT A;  1GVD A;  4ENJ A;  4WJ0 A;  4MIM A;  1WWP A;  1U9O A;  5IY5 H;  3IRR A;  3WGG A;  3KH2 A;  1JUS A;  4OWR B;  1QU3 A;  1B1B A;  2DT5 A;  4UUS B;  1LDJ A;  2TDX A;  4MEY F;  1OKK A;  3I4U A;  4CS9 A;  3GEZ A;  4CCN A;  3BT9 A;  1JKP C;  5F0F A;  5FKM A;  3JSP A;  3CUQ A;  1Q0G A;  3GFM A;  1TWC J;  4KN4 X;  2A6H F;  2R7F A;  3H9J A;  2ZXH A;  5KK1 A;  1IXR C;  3M1C B;  1FYM A;  1U8R A;  1B68 A;  4GGG A;  3CF2 A;  3U1K A;  5AIQ A;  4M9Z A;  2F5D A;  4NC3 A;  2COB A;  2EZK A;  4BDZ A;  3FHZ A;  1POG A;  1YS6 A;  2BY1 A;  3K2A A;  4JYK A;  1ZG5 A;  4I0A A;  4L9T A;  3G4S I;  1RKT A;  5BOX A;  1IN8 A;  1K78 B;  4AIJ A;  2XM4 A;  2VPR A;  3A0H C;  4JX5 A;  5DQZ A;  2XHK A;  4LLN A;  1BIB A;  3LSM A;  3S2D J;  3JRB A;  2E5N A;  1F36 A;  3Q7G A;  1G3W A;  3HHG A;  3I55 I;  2D5V A;  1QQ3 A;  4JJG A;  1RJ9 B;  4IQ4 A;  1B9N A;  4LB6 B;  1G59 A;  1DOW A;  1SD6 A;  5ILU A;  3UNG C;  3SZP A;  4BXF A;  2DJI A;  2E36 A;  4MW8 A;  1ZHX A;  3ZMU A;  2DMU A;  2WY8 Q;  4HQM A;  3S3O A;  3L00 A;  5BPI A;  4RM3 A;  3NAR A;  2V4J C;  4JCH A;  4YT2 A;  4YWQ A;  3BPX A;  3SNH A;  1SC7 A;  3JTH A;  2DI3 A;  3QRF F;  2J0X A;  2YZS A;  4WAB A;  1VI0 A;  2J5P A;  4XEK A;  1MBK A;  1O3Q A;  1O5H A;  5FFZ A;  2X0C A;  4HF1 A;  2Y0S N;  1SFU A;  5DS5 A;  3IQ6 A;  2VON A;  2NVQ J;  5D4R A;  3ZDL A;  3DMD A;  1U3E M;  1WTY A;  2NOG A;  2W00 A;  3SZT A;  1EH6 A;  4BQO A;  1ZH5 A;  4UHT A;  1O3U A;  3LWF A;  4PJL A;  3U9M A;  3WTT C;  2NUP A;  2K4J A;  5DCF A;  4ZDP A;  4JX4 A;  2DFE A;  1G4D A;  3EGD B;  1TWA A;  1FBU A;  3ECO A;  3ERE D;  3EFO B;  3QPL A;  5L0D A;  2AXT C;  1BR4 A;  3WGI A;  2XSE A;  3KZZ A;  4ZTJ A;  5F5F A;  4FES A;  4D5F A;  4MND A;  3ZN1 A;  4WK8 F;  4FX4 A;  4Z9J A;  2M34 A;  1H9G A;  2KMU A;  2EZL A;  3BR6 A;  4U7B A;  1LNW A;  2OAZ A;  3WTS C;  1VQ6 I;  5B3S H;  1QZX A;  3IWF A;  2XLV A;  3M79 A;  3G71 I;  2FQ3 A;  2WZL A;  3IQT A;  1UJ8 A;  5ERI A;  4QIW N;  3OL3 A;  3VAY A;  2QLZ A;  4Y33 A;  4CCK A;  3PIP F;  3ABM H;  4M74 A;  3DAG A;  1AKH A;  4XON A;  3DLL F;  3CDH A;  3LEV A;  3V8K A;  2A5Y B;  1VQN I;  2LLK A;  5T3T A;  2OQG A;  4ESF A;  2VKD A;  4A5M A;  3AG3 C;  3E0J B;  1B72 B;  2O5R A;  3GAN A;  2HZ8 A;  4JQF A;  1F1Z A;  4U87 A;  4BJ1 A;  3HOS A;  5EZH A;  3R61 A;  1HKS A;  3PIO F;  3F6O A;  4MTO A;  1RIO H;  3S16 J;  3CO7 C;  5T3W A;  2EIL H;  4AK9 A;  2ICW G;  2V1X A;  4A4A A;  2HTS A;  2CYY A;  2QQ8 A;  1G3S A;  2HMZ A;  4DVY P;  1Z77 A;  4XLE A;  1TQG A;  4NTA A;  2KT0 A;  4L5J A;  3PMR A;  4MLO A;  5FLM J;  2JA6 J;  4N0B A;  4HE8 D;  5M5Y J;  1Z1D A;  3W8H A;  3S84 A;  4MVS A;  3L09 A;  1A0B A;  2CUZ A;  3QWL A;  4LFU A;  3T5X A;  5J4V A;  2H6C A;  2XLD A;  4IWB A;  2QKM B;  3ZC4 A;  1AHD P;  4E0H A;  1T01 A;  1NH3 A;  1PD1 A;  3A4C A;  2C6Y A;  2JWT A;  3LAP A;  2LSO A;  3F8F A;  4RAZ A;  5CVU A;  1SF8 A;  2L6G A;  2FEZ A;  3TW6 A;  1S29 A;  2YEV A;  4YEJ A;  1R23 A;  2KJB A;  1YW8 A;  4BUP A;  1LI5 A;  2OV7 A;  2XKP A;  1XGO A;  1LDD A;  1BOB A;  1WJB A;  3GLL A;  5LHH A;  2OQR A;  1V54 C;  3NRH A;  1U0B B;  3CME I;  1X3Z B;  4BBR J;  2HDD A;  5K7Z A;  4H0E A;  4JTA B;  3ONQ A;  1FOY A;  3H65 A;  2HSQ A;  2EFQ A;  3GXO A;  3MAJ A;  3V4G A;  5IYC J;  2XIG A;  1J5Y A;  3PUF A;  4BGD A;  1J75 A;  1U6G A;  4G7O F;  5C4X J;  4MHG A;  1FTS A;  3LFK A;  1YZA A;  2ELH A;  3I4N J;  2BBY A;  2WAQ A;  1V74 B;  4E6K G;  4AU7 A;  1BW6 A;  4FAS D;  3GX4 X;  4JKV A;  3LSP A;  5IYD J;  3G4X A;  3OYJ A;  5CPR B;  2Y48 A;  4W97 A;  1RKC A;  5ICG A;  3GTK J;  2LRE A;  3DKY A;  5HLH A;  4JTD B;  4UNO A;  3L1P A;  4Z6Y A;  1UFB A;  4HYE A;  1A7V A;  1R7J A;  2L9R A;  1QZZ A;  3OIQ A;  2HKV A;  2FD5 A;  4NCQ A;  1VK5 A;  3GZ5 A;  4XKB A;  3T6G B;  3MD2 A;  4BJ6 C;  2NSF A;  2HUJ A;  1OCC C;  4BAY A;  4HV5 A;  4BEH A;  3K66 A;  2YUS A;  1QVT A;  9ANT A;  2JA5 J;  3IAM 2;  2E5Z A;  2K3F A;  1J09 A;  2EPL X;  4UVA A;  3DPL C;  1HW1 A;  1CGP A;  1WAT A;  3OEO A;  4XOR A;  5DD8 A;  5HLT A;  4DJ9 A;  2EV0 A;  1LB2 A;  1NZE A;  1ORY A;  4IHW A;  1J2X A;  3I5P A;  2ZXI A;  2L4M A;  3MQ0 A;  2XRO A;  3AKZ A;  5L0G A;  4B6I A;  4LGW A;  2EA4 A;  4G9Y A;  1ZYR F;  3RZD J;  4A3L J;  4M3D A;  1W2W A;  2XGC A;  4U5E E;  2OJE D;  4C3D A;  5FZT A;  3G3Z A;  4LMY A;  5FKN A;  2F5V A;  5KAF C;  2MG4 A;  1CPQ A;  2NUP B;  2RRE A;  1IO2 A;  4RB3 C;  5BS6 A;  3IL2 A;  1CGM E;  4RAF A;  3BQZ A;  1RMV A;  4AX2 A;  5JUA A;  1E85 A;  1RCP A;  2XUB A;  4IKF A;  3HXL A;  4E70 A;  2J7P A;  2XLW A;  2XLE A;  1R71 A;  3C8G A;  4PAC A;  2KYH A;  3CCJ I;  3S1R J;  1QKR A;  3CD6 I;  5JP7 A;  3LA2 A;  3KMI A;  2MBF A;  3TOM A;  3QPT A;  2HPI A;  3PNV A;  3KZI C;  2AWC A;  4AL1 A;  4MVM A;  1Z3I X;  4Y4R A;  1X1B A;  1R58 A;  3JRA A;  5KYX A;  2VCC A;  4PGH A;  1FZP B;  5F27 A;  2X6O A;  3QP5 A;  2H7B A;  1IW7 F;  2B0L A;  1A7E A;  5FLX K;  4XN3 A;  4IRG A;  2XLH A;  2BW3 A;  2KLO A;  4XQF A;  3DKA A;  3SEQ A;  2OEX A;  4QSH A;  5B3I A;  2HQN A;  4JOM A;  4D5C A;  4E7K A;  1RJ9 A;  5LRR A;  3FK6 A;  2MSY A;  5COM A;  3O3K A;  4CDG A;  2CQN A;  1ZRD A;  2L9S A;  5EJC A;  1YO5 C;  5BNG A;  3S17 J;  2J9U A;  1XSX A;  1XX5 A;  1RET A;  4LLG F;  2DQL A;  4XBF A;  3OYL A;  2GAQ A;  2NVU B;  4MVZ A;  1E84 A;  2M45 A;  1X4O A;  2HYJ A;  3C2G A;  3Q9S A;  3RIP A;  3FXM A;  4RGU A;  4QI2 A;  3HSE A;  2H1K A;  3X2Q H;  2E1M C;  2XRN A;  3K1I A;  2CUF A;  4KIB A;  1OLT A;  3ZTZ A;  4TV7 A;  2JT1 A;  2Y3G A;  4XTK A;  1BA5 A;  3G1L A;  2VKE A;  5DYM A;  3EG9 A;  2DA6 A;  3CJN A;  1X1C A;  1SFE A;  3I59 B;  3KPH A;  3M1C A;  5H20 A;  4U5D E;  1A31 A;  1IXC A;  2VQL A;  2JPB A;  3ZN0 A;  4U5H A;  1ZRF A;  1VQ7 I;  2XS1 A;  4U9D A;  3W6K B;  4BJ5 A;  2KC3 A;  2K4B A;  5TJJ A;  1YAU O;  2XVC A;  3L8I A;  3W8I A;  2JVH A;  4YRV A;  3GWZ A;  4B48 A;  1TT0 A;  1JUP A;  1ETX A;  2JK3 A;  4NB5 A;  3UKG A;  2VN2 A;  4KDP A;  3V5X A;  2D1V A;  2O8K A;  2M2E A;  4K1O A;  3JAM Z;  2GA2 A;  4CA0 A;  5A2Q Z;  2H7V C;  2Y39 A;  1W0T A;  2OU6 A;  3MFK A;  2HR3 A;  2B63 J;  4JP0 A;  4LG3 A;  3W2W A;  4HLY A;  4E7J A;  4GQH A;  2EPO A;  4RAY A;  4ZC3 A;  4MFE A;  5B66 C;  5ICC A;  5M5W J;  2EFO A;  1SFO J;  5GAG J;  2W1O A;  1ZLK A;  3AGU A;  2K40 A;  2KZV A;  2R7Z J;  3HOU J;  3PL8 A;  2QBY A;  1Y6I A;  2LOO A;  4IHX A;  2A6T A;  4A3I J;  2LK2 A;  4CDY A;  4J30 B;  5B3S C;  2F4O B;  4XRF A;  2QLA A;  3ZPL A;  4CS9 C;  1IGN A;  1MNM C;  3RKY A;  1OKK D;  2EPK X;  1EQ1 A;  3C62 A;  3AG1 H;  4CZC A;  1AWC A;  1IN4 A;  1WHU A;  3HTK C;  3T8R A;  2VKV A;  4UB8 C;  3OYD A;  4YIF A;  1V4R A;  2DMP A;  4HOB A;  3FXO A;  2O9X A;  4I02 A;  3RF3 A;  2HZD A;  4HLX A;  1ETW A;  3GTQ J;  3OYC A;  3PQJ A;  3DM5 A;  1R4T A;  3GF2 A;  1R00 A;  1MQV A;  2IM8 A;  3L0I A;  2ETH A;  3Q6N A;  2YRF A;  5F1J A;  1E3P A;  1X58 A;  3ECH A;  1L3L A;  1BC7 C;  3LEO A;  3M1E A;  4LAC B;  2NSG A;  2KRH A;  1ZKG A;  3ZG1 A;  3ZMZ A;  4CIC A;  5FKK A;  2EIJ C;  5BPD A;  4MVO A;  1PUE E;  1XTA A;  1VLS A;  4XOT A;  4A2N B;  1LUJ B;  1EH8 A;  2E19 A;  3WTV C;  3ABU A;  3M8F A;  4DRH B;  2CW0 F;  3K4B A;  2IXP A;  4G0H A;  2DYR C;  1XMA A;  2XAG A;  3LES A;  5K5R A;  2COM A;  2P5K A;  5C3E J;  1I3Q J;  3WHC A;  3L2Q A;  2VE9 A;  1I4Z A;  1VYK A;  3MYF A;  3F3X A;  4N4O B;  2E1C A;  4EKW A;  2VL8 A;  2VBX A;  3HRU A;  2CO5 A;  1O4X A;  4I1M A;  2CWE A;  1ENH A;  2FXA A;  2Q8K A;  4F91 B;  4Q5S F;  1KYZ A;  2LTP A;  1L3P A;  1YYV A;  2K7L A;  2IGN A;  2H8A A;  1BIA A;  3GO5 A;  4Y52 J;  2NAZ A;  3ZP5 A;  4KYW A;  5L3C A;  1VLT A;  3HNJ A;  4MW3 A;  4KI2 A;  5HNH A;  1H89 C;  2AWY A;  2CFO A;  3AL0 C;  2W4B A;  3E5Q A;  3MZY A;  2Z9O A;  3VOD A;  2HSB A;  2L9J A;  2W4M A;  3JRC A;  3DAF A;  1HBX G;  2CGE A;  3N97 A;  1KA8 A;  5L3D A;  2EZH A;  2QQA A;  5HOO A;  1GV2 A;  2ISY A;  3GFJ A;  3K1H A;  3NMJ A;  3PM1 A;  2A69 F;  2HMQ A;  4K2E A;  4S04 A;  3ZQI A;  3JYY A;  4HV6 A;  4XLN F;  4DYC A;  2XM0 A;  1SAX A;  2WA0 A;  3CLO A;  4C3E A;  2HZT A;  3DBL B;  3EET A;  2OUM A;  4G12 A;  2IGM A;  4E7Z A;  4PDK A;  3KCC A;  1LI7 A;  1CF7 B;  4XLA A;  1M2V A;  2H1L A;  3O6B B;  4N9I A;  1QPM A;  2Z1D A;  4IZZ A;  3GBG A;  5M3F J;  3W6V A;  3KYC B;  3H1C A;  1VQO I;  3BTI A;  1GXQ A;  4RA2 A;  5CIV A;  2O3F A;  5L0I A;  2ZNZ A;  1WSU A;  2VBZ A;  2HYG D;  2LY1 A;  5JFR A;  1VQM I;  1T6Q A;  1J7K A;  3DZA A;  2BY2 A;  4ZJZ A;  3CQZ A;  5JS5 A;  4JW1 A;  1I1G A;  3NQO A;  4IL6 C;  3DE8 A;  3PJR A;  1LIH A;  2PI0 A;  3H2U A;  4WXD A;  2K27 A;  4H4K C;  2LRD A;  5DUK A;  4UB6 C;  3L2V A;  2CNW A;  2ZJP F;  4J32 B;  5COG A;  4DW6 A;  1V55 C;  3I64 A;  4UUS A;  3ERM A;  2NRA C;  3CSK A;  1S7O A;  4C9Y A;  3I3L A;  5GP9 A;  2HVS A;  5AGF A;  1S7Z A;  4E17 A;  3QPS A;  5L3B A;  4MVR A;  4E7L A;  5L3Q A;  3CCE I;  1GLN A;  4DIQ A;  1B8I B;  4U9E A;  3NMK A;  4LOC A;  2A1D D;  1EH7 A;  5B5E C;  3SP1 A;  2IA0 A;  3FDY A;  2M7A A;  2VJI A;  3H92 A;  1W5C C;  1MSF C;  4MQ9 F;  1H9T A;  4FE7 A;  4JBA A;  1JGS A;  4BQA A;  5LGT A;  1SFK A;  4IXA A;  1QSP A;  2M3A A;  4XSZ F;  2IBF A;  5KYY A;  3OSF A;  3L34 A;  2MLG A;  3I59 A;  3VEP A;  4ETS A;  2PMZ N;  2X48 A;  2OPT A;  5C44 J;  1Z67 A;  1HE1 A;  3HNI A;  3S29 A;  1I6X A;  4U7D A;  1NU9 C;  3ZWI A;  1R5G A;  1M57 C;  2RAE A;  3K70 D;  4IHV A;  1FFH A;  2A6E F;  3F23 A;  4KBL A;  3A03 A;  1LFB A;  2ZCW A;  2E60 A;  5EEH A;  1C17 M;  4Q4Z F;  2IA2 A;  3E5X A;  1NLX A;  1ZW3 A;  3JSZ A;  4MTD A;  5IPA A;  4XN0 A;  3OL4 A;  4Y15 A;  4BQQ A;  4D7M A;  2JX0 A;  5E20 A;  2W9Y A;  3U21 A;  4HFF B;  3CF5 F;  3E6D A;  1K4T A;  2EIK H;  1JOG A;  1VND A;  2PMU A;  3C7J A;  1UG7 A;  2DOF A;  5HS7 A;  4FIS A;  3GFI A;  2WBM A;  3KZY A;  1ETY A;  4R1H A;  4PR9 A;  3SYT A;  1M2V B;  4MGR A;  1LVK A;  3TQN A;  4LDK A;  5HDN A;  1SMY F;  3IRQ A;  4WGY A;  4UUV A;  3EGX A;  3UMI A;  2DYR H;  1X1P A;  2DU9 A;  3FKJ A;  1VQ4 I;  2HKX A;  3G2B A;  2CQK A;  5E3C A;  3WTY C;  1P6R A;  2X51 A;  3K7D A;  1O7F A;  4ENK A;  4GO1 A;  1IAW A;  3EYI A;  1YRN A;  4HZF A;  3NYL A;  1BJZ A;  2H09 A;  3OR1 C;  1WGX A;  2ACJ A;  3TJ6 A;  1WH7 A;  1ZHW A;  3IQC A;  4EGZ A;  1BBY A;  2G7H A;  1MSE C;  2O8X A;  2X6Y A;  4ZDO A;  2CG4 A;  2HQR A;  4C30 A;  1WI9 A;  3RPQ A;  2Y69 C;  3C8G B;  5E1Z B;  4N4N B;  3OS1 A;  1HW5 A;  2RDP A;  4UV8 A;  2OCC C;  2EA2 A;  1FNT c;  1YVI A;  3A1Y A;  3P9I A;  1A7D A;  2XAQ A;  2A68 F;  5BMZ A;  1IZ1 A;  4F93 B;  5B1A H;  5ICE A;  1ZQ3 P;  2PBE A;  3RZO J;  4ZZD A;  3UGP A;  2XPU A;  3NEU A;  2MYS A;  2DYS H;  1YZC A;  3RIR A;  2STT A;  2IW5 A;  2JQ7 A;  4OD5 A;  3O39 A;  2XSJ C;  4JUR I;  3DFG A;  2LD5 A;  2PX0 A;  1I3A A;  3TKY A;  2QSF X;  2YLD A;  3C8G D;  4O6Y A;  3OYG A;  3S28 A;  1FP1 D;  2R25 A;  2BE5 F;  1LEB A;  2CV2 A;  3K1I C;  4W1U A;  3CCY A;  3OS0 A;  5EEA A;  4J01 A;  5DUI A;  3B9Q A;  4X6A J;  1LQ1 A;  2CYD A;  3I56 I;  1TWH A;  2KIS A;  3CC2 I;  3FDQ A;  1MKM A;  1FR0 A;  5CLS A;  3O8H A;  4B1R A;  3IEE A;  3ASO C;  4M63 A;  3D0S A;  3K9T A;  4H54 A;  4IAO A;  5BQG A;  3UGO A;  4BY1 J;  3JR9 A;  1HXD A;  2BXZ A;  4OIP F;  3ZVR A;  1NG6 A;  2BY3 A;  2B9S A;  3KP6 A;  2KSF A;  1JR8 A;  2L81 A;  2ZJR F;  2WB7 A;  2FJ1 A;  4LLC A;  4ULW A;  4XWJ A;  5DQT A;  2JSC A;  3GTL J;  4EMS A;  2C04 A;  1JKR C;  3M4B A;  2BHY A;  4LB5 A;  1KU9 A;  2DA1 A;  4KIF A;  2JA7 J;  3AGT A;  3ZTM A;  1NSG B;  5GPG B;  3Q0U A;  5LFA A;  1KU2 A;  3BZ6 A;  2F4M B;  1D1B A;  5CI8 A;  3WE2 A;  1R49 A;  1H6G A;  1P7I A;  1A6Q A;  1YQA A;  2K9Q A;  3HKZ N;  2DPD A;  4IPA A;  4E0I A;  1OYW A;  2YU9 J;  4PJJ A;  1FNN A;  1RXQ A;  3L1M A;  5L0C A;  1BM9 A;  5EYR A;  5JLW A;  4BE2 A;  4PGG A;  1S6L A;  2J9W A;  2FE3 A;  2ME6 A;  3LSH A;  1T95 A;  3S1N J;  3SFI A;  4L5E A;  5F0H A;  4CH7 A;  2IJL A;  3CDL A;  2PX9 A;  4AM3 A;  2LQG A;  5DCM A;  4JZA A;  5CVJ A;  3RQF A;  1WKM A;  3HM5 A;  5IYB J;  1RR8 C;  5CVI A;  1SD5 A;  4YIR X;  1Y0N A;  1FBQ A;  1XB4 A;  3OYE A;  1S9H A;  2H94 A;  2KHM A;  2PFB A;  4M6X A;  3T1B A;  3TP0 A;  1FTZ A;  3QVY A;  2V3C C;  3BTL A;  5GAD J;  1MH4 A;  4PJM A;  2PN6 A;  3COA C;  1HDD C;  4S0H B;  3H35 A;  3HHH A;  4LDR A;  2W85 A;  2VKH A;  2MFZ A;  2Y2Z A;  5E1W A;  3ZMS A;  3IV5 A;  2AU5 A;  2LK4 A;  1W4M A;  2P6V A;  2A05 A;  2IOQ A;  2YS9 A;  2X1E A;  2H8W A;  4A0X A;  3JCU C;  3ZQG A;  3KE2 A;  3M3Y J;  3U2R A;  4I44 A;  3PFY A;  4IO9 F;  3BCB A;  1W1W E;  4BHP A;  4K0D A;  2Y0M A;  3ABL C;  3DP7 A;  4DZP A;  3GVA A;  1LFP A;  1WJA A;  1WVR A;  3U1D A;  3H3U A;  4GDF A;  5FD6 A;  3R0A A;  3L2R A;  2KIF A;  1ZG1 A;  3S90 A;  2PQ8 A;  3V8L A;  1DOV A;  1ZHZ A;  4RGR A;  1AEP A;  2D5R B;  2EIM C;  4WX9 A;  2PBI A;  4O5V A;  5CYV A;  2XB0 X;  1YTY A;  3FM3 A;  2A3S A;  1S5L C;  2CSO A;  2IVM A;  3KYD B;  1YI2 I;  3WE3 A;  3K4J A;  2DMQ A;  2Y0S A;  1YIT I;  1A35 A;  2HFI A;  2K9L A;  2E1O A;  2GM4 A;  3J80 K;  3P9C A;  1Z91 A;  2MD0 A;  1N25 A;  2L9V A;  2WZG A;  3BP8 A;  3U2M A;  2BVM A;  1JI8 A;  5EK0 A;  1T6S A;  1GQA A;  1OYY A;  3SJM A;  2YLI A;  4XK4 A;  1AU7 A;  3H36 A;  1FPQ A;  3MYI A;  4AVZ A;  2XDV A;  3T0Y A;  3SXZ A;  4FWV A;  3E3V A;  4DJA A;  1FX7 A;  2LD6 A;  2P0W A;  3DEU A;  4EM1 A;  1NHA A;  2FOW A;  4WGZ A;  1ETQ A;  4A2U A;  4JC7 A;  5JI6 A;  4EVI A;  4BNC A;  1FT9 A;  1B9M A;  4E7S A;  4IF4 A;  1ZGW A;  2JPU A;  1VF9 A;  1Z3Y A;  1T6I A;  3LFU A;  5DS4 A;  1T38 A;  3FWE A;  4G94 A;  3JRM O;  3TD7 A;  1YFH A;  3DF8 A;  2QEN A;  4RB2 C;  5A6J A;  3K4C A;  1JTY A;  2VCA A;  3E97 A;  5F6F A;  1E83 A;  3HRT A;  4WXH A;  3RSN A;  3IH3 A;  1ZG3 A;  2CH0 A;  1GDT A;  5DS9 A;  3RPU A;  2P1A A;  3KEO A;  3NWS A;  1QO0 D;  1TWH J;  2LP0 A;  3EQL F;  3RPU D;  4CSW A;  1G5Z A;  4J7Y A;  4PZJ A;  1I5N A;  2LCH A;  4AE4 A;  3JYH A;  1T98 A;  3H5N A;  2IT0 A;  3WTX C;  3CJR B;  2R5Y A;  4AIK A;  1VTN C;  1H0M A;  1VQP I;  1H7I A;  4A3M J;  3SDG A;  1MGT A;  3ABL H;  2VOO A;  1LJ9 A;  1TQP A;  4EV0 A;  1DPR A;  2ECC A;  4KMU X;  3CCL I;  2YVK A;  3MX3 A;  3TOL A;  1TR2 A;  2DGJ A;  1WQ2 A;  3EHN A;  4L6R A;  5L3V A;  1PD0 A;  3OSG A;  4I3M A;  4ENN A;  1BBH A;  1P4W A;  1OXB A;  1RNL A;  5KYU A;  5ILS A;  1LS4 A;  1OCO C;  3K4K A;  1G3T A;  3I0T A;  4P9T A;  4U0Y A;  4ON0 A;  4KMF A;  4KNW A;  2ZXJ A;  3CJT B;  4I2O A;  4BE0 A;  4CXF A;  3B0U X;  2RNG A;  3HLZ A;  2VJ5 A;  3ABK C;  1ETV A;  4L9J A;  3BY6 A;  5E3L A;  3A02 A;  3ML6 A;  4R79 A;  2ZJQ F;  2KJG A;  3RYL A;  1L0O C;  1QPU A;  3TUL A;  1XMK A;  2HTJ A;  4HF0 A;  1QHG A;  1X2M A;  2P81 A;  3OV8 A;  1G8X A;  5HLG A;  1A5J A;  4O7G A;  2VH3 A;  4CJG A;  2QVO A;  4NNJ A;  2LC2 A;  3AOU A;  1YJG A;  4U0V A;  5AC4 A;  2KP6 A;  3LA7 A;  3B6C A;  3TW7 A;  5IP7 J;  5J8C A;  1G3Y A;  4JRZ A;  4FQG A;  1KYW A;  1LVA A;  2W4S A;  3R2P A;  5J1Y A;  4HA8 A;  2NVY J;  3BOQ A;  2UZK A;  2VLA A;  1ZU5 A;  2R0Q C;  2ZXW H;  3SEZ A;  4RAG A;  5HV9 A;  4KNV A;  1GUU A;  3J81 K;  3G1O A;  2HOA A;  3U3B A;  1YRN B;  2I15 A;  2HOT A;  5KHD A;  5LEJ A;  2H8R A;  2JN6 A;  3RW0 A;  2BV6 A;  2ZJ2 A;  2V1U A;  5E3O A;  4N4W A;  2GWW A;  1T08 B;  2JZY A;  2W48 A;  2VI6 A;  3MBG A;  4PJ0 C;  2P6S A;  3GEE A;  5COF A;  2AO9 A;  1IJW C;  4HX8 A;  2LG4 A;  2E7X A;  3QVZ A;  3DEW A;  4V2F A;  4A3E J;  3H3Z A;  4YL3 A;  3LAJ A;  1K7A A;  3E6M A;  4II2 A;  2ZFU A;  1YYJ A;  4II3 A;  3JRH A;  1ORJ A;  3N05 A;  4GXO A;  4BQN A;  2LF8 A;  1Y56 A;  3T6B A;  4AYB A;  2ZXO A;  3BG6 A;  2MAB A;  2E87 A;  3DXJ F;  1PP7 U;  3F8M A;  3ASN H;  4HRI A;  3UMH A;  2CS3 A;  4EAT A;  2O0Y A;  5HDG A;  2ZO4 A;  3ZQC A;  1UFM A;  3BEH A;  2FQ4 A;  5IOZ A;  4Q48 A;  3CMM A;  1H8A C;  3WOD F;  5F08 A;  3IQ5 A;  3VOE A;  1Q0K A;  2IP2 A;  4HEA J;  3ZQY A;  2KRC A;  3ZQH A;  3B73 A;  5B1A C;  2QGU A;  1IZM A;  3EUH C;  2Q2E B;  2VJ4 A;  3NYM A;  4HX4 A;  5DVW A;  1B6A A;  1ZEL A;  2EBI A;  5FB2 A;  1ZGA A;  3V7O A;  5B1B H;  4XOP A;  4V2G A;  1X3W B;  2PJR B;  3BJA A;  3CC7 I;  2M8E A;  2NVT J;  4LIV A;  2YL0 A;  4M3B A;  1DPU A;  1PJR A;  2R93 J;  4EWC A;  2L7Z A;  1G6N A;  1H88 C;  1PYV A;  2KGO A;  3GTG J;  2QYO A;  4KIG A;  2Q0O A;  1VYI A;  1ETK A;  3LNM B;  3KFW X;  1OCR H;  4BKX A;  5JHU A;  3HOZ J;  1M2O A;  2LP4 A;  3I71 A;  2ID6 A;  1T0F C;  2XL6 A;  2MWQ A;  3Q7L A;  4CGZ A;  2CGP A;  1U9N A;  4IJA A;  2FBH A;  4BL0 B;  3K1N A;  4CS7 A;  3J80 Z;  1FOK A;  2FBK A;  1QBJ A;  2BGC A;  1N77 A;  1TWC A;  4EQQ A;  1YX5 A;  5EF6 A;  3LSG A;  4X0G A;  1D5Y A;  4RD9 A;  2L9N A;  3Q3S A;  4HNV A;  5GTH C;  4WCG A;  3FF5 A;  3SXM A;  4M3F A;  3HOY J;  4JCZ A;  3ZCO A;  2PX3 A;  5IOY A;  3RFY A;  5IP9 J;  5F64 A;  1J9I A;  5TRD A;  4QPQ A;  3GWL A;  3DM9 B;  5IT9 K;  1WJ5 A;  2PP4 A;  3RJP A;  4P55 A;  3KP7 A;  3BDD A;  1Z9C A;  2J7P D;  3G4Z A;  1O3T A;  4OIO F;  1SAU A;  4YII A;  1GHC A;  2JTV A;  4QDL A;  5J4Y A;  1PV3 A;  4BEM J;  3K4L A;  2M8G X;  4QWQ A;  5CVV A;  4XLP F;  2J9B A;  3W4Y A;  1V5E A;  2JRT A;  4O6J A;  5F04 A;  3AAF A;  3RQE A;  2K86 A;  3EHM A;  2KNH A;  1REP C;  1U0J A;  1SVM A;  3G1M A;  2I5U A;  1MMS A;  4CJO A;  5CI9 A;  3REO A;  3S93 A;  4IGG A;  3FBI B;  3K0L A;  4WWC A;  4BJ6 A;  2FNA A;  4BY7 J;  3BTJ A;  1ZR4 A;  1XGM A;  3EH1 A;  4I0B A;  3HEF A;  4Z2Y A;  3J7A O;  1FYK A;  1ZZP A;  3HUG B;  5ICF A;  3C3W A;  3KL4 A;  5LBQ A;  1ETO A;  2ZSI B;  5D8L B;  3VM6 A;  1ZAR A;  4M73 A;  4HSR A;  2B0J A;  3C63 A;  4LK0 F;  5TIS C;  1FP2 A;  4D4N A;  2O6G E;  3S3N A;  2Z5U A;  2NS7 A;  3AJM A;  1L7C A;  3AG2 H;  2STW A;  3EZH A;  1X1D A;  4U0W A;  3I5Q A;  2LVS A;  2G9W A;  3I58 A;  3FMS A;  3X1O A;  4I7H A;  2HEO A;  2GXG A;  3KKB A;  1MIJ A;  2M30 A;  4RMN A;  1FC3 A;  2L7M P;  3W6J B;  4C2T A;  5HNF A;  3CDI A;  1BI3 A;  1WPK A;  2MW8 A;  1G4U S;  2K85 A;  1Z7Q c;  1JXS A;  3TJ5 A;  3OA1 A;  2Z16 A;  256B A;  4CCL A;  4Y3O A;  1V4A A;  2WZF A;  4P1W A;  2XLO A;  3QTH A;  2DQR A;  4ITV A;  1WZ2 A;  4NC8 A;  1TWA J;  2FX0 A;  1TL8 A;  1SR2 A;  3MKY B;  2HOS A;  5EZG A;  2VT3 A;  3I4P A;  4F7Z A;  5JLX A;  2EB7 A;  3POV A;  3LS0 A;  1MH3 A;  3JZ0 A;  3K1P A;  2UV1 A;  3DV8 A;  3TL4 X;  3TMO A;  4ZYE A;  1UG2 A;  1K61 A;  1FMW A;  2XRH A;  3NG1 A;  1BR2 A;  3WHB A;  4EJU A;  4PFP A;  3F72 A;  1QZE A;  3L2W A;  4PUS A;  3FX3 A;  4NC6 A;  3QZC A;  3C18 A;  2L6F A;  3GYH X;  4G6D A;  2VT2 A;  1OW6 A;  4NY3 A;  4BH9 A;  2KPM A;  1FWZ A;  5AC5 A;  1S3J A;  2Y30 A;  5L3E A;  3HL2 A;  4IJJ A;  4ZLC A;  1B72 A;  3LQQ A;  5CQG A;  1LPQ A;  2F48 A;  1HW2 A;  1IG7 A;  3I5U A;  2DT6 A;  4MTG A;  4LLL A;  1IRX A;  2JRM A;  4IX7 A;  1NG1 A;  5F1R A;  3DPU A;  4HAM A;  2LFB A;  1OR7 A;  1F43 A;  4CCJ A;  4LDQ A;  3LUT B;  2Z99 A;  1IUF A;  3E6B A;  5J8F A;  3VYU B;  1OCT C;  5J6X A;  1U89 A;  4BBS J;  2DA3 A;  3IWZ A;  3HOX J;  4RS8 A;  3JTG A;  3VYS B;  4BHB A;  3CAX A;  3FAP B;  1SYQ A;  1K6O A;  2ZSH B;  2CFX A;  1LDK B;  2JSP A;  3R6S A;  2NS0 A;  1KU3 A;  3SQN A;  1UHW A;  1TQM A;  2MLK A;  4KN7 X;  2QA4 I;  4YT5 A;  3LSJ A;  5D5W B;  4NQW A;  4O3M A;  1EJ9 A;  2FGY A;  3DE9 A;  3U5S A;  1QVU A;  4MFD A;  2EIJ H;  5DD4 A;  2RC4 A;  4EUK B;  1BN5 A;  1ON2 A;  4AUX A;  3DTI A;  3LLK A;  2Y9Y A;  1C03 A;  4I1O B;  4Q7C A;  2KRF A;  5LGU A;  4D9J A;  5HVQ C;  1I4Y A;  2XAU A;  1JE8 A;  1Q0D A;  3PO3 J;  4ZYG A;  1YX3 A;  3F47 A;  4YL1 A;  3VSK A;  2QQ9 A;  4NC7 A;  4KT5 C;  4CCM A;  2V6E A;  3H9Q A;  4A3J J;  5FD5 A;  2PFD A;  4QPO A;  2TMV P;  3RKX A;  2GDC A;  4F52 A;  2E7W A;  1T39 A;  3E7L A;  3BC8 A;  2UXN A;  3HOT A;  2FML A;  2XGX A;  2PMZ A;  3HSR A;  4HG2 A;  1DUX C;  4EJW A;  2CUE A;  1IC8 A;  1VQ8 I;  2DAO A;  3CMY A;  2RGV A;  3CCQ I;  5J1R A;  2KDO A;  3TQO A;  2IS1 A;  3HZJ A;  2XC7 A;  1HCR A;  3U8V A;  2QQB A;  2DA5 A;  2XF5 A;  3FKI J;  3QOD A;  3QU3 A;  4MQV A;  2L7K A;  4B3X A;  3BR3 A;  3M7G A;  2IA1 A;  4IHS A;  1Y6D A;  4XLF A;  2BVL A;  4ANJ A;  4A6D A;  2WY7 Q;  5FRN A;  4YT8 A;  2QM3 A;  1VTM P;  3JRT A;  2KQ9 A;  2YHS A;  5FRM A;  4D1Q A;  5DM7 F;  2BW3 B;  3SHF A;  2HXI A;  1Y8Q B;  2M0M A;  2V1N A;  4HPQ A;  4DXW A;  5KYW B;  3BWG A;  2O61 A;  3HOW J;  1XSD A;  3F8N A;  1A6I A;  4CIP A;  2ISZ A;  3GME A;  2DCE A;  3ZGK A;  1W7P A;  2M87 A;  3X2Q C;  3DBR B;  2WAD A;  3MKL A;  2FSW A;  2R5Z B;  1LFU P;  3I53 A;  1GXP A;  3H2V A;  2M4G A;  2XPW A;  4FET A;  3V7S A;  1PVE A;  5KAI C;  1P9Q C;  2DBB A;  6PAX A;  1SVL A;  4HNT A;  4ZYH A;  2CQX A;  5IT9 Z;  2Q9C A;  2I8B A;  4RGX A;  4P6I C;  4N06 A;  1DU6 A;  2J45 A;  1M6T A;  2DT7 B;  2GIV A;  2ZXP A;  2P7V A;  3WHN A;  5A6A A;  2YWA A;  3GCM A;  4UVC A;  5C4J J;  3WG7 H;  3FXJ A;  3FXK A;  3SXY A;  1QRY A;  4G6T B;  2M9H A;  1LE8 B;  3U3F A;  4JTC B;  5F0C A;  1LS1 A;  3RKW A;  3JT1 A;  3RH3 A;  2V79 A;  4EM0 B;  2C03 A;  3ZOB A;  2G7U A;  3MVP A;  3DCF A;  4LJZ F;  3EJN A;  2HVQ A;  2ESN A;  1MNE A;  5K5Q A;  1D3Y A;  3B6A A;  3Q0V A;  1RR7 A;  3ZQV A;  1B4A A;  1IDY A;  1D0Y A;  1SAN A;  4CIH A;  3G6E I;  1OW7 A;  3PUB A;  1NTC A;  3DEE A;  2A5W A;  3M8J A;  5J1U A;  1OKR A;  3LSR A;  2LDU A;  3HYI A;  1JGG A;  4EJV A;  2R7V A;  2J46 A;  3K70 C;  3AG4 C;  2OCE A;  5DLJ A;  2ZNY A;  1I27 A;  3H9G A;  1VFC A;  3HOV J;  4UY8 I;  4OIR F;  3ABT A;  3F21 A;  1X2N A;  3JW4 A;  1WCM J;  2L02 A;  1MMA A;  2XLM A;  3CEX A;  2ZD9 A;  1SFX A;  2V6C A;  4UUT A;  2JA8 J;  4A3B J;  1GVJ A;  3US6 A;  1BC8 C;  1S7A A;  2TCT A;  3PQK A;  1GGQ A;  5K5O A;  3NYJ A;  2QWW A;  2Y3B A;  2FNP A;  3EYY A;  4IB4 A;  1RC9 A;  2P7C B;  4XEV A;  2UWM A;  1P92 A;  1OCZ H;  3GEH A;  3UMK A;  1P4X A;  2M7B A;  4CSA C;  3BG9 A;  4P5O A;  3OMY A;  2EPM X;  5KYY B;  4OAY A;  4B43 A;  2CW7 A;  1Y8R B;  1TQI A;  4DYQ A;  5A69 A;  2YX7 A;  2KL4 A;  4O6N A;  3NDB B;  1OCC H;  1O57 A;  5H6Q A;  1JJ6 C;  1TNT A;  1FIP A;  2L7F P;  2DMT A;  3QOE A;  5B1B C;  3CP8 A;  5DTD A;  4D0P A;  4E4H A;  3C2B A;  2VC1 A;  3QQA A;  3P7N A;  4G6Q A;  2QUP A;  5A2Q K;  5F28 E;  1Z6T A;  2AS5 F;  2AVK A;  3E5U A;  2NUT A;  1I1S A;  1U2W A;  4PCQ A;  2XXA B;  4RBO A;  3V5Z A;  1V3F A;  4F92 B;  2AQE A;  2NG1 A;  1LKX A;  2WVN A;  4EM2 A;  2O9L A;  4Z9H A;  1CQT A;  4GCV A;  3I54 A;  2E2H J;  1DDN A;  3F6V A;  2M64 A;  2EIN C;  5D91 A;  4DRI B;  4DRJ B;  3PNT A;  3DI5 A;  3F9K A;  2OEV A;  1A41 A;  4YEL A;  4OAZ A;  2WV1 A;  5K0I A;  4CS8 C;  5J3L A;  2HU9 A;  2HPM A;  1HMD A;  1P2F A;  4XL9 A;  1ZVZ A;  3DTK A;  2RKH A;  1XCV A;  4LER A;  4A0Z A;  1CGN A;  1MBJ A;  2R02 A;  3C2H A;  1XS9 A;  3AQB A;  3MFN A;  2XSD C;  5FFX A;  5KYW A;  2ZB9 A;  4BHC A;  5KYN A;  1MND A;  3PHF 2;  2GAU A;  2GLO A;  2MA3 A;  4CS8 A;  1Z63 A;  3FHN A;  1MMN A;  2M4K A;  5JVG F;  1E2X A;  4LIU A;  3OYF A;  4I76 A;  1TW2 A;  2X1D A;  1GS9 A;  2WWY A;  2DOE A;  4IVN A;  3L7W A;  4BJT A;  1HOM A;  4EBB A;  4N6C A;  2GIZ A;  1JPN A;  1WH5 A;  2K5C A;  4XPW A;  2QF7 A;  3O2P E;  3K4M A;  4JEB A;  1V54 H;  1K78 A;  4CSA A;  4XRS A;  1V5F A;  4BAC A;  3QMK A;  2VB6 A;  3K69 A;  3L2C A;  2FBI A;  4YFX F;  2NNN A;  2BYV E;  1YJ9 I;  1JPJ A;  4M9S A;  4BE1 A;  1HKT A;  4UVB A;  2OJQ A;  1OCP A;  2IS4 A;  2WAE A;  2UUI A;  4EBK A;  2KJC A;  2NVX J;  2EV6 A;  4OIQ F;  2OA4 A;  1ZR2 A;  4AC0 A;  3NWT A;  4AE4 B;  3AL0 B;  1WN0 A;  1R5H A;  5BQT A;  4Y7N J;  1MBH A;  3NKD A;  1NBB A;  3BLY A;  4PSW A;  2NNY A;  2UXX A;  2VQH A;  1SZI A;  2LR8 A;  1BR1 A;  2QCO A;  2Z33 A;  2YSR A;  3EPV A;  5D5X B;  1R36 A;  1S05 A;  3FXL A;  1TFO B;  3BZC A;  1FJL A;  2YL3 A;  1FIA A;  3OYI A;  3CCR I;  4C2U A;  3HB9 A;  1W0U A;  3ZMV A;  3LAY A;  4XRM A;  2VQG A;  4QLC U;  3CTA A;  4HW0 A;  4CUG A;  3OOP A;  1JHH A;  4OMZ A;  4YFN F;  2OD5 A;  3WU2 C;  1F1M A;  2LYC A;  4EGY A;  1A36 A;  3QW1 A;  2EFW A;  3CUO A;  1ZHF A;  3JRE A;  1OQC A;  3RQG A;  2PJR A;  5ED4 A;  4ER9 A;  3O8G A;  1J8M F;  1WRJ A;  2A0B A;  4U88 A;  1GT0 C;  1Z23 A;  4M3G A;  2WVQ A;  1E0E A;  4BXX J;  4PSX A;  3ZRG A;  3GWN A;  2JUC A;  4HFK B;  1NFO A;  3DWW A;  2VBY A;  4EEF G;  4L0Z B;  3UR3 C;  4BEH B;  2DA2 A;  1TC3 C;  2X4H A;  4S05 A;  3EDP A;  3M4C A;  3ZSU A;  3HRM A;  1Z6R A;  2JPC A;  3K1M A;  4HQE A;  2W57 A;  1DGW Y;  1XCB A;  2KW3 C;  4KFC A;  4BYY A;  1TNS A;  3HTS B;  3ECS A;  2MHR A;  3C8Z A;  1W7P D;  3N24 A;  1R22 A;  4ABZ A;  3HKK A;  2JD3 A;  3WU1 B;  5L0F A;  3FK7 A;  2Y69 H;  2E35 A;  3HJC A;  3EPZ A;  3TOA A;  1O3R A;  3VFZ A;  4M9X A;  3GZ6 A;  2G3K A;  3K2Z A;  1YAR O;  2F5C A;  2IAI A;  3HDD A;  3T4R A;  4CZZ A;  4JK1 X;  2YKZ A;  3O6X A;  1OCZ C;  2JUG A;  4CYC A;  1OIS A;  2QNL A;  4CO8 A;  4RB0 A;  1ZRC A;  1D8K A;  3EFO A;  2Z15 A;  3SXK A;  1APL C;  1ZGJ A;  1BOA A;  1G4W R;  3EGD A;  2RVC A;  1DP7 P;  2R9R B;  4MVU A;  3QW0 A;  2XXA A;  2WTE A;  4UV9 A;  2FF4 A;  4EJO A;  2RQQ A;  3D1N I;  4NQW B;  2V9V A;  1F5T A;  5E17 F;  3DBH B;  2A0U A;  1P4A A;  1ONV A;  1HDP A;  4A12 A;  2EPN A;  1HST A;  3KP3 A;  2DW4 A;  2R3S A;  3EUK L;  1J59 A;  4IRI A;  2I8D A;  1UMQ A;  2PMH A;  2TRT A;  1DP3 A;  3ESW B;  4GYI A;  4BJ5 C;  1OPC A;  3S15 J;  4ZTF A;  2GZW A;  5E33 A;  4C7O B;  2EIK C;  1CPR A;  2YL7 A;  3K6B A;  4Y17 A;  4IQJ A;  2R7T A;  2G0E A;  1Q0F A;  1OYI A;  1SMT A;  3OYB A;  1USS A;  1YW9 A;  4XNF A;  1ZTR A;  5LRS A;  2DB4 A;  1C02 A;  4EHP A;  1IV8 A;  1T6U A;  1IXS B;  3PDM P;  2JVG A;  4D4X A;  4FE4 A;  2F22 A;  4A5N A;  3CO6 C;  5EEG A;  4IHY A;  1WAS A;  3RVZ A;  1RI7 A;  1PP8 F;  2CUJ A;  3BR2 A;  4ASN A;  2CJJ A;  2B0H A;  4B44 A;  4U5G A;  2RD9 A;  3KYJ A;  4AID A;  2ELJ A;  2LKX A;  4IRU A;  1BL0 A;  2VQC A;  3FZV A;  1QGP A;  4DBQ A;  3VSL A;  2KQR A;  3HJE A;  1FOW A;  4KJZ A;  4A3G J;  4DVZ A;  2Y31 A;  2X6X A;  4AWX B;  4NTF A;  1IRG A;  1GM5 A;  2GXA A;  1VQ5 I;  1UHS A;  2EK5 A;  4GEH A;  4XSX F;  4AYB N;  1JUM A;  4L9N A;  5LD2 C;  2ZME C;  1WJC A;  2W24 A;  3TDZ C;  1AKH B;  5E3A A;  1MMG A;  4IOA F;  3LS1 A;  1Y4C A;  4I98 B;  1IRZ A;  3JRF A;  1WJF A;  3V8J A;  2HFH A;  2FOK A;  4J19 A;  1WOL A;  3IPM O;  3K33 A;  3OYM A;  1JTX A;  4RDU A;  1TWG J;  1QPI A;  3F8B A;  3ZQL A;  3CJQ B;  2NYX A;  1S72 I;  1UCR A;  4FT8 A;  4HX7 A;  1PDN C;  4AVP A;  1Q1H A;  2DXI A;  5GTI C;  1KZH A;  1LE8 A;  3Q9V A;  1IRF A;  1AA7 A;  3WG9 A;  3GLX A;  1YG2 A;  2IBD A;  2IEK A;  2A07 F;  1I5Z A;  2M1B A;  1Z7U A;  1TZL A;  3CUQ B;  2IXN A;  3HGY A;  2PJP A;  2LNB A;  3JTL O;  4YT4 A;  1WFX A;  1WI3 A;  2DTZ A;  2OF7 A;  3FBN B;  4RDA A;  3QU6 A;  5HLI A;  4C3J J;  1ODD A;  2L5Q A;  5EGO B;  2ZPA A;  1XD7 A;  1WWX A;  1D1C A;  2LY9 A;  3HBL A;  2HQA A;  4OIN F;  3A2K A;  3GTJ J;  1O87 A;  2VC9 A;  3S9O A;  5HS9 A;  1D1A A;  5FGM A;  1LE2 A;  3RKO F;  3IAS 2;  4RLF A;  2F2E A;  3KLN A;  2DFH A;  3EH2 A;  1SEU A;  3JRI A;  5K1Y A;  2CQQ A;  2NOJ B;  1JAF A;  1OW8 A;  4FAP B;  3ASO H;  3NRV A;  5FJ8 J;  2FAP B;  1TLH B;  3A9C A;  1U5T A;  4P96 A;  2IXS A;  2Y75 A;  5JT4 A;  2BZT A;  2DK5 A;  4GYG A;  1FBS A;  2LSE A;  1Z21 A;  2D4U A;  4V19 K;  1OQY A;  3TO7 A;  4DZJ A;  1B59 A;  1RPW A;  2UUZ A;  1ZK8 A;  5K7H A;  4W8K A;  3S0X A;  2F5F A;  2IXM A;  2VAS A;  1YJN I;  4R32 A;  4PJN A;  3B0V C;  2QEX I;  4P9F A;  1JT0 A;  1LPE A;  1QA6 A;  1N1C A;  1U5T C;  1JHF A;  2XF6 A;  5AIP A;  4WF2 A;  2CV0 A;  2Q3T A;  1Z7L A;  1TKN A;  3RCO A;  3DLA A;  3ZXS A;  2HDW A;  5FO5 A;  3HPH A;  1XSV A;  3WTZ A;  1E3H A;  5GAH J;  3C1D A;  2W25 A;  1AUE A;  3H5R A;  3OYA A;  1T2K A;  3GM1 A;  3BG3 A;  3ZQF A;  1R1V A;  3MWM A;  4LLE A;  1K6Y A;  4KT6 A;  4M3E A;  2P6T A;  2QY9 A;  1T56 A;  2XGD A;  2FFH A;  4Z9I A;  2IGO A;  3GEI A;  2B7E A;  2OU2 A;  4MO7 A;  2R7R A;  2HDC A;  5FCL A;  4C7O A;  2LMD A;  4HF2 A;  1YYX A;  1XG1 A;  2DOD A;  1N78 A;  1O7L A;  1YOV B;  5DM6 F;  1DU0 A;  2K9N A;  3GFL A;  2HJ3 A;  1NG7 A;  1W5S A;  2DMN A;  3DKW A;  2QE9 A;  2RN7 A;  1G2H A;  1R1U A;  1TWG A;  2P4W A;  1LM3 B;  3KP5 A;  1RZ4 A;  4F55 A;  1NK3 P;  4CBE A;  2O7O A;  5GAE J;  2ECB A;  3JAM K;  2EZI A;  5KNL A;  4JVS A;  2N8G A;  2V9P A;  3V7C A;  4ZYD A;  1QLE C;  3H5A A;  3NKE A;  1D0Z A;  2R92 J;  1F9N A;  3FIW A;  2I10 A;  2WL8 A;  5D4S A;  2HQ5 A;  2J5O A;  1YJW I;  2OTJ I;  3A0B C;  3DU6 A;  4PK4 A;  5DS6 A;  3E9V A;  3MEX A;  3O10 A;  3GTM J;  1K40 A;  4IAR A;  5FLV A;  1MBF A;  5DV5 A;  4JIO A;  2M5W A;  2LH9 A;  5D5V B;  2W84 A;  2Q2E A;  3AG1 C;  3TOB A;  3G73 A;  2IS6 A;  2QTV A;  3F0C A;  5K7F A;  1UHM A;  2BC5 A;  1YW7 A;  2RSE B;  3HUG A;  3MZ8 A;  3P9K A;  1Z3X A;  2X0L A;  2IXO A;  2L7A A;  2D45 A;  2OZ6 A;  4GRI A;  1GV5 A;  2LBF A;  3G50 A;  5FKO A;  1YDI A;  5GPA A;  1BI2 A;  2V1D A;  5EHH A;  1R5I D;  4C3B A;  2OG2 A;  2KIM A;  3TO9 A;  3QP6 A;  3RI4 A;  4CX9 A;  1MDM A;  3RKQ A;  1TP4 A;  5E1X A;  2VXD A;  2XPV A;  5E3N A;  4R8H A;  3AQC A;  4AD9 A;  3GOR A;  5IT3 A;  1ZU4 A; 
#chains in the Genus database with same CATH homology
 1R5I D;  3KPH A;  2OJE D;  2ICW G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...