2OJED

Mycoplasma arthritidis-derived mitogen complexed with class ii mhc molecule hla-dr1/ha complex in the presence of edta
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
214
structure length
214
Chain Sequence
SMKLRVENPKKAQKHFVQNLNNVVFTNKELEDIYNLSNKEETKEVLKLFKLKVNQFYRHAFGIVNDYNGLLEYKEIFNMMFLKLSVVFDTQRKEANNVEQIKRNIAILDEIMAKADNDLSYFISQNKNFQELWDKAVKLTKEMKIKLKGQKLDLRDGEVAINKVRELFGSDKNVKELWWFRSLLVKGVYLIKRYYEGDIELKTTSDFAKAVFED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Zinc induces dimerization of the class II major histocompatibility complex molecule that leads to cooperative binding to a superantigen.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain prec
total genus 81
structure length 214
sequence length 214
chains with identical sequence H
ec nomenclature
pdb deposition date 2007-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF09245 MA-Mit Mycoplasma arthritidis-derived mitogen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.530 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A mam-mhc complex, Chain D, Domain 2 2ojeD02
1.20.120.390 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hla class ii histocompatibility antigen, dr alpha chain. Chain D, domain 1 2ojeD01
3KPHA 1R5ID 2OJED 2ICWG
chains in the Genus database with same CATH superfamily
2YZSA 1PUFA 3W2VA 3GZ5A 5LHGA 1BI0A 5M3FJ 2RDPA 5A6JA 3K2AA 3BR2A 4I76A 3CZ6A 3PFYA 4A2UA 4N0BA 2HXIA 2WAFA 2OQRA 2JVGA 3WG7C 2NSGA 3F23A 3S90A 5J3LA 1ZREA 1XCBA 1HMDA 3GFJA 2E7WA 3HRMA 3B6AA 4EBJA 1HDDC 4A2NB 4ZZLA 1K05A 2WZLA 2MG4A 2VBWA 4UVCA 3CF2A 3J80K 4PFPA 1QSPA 1E0EA 3M1CA 2LSEA 2DOEA 3K2ZA 3LSGA 5L3CA 2M34A 2ELKA 3VYSB 4B3XA 5ICGA 4GYIA 1ERDA 3JRGA 4BJ6A 2EIMH 3HHHA 2L4AA 1ULYA 4ZLCA 1S6LA 1WJEA 1A41A 3FISA 3GLXA 3I71A 2L4MA 4BJ6C 1RIOH 2R7ZJ 3GANA 3HNIA 1T01A 1H89C 1V4AA 1YDIA 1T6SA 1BW6A 3M8JA 1N1CA 4NQWA 4M72A 4JW1A 4BU2A 4MQVA 3H9GA 4OAZA 4UVBA 2M8GX 4KIBA 2MC4A 3SZTA 4RDUA 1K4SA 4FTHA 1O7FA 2YU3A 3K1IA 4YFKF 2FJ1A 2XL8A 2LVSA 3JRCA 2EIKC 4DVYP 3K1PA 3WTTC 1Z7Qc 1VF9A 3DEUA 4PJ0C 3K4KA 2OV7A 1IN5A 3AQBA 5GPGB 3LSTA 1WJCA 2IXPA 3A2KA 2GBYA 1FBSA 1K83J 2PQ8A 2XAJA 2NVQJ 2L6FA 1BR2A 1MMAA 4XORA 2JT1A 4G0HA 2DPUA 4IWBA 3FXOA 1MH4A 1SVLA 1QLEC 3M1CB 2WAQA 4RLQA 3IQTA 1XX5A 2K3PA 1O3QA 1EA8A 3AL0C 1N77A 1OPCA 1RUOA 4AL0A 2EFOA 4YJWA 2WZGA 3PUFA 1ETYA 2BZTA 2WA0A 2F48A 4XSZF 2RN7A 1FC3A 4FX5A 3MYIA 4Z9IA 4QTRA 3LQQA 4C30A 3VB2A 1JUMA 1ORYA 2V79A 3L2UA 1FIPA 2LY1A 3SZRA 3O8GA 5FKNA 1ODDA 3CSKA 3EUHC 1D0ZA 4MVMA 1BW5A 4KDPA 1G3WA 1EJ9A 5AONA 2DDBA 1BOAA 4E18A 3QODA 3VEPA 2X6OA 1TWGA 4DJ9A 2ZFWA 4PACA 4LITA 2CU7A 3KPHA 4BYYA 1V74B 2DMUA 3HOSA 1SFKA 2KFDA 1VQKI 1FEXA 3E5UA 1T56A 3P9KA 3K1NA 5K5RA 3DM9B 2DA5A 2MHRA 3LSRA 3BP8A 3RVYA 4B1RA 4FX4A 2DN0A 3QPHA 1G6NA 2E1CA 3JRTA 1LIHA 4RAGA 3T1BA 3DEEA 3PNYA 1IXRC 3V4GA 2CCYA 2PX0A 2QNLA 1FNTc 1YITI 2L81A 3RF3A 3DPLC 4C3HJ 3P9CA 1UJ8A 3H9QA 1KQ8A 2NNYA 5JHUA 4E4HA 1I5NA 5D8KB 2M4GA 1Z21A 2W25A 2X4HA 3R4KA 5GP9A 3F9KA 3H3UA 1I5ZA 3SP1A 2STTA 5F1JA 3U2RA 1RZ4A 3SQNA 2HGCA 2ZMEA 2RVCA 3I3LA 3DAGA 2G7HA 3EZHA 2Q1ZB 1W5TA 2FQ3A 4E0IA 2RC4A 2L7MP 4EBBA 3H3ZA 1F36A 1XB4A 4BJ5A 4DJAA 1I3AA 2GZWA 1EQ1A 1JJ8C 4W8KA 2XAQA 3ULQB 3LAPA 4EM2A 3C1DA 1BIBA 1DQUA 3Q0VA 2H8RA 1BC7C 4MVRA 2IA2A 1LVAA 3BR3A 1IXCA 2BY1A 4ULWA 3SZGA 4BS9A 2OZUA 9ANTA 1Z9CA 1N75A 3TQNA 3GM3A 4CIPA 3K66A 1TWAJ 3J81K 1VQPI 2LRDA 3OV8A 1RETA 4A3EJ 1G3SA 2EZLA 2F5DA 2Y31A 3GX4X 3LFKA 1NBBA 1FLIA 4CGZA 3KH2A 3H3VK 5AIQA 3REOA 2V6EA 4BJ1A 4YL0A 1ONVA 1TWGJ 2DBBA 2K85A 3K1IC 4JC7A 1HW2A 3ABKC 3ZQIA 1WJDA 1JKQC 2R7SA 5FB2A 3K6BA 4AX2A 1PVEA 1UHSA 3E5QA 4N4OB 2NUTA 3MX3A 2JWTA 1OJLA 3GW2A 1IN6A 4A0ZA 4R8HA 2ZXWH 2BEOA 3NAUA 4B3AA 1PYVA 1AVOB 2M4EA 4CS8C 4KNVA 5FD6A 1GLNA 2M4KA 4D4NA 3FKIJ 3NMIA 1WFXA 4X1EA 3SEOA 3LSHA 4UHTA 3BTIA 4IRIA 5DTDA 3MFNA 3U3FA 1X1DA 2I5UA 3ML6A 4E7HA 1TFOB 4ER9A 1Y39A 1MIJA 3MZ8A 3ASNH 5CVJA 3SYTA 3L8JA 1ZVZA 2C03A 3OYJA 1RJ9A 2QSGX 4LB5A 5EEAA 3AG2C 4A3FJ 3OOPA 1YIOA 3DLLF 4BE0A 5B1BC 3TO7A 3A01A 2MD5A 2K02A 3U9GA 3L9FA 3ISPA 4EJUA 3QYFA 3F21A 2OU6A 4JEAA 2HZTA 3MCZA 5HODA 5J4YA 2JK3A 5M5XJ 4LG0B 4J32B 3KFWX 2OCCH 1W0TA 4V2FA 2IS1A 1OCOC 4U5DE 2YUSA 5DDGA 3BJ6A 1XPXA 2OUMA 1H0MA 2DO7A 4CA0A 3HBLA 2R5YB 3OYIA 3K70C 2EPKX 1QPIA 3I58A 3LLKA 1DGWY 2J9BA 4PSWA 2H7OA 4I01A 4YFXF 1OCRC 3CC2I 1IZ1A 2CNWD 2WAEA 5FGMA 3F46A 1AKHB 5EZGA 4A3JJ 3S1MJ 1B8IA 2EBIA 3FK7A 1F43A 2MFZA 3EJNA 3DAFA 3H5RA 4UUSA 2ZMEC 4IAOA 3ZWIA 4G6QA 1H9TA 1FYMA 3CJRB 2FMYA 2IEKA 5LRSA 3SJMA 4IL6C 3KP2A 1FTTA 1P9QC 3R2PA 3W8IA 3LESA 2H09A 2CQXA 3SXYA 2XGEA 2R02A 3U2LA 4F52A 2ELHA 3GWNA 1MBHA 1YFHA 1YLMA 2M5WA 2VQHA 3BCBA 3HXLA 4AYBA 4I6ZA 1YJ9I 1HKTA 1JUSA 3JCUC 2LH9A 1G3TA 2GWRA 4P55A 1V5EA 3G2BA 5BS6A 4MS2A 1LE4A 2DK8A 2LTPA 1MNEA 3GTPJ 1E84A 3L2RA 3SZPA 1X1PA 3H9JA 5E20A 4KI2A 1TP4A 1HW1A 4L18B 4AU7A 3M4OJ 2HJ3A 1JGGA 2NUPB 5DS5A 2GA1A 1P6RA 4L5EA 1TQGA 4P5OA 1VB5A 3ZVRA 2FX0A 2G0EA 3G3ZA 3CDLA 3EGXA 1HSJA 2MYSA 2IS6A 4RMNA 4DIQA 3TKYA 1PP7U 2O9XA 2ZXPA 4UUSB 2XF6A 4QIWN 2B0JA 4HSTA 3HOZJ 4HF1A 2PMZA 2ZXJA 2CW7A 4Y7NJ 2LKPA 2LP4A 4Q48A 3EGXB 2HYGD 4IXAA 4MTEA 2BY3A 4N9IA 4E70A 1X3ZB 3C62A 3I5QA 4YN0B 1GM5A 3RKXA 3W2AA 4EQQA 3T9OA 5JLXA 4XQ1A 3RQFA 5KAFC 5JRAA 2Q9BA 2J5PA 1B68A 3LA3A 3C2HA 3JR9A 1VQ8I 1VYKA 1YX5A 3BRJA 5F5FA 4KIGA 2ESNA 4LLCA 1WCMJ 1MNDA 4AL1A 3RIRA 1H9GA 1RESA 4OAYA 4ZTJA 2C04A 3X1OA 2VPRA 2KZVA 4KT6A 4OIQF 3S14J 2CQKA 3MZYA 1W36D 3V7OA 5BQHA 2HOEA 3HSFA 5FO5A 2VONA 3A9CA 1PUFB 4HFKB 4JJGA 1Y8QB 2E1MB 2DFFA 2X6YA 3HGYA 2O8XA 1GDTA 2W7NA 4XTKA 4LB6B 4XRSG 2A6EF 1CGPA 3PHF2 4ESFA 4LGWA 4BG0A 3QU3A 4JZAA 2W85A 3MMYB 1FFTC 4GYTA 2A0BA 3ECOA 3CQZJ 3GEHA 4AIDA 2VN2A 2EZKA 2IXOA 2DCEA 3JT1A 4NB5A 1JE8A 2FAPB 3PUBA 1LVKA 1WOLA 2QWWA 2GOXB 2LMDA 3RQ4A 4HEA2 2R5ZA 2EPNA 3BG7A 2AO9A 5F5HA 3GM2A 2IOQA 2K9LA 4C7OA 3HUGB 1SEUA 4U5FE 2IGKA 3FXMA 3WAQA 1HC8A 4AIHA 1BOBA 3CCYA 2BHZA 2HOSA 4CDGA 3Q9VA 4J7YA 3GTGJ 3DPUA 2OQGA 2H7VC 2HMZA 1XMAA 1MJ9A 2DA7A 2OBPA 2KRCA 2ZO4A 3EQLF 4EJWA 1ZRCA 4XEFA 1BM9A 2CMPA 3ELKA 5D8LB 3WG7H 4EEFG 1HA8A 3E7LA 4XLNF 2F6CA 1LPQA 5CQGA 3AG4C 2N8GA 4I09A 4JBAA 2PJRB 1REPC 2KKOA 4I99C 5KK1A 5B1BH 5KYUB 2PFDA 3RQGA 2R7DA 2DAOA 5CQEA 3RI4A 3ECHA 1VYIA 4DRJB 2DA1A 2ZXRA 3QAHA 4J19A 1SFXA 5CVUA 2QUFA 2YS9A 2CUEA 2YWAA 2ECBA 1DPRA 1GXQA 3PSFA 3DV8A 2W00A 2DFHA 1LDJA 2VJIA 3EYIA 3HOYJ 1QZEA 4WABA 1JGSA 5CI8A 1MBJA 5AIPA 4PDKA 2HS5A 2LFFA 3L2VA 3L7WA 5FKOA 1SD5A 1LPEA 5TGTA 5J8CA 3ABKH 1LE8B 2Z1DA 4A6EA 1AEPA 1ZAOA 3IAM2 3ZMDA 5ILUA 5KHDA 3NEUA 2BVLA 3RCOA 3HGGA 4G6DA 3AG3H 4OU0A 2EIKH 4KNWA 5IPAA 3NMJA 1UELB 5L0CA 4IO9F 3DU6A 2J7PD 2JSCA 2FUG2 3JSPA 1J8MF 1XG1A 3OL3A 4U0YA 5M5YJ 3PSIA 1XD7A 1Z1DA 3VAYA 1T98A 4RBOA 3GYHX 3OWTA 2ZJRF 1OCTC 3ECSA 3I5UA 3DPTA 5T1DB 1FP2A 2MA3A 1VQMI 1G4DA 1NFNA 3U3BA 5KVRA 1LQ1A 5JI6A 2ID3A 1U9OA 2L01A 2Y69C 4XPXA 4HDVA 2B0HA 4HLXA 4MLOA 3C8GA 4YL3A 1FZPB 3RH3A 1YW7A 2WY7Q 3H35A 5D5WB 3DQVC 2NAZA 1A35A 3MD2A 1LS4A 2BBYA 4YT4A 1QQIA 3VWBA 5TJJA 3F6OA 1BA5A 4A6DA 4W1UA 3G6EI 5L3EA 1ZW3A 1MDMA 3C8GB 3S1NJ 1LM3B 3BWGA 3PIOF 3DXJF 4JYKA 2BW3B 1NSGB 1OKKD 2R93J 1P4AA 2DOFA 2K86A 5EGOB 2P6TA 2PLYA 5L0DA 2E36A 2JRMA 1MW7A 5BQTA 1PP8F 5EEGA 4PJLA 3D5RC 4XOPA 5F1RA 5C4XJ 2L2OA 2VC1A 1YYXA 5AGFA 3F8FA 4N6HA 1FBUA 3QQAA 4LG3A 2KDZA 3I4UA 4NUBA 4IPAA 4BQNA 3ZQHA 2IW5A 4RGXA 2XRHA 2Z15A 4DRIB 2E2IJ 2HR3A 2LC2A 1VOMA 2Y3HA 3LA2A 3K4CA 2HSBA 3AFHA 2YHSA 2NS7A 4GXOA 3AL0B 3EPZA 1PDNC 1WGWA 2O61A 4B09A 2F22A 1Z0XA 1V55H 2CQQA 3DKXA 4WCGA 5FKLA 3BG9A 1MMSA 2G62A 5DYMA 1CGME 1E17A 3BC8A 4AIJA 1EKEA 4LLNA 3A02A 4OINF 3HSEA 5J47A 4IRGA 4O79A 4XR6A 1F9NA 4KIFA 3GUDA 1FTSA 2L9NA 2XSDC 1A31A 3Q0UA 3K33A 4H54A 2X0CA 2JQ7A 3DWWA 2JA8J 5J8FA 5L3FA 1Z6RA 3D5SC 2D5RB 5LHHA 3CMYA 1ON1A 2CQNA 2XPVA 1D0YA 3PNVA 4V2GA 2W45A 4JCZA 2Q0OA 1B72A 3V8JA 4BAYA 4JCHA 2XF5A 2LF8A 3W3CA 4CSAA 5IYDJ 3K1HA 3A1YA 2P7VB 3AQCA 1UG2A 4M6XA 2BV6A 1WPKA 4LFUA 4ZTFA 3EZIA 3LSJA 4KMUX 1X3WB 4G9YA 5DM7F 1KU7A 1I27A 1OYWA 2R3SA 3Q9SA 4IOCF 1M56C 2DMNA 3B73A 2CUZA 3OYDA 1FOKA 3FVYA 2GA2A 3H65A 5E2QA 3TOLA 3LJBA 1FR0A 4PGGA 4LK1F 2R7TA 1HQCA 2DK5A 4RD9A 4NDLA 4YT5A 1MNMC 3LEOA 2NS0A 4LK0F 2O5RA 2R7OA 3F22A 4UDVA 1B59A 5JS5A 2CGEA 1HW5A 1IJWC 4Q47A 4AE4B 3GFMA 3HJEA 1IDZA 4YRVA 3CCVI 1V54C 2NRAC 4C2UA 3FX3A 1XSXA 2A5WA 1QPUA 3J7ZI 2YEVA 3KP3A 1SD4A 4DOZA 1OR3A 1NG6A 1VI0A 1XS9A 4BE2A 2F5VA 3WGIA 3OYKA 3Q5FA 3HRSA 3S0XA 2VC9A 5D5UB 3FDQA 1U5TB 4G7HF 2I15A 4HNTA 3IWFA 3ROUA 3CTAA 4D5CA 1B6AA 5EZHA 4R79A 4XWJA 1E3PA 5L3VA 4MQ9F 3IKTA 5KYYB 4FASD 1IGNA 1B4AA 2ICWG 2L9JA 3FK6A 3K7DA 4KBLA 1D8JA 2A5YB 1CPQA 1DOVA 4UV8A 1YA9A 2YLGA 4YIFA 2H8AA 2E34A 5E1WA 3S2DJ 3B71A 1X3UA 2G3KA 4S05A 1K78B 2EINC 3VDXA 1VQOI 4R1HA 3NKDA 3LQRA 2P81A 2P7CB 3G4ZA 2H94A 1WI3A 3HOVJ 1VFCA 1TNTA 1EH8A 2PX9A 5BUOA 3EDPA 3VSLA 1JKOC 4U87A 2EFWA 4R32A 1XDUA 3BG6A 3DBHB 4RAYA 4CCLA 4A3BJ 1ZHXA 4B48A 4I1MA 5HV9A 2AWCA 2XLDA 2LKSA 1U6HA 2RNJA 3OEOA 1S8NA 1S9HA 3K7AJ 1GV2A 1PV3A 4OD5A 3UGPA 4KISA 5ERIA 1Z63A 2A1DD 3U8VA 3E97A 2CDQA 1W5CC 2B7EA 1D5YA 4XPWA 2YLIA 3U2MA 4XL9A 1OR7C 3QU6A 4CZCA 3FAPB 3K4LA 1VQ7I 5BMZA 4KT5C 1WTYA 4HV6A 3H5NA 2H1LA 4Y3OA 4E7IA 4MTGA 4NQWB 5LLQA 2DA6A 3JYHA 3O2PE 3JSOA 2L6HA 3PMRA 3ZIBA 3K4NA 1M57C 4IQ4A 1X4OA 2HV7A 5FCLA 3N97A 2ZPAA 4XM3A 1C17M 3DD7A 1IRFA 3ESWB 1E85A 3HTUA 3DCFA 2MSYA 4JTCB 1IUFA 2BW3A 3A03A 1UZCA 2GFHA 2D1VA 3GWZA 2ZJ2A 2KSFA 2XLVA 2LFBA 5J1YA 1XZPA 2ELJA 1QHGA 2I8DA 4HX7A 1G5ZA 1ZHTA 5KYXB 4IHVA 3S27A 1F4KA 1Z05A 5JT4A 3RYRA 2W82A 3A0BC 3C3WA 1HCRA 4I0AA 1V55C 2ZFUA 2Y2ZA 3B02A 3IH3A 5CVVA 1ACIA 3JTLO 3M3YJ 5FLXK 4A0YA 3NQOA 1IRGA 4EJTA 1E86A 3VSKA 2QTVA 1M2VB 3ZSUA 3OYAA 5K5OA 2F5CA 3E70C 4PUSA 4CZZA 3A4CA 5E18F 3DZAA 1K6YA 2A69F 3CCMI 3QWLA 1U5TA 2DA4A 5EGOA 4KA4A 1XMXA 2XL4A 3O6XA 4IEJA 2KW3C 4C3DA 2KIQA 2HWVA 4D4XA 3HRUA 3POVA 4BNCA 4EJVA 3S15J 5HVQC 2QBYA 3ABMC 5FKMA 1W1WE 1X1BA 3O39A 3CCJI 2LY9A 2X85A 4JX5A 4Y13A 1Q1VA 2BXYA 2YX4A 1Q0FA 2FEZA 5LGTA 1Y4CA 4S0HB 4LDRA 1BI2A 4FCYA 3G1LA 5C4JJ 4OMYA 1QVTA 2JD3A 2Z5UA 4HLYA 4Y15A 5EYRA 3CD6I 2VPLA 5E33A 4BXUA 2XHKA 1NK2P 2R05A 4MFDA 2IPQX 1UG0A 5TRDA 1I6XA 2RSEB 4YK5A 1JT6A 4NBQA 3QTHA 3P5JA 4EUKB 3AKZA 4G6TB 2Y69H 1J59A 1MKMA 4NTBA 2XAUA 3GLLA 1G2HA 4EGYA 3VYWA 2HQAA 1U89A 4YELA 3TW7A 2VCBA 2XPWA 2QSHX 4BBRJ 5JLWA 4FWVA 3JAMK 4XSXF 1R71A 4FT8A 3RZOJ 1Y6IA 3F8CA 1PUEE 3PQJA 2W48A 4C3JJ 2HFHA 4MHGA 1YYJA 2OG2A 4C2MJ 3I4MJ 3M15A 4YL1A 5FLMJ 4CSAC 2FU4A 1YO5C 3IC7A 1OFCX 3FXRA 3WU2C 4F7ZA 3JRIA 2UZKA 3I55I 1FYLA 2FGYA 4FAPB 4RAZA 3WE2A 1U3EM 2LBFA 4BQOA 4EM0B 1SZIA 1OXKA 1P92A 5JLIA 3IV5A 2XC7A 1KA8A 4E7KA 2BVMA 5DD4A 3KKBA 1YS7A 2OQMA 3GEIA 1K79A 2YPRA 3I0TA 4XBFA 1ORSC 4IHYA 1BBYA 4ESBA 3K70D 1RXQA 3BTJA 1P2FA 1OXBA 4U5BE 2LDUA 3DLAA 3W8HA 2OD5A 4IF4A 3ZQGA 1I50J 1U8RA 5GAEJ 2QCOA 4LIVA 4Y17A 1TWHA 1YE9A 2BXZA 2LK2A 3MQ0A 4BBSJ 3RYPA 1SFOJ 3WHCA 2EIMC 2FF4A 4CJOA 1ZLJA 2TDXA 2X51A 3VYTB 4KUMA 3MLGA 4HQMA 1IUYA 3CESA 3SDGA 1JHHA 1S05A 3F8BA 3LSKA 2JUCA 1O87A 1TW3A 1EA3A 1A7VA 1D3YA 1QNTA 3QW0A 4LDQA 3RW0A 2CH0A 2O3FA 3H0GJ 5FD5A 2OTLI 4F3QA 1DOWA 1UG7A 3GORA 3NRHA 1QHHD 3S16J 2VCCA 3RYLA 3DJUB 3I9V2 2VQLA 1SAXA 2Z9OA 4JEBA 4HYEA 2EJRA 4HRIA 1ZN2A 2XF7A 3K4JA 3QYBA 2GAQA 1DU0A 2NVXJ 3MEXA 3ABUA 2Q7RA 3V8LA 5EK0A 2VH3A 3EHNA 4RGRA 1OKKA 1SANA 2XROA 3WHBA 3ERMA 3JCUQ 1TWCA 2I10A 3U0CA 4EIYA 1WRJA 1D0XA 1KU3A 1UHMA 2HMQA 1MJBA 3UNGC 5K0IA 2WB1N 3BQZA 1ZKGA 2KZGA 2R7WA 2ZD9A 3KZIC 1E3OC 2IAIA 4QI2A 2KRFA 3W6KB 1K4TA 3OIOA 3CCQI 4NHJA 2J9WA 1XSVA 1V54H 2J46A 1EH6A 4U0WA 4DYRA 3L1PA 4I7HA 4FISA 2BE5F 1R1UA 2K40A 3BZKA 4AVPA 5LGUA 4HDUA 4OIOF 2K27A 5EDNA 2LFDA 2VC0A 3LS0A 3U1KA 3HTKC 5DEQA 4DYCA 4HQEA 1IXSB 2CQ7A 3BR0A 1YOVB 3FBIB 4M9SA 1YIJI 3CC4I 1RKWA 2ZXOA 3GEZA 4N06A 2B0LA 2Z33A 2NVUB 4YFNF 2DYRC 1FOYA 1KU2A 4IB4A 3CLOA 1LI7A 4QDLA 1RKEB 1SFUA 1Z91A 1NH3A 1UFBA 2LD6A 4DXWA 1U0BB 2ZC2A 2NG1A 2VCAA 5L0JA 1OR2A 2QY9A 1LDDA 4KYWA 3E3VA 2XGCA 3KYLA 2FD5A 5LBQA 3F47A 1FOWA 5E3NA 2NOJB 1VQ4I 4W97A 2E1NA 3R61A 1YW9A 2KNHA 4O3MA 2IGOA 3HPHA 5DD8A 5FKKA 2H27A 4RA2A 1PJRA 2XRNA 4JK1X 1W7PD 2UXNA 1ON2A 2XKOA 3JRAA 1A0BA 2KC3A 2YL0A 2XXAA 5BQGA 4L5IA 1VTNC 3ZQ7A 2WV1A 3WTXC 1LB2A 2HZDA 2RQQA 4PZJA 4B43A 2PEXA 3SFZA 1POGA 4N6CA 1BIAA 1RUNA 4CS9C 5FZTA 4ON0A 3ZN0A 2JPCA 4K7BA 5IP9J 3H2VA 3T4RA 4ZYDA 2OPTA 4BHCA 3WGHA 5E1XA 1QVUA 3L2WA 4I3MA 2F4OB 4IARA 4UB8C 1MBEA 2Y0SA 1UMQA 2HKVA 3LA7A 3WGGA 4MIMA 4L0YB 2GXBA 3S84A 2HOAA 3L09A 3EUKL 1BI1A 2A3SA 1ZG5A 1OCRH 3T5XA 1ZGWA 1O4XA 2R7UA 5ICCA 2B63J 4NC3A 4MTOA 3U8PA 1BJZA 3BG3A 5GTIC 4HE8D 1QZZA 5IP7J 5LRRA 5T3TA 1R22A 4YWQA 1YARO 3I54A 4HOBA 5ILSA 4PGHA 1DP7P 2LF7A 3GO5A 1XZQA 5A6BA 4LD5A 3DFGA 1UB9A 5B1AH 2HTJA 4K2EA 3OIQA 2FSWA 1ETOA 2M0CA 1QKRA 5CI9A 5D92A 3VFZA 2AU5A 5HSWA 3H1CA 2YSRA 2L7ZA 1RRJA 5E8IA 1Z5ZA 2Q9AA 2Y9YA 2E2JJ 3AJMA 4CCNA 2L0KA 2VOOA 1T39A 2BY2A 2KRHA 4KFCA 2QE9A 3ZQYA 4CS7A 4JURI 4GEHA 4XKBA 1FY7A 3IWZA 3MKYB 1TKNA 1WASA 4CJGA 1PD0A 3CUQB 1R5GA 4ZDOA 1BR1A 3AGTA 4RB3C 4DZJA 4BEJA 3U21A 3BTCA 2Y75A 2V1NA 2OJED 4M3EA 1LI5A 1D5VA 2NPUA 2HYJA 2H1KA 3CMAI 1V4RA 2VIXA 2XAGA 4G94A 4CXFA 3KYJA 1DDNA 5EHHA 3ZMSA 2HYFA 3IPMO 3FKJA 2IBDA 4AYBN 4II2A 2KJBA 2WY8Q 2ZJPF 4JTDB 3R7CA 3WTWC 4RLFA 4BH9A 2R03A 2DW4A 3W2WA 4WXCA 1AOYA 2UV1A 2DXIA 1OKRA 3FXJA 3I59A 3S3NA 5E17F 2KQRA 3TO6A 2DQLA 2WBMA 5HS7A 3QOEA 3GZ6A 2R7RA 3CMEI 2M8EA 2HSQA 1Q0DA 2LIGA 1MGTA 2ZXIA 4C3IJ 1WHUA 3AG1H 3LOCA 2VI6A 1FNNA 2EH3A 2XKPA 2BHYA 2OJQA 2EV6A 4CYDA 3FDYA 2CWEA 4D7NA 3HYIA 3X2QC 3M79A 4CCKA 4D9JA 4ZC3A 5A69A 3KLOA 2A6TA 1NU7D 4XLAA 2H6BA 1OW8A 3OL4A 4ZYAA 5T3WA 3ZPLA 4Y33A 1VQ9I 3DTKA 2HVSA 4XEVA 2P8TA 1OW7A 3Q7LA 2VKDA 3AOUA 5GPAA 3KP6A 2VOPA 3FMSA 3D5LA 3KZYA 4E7JA 3VYRB 3OYFA 1R36A 3DP7A 4G8XA 1WZ2A 3CUOA 2QENA 3WTSC 1UAAA 3EUAA 1A5JA 2QQ9A 1FAPB 3SNHA 3RJPA 1CPRA 4P1WA 2PX3A 3WODF 1M6TA 1IV6A 2VQCA 1WJFA 4K1OA 2R4GA 3OYNA 2VODA 3G50A 2H8WA 4KJZA 3FHNA 3HRTA 3F8NA 5HS8A 4X0RA 1SF8A 4BJTA 2IJLA 3CCLI 1GHCA 2O8KA 2UWMA 1FBQA 5DCFA 4IZZA 4Y52J 4JRZA 4CUGA 4KICA 4ULVA 4JE9A 4BY7J 3OYMA 3BPVA 3F8MA 2CFOA 2KL4A 4ITVA 1G4US 3FMRA 4IVNA 2M3AA 1BBHA 1NK3P 2F5FA 1W5SA 4MFEA 1NLXA 3FXHA 4O7GA 5L0HA 2GQQA 1K40A 2EA4A 2IM8A 3QMKA 4HNVA 1MQVA 2R9RB 4G7ZF 2DMTA 2FOKA 3HOTA 1FSHA 2YL7A 1U78A 3F3XA 2VBXA 3VYUB 3PNTA 5GTHC 5K7HA 3EPVA 2CG4A 4LIUA 5BQIA 3FXQA 3C2BA 2FMLA 4IAQA 1R1TA 3IAS2 2DYRH 5COGA 1Y56A 4M6VA 1QPMA 3OSGA 5KYWB 2L9RA 1KYZA 3R0AA 1LFPA 2KK1A 1LFBA 4K0DA 1ORKA 4OWRB 2NYXA 2P5KA 2NVTJ 3MYFA 5B3SH 3U9MA 2K4JA 2K5CA 2BL2A 4U5CE 3MWMA 1U2WA 3T8RA 1KQ0A 4N9HA 2Y48A 4PSXA 1RR8C 1ZK8A 1Z67A 4NNJA 2HOTA 2E5NA 4EHPA 3O55A 1Z77A 4JJFA 4A3GJ 4CO8A 1P4WA 1Q1HA 1XWJA 3R6SA 3Q6NA 3TP0A 3L2QA 1FPQA 2EPFA 2ETHA 2J8WA 1LUJB 1TT0A 2PG4A 3PM1A 3UMIA 2A0UA 5DS9A 2XB5A 4MVQA 5KCMA 4TV7A 4HBLA 2UXXA 1T8IA 4A12A 1MBGA 1GUUA 4B8XA 2VXZA 4IHXA 4BACA 2HU9A 4BUPA 5CKTA 4AE4A 4M3FA 1IRXA 5FRNA 3FHZA 3KP4A 3RFYA 1KYWA 1YJGA 4MNDA 5IYCJ 1LKXA 2GAUA 3M9AA 1ZU5A 3IEEA 3UMHA 3ASOH 2O6GE 2R25A 3I4PA 2ZJQF 4KITB 3FM3A 1SR2A 3BPXA 4A3DJ 2X1CA 3IUOA 3DTIA 3B29A 2DOAA 4I1OB 1RKTA 3GEEA 2X48A 2EZHA 4C2TA 5DM6F 1RPWA 1ZU4A 3HDDA 3QZCA 2RKHA 3I64A 2DTRA 2IBFA 5EGYA 1QU3A 3QPTA 4AIKA 4XEKA 3TQOA 1QGPA 1F1MA 3GODA 2FE3A 2GDCA 2ISZA 5HDNA 4XK4A 4H0EA 2XB0X 3GFLA 3WU0A 1FFHA 1JMWA 2EZIA 2W4MA 3HZJA 4L6RA 3C8GD 4MVSA 4M6YA 2L7AA 1IN8A 5E3LA 2EFNA 2IXSA 2AS5F 4FQGA 1AA7A 3DE8A 3HNKA 2A68F 2P6SA 3IHUA 3CCUI 5DQZA 2M7BA 1PCXA 2J9UA 2ZCWA 3Q3SA 2E35A 3IKVA 2Y3GA 2QQBA 1O3TA 3PJRA 1YA7O 5IY5C 4U7DA 1IRZA 1XGNA 2M1BA 2VLAA 1R4TA 2Q9CA 3G1MA 3GM1A 1ZTRA 1A04A 3ZQQA 1X1AA 2EK5A 3S93A 1ETXA 3JTHA 4JP0A 4MW3A 2L9VA 3KCCA 1ZR2A 3FM5A 4UXNA 4CDVA 3VPRA 4XMYA 4U9EA 2E19A 3A0HC 4MTDA 1T6IA 1Y8RB 4XRSA 2X9DA 2FOWA 2ADUA 3NRVA 3SEZA 3OYHA 1HY5A 1JUPA 2R7FA 2VQGA 3LMMA 1UCRA 1IAWA 4ENKA 3WTVC 5BNGA 3QVZA 4Z6YA 4EWCA 2JA7J 3NYJA 4AC0A 3PCVA 3TULA 2YQYA 2NS8A 2TRTA 1CF7B 1RKEA 4XONA 5F27A 1SVMA 3ABLH 3H0DA 1X19A 4GO1A 2RNGA 2LOOA 2P4WA 2MBFA 5F0CA 1X2MA 3OS1A 1L3LA 1PD1A 2AP3A 2TCTA 5E79C 2AVKA 2KQ9A 4JIOA 2GOMA 2FBHA 3O6BB 2QLAA 3CUQC 3KLNA 3ITFA 2JSPA 3CJNA 1G4WR 1O5HA 4E0HA 3OR2C 3JRMO 4MVOA 1IN4A 1BDJB 3HNJA 4NQFA 4ZJZA 5H6QA 4IHWA 3BJOA 1FMWA 1ZHFA 2DFEA 2QGUA 4A3KJ 3G71I 3V5ZA 5CJ9A 1XC5A 4YEJA 4B47A 1AKHA 3DI5A 2ETSA 3U5SA 5HNHA 1GVDA 5CIVA 4IKFA 3PL8A 1OQCA 1KQ9A 5GPCA 2Y3DA 2O0YA 4ONSA 2COBA 4YT2A 3TMOA 1MBFA 2H6CA 2HPIA 4A0XA 3KYDB 1JPNA 2XV4S 2WZFA 1T2KA 1H7IA 3TOMA 1MMGA 5H6RA 2JJ7A 3J80Z 1VLSA 2LP0A 4YG2F 3RQIA 3SFIA 4HSRA 1HLVA 1T9KA 3EH2A 3W4YA 3CJQB 2HVRA 2J0XA 3V5XA 5L0IA 4M3BA 1V3FA 1TQPA 3OIPA 4Y4RA 4OMZA 3TO9A 2FBKA 3EFOB 4PCQA 1R4MB 5L3QA 3VM6A 2QLZA 2KMUA 2J5OA 3FXUA 3LS1A 3R0JA 1BR4A 1GV5A 1ZG3A 5DUKA 2D4UA 2KJGA 3GMEA 1NG1A 1K7AA 4U5HA 1MD0A 1R9TJ 1C03A 2NUTB 3C7JA 5J40A 1FJLA 1O7LA 2EB7A 5IP6A 4A3CJ 2OKUA 1C0WA 2P1AA 3O10A 2R0QC 2KJCA 1YHQI 2XVCA 3US6A 1BI3A 2V1UA 1TLHB 2K7LA 3JTGA 1WI9A 4O6JA 5C44J 1NG7A 5L3DA 3S28A 3PO3J 2PMUA 2PI0A 1APLC 4C3EA 1RNLA 5K1YA 5BOXA 3DKWA 4M9XA 1Z3IX 5D5VB 2D1HA 5DLJA 3C2GA 3T6BA 3B0UX 3S1QJ 3JYYA 2VL8A 2VUMJ 2XL6A 2MW8A 2E87A 3GTQJ 2LLKA 3K0LA 4FHTA 1XDSA 5IOYA 3S9OA 1A6QA 2ME0A 2E60A 3ZR8X 5COFA 1IZMA 1F1ZA 4FESA 1WJAA 1CGOA 4U0VA 2KP6A 1NZEA 4Q7CA 2WC2A 2E1OA 3ZMUA 2ZSIB 5A6BD 3EGDB 4HA8A 1MBKA 3CCEI 3FXKA 3M8FA 2J0WA 5F64A 3L8IA 2HI3A 2PBIA 2LBFB 5B5EC 2PJPA 5GADJ 4F92B 3SXZA 2EFQA 3Q7GA 4WF2A 2J9VA 4XLCA 1R58A 1AUEA 3MN2A 2HPMA 1R6RA 4IQJA 1YJNI 3J7AO 2XLHA 5JVTA 2JA5J 1Q0GA 1LS1A 4EBKA 4L0ZB 3TP3A 1YZCA 4J01A 4GYGA 5GAHJ 4PJNA 2Y39A 3ONQA 1WWPA 3ZGKA 2L3DA 1H88C 3ZTZA 3ZCOA 3NG1A 2M9HA 2LY2A 1B72B 4LACB 2L54A 3P9IA 1SFEA 3DKYA 2OAZA 4BEHA 2XLMA 1TR2A 4BPMA 5K5QA 1J7KA 3DKAA 5FROA 4LLEA 4C7OB 5L0FA 1N78A 4G7OF 2GIVA 2KLOA 5L0GA 2CUJA 4A4AA 4JKVA 2NOGA 3JSZA 2F4IA 1SC7A 5AC4A 2QF7A 5HLTA 2IXMA 1QZYA 2OZ6A 4XRMA 1Y0NA 1W7PA 1GQAA 1W2WA 5ED4A 3UGOA 3BT9A 3W6JB 2EINH 2V7FA 4MVZA 3RTRA 4EVIA 256BA 1WWXA 1EI7A 1HF0A 2XLOA 2XM0A 2STWA 1VTMP 1LE2A 3H5AA 1O3UA 4IHSA 4WXHA 1JJ6C 1WQ2A 1HSTA 3DBLB 2DT6A 3CDHA 4QPQA 4RB1A 4BY1J 4HV5A 4Q4ZF 3ZOBA 3TJ5A 5AC5A 4B6IA 3B9QA 2MH9A 4QSHA 2WL8A 3KZZA 5EF6A 1D1CA 1S7AA 1OCZH 1APCA 3HM5A 3HOWJ 4JTAB 1TZLA 1TBXA 3IP4B 1AU7A 4F91B 1E83A 4XKWA 2RGVA 3CO6C 3S3MA 3J06A 2JZYA 2YR2A 4XLFA 4BDZA 2WB1A 2M87A 4BQAA 1RC9A 5EG0B 1SYQA 2VE8A 4MTFA 2K4BA 3NMKA 1Y1VJ 3CO7C 2V6CA 3E0JB 2GLOA 1HOMA 3MVPA 3KETA 3MAJA 3G4XA 3KEOA 3SXKA 4LG0A 3PDMP 2LR8A 3L34A 2MD0A 4N4NB 1ZR4A 2XS8A 2PNOA 3BTLA 1S7EA 2JMWA 5HNFA 1YLFA 2W9YA 2FQ4A 4MNUA 3HNLA 4Z2YA 1K6OA 4RBNA 2O03A 1O57A 2ZB9A 3JW4A 3ATPA 4KNYA 2GXAA 3H2UA 1I6HJ 5IT9K 4EGZA 2M2EA 2NXNB 3C18A 1RMVA 3WTUC 3ZQVA 3H36A 4EATA 2IT0A 2ZXHA 3SXMA 3ZMTA 3N4MA 4AWXB 2A61A 1Z6AA 1S3JA 3LSMA 2BOLA 4A3IJ 3GTLJ 1QZXA 2UUZA 1T38A 3J81Z 1ETQA 3HHGA 3P7NA 1J8YF 4WJ0A 4HNUA 1ETKA 1P7IA 2R92J 2BY0A 2FBIA 2IA1A 3RSNA 1JOGA 2CW8A 5M5WJ 1T33A 2HQ5A 2COMA 2M64A 3LLIA 1AHDP 1KGSA 3IQ5A 1WKMA 2IVMA 2EWNA 4I0BA 1XGMA 1CQTA 4AUXA 4IOAF 1R23A 3IRQA 3FOPA 2WTEA 4D1QA 1HE9A 3E6DA 4M3DA 5F28E 3RKYA 3OSFA 2HEOA 4X6AJ 1DGRM 3HUGA 1S5LC 4H4KC 3CQZA 3V7CA 1JKRC 3K9TA 4HG2A 2V26A 3PFIA 4GCVA 5FJ8J 1NHAA 1OR7A 2IGMA 3QP5A 2WWYA 4ESJA 1K78A 1F5TA 4BXXJ 3EYYA 3A11A 3EFOA 1YX3A 3HEFA 4WGYA 2KYHA 4CS8A 3ZDLA 5J6XA 1O3RA 2CV1A 3NDBB 3HKKA 2WVQA 1JTYA 4BXFA 5D4RA 2GM4A 4I2OA 3EG9A 3KEQA 4EM1A 2LREA 4DQ2A 4ENMA 1HMOA 3LWFA 4B4CA 5DUIA 3NYLA 3V5YA 2IYLD 4CYCB 4NCQA 3K1MA 3BJAA 1TWHJ 5E3CA 1R00A 1XTAA 2F2EA 2ZSHB 5D6FA 3PIPF 1O3SA 3DEWA 2JX0A 1T08B 3CJTB 3Q0WA 3GWLA 2ASRA 1CGNA 3RVZA 4JQFA 1VQ5I 1JAFA 4J30B 1YZAA 1QRYA 3TL4X 4XLHA 5ILVA 3FMQA 2Y9ZA 3V8KA 2CFXA 2VBYA 1Y1WJ 1Z7UA 2KIFA 4E17A 2JVHA 4BKXA 2CYDA 2LK4A 1U0JA 5EG0A 4E7LA 3QP6A 4XPYA 3OYEA 1YAUO 3L00A 2KPMA 2KHMA 2XXAB 4G12A 4NTFA 3BG5A 3BROA 1ITYA 2K9NA 3FWEA 5A2QZ 2VXDA 4CX9A 5KYNA 1JHFA 1FIAA 1W36C 1J5YA 5A2QK 3LAJA 5BPDA 2DYSC 3K4MA 1YS6A 1H8AC 5IYBJ 2HDDA 4LDKA 5HLIA 4P9TA 2FNAA 4HW0A 1JI8A 3RZDJ 5CYVA 1FTZA 3NKEA 1RJ9B 1ZYRF 2L02A 2OTJI 1ZGAA 3E6BA 3K10A 5D5XB 4HZFA 3QPLA 5F0HA 2XAHA 4S04A 1YVIA 4RAFA 1JPJA 3HTSB 1HBXG 4U9DA 2QYOA 1YG2A 3T0YA 4AVZA 1LE8A 1M2OA 3B0VC 4HEAJ 2MC3A 2EV0A 1RI7A 2DU9A 4NC7A 1G59A 2OCEA 5F08A 3JZ0A 3IRRA 3AG3C 3KIOA 1KONA 2ISYA 3GZNB 2AXTC 1ZQ3P 2QKLB 4PFOA 4GDFA 3IQCA 2P7VA 3VF0A 1L0OC 2CUFA 3JRDA 1CF7A 2HTSA 3JRFA 1BC8C 2PN6A 1ETWA 1I1GA 3AG1C 3BR6A 4WXDA 1K61A 1UHWA 1RCPA 2OEVA 2RREA 3I5PA 1ZHYA 4ZYEA 3VOEA 1TTYA 4ZYGA 3EHMA 3HSRA 3AAFA 1DUXC 3KL4A 3KP5A 3GVAA 3G73A 1Q0MA 4Z9JA 2R7VA 1IG7A 1XGSA 1ZELA 2ESHA 3MZHA 5BPIA 4RB0A 2OOCA 5D4SA 5H20A 3SYNA 2X6WA 2YX7A 4AM3A 1OCCC 4F4BA 3BR1A 2CJJA 5B3SC 2K9QA 1KZHA 1OCPA 2B9SA 1SVOA 3CP8A 2LD5A 5COMA 2O9LA 1X58A 3L0IA 1U6GA 3GF2A 4IRHA 1MSEC 3NWSA 1KTMA 4BHBA 4I44A 1Q0KA 1SMTA 4RM2A 4XQFA 4A69C 2XS1A 1P4XA 3FXLA 4IJJA 2LNBA 3TDUC 2OA4A 4GRIA 5HS9A 1L3PA 3AGUA 3JRBA 4LJZF 5K7FA 4YIIA 1HXDA 4EKWA 1S7OA 3CLQA 4JX6A 3S3OA 2JTVA 3BR5A 2QSFX 3DF8A 2M0MA 4ZYHA 1ST6A 3HG9A 2W4BA 3S2HJ 1OMIA 3SDBA 3NYMA 2F5EA 1WJBA 4WX9A 5FLXZ 3LNMB 3DU5A 4P9FA 2Q8KA 5B3IA 2QZ8A 2HJMA 4CDAA 3BOQA 2A05A 2ZMEB 2VJJA 4XRFA 3BQYA 1Y0UA 2DMQA 2F4MB 1GT0C 1U5TC 3CCRI 2XSEA 3OS2A 5B1AC 1I39A 2HKXA 4BHPA 1ETVA 1MZBA 4UUTA 4HFFB 4GGGA 3CC7I 1J75A 3HOUJ 2Y0MA 2YL3A 1TQMA 1WH5A 5JR3A 1EH7A 2A6HF 3V42A 4U7BA 5GAGJ 1I4YA 2VT3A 2XIGA 5JVGF 2WV0A 2HV6A 4U5GA 4BL0B 1ORJA 4L9TA 4WK8F 3HKZN 3FBNB 2HDWA 2HVQA 4CCOA 1LFUP 4M71A 1Z6TA 4L9VA 4YT8A 3LL7A 1EKYA 2BGCA 2NNNA 4BJ5C 1TWAA 4OD4A 4IX7A 2K3FA 3ZQLA 4DRHB 2R7XA 2OEXA 4LOCA 5FLVA 4O6MA 3GXOA 4MGRA 1Z7LA 4XICA 2HQNA 3OY9A 2HUJA 3BZ6A 1E3HA 2QA4I 2CSOA 3N2ZB 3U1DA 2WAQN 2V9VA 2DFIA 1FP1D 4LMYA 4RM3A 4FE7A 3WHNA 1C02A 4J7TA 3SHFA 2ZKZA 2DGJA 3KMIA 1T0FC 1GGQA 2RD9A 2DA2A 5D91A 2KDOA 2X0LA 4EJOA 3GFIA 4UVAA 4YIRX 1VQLI 4DW6A 5DS4A 3NWTA 1WGXA 2WB7A 5JVEA 2CW0F 2JA2A 3ZMZA 1S72I 3ABMH 4I98B 2Y30A 3DWLE 3R60A 5DV5A 3GTJJ 1QVXA 2J7PA 1N25A 1QQ3A 1XMKA 4ENNA 5IOZA 5E1ZB 3LAYA 4XKCA 2GWWA 5KYWA 5LEJA 2CRGA 2CS3A 3N05A 2C6YA 3LNRA 4NY3A 5B66C 3TOBA 1FT9A 2OF7A 3CEXA 1TC3C 3LFUA 5HLGA 3VRCA 1ENHA 1JR8A 2XGXA 1TW2A 2L7KA 3RDIA 3S1RJ 3K69A 2EIJH 5CPRB 1ZG1A 2CNWA 2V9KA 4FETA 3DM5A 3FAJA 4PJMA 4XNFA 1I1SA 2DDAA 1R5HA 2ZXWC 1B8IB 3E6MA 4XN0A 2XGDA 5LHIA 2JPBA 3ZN1A 3KEYA 4BDYA 2R7QA 2W24A 1JTXA 1TFKB 2Z99A 3HJCA 2PMHA 4ABZA 4CBEA 4E7ZA 3ZG1A 1WSUA 1DP3A 1NFOA 2VKEA 3GTOJ 1OCOH 2OU2A 4QWQA 3CCSI 2K9SA 2Y3BA 2GXGA 1GVJA 1S29A 2YRFA 2DQRA 1LEAA 2DMPA 2PP4A 4D7MA 3MKZA 4MEXF 1P7JA 1RR7A 3C8ZA 3LSPA 3M8EA 3GTKJ 5A6KA 4AD9A 5EJCA 2JUGA 3MKWB 3L1MA 3KX2A 4KN7X 1VQ6I 4MVUA 3X2QH 2HKOA 3COAC 1UFMA 4CCMA 1ZHZA 3HL2A 1BN5A 4M9ZA 2G9WA 4KMFA 4UNOA 1ZGJA 5A6AA 4P6IC 1MJAA 1RKCA 2YKZA 4MW8A 5C3EJ 2NVYJ 5HLHA 3JAMZ 2XPUA 1OYIA 1B9NA 1W7PB 2LKXA 4JOMA 2E71A 2L7FP 3VODA 2FRHA 2D5VA 1TQIA 4DGWB 3AG2H 2QBYB 1XCVA 3LSIA 2LQGA 3HC7A 4HX4A 2VASA 4O5VA 3MBGA 1WVRA 2X6XA 2KIMA 4EMSA 4RB2C 2BYVE 3ZMVA 5JHFA 4XLEA 2GIZA 3TOAA 1FOXA 2VE9A 3RPUD 3BDDA 3G4SI 3EH1A 4D5FA 3RPUA 2M7AA 2V9PA 4ASNA 3C63A 4C3BA 1XGOA 2NUPA 1LJ9A 5E3MA 2QUPA 4QPOA 4HPQA 5J1RA 2IS2A 2IGNA 3T6GB 3CF5F 5KAIC 2VBZA 3IL2A 1HKQA 2NSFA 3H92A 2Q3TA 4KN4X 3RKWA 3I53A 2L9SA 2CV2A 2AHQA 3QPSA 2MH2A 3IQ6A 3QVYA 1TWCJ 5ICFA 3RKOF 2XM4A 3WTZA 3EETA 4A5MA 3ZQCA 2Q4FA 4A93J 3OS0A 4CICA 3M4BA 4G78A 1QO0D 2P5LC 1J9IA 3V7SA 1NTCA 2M30A 4J00A 2E7XA 3UKGA 3BZCA 5CVIA 4BQQA 2TMVP 1IV8A 3ASOC 4M73A 1ZW2A 5TJ5E 2W57A 2X1DA 1X4PA 1W0UA 3ZC4A 4I02A 2DJIA 5EEHA 3WE3A 4X0GA 4P9UA 5ICEA 2YL1A 4GFBA 3WG9A 3RQEA 2WADA 4CDYA 2P61A 3IH2A 2R5ZB 4XLPF 1LEBA 2X1EA 4V19K 4M63A 3TJ6A 3DMDA 4IRUA 2Z16A 3RIPA 1J2XA 3KYIA 1IO2A 1FSEA 1X1CA 1WN0A 4RDAA 4DVZA 1R4NB 2EFPA 2PBEA 1VMAA 3OMYA 2H7BA 1Z3XA 1IDYA 2MWQA 3BCAA 2PMZN 3T8TA 1V5GA 4IHTA 2MGQA 2IXNA 1YW8A 4CIHA 4ZDPA 1U8BA 1X2NA 2E5ZA 4U5EE 1EF4A 5FFXA 3KYCB 4QLCU 3HOXJ 1BJAA 2EQRA 1R1VA 2JRTA 2DYSH 3CAXA 2Q2EB 2FNPA 5JP7A 1TNSA 2AXLA 2QM3A 3JREA 2XSJC 3IH4A 3RPQA 3GTMJ 2WVNA 3M4CA 5FFZA 3CMMA 1ZRFA 2G7UA 5HDGA 1M2VA 2XLEA 2E1MC 1IW7F 2EIJC 5JSLA 1B1BA 2K9MA 3UMKA 2CGPA 2VKHA 2Q2EA 2JN6A 2P5VA 3DBRB 2EA2A 5J4VA 2BC5A 4HF2A 3N0TA 2DA3A 2W84A 1KNYA 2Z2SB 5IT9Z 2YVKA 4L9NA 4JX4A 2RV8A 5HOOA 3E6CC 4RGSA 3JRHA 1OCCH 4O6YA 2ECCA 3CDIA 4II3A 5KYXA 3TEDA 1S7ZA 3M7GA 5F0FA 1U9NA 1J0RA 3BY6A 2DI3A 3F72A 4AK9A 4BE1A 3SEQA 4HX8A 3F0CA 3Q6MA 2XUBA 2PF4E 2Z3YA 4E7SA 5HDKA 1A6IA 2ZNYA 1USTA 4MEYF 4RS8A 4BEHB 4L5JA 3OYBA 1ZRDA 4F55A 5L3GA 1OW6A 2EV5A 4E6KG 3GCMA 6PAXA 1SMYF 1OLTA 1D1BA 2DT5A 2V1XA 4C9YA 1G8XA 5CLSA 2ACJA 2KISA 2FA5A 3HKZA 3S8PA 2I8BA 3V7RA 2L6GA 3DTEA 1I3QJ 2XASA 4IJAA 3W6VA 4N4WA 3KE2A 2PJRA 3ZQFA 1M1EB 2RAEA 1YRNB 4DZPA 4A3LJ 2ME6A 2AQFA 2LSOA 1FX7A 3QRFF 4Q5SF 2CV0A 2EPMX 4L9JA 3F6VA 5DCMB 3EG9B 2EILH 3LUTB 4P96A 3OOUA 2CO5A 3JSEO 2AQEA 5TISC 1YTYA 3QYEA 2MABA 4W8PA 4B44A 4OIPF 3EGDA 4A5NA 3M07A 1STZA 4FX0A 2V4JC 4M74A 5IT3A 2DJNA 2FXAA 4UY8I 2L5QA 5CVRA 1DU6A 3G1OA 4EV0A 2IS4A 4DBQA 1Z3YA 3ASNC 2DT7B 3ZTMA 3WTYC 1MH3A 2QVOA 3ZRGA 1T5OA 1WATA 2HDCA 2AWYA 3ABLC 3B0PA 2ID6A 4U88A 3HLZA 3WU1B 3DJNB 2QQ8A 3ERED 2VT2A 3HPGA 3I4NJ 1HDPA 2OCCC 4Z9HA 3QOPA 4ZDLA 4ETSA 1I4ZA 1E2XA 1A7DA 1T6UA 3U9JA 5JUAA 3CP2A 4PK4A 1GS9A 2W1OA 3LEVA 3M1EA 4QI0A 1ZZPA 2D45A 4CH7A 4LLGF 4ZH4F 1BZ4A 2O7OA 1MDMB 1QA6A 1MSFC 1OISA 1W4MA 1B9MA 4PR9A 2V3CC 3A01B 2QEXI 2DB4A 2QKMB 4ANJA 1R5ID 5H2FC 2HNHA 5F04A 5IY5H 4CHUA 2Q00A 2ZBKA 4IGGA 3K6GA 3EUHA 4A3MJ 2P6VA 1SAUA 2VB6A 4CYCA 3BEHA 4M3GA 1IC8A 1QBJA 2EPOA 4CS9A 1J09A 1DPUA 1LNWA 1Y6DA 4LLLA 2R5YA 1SD6A 3FHDA 3FF5A 1VQNI 2YLDA 1D1AA 3ABTA 3J7YJ 2CYYA 1OCZC 3FOOA 5DS6A 3AG4H 2IP2A 3FZVA 3OYLA 1MMDA 2YU9J 1ZLKA 1G3YA 1JRAA 2LYCA 2UUIA 5KYYA 1TWFJ 1VNDA 3E1SA 1H6GA 3S17J 2D2WA 1ZH5A 3E9VA 2WVOA 3OR1C 2QQAA 1ZHWA 1EV7A 2XRLA 3TK0A 3OYCA 3ZP5A 4OOIA 1WH7A 2ZNZA 2W4SA 2RQPA 1GXPA 2E2HJ 2MLKA 3ZXSA 1K04A 4ZLDA 3J7AY 1YJWI 2EPLX 1HE1A 5M3MJ 2VJ5A 2V1DA 4UV9A 4NC8A 3O8HA 1T0FA 3PO2J 1JXSA 4BEMJ 5LD2C 1XSDA 2DPDA 2HXOA 4NC6A 1SD7A 1LDKB 1V5FA 3NARA 4DYQA 2A07F 2Y0SN 4HF0A 2XAFA 1OYYA 1JKPC 3I56I 5LEKA 3QW1A 1YYVA 2DTZA 3HB9A 3B6CA 4OIRF 1NU9C 2HZ8A 4F93B 1XN7A 3I59B 1IF1A 5DCMA 3S29A 4D0PA 5E8GA 4CCJA 4DBRA 4XOTA 5F6FA 3N24A 1FWZA 3UR3C 1T6QA 1VZ0A 4WWCA 4XKVA 3RKQA 4RGUA 1MMNA 2XDVA 3S32A 5JFRA 4FE4A 1D8KA 5DVWA 3DE9A 3MFKA 3CUQA 3GBGA 4XIDA 4JVSA 2PFBA 4HAMA 3HIFA 2OC6A 3TGNA 5E3AA 2DLLA 5K7ZA 2FFHA 4O6NA 2P0NA 2IA0A 3FIWA 1VLTA 1TL8A 3K4BA 4PJJA 1YI2I 2HQRA 1Z23A 2JPUA 3LNQA 1YQAA 3BLYA 2G3VA 4DNCA 2GA0A 3L2CA 5LFAA 1A7EA 1VK5A 2VJ4A 5KYUA 4BGDA 1L7CA 1JT0A 4UB6C 3T6JA 2KGOA 4CSWA 5FRMA 3E5XA 3S2WA 2M45A 1OQYA 5L3BA 1FYKA 1BL0A 4ZZDA 2LCHA 4GQHA 4MO7A 2KT0A 5J1UA 5E3OA 4NTAA 3OA1A 1YRNA 4XN3A 4LERA 1AWCA 2DODA 3D1NI 2UUHA 1KU9A 2KIUA 2JA6J 3MKLA 3TD7A 3D0SA 4WGZA 5KNLA 3TDZC 2MLGA 3TBIA 1T95A 5D6EA 1A36A 1TT5B 1IN7A 1WJ5A 1R49A 1R7JA 2EILC 4KC9A 1HKSA 1ZARA 2LG4A 4ENJA 3TW6A 1USSA 5LGNA 4UUVA 2J45A 2P0WA 5DQTA 3OYGA 2IRFG 1FMVA 3PQKA 2HFIA 3KP7A 2XLWA 2VKVA 3O3KA
chains in the Genus database with same CATH topology
3KPHA 1R5ID 2OJED 2ICWG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KPH A;  1R5I D;  2OJE D;  2ICW G; 
#chains in the Genus database with same CATH topology
 2YZS A;  1PUF A;  3W2V A;  3GZ5 A;  5LHG A;  1BI0 A;  5M3F J;  2RDP A;  5A6J A;  3K2A A;  3BR2 A;  4I76 A;  3CZ6 A;  3PFY A;  4A2U A;  4N0B A;  2HXI A;  2WAF A;  2OQR A;  2JVG A;  3WG7 C;  2NSG A;  3F23 A;  3S90 A;  5J3L A;  1ZRE A;  1XCB A;  1HMD A;  3GFJ A;  2E7W A;  3HRM A;  3B6A A;  4EBJ A;  1HDD C;  4A2N B;  4ZZL A;  1K05 A;  2WZL A;  2MG4 A;  2VBW A;  4UVC A;  3CF2 A;  3J80 K;  4PFP A;  1QSP A;  1E0E A;  3M1C A;  2LSE A;  2DOE A;  3K2Z A;  3LSG A;  5L3C A;  2M34 A;  2ELK A;  3VYS B;  4B3X A;  5ICG A;  4GYI A;  1ERD A;  3JRG A;  4BJ6 A;  2EIM H;  3HHH A;  2L4A A;  1ULY A;  4ZLC A;  1S6L A;  1WJE A;  1A41 A;  3FIS A;  3GLX A;  3I71 A;  2L4M A;  4BJ6 C;  1RIO H;  2R7Z J;  3GAN A;  3HNI A;  1T01 A;  1H89 C;  1V4A A;  1YDI A;  1T6S A;  1BW6 A;  3M8J A;  1N1C A;  4NQW A;  4M72 A;  4JW1 A;  4BU2 A;  4MQV A;  3H9G A;  4OAZ A;  4UVB A;  2M8G X;  4KIB A;  2MC4 A;  3SZT A;  4RDU A;  1K4S A;  4FTH A;  1O7F A;  2YU3 A;  3K1I A;  4YFK F;  2FJ1 A;  2XL8 A;  2LVS A;  3JRC A;  2EIK C;  4DVY P;  3K1P A;  3WTT C;  1Z7Q c;  1VF9 A;  3DEU A;  4PJ0 C;  3K4K A;  2OV7 A;  1IN5 A;  3AQB A;  5GPG B;  3LST A;  1WJC A;  2IXP A;  3A2K A;  2GBY A;  1FBS A;  1K83 J;  2PQ8 A;  2XAJ A;  2NVQ J;  2L6F A;  1BR2 A;  1MMA A;  4XOR A;  2JT1 A;  4G0H A;  2DPU A;  4IWB A;  3FXO A;  1MH4 A;  1SVL A;  1QLE C;  3M1C B;  2WAQ A;  4RLQ A;  3IQT A;  1XX5 A;  2K3P A;  1O3Q A;  1EA8 A;  3AL0 C;  1N77 A;  1OPC A;  1RUO A;  4AL0 A;  2EFO A;  4YJW A;  2WZG A;  3PUF A;  1ETY A;  2BZT A;  2WA0 A;  2F48 A;  4XSZ F;  2RN7 A;  1FC3 A;  4FX5 A;  3MYI A;  4Z9I A;  4QTR A;  3LQQ A;  4C30 A;  3VB2 A;  1JUM A;  1ORY A;  2V79 A;  3L2U A;  1FIP A;  2LY1 A;  3SZR A;  3O8G A;  5FKN A;  1ODD A;  3CSK A;  3EUH C;  1D0Z A;  4MVM A;  1BW5 A;  4KDP A;  1G3W A;  1EJ9 A;  5AON A;  2DDB A;  1BOA A;  4E18 A;  3QOD A;  3VEP A;  2X6O A;  1TWG A;  4DJ9 A;  2ZFW A;  4PAC A;  4LIT A;  2CU7 A;  3KPH A;  4BYY A;  1V74 B;  2DMU A;  3HOS A;  1SFK A;  2KFD A;  1VQK I;  1FEX A;  3E5U A;  1T56 A;  3P9K A;  3K1N A;  5K5R A;  3DM9 B;  2DA5 A;  2MHR A;  3LSR A;  3BP8 A;  3RVY A;  4B1R A;  4FX4 A;  2DN0 A;  3QPH A;  1G6N A;  2E1C A;  3JRT A;  1LIH A;  4RAG A;  3T1B A;  3DEE A;  3PNY A;  1IXR C;  3V4G A;  2CCY A;  2PX0 A;  2QNL A;  1FNT c;  1YIT I;  2L81 A;  3RF3 A;  3DPL C;  4C3H J;  3P9C A;  1UJ8 A;  3H9Q A;  1KQ8 A;  2NNY A;  5JHU A;  4E4H A;  1I5N A;  5D8K B;  2M4G A;  1Z21 A;  2W25 A;  2X4H A;  3R4K A;  5GP9 A;  3F9K A;  3H3U A;  1I5Z A;  3SP1 A;  2STT A;  5F1J A;  3U2R A;  1RZ4 A;  3SQN A;  2HGC A;  2ZME A;  2RVC A;  3I3L A;  3DAG A;  2G7H A;  3EZH A;  2Q1Z B;  1W5T A;  2FQ3 A;  4E0I A;  2RC4 A;  2L7M P;  4EBB A;  3H3Z A;  1F36 A;  1XB4 A;  4BJ5 A;  4DJA A;  1I3A A;  2GZW A;  1EQ1 A;  1JJ8 C;  4W8K A;  2XAQ A;  3ULQ B;  3LAP A;  4EM2 A;  3C1D A;  1BIB A;  1DQU A;  3Q0V A;  2H8R A;  1BC7 C;  4MVR A;  2IA2 A;  1LVA A;  3BR3 A;  1IXC A;  2BY1 A;  4ULW A;  3SZG A;  4BS9 A;  2OZU A;  9ANT A;  1Z9C A;  1N75 A;  3TQN A;  3GM3 A;  4CIP A;  3K66 A;  1TWA J;  3J81 K;  1VQP I;  2LRD A;  3OV8 A;  1RET A;  4A3E J;  1G3S A;  2EZL A;  2F5D A;  2Y31 A;  3GX4 X;  3LFK A;  1NBB A;  1FLI A;  4CGZ A;  3KH2 A;  3H3V K;  5AIQ A;  3REO A;  2V6E A;  4BJ1 A;  4YL0 A;  1ONV A;  1TWG J;  2DBB A;  2K85 A;  3K1I C;  4JC7 A;  1HW2 A;  3ABK C;  3ZQI A;  1WJD A;  1JKQ C;  2R7S A;  5FB2 A;  3K6B A;  4AX2 A;  1PVE A;  1UHS A;  3E5Q A;  4N4O B;  2NUT A;  3MX3 A;  2JWT A;  1OJL A;  3GW2 A;  1IN6 A;  4A0Z A;  4R8H A;  2ZXW H;  2BEO A;  3NAU A;  4B3A A;  1PYV A;  1AVO B;  2M4E A;  4CS8 C;  4KNV A;  5FD6 A;  1GLN A;  2M4K A;  4D4N A;  3FKI J;  3NMI A;  1WFX A;  4X1E A;  3SEO A;  3LSH A;  4UHT A;  3BTI A;  4IRI A;  5DTD A;  3MFN A;  3U3F A;  1X1D A;  2I5U A;  3ML6 A;  4E7H A;  1TFO B;  4ER9 A;  1Y39 A;  1MIJ A;  3MZ8 A;  3ASN H;  5CVJ A;  3SYT A;  3L8J A;  1ZVZ A;  2C03 A;  3OYJ A;  1RJ9 A;  2QSG X;  4LB5 A;  5EEA A;  3AG2 C;  4A3F J;  3OOP A;  1YIO A;  3DLL F;  4BE0 A;  5B1B C;  3TO7 A;  3A01 A;  2MD5 A;  2K02 A;  3U9G A;  3L9F A;  3ISP A;  4EJU A;  3QYF A;  3F21 A;  2OU6 A;  4JEA A;  2HZT A;  3MCZ A;  5HOD A;  5J4Y A;  2JK3 A;  5M5X J;  4LG0 B;  4J32 B;  3KFW X;  2OCC H;  1W0T A;  4V2F A;  2IS1 A;  1OCO C;  4U5D E;  2YUS A;  5DDG A;  3BJ6 A;  1XPX A;  2OUM A;  1H0M A;  2DO7 A;  4CA0 A;  3HBL A;  2R5Y B;  3OYI A;  3K70 C;  2EPK X;  1QPI A;  3I58 A;  3LLK A;  1DGW Y;  2J9B A;  4PSW A;  2H7O A;  4I01 A;  4YFX F;  1OCR C;  3CC2 I;  1IZ1 A;  2CNW D;  2WAE A;  5FGM A;  3F46 A;  1AKH B;  5EZG A;  4A3J J;  3S1M J;  1B8I A;  2EBI A;  3FK7 A;  1F43 A;  2MFZ A;  3EJN A;  3DAF A;  3H5R A;  4UUS A;  2ZME C;  4IAO A;  3ZWI A;  4G6Q A;  1H9T A;  1FYM A;  3CJR B;  2FMY A;  2IEK A;  5LRS A;  3SJM A;  4IL6 C;  3KP2 A;  1FTT A;  1P9Q C;  3R2P A;  3W8I A;  3LES A;  2H09 A;  2CQX A;  3SXY A;  2XGE A;  2R02 A;  3U2L A;  4F52 A;  2ELH A;  3GWN A;  1MBH A;  1YFH A;  1YLM A;  2M5W A;  2VQH A;  3BCB A;  3HXL A;  4AYB A;  4I6Z A;  1YJ9 I;  1HKT A;  1JUS A;  3JCU C;  2LH9 A;  1G3T A;  2GWR A;  4P55 A;  1V5E A;  3G2B A;  5BS6 A;  4MS2 A;  1LE4 A;  2DK8 A;  2LTP A;  1MNE A;  3GTP J;  1E84 A;  3L2R A;  3SZP A;  1X1P A;  3H9J A;  5E20 A;  4KI2 A;  1TP4 A;  1HW1 A;  4L18 B;  4AU7 A;  3M4O J;  2HJ3 A;  1JGG A;  2NUP B;  5DS5 A;  2GA1 A;  1P6R A;  4L5E A;  1TQG A;  4P5O A;  1VB5 A;  3ZVR A;  2FX0 A;  2G0E A;  3G3Z A;  3CDL A;  3EGX A;  1HSJ A;  2MYS A;  2IS6 A;  4RMN A;  4DIQ A;  3TKY A;  1PP7 U;  2O9X A;  2ZXP A;  4UUS B;  2XF6 A;  4QIW N;  2B0J A;  4HST A;  3HOZ J;  4HF1 A;  2PMZ A;  2ZXJ A;  2CW7 A;  4Y7N J;  2LKP A;  2LP4 A;  4Q48 A;  3EGX B;  2HYG D;  4IXA A;  4MTE A;  2BY3 A;  4N9I A;  4E70 A;  1X3Z B;  3C62 A;  3I5Q A;  4YN0 B;  1GM5 A;  3RKX A;  3W2A A;  4EQQ A;  3T9O A;  5JLX A;  4XQ1 A;  3RQF A;  5KAF C;  5JRA A;  2Q9B A;  2J5P A;  1B68 A;  3LA3 A;  3C2H A;  3JR9 A;  1VQ8 I;  1VYK A;  1YX5 A;  3BRJ A;  5F5F A;  4KIG A;  2ESN A;  4LLC A;  1WCM J;  1MND A;  4AL1 A;  3RIR A;  1H9G A;  1RES A;  4OAY A;  4ZTJ A;  2C04 A;  3X1O A;  2VPR A;  2KZV A;  4KT6 A;  4OIQ F;  3S14 J;  2CQK A;  3MZY A;  1W36 D;  3V7O A;  5BQH A;  2HOE A;  3HSF A;  5FO5 A;  2VON A;  3A9C A;  1PUF B;  4HFK B;  4JJG A;  1Y8Q B;  2E1M B;  2DFF A;  2X6Y A;  3HGY A;  2O8X A;  1GDT A;  2W7N A;  4XTK A;  4LB6 B;  4XRS G;  2A6E F;  1CGP A;  3PHF 2;  4ESF A;  4LGW A;  4BG0 A;  3QU3 A;  4JZA A;  2W85 A;  3MMY B;  1FFT C;  4GYT A;  2A0B A;  3ECO A;  3CQZ J;  3GEH A;  4AID A;  2VN2 A;  2EZK A;  2IXO A;  2DCE A;  3JT1 A;  4NB5 A;  1JE8 A;  2FAP B;  3PUB A;  1LVK A;  1WOL A;  2QWW A;  2GOX B;  2LMD A;  3RQ4 A;  4HEA 2;  2R5Z A;  2EPN A;  3BG7 A;  2AO9 A;  5F5H A;  3GM2 A;  2IOQ A;  2K9L A;  4C7O A;  3HUG B;  1SEU A;  4U5F E;  2IGK A;  3FXM A;  3WAQ A;  1HC8 A;  4AIH A;  1BOB A;  3CCY A;  2BHZ A;  2HOS A;  4CDG A;  3Q9V A;  4J7Y A;  3GTG J;  3DPU A;  2OQG A;  2H7V C;  2HMZ A;  1XMA A;  1MJ9 A;  2DA7 A;  2OBP A;  2KRC A;  2ZO4 A;  3EQL F;  4EJW A;  1ZRC A;  4XEF A;  1BM9 A;  2CMP A;  3ELK A;  5D8L B;  3WG7 H;  4EEF G;  1HA8 A;  3E7L A;  4XLN F;  2F6C A;  1LPQ A;  5CQG A;  3AG4 C;  2N8G A;  4I09 A;  4JBA A;  2PJR B;  1REP C;  2KKO A;  4I99 C;  5KK1 A;  5B1B H;  5KYU B;  2PFD A;  3RQG A;  2R7D A;  2DAO A;  5CQE A;  3RI4 A;  3ECH A;  1VYI A;  4DRJ B;  2DA1 A;  2ZXR A;  3QAH A;  4J19 A;  1SFX A;  5CVU A;  2QUF A;  2YS9 A;  2CUE A;  2YWA A;  2ECB A;  1DPR A;  1GXQ A;  3PSF A;  3DV8 A;  2W00 A;  2DFH A;  1LDJ A;  2VJI A;  3EYI A;  3HOY J;  1QZE A;  4WAB A;  1JGS A;  5CI8 A;  1MBJ A;  5AIP A;  4PDK A;  2HS5 A;  2LFF A;  3L2V A;  3L7W A;  5FKO A;  1SD5 A;  1LPE A;  5TGT A;  5J8C A;  3ABK H;  1LE8 B;  2Z1D A;  4A6E A;  1AEP A;  1ZAO A;  3IAM 2;  3ZMD A;  5ILU A;  5KHD A;  3NEU A;  2BVL A;  3RCO A;  3HGG A;  4G6D A;  3AG3 H;  4OU0 A;  2EIK H;  4KNW A;  5IPA A;  3NMJ A;  1UEL B;  5L0C A;  4IO9 F;  3DU6 A;  2J7P D;  2JSC A;  2FUG 2;  3JSP A;  1J8M F;  1XG1 A;  3OL3 A;  4U0Y A;  5M5Y J;  3PSI A;  1XD7 A;  1Z1D A;  3VAY A;  1T98 A;  4RBO A;  3GYH X;  3OWT A;  2ZJR F;  1OCT C;  3ECS A;  3I5U A;  3DPT A;  5T1D B;  1FP2 A;  2MA3 A;  1VQM I;  1G4D A;  1NFN A;  3U3B A;  5KVR A;  1LQ1 A;  5JI6 A;  2ID3 A;  1U9O A;  2L01 A;  2Y69 C;  4XPX A;  4HDV A;  2B0H A;  4HLX A;  4MLO A;  3C8G A;  4YL3 A;  1FZP B;  3RH3 A;  1YW7 A;  2WY7 Q;  3H35 A;  5D5W B;  3DQV C;  2NAZ A;  1A35 A;  3MD2 A;  1LS4 A;  2BBY A;  4YT4 A;  1QQI A;  3VWB A;  5TJJ A;  3F6O A;  1BA5 A;  4A6D A;  4W1U A;  3G6E I;  5L3E A;  1ZW3 A;  1MDM A;  3C8G B;  3S1N J;  1LM3 B;  3BWG A;  3PIO F;  3DXJ F;  4JYK A;  2BW3 B;  1NSG B;  1OKK D;  2R93 J;  1P4A A;  2DOF A;  2K86 A;  5EGO B;  2P6T A;  2PLY A;  5L0D A;  2E36 A;  2JRM A;  1MW7 A;  5BQT A;  1PP8 F;  5EEG A;  4PJL A;  3D5R C;  4XOP A;  5F1R A;  5C4X J;  2L2O A;  2VC1 A;  1YYX A;  5AGF A;  3F8F A;  4N6H A;  1FBU A;  3QQA A;  4LG3 A;  2KDZ A;  3I4U A;  4NUB A;  4IPA A;  4BQN A;  3ZQH A;  2IW5 A;  4RGX A;  2XRH A;  2Z15 A;  4DRI B;  2E2I J;  2HR3 A;  2LC2 A;  1VOM A;  2Y3H A;  3LA2 A;  3K4C A;  2HSB A;  3AFH A;  2YHS A;  2NS7 A;  4GXO A;  3AL0 B;  3EPZ A;  1PDN C;  1WGW A;  2O61 A;  4B09 A;  2F22 A;  1Z0X A;  1V55 H;  2CQQ A;  3DKX A;  4WCG A;  5FKL A;  3BG9 A;  1MMS A;  2G62 A;  5DYM A;  1CGM E;  1E17 A;  3BC8 A;  4AIJ A;  1EKE A;  4LLN A;  3A02 A;  4OIN F;  3HSE A;  5J47 A;  4IRG A;  4O79 A;  4XR6 A;  1F9N A;  4KIF A;  3GUD A;  1FTS A;  2L9N A;  2XSD C;  1A31 A;  3Q0U A;  3K33 A;  4H54 A;  2X0C A;  2JQ7 A;  3DWW A;  2JA8 J;  5J8F A;  5L3F A;  1Z6R A;  3D5S C;  2D5R B;  5LHH A;  3CMY A;  1ON1 A;  2CQN A;  2XPV A;  1D0Y A;  3PNV A;  4V2G A;  2W45 A;  4JCZ A;  2Q0O A;  1B72 A;  3V8J A;  4BAY A;  4JCH A;  2XF5 A;  2LF8 A;  3W3C A;  4CSA A;  5IYD J;  3K1H A;  3A1Y A;  2P7V B;  3AQC A;  1UG2 A;  4M6X A;  2BV6 A;  1WPK A;  4LFU A;  4ZTF A;  3EZI A;  3LSJ A;  4KMU X;  1X3W B;  4G9Y A;  5DM7 F;  1KU7 A;  1I27 A;  1OYW A;  2R3S A;  3Q9S A;  4IOC F;  1M56 C;  2DMN A;  3B73 A;  2CUZ A;  3OYD A;  1FOK A;  3FVY A;  2GA2 A;  3H65 A;  5E2Q A;  3TOL A;  3LJB A;  1FR0 A;  4PGG A;  4LK1 F;  2R7T A;  1HQC A;  2DK5 A;  4RD9 A;  4NDL A;  4YT5 A;  1MNM C;  3LEO A;  2NS0 A;  4LK0 F;  2O5R A;  2R7O A;  3F22 A;  4UDV A;  1B59 A;  5JS5 A;  2CGE A;  1HW5 A;  1IJW C;  4Q47 A;  4AE4 B;  3GFM A;  3HJE A;  1IDZ A;  4YRV A;  3CCV I;  1V54 C;  2NRA C;  4C2U A;  3FX3 A;  1XSX A;  2A5W A;  1QPU A;  3J7Z I;  2YEV A;  3KP3 A;  1SD4 A;  4DOZ A;  1OR3 A;  1NG6 A;  1VI0 A;  1XS9 A;  4BE2 A;  2F5V A;  3WGI A;  3OYK A;  3Q5F A;  3HRS A;  3S0X A;  2VC9 A;  5D5U B;  3FDQ A;  1U5T B;  4G7H F;  2I15 A;  4HNT A;  3IWF A;  3ROU A;  3CTA A;  4D5C A;  1B6A A;  5EZH A;  4R79 A;  4XWJ A;  1E3P A;  5L3V A;  4MQ9 F;  3IKT A;  5KYY B;  4FAS D;  1IGN A;  1B4A A;  2ICW G;  2L9J A;  3FK6 A;  3K7D A;  4KBL A;  1D8J A;  2A5Y B;  1CPQ A;  1DOV A;  4UV8 A;  1YA9 A;  2YLG A;  4YIF A;  2H8A A;  2E34 A;  5E1W A;  3S2D J;  3B71 A;  1X3U A;  2G3K A;  4S05 A;  1K78 B;  2EIN C;  3VDX A;  1VQO I;  4R1H A;  3NKD A;  3LQR A;  2P81 A;  2P7C B;  3G4Z A;  2H94 A;  1WI3 A;  3HOV J;  1VFC A;  1TNT A;  1EH8 A;  2PX9 A;  5BUO A;  3EDP A;  3VSL A;  1JKO C;  4U87 A;  2EFW A;  4R32 A;  1XDU A;  3BG6 A;  3DBH B;  4RAY A;  4CCL A;  4A3B J;  1ZHX A;  4B48 A;  4I1M A;  5HV9 A;  2AWC A;  2XLD A;  2LKS A;  1U6H A;  2RNJ A;  3OEO A;  1S8N A;  1S9H A;  3K7A J;  1GV2 A;  1PV3 A;  4OD5 A;  3UGP A;  4KIS A;  5ERI A;  1Z63 A;  2A1D D;  3U8V A;  3E97 A;  2CDQ A;  1W5C C;  2B7E A;  1D5Y A;  4XPW A;  2YLI A;  3U2M A;  4XL9 A;  1OR7 C;  3QU6 A;  4CZC A;  3FAP B;  3K4L A;  1VQ7 I;  5BMZ A;  4KT5 C;  1WTY A;  4HV6 A;  3H5N A;  2H1L A;  4Y3O A;  4E7I A;  4MTG A;  4NQW B;  5LLQ A;  2DA6 A;  3JYH A;  3O2P E;  3JSO A;  2L6H A;  3PMR A;  3ZIB A;  3K4N A;  1M57 C;  4IQ4 A;  1X4O A;  2HV7 A;  5FCL A;  3N97 A;  2ZPA A;  4XM3 A;  1C17 M;  3DD7 A;  1IRF A;  3ESW B;  1E85 A;  3HTU A;  3DCF A;  2MSY A;  4JTC B;  1IUF A;  2BW3 A;  3A03 A;  1UZC A;  2GFH A;  2D1V A;  3GWZ A;  2ZJ2 A;  2KSF A;  2XLV A;  2LFB A;  5J1Y A;  1XZP A;  2ELJ A;  1QHG A;  2I8D A;  4HX7 A;  1G5Z A;  1ZHT A;  5KYX B;  4IHV A;  3S27 A;  1F4K A;  1Z05 A;  5JT4 A;  3RYR A;  2W82 A;  3A0B C;  3C3W A;  1HCR A;  4I0A A;  1V55 C;  2ZFU A;  2Y2Z A;  3B02 A;  3IH3 A;  5CVV A;  1ACI A;  3JTL O;  3M3Y J;  5FLX K;  4A0Y A;  3NQO A;  1IRG A;  4EJT A;  1E86 A;  3VSK A;  2QTV A;  1M2V B;  3ZSU A;  3OYA A;  5K5O A;  2F5C A;  3E70 C;  4PUS A;  4CZZ A;  3A4C A;  5E18 F;  3DZA A;  1K6Y A;  2A69 F;  3CCM I;  3QWL A;  1U5T A;  2DA4 A;  5EGO A;  4KA4 A;  1XMX A;  2XL4 A;  3O6X A;  4IEJ A;  2KW3 C;  4C3D A;  2KIQ A;  2HWV A;  4D4X A;  3HRU A;  3POV A;  4BNC A;  4EJV A;  3S15 J;  5HVQ C;  2QBY A;  3ABM C;  5FKM A;  1W1W E;  1X1B A;  3O39 A;  3CCJ I;  2LY9 A;  2X85 A;  4JX5 A;  4Y13 A;  1Q1V A;  2BXY A;  2YX4 A;  1Q0F A;  2FEZ A;  5LGT A;  1Y4C A;  4S0H B;  4LDR A;  1BI2 A;  4FCY A;  3G1L A;  5C4J J;  4OMY A;  1QVT A;  2JD3 A;  2Z5U A;  4HLY A;  4Y15 A;  5EYR A;  3CD6 I;  2VPL A;  5E33 A;  4BXU A;  2XHK A;  1NK2 P;  2R05 A;  4MFD A;  2IPQ X;  1UG0 A;  5TRD A;  1I6X A;  2RSE B;  4YK5 A;  1JT6 A;  4NBQ A;  3QTH A;  3P5J A;  4EUK B;  3AKZ A;  4G6T B;  2Y69 H;  1J59 A;  1MKM A;  4NTB A;  2XAU A;  3GLL A;  1G2H A;  4EGY A;  3VYW A;  2HQA A;  1U89 A;  4YEL A;  3TW7 A;  2VCB A;  2XPW A;  2QSH X;  4BBR J;  5JLW A;  4FWV A;  3JAM K;  4XSX F;  1R71 A;  4FT8 A;  3RZO J;  1Y6I A;  3F8C A;  1PUE E;  3PQJ A;  2W48 A;  4C3J J;  2HFH A;  4MHG A;  1YYJ A;  2OG2 A;  4C2M J;  3I4M J;  3M15 A;  4YL1 A;  5FLM J;  4CSA C;  2FU4 A;  1YO5 C;  3IC7 A;  1OFC X;  3FXR A;  3WU2 C;  4F7Z A;  3JRI A;  2UZK A;  3I55 I;  1FYL A;  2FGY A;  4FAP B;  4RAZ A;  3WE2 A;  1U3E M;  2LBF A;  4BQO A;  4EM0 B;  1SZI A;  1OXK A;  1P92 A;  5JLI A;  3IV5 A;  2XC7 A;  1KA8 A;  4E7K A;  2BVM A;  5DD4 A;  3KKB A;  1YS7 A;  2OQM A;  3GEI A;  1K79 A;  2YPR A;  3I0T A;  4XBF A;  1ORS C;  4IHY A;  1BBY A;  4ESB A;  3K70 D;  1RXQ A;  3BTJ A;  1P2F A;  1OXB A;  4U5B E;  2LDU A;  3DLA A;  3W8H A;  2OD5 A;  4IF4 A;  3ZQG A;  1I50 J;  1U8R A;  5GAE J;  2QCO A;  4LIV A;  4Y17 A;  1TWH A;  1YE9 A;  2BXZ A;  2LK2 A;  3MQ0 A;  4BBS J;  3RYP A;  1SFO J;  3WHC A;  2EIM C;  2FF4 A;  4CJO A;  1ZLJ A;  2TDX A;  2X51 A;  3VYT B;  4KUM A;  3MLG A;  4HQM A;  1IUY A;  3CES A;  3SDG A;  1JHH A;  1S05 A;  3F8B A;  3LSK A;  2JUC A;  1O87 A;  1TW3 A;  1EA3 A;  1A7V A;  1D3Y A;  1QNT A;  3QW0 A;  4LDQ A;  3RW0 A;  2CH0 A;  2O3F A;  3H0G J;  5FD5 A;  2OTL I;  4F3Q A;  1DOW A;  1UG7 A;  3GOR A;  3NRH A;  1QHH D;  3S16 J;  2VCC A;  3RYL A;  3DJU B;  3I9V 2;  2VQL A;  1SAX A;  2Z9O A;  4JEB A;  4HYE A;  2EJR A;  4HRI A;  1ZN2 A;  2XF7 A;  3K4J A;  3QYB A;  2GAQ A;  1DU0 A;  2NVX J;  3MEX A;  3ABU A;  2Q7R A;  3V8L A;  5EK0 A;  2VH3 A;  3EHN A;  4RGR A;  1OKK A;  1SAN A;  2XRO A;  3WHB A;  3ERM A;  3JCU Q;  1TWC A;  2I10 A;  3U0C A;  4EIY A;  1WRJ A;  1D0X A;  1KU3 A;  1UHM A;  2HMQ A;  1MJB A;  3UNG C;  5K0I A;  2WB1 N;  3BQZ A;  1ZKG A;  2KZG A;  2R7W A;  2ZD9 A;  3KZI C;  1E3O C;  2IAI A;  4QI2 A;  2KRF A;  3W6K B;  1K4T A;  3OIO A;  3CCQ I;  4NHJ A;  2J9W A;  1XSV A;  1V54 H;  2J46 A;  1EH6 A;  4U0W A;  4DYR A;  3L1P A;  4I7H A;  4FIS A;  2BE5 F;  1R1U A;  2K40 A;  3BZK A;  4AVP A;  5LGU A;  4HDU A;  4OIO F;  2K27 A;  5EDN A;  2LFD A;  2VC0 A;  3LS0 A;  3U1K A;  3HTK C;  5DEQ A;  4DYC A;  4HQE A;  1IXS B;  2CQ7 A;  3BR0 A;  1YOV B;  3FBI B;  4M9S A;  1YIJ I;  3CC4 I;  1RKW A;  2ZXO A;  3GEZ A;  4N06 A;  2B0L A;  2Z33 A;  2NVU B;  4YFN F;  2DYR C;  1FOY A;  1KU2 A;  4IB4 A;  3CLO A;  1LI7 A;  4QDL A;  1RKE B;  1SFU A;  1Z91 A;  1NH3 A;  1UFB A;  2LD6 A;  4DXW A;  1U0B B;  2ZC2 A;  2NG1 A;  2VCA A;  5L0J A;  1OR2 A;  2QY9 A;  1LDD A;  4KYW A;  3E3V A;  2XGC A;  3KYL A;  2FD5 A;  5LBQ A;  3F47 A;  1FOW A;  5E3N A;  2NOJ B;  1VQ4 I;  4W97 A;  2E1N A;  3R61 A;  1YW9 A;  2KNH A;  4O3M A;  2IGO A;  3HPH A;  5DD8 A;  5FKK A;  2H27 A;  4RA2 A;  1PJR A;  2XRN A;  4JK1 X;  1W7P D;  2UXN A;  1ON2 A;  2XKO A;  3JRA A;  1A0B A;  2KC3 A;  2YL0 A;  2XXA A;  5BQG A;  4L5I A;  1VTN C;  3ZQ7 A;  2WV1 A;  3WTX C;  1LB2 A;  2HZD A;  2RQQ A;  4PZJ A;  4B43 A;  2PEX A;  3SFZ A;  1POG A;  4N6C A;  1BIA A;  1RUN A;  4CS9 C;  5FZT A;  4ON0 A;  3ZN0 A;  2JPC A;  4K7B A;  5IP9 J;  3H2V A;  3T4R A;  4ZYD A;  2OPT A;  4BHC A;  3WGH A;  5E1X A;  1QVU A;  3L2W A;  4I3M A;  2F4O B;  4IAR A;  4UB8 C;  1MBE A;  2Y0S A;  1UMQ A;  2HKV A;  3LA7 A;  3WGG A;  4MIM A;  4L0Y B;  2GXB A;  3S84 A;  2HOA A;  3L09 A;  3EUK L;  1BI1 A;  2A3S A;  1ZG5 A;  1OCR H;  3T5X A;  1ZGW A;  1O4X A;  2R7U A;  5ICC A;  2B63 J;  4NC3 A;  4MTO A;  3U8P A;  1BJZ A;  3BG3 A;  5GTI C;  4HE8 D;  1QZZ A;  5IP7 J;  5LRR A;  5T3T A;  1R22 A;  4YWQ A;  1YAR O;  3I54 A;  4HOB A;  5ILS A;  4PGH A;  1DP7 P;  2LF7 A;  3GO5 A;  1XZQ A;  5A6B A;  4LD5 A;  3DFG A;  1UB9 A;  5B1A H;  2HTJ A;  4K2E A;  3OIQ A;  2FSW A;  1ETO A;  2M0C A;  1QKR A;  5CI9 A;  5D92 A;  3VFZ A;  2AU5 A;  5HSW A;  3H1C A;  2YSR A;  2L7Z A;  1RRJ A;  5E8I A;  1Z5Z A;  2Q9A A;  2Y9Y A;  2E2J J;  3AJM A;  4CCN A;  2L0K A;  2VOO A;  1T39 A;  2BY2 A;  2KRH A;  4KFC A;  2QE9 A;  3ZQY A;  4CS7 A;  4JUR I;  4GEH A;  4XKB A;  1FY7 A;  3IWZ A;  3MKY B;  1TKN A;  1WAS A;  4CJG A;  1PD0 A;  3CUQ B;  1R5G A;  4ZDO A;  1BR1 A;  3AGT A;  4RB3 C;  4DZJ A;  4BEJ A;  3U21 A;  3BTC A;  2Y75 A;  2V1N A;  2OJE D;  4M3E A;  1LI5 A;  1D5V A;  2NPU A;  2HYJ A;  2H1K A;  3CMA I;  1V4R A;  2VIX A;  2XAG A;  4G94 A;  4CXF A;  3KYJ A;  1DDN A;  5EHH A;  3ZMS A;  2HYF A;  3IPM O;  3FKJ A;  2IBD A;  4AYB N;  4II2 A;  2KJB A;  2WY8 Q;  2ZJP F;  4JTD B;  3R7C A;  3WTW C;  4RLF A;  4BH9 A;  2R03 A;  2DW4 A;  3W2W A;  4WXC A;  1AOY A;  2UV1 A;  2DXI A;  1OKR A;  3FXJ A;  3I59 A;  3S3N A;  5E17 F;  2KQR A;  3TO6 A;  2DQL A;  2WBM A;  5HS7 A;  3QOE A;  3GZ6 A;  2R7R A;  3CME I;  2M8E A;  2HSQ A;  1Q0D A;  2LIG A;  1MGT A;  2ZXI A;  4C3I J;  1WHU A;  3AG1 H;  3LOC A;  2VI6 A;  1FNN A;  2EH3 A;  2XKP A;  2BHY A;  2OJQ A;  2EV6 A;  4CYD A;  3FDY A;  2CWE A;  4D7N A;  3HYI A;  3X2Q C;  3M79 A;  4CCK A;  4D9J A;  4ZC3 A;  5A69 A;  3KLO A;  2A6T A;  1NU7 D;  4XLA A;  2H6B A;  1OW8 A;  3OL4 A;  4ZYA A;  5T3W A;  3ZPL A;  4Y33 A;  1VQ9 I;  3DTK A;  2HVS A;  4XEV A;  2P8T A;  1OW7 A;  3Q7L A;  2VKD A;  3AOU A;  5GPA A;  3KP6 A;  2VOP A;  3FMS A;  3D5L A;  3KZY A;  4E7J A;  3VYR B;  3OYF A;  1R36 A;  3DP7 A;  4G8X A;  1WZ2 A;  3CUO A;  2QEN A;  3WTS C;  1UAA A;  3EUA A;  1A5J A;  2QQ9 A;  1FAP B;  3SNH A;  3RJP A;  1CPR A;  4P1W A;  2PX3 A;  3WOD F;  1M6T A;  1IV6 A;  2VQC A;  1WJF A;  4K1O A;  2R4G A;  3OYN A;  2VOD A;  3G50 A;  2H8W A;  4KJZ A;  3FHN A;  3HRT A;  3F8N A;  5HS8 A;  4X0R A;  1SF8 A;  4BJT A;  2IJL A;  3CCL I;  1GHC A;  2O8K A;  2UWM A;  1FBQ A;  5DCF A;  4IZZ A;  4Y52 J;  4JRZ A;  4CUG A;  4KIC A;  4ULV A;  4JE9 A;  4BY7 J;  3OYM A;  3BPV A;  3F8M A;  2CFO A;  2KL4 A;  4ITV A;  1G4U S;  3FMR A;  4IVN A;  2M3A A;  1BBH A;  1NK3 P;  2F5F A;  1W5S A;  4MFE A;  1NLX A;  3FXH A;  4O7G A;  5L0H A;  2GQQ A;  1K40 A;  2EA4 A;  2IM8 A;  3QMK A;  4HNV A;  1MQV A;  2R9R B;  4G7Z F;  2DMT A;  2FOK A;  3HOT A;  1FSH A;  2YL7 A;  1U78 A;  3F3X A;  2VBX A;  3VYU B;  3PNT A;  5GTH C;  5K7H A;  3EPV A;  2CG4 A;  4LIU A;  5BQI A;  3FXQ A;  3C2B A;  2FML A;  4IAQ A;  1R1T A;  3IAS 2;  2DYR H;  5COG A;  1Y56 A;  4M6V A;  1QPM A;  3OSG A;  5KYW B;  2L9R A;  1KYZ A;  3R0A A;  1LFP A;  2KK1 A;  1LFB A;  4K0D A;  1ORK A;  4OWR B;  2NYX A;  2P5K A;  2NVT J;  3MYF A;  5B3S H;  3U9M A;  2K4J A;  2K5C A;  2BL2 A;  4U5C E;  3MWM A;  1U2W A;  3T8R A;  1KQ0 A;  4N9H A;  2Y48 A;  4PSX A;  1RR8 C;  1ZK8 A;  1Z67 A;  4NNJ A;  2HOT A;  2E5N A;  4EHP A;  3O55 A;  1Z77 A;  4JJF A;  4A3G J;  4CO8 A;  1P4W A;  1Q1H A;  1XWJ A;  3R6S A;  3Q6N A;  3TP0 A;  3L2Q A;  1FPQ A;  2EPF A;  2ETH A;  2J8W A;  1LUJ B;  1TT0 A;  2PG4 A;  3PM1 A;  3UMI A;  2A0U A;  5DS9 A;  2XB5 A;  4MVQ A;  5KCM A;  4TV7 A;  4HBL A;  2UXX A;  1T8I A;  4A12 A;  1MBG A;  1GUU A;  4B8X A;  2VXZ A;  4IHX A;  4BAC A;  2HU9 A;  4BUP A;  5CKT A;  4AE4 A;  4M3F A;  1IRX A;  5FRN A;  3FHZ A;  3KP4 A;  3RFY A;  1KYW A;  1YJG A;  4MND A;  5IYC J;  1LKX A;  2GAU A;  3M9A A;  1ZU5 A;  3IEE A;  3UMH A;  3ASO H;  2O6G E;  2R25 A;  3I4P A;  2ZJQ F;  4KIT B;  3FM3 A;  1SR2 A;  3BPX A;  4A3D J;  2X1C A;  3IUO A;  3DTI A;  3B29 A;  2DOA A;  4I1O B;  1RKT A;  3GEE A;  2X48 A;  2EZH A;  4C2T A;  5DM6 F;  1RPW A;  1ZU4 A;  3HDD A;  3QZC A;  2RKH A;  3I64 A;  2DTR A;  2IBF A;  5EGY A;  1QU3 A;  3QPT A;  4AIK A;  4XEK A;  3TQO A;  1QGP A;  1F1M A;  3GOD A;  2FE3 A;  2GDC A;  2ISZ A;  5HDN A;  4XK4 A;  4H0E A;  2XB0 X;  3GFL A;  3WU0 A;  1FFH A;  1JMW A;  2EZI A;  2W4M A;  3HZJ A;  4L6R A;  3C8G D;  4MVS A;  4M6Y A;  2L7A A;  1IN8 A;  5E3L A;  2EFN A;  2IXS A;  2AS5 F;  4FQG A;  1AA7 A;  3DE8 A;  3HNK A;  2A68 F;  2P6S A;  3IHU A;  3CCU I;  5DQZ A;  2M7B A;  1PCX A;  2J9U A;  2ZCW A;  3Q3S A;  2E35 A;  3IKV A;  2Y3G A;  2QQB A;  1O3T A;  3PJR A;  1YA7 O;  5IY5 C;  4U7D A;  1IRZ A;  1XGN A;  2M1B A;  2VLA A;  1R4T A;  2Q9C A;  3G1M A;  3GM1 A;  1ZTR A;  1A04 A;  3ZQQ A;  1X1A A;  2EK5 A;  3S93 A;  1ETX A;  3JTH A;  4JP0 A;  4MW3 A;  2L9V A;  3KCC A;  1ZR2 A;  3FM5 A;  4UXN A;  4CDV A;  3VPR A;  4XMY A;  4U9E A;  2E19 A;  3A0H C;  4MTD A;  1T6I A;  1Y8R B;  4XRS A;  2X9D A;  2FOW A;  2ADU A;  3NRV A;  3SEZ A;  3OYH A;  1HY5 A;  1JUP A;  2R7F A;  2VQG A;  3LMM A;  1UCR A;  1IAW A;  4ENK A;  3WTV C;  5BNG A;  3QVZ A;  4Z6Y A;  4EWC A;  2JA7 J;  3NYJ A;  4AC0 A;  3PCV A;  3TUL A;  2YQY A;  2NS8 A;  2TRT A;  1CF7 B;  1RKE A;  4XON A;  5F27 A;  1SVM A;  3ABL H;  3H0D A;  1X19 A;  4GO1 A;  2RNG A;  2LOO A;  2P4W A;  2MBF A;  5F0C A;  1X2M A;  3OS1 A;  1L3L A;  1PD1 A;  2AP3 A;  2TCT A;  5E79 C;  2AVK A;  2KQ9 A;  4JIO A;  2GOM A;  2FBH A;  3O6B B;  2QLA A;  3CUQ C;  3KLN A;  3ITF A;  2JSP A;  3CJN A;  1G4W R;  1O5H A;  4E0H A;  3OR2 C;  3JRM O;  4MVO A;  1IN4 A;  1BDJ B;  3HNJ A;  4NQF A;  4ZJZ A;  5H6Q A;  4IHW A;  3BJO A;  1FMW A;  1ZHF A;  2DFE A;  2QGU A;  4A3K J;  3G71 I;  3V5Z A;  5CJ9 A;  1XC5 A;  4YEJ A;  4B47 A;  1AKH A;  3DI5 A;  2ETS A;  3U5S A;  5HNH A;  1GVD A;  5CIV A;  4IKF A;  3PL8 A;  1OQC A;  1KQ9 A;  5GPC A;  2Y3D A;  2O0Y A;  4ONS A;  2COB A;  4YT2 A;  3TMO A;  1MBF A;  2H6C A;  2HPI A;  4A0X A;  3KYD B;  1JPN A;  2XV4 S;  2WZF A;  1T2K A;  1H7I A;  3TOM A;  1MMG A;  5H6R A;  2JJ7 A;  3J80 Z;  1VLS A;  2LP0 A;  4YG2 F;  3RQI A;  3SFI A;  4HSR A;  1HLV A;  1T9K A;  3EH2 A;  3W4Y A;  3CJQ B;  2HVR A;  2J0X A;  3V5X A;  5L0I A;  4M3B A;  1V3F A;  1TQP A;  3OIP A;  4Y4R A;  4OMZ A;  3TO9 A;  2FBK A;  3EFO B;  4PCQ A;  1R4M B;  5L3Q A;  3VM6 A;  2QLZ A;  2KMU A;  2J5O A;  3FXU A;  3LS1 A;  3R0J A;  1BR4 A;  1GV5 A;  1ZG3 A;  5DUK A;  2D4U A;  2KJG A;  3GME A;  1NG1 A;  1K7A A;  4U5H A;  1MD0 A;  1R9T J;  1C03 A;  2NUT B;  3C7J A;  5J40 A;  1FJL A;  1O7L A;  2EB7 A;  5IP6 A;  4A3C J;  2OKU A;  1C0W A;  2P1A A;  3O10 A;  2R0Q C;  2KJC A;  1YHQ I;  2XVC A;  3US6 A;  1BI3 A;  2V1U A;  1TLH B;  2K7L A;  3JTG A;  1WI9 A;  4O6J A;  5C44 J;  1NG7 A;  5L3D A;  3S28 A;  3PO3 J;  2PMU A;  2PI0 A;  1APL C;  4C3E A;  1RNL A;  5K1Y A;  5BOX A;  3DKW A;  4M9X A;  1Z3I X;  5D5V B;  2D1H A;  5DLJ A;  3C2G A;  3T6B A;  3B0U X;  3S1Q J;  3JYY A;  2VL8 A;  2VUM J;  2XL6 A;  2MW8 A;  2E87 A;  3GTQ J;  2LLK A;  3K0L A;  4FHT A;  1XDS A;  5IOY A;  3S9O A;  1A6Q A;  2ME0 A;  2E60 A;  3ZR8 X;  5COF A;  1IZM A;  1F1Z A;  4FES A;  1WJA A;  1CGO A;  4U0V A;  2KP6 A;  1NZE A;  4Q7C A;  2WC2 A;  2E1O A;  3ZMU A;  2ZSI B;  5A6B D;  3EGD B;  4HA8 A;  1MBK A;  3CCE I;  3FXK A;  3M8F A;  2J0W A;  5F64 A;  3L8I A;  2HI3 A;  2PBI A;  2LBF B;  5B5E C;  2PJP A;  5GAD J;  4F92 B;  3SXZ A;  2EFQ A;  3Q7G A;  4WF2 A;  2J9V A;  4XLC A;  1R58 A;  1AUE A;  3MN2 A;  2HPM A;  1R6R A;  4IQJ A;  1YJN I;  3J7A O;  2XLH A;  5JVT A;  2JA5 J;  1Q0G A;  1LS1 A;  4EBK A;  4L0Z B;  3TP3 A;  1YZC A;  4J01 A;  4GYG A;  5GAH J;  4PJN A;  2Y39 A;  3ONQ A;  1WWP A;  3ZGK A;  2L3D A;  1H88 C;  3ZTZ A;  3ZCO A;  3NG1 A;  2M9H A;  2LY2 A;  1B72 B;  4LAC B;  2L54 A;  3P9I A;  1SFE A;  3DKY A;  2OAZ A;  4BEH A;  2XLM A;  1TR2 A;  4BPM A;  5K5Q A;  1J7K A;  3DKA A;  5FRO A;  4LLE A;  4C7O B;  5L0F A;  1N78 A;  4G7O F;  2GIV A;  2KLO A;  5L0G A;  2CUJ A;  4A4A A;  4JKV A;  2NOG A;  3JSZ A;  2F4I A;  1SC7 A;  5AC4 A;  2QF7 A;  5HLT A;  2IXM A;  1QZY A;  2OZ6 A;  4XRM A;  1Y0N A;  1W7P A;  1GQA A;  1W2W A;  5ED4 A;  3UGO A;  3BT9 A;  3W6J B;  2EIN H;  2V7F A;  4MVZ A;  3RTR A;  4EVI A;  256B A;  1WWX A;  1EI7 A;  1HF0 A;  2XLO A;  2XM0 A;  2STW A;  1VTM P;  1LE2 A;  3H5A A;  1O3U A;  4IHS A;  4WXH A;  1JJ6 C;  1WQ2 A;  1HST A;  3DBL B;  2DT6 A;  3CDH A;  4QPQ A;  4RB1 A;  4BY1 J;  4HV5 A;  4Q4Z F;  3ZOB A;  3TJ5 A;  5AC5 A;  4B6I A;  3B9Q A;  2MH9 A;  4QSH A;  2WL8 A;  3KZZ A;  5EF6 A;  1D1C A;  1S7A A;  1OCZ H;  1APC A;  3HM5 A;  3HOW J;  4JTA B;  1TZL A;  1TBX A;  3IP4 B;  1AU7 A;  4F91 B;  1E83 A;  4XKW A;  2RGV A;  3CO6 C;  3S3M A;  3J06 A;  2JZY A;  2YR2 A;  4XLF A;  4BDZ A;  2WB1 A;  2M87 A;  4BQA A;  1RC9 A;  5EG0 B;  1SYQ A;  2VE8 A;  4MTF A;  2K4B A;  3NMK A;  1Y1V J;  3CO7 C;  2V6C A;  3E0J B;  2GLO A;  1HOM A;  3MVP A;  3KET A;  3MAJ A;  3G4X A;  3KEO A;  3SXK A;  4LG0 A;  3PDM P;  2LR8 A;  3L34 A;  2MD0 A;  4N4N B;  1ZR4 A;  2XS8 A;  2PNO A;  3BTL A;  1S7E A;  2JMW A;  5HNF A;  1YLF A;  2W9Y A;  2FQ4 A;  4MNU A;  3HNL A;  4Z2Y A;  1K6O A;  4RBN A;  2O03 A;  1O57 A;  2ZB9 A;  3JW4 A;  3ATP A;  4KNY A;  2GXA A;  3H2U A;  1I6H J;  5IT9 K;  4EGZ A;  2M2E A;  2NXN B;  3C18 A;  1RMV A;  3WTU C;  3ZQV A;  3H36 A;  4EAT A;  2IT0 A;  2ZXH A;  3SXM A;  3ZMT A;  3N4M A;  4AWX B;  2A61 A;  1Z6A A;  1S3J A;  3LSM A;  2BOL A;  4A3I J;  3GTL J;  1QZX A;  2UUZ A;  1T38 A;  3J81 Z;  1ETQ A;  3HHG A;  3P7N A;  1J8Y F;  4WJ0 A;  4HNU A;  1ETK A;  1P7I A;  2R92 J;  2BY0 A;  2FBI A;  2IA1 A;  3RSN A;  1JOG A;  2CW8 A;  5M5W J;  1T33 A;  2HQ5 A;  2COM A;  2M64 A;  3LLI A;  1AHD P;  1KGS A;  3IQ5 A;  1WKM A;  2IVM A;  2EWN A;  4I0B A;  1XGM A;  1CQT A;  4AUX A;  4IOA F;  1R23 A;  3IRQ A;  3FOP A;  2WTE A;  4D1Q A;  1HE9 A;  3E6D A;  4M3D A;  5F28 E;  3RKY A;  3OSF A;  2HEO A;  4X6A J;  1DGR M;  3HUG A;  1S5L C;  4H4K C;  3CQZ A;  3V7C A;  1JKR C;  3K9T A;  4HG2 A;  2V26 A;  3PFI A;  4GCV A;  5FJ8 J;  1NHA A;  1OR7 A;  2IGM A;  3QP5 A;  2WWY A;  4ESJ A;  1K78 A;  1F5T A;  4BXX J;  3EYY A;  3A11 A;  3EFO A;  1YX3 A;  3HEF A;  4WGY A;  2KYH A;  4CS8 A;  3ZDL A;  5J6X A;  1O3R A;  2CV1 A;  3NDB B;  3HKK A;  2WVQ A;  1JTY A;  4BXF A;  5D4R A;  2GM4 A;  4I2O A;  3EG9 A;  3KEQ A;  4EM1 A;  2LRE A;  4DQ2 A;  4ENM A;  1HMO A;  3LWF A;  4B4C A;  5DUI A;  3NYL A;  3V5Y A;  2IYL D;  4CYC B;  4NCQ A;  3K1M A;  3BJA A;  1TWH J;  5E3C A;  1R00 A;  1XTA A;  2F2E A;  2ZSH B;  5D6F A;  3PIP F;  1O3S A;  3DEW A;  2JX0 A;  1T08 B;  3CJT B;  3Q0W A;  3GWL A;  2ASR A;  1CGN A;  3RVZ A;  4JQF A;  1VQ5 I;  1JAF A;  4J30 B;  1YZA A;  1QRY A;  3TL4 X;  4XLH A;  5ILV A;  3FMQ A;  2Y9Z A;  3V8K A;  2CFX A;  2VBY A;  1Y1W J;  1Z7U A;  2KIF A;  4E17 A;  2JVH A;  4BKX A;  2CYD A;  2LK4 A;  1U0J A;  5EG0 A;  4E7L A;  3QP6 A;  4XPY A;  3OYE A;  1YAU O;  3L00 A;  2KPM A;  2KHM A;  2XXA B;  4G12 A;  4NTF A;  3BG5 A;  3BRO A;  1ITY A;  2K9N A;  3FWE A;  5A2Q Z;  2VXD A;  4CX9 A;  5KYN A;  1JHF A;  1FIA A;  1W36 C;  1J5Y A;  5A2Q K;  3LAJ A;  5BPD A;  2DYS C;  3K4M A;  1YS6 A;  1H8A C;  5IYB J;  2HDD A;  4LDK A;  5HLI A;  4P9T A;  2FNA A;  4HW0 A;  1JI8 A;  3RZD J;  5CYV A;  1FTZ A;  3NKE A;  1RJ9 B;  1ZYR F;  2L02 A;  2OTJ I;  1ZGA A;  3E6B A;  3K10 A;  5D5X B;  4HZF A;  3QPL A;  5F0H A;  2XAH A;  4S04 A;  1YVI A;  4RAF A;  1JPJ A;  3HTS B;  1HBX G;  4U9D A;  2QYO A;  1YG2 A;  3T0Y A;  4AVZ A;  1LE8 A;  1M2O A;  3B0V C;  4HEA J;  2MC3 A;  2EV0 A;  1RI7 A;  2DU9 A;  4NC7 A;  1G59 A;  2OCE A;  5F08 A;  3JZ0 A;  3IRR A;  3AG3 C;  3KIO A;  1KON A;  2ISY A;  3GZN B;  2AXT C;  1ZQ3 P;  2QKL B;  4PFO A;  4GDF A;  3IQC A;  2P7V A;  3VF0 A;  1L0O C;  2CUF A;  3JRD A;  1CF7 A;  2HTS A;  3JRF A;  1BC8 C;  2PN6 A;  1ETW A;  1I1G A;  3AG1 C;  3BR6 A;  4WXD A;  1K61 A;  1UHW A;  1RCP A;  2OEV A;  2RRE A;  3I5P A;  1ZHY A;  4ZYE A;  3VOE A;  1TTY A;  4ZYG A;  3EHM A;  3HSR A;  3AAF A;  1DUX C;  3KL4 A;  3KP5 A;  3GVA A;  3G73 A;  1Q0M A;  4Z9J A;  2R7V A;  1IG7 A;  1XGS A;  1ZEL A;  2ESH A;  3MZH A;  5BPI A;  4RB0 A;  2OOC A;  5D4S A;  5H20 A;  3SYN A;  2X6W A;  2YX7 A;  4AM3 A;  1OCC C;  4F4B A;  3BR1 A;  2CJJ A;  5B3S C;  2K9Q A;  1KZH A;  1OCP A;  2B9S A;  1SVO A;  3CP8 A;  2LD5 A;  5COM A;  2O9L A;  1X58 A;  3L0I A;  1U6G A;  3GF2 A;  4IRH A;  1MSE C;  3NWS A;  1KTM A;  4BHB A;  4I44 A;  1Q0K A;  1SMT A;  4RM2 A;  4XQF A;  4A69 C;  2XS1 A;  1P4X A;  3FXL A;  4IJJ A;  2LNB A;  3TDU C;  2OA4 A;  4GRI A;  5HS9 A;  1L3P A;  3AGU A;  3JRB A;  4LJZ F;  5K7F A;  4YII A;  1HXD A;  4EKW A;  1S7O A;  3CLQ A;  4JX6 A;  3S3O A;  2JTV A;  3BR5 A;  2QSF X;  3DF8 A;  2M0M A;  4ZYH A;  1ST6 A;  3HG9 A;  2W4B A;  3S2H J;  1OMI A;  3SDB A;  3NYM A;  2F5E A;  1WJB A;  4WX9 A;  5FLX Z;  3LNM B;  3DU5 A;  4P9F A;  2Q8K A;  5B3I A;  2QZ8 A;  2HJM A;  4CDA A;  3BOQ A;  2A05 A;  2ZME B;  2VJJ A;  4XRF A;  3BQY A;  1Y0U A;  2DMQ A;  2F4M B;  1GT0 C;  1U5T C;  3CCR I;  2XSE A;  3OS2 A;  5B1A C;  1I39 A;  2HKX A;  4BHP A;  1ETV A;  1MZB A;  4UUT A;  4HFF B;  4GGG A;  3CC7 I;  1J75 A;  3HOU J;  2Y0M A;  2YL3 A;  1TQM A;  1WH5 A;  5JR3 A;  1EH7 A;  2A6H F;  3V42 A;  4U7B A;  5GAG J;  1I4Y A;  2VT3 A;  2XIG A;  5JVG F;  2WV0 A;  2HV6 A;  4U5G A;  4BL0 B;  1ORJ A;  4L9T A;  4WK8 F;  3HKZ N;  3FBN B;  2HDW A;  2HVQ A;  4CCO A;  1LFU P;  4M71 A;  1Z6T A;  4L9V A;  4YT8 A;  3LL7 A;  1EKY A;  2BGC A;  2NNN A;  4BJ5 C;  1TWA A;  4OD4 A;  4IX7 A;  2K3F A;  3ZQL A;  4DRH B;  2R7X A;  2OEX A;  4LOC A;  5FLV A;  4O6M A;  3GXO A;  4MGR A;  1Z7L A;  4XIC A;  2HQN A;  3OY9 A;  2HUJ A;  3BZ6 A;  1E3H A;  2QA4 I;  2CSO A;  3N2Z B;  3U1D A;  2WAQ N;  2V9V A;  2DFI A;  1FP1 D;  4LMY A;  4RM3 A;  4FE7 A;  3WHN A;  1C02 A;  4J7T A;  3SHF A;  2ZKZ A;  2DGJ A;  3KMI A;  1T0F C;  1GGQ A;  2RD9 A;  2DA2 A;  5D91 A;  2KDO A;  2X0L A;  4EJO A;  3GFI A;  4UVA A;  4YIR X;  1VQL I;  4DW6 A;  5DS4 A;  3NWT A;  1WGX A;  2WB7 A;  5JVE A;  2CW0 F;  2JA2 A;  3ZMZ A;  1S72 I;  3ABM H;  4I98 B;  2Y30 A;  3DWL E;  3R60 A;  5DV5 A;  3GTJ J;  1QVX A;  2J7P A;  1N25 A;  1QQ3 A;  1XMK A;  4ENN A;  5IOZ A;  5E1Z B;  3LAY A;  4XKC A;  2GWW A;  5KYW A;  5LEJ A;  2CRG A;  2CS3 A;  3N05 A;  2C6Y A;  3LNR A;  4NY3 A;  5B66 C;  3TOB A;  1FT9 A;  2OF7 A;  3CEX A;  1TC3 C;  3LFU A;  5HLG A;  3VRC A;  1ENH A;  1JR8 A;  2XGX A;  1TW2 A;  2L7K A;  3RDI A;  3S1R J;  3K69 A;  2EIJ H;  5CPR B;  1ZG1 A;  2CNW A;  2V9K A;  4FET A;  3DM5 A;  3FAJ A;  4PJM A;  4XNF A;  1I1S A;  2DDA A;  1R5H A;  2ZXW C;  1B8I B;  3E6M A;  4XN0 A;  2XGD A;  5LHI A;  2JPB A;  3ZN1 A;  3KEY A;  4BDY A;  2R7Q A;  2W24 A;  1JTX A;  1TFK B;  2Z99 A;  3HJC A;  2PMH A;  4ABZ A;  4CBE A;  4E7Z A;  3ZG1 A;  1WSU A;  1DP3 A;  1NFO A;  2VKE A;  3GTO J;  1OCO H;  2OU2 A;  4QWQ A;  3CCS I;  2K9S A;  2Y3B A;  2GXG A;  1GVJ A;  1S29 A;  2YRF A;  2DQR A;  1LEA A;  2DMP A;  2PP4 A;  4D7M A;  3MKZ A;  4MEX F;  1P7J A;  1RR7 A;  3C8Z A;  3LSP A;  3M8E A;  3GTK J;  5A6K A;  4AD9 A;  5EJC A;  2JUG A;  3MKW B;  3L1M A;  3KX2 A;  4KN7 X;  1VQ6 I;  4MVU A;  3X2Q H;  2HKO A;  3COA C;  1UFM A;  4CCM A;  1ZHZ A;  3HL2 A;  1BN5 A;  4M9Z A;  2G9W A;  4KMF A;  4UNO A;  1ZGJ A;  5A6A A;  4P6I C;  1MJA A;  1RKC A;  2YKZ A;  4MW8 A;  5C3E J;  2NVY J;  5HLH A;  3JAM Z;  2XPU A;  1OYI A;  1B9N A;  1W7P B;  2LKX A;  4JOM A;  2E71 A;  2L7F P;  3VOD A;  2FRH A;  2D5V A;  1TQI A;  4DGW B;  3AG2 H;  2QBY B;  1XCV A;  3LSI A;  2LQG A;  3HC7 A;  4HX4 A;  2VAS A;  4O5V A;  3MBG A;  1WVR A;  2X6X A;  2KIM A;  4EMS A;  4RB2 C;  2BYV E;  3ZMV A;  5JHF A;  4XLE A;  2GIZ A;  3TOA A;  1FOX A;  2VE9 A;  3RPU D;  3BDD A;  3G4S I;  3EH1 A;  4D5F A;  3RPU A;  2M7A A;  2V9P A;  4ASN A;  3C63 A;  4C3B A;  1XGO A;  2NUP A;  1LJ9 A;  5E3M A;  2QUP A;  4QPO A;  4HPQ A;  5J1R A;  2IS2 A;  2IGN A;  3T6G B;  3CF5 F;  5KAI C;  2VBZ A;  3IL2 A;  1HKQ A;  2NSF A;  3H92 A;  2Q3T A;  4KN4 X;  3RKW A;  3I53 A;  2L9S A;  2CV2 A;  2AHQ A;  3QPS A;  2MH2 A;  3IQ6 A;  3QVY A;  1TWC J;  5ICF A;  3RKO F;  2XM4 A;  3WTZ A;  3EET A;  4A5M A;  3ZQC A;  2Q4F A;  4A93 J;  3OS0 A;  4CIC A;  3M4B A;  4G78 A;  1QO0 D;  2P5L C;  1J9I A;  3V7S A;  1NTC A;  2M30 A;  4J00 A;  2E7X A;  3UKG A;  3BZC A;  5CVI A;  4BQQ A;  2TMV P;  1IV8 A;  3ASO C;  4M73 A;  1ZW2 A;  5TJ5 E;  2W57 A;  2X1D A;  1X4P A;  1W0U A;  3ZC4 A;  4I02 A;  2DJI A;  5EEH A;  3WE3 A;  4X0G A;  4P9U A;  5ICE A;  2YL1 A;  4GFB A;  3WG9 A;  3RQE A;  2WAD A;  4CDY A;  2P61 A;  3IH2 A;  2R5Z B;  4XLP F;  1LEB A;  2X1E A;  4V19 K;  4M63 A;  3TJ6 A;  3DMD A;  4IRU A;  2Z16 A;  3RIP A;  1J2X A;  3KYI A;  1IO2 A;  1FSE A;  1X1C A;  1WN0 A;  4RDA A;  4DVZ A;  1R4N B;  2EFP A;  2PBE A;  1VMA A;  3OMY A;  2H7B A;  1Z3X A;  1IDY A;  2MWQ A;  3BCA A;  2PMZ N;  3T8T A;  1V5G A;  4IHT A;  2MGQ A;  2IXN A;  1YW8 A;  4CIH A;  4ZDP A;  1U8B A;  1X2N A;  2E5Z A;  4U5E E;  1EF4 A;  5FFX A;  3KYC B;  4QLC U;  3HOX J;  1BJA A;  2EQR A;  1R1V A;  2JRT A;  2DYS H;  3CAX A;  2Q2E B;  2FNP A;  5JP7 A;  1TNS A;  2AXL A;  2QM3 A;  3JRE A;  2XSJ C;  3IH4 A;  3RPQ A;  3GTM J;  2WVN A;  3M4C A;  5FFZ A;  3CMM A;  1ZRF A;  2G7U A;  5HDG A;  1M2V A;  2XLE A;  2E1M C;  1IW7 F;  2EIJ C;  5JSL A;  1B1B A;  2K9M A;  3UMK A;  2CGP A;  2VKH A;  2Q2E A;  2JN6 A;  2P5V A;  3DBR B;  2EA2 A;  5J4V A;  2BC5 A;  4HF2 A;  3N0T A;  2DA3 A;  2W84 A;  1KNY A;  2Z2S B;  5IT9 Z;  2YVK A;  4L9N A;  4JX4 A;  2RV8 A;  5HOO A;  3E6C C;  4RGS A;  3JRH A;  1OCC H;  4O6Y A;  2ECC A;  3CDI A;  4II3 A;  5KYX A;  3TED A;  1S7Z A;  3M7G A;  5F0F A;  1U9N A;  1J0R A;  3BY6 A;  2DI3 A;  3F72 A;  4AK9 A;  4BE1 A;  3SEQ A;  4HX8 A;  3F0C A;  3Q6M A;  2XUB A;  2PF4 E;  2Z3Y A;  4E7S A;  5HDK A;  1A6I A;  2ZNY A;  1UST A;  4MEY F;  4RS8 A;  4BEH B;  4L5J A;  3OYB A;  1ZRD A;  4F55 A;  5L3G A;  1OW6 A;  2EV5 A;  4E6K G;  3GCM A;  6PAX A;  1SMY F;  1OLT A;  1D1B A;  2DT5 A;  2V1X A;  4C9Y A;  1G8X A;  5CLS A;  2ACJ A;  2KIS A;  2FA5 A;  3HKZ A;  3S8P A;  2I8B A;  3V7R A;  2L6G A;  3DTE A;  1I3Q J;  2XAS A;  4IJA A;  3W6V A;  4N4W A;  3KE2 A;  2PJR A;  3ZQF A;  1M1E B;  2RAE A;  1YRN B;  4DZP A;  4A3L J;  2ME6 A;  2AQF A;  2LSO A;  1FX7 A;  3QRF F;  4Q5S F;  2CV0 A;  2EPM X;  4L9J A;  3F6V A;  5DCM B;  3EG9 B;  2EIL H;  3LUT B;  4P96 A;  3OOU A;  2CO5 A;  3JSE O;  2AQE A;  5TIS C;  1YTY A;  3QYE A;  2MAB A;  4W8P A;  4B44 A;  4OIP F;  3EGD A;  4A5N A;  3M07 A;  1STZ A;  4FX0 A;  2V4J C;  4M74 A;  5IT3 A;  2DJN A;  2FXA A;  4UY8 I;  2L5Q A;  5CVR A;  1DU6 A;  3G1O A;  4EV0 A;  2IS4 A;  4DBQ A;  1Z3Y A;  3ASN C;  2DT7 B;  3ZTM A;  3WTY C;  1MH3 A;  2QVO A;  3ZRG A;  1T5O A;  1WAT A;  2HDC A;  2AWY A;  3ABL C;  3B0P A;  2ID6 A;  4U88 A;  3HLZ A;  3WU1 B;  3DJN B;  2QQ8 A;  3ERE D;  2VT2 A;  3HPG A;  3I4N J;  1HDP A;  2OCC C;  4Z9H A;  3QOP A;  4ZDL A;  4ETS A;  1I4Z A;  1E2X A;  1A7D A;  1T6U A;  3U9J A;  5JUA A;  3CP2 A;  4PK4 A;  1GS9 A;  2W1O A;  3LEV A;  3M1E A;  4QI0 A;  1ZZP A;  2D45 A;  4CH7 A;  4LLG F;  4ZH4 F;  1BZ4 A;  2O7O A;  1MDM B;  1QA6 A;  1MSF C;  1OIS A;  1W4M A;  1B9M A;  4PR9 A;  2V3C C;  3A01 B;  2QEX I;  2DB4 A;  2QKM B;  4ANJ A;  1R5I D;  5H2F C;  2HNH A;  5F04 A;  5IY5 H;  4CHU A;  2Q00 A;  2ZBK A;  4IGG A;  3K6G A;  3EUH A;  4A3M J;  2P6V A;  1SAU A;  2VB6 A;  4CYC A;  3BEH A;  4M3G A;  1IC8 A;  1QBJ A;  2EPO A;  4CS9 A;  1J09 A;  1DPU A;  1LNW A;  1Y6D A;  4LLL A;  2R5Y A;  1SD6 A;  3FHD A;  3FF5 A;  1VQN I;  2YLD A;  1D1A A;  3ABT A;  3J7Y J;  2CYY A;  1OCZ C;  3FOO A;  5DS6 A;  3AG4 H;  2IP2 A;  3FZV A;  3OYL A;  1MMD A;  2YU9 J;  1ZLK A;  1G3Y A;  1JRA A;  2LYC A;  2UUI A;  5KYY A;  1TWF J;  1VND A;  3E1S A;  1H6G A;  3S17 J;  2D2W A;  1ZH5 A;  3E9V A;  2WVO A;  3OR1 C;  2QQA A;  1ZHW A;  1EV7 A;  2XRL A;  3TK0 A;  3OYC A;  3ZP5 A;  4OOI A;  1WH7 A;  2ZNZ A;  2W4S A;  2RQP A;  1GXP A;  2E2H J;  2MLK A;  3ZXS A;  1K04 A;  4ZLD A;  3J7A Y;  1YJW I;  2EPL X;  1HE1 A;  5M3M J;  2VJ5 A;  2V1D A;  4UV9 A;  4NC8 A;  3O8H A;  1T0F A;  3PO2 J;  1JXS A;  4BEM J;  5LD2 C;  1XSD A;  2DPD A;  2HXO A;  4NC6 A;  1SD7 A;  1LDK B;  1V5F A;  3NAR A;  4DYQ A;  2A07 F;  2Y0S N;  4HF0 A;  2XAF A;  1OYY A;  1JKP C;  3I56 I;  5LEK A;  3QW1 A;  1YYV A;  2DTZ A;  3HB9 A;  3B6C A;  4OIR F;  1NU9 C;  2HZ8 A;  4F93 B;  1XN7 A;  3I59 B;  1IF1 A;  5DCM A;  3S29 A;  4D0P A;  5E8G A;  4CCJ A;  4DBR A;  4XOT A;  5F6F A;  3N24 A;  1FWZ A;  3UR3 C;  1T6Q A;  1VZ0 A;  4WWC A;  4XKV A;  3RKQ A;  4RGU A;  1MMN A;  2XDV A;  3S32 A;  5JFR A;  4FE4 A;  1D8K A;  5DVW A;  3DE9 A;  3MFK A;  3CUQ A;  3GBG A;  4XID A;  4JVS A;  2PFB A;  4HAM A;  3HIF A;  2OC6 A;  3TGN A;  5E3A A;  2DLL A;  5K7Z A;  2FFH A;  4O6N A;  2P0N A;  2IA0 A;  3FIW A;  1VLT A;  1TL8 A;  3K4B A;  4PJJ A;  1YI2 I;  2HQR A;  1Z23 A;  2JPU A;  3LNQ A;  1YQA A;  3BLY A;  2G3V A;  4DNC A;  2GA0 A;  3L2C A;  5LFA A;  1A7E A;  1VK5 A;  2VJ4 A;  5KYU A;  4BGD A;  1L7C A;  1JT0 A;  4UB6 C;  3T6J A;  2KGO A;  4CSW A;  5FRM A;  3E5X A;  3S2W A;  2M45 A;  1OQY A;  5L3B A;  1FYK A;  1BL0 A;  4ZZD A;  2LCH A;  4GQH A;  4MO7 A;  2KT0 A;  5J1U A;  5E3O A;  4NTA A;  3OA1 A;  1YRN A;  4XN3 A;  4LER A;  1AWC A;  2DOD A;  3D1N I;  2UUH A;  1KU9 A;  2KIU A;  2JA6 J;  3MKL A;  3TD7 A;  3D0S A;  4WGZ A;  5KNL A;  3TDZ C;  2MLG A;  3TBI A;  1T95 A;  5D6E A;  1A36 A;  1TT5 B;  1IN7 A;  1WJ5 A;  1R49 A;  1R7J A;  2EIL C;  4KC9 A;  1HKS A;  1ZAR A;  2LG4 A;  4ENJ A;  3TW6 A;  1USS A;  5LGN A;  4UUV A;  2J45 A;  2P0W A;  5DQT A;  3OYG A;  2IRF G;  1FMV A;  3PQK A;  2HFI A;  3KP7 A;  2XLW A;  2VKV A;  3O3K A; 
#chains in the Genus database with same CATH homology
 3KPH A;  1R5I D;  2OJE D;  2ICW G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...