2OJED

Mycoplasma arthritidis-derived mitogen complexed with class ii mhc molecule hla-dr1/ha complex in the presence of edta
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
214
structure length
214
Chain Sequence
SMKLRVENPKKAQKHFVQNLNNVVFTNKELEDIYNLSNKEETKEVLKLFKLKVNQFYRHAFGIVNDYNGLLEYKEIFNMMFLKLSVVFDTQRKEANNVEQIKRNIAILDEIMAKADNDLSYFISQNKNFQELWDKAVKLTKEMKIKLKGQKLDLRDGEVAINKVRELFGSDKNVKELWWFRSLLVKGVYLIKRYYEGDIELKTTSDFAKAVFED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain prec
publication title Zinc induces dimerization of the class II major histocompatibility complex molecule that leads to cooperative binding to a superantigen.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 81
structure length 214
sequence length 214
chains with identical sequence H
ec nomenclature
pdb deposition date 2007-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF09245 MA-Mit Mycoplasma arthritidis-derived mitogen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.530 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A mam-mhc complex, Chain D, Domain 2 2ojeD02
1.20.120.390 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hla class ii histocompatibility antigen, dr alpha chain. Chain D, domain 1 2ojeD01
2OJED 3KPHA 2ICWG 1R5ID
chains in the Genus database with same CATH superfamily
3EGDA 3C7JA 1NFNA 3KX2A 5J8CA 3RQFA 1JMWA 4HQEA 3HKKA 1WJBA 1YI2I 3U2RA 2EFPA 2EJRA 3C3WA 3G1LA 2LY2A 5FKMA 4CCMA 2X85A 3DWWA 2XRNA 4QDLA 3K7AJ 1APCA 3LJBA 2X4HA 3GEZA 5FLXK 1D5VA 1PCXA 2QSGX 2M8EA 3H65A 4U7BA 3OR1C 5E3OA 4IZZA 2YL1A 3ZOBA 2G62A 1BI3A 5J1UA 1SF8A 1E84A 2Y0SA 4F93B 3F3XA 1HKQA 4XLPF 4FE4A 1YRNB 3QOEA 1P9QC 5GP9A 2CNWA 2KSFA 3DXJF 3U8PA 4ZH4F 2WAQN 3WGIA 1MSFC 3PUFA 4XRSA 1ZYRF 4U7DA 1K61A 3NQOA 2ZFWA 4RGSA 4XRMA 2IGOA 1Q1HA 2H8RA 4FHTA 3KYJA 4MLOA 3FF5A 3SXYA 1RJ9A 5JT4A 3VB2A 4KIBA 4C3JJ 1VZ0A 2M30A 2I15A 5D92A 1ZHFA 2OA4A 1BDJB 3SXMA 4A12A 2BBYA 4L5JA 4XICA 3OYCA 2VE8A 3LNMB 3IEEA 5DQZA 4FQGA 3K1IA 2Q1ZB 4C2TA 1OR7C 2RVCA 2Y0MA 2BVLA 1TQPA 5KVRA 4A5NA 5ILUA 3QZCA 1N78A 4NCQA 2NRAC 3BR0A 5HOOA 2BW3A 2E19A 3K10A 5K1YA 3WE2A 2H7OA 2R7DA 2IP2A 4II2A 1X2MA 4ENJA 1FLIA 5A6JA 2FRHA 2VBXA 2QE9A 2FU4A 3ZQFA 3A2KA 3LFKA 3CC2I 1R36A 2YLDA 4Y52J 2HJMA 5LHHA 1E3OC 3GTLJ 1UHWA 4UV8A 5IT9K 2HTSA 2FBKA 2OUMA 4D4XA 4IHYA 1V5EA 1AA7A 5GAHJ 5DUKA 3BPXA 1VF9A 1IZ1A 3MKZA 5FKNA 3HLZA 4NTFA 2DPUA 5E3CA 5H6QA 3J81K 1ZN2A 3JCUQ 1RETA 2DJIA 3CUQA 4BY1J 5E1XA 3V7RA 3B0UX 1X4OA 1WKMA 4XLAA 3A01A 3KFWX 1D0XA 2FAPB 2LBFA 2QLZA 2EFWA 2ZXRA 1LM3B 1XTAA 2NVUB 2ZJRF 4UY8I 2PQ8A 1MBGA 1WVRA 3H9GA 5KNLA 3I3LA 3F23A 3GF2A 2MG4A 4G8XA 2YKZA 3ZIBA 2OC6A 3K70C 4HLYA 3BZKA 2FJ1A 2HMQA 3QU6A 3W8IA 2WBMA 1ULYA 2EK5A 4K2EA 5FLVA 4XK4A 1GLNA 2RREA 2CSOA 2J7PD 5BPIA 3PUBA 1R58A 3ZWIA 3K33A 2LH9A 4IOAF 3E5UA 1UELB 3DFGA 5E8IA 1CPQA 4I44A 2QLAA 1FBSA 4IHVA 4MHGA 2JA6J 4ASNA 1A7EA 3FXLA 3S2DJ 4BEMJ 1GM5A 4XEFA 1H89C 2J45A 3EPVA 1LJ9A 3AG2C 4XOPA 2HNHA 3O6BB 2BVMA 3KPHA 3HYIA 3L2RA 5K5OA 1QPMA 4Y33A 2VE9A 2IBFA 2LCHA 1Z91A 4QPOA 2R4GA 1LKXA 2XV4S 4WCGA 2V9PA 1V5GA 4U87A 2XLEA 4NTBA 3HNIA 1PUFA 1J7KA 3IKTA 2MC3A 1RKEB 2XSJC 2Z15A 1ZHWA 4GGGA 1O7LA 4I99C 3LUTB 3FKIJ 2M9HA 3PIOF 2YVKA 5CQGA 3JT1A 5T3WA 3DE8A 3V8JA 2UUHA 5DDGA 3BT9A 4LB5A 2A69F 2OOCA 1X3UA 1JHFA 2OAZA 2L6HA 1YIOA 1CPRA 3QPHA 2R7VA 2L9RA 3QOPA 3KP5A 3GFIA 4F7ZA 2NVQJ 4XPYA 4BQAA 1ITYA 2FBIA 3KP4A 1G59A 4XSZF 3VODA 2O03A 5A6AA 2L0KA 4BKXA 2GAQA 2CU7A 3DM9B 5F28E 3HC7A 2F4IA 3SZGA 2JQ7A 5EYRA 1USSA 2DA6A 3HSFA 1V74B 2QKMB 3N05A 1TFOB 3C8ZA 2JD3A 1Y56A 4BGDA 1Q0MA 4EBKA 1IN8A 2YPRA 3OYMA 1STZA 4L0ZB 1SFEA 5A2QK 3LS1A 1J09A 1S05A 2XLHA 1A6QA 3TQOA 1IXSB 4IRIA 2XM4A 3P9IA 3HB9A 3PQJA 1HOMA 2YQYA 3N2ZB 1ZREA 1FYKA 2Z2SB 3EG9B 3DBRB 3K4NA 2DOEA 1MZBA 2R7OA 3K4KA 1ZHTA 3HTKC 1XGOA 1FR0A 1SVMA 3CDLA 3ABTA 3FHNA 4HV6A 1D5YA 1RC9A 3EYIA 4F55A 2QY9A 3U2MA 3CMMA 1TT0A 2I8DA 3FAPB 1S29A 3DAFA 4Q47A 4NC8A 1U5TA 2OTJI 2XSEA 1VI0A 1P4WA 3C2HA 1IRXA 2XPVA 3GTPJ 3M3YJ 1W4MA 5J1YA 3KP6A 3EJNA 5F1RA 4L9TA 2JA2A 4RLFA 2YWAA 1ZK8A 2CH0A 3FXKA 1JT6A 3QU3A 3HPHA 2VKHA 2OJQA 1IF1A 2DA1A 1FTTA 3BR6A 1XGMA 3OY9A 3CO6C 4OOIA 4U9EA 4G7HF 2WV0A 4YT8A 2O0YA 2OV7A 1ZHZA 3COAC 4LD5A 1D1AA 3RIPA 4M3DA 1OYYA 1X1PA 2E5NA 1FC3A 4KMFA 2G7UA 2LKSA 4L9NA 4RLQA 5L3FA 4RAFA 1V4AA 2ETSA 4JX5A 3LEVA 4IARA 1WGXA 4BL0B 4MVZA 4XQ1A 1R1TA 4I1OB 4YIFA 3NDBB 4YK5A 1ETVA 2JVGA 4LG3A 4JX6A 1FJLA 4E7JA 1G8XA 4KMUX 1JTYA 2F6CA 4AU7A 2LC2A 4CCKA 1IN7A 1LVKA 2DQLA 4JX4A 3WTXC 3S1QJ 3E70C 1FT9A 2X0CA 2ME6A 2HOEA 1AEPA 1S7AA 3BG9A 3RZOJ 4IF4A 5ERIA 1QPUA 3K6GA 3ASOC 3R0AA 2L2OA 3T6JA 2XRHA 1A04A 2VQGA 2EZLA 2O8XA 2OD5A 1OCZC 2OJED 4IRUA 4HEA2 2K9SA 4H54A 4B3AA 1AUEA 1M1EB 4CUGA 1W2WA 5DD8A 5L0IA 3HBLA 1YJWI 5F5FA 3J7ZI 3NMKA 1A7VA 3CP2A 1ORYA 2H6CA 2LK4A 2AQEA 4U0WA 5F0HA 3HIFA 4HG2A 3L2CA 4HDVA 1FAPB 4C3EA 4CH7A 2DPDA 5CVRA 4L5EA 3T8RA 2R7UA 3ATPA 2K7LA 3Q9VA 1Z77A 3B6CA 2KLOA 2AO9A 2J9VA 1WJCA 3B02A 2OTLI 1U5TB 3I9V2 3M79A 4XSXF 4DGWB 3MN2A 1PUEE 3UR3C 1YZAA 2Y3DA 4YEJA 3ASOH 3JRGA 3CTAA 3DPUA 2MA3A 1TP4A 2LFBA 3DKWA 3PNYA 4HNVA 1E0EA 4CS7A 3O8GA 1IC8A 4GEHA 2HOTA 1WH7A 4OD5A 1R9TJ 2XSDC 2DT5A 3PJRA 3KYCB 3CZ6A 5FLMJ 4OD4A 4KYWA 3S1RJ 2TRTA 2JWTA 4OIRF 3L2VA 1LE2A 3AGTA 1FIPA 2Y48A 3BCAA 4AWXB 3E9VA 3TO7A 1ZRFA 1X2NA 2KJGA 4M74A 4FX5A 2VI6A 2Z9OA 3BC8A 1NHAA 2V6CA 2PI0A 3MBGA 1XMXA 4IO9F 3ZRGA 2STWA 4O6NA 4C3HJ 2VQHA 3OYFA 3IH3A 4LGWA 2IXPA 1TWCJ 1MD0A 2RNGA 3Q9SA 5HDNA 1RRJA 1LPQA 3BJ6A 3I0TA 3PNVA 3FX3A 1FMWA 3OYKA 3JR9A 1QQ3A 4B3XA 2KRCA 4M71A 1BOBA 2KIQA 3FBNB 2EFOA 4JURI 1HSJA 3SYNA 2ECBA 1A0BA 5D4RA 4BJ6A 5JVGF 3ZQQA 1LEAA 4ER9A 2A5YB 1YA9A 3PCVA 4KICA 2WADA 1ZVZA 4XEVA 2VPLA 3EZIA 4PGHA 5LRSA 4IGGA 2DXIA 2UV1A 4XKVA 1Y6DA 1R5ID 2DOFA 4LLNA 1Z05A 1RUNA 2GOMA 1VQ5I 2EILH 2LK2A 3GFJA 1MJBA 4O6JA 2XL4A 4L9VA 4ZYEA 4UVBA 3X2QC 4ZYAA 2GXGA 3C8GD 1WH5A 3MQ0A 3L2WA 4BPMA 2MC4A 1U6HA 1HA8A 2Q00A 4WGYA 2L6FA 4CS8A 4PGGA 3JRBA 1VMAA 1HXDA 1B9NA 2H8WA 3BP8A 5E1WA 2VOPA 4DYQA 1T08B 5ICGA 3JAMK 3ZN1A 5JI6A 1USTA 4U9DA 5BMZA 3LA7A 1QBJA 5F5HA 5IT3A 2WAQA 1IJWC 1X19A 3ZC4A 4YG2F 3S8PA 4D1QA 2IOQA 1GV2A 1UHMA 1WQ2A 5JLXA 2LNBA 5E33A 3GYHX 1BBHA 3TDUC 2L02A 4JOMA 2D1VA 4LIUA 3I56I 4JJFA 1FZPB 1ZLJA 4D0PA 2DA2A 2ZC2A 3RI4A 5ICFA 2X6XA 5IYCJ 4NC3A 1UFMA 5KK1A 3WE3A 3IRRA 3AG3C 4FCYA 4AE4A 4BE2A 4V2FA 2VBYA 2CUFA 5LBQA 2DT7B 1OPCA 4UDVA 1W7PA 2F4OB 5CVJA 2A5WA 1J5YA 3K4CA 3OL3A 3C62A 3GW2A 1P7IA 1TQIA 1POGA 4J19A 4FISA 3RFYA 1TQMA 3ABKC 3SZPA 3WHBA 1GXPA 2EPMX 1M2VA 3IKVA 4O5VA 2QYOA 4OMZA 3CD6I 1N77A 3CJTB 2EA4A 4Q5SF 3NWSA 5D8LB 4E70A 1SVLA 4CSAA 5DEQA 3JSZA 2R7XA 1QKRA 2DTRA 1C03A 2ZSIB 3SHFA 3JRTA 5T3TA 1MBJA 1QQIA 1XSXA 4HAMA 2JUGA 3GORA 3AG3H 4RBOA 4C2MJ 3JTHA 3A03A 3E6MA 5JHFA 5BQIA 4P5OA 2EZHA 5FKOA 2QEXI 5D91A 3OMYA 4M6YA 2DFFA 3K6BA 3B0VC 4C7OB 4D9JA 2KFDA 1RMVA 3TOLA 4EBBA 4MW8A 1Y0UA 3KEYA 4Y3OA 2HU9A 2HSBA 2E1MC 4RMNA 1A41A 1ONVA 2LQGA 2OCCC 3AKZA 1LS1A 3ASNH 3G50A 2UXNA 1D1BA 2L01A 4DIQA 4ZTFA 1U8BA 1Z23A 1CGME 2DYSC 4JP0A 1FSHA 5IY5H 3KZZA 2L7FP 4DJAA 2KJCA 1RR8C 3Q6NA 2UZKA 5K5QA 1V54H 3S1MJ 4PFPA 4B1RA 3CQZA 5J47A 2DA3A 2LYCA 2N8GA 4LK0F 3ZMTA 3KL4A 1VQMI 3DI5A 4FETA 3ZQGA 1JXSA 1WN0A 2DU9A 1I6XA 3A0HC 5CKTA 1XPXA 3LSPA 3EYYA 5AONA 3ZP5A 5DM6F 1UG7A 4XTKA 2ZXPA 1O3QA 2DTZA 1NG1A 6PAXA 5K0IA 2VJJA 4R79A 1FSEA 1JKQC 1IUFA 4KDPA 2DMNA 1F1MA 5B5EC 2WZLA 4EBJA 3CMAI 4KA4A 4MVQA 2Y69C 2KW3C 3M8EA 1X3ZB 4BEHA 1OR7A 2DYSH 1T2KA 3T6GB 3S14J 1OCTC 1NH3A 5M3MJ 5GPCA 3TP3A 2OU2A 1ST6A 1MBHA 3ZR8X 2EQRA 3H9JA 4ZYHA 4U88A 3OYGA 3OYJA 3I5UA 5ICEA 2P5LC 3GO5A 1WTYA 1YE9A 2FOKA 2KKOA 2D4UA 4NTAA 1FY7A 1MGTA 1SFUA 4ULWA 4MFEA 3HRTA 4D7MA 5M3FJ 1HKTA 3JYYA 3VYWA 2PJRA 1ZH5A 5AIPA 5BQGA 3BTJA 4MQ9F 4NDLA 2VC0A 4A3IJ 2L9VA 2R03A 4KISA 4YRVA 4M72A 4BHCA 4BQOA 3Q3SA 3MYIA 3OOUA 5A69A 2ZXHA 1E3HA 3FXMA 3E1SA 4HEAJ 5HS7A 4AVZA 2W9YA 1O3UA 2Y69H 2PMHA 3RKXA 3F8MA 1G4DA 1U89A 2JJ7A 2FQ4A 3DEWA 1Z3YA 3BZCA 4E0HA 5JLWA 5DS6A 1SFXA 3UGPA 3QYBA 1YS7A 4WXCA 3FOPA 1KU2A 1I5ZA 1X1BA 2XPUA 4P9TA 3US6A 3S2WA 3R61A 3KMIA 4LLLA 5L3GA 5JS5A 4H4KC 4A0YA 4MVSA 2P7CB 4O6MA 4YWQA 3OYIA 1D3YA 3M4CA 3FBIB 2X6OA 1VQ7I 3GCMA 2IGNA 3D5LA 4IRGA 1WPKA 1LDJA 2DT6A 2OZ6A 4HQMA 2AXLA 1HQCA 1AKHB 3KLNA 4OMYA 3B9QA 2JPCA 1X1AA 1OYWA 2NVYJ 1FEXA 1HMOA 3S32A 4ZC3A 5CPRB 4EUKB 3C8GB 3IH4A 1LE8B 2KMUA 4BEHB 5EGOA 2P0NA 3QW0A 2R7TA 2L7KA 1P2FA 2PLYA 2ZSHB 1BC8C 2DDBA 4JZAA 1ZW3A 3I71A 1H6GA 2PMZN 2DO7A 2A61A 3V8LA 1X1CA 2NVTJ 2KQ9A 3F8BA 1TR2A 1KU7A 3PFYA 2NOJB 4BJ5C 3S16J 4J00A 5JRAA 2ZNZA 1YJ9I 1B72B 2AS5F 1VQKI 3B0PA 5DQTA 4GRIA 1L3LA 2EFQA 3TBIA 2HGCA 3OIQA 3J7AY 1XD7A 2HQRA 4HRIA 3ABLC 2ZMEA 4M9ZA 1RNLA 3HEFA 5EG0A 4MVOA 1D0YA 1ON1A 5AGFA 3D0SA 1PDNC 2K4BA 5D5VB 4C9YA 1KQ9A 1R6RA 1RESA 3ONQA 3SEZA 4RD9A 4XLEA 3AOUA 3CCRI 2P5KA 3J7AO 3EFOA 2YLGA 3I59A 3U0CA 1IRFA 3LOCA 3NARA 3RYLA 3KEOA 4JEAA 2XXAA 3TGNA 2H1LA 4UVCA 5HLIA 2KGOA 3H3VK 3RIRA 1U9OA 2NOGA 3MZHA 3BTLA 3RPUA 2HFHA 1B8IA 2R7FA 1QNTA 2CFOA 4CZZA 5E79C 3Q5FA 2R7WA 4QSHA 3S0XA 3VRCA 2VJ5A 4AIHA 4E7HA 1J59A 5F04A 2K3FA 2X9DA 3CESA 1H88C 3B71A 5GPGB 2GIZA 2QM3A 1I1SA 3FK6A 3DD7A 1Z3IX 4UB6C 5TRDA 2LFDA 2XS8A 3WAQA 3NAUA 3JSPA 3Q7LA 3FAJA 1B4AA 2AHQA 3SDBA 1SVOA 1YRNA 2PEXA 3C2GA 1A36A 2E2JJ 1OKKD 5F0FA 2JSPA 1SMYF 3F9KA 1ON2A 1T39A 4Y17A 1QVXA 1FFTC 2R7RA 2LVSA 3FXQA 5FRNA 4U5FE 4BE0A 1Z67A 3D5SC 4CO8A 2K4JA 4GFBA 3V7CA 5GTHC 1HE1A 5KCMA 4N06A 2E5ZA 1YA7O 2BY1A 4RDAA 1HE9A 1ORSC 3BWGA 2KT0A 5L3BA 2H7BA 1WSUA 1FPQA 3S2HJ 4G12A 4A4AA 5CLSA 4HPQA 1OCCH 4N9HA 2AWYA 3HOTA 4YL3A 5JVTA 3HOXJ 4ZYDA 5CVIA 5EEGA 2KIUA 1HLVA 2A3SA 1MNDA 2XAHA 3AFHA 2MW8A 4HLXA 2M45A 1I4YA 3J80Z 3BR5A 1IN5A 1XDSA 2YX4A 4WGZA 2XGXA 2P6VA 4PJ0C 4WXHA 2HR3A 1QVUA 4BE1A 2P7VA 2KDZA 1EF4A 1KYWA 3SNHA 1Q1VA 2YLIA 1UFBA 2A07F 1WGWA 3KETA 2VCAA 2KHMA 4AYBN 1UAAA 3FWEA 1KGSA 3J7YJ 3I59B 4RB1A 2IW5A 2XDVA 2B0HA 1L7CA 1W1WE 1K6YA 3ABUA 1W0UA 1XWJA 2KK1A 2XXAB 3NMJA 3EUHC 1U78A 3W3CA 2R5YA 3LNRA 1B8IB 3JTGA 4EGYA 4U0VA 1SMTA 1OISA 2AXTC 2GDCA 3GANA 4J30B 3PQKA 3TL4X 4I3MA 4QPQA 2G0EA 3C2BA 1VTNC 1TWGA 1KA8A 2P81A 2Y9ZA 2DFIA 3ZPLA 2WL8A 3JRFA 1U2WA 3LSJA 5J8FA 3E7LA 2XGCA 5C44J 1S5LC 2R02A 3DLLF 3IC7A 1YARO 2PJPA 2P4WA 2XB5A 3KZYA 4RAGA 5LGUA 4JCHA 1EV7A 2RN7A 3L1PA 1IRZA 3GTKJ 1M57C 2PP4A 2NXNB 2Q9CA 2ADUA 1LE4A 4MS2A 5FJ8J 2DA7A 1WI3A 1XDUA 3E3VA 4EEFG 2UXXA 2R05A 1L0OC 2Q9BA 1YS6A 3R4KA 4D5CA 4EATA 4C3DA 3IQ6A 2D5VA 4ABZA 1BIAA 4M9SA 3HHHA 3WTSC 4CDYA 3WTVC 2XKOA 1OW7A 2HYJA 2P7VB 1NK2P 1VOMA 2R0QC 3K4MA 2KP6A 1RKEA 2R25A 2F48A 3TULA 2VKDA 5LRRA 2X1EA 3CMYA 4YFKF 3OYHA 1KQ8A 3B29A 1YYJA 1JT0A 4ZDOA 1YLFA 3G4SI 2Q2EB 4B48A 4B8XA 2R5YB 4WWCA 1HBXG 2W82A 3R6SA 5AIQA 2BY0A 1T95A 2IS1A 3K1NA 4R32A 2HQAA 3R7CA 2L4AA 1R4TA 2H8AA 1MQVA 4ZYGA 1REPC 4A3BJ 4UUVA 3M4OJ 2GLOA 4N6CA 2CG4A 2H94A 4PJJA 1BJZA 3ULQB 1A31A 3AG1C 5H6RA 5L0DA 2W84A 4A3MJ 2QUPA 2GBYA 2HUJA 3KP3A 3A1YA 4N4OB 4RAZA 2OEXA 4G6TB 2ESNA 1QZZA 4IVNA 4PDKA 3G4ZA 2IYLD 1IN4A 1HKSA 1BR4A 4FTHA 1WFXA 2K02A 1R23A 3FK7A 2C6YA 4A3DJ 1RCPA 2DB4A 2IS2A 1AVOB 3NEUA 4C3IJ 2OU6A 3WU1B 3ZQCA 2R9RB 2JSCA 3ZQIA 1MNMC 3EG9A 1LI5A 4U5HA 2E60A 3AAFA 3D1NI 3BG7A 4HOBA 5TGTA 2HZ8A 2W24A 1ZRCA 2RGVA 2HPMA 3K69A 3K2AA 3H0DA 3TOBA 1F36A 2CYYA 1YQAA 2P6SA 1BW6A 5D5XB 1Q0KA 3G4XA 3GWNA 1NK3P 5A6BD 3AG1H 1FX7A 2LR8A 1P7JA 1TWFJ 1NZEA 3E6BA 1YYXA 1Q0DA 2K40A 4AL0A 3IPMO 1Y0NA 2WB1N 5FD6A 4ZJZA 3HGGA 3X1OA 4I2OA 2FX0A 4J7YA 3ZTZA 3KYIA 1D1CA 3UMKA 3U1DA 2H6BA 2HKXA 3NKEA 2DGJA 2BY3A 2YL0A 3MZ8A 3V5YA 1AHDP 1EA8A 4LDRA 2EIKC 2XB0X 1F1ZA 1T6SA 1OW6A 3QTHA 1WCMJ 2XGDA 3RCOA 2VC1A 5D6FA 1QZXA 1BBYA 4BHBA 1OQYA 3HDDA 1CGPA 4CIPA 2QSHX 1PJRA 2NG1A 4I09A 4GDFA 3I5QA 2CGEA 3DF8A 4A3JJ 4A3GJ 1LVAA 3QVYA 2XM0A 3EDPA 1T5OA 2LY9A 2EB7A 4CJGA 1T6QA 2FBHA 3PO3J 3OYAA 4RA2A 3OYNA 2R93J 2COBA 4KNVA 2IXOA 5IYBJ 2R7ZJ 4LIVA 2R7SA 2BYVE 3HHGA 2WY7Q 3KCCA 3ZSUA 5JP7A 2EIKH 2QQ8A 4CJOA 2W45A 2Z5UA 3JRHA 4U5DE 1K40A 1YX3A 2CO5A 2Y9YA 3BJAA 4D5FA 1YOVB 2ZJQF 1I5NA 3G73A 1HW2A 2HXOA 4G6DA 1A35A 3WU0A 1SFKA 2F5CA 3DV8A 4IEJA 3CDHA 1ENHA 2XAGA 1WI9A 3S3NA 1XX5A 1ZG1A 1XMKA 5FLXZ 3G71I 1KYZA 3F46A 4JTDB 3GZ5A 4RB3C 1ACIA 2L3DA 2UUZA 3PL8A 4JTAB 2W1OA 2MFZA 2HQ5A 3DKYA 2H27A 4IAOA 3QODA 5B1AH 1NU7D 3OIPA 4AVPA 2PMZA 1T01A 1IRGA 2EH3A 1I1GA 3GBGA 1WJFA 2XHKA 3K7DA 1HW5A 1I4ZA 1S7OA 2AVKA 2P8TA 2VKVA 3LSRA 1B9MA 3F47A 2FNPA 2FQ3A 3ZMUA 2Q7RA 3ZTMA 2ACJA 5F08A 5GAEJ 3HZJA 4QLCU 2CUJA 2X1DA 1FNNA 1JUPA 5CYVA 5KAIC 4WK8F 3H5NA 2IM8A 2BXYA 1WZ2A 2J7PA 1EH8A 4MVRA 4JE9A 4HNTA 1GT0C 2IS4A 3CF2A 4CX9A 1GXQA 2WY8Q 4DOZA 2HXIA 2J5OA 2FD5A 3DBHB 3PMRA 5J4YA 3S28A 5FFZA 5E3LA 4BBSJ 1MMSA 2HJ3A 3M15A 4UUSA 2QVOA 3LSGA 3RQ4A 5B1BC 2A05A 2R7QA 4HZFA 2AQFA 4NQWA 2DMUA 1WJ5A 2VH3A 2E1MB 4I98B 5E8GA 1FFHA 3CCUI 2DQRA 1X4PA 2JMWA 3BQZA 3H0GJ 4PK4A 2VONA 2WVNA 3NYJA 1KZHA 1L3PA 1K6OA 1EKYA 2CW8A 2EIJH 2GA1A 4I0AA 3BZ6A 3DTEA 2WAFA 3O3KA 2MSYA 3FKJA 4AUXA 4BH9A 5LD2C 2VLAA 5IT9Z 2K9LA 2KISA 4B44A 3CO7C 4DXWA 4IX7A 2P6TA 4RAYA 1IAWA 1QSPA 1WASA 1GV5A 3L00A 1G6NA 4ESBA 3RF3A 3ELKA 3J81Z 1FIAA 1ZHYA 1JPJA 4BNCA 2NUTB 1IV6A 4ONSA 1QRYA 3WHCA 4A6EA 1GHCA 1LIHA 1LDKB 4S0HB 2LIGA 3DP7A 1G3TA 1U3EM 1FBQA 4XLFA 2V1NA 3TMOA 2M64A 1X58A 1VQOI 5L0GA 3L09A 5B1BH 3CCJI 1DU0A 1Z3XA 5IYDJ 1KQ0A 3M7GA 2ZXOA 3BTCA 1SD5A 4LMYA 1S3JA 2PX0A 3HNLA 2ISZA 1U8RA 1XN7A 3AJMA 1LS4A 4A6DA 1XMAA 2YEVA 2V1XA 4P9UA 2CFXA 1GQAA 1I39A 3HRMA 3DTKA 4HW0A 4PJLA 3JRAA 3LA2A 4GXOA 5GAGJ 2EILC 4MTDA 2EV6A 2W4SA 4YELA 3GZNB 4XR6A 2OCEA 5CVUA 2ZB9A 4BJ5A 2BHYA 5KAFC 5EHHA 3ABMH 1OCPA 3DKXA 4RM2A 5ED4A 2WTEA 1NG7A 3K2ZA 1ZHXA 3S29A 5HNFA 5J1RA 5EZHA 3U5SA 4TV7A 2JK3A 2V7FA 3L8IA 3GEIA 3S27A 2HOSA 4Z9HA 4ENNA 4L5IA 3TO6A 4UUSB 1ERDA 3TD7A 2EPLX 2MLGA 3LSIA 2X51A 2OQRA 4AYBA 4NQWB 2VODA 3GZ6A 2EV5A 4XQFA 3ZCOA 4XIDA 3CJNA 2CJJA 2P1AA 3V8KA 1I50J 1YDIA 1E85A 3W2WA 2KNHA 2WVOA 3OV8A 3JRIA 3O55A 5L3VA 5J4VA 1LFUP 3TOAA 5KYYB 5L3CA 2WA0A 2PFBA 4UVAA 5C3EJ 2FF4A 4OIQF 1YLMA 2VN2A 3RKYA 3ZMDA 4E6KG 2MH2A 3WTYC 3ZVRA 1TBXA 2XVCA 1TFKB 5E20A 1SYQA 1T6UA 1K04A 4C7OA 1SAXA 3BRJA 4RGUA 1ZARA 2O7OA 2IJLA 5FKLA 4BY7J 1N1CA 4YIRX 4WX9A 2GA2A 2QUFA 1GVDA 1O3RA 3HOYJ 4LDQA 4BG0A 5F64A 3CUQC 1DDNA 5J3LA 3JREA 1RXQA 3F8CA 3Q6MA 5K5RA 3FMQA 4I1MA 4IXAA 2DMQA 2H1KA 1A7DA 2KL4A 1CF7B 3SEOA 1CGNA 5CI9A 5DCFA 2DMTA 1E17A 2WV1A 2XAJA 4G9YA 3MFKA 4W8PA 5COFA 3C1DA 5KYXA 1ORKA 2VB6A 1JOGA 5DS5A 2XS1A 3P9CA 4LLGF 1Z1DA 3QPLA 4PSXA 3FHZA 2L9JA 3DTIA 2J46A 3POVA 1FOXA 1HCRA 2FSWA 4A93J 4M3FA 2BZTA 3SDGA 3H2UA 4FESA 1J75A 2ZXIA 5D4SA 4LLCA 3V5ZA 3VOEA 4AK9A 4LB6B 5FO5A 1R7JA 5DTDA 2C04A 4Y7NJ 1JKPC 2DFHA 2FXAA 3GVAA 3DLAA 3K4BA 1JGGA 2CQKA 1CQTA 4M3BA 3WTWC 2UWMA 1G5ZA 2V3CC 4LG0B 3ASNC 3GM2A 2MWQA 3QRFF 4EWCA 2ECCA 5IY5C 3PSFA 2O8KA 5FRMA 2JPBA 2Z3YA 4ZDPA 3A4CA 1V54C 1TWHA 3LWFA 3S90A 3GTQJ 2PNOA 3NYLA 4GCVA 3GLLA 4XLCA 4DW6A 1BI0A 2VIXA 5H20A 5BQTA 4ENMA 1TC3C 5E17F 2EA2A 1SZIA 2L81A 4Q4ZF 1K83J 3EUHA 1JE8A 1TQGA 4YT2A 1X3WB 3TP0A 2L5QA 2HQNA 2QENA 4FAPB 2E7WA 4NHJA 3GTMJ 4MTOA 3RKOF 3SEQA 3QP5A 2NS8A 2WAEA 1VNDA 2IXNA 1O57A 1RI7A 3EUAA 5LGNA 3CCQI 3F0CA 3JRCA 3K0LA 2R5ZB 1JKOC 1WATA 4V2GA 3EFOB 1BC7C 4DZJA 1XCBA 2V1UA 1MBFA 3G1MA 2GM4A 2NS0A 1VQ9I 1YYVA 3VSLA 1YFHA 5M5XJ 4BEJA 2HOAA 2C03A 3EH1A 2CRGA 2GXBA 3MX3A 4XPXA 4BS9A 2M4KA 5HS9A 3L2UA 2PFDA 3HTSB 1WRJA 5EF6A 2IGMA 2M0MA 1PV3A 5LEJA 5KYXB 3W6JB 4A3KJ 4IB4A 1Z5ZA 4HBLA 2XAUA 3SFIA 2VT3A 5HVQC 3RZDJ 1DOWA 2V9VA 4JBAA 3OYBA 4PJMA 4ZTJA 1AKHA 5M5YJ 1BR1A 1Y8RB 4XMYA 1YG2A 1ZKGA 1YW7A 4B4CA 2M1BA 1TNSA 5D5WB 2WB1A 2EV0A 2RDPA 3I4UA 4EJOA 3K1MA 3C8GA 1LE8A 3OEOA 2IEKA 3EQLF 5BOXA 1ZELA 3GFLA 5F0CA 3VWBA 3SXZA 2PG4A 4A2UA 2ME0A 1IW7F 1W5SA 1VYKA 1P92A 3ERED 4EIYA 5JFRA 2IBDA 4HNUA 3ZDLA 5HNHA 3WTZA 3Q7GA 2Y3BA 4CDVA 3T9OA 1ZTRA 3GODA 5HS8A 4M73A 3ECSA 3F72A 1TWGJ 3LQRA 4X0GA 2B63J 2QQ9A 2K9QA 4DRHB 3J80K 2P61A 2RQQA 3WG7H 3PM1A 4L9JA 3ZMSA 1B72A 1KU3A 1GUUA 1Z0XA 2V4JC 3OYEA 4JQFA 4Y15A 4YT4A 4ESJA 1WHUA 1FWZA 2ELHA 4JVSA 4LERA 2MABA 3O6XA 3UKGA 3HOVJ 1DOVA 1OCOH 1EH7A 1GS9A 1ZLKA 2B0JA 2I8BA 4DVYP 4XL9A 2VJIA 1I3AA 4ANJA 1ETWA 4JYKA 2VC9A 1S9HA 3F6VA 4LITA 5IP9J 4RDUA 2NAZA 4HDUA 1FYLA 1QHGA 1OXKA 3L8JA 1OXBA 3IQTA 1QZYA 1ETKA 2TCTA 1ZR2A 3CLOA 5EEAA 2F4MB 2H09A 1BR2A 1SC7A 4XBFA 1UB9A 3KP2A 1K7AA 1WJAA 3CP8A 1BI2A 2HKOA 4WXDA 3IUOA 2J8WA 3NG1A 3A0BC 4AD9A 3E6DA 2Z33A 2OG2A 1U0JA 3C18A 3OR2C 4ITVA 5B3SH 2ELKA 4X0RA 1HDDC 1K78B 1RKTA 4E7KA 1HMDA 5EK0A 3HOZJ 4M3GA 2O6GE 2VQLA 1RZ4A 2EWNA 2LOOA 2J5PA 4FT8A 2Y39A 4E17A 1TW3A 2E1NA 5H2FC 1R71A 2J9UA 1UHSA 2KZVA 5LHGA 3CSKA 2XLVA 3K66A 4CCOA 3M8JA 3BOQA 3GUDA 3LEOA 3JAMZ 4K1OA 2CW7A 1O5HA 1DUXC 3EZHA 1MBEA 3MMYB 5F1JA 1G3SA 2ZKZA 3ROUA 4I0BA 1SD6A 1H0MA 1E86A 1R1UA 3E5QA 3VSKA 5DS4A 4MTGA 1FP2A 2CYDA 3PSIA 4J32B 1P6RA 1VQ4I 2HEOA 2ICWG 5K7HA 2LD5A 3BG6A 3LQQA 3VYTB 2RQPA 2J0XA 4U5CE 5EGYA 1JJ8C 2RC4A 4MVMA 3FOOA 2JRTA 3OSFA 4W8KA 1W0TA 3MD2A 5FZTA 1D0ZA 4PUSA 3FXJA 4YT5A 3DPTA 1T0FC 4NBQA 3BR3A 3IH2A 4HYEA 4FASD 3AL0C 3MAJA 1U6GA 1MMAA 4MTEA 2DYRH 2QQAA 3KYDB 4ZLCA 2XAQA 2OBPA 2YS9A 2YX7A 1N25A 4GYGA 1UMQA 4NUBA 4AX2A 2XASA 2CWEA 3ZQYA 4IL6C 4OAZA 3TOMA 4C30A 2CNWD 5JHUA 1J2XA 2F5FA 2HMZA 5EZGA 4IJAA 4RBNA 2HDDA 4M3EA 3BEHA 4FX4A 5JLIA 4UV9A 2NS7A 1Y4CA 3T5XA 1OCCC 1G3YA 5HODA 3U8VA 2NYXA 2FNAA 2ESHA 4B6IA 2M4EA 2LFFA 3OSGA 1S8NA 1OR2A 3LS0A 3B6AA 4HX8A 1JJ6C 1FOYA 5FKKA 1FBUA 2ZXJA 3WG9A 1ZG3A 1J9IA 4XWJA 4JIOA 3L9FA 2TDXA 4HX7A 3KP7A 3GEHA 4Z6YA 2PF4E 2E36A 1Z6RA 4QIWN 3E0JB 4IHXA 1M6TA 2KYHA 4IJJA 3WGHA 4CZCA 1HF0A 2BV6A 1FOWA 3W2AA 2Z16A 2LG4A 1TL8A 2CDQA 1UZCA 3I5PA 2CGPA 3G2BA 2PX9A 4FX0A 3LLIA 3L2QA 1VQLI 2JA7J 3GWLA 4XN3A 4GYIA 1TT5B 1WWXA 1C0WA 4UNOA 3AQCA 2BC5A 3N4MA 3NMIA 3H35A 4LOCA 4PSWA 1QZEA 4JEBA 3B73A 4N4WA 2ID3A 3BPVA 3FXRA 2JRMA 2BOLA 2DW4A 3BCBA 3T8TA 1RPWA 5M5WJ 3C63A 1VLTA 2EINH 1DP3A 3VEPA 4ESFA 1J8MF 1Z7UA 3TW7A 2A0BA 5T1DB 5JSLA 2HWVA 3PHF2 4B47A 2QKLB 4DJ9A 5JR3A 1MMDA 2X1CA 3L7WA 3TEDA 1VTMP 4EM2A 1F4KA 2GWWA 4DVZA 5DM7F 2KRHA 2ID6A 4YFNF 4ETSA 2FMYA 3GWZA 4KUMA 4PZJA 1SFOJ 1H8AC 5L0HA 1APLC 2Y31A 2BEOA 2Q2EA 3K4JA 4CCJA 4YFXF 1MJ9A 2X6WA 3QPTA 2DA4A 3HPGA 3V4GA 2B9SA 2FGYA 4RM3A 2YZSA 1TZLA 2K9MA 3K4LA 1ZR4A 4CGZA 2DN0A 4RB2C 1I6HJ 4LJZF 4UHTA 4MGRA 4ENKA 1ZW2A 4N0BA 2OEVA 256BA 2W4BA 1ZU5A 2M87A 5B66C 3H5AA 3MZYA 1MDMA 1ZU4A 2ZJPF 5E3MA 1S7EA 2D45A 2QCOA 3FM5A 2JN6A 2XL8A 3R0JA 2ZD9A 3O39A 4K7BA 2W85A 3HSEA 2O61A 1PD0A 1Q0FA 3LL7A 2MHRA 3EETA 3KKBA 1BN5A 1M56C 2ISYA 5AC5A 2VBZA 3SYTA 2E1CA 1XZQA 1IV8A 2GA0A 3CEXA 3H36A 2G3KA 2O9XA 3OWTA 1BI1A 2CQNA 3RYRA 1ZG5A 1H9GA 3DEUA 1MH4A 2K5CA 2ZO4A 1XB4A 2ZCWA 1VQNI 2QF7A 4XKBA 1OFCX 4Q7CA 1VK5A 1I27A 5L3QA 3FM3A 2Y2ZA 2CQQA 4BACA 3CCMI 4L0YB 2K86A 1NBBA 2OQMA 2FOWA 2VJ4A 3FDYA 4MQVA 4DYCA 3IL2A 1QPIA 1CGOA 4Z9IA 2XLOA 3SFZA 5CJ9A 3ZN0A 4IKFA 1Q0GA 2RNJA 1FYMA 3GEEA 2CQ7A 3K9TA 1QA6A 2EPNA 3OYLA 4PFOA 2AU5A 4OU0A 5JUAA 1JTXA 1ZZPA 2DMPA 1SANA 1TLHB 3VPRA 2Q3TA 4C3BA 3V42A 1DPUA 1YX5A 4AIJA 1BL0A 2DLLA 1ETYA 4DNCA 1Z9CA 5DUIA 3DE9A 5KYWB 1OKKA 2OKUA 2M7BA 2Q8KA 3JCUC 3W2VA 2EPKX 4Z2YA 4D4NA 3A02A 3H92A 3I64A 4PR9A 3P9KA 2QSFX 3OIOA 2VASA 5J6XA 4J01A 4A3FJ 2G7HA 2J0WA 4E7ZA 4E0IA 3VYRB 4KITB 4BXUA 3HG9A 4Y13A 3KEQA 3SZTA 2VT2A 2IVMA 1IXRC 2BGCA 3QP6A 3UGOA 1ETQA 3BTIA 5K7ZA 1MDMB 1OKRA 3DJUB 1JUSA 5ILSA 1B68A 4ZDLA 1VQPI 2M7AA 2HVSA 1WWPA 3IWFA 3SXKA 3U9MA 3S84A 2KZGA 2NUPB 2W00A 2X0LA 3DBLB 3N0TA 5FFXA 5F6FA 2WZFA 1FMVA 3EGDB 3CC4I 2D1HA 3BG3A 1N75A 3U2LA 2FUG2 3HKZN 2A68F 3M9AA 4HSTA 1G2HA 4CS9C 3HGYA 1DU6A 3CDIA 5HLHA 4E7LA 1XSDA 1T38A 4G78A 4CDAA 2GFHA 3F8NA 3DEEA 3QAHA 4LK1F 4XRFA 3JSOA 4X1EA 1LFBA 3DKAA 3ZMVA 2PX3A 4DBRA 1MH3A 2CV2A 5TJJA 4ULVA 2O5RA 1T56A 2XLWA 2MD5A 1ODDA 5EJCA 2XIGA 3F6OA 2CUZA 2MYSA 2IRFG 2E2HJ 3LMMA 1AWCA 1MNEA 4A0ZA 2PBEA 1V4RA 3W6VA 4LACB 1WJEA 3UNGC 4KT6A 4O79A 4BXFA 2KDOA 4KN7X 2R3SA 3IV5A 1K05A 2J9WA 1Y8QB 3GTGJ 1RJ9B 3RTRA 1YZCA 4KNWA 2J9BA 4XEKA 4XLNF 3KE2A 4XPWA 1FNTc 3HOSA 1OCRC 5CQEA 2FE3A 2YU9J 3BROA 4BYYA 3WTTC 1EKEA 4B09A 1D8KA 1QU3A 3FZVA 1IN6A 4BDYA 4YL1A 2ZFUA 4RGXA 2W48A 2CV0A 4KIGA 3M8FA 4U0YA 1K4TA 3LAYA 3DAGA 2LMDA 3CC7I 5GPAA 3CJQB 2LREA 4MO7A 2BW3B 3FIWA 3Q0VA 3GM3A 1O7FA 3SZRA 3REOA 5IP6A 3NRHA 3OA1A 4KI2A 4A69C 1TWAA 1XGNA 1MKMA 2HVQA 9ANTA 2A6EF 3LAJA 4CA0A 2Q0OA 3K1PA 2VXZA 2HDCA 1XC5A 3H3UA 3LA3A 1BM9A 1NG6A 4XM3A 2QBYA 3ZGKA 3HOWJ 4XKWA 1VQ6I 1LPEA 4EKWA 2E1OA 1A6IA 2FEZA 2GXAA 2PMUA 2V6EA 5GTIC 1OCRH 2GOXB 2F5VA 2M4GA 2Z1DA 3KYLA 3T4RA 2A1DD 2ZMEC 4CXFA 2E7XA 3DZAA 5B1AC 3RDIA 2XC7A 4N9IA 3L34A 3E5XA 1VYIA 3RQEA 2OZUA 3CUQB 4ZZDA 3GTOJ 3BQYA 3A01B 2EFNA 2JTVA 5L3DA 2QGUA 3AG2H 2LBFB 5LLQA 1IZMA 1VLSA 1V5FA 2XPWA 1XSVA 4U5EE 4E7SA 3JRDA 5COMA 2LSOA 4S05A 1MMNA 1G4US 2YL7A 3RKQA 1JAFA 3JTLO 4YN0B 1XZPA 4F4BA 3LSMA 1DGWY 2NUTA 3GLXA 2A6TA 2E87A 1TWHJ 2KPMA 2VPRA 2DK5A 5KYUA 4EM0B 1JHHA 2GIVA 3IP4B 3I4NJ 4IRHA 2IXSA 2NVXJ 4E4HA 3W8HA 4MW3A 2NPUA 2VXDA 1RUOA 1Z63A 3ERMA 5D5UB 2DODA 2IPQX 1GDTA 2NSGA 3EHMA 1C17M 3FXHA 4NY3A 2IS6A 4WABA 3Q0UA 3TO9A 2EPOA 1EQ1A 4G7ZF 2YL3A 2A6HF 4R1HA 5KHDA 1I3QJ 3DWLE 2EIJC 1E83A 3SP1A 2XROA 3E6CC 2LY1A 2JPUA 1DP7P 3A9CA 2CW0F 1A5JA 1TTYA 2P0WA 4DZPA 4H0EA 4BHPA 3M1EA 4IOCF 2VL8A 2XRLA 4XNFA 3N24A 1KONA 3CQZJ 1PUFB 4PJNA 4ON0A 1JKRC 4BBRJ 3M4BA 3IQCA 1P4AA 3DU6A 2LKPA 3CLQA 3EGXB 1IDZA 2QBYB 1EH6A 3JRMO 3RKWA 4AIKA 1Z7Qc 4D7NA 5A6BA 3P7NA 1MBKA 4CIHA 5HLGA 3QWLA 1YTYA 5DV5A 4ZLDA 4HFFB 1U9NA 2LF8A 1YO5C 4DRJB 3MWMA 1Z6AA 3OOPA 1JRAA 2XLMA 1B59A 4BXXJ 3ITFA 5JVEA 3CCSI 3JSEO 5KYYA 3GX4X 4G94A 4RGRA 1XG1A 2HTJA 1OJLA 2X6YA 5CVVA 3K1HA 3CUOA 4L6RA 5AC4A 4BU2A 4JW1A 2PN6A 4KC9A 1XCVA 2CUEA 1HW1A 2HZTA 4FE7A 4MNUA 2D2WA 2HPIA 2L6GA 3KH2A 1D8JA 2WZGA 2KQRA 1IUYA 2W7NA 4P6IC 1O3TA 3ABMC 4V19K 5KYUB 1R1VA 4OINF 5LGTA 2HS5A 3OS0A 5IOZA 2ZXWC 3LSTA 2KIFA 1W36D 5HSWA 4S04A 1LB2A 4HF1A 1ZGWA 1JR8A 4IAQA 3IWZA 3IHUA 1W7PD 3IQ5A 4EJTA 4UB8C 4QWQA 3I58A 4HV5A 3QYFA 4WF2A 3W6KB 3QPSA 3OS2A 5LFAA 3I54A 3U3BA 3TQNA 1CF7A 3JYHA 2IXMA 3ZXSA 1O4XA 2Q4FA 2F2EA 2VOOA 4QI2A 3HNJA 1OCZH 2XGEA 4CYDA 4RS8A 2DOAA 2LP4A 5B3IA 3SJMA 2F5EA 2G3VA 3DMDA 2QTVA 1F5TA 3LLKA 4OWRB 5TISC 4CYCA 4HFKB 2LDUA 2LRDA 4LDKA 1JI8A 1J0RA 4DYRA 2IT0A 4JTCB 5EEHA 2ZXWH 1V55C 2RAEA 3EUKL 3PIPF 3T1BA 1IO2A 3SQNA 2KIMA 1HC8A 3F22A 2NSFA 1Z7LA 3ESWB 1DQUA 1IGNA 3HNKA 4LG0A 5C4XJ 1VB5A 1ZAOA 3K1IC 2B7EA 2V26A 4BQNA 1NTCA 1T33A 5FGMA 4GYTA 2XF6A 1T0FA 3LNQA 1VFCA 1VQ8I 3W4YA 3FDQA 2QQBA 5D8KB 4GO1A 2RSEB 1MIJA 3GFMA 4F3QA 4F92B 4G7OF 4EV0A 4XOTA 4MNDA 5L0JA 1OQCA 3LESA 4AIDA 4KT5C 2TMVP 2Y3HA 5DCMA 5BNGA 2BE5F 3FHDA 1O87A 4CICA 4A0XA 3CAXA 4M9XA 5F27A 5DVWA 1V55H 3RW0A 3WGGA 3MKWB 3IRQA 3MEXA 5TJ5E 4NQFA 4W1UA 1YJGA 1E2XA 2R5ZA 3HM5A 1JPNA 4EQQA 4IWBA 4CCLA 1NFOA 3DCFA 4M63A 1LI7A 5A2QZ 1YIJI 2M5WA 3BY6A 3BR1A 2KRFA 3EPZA 4EVIA 1XS9A 3Q0WA 3MCZA 3U21A 1OLTA 4EHPA 3VF0A 1KU9A 5BPDA 1QO0D 2P5VA 2O9LA 1OW8A 3AQBA 5E2QA 1ZGJA 4PCQA 1K79A 4OAYA 2CMPA 3KIOA 1R5HA 1TW2A 3RH3A 1ETXA 2HI3A 3LFUA 2DK8A 3FISA 4P9FA 2XL6A 1HDPA 5HV9A 1FTZA 1PYVA 4P96A 2Y0SN 2W57A 4CYCB 4Z9JA 3NKDA 4UXNA 2R92J 3TDZC 1KNYA 2MGQA 5IP7J 2EIMC 3L1MA 2OPTA 2UUIA 5E3AA 4CCNA 2VCBA 1E3PA 4E18A 2XKPA 3PDMP 1TNTA 4P1WA 3S15J 1YAUO 3MLGA 3X2QH 4BDZA 2WVQA 3S9OA 5KYNA 1Y39A 1UG2A 3UMHA 3LAPA 1J8YF 5ILVA 2HVRA 2I10A 2EPFA 5K7FA 3CMEI 4HA8A 4A3CJ 3AL0B 2G9WA 4A3EJ 2DFEA 2MLKA 5A6KA 4W97A 2JT1A 2VCCA 5FB2A 4F52A 4II3A 4MFDA 3VFZA 3T0YA 2JZYA 1QGPA 4R8HA 4B43A 2L7ZA 5EDNA 3ECOA 1T9KA 5DCMB 4O7GA 2BHZA 2YU3A 1LFPA 3FMSA 2CQXA 5C4JJ 2IA1A 3K70D 1YHQI 1NSGB 3WTUC 3QMKA 4OIOF 2EIMH 3HJCA 4N4NB 3CCEI 1PVEA 1R4MB 2QWWA 2F5DA 2HFIA 1GGQA 3H5RA 1R5GA 2JUCA 2KJBA 4AL1A 1X1DA 4MIMA 1ETOA 5GADJ 3AGUA 3E97A 5LEKA 1YW8A 4BUPA 3BDDA 1BW5A 3WU2C 3RSNA 5FROA 2L7MP 3HKZA 4U5GA 5IPAA 3PNTA 3MKYB 1Z6TA 3WHNA 4Q48A 3D5RC 5BQHA 2HV7A 3ECHA 4N6HA 1BJAA 2HYFA 3GTJJ 4BJTA 1JUMA 2DCEA 4XLHA 1K4SA 2CS3A 2RV8A 3I4PA 4YL0A 3R60A 3OS1A 4C2UA 3H2VA 2HKVA 2BL2A 3RPQA 4I02A 1OYIA 3WG7C 1UJ8A 2BXZA 3V7SA 2H7VC 4I01A 1WOLA 4JJGA 1YW9A 1K78A 3QW1A 1LNWA 4QI0A 3ABKH 4KJZA 1RKWA 1IG7A 3P5JA 5D6EA 4JK1X 1ORJA 3G1OA 1FTSA 2YR2A 3ZQ7A 3VYUB 3NWTA 3MVPA 4P55A 4EMSA 1G4WR 5COGA 1Y1VJ 2L4MA 1ZQ3P 5DLJA 1OCOC 3ZQLA 4MVUA 3S1NJ 1YITI 1U5TC 3HUGA 4EJWA 2W4MA 1PP8F 2L7AA 1F9NA 4X6AJ 2FMLA 2HSQA 4DQ2A 1PD1A 4NB5A 2HV6A 2LLKA 2YHSA 1RR7A 3RQGA 3CJRB 1PP7U 2YUSA 2A0UA 2JX0A 1Z21A 2Z99A 4IQ4A 1S6LA 3S3MA 4AE4B 2E35A 2X48A 1FP1D 1AU7A 2KC3A 3U3FA 3ML6A 3OL4A 3VM6A 1JGSA 1W7PB 1XGSA 5BUOA 3HJEA 1SD7A 3QQAA 1NU9C 2OCCH 1IDYA 1LUJB 5HDGA 3I53A 2M2EA 3ZQHA 2AWCA 1LQ1A 4GQHA 2XF7A 2VUMJ 5B3SC 2IA2A 3TKYA 4KFCA 4CBEA 3LSKA 3RPUD 5IOYA 1MW7A 2GQQA 4UUTA 4XN0A 1M2VB 2FA5A 3ZMZA 5FD5A 1QVTA 4KN4X 3CF5F 2QNLA 1B6AA 4M6XA 1S72I 3I55I 1C02A 3MKLA 3V5XA 3BR2A 3ZG1A 2PBIA 4DRIB 5FCLA 3EHNA 3HOUJ 2LF7A 4QTRA 2LD6A 3H1CA 3OYDA 3I4MJ 2WC2A 1OMIA 5BS6A 1NLXA 1QLEC 3DJNB 5CIVA 2B0LA 2XF5A 4CHUA 1V3FA 2FFHA 3GMEA 3TJ6A 4CS9A 3H3ZA 4IHWA 1AOYA 2ELJA 3CCLI 1W5TA 2ZPAA 4A3LJ 4XORA 2XAFA 3FVYA 3BJOA 3KZIC 1SAUA 3F21A 2K85A 2MH9A 4HF0A 4JCZA 2L54A 3G3ZA 4XRSG 3NRVA 1ZRDA 4FWVA 1SEUA 2GZWA 1TWCA 2M8GX 1B1BA 1QHHD 2Y75A 1H7IA 4IHSA 2QA4I 3A11A 3S3OA 1F43A 4EM1A 2M3AA 2I5UA 2JA5J 2COMA 4YIIA 1IXCA 3T6BA 3DPLC 3HUGB 3BG5A 3PFIA 4NC6A 4I7HA 1TKNA 2K3PA 4G6QA 2VQCA 1T98A 3M1CA 1R00A 4J7TA 2OQGA 4HE8D 4IPAA 3CCVI 5E18F 2AP3A 3H9QA 1LEBA 2DYRC 2VBWA 2K9NA 4F91B 5E1ZB 4HSRA 2RD9A 1Y6IA 4WJ0A 2W25A 5CI8A 2M0CA 4M6VA 1UG0A 4MEYF 4RB0A 3GM1A 1RIOH 3FXUA 2HYGD 3U1KA 1BA5A 3HRSA 1HY5A 3NYMA 2GAUA 2ZNYA 3RVYA 3JW4A 2EBIA 5HDKA 3TJ5A 4A5MA 2DDAA 3RJPA 1DPRA 4CSWA 4KIFA 3DQVC 1BZ4A 3MYFA 4EJVA 3N97A 4KNYA 5E3NA 1DGRM 2PJRB 3IAM2 2YRFA 4XONA 5L3EA 3QVZA 2BY2A 3HTUA 3CCYA 4I76A 2LSEA 3S93A 1EA3A 2F22A 3VAYA 2QZ8A 2RKHA 5DS9A 1YVIA 5ICCA 1BIBA 5DD4A 1H9TA 4K0DA 3AG4C 3ISPA 3HRUA 3HSRA 4BJ6C 3PO2J 2IA0A 1SR2A 1G3WA 3O8HA 4ZZLA 4LLEA 3IAS2 3G6EI 3BLYA 5J40A 1KTMA 2ZJ2A 1ZGAA 3R2PA 2LP0A 2O3FA 3MFNA 3HXLA 2YSRA 1MSEC 1M2OA 4YJWA 4BJ1A 4E7IA 4JC7A 1LDDA 4Y4RA 2MBFA 1UCRA 4AC0A 2M34A 3KLOA 2WWYA 4KBLA 2STTA 3EGXA 2EINC 2V79A 3LSHA 1EJ9A 2E34A 4O6YA 3TK0A 3J06A 3FMRA 3RQIA 3M1CB 2OF7A 2LKXA 2L9NA 2IGKA 4CS8C 3RVZA 3GXOA 4CDGA 1T6IA 2K27A 1TWAJ 4OIPF 3ABLH 1WJDA 1RKCA 3AG4H 2Q9AA 4A2NB 4NC7A 2CV1A 1BOAA 5HLTA 3O10A 4G0HA 2E2IJ 3DU5A 2VKEA 4XKCA 1SD4A 3DM5A 1O3SA 2Y30A 4JKVA 3S17J 2JA8J 1S7ZA 5EGOB 4MEXF 1U0BB 2DJNA 4EGZA 2ASRA 2E71A 3UMIA 2Y3GA 2ETHA 3QYEA 3RYPA 1YJNI 3L0IA 2ZBKA 4EJUA 4BQQA 3U9JA 5DYMA 4DBQA 4BAYA 5L0FA 1HSTA 1W5CC 2XUBA 1T8IA 4L18B 3EH2A 2NNNA 3VYSB 4IQJA 3WODF 1W36C 2EZIA 4JRZA 3V7OA 4AM3A 2MD0A 3F8FA 4IHTA 4MTFA 4LFUA 4O3MA 2GWRA 2D5RB 1MJAA 1FOKA 5KYWA 3M07A 2LTPA 3TW6A 1GVJA 3JZ0A 3FXOA 1R49A 2NNYA 2JVHA 2ZMEB 1R4NB 3ZQVA 5L0CA 2DBBA 5EG0B 2HDWA 4U5BE 2DI3A 1R22A 2DAOA 4HX4A 1EI7A 1P4XA 2V9KA 1Y1WJ 4NNJA 2EZKA 4CSAC 3HL2A 2XLDA 2WB7A 2IAIA 3VDXA 3O2PE 2HZDA 5LHIA 4HF2A 2CCYA 2L9SA 2V1DA 4I6ZA 3U9GA 2DA5A 2NUPA 4PACA 1MMGA 1OR3A
chains in the Genus database with same CATH topology
2OJED 3KPHA 2ICWG 1R5ID
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OJE D;  3KPH A;  2ICW G;  1R5I D; 
#chains in the Genus database with same CATH topology
 3EGD A;  3C7J A;  1NFN A;  3KX2 A;  5J8C A;  3RQF A;  1JMW A;  4HQE A;  3HKK A;  1WJB A;  1YI2 I;  3U2R A;  2EFP A;  2EJR A;  3C3W A;  3G1L A;  2LY2 A;  5FKM A;  4CCM A;  2X85 A;  3DWW A;  2XRN A;  4QDL A;  3K7A J;  1APC A;  3LJB A;  2X4H A;  3GEZ A;  5FLX K;  1D5V A;  1PCX A;  2QSG X;  2M8E A;  3H65 A;  4U7B A;  3OR1 C;  5E3O A;  4IZZ A;  2YL1 A;  3ZOB A;  2G62 A;  1BI3 A;  5J1U A;  1SF8 A;  1E84 A;  2Y0S A;  4F93 B;  3F3X A;  1HKQ A;  4XLP F;  4FE4 A;  1YRN B;  3QOE A;  1P9Q C;  5GP9 A;  2CNW A;  2KSF A;  3DXJ F;  3U8P A;  4ZH4 F;  2WAQ N;  3WGI A;  1MSF C;  3PUF A;  4XRS A;  1ZYR F;  4U7D A;  1K61 A;  3NQO A;  2ZFW A;  4RGS A;  4XRM A;  2IGO A;  1Q1H A;  2H8R A;  4FHT A;  3KYJ A;  4MLO A;  3FF5 A;  3SXY A;  1RJ9 A;  5JT4 A;  3VB2 A;  4KIB A;  4C3J J;  1VZ0 A;  2M30 A;  2I15 A;  5D92 A;  1ZHF A;  2OA4 A;  1BDJ B;  3SXM A;  4A12 A;  2BBY A;  4L5J A;  4XIC A;  3OYC A;  2VE8 A;  3LNM B;  3IEE A;  5DQZ A;  4FQG A;  3K1I A;  2Q1Z B;  4C2T A;  1OR7 C;  2RVC A;  2Y0M A;  2BVL A;  1TQP A;  5KVR A;  4A5N A;  5ILU A;  3QZC A;  1N78 A;  4NCQ A;  2NRA C;  3BR0 A;  5HOO A;  2BW3 A;  2E19 A;  3K10 A;  5K1Y A;  3WE2 A;  2H7O A;  2R7D A;  2IP2 A;  4II2 A;  1X2M A;  4ENJ A;  1FLI A;  5A6J A;  2FRH A;  2VBX A;  2QE9 A;  2FU4 A;  3ZQF A;  3A2K A;  3LFK A;  3CC2 I;  1R36 A;  2YLD A;  4Y52 J;  2HJM A;  5LHH A;  1E3O C;  3GTL J;  1UHW A;  4UV8 A;  5IT9 K;  2HTS A;  2FBK A;  2OUM A;  4D4X A;  4IHY A;  1V5E A;  1AA7 A;  5GAH J;  5DUK A;  3BPX A;  1VF9 A;  1IZ1 A;  3MKZ A;  5FKN A;  3HLZ A;  4NTF A;  2DPU A;  5E3C A;  5H6Q A;  3J81 K;  1ZN2 A;  3JCU Q;  1RET A;  2DJI A;  3CUQ A;  4BY1 J;  5E1X A;  3V7R A;  3B0U X;  1X4O A;  1WKM A;  4XLA A;  3A01 A;  3KFW X;  1D0X A;  2FAP B;  2LBF A;  2QLZ A;  2EFW A;  2ZXR A;  1LM3 B;  1XTA A;  2NVU B;  2ZJR F;  4UY8 I;  2PQ8 A;  1MBG A;  1WVR A;  3H9G A;  5KNL A;  3I3L A;  3F23 A;  3GF2 A;  2MG4 A;  4G8X A;  2YKZ A;  3ZIB A;  2OC6 A;  3K70 C;  4HLY A;  3BZK A;  2FJ1 A;  2HMQ A;  3QU6 A;  3W8I A;  2WBM A;  1ULY A;  2EK5 A;  4K2E A;  5FLV A;  4XK4 A;  1GLN A;  2RRE A;  2CSO A;  2J7P D;  5BPI A;  3PUB A;  1R58 A;  3ZWI A;  3K33 A;  2LH9 A;  4IOA F;  3E5U A;  1UEL B;  3DFG A;  5E8I A;  1CPQ A;  4I44 A;  2QLA A;  1FBS A;  4IHV A;  4MHG A;  2JA6 J;  4ASN A;  1A7E A;  3FXL A;  3S2D J;  4BEM J;  1GM5 A;  4XEF A;  1H89 C;  2J45 A;  3EPV A;  1LJ9 A;  3AG2 C;  4XOP A;  2HNH A;  3O6B B;  2BVM A;  3KPH A;  3HYI A;  3L2R A;  5K5O A;  1QPM A;  4Y33 A;  2VE9 A;  2IBF A;  2LCH A;  1Z91 A;  4QPO A;  2R4G A;  1LKX A;  2XV4 S;  4WCG A;  2V9P A;  1V5G A;  4U87 A;  2XLE A;  4NTB A;  3HNI A;  1PUF A;  1J7K A;  3IKT A;  2MC3 A;  1RKE B;  2XSJ C;  2Z15 A;  1ZHW A;  4GGG A;  1O7L A;  4I99 C;  3LUT B;  3FKI J;  2M9H A;  3PIO F;  2YVK A;  5CQG A;  3JT1 A;  5T3W A;  3DE8 A;  3V8J A;  2UUH A;  5DDG A;  3BT9 A;  4LB5 A;  2A69 F;  2OOC A;  1X3U A;  1JHF A;  2OAZ A;  2L6H A;  1YIO A;  1CPR A;  3QPH A;  2R7V A;  2L9R A;  3QOP A;  3KP5 A;  3GFI A;  4F7Z A;  2NVQ J;  4XPY A;  4BQA A;  1ITY A;  2FBI A;  3KP4 A;  1G59 A;  4XSZ F;  3VOD A;  2O03 A;  5A6A A;  2L0K A;  4BKX A;  2GAQ A;  2CU7 A;  3DM9 B;  5F28 E;  3HC7 A;  2F4I A;  3SZG A;  2JQ7 A;  5EYR A;  1USS A;  2DA6 A;  3HSF A;  1V74 B;  2QKM B;  3N05 A;  1TFO B;  3C8Z A;  2JD3 A;  1Y56 A;  4BGD A;  1Q0M A;  4EBK A;  1IN8 A;  2YPR A;  3OYM A;  1STZ A;  4L0Z B;  1SFE A;  5A2Q K;  3LS1 A;  1J09 A;  1S05 A;  2XLH A;  1A6Q A;  3TQO A;  1IXS B;  4IRI A;  2XM4 A;  3P9I A;  3HB9 A;  3PQJ A;  1HOM A;  2YQY A;  3N2Z B;  1ZRE A;  1FYK A;  2Z2S B;  3EG9 B;  3DBR B;  3K4N A;  2DOE A;  1MZB A;  2R7O A;  3K4K A;  1ZHT A;  3HTK C;  1XGO A;  1FR0 A;  1SVM A;  3CDL A;  3ABT A;  3FHN A;  4HV6 A;  1D5Y A;  1RC9 A;  3EYI A;  4F55 A;  2QY9 A;  3U2M A;  3CMM A;  1TT0 A;  2I8D A;  3FAP B;  1S29 A;  3DAF A;  4Q47 A;  4NC8 A;  1U5T A;  2OTJ I;  2XSE A;  1VI0 A;  1P4W A;  3C2H A;  1IRX A;  2XPV A;  3GTP J;  3M3Y J;  1W4M A;  5J1Y A;  3KP6 A;  3EJN A;  5F1R A;  4L9T A;  2JA2 A;  4RLF A;  2YWA A;  1ZK8 A;  2CH0 A;  3FXK A;  1JT6 A;  3QU3 A;  3HPH A;  2VKH A;  2OJQ A;  1IF1 A;  2DA1 A;  1FTT A;  3BR6 A;  1XGM A;  3OY9 A;  3CO6 C;  4OOI A;  4U9E A;  4G7H F;  2WV0 A;  4YT8 A;  2O0Y A;  2OV7 A;  1ZHZ A;  3COA C;  4LD5 A;  1D1A A;  3RIP A;  4M3D A;  1OYY A;  1X1P A;  2E5N A;  1FC3 A;  4KMF A;  2G7U A;  2LKS A;  4L9N A;  4RLQ A;  5L3F A;  4RAF A;  1V4A A;  2ETS A;  4JX5 A;  3LEV A;  4IAR A;  1WGX A;  4BL0 B;  4MVZ A;  4XQ1 A;  1R1T A;  4I1O B;  4YIF A;  3NDB B;  4YK5 A;  1ETV A;  2JVG A;  4LG3 A;  4JX6 A;  1FJL A;  4E7J A;  1G8X A;  4KMU X;  1JTY A;  2F6C A;  4AU7 A;  2LC2 A;  4CCK A;  1IN7 A;  1LVK A;  2DQL A;  4JX4 A;  3WTX C;  3S1Q J;  3E70 C;  1FT9 A;  2X0C A;  2ME6 A;  2HOE A;  1AEP A;  1S7A A;  3BG9 A;  3RZO J;  4IF4 A;  5ERI A;  1QPU A;  3K6G A;  3ASO C;  3R0A A;  2L2O A;  3T6J A;  2XRH A;  1A04 A;  2VQG A;  2EZL A;  2O8X A;  2OD5 A;  1OCZ C;  2OJE D;  4IRU A;  4HEA 2;  2K9S A;  4H54 A;  4B3A A;  1AUE A;  1M1E B;  4CUG A;  1W2W A;  5DD8 A;  5L0I A;  3HBL A;  1YJW I;  5F5F A;  3J7Z I;  3NMK A;  1A7V A;  3CP2 A;  1ORY A;  2H6C A;  2LK4 A;  2AQE A;  4U0W A;  5F0H A;  3HIF A;  4HG2 A;  3L2C A;  4HDV A;  1FAP B;  4C3E A;  4CH7 A;  2DPD A;  5CVR A;  4L5E A;  3T8R A;  2R7U A;  3ATP A;  2K7L A;  3Q9V A;  1Z77 A;  3B6C A;  2KLO A;  2AO9 A;  2J9V A;  1WJC A;  3B02 A;  2OTL I;  1U5T B;  3I9V 2;  3M79 A;  4XSX F;  4DGW B;  3MN2 A;  1PUE E;  3UR3 C;  1YZA A;  2Y3D A;  4YEJ A;  3ASO H;  3JRG A;  3CTA A;  3DPU A;  2MA3 A;  1TP4 A;  2LFB A;  3DKW A;  3PNY A;  4HNV A;  1E0E A;  4CS7 A;  3O8G A;  1IC8 A;  4GEH A;  2HOT A;  1WH7 A;  4OD5 A;  1R9T J;  2XSD C;  2DT5 A;  3PJR A;  3KYC B;  3CZ6 A;  5FLM J;  4OD4 A;  4KYW A;  3S1R J;  2TRT A;  2JWT A;  4OIR F;  3L2V A;  1LE2 A;  3AGT A;  1FIP A;  2Y48 A;  3BCA A;  4AWX B;  3E9V A;  3TO7 A;  1ZRF A;  1X2N A;  2KJG A;  4M74 A;  4FX5 A;  2VI6 A;  2Z9O A;  3BC8 A;  1NHA A;  2V6C A;  2PI0 A;  3MBG A;  1XMX A;  4IO9 F;  3ZRG A;  2STW A;  4O6N A;  4C3H J;  2VQH A;  3OYF A;  3IH3 A;  4LGW A;  2IXP A;  1TWC J;  1MD0 A;  2RNG A;  3Q9S A;  5HDN A;  1RRJ A;  1LPQ A;  3BJ6 A;  3I0T A;  3PNV A;  3FX3 A;  1FMW A;  3OYK A;  3JR9 A;  1QQ3 A;  4B3X A;  2KRC A;  4M71 A;  1BOB A;  2KIQ A;  3FBN B;  2EFO A;  4JUR I;  1HSJ A;  3SYN A;  2ECB A;  1A0B A;  5D4R A;  4BJ6 A;  5JVG F;  3ZQQ A;  1LEA A;  4ER9 A;  2A5Y B;  1YA9 A;  3PCV A;  4KIC A;  2WAD A;  1ZVZ A;  4XEV A;  2VPL A;  3EZI A;  4PGH A;  5LRS A;  4IGG A;  2DXI A;  2UV1 A;  4XKV A;  1Y6D A;  1R5I D;  2DOF A;  4LLN A;  1Z05 A;  1RUN A;  2GOM A;  1VQ5 I;  2EIL H;  2LK2 A;  3GFJ A;  1MJB A;  4O6J A;  2XL4 A;  4L9V A;  4ZYE A;  4UVB A;  3X2Q C;  4ZYA A;  2GXG A;  3C8G D;  1WH5 A;  3MQ0 A;  3L2W A;  4BPM A;  2MC4 A;  1U6H A;  1HA8 A;  2Q00 A;  4WGY A;  2L6F A;  4CS8 A;  4PGG A;  3JRB A;  1VMA A;  1HXD A;  1B9N A;  2H8W A;  3BP8 A;  5E1W A;  2VOP A;  4DYQ A;  1T08 B;  5ICG A;  3JAM K;  3ZN1 A;  5JI6 A;  1UST A;  4U9D A;  5BMZ A;  3LA7 A;  1QBJ A;  5F5H A;  5IT3 A;  2WAQ A;  1IJW C;  1X19 A;  3ZC4 A;  4YG2 F;  3S8P A;  4D1Q A;  2IOQ A;  1GV2 A;  1UHM A;  1WQ2 A;  5JLX A;  2LNB A;  5E33 A;  3GYH X;  1BBH A;  3TDU C;  2L02 A;  4JOM A;  2D1V A;  4LIU A;  3I56 I;  4JJF A;  1FZP B;  1ZLJ A;  4D0P A;  2DA2 A;  2ZC2 A;  3RI4 A;  5ICF A;  2X6X A;  5IYC J;  4NC3 A;  1UFM A;  5KK1 A;  3WE3 A;  3IRR A;  3AG3 C;  4FCY A;  4AE4 A;  4BE2 A;  4V2F A;  2VBY A;  2CUF A;  5LBQ A;  2DT7 B;  1OPC A;  4UDV A;  1W7P A;  2F4O B;  5CVJ A;  2A5W A;  1J5Y A;  3K4C A;  3OL3 A;  3C62 A;  3GW2 A;  1P7I A;  1TQI A;  1POG A;  4J19 A;  4FIS A;  3RFY A;  1TQM A;  3ABK C;  3SZP A;  3WHB A;  1GXP A;  2EPM X;  1M2V A;  3IKV A;  4O5V A;  2QYO A;  4OMZ A;  3CD6 I;  1N77 A;  3CJT B;  2EA4 A;  4Q5S F;  3NWS A;  5D8L B;  4E70 A;  1SVL A;  4CSA A;  5DEQ A;  3JSZ A;  2R7X A;  1QKR A;  2DTR A;  1C03 A;  2ZSI B;  3SHF A;  3JRT A;  5T3T A;  1MBJ A;  1QQI A;  1XSX A;  4HAM A;  2JUG A;  3GOR A;  3AG3 H;  4RBO A;  4C2M J;  3JTH A;  3A03 A;  3E6M A;  5JHF A;  5BQI A;  4P5O A;  2EZH A;  5FKO A;  2QEX I;  5D91 A;  3OMY A;  4M6Y A;  2DFF A;  3K6B A;  3B0V C;  4C7O B;  4D9J A;  2KFD A;  1RMV A;  3TOL A;  4EBB A;  4MW8 A;  1Y0U A;  3KEY A;  4Y3O A;  2HU9 A;  2HSB A;  2E1M C;  4RMN A;  1A41 A;  1ONV A;  2LQG A;  2OCC C;  3AKZ A;  1LS1 A;  3ASN H;  3G50 A;  2UXN A;  1D1B A;  2L01 A;  4DIQ A;  4ZTF A;  1U8B A;  1Z23 A;  1CGM E;  2DYS C;  4JP0 A;  1FSH A;  5IY5 H;  3KZZ A;  2L7F P;  4DJA A;  2KJC A;  1RR8 C;  3Q6N A;  2UZK A;  5K5Q A;  1V54 H;  3S1M J;  4PFP A;  4B1R A;  3CQZ A;  5J47 A;  2DA3 A;  2LYC A;  2N8G A;  4LK0 F;  3ZMT A;  3KL4 A;  1VQM I;  3DI5 A;  4FET A;  3ZQG A;  1JXS A;  1WN0 A;  2DU9 A;  1I6X A;  3A0H C;  5CKT A;  1XPX A;  3LSP A;  3EYY A;  5AON A;  3ZP5 A;  5DM6 F;  1UG7 A;  4XTK A;  2ZXP A;  1O3Q A;  2DTZ A;  1NG1 A;  6PAX A;  5K0I A;  2VJJ A;  4R79 A;  1FSE A;  1JKQ C;  1IUF A;  4KDP A;  2DMN A;  1F1M A;  5B5E C;  2WZL A;  4EBJ A;  3CMA I;  4KA4 A;  4MVQ A;  2Y69 C;  2KW3 C;  3M8E A;  1X3Z B;  4BEH A;  1OR7 A;  2DYS H;  1T2K A;  3T6G B;  3S14 J;  1OCT C;  1NH3 A;  5M3M J;  5GPC A;  3TP3 A;  2OU2 A;  1ST6 A;  1MBH A;  3ZR8 X;  2EQR A;  3H9J A;  4ZYH A;  4U88 A;  3OYG A;  3OYJ A;  3I5U A;  5ICE A;  2P5L C;  3GO5 A;  1WTY A;  1YE9 A;  2FOK A;  2KKO A;  2D4U A;  4NTA A;  1FY7 A;  1MGT A;  1SFU A;  4ULW A;  4MFE A;  3HRT A;  4D7M A;  5M3F J;  1HKT A;  3JYY A;  3VYW A;  2PJR A;  1ZH5 A;  5AIP A;  5BQG A;  3BTJ A;  4MQ9 F;  4NDL A;  2VC0 A;  4A3I J;  2L9V A;  2R03 A;  4KIS A;  4YRV A;  4M72 A;  4BHC A;  4BQO A;  3Q3S A;  3MYI A;  3OOU A;  5A69 A;  2ZXH A;  1E3H A;  3FXM A;  3E1S A;  4HEA J;  5HS7 A;  4AVZ A;  2W9Y A;  1O3U A;  2Y69 H;  2PMH A;  3RKX A;  3F8M A;  1G4D A;  1U89 A;  2JJ7 A;  2FQ4 A;  3DEW A;  1Z3Y A;  3BZC A;  4E0H A;  5JLW A;  5DS6 A;  1SFX A;  3UGP A;  3QYB A;  1YS7 A;  4WXC A;  3FOP A;  1KU2 A;  1I5Z A;  1X1B A;  2XPU A;  4P9T A;  3US6 A;  3S2W A;  3R61 A;  3KMI A;  4LLL A;  5L3G A;  5JS5 A;  4H4K C;  4A0Y A;  4MVS A;  2P7C B;  4O6M A;  4YWQ A;  3OYI A;  1D3Y A;  3M4C A;  3FBI B;  2X6O A;  1VQ7 I;  3GCM A;  2IGN A;  3D5L A;  4IRG A;  1WPK A;  1LDJ A;  2DT6 A;  2OZ6 A;  4HQM A;  2AXL A;  1HQC A;  1AKH B;  3KLN A;  4OMY A;  3B9Q A;  2JPC A;  1X1A A;  1OYW A;  2NVY J;  1FEX A;  1HMO A;  3S32 A;  4ZC3 A;  5CPR B;  4EUK B;  3C8G B;  3IH4 A;  1LE8 B;  2KMU A;  4BEH B;  5EGO A;  2P0N A;  3QW0 A;  2R7T A;  2L7K A;  1P2F A;  2PLY A;  2ZSH B;  1BC8 C;  2DDB A;  4JZA A;  1ZW3 A;  3I71 A;  1H6G A;  2PMZ N;  2DO7 A;  2A61 A;  3V8L A;  1X1C A;  2NVT J;  2KQ9 A;  3F8B A;  1TR2 A;  1KU7 A;  3PFY A;  2NOJ B;  4BJ5 C;  3S16 J;  4J00 A;  5JRA A;  2ZNZ A;  1YJ9 I;  1B72 B;  2AS5 F;  1VQK I;  3B0P A;  5DQT A;  4GRI A;  1L3L A;  2EFQ A;  3TBI A;  2HGC A;  3OIQ A;  3J7A Y;  1XD7 A;  2HQR A;  4HRI A;  3ABL C;  2ZME A;  4M9Z A;  1RNL A;  3HEF A;  5EG0 A;  4MVO A;  1D0Y A;  1ON1 A;  5AGF A;  3D0S A;  1PDN C;  2K4B A;  5D5V B;  4C9Y A;  1KQ9 A;  1R6R A;  1RES A;  3ONQ A;  3SEZ A;  4RD9 A;  4XLE A;  3AOU A;  3CCR I;  2P5K A;  3J7A O;  3EFO A;  2YLG A;  3I59 A;  3U0C A;  1IRF A;  3LOC A;  3NAR A;  3RYL A;  3KEO A;  4JEA A;  2XXA A;  3TGN A;  2H1L A;  4UVC A;  5HLI A;  2KGO A;  3H3V K;  3RIR A;  1U9O A;  2NOG A;  3MZH A;  3BTL A;  3RPU A;  2HFH A;  1B8I A;  2R7F A;  1QNT A;  2CFO A;  4CZZ A;  5E79 C;  3Q5F A;  2R7W A;  4QSH A;  3S0X A;  3VRC A;  2VJ5 A;  4AIH A;  4E7H A;  1J59 A;  5F04 A;  2K3F A;  2X9D A;  3CES A;  1H88 C;  3B71 A;  5GPG B;  2GIZ A;  2QM3 A;  1I1S A;  3FK6 A;  3DD7 A;  1Z3I X;  4UB6 C;  5TRD A;  2LFD A;  2XS8 A;  3WAQ A;  3NAU A;  3JSP A;  3Q7L A;  3FAJ A;  1B4A A;  2AHQ A;  3SDB A;  1SVO A;  1YRN A;  2PEX A;  3C2G A;  1A36 A;  2E2J J;  1OKK D;  5F0F A;  2JSP A;  1SMY F;  3F9K A;  1ON2 A;  1T39 A;  4Y17 A;  1QVX A;  1FFT C;  2R7R A;  2LVS A;  3FXQ A;  5FRN A;  4U5F E;  4BE0 A;  1Z67 A;  3D5S C;  4CO8 A;  2K4J A;  4GFB A;  3V7C A;  5GTH C;  1HE1 A;  5KCM A;  4N06 A;  2E5Z A;  1YA7 O;  2BY1 A;  4RDA A;  1HE9 A;  1ORS C;  3BWG A;  2KT0 A;  5L3B A;  2H7B A;  1WSU A;  1FPQ A;  3S2H J;  4G12 A;  4A4A A;  5CLS A;  4HPQ A;  1OCC H;  4N9H A;  2AWY A;  3HOT A;  4YL3 A;  5JVT A;  3HOX J;  4ZYD A;  5CVI A;  5EEG A;  2KIU A;  1HLV A;  2A3S A;  1MND A;  2XAH A;  3AFH A;  2MW8 A;  4HLX A;  2M45 A;  1I4Y A;  3J80 Z;  3BR5 A;  1IN5 A;  1XDS A;  2YX4 A;  4WGZ A;  2XGX A;  2P6V A;  4PJ0 C;  4WXH A;  2HR3 A;  1QVU A;  4BE1 A;  2P7V A;  2KDZ A;  1EF4 A;  1KYW A;  3SNH A;  1Q1V A;  2YLI A;  1UFB A;  2A07 F;  1WGW A;  3KET A;  2VCA A;  2KHM A;  4AYB N;  1UAA A;  3FWE A;  1KGS A;  3J7Y J;  3I59 B;  4RB1 A;  2IW5 A;  2XDV A;  2B0H A;  1L7C A;  1W1W E;  1K6Y A;  3ABU A;  1W0U A;  1XWJ A;  2KK1 A;  2XXA B;  3NMJ A;  3EUH C;  1U78 A;  3W3C A;  2R5Y A;  3LNR A;  1B8I B;  3JTG A;  4EGY A;  4U0V A;  1SMT A;  1OIS A;  2AXT C;  2GDC A;  3GAN A;  4J30 B;  3PQK A;  3TL4 X;  4I3M A;  4QPQ A;  2G0E A;  3C2B A;  1VTN C;  1TWG A;  1KA8 A;  2P81 A;  2Y9Z A;  2DFI A;  3ZPL A;  2WL8 A;  3JRF A;  1U2W A;  3LSJ A;  5J8F A;  3E7L A;  2XGC A;  5C44 J;  1S5L C;  2R02 A;  3DLL F;  3IC7 A;  1YAR O;  2PJP A;  2P4W A;  2XB5 A;  3KZY A;  4RAG A;  5LGU A;  4JCH A;  1EV7 A;  2RN7 A;  3L1P A;  1IRZ A;  3GTK J;  1M57 C;  2PP4 A;  2NXN B;  2Q9C A;  2ADU A;  1LE4 A;  4MS2 A;  5FJ8 J;  2DA7 A;  1WI3 A;  1XDU A;  3E3V A;  4EEF G;  2UXX A;  2R05 A;  1L0O C;  2Q9B A;  1YS6 A;  3R4K A;  4D5C A;  4EAT A;  4C3D A;  3IQ6 A;  2D5V A;  4ABZ A;  1BIA A;  4M9S A;  3HHH A;  3WTS C;  4CDY A;  3WTV C;  2XKO A;  1OW7 A;  2HYJ A;  2P7V B;  1NK2 P;  1VOM A;  2R0Q C;  3K4M A;  2KP6 A;  1RKE A;  2R25 A;  2F48 A;  3TUL A;  2VKD A;  5LRR A;  2X1E A;  3CMY A;  4YFK F;  3OYH A;  1KQ8 A;  3B29 A;  1YYJ A;  1JT0 A;  4ZDO A;  1YLF A;  3G4S I;  2Q2E B;  4B48 A;  4B8X A;  2R5Y B;  4WWC A;  1HBX G;  2W82 A;  3R6S A;  5AIQ A;  2BY0 A;  1T95 A;  2IS1 A;  3K1N A;  4R32 A;  2HQA A;  3R7C A;  2L4A A;  1R4T A;  2H8A A;  1MQV A;  4ZYG A;  1REP C;  4A3B J;  4UUV A;  3M4O J;  2GLO A;  4N6C A;  2CG4 A;  2H94 A;  4PJJ A;  1BJZ A;  3ULQ B;  1A31 A;  3AG1 C;  5H6R A;  5L0D A;  2W84 A;  4A3M J;  2QUP A;  2GBY A;  2HUJ A;  3KP3 A;  3A1Y A;  4N4O B;  4RAZ A;  2OEX A;  4G6T B;  2ESN A;  1QZZ A;  4IVN A;  4PDK A;  3G4Z A;  2IYL D;  1IN4 A;  1HKS A;  1BR4 A;  4FTH A;  1WFX A;  2K02 A;  1R23 A;  3FK7 A;  2C6Y A;  4A3D J;  1RCP A;  2DB4 A;  2IS2 A;  1AVO B;  3NEU A;  4C3I J;  2OU6 A;  3WU1 B;  3ZQC A;  2R9R B;  2JSC A;  3ZQI A;  1MNM C;  3EG9 A;  1LI5 A;  4U5H A;  2E60 A;  3AAF A;  3D1N I;  3BG7 A;  4HOB A;  5TGT A;  2HZ8 A;  2W24 A;  1ZRC A;  2RGV A;  2HPM A;  3K69 A;  3K2A A;  3H0D A;  3TOB A;  1F36 A;  2CYY A;  1YQA A;  2P6S A;  1BW6 A;  5D5X B;  1Q0K A;  3G4X A;  3GWN A;  1NK3 P;  5A6B D;  3AG1 H;  1FX7 A;  2LR8 A;  1P7J A;  1TWF J;  1NZE A;  3E6B A;  1YYX A;  1Q0D A;  2K40 A;  4AL0 A;  3IPM O;  1Y0N A;  2WB1 N;  5FD6 A;  4ZJZ A;  3HGG A;  3X1O A;  4I2O A;  2FX0 A;  4J7Y A;  3ZTZ A;  3KYI A;  1D1C A;  3UMK A;  3U1D A;  2H6B A;  2HKX A;  3NKE A;  2DGJ A;  2BY3 A;  2YL0 A;  3MZ8 A;  3V5Y A;  1AHD P;  1EA8 A;  4LDR A;  2EIK C;  2XB0 X;  1F1Z A;  1T6S A;  1OW6 A;  3QTH A;  1WCM J;  2XGD A;  3RCO A;  2VC1 A;  5D6F A;  1QZX A;  1BBY A;  4BHB A;  1OQY A;  3HDD A;  1CGP A;  4CIP A;  2QSH X;  1PJR A;  2NG1 A;  4I09 A;  4GDF A;  3I5Q A;  2CGE A;  3DF8 A;  4A3J J;  4A3G J;  1LVA A;  3QVY A;  2XM0 A;  3EDP A;  1T5O A;  2LY9 A;  2EB7 A;  4CJG A;  1T6Q A;  2FBH A;  3PO3 J;  3OYA A;  4RA2 A;  3OYN A;  2R93 J;  2COB A;  4KNV A;  2IXO A;  5IYB J;  2R7Z J;  4LIV A;  2R7S A;  2BYV E;  3HHG A;  2WY7 Q;  3KCC A;  3ZSU A;  5JP7 A;  2EIK H;  2QQ8 A;  4CJO A;  2W45 A;  2Z5U A;  3JRH A;  4U5D E;  1K40 A;  1YX3 A;  2CO5 A;  2Y9Y A;  3BJA A;  4D5F A;  1YOV B;  2ZJQ F;  1I5N A;  3G73 A;  1HW2 A;  2HXO A;  4G6D A;  1A35 A;  3WU0 A;  1SFK A;  2F5C A;  3DV8 A;  4IEJ A;  3CDH A;  1ENH A;  2XAG A;  1WI9 A;  3S3N A;  1XX5 A;  1ZG1 A;  1XMK A;  5FLX Z;  3G71 I;  1KYZ A;  3F46 A;  4JTD B;  3GZ5 A;  4RB3 C;  1ACI A;  2L3D A;  2UUZ A;  3PL8 A;  4JTA B;  2W1O A;  2MFZ A;  2HQ5 A;  3DKY A;  2H27 A;  4IAO A;  3QOD A;  5B1A H;  1NU7 D;  3OIP A;  4AVP A;  2PMZ A;  1T01 A;  1IRG A;  2EH3 A;  1I1G A;  3GBG A;  1WJF A;  2XHK A;  3K7D A;  1HW5 A;  1I4Z A;  1S7O A;  2AVK A;  2P8T A;  2VKV A;  3LSR A;  1B9M A;  3F47 A;  2FNP A;  2FQ3 A;  3ZMU A;  2Q7R A;  3ZTM A;  2ACJ A;  5F08 A;  5GAE J;  3HZJ A;  4QLC U;  2CUJ A;  2X1D A;  1FNN A;  1JUP A;  5CYV A;  5KAI C;  4WK8 F;  3H5N A;  2IM8 A;  2BXY A;  1WZ2 A;  2J7P A;  1EH8 A;  4MVR A;  4JE9 A;  4HNT A;  1GT0 C;  2IS4 A;  3CF2 A;  4CX9 A;  1GXQ A;  2WY8 Q;  4DOZ A;  2HXI A;  2J5O A;  2FD5 A;  3DBH B;  3PMR A;  5J4Y A;  3S28 A;  5FFZ A;  5E3L A;  4BBS J;  1MMS A;  2HJ3 A;  3M15 A;  4UUS A;  2QVO A;  3LSG A;  3RQ4 A;  5B1B C;  2A05 A;  2R7Q A;  4HZF A;  2AQF A;  4NQW A;  2DMU A;  1WJ5 A;  2VH3 A;  2E1M B;  4I98 B;  5E8G A;  1FFH A;  3CCU I;  2DQR A;  1X4P A;  2JMW A;  3BQZ A;  3H0G J;  4PK4 A;  2VON A;  2WVN A;  3NYJ A;  1KZH A;  1L3P A;  1K6O A;  1EKY A;  2CW8 A;  2EIJ H;  2GA1 A;  4I0A A;  3BZ6 A;  3DTE A;  2WAF A;  3O3K A;  2MSY A;  3FKJ A;  4AUX A;  4BH9 A;  5LD2 C;  2VLA A;  5IT9 Z;  2K9L A;  2KIS A;  4B44 A;  3CO7 C;  4DXW A;  4IX7 A;  2P6T A;  4RAY A;  1IAW A;  1QSP A;  1WAS A;  1GV5 A;  3L00 A;  1G6N A;  4ESB A;  3RF3 A;  3ELK A;  3J81 Z;  1FIA A;  1ZHY A;  1JPJ A;  4BNC A;  2NUT B;  1IV6 A;  4ONS A;  1QRY A;  3WHC A;  4A6E A;  1GHC A;  1LIH A;  1LDK B;  4S0H B;  2LIG A;  3DP7 A;  1G3T A;  1U3E M;  1FBQ A;  4XLF A;  2V1N A;  3TMO A;  2M64 A;  1X58 A;  1VQO I;  5L0G A;  3L09 A;  5B1B H;  3CCJ I;  1DU0 A;  1Z3X A;  5IYD J;  1KQ0 A;  3M7G A;  2ZXO A;  3BTC A;  1SD5 A;  4LMY A;  1S3J A;  2PX0 A;  3HNL A;  2ISZ A;  1U8R A;  1XN7 A;  3AJM A;  1LS4 A;  4A6D A;  1XMA A;  2YEV A;  2V1X A;  4P9U A;  2CFX A;  1GQA A;  1I39 A;  3HRM A;  3DTK A;  4HW0 A;  4PJL A;  3JRA A;  3LA2 A;  4GXO A;  5GAG J;  2EIL C;  4MTD A;  2EV6 A;  2W4S A;  4YEL A;  3GZN B;  4XR6 A;  2OCE A;  5CVU A;  2ZB9 A;  4BJ5 A;  2BHY A;  5KAF C;  5EHH A;  3ABM H;  1OCP A;  3DKX A;  4RM2 A;  5ED4 A;  2WTE A;  1NG7 A;  3K2Z A;  1ZHX A;  3S29 A;  5HNF A;  5J1R A;  5EZH A;  3U5S A;  4TV7 A;  2JK3 A;  2V7F A;  3L8I A;  3GEI A;  3S27 A;  2HOS A;  4Z9H A;  4ENN A;  4L5I A;  3TO6 A;  4UUS B;  1ERD A;  3TD7 A;  2EPL X;  2MLG A;  3LSI A;  2X51 A;  2OQR A;  4AYB A;  4NQW B;  2VOD A;  3GZ6 A;  2EV5 A;  4XQF A;  3ZCO A;  4XID A;  3CJN A;  2CJJ A;  2P1A A;  3V8K A;  1I50 J;  1YDI A;  1E85 A;  3W2W A;  2KNH A;  2WVO A;  3OV8 A;  3JRI A;  3O55 A;  5L3V A;  5J4V A;  1LFU P;  3TOA A;  5KYY B;  5L3C A;  2WA0 A;  2PFB A;  4UVA A;  5C3E J;  2FF4 A;  4OIQ F;  1YLM A;  2VN2 A;  3RKY A;  3ZMD A;  4E6K G;  2MH2 A;  3WTY C;  3ZVR A;  1TBX A;  2XVC A;  1TFK B;  5E20 A;  1SYQ A;  1T6U A;  1K04 A;  4C7O A;  1SAX A;  3BRJ A;  4RGU A;  1ZAR A;  2O7O A;  2IJL A;  5FKL A;  4BY7 J;  1N1C A;  4YIR X;  4WX9 A;  2GA2 A;  2QUF A;  1GVD A;  1O3R A;  3HOY J;  4LDQ A;  4BG0 A;  5F64 A;  3CUQ C;  1DDN A;  5J3L A;  3JRE A;  1RXQ A;  3F8C A;  3Q6M A;  5K5R A;  3FMQ A;  4I1M A;  4IXA A;  2DMQ A;  2H1K A;  1A7D A;  2KL4 A;  1CF7 B;  3SEO A;  1CGN A;  5CI9 A;  5DCF A;  2DMT A;  1E17 A;  2WV1 A;  2XAJ A;  4G9Y A;  3MFK A;  4W8P A;  5COF A;  3C1D A;  5KYX A;  1ORK A;  2VB6 A;  1JOG A;  5DS5 A;  2XS1 A;  3P9C A;  4LLG F;  1Z1D A;  3QPL A;  4PSX A;  3FHZ A;  2L9J A;  3DTI A;  2J46 A;  3POV A;  1FOX A;  1HCR A;  2FSW A;  4A93 J;  4M3F A;  2BZT A;  3SDG A;  3H2U A;  4FES A;  1J75 A;  2ZXI A;  5D4S A;  4LLC A;  3V5Z A;  3VOE A;  4AK9 A;  4LB6 B;  5FO5 A;  1R7J A;  5DTD A;  2C04 A;  4Y7N J;  1JKP C;  2DFH A;  2FXA A;  3GVA A;  3DLA A;  3K4B A;  1JGG A;  2CQK A;  1CQT A;  4M3B A;  3WTW C;  2UWM A;  1G5Z A;  2V3C C;  4LG0 B;  3ASN C;  3GM2 A;  2MWQ A;  3QRF F;  4EWC A;  2ECC A;  5IY5 C;  3PSF A;  2O8K A;  5FRM A;  2JPB A;  2Z3Y A;  4ZDP A;  3A4C A;  1V54 C;  1TWH A;  3LWF A;  3S90 A;  3GTQ J;  2PNO A;  3NYL A;  4GCV A;  3GLL A;  4XLC A;  4DW6 A;  1BI0 A;  2VIX A;  5H20 A;  5BQT A;  4ENM A;  1TC3 C;  5E17 F;  2EA2 A;  1SZI A;  2L81 A;  4Q4Z F;  1K83 J;  3EUH A;  1JE8 A;  1TQG A;  4YT2 A;  1X3W B;  3TP0 A;  2L5Q A;  2HQN A;  2QEN A;  4FAP B;  2E7W A;  4NHJ A;  3GTM J;  4MTO A;  3RKO F;  3SEQ A;  3QP5 A;  2NS8 A;  2WAE A;  1VND A;  2IXN A;  1O57 A;  1RI7 A;  3EUA A;  5LGN A;  3CCQ I;  3F0C A;  3JRC A;  3K0L A;  2R5Z B;  1JKO C;  1WAT A;  4V2G A;  3EFO B;  1BC7 C;  4DZJ A;  1XCB A;  2V1U A;  1MBF A;  3G1M A;  2GM4 A;  2NS0 A;  1VQ9 I;  1YYV A;  3VSL A;  1YFH A;  5M5X J;  4BEJ A;  2HOA A;  2C03 A;  3EH1 A;  2CRG A;  2GXB A;  3MX3 A;  4XPX A;  4BS9 A;  2M4K A;  5HS9 A;  3L2U A;  2PFD A;  3HTS B;  1WRJ A;  5EF6 A;  2IGM A;  2M0M A;  1PV3 A;  5LEJ A;  5KYX B;  3W6J B;  4A3K J;  4IB4 A;  1Z5Z A;  4HBL A;  2XAU A;  3SFI A;  2VT3 A;  5HVQ C;  3RZD J;  1DOW A;  2V9V A;  4JBA A;  3OYB A;  4PJM A;  4ZTJ A;  1AKH A;  5M5Y J;  1BR1 A;  1Y8R B;  4XMY A;  1YG2 A;  1ZKG A;  1YW7 A;  4B4C A;  2M1B A;  1TNS A;  5D5W B;  2WB1 A;  2EV0 A;  2RDP A;  3I4U A;  4EJO A;  3K1M A;  3C8G A;  1LE8 A;  3OEO A;  2IEK A;  3EQL F;  5BOX A;  1ZEL A;  3GFL A;  5F0C A;  3VWB A;  3SXZ A;  2PG4 A;  4A2U A;  2ME0 A;  1IW7 F;  1W5S A;  1VYK A;  1P92 A;  3ERE D;  4EIY A;  5JFR A;  2IBD A;  4HNU A;  3ZDL A;  5HNH A;  3WTZ A;  3Q7G A;  2Y3B A;  4CDV A;  3T9O A;  1ZTR A;  3GOD A;  5HS8 A;  4M73 A;  3ECS A;  3F72 A;  1TWG J;  3LQR A;  4X0G A;  2B63 J;  2QQ9 A;  2K9Q A;  4DRH B;  3J80 K;  2P61 A;  2RQQ A;  3WG7 H;  3PM1 A;  4L9J A;  3ZMS A;  1B72 A;  1KU3 A;  1GUU A;  1Z0X A;  2V4J C;  3OYE A;  4JQF A;  4Y15 A;  4YT4 A;  4ESJ A;  1WHU A;  1FWZ A;  2ELH A;  4JVS A;  4LER A;  2MAB A;  3O6X A;  3UKG A;  3HOV J;  1DOV A;  1OCO H;  1EH7 A;  1GS9 A;  1ZLK A;  2B0J A;  2I8B A;  4DVY P;  4XL9 A;  2VJI A;  1I3A A;  4ANJ A;  1ETW A;  4JYK A;  2VC9 A;  1S9H A;  3F6V A;  4LIT A;  5IP9 J;  4RDU A;  2NAZ A;  4HDU A;  1FYL A;  1QHG A;  1OXK A;  3L8J A;  1OXB A;  3IQT A;  1QZY A;  1ETK A;  2TCT A;  1ZR2 A;  3CLO A;  5EEA A;  2F4M B;  2H09 A;  1BR2 A;  1SC7 A;  4XBF A;  1UB9 A;  3KP2 A;  1K7A A;  1WJA A;  3CP8 A;  1BI2 A;  2HKO A;  4WXD A;  3IUO A;  2J8W A;  3NG1 A;  3A0B C;  4AD9 A;  3E6D A;  2Z33 A;  2OG2 A;  1U0J A;  3C18 A;  3OR2 C;  4ITV A;  5B3S H;  2ELK A;  4X0R A;  1HDD C;  1K78 B;  1RKT A;  4E7K A;  1HMD A;  5EK0 A;  3HOZ J;  4M3G A;  2O6G E;  2VQL A;  1RZ4 A;  2EWN A;  2LOO A;  2J5P A;  4FT8 A;  2Y39 A;  4E17 A;  1TW3 A;  2E1N A;  5H2F C;  1R71 A;  2J9U A;  1UHS A;  2KZV A;  5LHG A;  3CSK A;  2XLV A;  3K66 A;  4CCO A;  3M8J A;  3BOQ A;  3GUD A;  3LEO A;  3JAM Z;  4K1O A;  2CW7 A;  1O5H A;  1DUX C;  3EZH A;  1MBE A;  3MMY B;  5F1J A;  1G3S A;  2ZKZ A;  3ROU A;  4I0B A;  1SD6 A;  1H0M A;  1E86 A;  1R1U A;  3E5Q A;  3VSK A;  5DS4 A;  4MTG A;  1FP2 A;  2CYD A;  3PSI A;  4J32 B;  1P6R A;  1VQ4 I;  2HEO A;  2ICW G;  5K7H A;  2LD5 A;  3BG6 A;  3LQQ A;  3VYT B;  2RQP A;  2J0X A;  4U5C E;  5EGY A;  1JJ8 C;  2RC4 A;  4MVM A;  3FOO A;  2JRT A;  3OSF A;  4W8K A;  1W0T A;  3MD2 A;  5FZT A;  1D0Z A;  4PUS A;  3FXJ A;  4YT5 A;  3DPT A;  1T0F C;  4NBQ A;  3BR3 A;  3IH2 A;  4HYE A;  4FAS D;  3AL0 C;  3MAJ A;  1U6G A;  1MMA A;  4MTE A;  2DYR H;  2QQA A;  3KYD B;  4ZLC A;  2XAQ A;  2OBP A;  2YS9 A;  2YX7 A;  1N25 A;  4GYG A;  1UMQ A;  4NUB A;  4AX2 A;  2XAS A;  2CWE A;  3ZQY A;  4IL6 C;  4OAZ A;  3TOM A;  4C30 A;  2CNW D;  5JHU A;  1J2X A;  2F5F A;  2HMZ A;  5EZG A;  4IJA A;  4RBN A;  2HDD A;  4M3E A;  3BEH A;  4FX4 A;  5JLI A;  4UV9 A;  2NS7 A;  1Y4C A;  3T5X A;  1OCC C;  1G3Y A;  5HOD A;  3U8V A;  2NYX A;  2FNA A;  2ESH A;  4B6I A;  2M4E A;  2LFF A;  3OSG A;  1S8N A;  1OR2 A;  3LS0 A;  3B6A A;  4HX8 A;  1JJ6 C;  1FOY A;  5FKK A;  1FBU A;  2ZXJ A;  3WG9 A;  1ZG3 A;  1J9I A;  4XWJ A;  4JIO A;  3L9F A;  2TDX A;  4HX7 A;  3KP7 A;  3GEH A;  4Z6Y A;  2PF4 E;  2E36 A;  1Z6R A;  4QIW N;  3E0J B;  4IHX A;  1M6T A;  2KYH A;  4IJJ A;  3WGH A;  4CZC A;  1HF0 A;  2BV6 A;  1FOW A;  3W2A A;  2Z16 A;  2LG4 A;  1TL8 A;  2CDQ A;  1UZC A;  3I5P A;  2CGP A;  3G2B A;  2PX9 A;  4FX0 A;  3LLI A;  3L2Q A;  1VQL I;  2JA7 J;  3GWL A;  4XN3 A;  4GYI A;  1TT5 B;  1WWX A;  1C0W A;  4UNO A;  3AQC A;  2BC5 A;  3N4M A;  3NMI A;  3H35 A;  4LOC A;  4PSW A;  1QZE A;  4JEB A;  3B73 A;  4N4W A;  2ID3 A;  3BPV A;  3FXR A;  2JRM A;  2BOL A;  2DW4 A;  3BCB A;  3T8T A;  1RPW A;  5M5W J;  3C63 A;  1VLT A;  2EIN H;  1DP3 A;  3VEP A;  4ESF A;  1J8M F;  1Z7U A;  3TW7 A;  2A0B A;  5T1D B;  5JSL A;  2HWV A;  3PHF 2;  4B47 A;  2QKL B;  4DJ9 A;  5JR3 A;  1MMD A;  2X1C A;  3L7W A;  3TED A;  1VTM P;  4EM2 A;  1F4K A;  2GWW A;  4DVZ A;  5DM7 F;  2KRH A;  2ID6 A;  4YFN F;  4ETS A;  2FMY A;  3GWZ A;  4KUM A;  4PZJ A;  1SFO J;  1H8A C;  5L0H A;  1APL C;  2Y31 A;  2BEO A;  2Q2E A;  3K4J A;  4CCJ A;  4YFX F;  1MJ9 A;  2X6W A;  3QPT A;  2DA4 A;  3HPG A;  3V4G A;  2B9S A;  2FGY A;  4RM3 A;  2YZS A;  1TZL A;  2K9M A;  3K4L A;  1ZR4 A;  4CGZ A;  2DN0 A;  4RB2 C;  1I6H J;  4LJZ F;  4UHT A;  4MGR A;  4ENK A;  1ZW2 A;  4N0B A;  2OEV A;  256B A;  2W4B A;  1ZU5 A;  2M87 A;  5B66 C;  3H5A A;  3MZY A;  1MDM A;  1ZU4 A;  2ZJP F;  5E3M A;  1S7E A;  2D45 A;  2QCO A;  3FM5 A;  2JN6 A;  2XL8 A;  3R0J A;  2ZD9 A;  3O39 A;  4K7B A;  2W85 A;  3HSE A;  2O61 A;  1PD0 A;  1Q0F A;  3LL7 A;  2MHR A;  3EET A;  3KKB A;  1BN5 A;  1M56 C;  2ISY A;  5AC5 A;  2VBZ A;  3SYT A;  2E1C A;  1XZQ A;  1IV8 A;  2GA0 A;  3CEX A;  3H36 A;  2G3K A;  2O9X A;  3OWT A;  1BI1 A;  2CQN A;  3RYR A;  1ZG5 A;  1H9G A;  3DEU A;  1MH4 A;  2K5C A;  2ZO4 A;  1XB4 A;  2ZCW A;  1VQN I;  2QF7 A;  4XKB A;  1OFC X;  4Q7C A;  1VK5 A;  1I27 A;  5L3Q A;  3FM3 A;  2Y2Z A;  2CQQ A;  4BAC A;  3CCM I;  4L0Y B;  2K86 A;  1NBB A;  2OQM A;  2FOW A;  2VJ4 A;  3FDY A;  4MQV A;  4DYC A;  3IL2 A;  1QPI A;  1CGO A;  4Z9I A;  2XLO A;  3SFZ A;  5CJ9 A;  3ZN0 A;  4IKF A;  1Q0G A;  2RNJ A;  1FYM A;  3GEE A;  2CQ7 A;  3K9T A;  1QA6 A;  2EPN A;  3OYL A;  4PFO A;  2AU5 A;  4OU0 A;  5JUA A;  1JTX A;  1ZZP A;  2DMP A;  1SAN A;  1TLH B;  3VPR A;  2Q3T A;  4C3B A;  3V42 A;  1DPU A;  1YX5 A;  4AIJ A;  1BL0 A;  2DLL A;  1ETY A;  4DNC A;  1Z9C A;  5DUI A;  3DE9 A;  5KYW B;  1OKK A;  2OKU A;  2M7B A;  2Q8K A;  3JCU C;  3W2V A;  2EPK X;  4Z2Y A;  4D4N A;  3A02 A;  3H92 A;  3I64 A;  4PR9 A;  3P9K A;  2QSF X;  3OIO A;  2VAS A;  5J6X A;  4J01 A;  4A3F J;  2G7H A;  2J0W A;  4E7Z A;  4E0I A;  3VYR B;  4KIT B;  4BXU A;  3HG9 A;  4Y13 A;  3KEQ A;  3SZT A;  2VT2 A;  2IVM A;  1IXR C;  2BGC A;  3QP6 A;  3UGO A;  1ETQ A;  3BTI A;  5K7Z A;  1MDM B;  1OKR A;  3DJU B;  1JUS A;  5ILS A;  1B68 A;  4ZDL A;  1VQP I;  2M7A A;  2HVS A;  1WWP A;  3IWF A;  3SXK A;  3U9M A;  3S84 A;  2KZG A;  2NUP B;  2W00 A;  2X0L A;  3DBL B;  3N0T A;  5FFX A;  5F6F A;  2WZF A;  1FMV A;  3EGD B;  3CC4 I;  2D1H A;  3BG3 A;  1N75 A;  3U2L A;  2FUG 2;  3HKZ N;  2A68 F;  3M9A A;  4HST A;  1G2H A;  4CS9 C;  3HGY A;  1DU6 A;  3CDI A;  5HLH A;  4E7L A;  1XSD A;  1T38 A;  4G78 A;  4CDA A;  2GFH A;  3F8N A;  3DEE A;  3QAH A;  4LK1 F;  4XRF A;  3JSO A;  4X1E A;  1LFB A;  3DKA A;  3ZMV A;  2PX3 A;  4DBR A;  1MH3 A;  2CV2 A;  5TJJ A;  4ULV A;  2O5R A;  1T56 A;  2XLW A;  2MD5 A;  1ODD A;  5EJC A;  2XIG A;  3F6O A;  2CUZ A;  2MYS A;  2IRF G;  2E2H J;  3LMM A;  1AWC A;  1MNE A;  4A0Z A;  2PBE A;  1V4R A;  3W6V A;  4LAC B;  1WJE A;  3UNG C;  4KT6 A;  4O79 A;  4BXF A;  2KDO A;  4KN7 X;  2R3S A;  3IV5 A;  1K05 A;  2J9W A;  1Y8Q B;  3GTG J;  1RJ9 B;  3RTR A;  1YZC A;  4KNW A;  2J9B A;  4XEK A;  4XLN F;  3KE2 A;  4XPW A;  1FNT c;  3HOS A;  1OCR C;  5CQE A;  2FE3 A;  2YU9 J;  3BRO A;  4BYY A;  3WTT C;  1EKE A;  4B09 A;  1D8K A;  1QU3 A;  3FZV A;  1IN6 A;  4BDY A;  4YL1 A;  2ZFU A;  4RGX A;  2W48 A;  2CV0 A;  4KIG A;  3M8F A;  4U0Y A;  1K4T A;  3LAY A;  3DAG A;  2LMD A;  3CC7 I;  5GPA A;  3CJQ B;  2LRE A;  4MO7 A;  2BW3 B;  3FIW A;  3Q0V A;  3GM3 A;  1O7F A;  3SZR A;  3REO A;  5IP6 A;  3NRH A;  3OA1 A;  4KI2 A;  4A69 C;  1TWA A;  1XGN A;  1MKM A;  2HVQ A;  9ANT A;  2A6E F;  3LAJ A;  4CA0 A;  2Q0O A;  3K1P A;  2VXZ A;  2HDC A;  1XC5 A;  3H3U A;  3LA3 A;  1BM9 A;  1NG6 A;  4XM3 A;  2QBY A;  3ZGK A;  3HOW J;  4XKW A;  1VQ6 I;  1LPE A;  4EKW A;  2E1O A;  1A6I A;  2FEZ A;  2GXA A;  2PMU A;  2V6E A;  5GTI C;  1OCR H;  2GOX B;  2F5V A;  2M4G A;  2Z1D A;  3KYL A;  3T4R A;  2A1D D;  2ZME C;  4CXF A;  2E7X A;  3DZA A;  5B1A C;  3RDI A;  2XC7 A;  4N9I A;  3L34 A;  3E5X A;  1VYI A;  3RQE A;  2OZU A;  3CUQ B;  4ZZD A;  3GTO J;  3BQY A;  3A01 B;  2EFN A;  2JTV A;  5L3D A;  2QGU A;  3AG2 H;  2LBF B;  5LLQ A;  1IZM A;  1VLS A;  1V5F A;  2XPW A;  1XSV A;  4U5E E;  4E7S A;  3JRD A;  5COM A;  2LSO A;  4S05 A;  1MMN A;  1G4U S;  2YL7 A;  3RKQ A;  1JAF A;  3JTL O;  4YN0 B;  1XZP A;  4F4B A;  3LSM A;  1DGW Y;  2NUT A;  3GLX A;  2A6T A;  2E87 A;  1TWH J;  2KPM A;  2VPR A;  2DK5 A;  5KYU A;  4EM0 B;  1JHH A;  2GIV A;  3IP4 B;  3I4N J;  4IRH A;  2IXS A;  2NVX J;  4E4H A;  3W8H A;  4MW3 A;  2NPU A;  2VXD A;  1RUO A;  1Z63 A;  3ERM A;  5D5U B;  2DOD A;  2IPQ X;  1GDT A;  2NSG A;  3EHM A;  1C17 M;  3FXH A;  4NY3 A;  2IS6 A;  4WAB A;  3Q0U A;  3TO9 A;  2EPO A;  1EQ1 A;  4G7Z F;  2YL3 A;  2A6H F;  4R1H A;  5KHD A;  1I3Q J;  3DWL E;  2EIJ C;  1E83 A;  3SP1 A;  2XRO A;  3E6C C;  2LY1 A;  2JPU A;  1DP7 P;  3A9C A;  2CW0 F;  1A5J A;  1TTY A;  2P0W A;  4DZP A;  4H0E A;  4BHP A;  3M1E A;  4IOC F;  2VL8 A;  2XRL A;  4XNF A;  3N24 A;  1KON A;  3CQZ J;  1PUF B;  4PJN A;  4ON0 A;  1JKR C;  4BBR J;  3M4B A;  3IQC A;  1P4A A;  3DU6 A;  2LKP A;  3CLQ A;  3EGX B;  1IDZ A;  2QBY B;  1EH6 A;  3JRM O;  3RKW A;  4AIK A;  1Z7Q c;  4D7N A;  5A6B A;  3P7N A;  1MBK A;  4CIH A;  5HLG A;  3QWL A;  1YTY A;  5DV5 A;  4ZLD A;  4HFF B;  1U9N A;  2LF8 A;  1YO5 C;  4DRJ B;  3MWM A;  1Z6A A;  3OOP A;  1JRA A;  2XLM A;  1B59 A;  4BXX J;  3ITF A;  5JVE A;  3CCS I;  3JSE O;  5KYY A;  3GX4 X;  4G94 A;  4RGR A;  1XG1 A;  2HTJ A;  1OJL A;  2X6Y A;  5CVV A;  3K1H A;  3CUO A;  4L6R A;  5AC4 A;  4BU2 A;  4JW1 A;  2PN6 A;  4KC9 A;  1XCV A;  2CUE A;  1HW1 A;  2HZT A;  4FE7 A;  4MNU A;  2D2W A;  2HPI A;  2L6G A;  3KH2 A;  1D8J A;  2WZG A;  2KQR A;  1IUY A;  2W7N A;  4P6I C;  1O3T A;  3ABM C;  4V19 K;  5KYU B;  1R1V A;  4OIN F;  5LGT A;  2HS5 A;  3OS0 A;  5IOZ A;  2ZXW C;  3LST A;  2KIF A;  1W36 D;  5HSW A;  4S04 A;  1LB2 A;  4HF1 A;  1ZGW A;  1JR8 A;  4IAQ A;  3IWZ A;  3IHU A;  1W7P D;  3IQ5 A;  4EJT A;  4UB8 C;  4QWQ A;  3I58 A;  4HV5 A;  3QYF A;  4WF2 A;  3W6K B;  3QPS A;  3OS2 A;  5LFA A;  3I54 A;  3U3B A;  3TQN A;  1CF7 A;  3JYH A;  2IXM A;  3ZXS A;  1O4X A;  2Q4F A;  2F2E A;  2VOO A;  4QI2 A;  3HNJ A;  1OCZ H;  2XGE A;  4CYD A;  4RS8 A;  2DOA A;  2LP4 A;  5B3I A;  3SJM A;  2F5E A;  2G3V A;  3DMD A;  2QTV A;  1F5T A;  3LLK A;  4OWR B;  5TIS C;  4CYC A;  4HFK B;  2LDU A;  2LRD A;  4LDK A;  1JI8 A;  1J0R A;  4DYR A;  2IT0 A;  4JTC B;  5EEH A;  2ZXW H;  1V55 C;  2RAE A;  3EUK L;  3PIP F;  3T1B A;  1IO2 A;  3SQN A;  2KIM A;  1HC8 A;  3F22 A;  2NSF A;  1Z7L A;  3ESW B;  1DQU A;  1IGN A;  3HNK A;  4LG0 A;  5C4X J;  1VB5 A;  1ZAO A;  3K1I C;  2B7E A;  2V26 A;  4BQN A;  1NTC A;  1T33 A;  5FGM A;  4GYT A;  2XF6 A;  1T0F A;  3LNQ A;  1VFC A;  1VQ8 I;  3W4Y A;  3FDQ A;  2QQB A;  5D8K B;  4GO1 A;  2RSE B;  1MIJ A;  3GFM A;  4F3Q A;  4F92 B;  4G7O F;  4EV0 A;  4XOT A;  4MND A;  5L0J A;  1OQC A;  3LES A;  4AID A;  4KT5 C;  2TMV P;  2Y3H A;  5DCM A;  5BNG A;  2BE5 F;  3FHD A;  1O87 A;  4CIC A;  4A0X A;  3CAX A;  4M9X A;  5F27 A;  5DVW A;  1V55 H;  3RW0 A;  3WGG A;  3MKW B;  3IRQ A;  3MEX A;  5TJ5 E;  4NQF A;  4W1U A;  1YJG A;  1E2X A;  2R5Z A;  3HM5 A;  1JPN A;  4EQQ A;  4IWB A;  4CCL A;  1NFO A;  3DCF A;  4M63 A;  1LI7 A;  5A2Q Z;  1YIJ I;  2M5W A;  3BY6 A;  3BR1 A;  2KRF A;  3EPZ A;  4EVI A;  1XS9 A;  3Q0W A;  3MCZ A;  3U21 A;  1OLT A;  4EHP A;  3VF0 A;  1KU9 A;  5BPD A;  1QO0 D;  2P5V A;  2O9L A;  1OW8 A;  3AQB A;  5E2Q A;  1ZGJ A;  4PCQ A;  1K79 A;  4OAY A;  2CMP A;  3KIO A;  1R5H A;  1TW2 A;  3RH3 A;  1ETX A;  2HI3 A;  3LFU A;  2DK8 A;  3FIS A;  4P9F A;  2XL6 A;  1HDP A;  5HV9 A;  1FTZ A;  1PYV A;  4P96 A;  2Y0S N;  2W57 A;  4CYC B;  4Z9J A;  3NKD A;  4UXN A;  2R92 J;  3TDZ C;  1KNY A;  2MGQ A;  5IP7 J;  2EIM C;  3L1M A;  2OPT A;  2UUI A;  5E3A A;  4CCN A;  2VCB A;  1E3P A;  4E18 A;  2XKP A;  3PDM P;  1TNT A;  4P1W A;  3S15 J;  1YAU O;  3MLG A;  3X2Q H;  4BDZ A;  2WVQ A;  3S9O A;  5KYN A;  1Y39 A;  1UG2 A;  3UMH A;  3LAP A;  1J8Y F;  5ILV A;  2HVR A;  2I10 A;  2EPF A;  5K7F A;  3CME I;  4HA8 A;  4A3C J;  3AL0 B;  2G9W A;  4A3E J;  2DFE A;  2MLK A;  5A6K A;  4W97 A;  2JT1 A;  2VCC A;  5FB2 A;  4F52 A;  4II3 A;  4MFD A;  3VFZ A;  3T0Y A;  2JZY A;  1QGP A;  4R8H A;  4B43 A;  2L7Z A;  5EDN A;  3ECO A;  1T9K A;  5DCM B;  4O7G A;  2BHZ A;  2YU3 A;  1LFP A;  3FMS A;  2CQX A;  5C4J J;  2IA1 A;  3K70 D;  1YHQ I;  1NSG B;  3WTU C;  3QMK A;  4OIO F;  2EIM H;  3HJC A;  4N4N B;  3CCE I;  1PVE A;  1R4M B;  2QWW A;  2F5D A;  2HFI A;  1GGQ A;  3H5R A;  1R5G A;  2JUC A;  2KJB A;  4AL1 A;  1X1D A;  4MIM A;  1ETO A;  5GAD J;  3AGU A;  3E97 A;  5LEK A;  1YW8 A;  4BUP A;  3BDD A;  1BW5 A;  3WU2 C;  3RSN A;  5FRO A;  2L7M P;  3HKZ A;  4U5G A;  5IPA A;  3PNT A;  3MKY B;  1Z6T A;  3WHN A;  4Q48 A;  3D5R C;  5BQH A;  2HV7 A;  3ECH A;  4N6H A;  1BJA A;  2HYF A;  3GTJ J;  4BJT A;  1JUM A;  2DCE A;  4XLH A;  1K4S A;  2CS3 A;  2RV8 A;  3I4P A;  4YL0 A;  3R60 A;  3OS1 A;  4C2U A;  3H2V A;  2HKV A;  2BL2 A;  3RPQ A;  4I02 A;  1OYI A;  3WG7 C;  1UJ8 A;  2BXZ A;  3V7S A;  2H7V C;  4I01 A;  1WOL A;  4JJG A;  1YW9 A;  1K78 A;  3QW1 A;  1LNW A;  4QI0 A;  3ABK H;  4KJZ A;  1RKW A;  1IG7 A;  3P5J A;  5D6E A;  4JK1 X;  1ORJ A;  3G1O A;  1FTS A;  2YR2 A;  3ZQ7 A;  3VYU B;  3NWT A;  3MVP A;  4P55 A;  4EMS A;  1G4W R;  5COG A;  1Y1V J;  2L4M A;  1ZQ3 P;  5DLJ A;  1OCO C;  3ZQL A;  4MVU A;  3S1N J;  1YIT I;  1U5T C;  3HUG A;  4EJW A;  2W4M A;  1PP8 F;  2L7A A;  1F9N A;  4X6A J;  2FML A;  2HSQ A;  4DQ2 A;  1PD1 A;  4NB5 A;  2HV6 A;  2LLK A;  2YHS A;  1RR7 A;  3RQG A;  3CJR B;  1PP7 U;  2YUS A;  2A0U A;  2JX0 A;  1Z21 A;  2Z99 A;  4IQ4 A;  1S6L A;  3S3M A;  4AE4 B;  2E35 A;  2X48 A;  1FP1 D;  1AU7 A;  2KC3 A;  3U3F A;  3ML6 A;  3OL4 A;  3VM6 A;  1JGS A;  1W7P B;  1XGS A;  5BUO A;  3HJE A;  1SD7 A;  3QQA A;  1NU9 C;  2OCC H;  1IDY A;  1LUJ B;  5HDG A;  3I53 A;  2M2E A;  3ZQH A;  2AWC A;  1LQ1 A;  4GQH A;  2XF7 A;  2VUM J;  5B3S C;  2IA2 A;  3TKY A;  4KFC A;  4CBE A;  3LSK A;  3RPU D;  5IOY A;  1MW7 A;  2GQQ A;  4UUT A;  4XN0 A;  1M2V B;  2FA5 A;  3ZMZ A;  5FD5 A;  1QVT A;  4KN4 X;  3CF5 F;  2QNL A;  1B6A A;  4M6X A;  1S72 I;  3I55 I;  1C02 A;  3MKL A;  3V5X A;  3BR2 A;  3ZG1 A;  2PBI A;  4DRI B;  5FCL A;  3EHN A;  3HOU J;  2LF7 A;  4QTR A;  2LD6 A;  3H1C A;  3OYD A;  3I4M J;  2WC2 A;  1OMI A;  5BS6 A;  1NLX A;  1QLE C;  3DJN B;  5CIV A;  2B0L A;  2XF5 A;  4CHU A;  1V3F A;  2FFH A;  3GME A;  3TJ6 A;  4CS9 A;  3H3Z A;  4IHW A;  1AOY A;  2ELJ A;  3CCL I;  1W5T A;  2ZPA A;  4A3L J;  4XOR A;  2XAF A;  3FVY A;  3BJO A;  3KZI C;  1SAU A;  3F21 A;  2K85 A;  2MH9 A;  4HF0 A;  4JCZ A;  2L54 A;  3G3Z A;  4XRS G;  3NRV A;  1ZRD A;  4FWV A;  1SEU A;  2GZW A;  1TWC A;  2M8G X;  1B1B A;  1QHH D;  2Y75 A;  1H7I A;  4IHS A;  2QA4 I;  3A11 A;  3S3O A;  1F43 A;  4EM1 A;  2M3A A;  2I5U A;  2JA5 J;  2COM A;  4YII A;  1IXC A;  3T6B A;  3DPL C;  3HUG B;  3BG5 A;  3PFI A;  4NC6 A;  4I7H A;  1TKN A;  2K3P A;  4G6Q A;  2VQC A;  1T98 A;  3M1C A;  1R00 A;  4J7T A;  2OQG A;  4HE8 D;  4IPA A;  3CCV I;  5E18 F;  2AP3 A;  3H9Q A;  1LEB A;  2DYR C;  2VBW A;  2K9N A;  4F91 B;  5E1Z B;  4HSR A;  2RD9 A;  1Y6I A;  4WJ0 A;  2W25 A;  5CI8 A;  2M0C A;  4M6V A;  1UG0 A;  4MEY F;  4RB0 A;  3GM1 A;  1RIO H;  3FXU A;  2HYG D;  3U1K A;  1BA5 A;  3HRS A;  1HY5 A;  3NYM A;  2GAU A;  2ZNY A;  3RVY A;  3JW4 A;  2EBI A;  5HDK A;  3TJ5 A;  4A5M A;  2DDA A;  3RJP A;  1DPR A;  4CSW A;  4KIF A;  3DQV C;  1BZ4 A;  3MYF A;  4EJV A;  3N97 A;  4KNY A;  5E3N A;  1DGR M;  2PJR B;  3IAM 2;  2YRF A;  4XON A;  5L3E A;  3QVZ A;  2BY2 A;  3HTU A;  3CCY A;  4I76 A;  2LSE A;  3S93 A;  1EA3 A;  2F22 A;  3VAY A;  2QZ8 A;  2RKH A;  5DS9 A;  1YVI A;  5ICC A;  1BIB A;  5DD4 A;  1H9T A;  4K0D A;  3AG4 C;  3ISP A;  3HRU A;  3HSR A;  4BJ6 C;  3PO2 J;  2IA0 A;  1SR2 A;  1G3W A;  3O8H A;  4ZZL A;  4LLE A;  3IAS 2;  3G6E I;  3BLY A;  5J40 A;  1KTM A;  2ZJ2 A;  1ZGA A;  3R2P A;  2LP0 A;  2O3F A;  3MFN A;  3HXL A;  2YSR A;  1MSE C;  1M2O A;  4YJW A;  4BJ1 A;  4E7I A;  4JC7 A;  1LDD A;  4Y4R A;  2MBF A;  1UCR A;  4AC0 A;  2M34 A;  3KLO A;  2WWY A;  4KBL A;  2STT A;  3EGX A;  2EIN C;  2V79 A;  3LSH A;  1EJ9 A;  2E34 A;  4O6Y A;  3TK0 A;  3J06 A;  3FMR A;  3RQI A;  3M1C B;  2OF7 A;  2LKX A;  2L9N A;  2IGK A;  4CS8 C;  3RVZ A;  3GXO A;  4CDG A;  1T6I A;  2K27 A;  1TWA J;  4OIP F;  3ABL H;  1WJD A;  1RKC A;  3AG4 H;  2Q9A A;  4A2N B;  4NC7 A;  2CV1 A;  1BOA A;  5HLT A;  3O10 A;  4G0H A;  2E2I J;  3DU5 A;  2VKE A;  4XKC A;  1SD4 A;  3DM5 A;  1O3S A;  2Y30 A;  4JKV A;  3S17 J;  2JA8 J;  1S7Z A;  5EGO B;  4MEX F;  1U0B B;  2DJN A;  4EGZ A;  2ASR A;  2E71 A;  3UMI A;  2Y3G A;  2ETH A;  3QYE A;  3RYP A;  1YJN I;  3L0I A;  2ZBK A;  4EJU A;  4BQQ A;  3U9J A;  5DYM A;  4DBQ A;  4BAY A;  5L0F A;  1HST A;  1W5C C;  2XUB A;  1T8I A;  4L18 B;  3EH2 A;  2NNN A;  3VYS B;  4IQJ A;  3WOD F;  1W36 C;  2EZI A;  4JRZ A;  3V7O A;  4AM3 A;  2MD0 A;  3F8F A;  4IHT A;  4MTF A;  4LFU A;  4O3M A;  2GWR A;  2D5R B;  1MJA A;  1FOK A;  5KYW A;  3M07 A;  2LTP A;  3TW6 A;  1GVJ A;  3JZ0 A;  3FXO A;  1R49 A;  2NNY A;  2JVH A;  2ZME B;  1R4N B;  3ZQV A;  5L0C A;  2DBB A;  5EG0 B;  2HDW A;  4U5B E;  2DI3 A;  1R22 A;  2DAO A;  4HX4 A;  1EI7 A;  1P4X A;  2V9K A;  1Y1W J;  4NNJ A;  2EZK A;  4CSA C;  3HL2 A;  2XLD A;  2WB7 A;  2IAI A;  3VDX A;  3O2P E;  2HZD A;  5LHI A;  4HF2 A;  2CCY A;  2L9S A;  2V1D A;  4I6Z A;  3U9G A;  2DA5 A;  2NUP A;  4PAC A;  1MMG A;  1OR3 A; 
#chains in the Genus database with same CATH homology
 2OJE D;  3KPH A;  2ICW G;  1R5I D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...