2OJED

Mycoplasma arthritidis-derived mitogen complexed with class ii mhc molecule hla-dr1/ha complex in the presence of edta
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
214
structure length
214
Chain Sequence
SMKLRVENPKKAQKHFVQNLNNVVFTNKELEDIYNLSNKEETKEVLKLFKLKVNQFYRHAFGIVNDYNGLLEYKEIFNMMFLKLSVVFDTQRKEANNVEQIKRNIAILDEIMAKADNDLSYFISQNKNFQELWDKAVKLTKEMKIKLKGQKLDLRDGEVAINKVRELFGSDKNVKELWWFRSLLVKGVYLIKRYYEGDIELKTTSDFAKAVFED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain prec
publication title Zinc induces dimerization of the class II major histocompatibility complex molecule that leads to cooperative binding to a superantigen.
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 214
sequence length 214
chains with identical sequence H
ec nomenclature
pdb deposition date 2007-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF09245 MA-Mit Mycoplasma arthritidis-derived mitogen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.530 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A mam-mhc complex, Chain D, Domain 2 2ojeD02
1.20.120.390 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hla class ii histocompatibility antigen, dr alpha chain. Chain D, domain 1 2ojeD01
3KPHA 2ICWG 2OJED 1R5ID
chains in the Genus database with same CATH superfamily
2L9NA 2BVLA 1V4RA 4EBBA 3ZCOA 5J40A 4BACA 5ICCA 4OAYA 5L3CA 2EZHA 1T5OA 2MSYA 3MBGA 4D7NA 2FBIA 2J46A 3CDHA 2Q9BA 4EHPA 1PV3A 2PI0A 4ZTJA 1OW6A 3PMRA 1GUUA 3F8MA 3J81K 2DK8A 3QU3A 1XPXA 2EZLA 3HYIA 1XG1A 4YIRX 1I6HJ 1BW5A 2ACJA 1S7ZA 2W4BA 3G50A 4JP0A 3HNLA 4RS8A 5JS5A 1BDJB 5J3LA 4GYTA 2X1CA 4IWBA 3JW4A 4AX2A 2AS5F 2OBPA 3SZTA 1H0MA 4XRFA 3HM5A 4AU7A 3FVYA 1J9IA 4PZJA 3ONQA 4YFNF 4LIUA 1Z7UA 4RGXA 3M3YJ 3QOEA 2O8XA 4M72A 1NSGB 1Y8RB 5T3TA 1XCVA 3KYDB 2ADUA 3M8FA 1KGSA 3F22A 2IXNA 5H2FC 3TW7A 3KYJA 2E2HJ 2NOJB 3OYIA 1ETOA 2KL4A 2BXZA 5F1RA 4C3IJ 1S05A 1T0FA 3HOWJ 1AVOB 3JSPA 4IO9F 4AVZA 5E1WA 1U6GA 2WA0A 1LKXA 3ZSUA 5F5FA 5HDNA 3WU0A 3HSRA 4RBNA 1NFNA 4II2A 3JREA 4L5EA 3ISPA 3HRTA 2M87A 5J1YA 2EK5A 1TWHA 3UMKA 4XKVA 1FC3A 3ZIBA 4HYEA 1ZZPA 4K1OA 4EKWA 4HF0A 3DBRB 4J30B 2H94A 2BL2A 2GIVA 1G3TA 1EKYA 2DMQA 1T33A 2KIFA 1J5YA 4G7OF 3OY9A 1Y0UA 1FTTA 3WG9A 2CFOA 2COMA 2FMYA 5FRNA 5DM7F 3SZRA 2VQCA 4C3JJ 4IHVA 3C7JA 2CUJA 4K2EA 3JRHA 3GWLA 3ZC4A 1MDMA 5ED4A 2WWYA 2PFDA 1TBXA 3U1DA 2MBFA 2F4MB 2HKXA 3HG9A 2Y30A 2R7TA 1ZHZA 3GW2A 5A2QZ 2BW3B 2IJLA 5F04A 1WJDA 2PJRA 4HF1A 2HKVA 3HNKA 4JURI 3FXRA 3W2AA 3HKZA 1IV8A 1LB2A 1WATA 2L7AA 2YL3A 3EGXA 4JCZA 4V2FA 3SP1A 2MA3A 5JFRA 5HODA 4I1MA 1T6UA 2EFWA 2M8GX 2CO5A 2IEKA 3FK7A 2XM4A 2LOOA 4HA8A 1LJ9A 2X6OA 2VJ5A 4Z9HA 1O7LA 3RPUD 2EIMH 2XAUA 5CQEA 3UR3C 3JTLO 4A2NB 1Y1VJ 1W36C 4FX4A 1MBJA 2FX0A 3FBNB 1YE9A 3FWEA 4BUPA 5ICEA 2KJBA 1SC7A 4G0HA 1RUOA 3FXOA 3J7AY 2GBYA 1I3AA 2P7VA 3NWSA 5F0CA 2FD5A 2HTSA 1YVIA 4XLHA 1FP2A 4EMSA 4MTFA 4DBRA 3CCUI 4OIOF 2HU9A 2RAEA 1WJFA 3K2AA 1DP7P 3OYMA 3BEHA 3UMIA 3G4XA 2HXOA 2AO9A 1SR2A 2VJJA 3HUGA 1QQ3A 4LGWA 1I39A 2R5YA 3KYCB 4M3DA 3DCFA 1YIJI 2XRNA 2H09A 2E5ZA 3OMYA 2R7RA 4CGZA 1V55H 3LSIA 4CIPA 1YZCA 1G4US 3HC7A 4OWRB 2EPOA 4FHTA 3ZRGA 1A04A 2PN6A 1JHFA 4CS9A 4JJFA 4MNDA 3LSPA 3IH2A 1MNDA 1QZEA 4MIMA 1T2KA 4YK5A 2FSWA 5E8GA 2A0UA 3MZHA 3SHFA 3W2WA 3M8EA 3DKAA 2HZTA 2KZGA 5TISC 2UV1A 1OYIA 3BRJA 4V2GA 2PBIA 1ONVA 1X1PA 3B9QA 5LGTA 4XEKA 4G6DA 2UWMA 3WGGA 4NY3A 2FNAA 2QZ8A 3NRVA 3H3UA 4KNYA 4N0BA 3F6OA 4OIPF 4IPAA 4WXDA 1X19A 1DPUA 3CMEI 4E17A 1Z91A 3TEDA 2X48A 4HW0A 4MEYF 2RC4A 1TTYA 2NVTJ 1A31A 3FDYA 3M4OJ 2B9SA 5ERIA 2Q2EB 3ASOH 4XPWA 3VOEA 5FROA 1O3TA 1F1MA 3GORA 4HLYA 3TP0A 3AQBA 5IOZA 2WY8Q 2UUIA 2EZIA 3DBHB 2AHQA 4NC8A 1NTCA 1PYVA 1A6QA 2R03A 1P92A 4S04A 3K9TA 1MSFC 3PQJA 1GT0C 2A6TA 1Z3IX 1M56C 4HDUA 3KYIA 2EILH 3V4GA 1IXCA 2PP4A 2E5NA 4Q4ZF 4PFOA 4LB5A 5DM6F 4A0YA 4B6IA 3ECOA 4ZTFA 4RD9A 3H5NA 4CXFA 1PUEE 1OCZH 2Y9ZA 3O2PE 5COMA 1QHGA 3TOLA 2F5VA 3BY6A 4N6HA 3GTKJ 2I10A 2QEXI 1LIHA 5BQGA 5L0IA 2GA1A 3DQVC 3GX4X 1V54C 2W84A 1M2VB 3BG3A 4WWCA 2WC2A 5E17F 5HLTA 2W9YA 2V26A 4M9XA 2HQRA 2MFZA 2CYYA 4M9ZA 2UUHA 2QQ8A 1HKSA 1W7PD 3E3VA 2L3DA 1O57A 3LA7A 4DYCA 5AC4A 4DZPA 1JPNA 1PDNC 2OF7A 1Z5ZA 1AKHA 3M79A 4JEAA 3GEZA 5L0CA 5C4XJ 2Z2SB 3BZCA 5E3LA 1MJBA 4HNTA 1FY7A 4PSWA 4CDYA 2KKOA 3S1MJ 3JYYA 3EG9A 4M6XA 2M4KA 4JK1X 5M3FJ 4MVRA 3BR1A 5F0HA 2BOLA 3BC8A 3K0LA 3IKTA 5IYCJ 3WTUC 3C3WA 3PIOF 5DV5A 5IY5C 2RDPA 1RETA 4DYQA 2D5VA 4HX7A 4JW1A 1OQCA 1OCCH 4L9TA 5B5EC 1B59A 2KDOA 2PBEA 4N4OB 3LQRA 3VEPA 3ZWIA 1HY5A 1ETYA 1V4AA 3FM3A 2HZ8A 2M0MA 2ELHA 3FMQA 3Q9SA 1D8KA 3ELKA 2BC5A 1AU7A 2CV0A 4BJTA 1F5TA 2KDZA 1YW9A 2F22A 1SMTA 3MKLA 2QQAA 2HV6A 3TOBA 2M45A 4UUSB 1KQ9A 2IS6A 5K7HA 2DDAA 1QZXA 1XZQA 3L8IA 2VXZA 4UVCA 1ZQ3P 3EH2A 2MD0A 1NG1A 1YDIA 4LLEA 1PCXA 5L0FA 1MJAA 4DGWB 4HV5A 3S29A 2FJ1A 2Y2ZA 2Q8KA 1WI3A 3OYNA 4AYBA 1I6XA 4EBJA 1PJRA 5DUKA 5H6QA 5K7FA 3RQ4A 3WTTC 5F27A 4E7JA 3PO2J 2VASA 2QYOA 3OOUA 2YU9J 1J59A 4FWVA 2YS9A 1FNTc 1OCTC 4ZH4F 3H9QA 1J09A 4OOIA 1TT0A 2P5VA 2F4IA 1BA5A 3VWBA 4MVQA 3DE8A 1A41A 5L0DA 3SYNA 4PJLA 2P61A 4IKFA 2K02A 3OYAA 4CBEA 3BTLA 1GDTA 5IPAA 4JX4A 1T39A 1XS9A 3MYFA 5JP7A 5BPIA 3VYWA 4KJZA 3E0JB 1JI8A 1S9HA 4IRIA 1NU7D 3I4MJ 2XVCA 4XKCA 2L54A 4IOAF 4LACB 1QKRA 4I01A 4KYWA 4MVMA 3TJ5A 4RB1A 2EBIA 1GV2A 3DMDA 3DKWA 4XK4A 3POVA 3DLAA 1VF9A 3AQCA 1N25A 2DTRA 3BG7A 2LY9A 3HIFA 5DD4A 2JUGA 4E6KG 4XPYA 5B3IA 1EA8A 2V1UA 2H1KA 1FMVA 1T6QA 4ZLCA 2KNHA 4ESFA 2LKPA 5EGYA 1U9NA 2UXXA 2DBBA 2ELKA 3I4PA 2P6VA 2EFQA 2E36A 1IDYA 2X6XA 1HCRA 2TCTA 3L2UA 1LFBA 1NK2P 1E86A 1OFCX 4HOBA 3OA1A 3F6VA 3B6AA 1JKQC 1ZVZA 2IGNA 2KIMA 3VRCA 3BWGA 4KN7X 5M5WJ 1EH8A 5D8LB 4B8XA 1HDPA 3L2VA 2WB1A 3HLZA 4U0YA 5LHIA 2V9KA 1IG7A 3AG2C 3W4YA 2VIXA 1R5HA 4RAGA 1IZ1A 1O7FA 2QY9A 2KIUA 2Y48A 1HF0A 3SEOA 1P7JA 3CSKA 2YHSA 3K70C 2XLHA 4YFXF 1JT0A 1FP1D 5C3EJ 5J8CA 4MGRA 4RAZA 3S32A 4IGGA 1YITI 1J75A 5F6FA 5FB2A 2NS0A 3EFOB 3TOAA 1Z21A 3K4CA 4AIJA 2YUSA 3M4BA 2K4BA 2NXNB 4FQGA 1LE8B 2A0BA 3TO9A 1R4NB 2G9WA 2K9NA 2O3FA 4EEFG 1WWXA 5JR3A 5LEKA 2NVYJ 4FX0A 1G4WR 2J7PA 2FNPA 2EIMC 3WTYC 3DE9A 3K33A 4IAQA 5E33A 2E1OA 3A11A 4JE9A 2WVOA 2Y3GA 3WTSC 4IL6C 1LFUP 3A03A 2W82A 1Y4CA 3F8NA 1I3QJ 1T98A 4LLLA 1W7PB 2Z33A 3GTGJ 2IS4A 1JOGA 2B7EA 1ZELA 2G7HA 1STZA 4GRIA 1V5EA 4BNCA 1SVOA 5DS5A 4U88A 4ZYAA 5FLVA 4OAZA 1USSA 1X4OA 4NC7A 3MYIA 4UNOA 4RM3A 2LF8A 1G59A 2CQQA 1VB5A 4YJWA 2R0QC 4OIQF 1UELB 4C3EA 3H5AA 1T8IA 2RSEB 4Q7CA 3TMOA 1QO0D 2BXYA 4CCOA 1LI5A 4C9YA 4GEHA 1C03A 3EUHC 3GFJA 4BQQA 2QGUA 1VQMI 5KVRA 4QI0A 4P5OA 2EPNA 1V55C 1OLTA 2LVSA 2Z15A 2QCOA 2OU6A 3QOPA 4N4NB 2Y75A 1WN0A 3Q0VA 1EH6A 3QPSA 1PVEA 4EM0B 4UB6C 3H0GJ 2LFDA 2ESNA 2D45A 1EJ9A 4O6NA 1TZLA 2IOQA 3V5XA 5BNGA 2XS8A 1ACIA 2NYXA 4YRVA 4L6RA 3O10A 3KZIC 3J80K 1VQ4I 1SANA 5EEGA 2DMTA 3L9FA 2KP6A 3WTWC 2ZXOA 2IP2A 3ERED 2Q7RA 2WTEA 3PNTA 4XBFA 2XRHA 1AA7A 1L0OC 3N0TA 2V1NA 4PCQA 4HFFB 5ILSA 1VLSA 2Q3TA 5D6FA 4B3XA 2ZC2A 3L0IA 5C4JJ 1E17A 3V8LA 2FGYA 4UVAA 4E4HA 5FLXK 3V7SA 2GAUA 1ST6A 4P9TA 3GTPJ 4I0AA 1QLEC 3QODA 4NBQA 3HNJA 2A5WA 2DMNA 1FBUA 1PD0A 1W2WA 2AQFA 4LERA 2XF7A 2IGKA 2Z3YA 3FM5A 3DP7A 3IH4A 3KEQA 1T9KA 1HW1A 5KNLA 2WADA 4XIDA 1D5YA 4CDVA 2XAFA 5FKMA 4A12A 4IEJA 2QTVA 2DK5A 4GGGA 1JKPC 3OS1A 1OYYA 2P6SA 2VPRA 2NOGA 5L0HA 2PG4A 4LG0B 4G94A 1WH5A 3EYIA 4EV0A 3TQNA 4P9UA 3A1YA 3S1RJ 1RRJA 5ILVA 4ONSA 3OYFA 3T5XA 2EILC 2XAHA 1J7KA 1AWCA 2ZBKA 4WGYA 3VF0A 2EWNA 1A7VA 2K27A 4II3A 4BJ1A 3MVPA 5D6EA 4W8PA 2JSCA 5K0IA 4KT5C 4FESA 4NQFA 2H6BA 3U9MA 3GXOA 3RSNA 2HFIA 2Q2EA 4PJJA 4J7YA 5L0JA 1VQLI 3F72A 1S6LA 4XONA 4QTRA 1R49A 4WK8F 4NCQA 3DKXA 4KT6A 2GLOA 3BTCA 4IHYA 1HXDA 4A3FJ 4M74A 1B1BA 2GXGA 2HR3A 1ZK8A 3KCCA 5L3DA 3Q7GA 3HGGA 4AM3A 2CV2A 5HLGA 3BG6A 4BEHB 3BG5A 5K5RA 1ETKA 3R4KA 4UV9A 2JMWA 2JQ7A 1ZHWA 2XLEA 1R4MB 3PNYA 3FHNA 2XXAB 1JTXA 3G1LA 3ITFA 4YL1A 1UJ8A 4BGDA 1L3PA 4E7SA 1A0BA 5KCMA 3AFHA 3I59B 4ER9A 1Y8QB 1PUFB 2RV8A 2VBZA 5KYYB 3GANA 4MLOA 3PO3J 2Z16A 4PR9A 1D1AA 2KISA 4JYKA 3A01B 2LDUA 2ZCWA 1RKCA 1FIAA 1D0ZA 5HSWA 2ZXIA 2XSDC 1ERDA 2L7MP 5FJ8J 1UB9A 3CUOA 3LSTA 2Q1ZB 5JLIA 1IRXA 4L9VA 2L01A 4EJUA 1FPQA 3F46A 4WXCA 2Y3HA 3U2MA 3DTKA 1KQ0A 2Z5UA 3O8GA 3O6XA 3BJOA 5GPCA 1H7IA 3RIPA 4CZZA 3S90A 2JJ7A 3C2BA 2ZXHA 1YOVB 1TNTA 2IA1A 3ZQQA 1IF1A 2ISYA 4HX4A 1ZR4A 5L3BA 1K6YA 1OQYA 3LESA 5CQGA 4U5HA 4M71A 1YJNI 5CJ9A 3B0UX 4XEVA 1IC8A 1MD0A 2V9VA 2XF6A 5HDKA 2LYCA 2VCAA 4I44A 1DU0A 3K2ZA 4A3EJ 2YWAA 2YX7A 3HOSA 3N2ZB 1TNSA 4HPQA 2XSEA 4ZYEA 2DFFA 2FUG2 2LSOA 2H1LA 3RKXA 3QPLA 2OCEA 3HTSB 2J9UA 4A3BJ 3A02A 5DTDA 4FAPB 2VN2A 4A3DJ 1YA7O 1YARO 4N9HA 2IYLD 6PAXA 4U7BA 3M8JA 1CQTA 2IAIA 3LOCA 1W0TA 1VMAA 2XUBA 3BJAA 3FIWA 1U89A 1VYKA 4BY1J 1WOLA 4GDFA 3LSJA 5L3GA 3QP6A 3RPUA 3CP8A 4GFBA 3EHNA 1RMVA 2C04A 4MVUA 4UUSA 1G6NA 3CCQI 5GP9A 3SQNA 1HA8A 2D1VA 4EJVA 3LAYA 3MFNA 1EH7A 4FCYA 1Z1DA 3M9AA 4W1UA 2EPLX 3SDBA 3IQCA 2E7XA 3PUBA 4G7HF 1ZAOA 2DFEA 1JUPA 3TDZC 4KNVA 2Y0SA 1FYKA 1UG7A 3NKEA 4R1HA 2QSHX 2DB4A 2DT6A 3LMMA 3Q7LA 1SAUA 4L5IA 3RJPA 4JOMA 1VZ0A 3RDIA 1ORKA 2E1CA 5ICGA 1R7JA 4RBOA 3LA2A 2V79A 4A0XA 3N24A 5J8FA 3T9OA 5JLXA 4JKVA 1JT6A 1Z7Qc 1ETQA 2DA6A 1XSDA 2HJMA 2XM0A 5IP9J 2VOOA 2KC3A 3LUTB 4EQQA 2K3FA 3EUHA 5TJJA 1JMWA 1K05A 1ZARA 3HKZN 1RR8C 1I5ZA 2QM3A 3WTXC 3JSZA 2DYRH 3CP2A 1NBBA 1Q0MA 1WSUA 2HZDA 4U5FE 4G78A 1Z3XA 2R5ZB 4FE4A 5BMZA 3AGUA 2ZNZA 5BOXA 4U5DE 3BR0A 4D9JA 2H7VC 2EPMX 2HUJA 1W5SA 3OYCA 2OJQA 3ZTZA 4LFUA 2B0LA 4Y3OA 1OCPA 5E79C 4BG0A 1LVAA 5IYBJ 1SAXA 1MBFA 4AIHA 1WFXA 5E3NA 3A0HC 2HKOA 3F8BA 3JRDA 1UZCA 2JD3A 2DXIA 2LSEA 2XSJC 2CYDA 1VQKI 3HHHA 3BR2A 4NHJA 2QBYB 2H8AA 2LR8A 3S28A 3CDIA 2HDCA 2CMPA 2FU4A 2G3KA 9ANTA 2A07F 2KMUA 5IY5H 4B44A 2EPFA 2DFIA 2L7ZA 4I99C 4XR6A 1AUEA 2XHKA 1N75A 3S17J 2A5YB 1Z05A 2M9HA 4I09A 2L6HA 3DTEA 2LTPA 1QVTA 2UXNA 3BPXA 3V7RA 2ETSA 3BCAA 3S8PA 5ILUA 5DCFA 2EJRA 1CGME 4MFEA 1J8YF 3GZNB 1LEAA 2JT1A 3AAFA 2V3CC 3EFOA 3GWNA 2HI3A 1HQCA 2DT7B 1RIOH 2BY1A 1MMGA 1KU3A 4IQ4A 4PJMA 4C30A 4BE1A 1IRGA 1U0BB 1LE8A 1PD1A 2NNNA 2OAZA 1OJLA 3TGNA 4U5BE 1X1CA 1S7AA 1W5TA 1T38A 2MH9A 1HOMA 3ZQGA 2DOFA 3IPMO 4RDAA 3LL7A 3KP2A 2ZSIB 3DEEA 3Q0UA 5IT9K 2F48A 4XOTA 4E7KA 2CV1A 3NYMA 3DWLE 2KPMA 1KU2A 1W7PA 3OYBA 1JAFA 5EYRA 5BPDA 3MLGA 4Q5SF 3OIPA 2FE3A 3ASNH 2LBFB 2DMPA 3T1BA 4EGZA 4CCLA 5E1XA 1BW6A 3JAMZ 3A9CA 4N6CA 4CUGA 4GXOA 2H7BA 3BDDA 1JKRC 2LY1A 4XICA 3J7AO 3MMYB 2GXAA 4AC0A 5CI8A 1WKMA 2DO7A 2X6WA 2HOTA 2FEZA 1V5FA 3D1NI 1A36A 3RKWA 2PX3A 1M1EB 3H36A 2XPVA 2OC6A 2HVRA 2O03A 1WQ2A 4MFDA 4A6DA 1K61A 2XROA 4RA2A 1I5NA 2NSGA 3GTMJ 3UGPA 3JT1A 3E5QA 2VXDA 3DU6A 3MWMA 5HS9A 2YLIA 1D0XA 5BQIA 3P9IA 1IN6A 1HE1A 2R4GA 1VQOI 2W00A 4LDRA 3MKWB 3KLNA 1ORSC 2A1DD 3G1MA 1ZW2A 3FXKA 2WVNA 1O3QA 4CDAA 1TWGJ 1OR3A 5B66C 2K9QA 5CIVA 1S5LC 2X0CA 3Q0WA 1F9NA 3ABMH 3GTQJ 3K7DA 2W57A 5CVVA 4XWJA 2BHYA 2DA5A 3MKYB 3Q6MA 4XLAA 4X6AJ 2OTJI 1ZHFA 4A5MA 2XV4S 3KZZA 4UB8C 3U21A 5HLIA 2ZPAA 4DRIB 3K4KA 1KZHA 1Q0KA 4JVSA 1RKEB 3UNGC 3MCZA 1SVMA 4BKXA 5K7ZA 5A6BD 1SFXA 4M6VA 2CGPA 4BQAA 3V5ZA 2P6TA 3AG2H 1VQ5I 5DS6A 1OISA 1R5GA 4BBRJ 5JVEA 1VNDA 4BHCA 4CCNA 2I15A 4I76A 3NMJA 2NAZA 3KEYA 4F55A 2F5FA 3TDUC 2LK4A 4Y13A 2F5EA 4E18A 4I0BA 2X51A 5DCMB 3ZQHA 2QQ9A 1T08B 4GO1A 5AIPA 1MIJA 4DRHB 3S93A 4Z6YA 3KEOA 2CU7A 4LG0A 2K7LA 2DOAA 2AVKA 5JT4A 3K70D 1R22A 2BV6A 3KMIA 1RKTA 5M5XJ 1Z23A 3CEXA 5EEAA 4OD4A 2GFHA 2BYVE 3VYUB 3V8JA 2K9SA 4RM2A 3ERMA 2FOKA 2CUEA 2PMZA 1ETXA 2CQNA 3LNRA 1ENHA 1D3YA 3W2VA 4O7GA 5EZGA 4HG2A 3SZPA 4OMZA 4JTDB 1TWCA 2ZO4A 3PIPF 4KIGA 2J8WA 4E7IA 2DN0A 2ZNYA 2UUZA 3MX3A 4RGRA 1S3JA 2EPKX 2IVMA 4BEHA 4RB3C 3SFZA 2JN6A 2XXAA 5KYWB 4RAFA 1ZU5A 3PNVA 4JC7A 2DAOA 2RQPA 3DFGA 5ICFA 3DD7A 2XL6A 2VKHA 3I59A 4JRZA 1PUFA 3GODA 3RVYA 3SZGA 3MN2A 5KYYA 3FMSA 4G8XA 1WH7A 3E6BA 2EIJH 5F0FA 1YW7A 2MD5A 3A01A 4LD5A 3SDGA 2CSOA 3R0AA 4CYDA 3T6GB 3ML6A 2GXBA 2ICWG 3N4MA 1E3OC 2E87A 1DDNA 1SYQA 2NS7A 4F7ZA 3BQZA 3US6A 4E7ZA 4UXNA 5EZHA 3I9V2 5EHHA 1Q1HA 1TC3C 2M30A 1E3HA 4M3GA 4LLCA 5AONA 1X2MA 3HPHA 1QU3A 4KI2A 3LLIA 3JRCA 4NTBA 3OR1C 4Z9IA 3PFIA 1NG6A 1SFUA 2M64A 2WZGA 4IF4A 3WGIA 1ORJA 2NSFA 4HRIA 1QBJA 3OIQA 3BT9A 2BGCA 2XL4A 1IUYA 1K83J 3IP4B 1TWHJ 2B0HA 2PF4E 1S72I 1IGNA 4JTAB 1G3WA 3CCJI 2ZMEB 1MH4A 5FKOA 4LB6B 3GUDA 2YL1A 2AWYA 4CJGA 2D1HA 1XTAA 3HZJA 3B29A 1W1WE 4XLCA 4CIHA 4I1OB 1Q1VA 2EINC 2XDVA 2GIZA 3CF2A 2K9LA 1J8MF 3E6CC 4BJ5C 3B73A 3K1IC 2ETHA 1WJBA 2GOMA 2WB1N 4HQMA 3ZQIA 4CCMA 2H8WA 1T01A 2D5RB 5AC5A 2V4JC 5GTHC 2HEOA 1CPQA 1RNLA 3R61A 2L9JA 3SXZA 4EATA 4JIOA 1YG2A 2E34A 2W48A 3ZXSA 3FZVA 4HBLA 4EJTA 3CAXA 5A2QK 3L1MA 2F5DA 2HVQA 1WVRA 1W5CC 4WF2A 4BQOA 3NWTA 4LOCA 3DF8A 2PJPA 1UHMA 3G2BA 4A2UA 3LSKA 2DYRC 2IW5A 3NKDA 5F5HA 3JRFA 3WAQA 1JJ6C 2NUPB 4U0VA 3S15J 3S1QJ 3FK6A 1JUMA 1Z63A 3CCLI 3DKYA 1TKNA 3OWTA 1BI0A 4LG3A 2A3SA 1IDZA 1LQ1A 4YFKF 4JBAA 3TJ6A 3L09A 3K1NA 1IN7A 5D8KB 1BI2A 4K0DA 1FX7A 1G3SA 1H88C 2ID3A 5LLQA 3RZDJ 3HDDA 4XRSA 3HHGA 4XQFA 4ZYGA 4TV7A 2JRTA 1Q0GA 3JTGA 5FFXA 4EJOA 5F28E 1KNYA 1UCRA 4E70A 1H6GA 1IXSB 3ZTMA 4CYCB 4KFCA 3OYKA 2VE9A 2R5ZA 3HRSA 3CMYA 1H89C 3DWWA 2HPIA 4Y4RA 3V42A 4A3JJ 1LEBA 4CDGA 2QLZA 3ZQVA 3JTHA 2ZFUA 2DGJA 1KQ8A 1G3YA 2LLKA 3CC7I 3FOPA 1ZU4A 2V1XA 1SMYF 2J5PA 5AIQA 2EA2A 4U0WA 5D5VB 3CLQA 1FWZA 2QSFX 3AJMA 3KKBA 2HYGD 5AGFA 2P81A 5B1BC 2R7ZJ 2QBYA 3F47A 4QLCU 3L2RA 2ZMEC 5L3VA 3LFKA 3M1CB 5COFA 1SD5A 1D0YA 2LMDA 1QNTA 3E5XA 3BQYA 4YWQA 2GM4A 1OW7A 2XKPA 4EVIA 3FAPB 1OCRH 3ASNC 2QWWA 1K04A 1MQVA 3CJQB 2WV0A 2W25A 5LEJA 3JRMO 4HNUA 1DOVA 1LNWA 1WI9A 1CF7B 2CQKA 1YAUO 2HXIA 3L00A 2DDBA 4XORA 3T8RA 2DQRA 1BN5A 5E3MA 1MZBA 3KYLA 1JGGA 4F52A 1FAPB 2EFOA 2QE9A 1BBHA 2AXLA 1X1AA 4XQ1A 4AVPA 5T1DB 4N9IA 4C2TA 3CCEI 1JHHA 2VONA 2ZKZA 4XN3A 2J45A 2HVSA 4D4NA 3DV8A 2M2EA 1R1TA 3WE2A 2ZXPA 3EHMA 2LF7A 1OPCA 1EA3A 3CZ6A 1T95A 2YVKA 5GAHJ 4KA4A 1FTSA 2QKMB 3RYPA 2HPMA 4CSAC 4AL1A 3QVYA 4XSZF 3ZMVA 2LBFA 2RNJA 2O61A 1VTMP 1BIAA 2G7UA 1U78A 5HOOA 3S16J 3ABMC 2WAQN 3BTJA 4BS9A 3OYEA 4OIRF 3VYRB 1VOMA 4XM3A 2M8EA 4QSHA 3GLLA 3NYLA 3S1NJ 2TMVP 1KYZA 4H0EA 1LPQA 4YIIA 3Q9VA 1LPEA 1WASA 2W4MA 1U8RA 3I3LA 5CVUA 5DD8A 1MMAA 4XMYA 2RKHA 2G0EA 4JJGA 3U8PA 3AKZA 2NRAC 4Z9JA 2M7AA 3EH1A 2ELJA 5IYDJ 2HFHA 2Y0MA 2HDWA 3FXUA 5GADJ 1SD6A 2VOPA 3NMKA 3QTHA 2IXOA 5HS8A 3CD6I 2KRHA 3VDXA 2EZKA 1CGOA 3CQZA 5A69A 1VYIA 3ESWB 2X85A 5L3EA 4C2UA 1ORYA 2STTA 1I27A 1F36A 1SD4A 1M57C 4YT5A 2DMUA 3AOUA 1MGTA 2PX9A 4CS7A 1P9QC 1HMOA 2XAQA 2XAJA 4UV8A 3REOA 1W0UA 1GLNA 1TR2A 2LIGA 2VC1A 4EGYA 4CX9A 5DYMA 4BY7J 2MLGA 4IQJA 5H20A 4MEXF 2FFHA 2YLGA 2IGOA 1R58A 1RKEA 2YLDA 2F2EA 1DGWY 3A4CA 3CJNA 4DW6A 4H54A 1D1BA 1MMDA 2HYFA 5A6KA 1B9NA 3M07A 4ABZA 5LD2C 2KYHA 2RGVA 3PCVA 1LDKB 3EPVA 3K4NA 3PJRA 3T6JA 3CCRI 1UHSA 1GVDA 5K1YA 1XDSA 3GCMA 2D4UA 2OEXA 3B0VC 3S2HJ 4U9EA 2GDCA 2IXPA 4BJ5A 3HSFA 2CGEA 5FRMA 3K1IA 4U5EE 5DCMA 2HOSA 3P5JA 3LEOA 1XGNA 2BW3A 3CESA 4M3EA 4BDZA 3GM2A 3QQAA 4XRMA 4ZZDA 2GOXB 5GPGB 2ZXJA 4JEBA 2IRFG 2M4EA 1MH3A 3HOTA 1FOYA 3U3BA 2LD6A 2FA5A 2HDDA 4MTGA 4H4KC 5KAIC 3C2HA 2C6YA 3U8VA 3G71I 4DVYP 2QENA 5KYUB 3M7GA 4LITA 1P4XA 2O5RA 4C3HJ 4OD5A 2EIJC 2VT3A 2Y31A 4RGSA 1K4TA 2FQ4A 3TD7A 2YSRA 3W6JB 2OUMA 3OYGA 2JVGA 2OJED 1HBXG 3D5SC 4PK4A 4A3MJ 2LFBA 2VUMJ 2NG1A 2JA5J 1FBQA 4RB0A 3S3OA 2R02A 4IARA 3QVZA 2KJCA 2QVOA 5LHHA 4MHGA 3LEVA 2LKXA 1XSXA 1YYVA 3IC7A 1ITYA 3IV5A 4IOCF 1YYXA 1MBKA 2VBYA 3DPLC 4BL0B 4KISA 1FTZA 1BI3A 2IGMA 3CLOA 3AGTA 4CJOA 4RDUA 1YX5A 4MTDA 5BUOA 2L2OA 2JA7J 5F64A 3I55I 1BM9A 3HSEA 1S7EA 2O9XA 2HSBA 3IAS2 2M1BA 1HMDA 5KAFC 4HLXA 2X1EA 1DQUA 5B1AH 2QUPA 4ON0A 3QW1A 4PGHA 2XIGA 2ME6A 2NNYA 3LAJA 1NU9C 3IEEA 3K66A 2E1NA 1XDUA 4IVNA 4IZZA 2E19A 4OINF 2O7OA 3ZPLA 5GAEJ 3WGHA 3RFYA 1ODDA 3F23A 2OOCA 4KN4X 3E97A 1QA6A 2D2WA 2IS2A 4Q47A 4EBKA 2I5UA 4NC3A 2A69F 2VI6A 4ZYDA 1KU9A 1BL0A 1BR1A 1E0EA 1TW2A 2ID6A 3VYSB 4ANJA 2HJ3A 1SFKA 1Z67A 3AG4H 3GLXA 5FCLA 3I56I 3R60A 1ZYRF 3TO6A 5FLMJ 1I4ZA 4A3KJ 1VQ8I 2Y3DA 4ENMA 2XAGA 4NTAA 1ZG3A 2ZMEA 3HOVJ 2VB6A 3MKZA 3JRTA 1J2XA 3F8CA 1BC8C 3B0PA 2L0KA 3EGDB 5FGMA 3D5RC 3RQFA 1P4AA 1A7EA 3DJNB 4A6EA 1JE8A 1KU7A 4LLGF 1QPUA 4FETA 2AWCA 3BJ6A 3KFWX 2DJNA 3KP7A 4YT4A 2LY2A 2PMHA 4C3BA 2W4SA 4M9SA 5DQZA 1XCBA 1ZKGA 1V3FA 1YJWI 2F4OB 4AIKA 4B48A 1B9MA 5L3FA 4P55A 2XKOA 5HNHA 4UY8I 4UVBA 2PFBA 3HOYJ 2B0JA 3X1OA 3N97A 3WHNA 1I4YA 2Y69H 5KYXB 2EFNA 2VT2A 3RH3A 3IWZA 3PHF2 3EDPA 4AK9A 2UZKA 2E2JJ 5HDGA 2Z99A 4QPQA 4Y7NJ 4L18B 5EEHA 3GFIA 3ABKC 1BC7C 2H6CA 1GGQA 2NPUA 3FF5A 4L5JA 4CH7A 1KYWA 2NUPA 2NUTB 3NG1A 4L9JA 1M2VA 3TULA 1DGRM 2YZSA 1YA9A 4ULVA 3F3XA 1I1SA 2W7NA 1A7DA 1FYLA 1R1UA 2OQRA 2XLOA 4YT2A 2ASRA 4CSAA 2MW8A 4P1WA 4FTHA 1BR4A 2P0WA 2VKDA 2K4JA 5FKLA 3QP5A 4MQ9F 3T8TA 2EV0A 4AD9A 2IM8A 2W45A 2DLLA 1VI0A 1RXQA 1AEPA 1MBGA 2ESHA 4DRJB 3R2PA 2XGCA 3HRUA 1Y1WJ 1JJ8C 5A6BA 2QQBA 4R79A 3W6VA 1O4XA 1OKRA 1X3ZB 2VJ4A 2W24A 5JVGF 1E83A 3L2WA 3K69A 4PJNA 3SJMA 1NLXA 1U5TB 2JTVA 3C8GD 2YL0A 3J7YJ 1YS7A 3RQEA 3HL2A 1LS4A 2LC2A 3DXJF 2CUZA 4E7HA 3NMIA 3EQLF 3U9GA 4CYCA 1YRNB 4Y17A 4KMFA 4C2MJ 1GV5A 4G9YA 4D0PA 3H35A 1S8NA 3H9GA 3V8KA 1OCRC 4BH9A 4A4AA 2DFHA 2CRGA 4F93B 2Y9YA 3CO7C 3RKQA 3I53A 3RYRA 1HKQA 3IKVA 4ZDOA 2MYSA 2XGDA 3B6CA 4G7ZF 1EI7A 3JCUQ 1VQNI 3E5UA 1F4KA 5EGOB 1TQMA 1H9TA 3LSHA 1JGSA 1I50J 3P9KA 4BHBA 1Z7LA 3OL3A 2Y3BA 4YL0A 1IW7F 2NVXJ 1IUFA 1YW8A 5IP7J 1ZRFA 4EIYA 3GVAA 1MW7A 4P6IC 4WJ0A 1FBSA 2CQXA 3M1CA 2EINH 4QWQA 2CDQA 3OYDA 4XNFA 3FHDA 4X1EA 1WTYA 4NDLA 3J81Z 2P5LC 2RVCA 4AIDA 4JX6A 3BCBA 4LMYA 4EWCA 1QVUA 5D4RA 1ZRCA 2WB7A 3GMEA 5IT9Z 3GYHX 2HMZA 2WZLA 3LLKA 1XMAA 4A3IJ 4NTFA 1CF7A 3MEXA 5D5XB 3S0XA 4F91B 4XOPA 3HOZJ 4HNVA 2YKZA 1MMNA 3U0CA 3L1PA 1HE9A 2IBFA 3QW0A 4NC6A 3COAC 3WODF 2L9VA 1SF8A 3ATPA 1K7AA 4BBSJ 2K3PA 3ABUA 3QYEA 5CI9A 1WGXA 5FKKA 5EDNA 1U3EM 1R71A 1IV6A 1U0JA 4HZFA 2YQYA 2RN7A 4J19A 2C03A 4G6TB 4U5GA 2LCHA 2V6EA 3GEIA 1UFMA 4HEA2 1QRYA 5F1JA 3M4CA 3LSRA 3S3NA 4AUXA 1ZRDA 1RJ9B 2HQAA 3A2KA 4HF2A 3EG9B 3G4SI 3SXYA 2PMUA 1LM3B 4IAOA 4IHXA 2RNGA 1USTA 3TQOA 3H92A 1DUXC 3NRHA 1R1VA 2GAQA 2WY7Q 2I8BA 4BXUA 4FASD 4HV6A 3FOOA 4J32B 4CO8A 1JPJA 1XWJA 2J9WA 2HSQA 3DJUB 1U5TC 3MQ0A 2YRFA 4MNUA 1MBEA 2JK3A 3SFIA 3NEUA 1T56A 1XGOA 2DYSH 3RVZA 4C7OB 3RF3A 1QZYA 1IN5A 3KIOA 2WV1A 5T3WA 1WJCA 1YI2I 4BXFA 1TL8A 2BHZA 3OOPA 4U9DA 5A6JA 4YG2F 3IAM2 4KUMA 4RB2C 3BZ6A 3GM3A 3CC2I 1IAWA 3BR3A 3LNQA 2VPLA 5E3CA 2CFXA 1E2XA 2P8TA 2R7WA 4N4WA 5B1BH 3CCSI 1FOKA 3V7CA 4HFKB 3PL8A 1M6TA 3JZ0A 1HKTA 5LHGA 3I58A 4ESBA 4KIFA 1SD7A 5KHDA 5E18F 1MMSA 3DAFA 3FHZA 3VODA 4XKWA 3F8FA 2A05A 1QPIA 3C18A 2Q0OA 1R23A 1XMKA 4CS8C 4ASNA 4I2OA 3JYHA 2KFDA 1XGSA 2PX0A 1Z6TA 2JX0A 1YX3A 1WJ5A 3GF2A 4S05A 1JTYA 2JPCA 2FRHA 2JUCA 3BPVA 4WABA 2YU3A 5IOYA 1VK5A 3HOXJ 3C8GB 3DPUA 1RI7A 2BBYA 4M6YA 5DLJA 2M4GA 3P7NA 3T4RA 3BZKA 3QAHA 4DQ2A 5KYUA 1BOAA 3GBGA 3TBIA 3O39A 3W8IA 3Q3SA 5B1AC 2R7UA 3OS2A 5J4VA 3R6SA 1OYWA 1CGNA 4A69C 1G8XA 5DVWA 3TW6A 1LI7A 1MNMC 1Z77A 2JA6J 3E70C 3KP5A 1C02A 3K4LA 1D1CA 2X0LA 2XS1A 1BIBA 3L2CA 4AE4B 5BS6A 2EIKH 5A6AA 4IRHA 1K40A 5GTIC 1B8IB 1YTYA 1MSEC 3BTIA 3UKGA 1JXSA 1TQIA 1ON2A 4IHSA 2FBHA 4U7DA 5CLSA 5TJ5E 3K4JA 3T0YA 3RKOF 3TO7A 2Q4FA 3AG4C 1F1ZA 3ZDLA 4BE2A 2R7SA 3HOUJ 3GZ6A 2P1AA 3IH3A 4YIFA 4KITB 5FO5A 4XLEA 4OU0A 3LWFA 3DM9B 3G1OA 1BI1A 3CF5F 2NVUB 2DTZA 1UMQA 4Y33A 5H6RA 2CNWD 3G4ZA 3KX2A 1MJ9A 1T6SA 2VJIA 2LREA 2X6YA 3N05A 2OTLI 1GVJA 4RLFA 2LP4A 2VL8A 2R7QA 1IJWC 1O3SA 2WZFA 4OMYA 3JRBA 2CQ7A 2DCEA 2R25A 3NDBB 4W8KA 2DA3A 3OSGA 2LG4A 2MABA 3IHUA 1O87A 2IA2A 3DBLB 3E1SA 4BEMJ 2Y69C 4W97A 2QLAA 1FJLA 3SEQA 1OKKD 1Z3YA 3KZYA 3K1MA 4MTEA 4KDPA 2OG2A 1QPMA 2R7FA 4ENJA 4XSXF 3H3VK 4IB4A 1X2NA 3PFYA 2JWTA 3EGDA 3WU1B 1F43A 2AQEA 1D5VA 2CCYA 1TFOB 3WG7C 3CJRB 5J1RA 4L0YB 2KQ9A 2MGQA 5FD5A 4ZDLA 2OCCC 4IJJA 4AYBN 5HNFA 1QQIA 4G6QA 3TOMA 3QPTA 2AP3A 2ZXWC 3HB9A 1BJAA 1S29A 2ECCA 4YN0B 4DNCA 3H0DA 3H2VA 2QUFA 3O8HA 5IP6A 2VH3A 1ULYA 2M34A 1EKEA 3DZAA 3DEWA 2J5OA 4I02A 1O3UA 3JAMK 5KYXA 3VAYA 2XGEA 1T6IA 1IN4A 5D4SA 4M63A 1PP8F 3VYTB 3X2QC 1OXBA 4IXAA 1FNNA 2QNLA 2FOWA 3U9JA 2W85A 3GEHA 1Y0NA 3FKIJ 2LRDA 4LK1F 3E9VA 2E71A 3OYHA 2NS8A 2NUTA 3K4BA 2IBDA 3EUAA 4XRSG 2NVQJ 2HQNA 3OL4A 5FFZA 2VLAA 5M5YJ 1TQPA 3LS1A 1HW5A 1Q0DA 1GXQA 3PSFA 4PACA 2KRCA 4BHPA 2K85A 3IRRA 2DW4A 2L9SA 4K7BA 2O9LA 1YLMA 2DA2A 3K6GA 4IHTA 1G5ZA 2ZSHB 1R9TJ 2KGOA 1C0WA 1HC8A 1LDJA 1Y6IA 2KK1A 4J00A 3U5SA 5JRAA 2DPDA 2OU2A 1RC9A 4ENKA 4DYRA 4CZCA 1U5TA 3RW0A 5JHUA 1B6AA 1K78B 1LUJB 3HPGA 3E6MA 4XL9A 5E20A 4HQEA 5E8IA 1TWFJ 1RUNA 1FFTC 2KZVA 2P5KA 1FEXA 3DAGA 3ZQYA 3EPZA 3S9OA 1B72B 3T6BA 5BQHA 2ISZA 1N77A 1YLFA 1YRNA 4KIBA 2HYJA 3LJBA 3TK0A 3FXHA 3DI5A 2K86A 1N78A 2OKUA 1XMXA 2XPWA 2EV5A 3W3CA 1APLC 3H65A 4ETSA 4DOZA 4MVSA 3OIOA 1RCPA 3TL4X 4M73A 4O3MA 3RKYA 3IQTA 4C3DA 3CDLA 3H9JA 3IWFA 3AG1H 2L5QA 2RREA 5EGOA 4F92B 3I4NJ 3UGOA 2BY0A 3VSLA 2FMLA 2HOEA 2VBXA 3GWZA 3GTOJ 3QZCA 4S0HB 3B71A 1YIOA 2FXAA 1NG7A 5LRRA 1VTNC 2MHRA 1X4PA 1CPRA 1WHUA 3GM1A 2JA8J 5F08A 1A6IA 4CICA 3R0JA 2PEXA 3DEUA 1UFBA 4A5NA 3S27A 2KIQA 2KHMA 1RESA 4GCVA 1FOWA 2YX4A 1ZREA 3EJNA 2OD5A 3C1DA 4CS8A 3OYJA 1LFPA 4KC9A 2LFFA 1WCMJ 1TWCJ 2XB5A 3ZN0A 2E1MB 1WJEA 1K4SA 1Z9CA 3ZG1A 1OXKA 2RQQA 1FMWA 1FLIA 2F5CA 1XSVA 3ZMDA 1IRZA 5JVTA 4N06A 4UDVA 2OPTA 4RLQA 3ZMZA 2P7CB 3LA3A 1TW3A 1TLHB 3OS0A 5J1UA 1AOYA 2GQQA 3ABKH 4BE0A 1HW2A 1VLTA 2PQ8A 5L0GA 1BZ4A 1H9GA 3MZYA 2DYSC 2Q9CA 3BG9A 1Z6AA 3G73A 1OR7C 3DM5A 3LAPA 1YJGA 1MNEA 1RKWA 3NARA 1IZMA 4BEJA 1RPWA 1SFEA 3W6KB 2XL8A 1RJ9A 5HS7A 4MTOA 5DQTA 4J01A 1P7IA 2H27A 4YELA 3HEFA 1XZPA 3J06A 2CW7A 1BJZA 3ECHA 1G2HA 2IS1A 4NQWB 4PUSA 4MQVA 3LSGA 4JCHA 4O79A 5JHFA 1VFCA 2A6EF 1L7CA 5K5OA 3LNMB 2KQRA 2VC0A 2CG4A 3VPRA 1DP3A 2VCBA 3R7CA 3K1PA 2LNBA 5CVRA 1RZ4A 3ZMUA 3JRIA 3RI4A 2O8KA 5HLHA 2N8GA 3NAUA 1X1DA 3ABLC 5EG0B 3HTUA 1VQ9I 3E6DA 2R9RB 2IXMA 5B3SC 5LGNA 2ZXRA 2HS5A 4C7OA 3BP8A 2Y39A 2HTJA 2L4MA 1ZHTA 2YL7A 3SYTA 2V7FA 2CJJA 1YHQI 3F21A 2DU9A 3A0BC 3PSIA 4O6MA 4XLPF 5C44J 2L7FP 1XN7A 4ULWA 2CW0F 3HJCA 2P4WA 3FMRA 1YYJA 1X1BA 1O3RA 2XLDA 4EM2A 2F6CA 1FYMA 3H5RA 2J9BA 3EZIA 3VB2A 1J0RA 4A93J 3WTVC 5E2QA 2EB7A 5EK0A 1Q0FA 1L3LA 3HNIA 3RQGA 4F4BA 2L4AA 1FR0A 2K5CA 4P96A 3M1EA 4R8HA 2CH0A 2KRFA 5M3MJ 1HLVA 2Q9AA 3CUQB 3F0CA 3D0SA 5E1ZB 1SVLA 4ESJA 5TRDA 2R92J 2MC3A 1C17M 3KL4A 4D5CA 4RMNA 3V7OA 5FKNA 2LD5A 5HV9A 3J7ZI 1QVXA 3CMAI 2QF7A 3S14J 2OV7A 3I5QA 2JA2A 4IX7A 3HRMA 3EUKL 4I6ZA 4I3MA 4EUKB 4KNWA 2EIKC 4HSRA 3LQQA 2M0CA 1IO2A 4CHUA 3LSMA 3TKYA 4O6JA 5J47A 2E1MC 3BLYA 3J80Z 4D4XA 4DIQA 3ZMTA 2ZD9A 2WL8A 1ZTRA 3C8GA 4CCJA 2Z9OA 2Z1DA 3ZQ7A 2ECBA 5D5WB 3G6EI 3H3ZA 5E3OA 2DA1A 2L81A 1ZR2A 2R3SA 5FD6A 1R4TA 1LDDA 4UUTA 5GPAA 5KYNA 5LFAA 1ZN2A 1OCOH 4Y15A 3CCVI 4V19K 3ZOBA 1IXRC 5FLXZ 2R7VA 2JRMA 2JZYA 5CPRB 2M5WA 1WPKA 1E3PA 1POGA 3KE2A 5LRSA 1YQAA 1BBYA 4DBQA 3U3FA 2E2IJ 3CCMI 3I0TA 4AE4A 1R6RA 4EJWA 5DUIA 4XLFA 2COBA 3GTJJ 1CGPA 4Q48A 2E60A 3PM1A 2E35A 5BQTA 4GYIA 1B8IA 2XLVA 2OQMA 3PUFA 1APCA 1HSTA 4UHTA 2O6GE 4M3BA 2XPUA 3QRFF 3MZ8A 4NUBA 2GA0A 4CA0A 3EYYA 2A6HF 2GWWA 4AL0A 3ZQCA 1SZIA 4KICA 4QI2A 3G3ZA 2QSGX 1X3WB 3BR6A 3NYJA 2KLOA 5CVIA 5JUAA 2CWEA 2VE8A 2VKVA 3CCYA 2WAEA 1GHCA 2A61A 2GWRA 3L2QA 2KSFA 1YS6A 2L7KA 4B47A 1XGMA 3FISA 4L9NA 3DLLF 1P6RA 4ZC3A 1U8BA 1JRAA 2L02A 2J0XA 3AG3H 2OEVA 3L8JA 2HV7A 2R7DA 3FAJA 3C2GA 1O5HA 2E7WA 3SEZA 5TGTA 2XF5A 3U2LA 3F9KA 3RQIA 1HDDC 2V6CA 4MW3A 2EV6A 1TWAA 2ME0A 4MW8A 1FFHA 4HX8A 4U87A 1EV7A 4IJAA 1ZHYA 2YEVA 1YFHA 2HGCA 2V1DA 4B43A 3WU2C 4U5CE 2BEOA 2FF4A 1I1GA 3CUQC 4PSXA 2AU5A 2XASA 5D92A 1JKOC 1ON1A 2HNHA 4ZYHA 2AXTC 4BPMA 3AL0B 256BA 3WTZA 5E3AA 3BOQA 1GS9A 3FKJA 1G4DA 4WCGA 3O3KA 5JI6A 2Y0SN 2JSPA 3ULQB 2ZJ2A 2DJIA 1A35A 3SXMA 3FXLA 4X0GA 1TT5B 2FBKA 3EETA 5KYWA 3ZP5A 1ZH5A 4BJ6C 3ABTA 2R05A 4HEAJ 4Y52J 4PDKA 5HVQC 1XX5A 2J9VA 5DS9A 2PNOA 5K5QA 3HKKA 3KPHA 3QWLA 3QMKA 3RZOJ 3DU5A 1FOXA 4CSWA 2BY2A 4RAYA 3C8ZA 1QGPA 3K4MA 2CUFA 3IQ6A 1FIPA 1Z0XA 3HJEA 4YL3A 2XLWA 2QA4I 4MO7A 2O0YA 2VKEA 3KP3A 1OR7A 2DA4A 5CYVA 3GTLJ 1Y6DA 2LK2A 1WGWA 1UAAA 3BR5A 1GQAA 1ZHXA 1H8AC 2K9MA 1NZEA 2R93J 1U9OA 2LP0A 3WE3A 4WX9A 4HAMA 3GZ5A 3KP4A 4BU2A 1HSJA 2TRTA 3WHCA 1NH3A 2VBWA 2FAPB 4XKBA 3I54A 3MFKA 1NK3P 3CQZJ 3OSFA 2CS3A 3ASOC 3JR9A 1LE2A 3W8HA 3AG1C 3HXLA 1VQPI 5IT3A 2DI3A 2GA2A 1ZGJA 2DOEA 4BAYA 1MDMB 1AHDP 4DXWA 3WHBA 2I8DA 4MS2A 3IUOA 4JX5A 1K78A 5J4YA 1D8JA 4WXHA 1OR2A 3C63A 3VM6A 1R36A 2PJRB 4HE8D 2GZWA 3S2DJ 3S84A 4XTKA 2ZJQF 3FXJA 1B72A 4R32A 3EGXB 1WJAA 2MH2A 2W1OA 1MKMA 1P4WA 3ZR8X 2MG4A 5GAGJ 1U6HA 4IRGA 2X9DA 1FSHA 3K1HA 4QPOA 3O55A 4BDYA 1A5JA 3QYBA 4LLNA 2OZUA 3I4UA 3PDMP 4ITVA 2L6FA 4A3CJ 4XEFA 3MAJA 3FXQA 1M2OA 1OCZC 4KBLA 3JRGA 3EZHA 4ZZLA 1OW8A 2M3AA 2BVMA 2XLMA 4MVZA 4IHWA 4GYGA 1NHAA 1ETVA 1XC5A 3JCUC 1Y39A 3I5PA 2P7VB 1W4MA 4G12A 1RR7A 3C62A 2H8RA 2WAQA 4B09A 4LIVA 1TWAJ 1X58A 2P0NA 1LVKA 1ZGAA 2MWQA 3AL0C 1P2FA 3WG7H 1TFKB 4I98B 3KH2A 2OCCH 4WGZA 3HUGB 4DZJA 1REPC 3JSEO 3BROA 4KMUX 2BY3A 5CKTA 4O6YA 2R5YB 1B68A 2ZXWH 2IPQX 4HSTA 4LK0F 2TDXA 2DA7A 1K6OA 1ZGWA 2DPUA 1DOWA 3RYLA 1FZPB 3CMMA 3HBLA 1QSPA 1T0FC 2DQLA 2LKSA 2XGXA 1EQ1A 1FSEA 1JR8A 4IRUA 4NB5A 3X2QH 1N1CA 1OCCC 2M7BA 3L7WA 1PP7U 3GFLA 2J0WA 3I64A 1W36D 3DPTA 2CNWA 3ZMSA 4UUVA 2OQGA 2ZB9A 3OR2C 1YZAA 5EF6A 3CC4I 2HMQA 2EA4A 3VSKA 1Y56A 2V9PA 3I71A 2YPRA 4QDLA 3RCOA 5DDGA 4LDQA 4D7MA 1ZG5A 3ZVRA 3O6BB 4D5FA 1JUSA 2LH9A 1VQ6I 2X1DA 3QPHA 4M3FA 3H1CA 2HWVA 5J6XA 2XRLA 3Q6NA 2H7OA 2KW3C 2L9RA 1DPRA 1K79A 1OKKA 4NQWA 1QZZA 4EM1A 2ZFWA 2Q00A 3ZGKA 2EQRA 4DVZA 3SNHA 4MVOA 3ZN1A 1TP4A 1R5ID 2BZTA 3IL2A 1TQGA 1XD7A 1ETWA 4FISA 2EH3A 5EG0A 4AWXB 1WRJA 2OZ6A 5DEQA 3GO5A 5JSLA 4F3QA 1E84A 2OA4A 1YO5C 1GXPA 3QU6A 1YJ9I 3LFUA 2B63J 3GEEA 2MLKA 4P9FA 2G62A 4YT8A 3S2WA 3JSOA 5EJCA 3V5YA 3OEOA 1B4AA 2DT5A 2WAFA 2VQGA 3FBIB 3HGYA 4CCKA 1ZLKA 1KA8A 4RGUA 3ZQFA 3OV8A 3B02A 2KT0A 3H2UA 3LS0A 2JPUA 2XB0X 3QYFA 4L0ZB 1LE4A 1ZW3A 5DS4A 1E85A 5LGUA 1WZ2A 3CO6C 4B1RA 3ROUA 3ECSA 2J7PD 3DTIA 3IRQA 1FT9A 4PFPA 3RTRA 4BQNA 5L3QA 3E7LA 1OMIA 3MD2A 3D5LA 5CVJA 4JTCB 1OCOC 2WVQA 4XN0A 1KTMA 1X3UA 5COGA 3CUQA 4A3LJ 4I7HA 5D91A 1WWPA 4YEJA 2VCCA 4XLNF 2PMZN 3I5UA 1DU6A 2X4HA 4NNJA 1AKHB 1VQ7I 4LDKA 3TP3A 4ZDPA 3FDQA 3U1KA 1U2WA 4X0RA 1SEUA 3KLOA 4BXXJ 1LS1A 3PQKA 2QKLB 2K40A 3CJTB 3GFMA 3SXKA 3VFZA 2STWA 3OYLA 2BE5F 3FXMA 3M15A 4ZJZA 4JZAA 4A0ZA 4B4CA 1NFOA 1MBHA 3UMHA 2WBMA 4BJ6A 2VQLA 4CS9C 2A68F 2R7OA 3NQOA 1TWGA 3K6BA 4GQHA 3P9CA 4PGGA 3S3MA 1V54H 4FX5A 2MC4A 2EFPA 1IRFA 4E0HA 5LBQA 2XC7A 2ZJPF 2ZJRF 2YR2A 4E7LA 2VODA 1ZG1A 3FX3A 1BOBA 2CW8A 1BR2A 3K10A 1V5GA 3RIRA 4D1QA 4O5VA 3ZQLA 4A3GJ 2IA0A 1V74B 3HTKC 2HOAA 2IT0A 4J7TA 1EF4A 3Q5FA 2JVHA 3U2RA 1UG0A 2DODA 4LJZF 4HDVA 2L6GA 4DJ9A 2JPBA 2PLYA 2LQGA 3KP6A 1S7OA 3AG3C 5D5UB 2VQHA 3IQ5A 4QIWN 5KK1A 2G3VA 3L34A 4B3AA 1R00A 1KONA 4ENNA 2R7XA 3KETA 1Z6RA 2FQ3A 4XPXA 2HQ5A 3CTAA 4FT8A 4FE7A 4DJAA 1ZLJA 5JLWA 4Z2YA 1IN8A 4E0IA 1QHHD 3ABLH 2RD9A 4BYYA 4JQFA 3RPQA 5B3SH 3JRAA 2VC9A 1UHWA 1SFOJ 1GM5A 4PJ0C 1UG2A 5FZTA 3K7AJ 4ZLDA 1XB4A 2IXSA 2KJGA
chains in the Genus database with same CATH topology
3KPHA 2ICWG 2OJED 1R5ID
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KPH A;  2ICW G;  2OJE D;  1R5I D; 
#chains in the Genus database with same CATH topology
 2L9N A;  2BVL A;  1V4R A;  4EBB A;  3ZCO A;  5J40 A;  4BAC A;  5ICC A;  4OAY A;  5L3C A;  2EZH A;  1T5O A;  2MSY A;  3MBG A;  4D7N A;  2FBI A;  2J46 A;  3CDH A;  2Q9B A;  4EHP A;  1PV3 A;  2PI0 A;  4ZTJ A;  1OW6 A;  3PMR A;  1GUU A;  3F8M A;  3J81 K;  2DK8 A;  3QU3 A;  1XPX A;  2EZL A;  3HYI A;  1XG1 A;  4YIR X;  1I6H J;  1BW5 A;  2ACJ A;  1S7Z A;  2W4B A;  3G50 A;  4JP0 A;  3HNL A;  4RS8 A;  5JS5 A;  1BDJ B;  5J3L A;  4GYT A;  2X1C A;  4IWB A;  3JW4 A;  4AX2 A;  2AS5 F;  2OBP A;  3SZT A;  1H0M A;  4XRF A;  3HM5 A;  4AU7 A;  3FVY A;  1J9I A;  4PZJ A;  3ONQ A;  4YFN F;  4LIU A;  1Z7U A;  4RGX A;  3M3Y J;  3QOE A;  2O8X A;  4M72 A;  1NSG B;  1Y8R B;  5T3T A;  1XCV A;  3KYD B;  2ADU A;  3M8F A;  1KGS A;  3F22 A;  2IXN A;  5H2F C;  3TW7 A;  3KYJ A;  2E2H J;  2NOJ B;  3OYI A;  1ETO A;  2KL4 A;  2BXZ A;  5F1R A;  4C3I J;  1S05 A;  1T0F A;  3HOW J;  1AVO B;  3JSP A;  4IO9 F;  4AVZ A;  5E1W A;  1U6G A;  2WA0 A;  1LKX A;  3ZSU A;  5F5F A;  5HDN A;  3WU0 A;  3HSR A;  4RBN A;  1NFN A;  4II2 A;  3JRE A;  4L5E A;  3ISP A;  3HRT A;  2M87 A;  5J1Y A;  2EK5 A;  1TWH A;  3UMK A;  4XKV A;  1FC3 A;  3ZIB A;  4HYE A;  1ZZP A;  4K1O A;  4EKW A;  4HF0 A;  3DBR B;  4J30 B;  2H94 A;  2BL2 A;  2GIV A;  1G3T A;  1EKY A;  2DMQ A;  1T33 A;  2KIF A;  1J5Y A;  4G7O F;  3OY9 A;  1Y0U A;  1FTT A;  3WG9 A;  2CFO A;  2COM A;  2FMY A;  5FRN A;  5DM7 F;  3SZR A;  2VQC A;  4C3J J;  4IHV A;  3C7J A;  2CUJ A;  4K2E A;  3JRH A;  3GWL A;  3ZC4 A;  1MDM A;  5ED4 A;  2WWY A;  2PFD A;  1TBX A;  3U1D A;  2MBF A;  2F4M B;  2HKX A;  3HG9 A;  2Y30 A;  2R7T A;  1ZHZ A;  3GW2 A;  5A2Q Z;  2BW3 B;  2IJL A;  5F04 A;  1WJD A;  2PJR A;  4HF1 A;  2HKV A;  3HNK A;  4JUR I;  3FXR A;  3W2A A;  3HKZ A;  1IV8 A;  1LB2 A;  1WAT A;  2L7A A;  2YL3 A;  3EGX A;  4JCZ A;  4V2F A;  3SP1 A;  2MA3 A;  5JFR A;  5HOD A;  4I1M A;  1T6U A;  2EFW A;  2M8G X;  2CO5 A;  2IEK A;  3FK7 A;  2XM4 A;  2LOO A;  4HA8 A;  1LJ9 A;  2X6O A;  2VJ5 A;  4Z9H A;  1O7L A;  3RPU D;  2EIM H;  2XAU A;  5CQE A;  3UR3 C;  3JTL O;  4A2N B;  1Y1V J;  1W36 C;  4FX4 A;  1MBJ A;  2FX0 A;  3FBN B;  1YE9 A;  3FWE A;  4BUP A;  5ICE A;  2KJB A;  1SC7 A;  4G0H A;  1RUO A;  3FXO A;  3J7A Y;  2GBY A;  1I3A A;  2P7V A;  3NWS A;  5F0C A;  2FD5 A;  2HTS A;  1YVI A;  4XLH A;  1FP2 A;  4EMS A;  4MTF A;  4DBR A;  3CCU I;  4OIO F;  2HU9 A;  2RAE A;  1WJF A;  3K2A A;  1DP7 P;  3OYM A;  3BEH A;  3UMI A;  3G4X A;  2HXO A;  2AO9 A;  1SR2 A;  2VJJ A;  3HUG A;  1QQ3 A;  4LGW A;  1I39 A;  2R5Y A;  3KYC B;  4M3D A;  3DCF A;  1YIJ I;  2XRN A;  2H09 A;  2E5Z A;  3OMY A;  2R7R A;  4CGZ A;  1V55 H;  3LSI A;  4CIP A;  1YZC A;  1G4U S;  3HC7 A;  4OWR B;  2EPO A;  4FHT A;  3ZRG A;  1A04 A;  2PN6 A;  1JHF A;  4CS9 A;  4JJF A;  4MND A;  3LSP A;  3IH2 A;  1MND A;  1QZE A;  4MIM A;  1T2K A;  4YK5 A;  2FSW A;  5E8G A;  2A0U A;  3MZH A;  3SHF A;  3W2W A;  3M8E A;  3DKA A;  2HZT A;  2KZG A;  5TIS C;  2UV1 A;  1OYI A;  3BRJ A;  4V2G A;  2PBI A;  1ONV A;  1X1P A;  3B9Q A;  5LGT A;  4XEK A;  4G6D A;  2UWM A;  3WGG A;  4NY3 A;  2FNA A;  2QZ8 A;  3NRV A;  3H3U A;  4KNY A;  4N0B A;  3F6O A;  4OIP F;  4IPA A;  4WXD A;  1X19 A;  1DPU A;  3CME I;  4E17 A;  1Z91 A;  3TED A;  2X48 A;  4HW0 A;  4MEY F;  2RC4 A;  1TTY A;  2NVT J;  1A31 A;  3FDY A;  3M4O J;  2B9S A;  5ERI A;  2Q2E B;  3ASO H;  4XPW A;  3VOE A;  5FRO A;  1O3T A;  1F1M A;  3GOR A;  4HLY A;  3TP0 A;  3AQB A;  5IOZ A;  2WY8 Q;  2UUI A;  2EZI A;  3DBH B;  2AHQ A;  4NC8 A;  1NTC A;  1PYV A;  1A6Q A;  2R03 A;  1P92 A;  4S04 A;  3K9T A;  1MSF C;  3PQJ A;  1GT0 C;  2A6T A;  1Z3I X;  1M56 C;  4HDU A;  3KYI A;  2EIL H;  3V4G A;  1IXC A;  2PP4 A;  2E5N A;  4Q4Z F;  4PFO A;  4LB5 A;  5DM6 F;  4A0Y A;  4B6I A;  3ECO A;  4ZTF A;  4RD9 A;  3H5N A;  4CXF A;  1PUE E;  1OCZ H;  2Y9Z A;  3O2P E;  5COM A;  1QHG A;  3TOL A;  2F5V A;  3BY6 A;  4N6H A;  3GTK J;  2I10 A;  2QEX I;  1LIH A;  5BQG A;  5L0I A;  2GA1 A;  3DQV C;  3GX4 X;  1V54 C;  2W84 A;  1M2V B;  3BG3 A;  4WWC A;  2WC2 A;  5E17 F;  5HLT A;  2W9Y A;  2V26 A;  4M9X A;  2HQR A;  2MFZ A;  2CYY A;  4M9Z A;  2UUH A;  2QQ8 A;  1HKS A;  1W7P D;  3E3V A;  2L3D A;  1O57 A;  3LA7 A;  4DYC A;  5AC4 A;  4DZP A;  1JPN A;  1PDN C;  2OF7 A;  1Z5Z A;  1AKH A;  3M79 A;  4JEA A;  3GEZ A;  5L0C A;  5C4X J;  2Z2S B;  3BZC A;  5E3L A;  1MJB A;  4HNT A;  1FY7 A;  4PSW A;  4CDY A;  2KKO A;  3S1M J;  3JYY A;  3EG9 A;  4M6X A;  2M4K A;  4JK1 X;  5M3F J;  4MVR A;  3BR1 A;  5F0H A;  2BOL A;  3BC8 A;  3K0L A;  3IKT A;  5IYC J;  3WTU C;  3C3W A;  3PIO F;  5DV5 A;  5IY5 C;  2RDP A;  1RET A;  4DYQ A;  2D5V A;  4HX7 A;  4JW1 A;  1OQC A;  1OCC H;  4L9T A;  5B5E C;  1B59 A;  2KDO A;  2PBE A;  4N4O B;  3LQR A;  3VEP A;  3ZWI A;  1HY5 A;  1ETY A;  1V4A A;  3FM3 A;  2HZ8 A;  2M0M A;  2ELH A;  3FMQ A;  3Q9S A;  1D8K A;  3ELK A;  2BC5 A;  1AU7 A;  2CV0 A;  4BJT A;  1F5T A;  2KDZ A;  1YW9 A;  2F22 A;  1SMT A;  3MKL A;  2QQA A;  2HV6 A;  3TOB A;  2M45 A;  4UUS B;  1KQ9 A;  2IS6 A;  5K7H A;  2DDA A;  1QZX A;  1XZQ A;  3L8I A;  2VXZ A;  4UVC A;  1ZQ3 P;  3EH2 A;  2MD0 A;  1NG1 A;  1YDI A;  4LLE A;  1PCX A;  5L0F A;  1MJA A;  4DGW B;  4HV5 A;  3S29 A;  2FJ1 A;  2Y2Z A;  2Q8K A;  1WI3 A;  3OYN A;  4AYB A;  1I6X A;  4EBJ A;  1PJR A;  5DUK A;  5H6Q A;  5K7F A;  3RQ4 A;  3WTT C;  5F27 A;  4E7J A;  3PO2 J;  2VAS A;  2QYO A;  3OOU A;  2YU9 J;  1J59 A;  4FWV A;  2YS9 A;  1FNT c;  1OCT C;  4ZH4 F;  3H9Q A;  1J09 A;  4OOI A;  1TT0 A;  2P5V A;  2F4I A;  1BA5 A;  3VWB A;  4MVQ A;  3DE8 A;  1A41 A;  5L0D A;  3SYN A;  4PJL A;  2P61 A;  4IKF A;  2K02 A;  3OYA A;  4CBE A;  3BTL A;  1GDT A;  5IPA A;  4JX4 A;  1T39 A;  1XS9 A;  3MYF A;  5JP7 A;  5BPI A;  3VYW A;  4KJZ A;  3E0J B;  1JI8 A;  1S9H A;  4IRI A;  1NU7 D;  3I4M J;  2XVC A;  4XKC A;  2L54 A;  4IOA F;  4LAC B;  1QKR A;  4I01 A;  4KYW A;  4MVM A;  3TJ5 A;  4RB1 A;  2EBI A;  1GV2 A;  3DMD A;  3DKW A;  4XK4 A;  3POV A;  3DLA A;  1VF9 A;  3AQC A;  1N25 A;  2DTR A;  3BG7 A;  2LY9 A;  3HIF A;  5DD4 A;  2JUG A;  4E6K G;  4XPY A;  5B3I A;  1EA8 A;  2V1U A;  2H1K A;  1FMV A;  1T6Q A;  4ZLC A;  2KNH A;  4ESF A;  2LKP A;  5EGY A;  1U9N A;  2UXX A;  2DBB A;  2ELK A;  3I4P A;  2P6V A;  2EFQ A;  2E36 A;  1IDY A;  2X6X A;  1HCR A;  2TCT A;  3L2U A;  1LFB A;  1NK2 P;  1E86 A;  1OFC X;  4HOB A;  3OA1 A;  3F6V A;  3B6A A;  1JKQ C;  1ZVZ A;  2IGN A;  2KIM A;  3VRC A;  3BWG A;  4KN7 X;  5M5W J;  1EH8 A;  5D8L B;  4B8X A;  1HDP A;  3L2V A;  2WB1 A;  3HLZ A;  4U0Y A;  5LHI A;  2V9K A;  1IG7 A;  3AG2 C;  3W4Y A;  2VIX A;  1R5H A;  4RAG A;  1IZ1 A;  1O7F A;  2QY9 A;  2KIU A;  2Y48 A;  1HF0 A;  3SEO A;  1P7J A;  3CSK A;  2YHS A;  3K70 C;  2XLH A;  4YFX F;  1JT0 A;  1FP1 D;  5C3E J;  5J8C A;  4MGR A;  4RAZ A;  3S32 A;  4IGG A;  1YIT I;  1J75 A;  5F6F A;  5FB2 A;  2NS0 A;  3EFO B;  3TOA A;  1Z21 A;  3K4C A;  4AIJ A;  2YUS A;  3M4B A;  2K4B A;  2NXN B;  4FQG A;  1LE8 B;  2A0B A;  3TO9 A;  1R4N B;  2G9W A;  2K9N A;  2O3F A;  4EEF G;  1WWX A;  5JR3 A;  5LEK A;  2NVY J;  4FX0 A;  1G4W R;  2J7P A;  2FNP A;  2EIM C;  3WTY C;  3DE9 A;  3K33 A;  4IAQ A;  5E33 A;  2E1O A;  3A11 A;  4JE9 A;  2WVO A;  2Y3G A;  3WTS C;  4IL6 C;  1LFU P;  3A03 A;  2W82 A;  1Y4C A;  3F8N A;  1I3Q J;  1T98 A;  4LLL A;  1W7P B;  2Z33 A;  3GTG J;  2IS4 A;  1JOG A;  2B7E A;  1ZEL A;  2G7H A;  1STZ A;  4GRI A;  1V5E A;  4BNC A;  1SVO A;  5DS5 A;  4U88 A;  4ZYA A;  5FLV A;  4OAZ A;  1USS A;  1X4O A;  4NC7 A;  3MYI A;  4UNO A;  4RM3 A;  2LF8 A;  1G59 A;  2CQQ A;  1VB5 A;  4YJW A;  2R0Q C;  4OIQ F;  1UEL B;  4C3E A;  3H5A A;  1T8I A;  2RSE B;  4Q7C A;  3TMO A;  1QO0 D;  2BXY A;  4CCO A;  1LI5 A;  4C9Y A;  4GEH A;  1C03 A;  3EUH C;  3GFJ A;  4BQQ A;  2QGU A;  1VQM I;  5KVR A;  4QI0 A;  4P5O A;  2EPN A;  1V55 C;  1OLT A;  2LVS A;  2Z15 A;  2QCO A;  2OU6 A;  3QOP A;  4N4N B;  2Y75 A;  1WN0 A;  3Q0V A;  1EH6 A;  3QPS A;  1PVE A;  4EM0 B;  4UB6 C;  3H0G J;  2LFD A;  2ESN A;  2D45 A;  1EJ9 A;  4O6N A;  1TZL A;  2IOQ A;  3V5X A;  5BNG A;  2XS8 A;  1ACI A;  2NYX A;  4YRV A;  4L6R A;  3O10 A;  3KZI C;  3J80 K;  1VQ4 I;  1SAN A;  5EEG A;  2DMT A;  3L9F A;  2KP6 A;  3WTW C;  2ZXO A;  2IP2 A;  3ERE D;  2Q7R A;  2WTE A;  3PNT A;  4XBF A;  2XRH A;  1AA7 A;  1L0O C;  3N0T A;  2V1N A;  4PCQ A;  4HFF B;  5ILS A;  1VLS A;  2Q3T A;  5D6F A;  4B3X A;  2ZC2 A;  3L0I A;  5C4J J;  1E17 A;  3V8L A;  2FGY A;  4UVA A;  4E4H A;  5FLX K;  3V7S A;  2GAU A;  1ST6 A;  4P9T A;  3GTP J;  4I0A A;  1QLE C;  3QOD A;  4NBQ A;  3HNJ A;  2A5W A;  2DMN A;  1FBU A;  1PD0 A;  1W2W A;  2AQF A;  4LER A;  2XF7 A;  2IGK A;  2Z3Y A;  3FM5 A;  3DP7 A;  3IH4 A;  3KEQ A;  1T9K A;  1HW1 A;  5KNL A;  2WAD A;  4XID A;  1D5Y A;  4CDV A;  2XAF A;  5FKM A;  4A12 A;  4IEJ A;  2QTV A;  2DK5 A;  4GGG A;  1JKP C;  3OS1 A;  1OYY A;  2P6S A;  2VPR A;  2NOG A;  5L0H A;  2PG4 A;  4LG0 B;  4G94 A;  1WH5 A;  3EYI A;  4EV0 A;  3TQN A;  4P9U A;  3A1Y A;  3S1R J;  1RRJ A;  5ILV A;  4ONS A;  3OYF A;  3T5X A;  2EIL C;  2XAH A;  1J7K A;  1AWC A;  2ZBK A;  4WGY A;  3VF0 A;  2EWN A;  1A7V A;  2K27 A;  4II3 A;  4BJ1 A;  3MVP A;  5D6E A;  4W8P A;  2JSC A;  5K0I A;  4KT5 C;  4FES A;  4NQF A;  2H6B A;  3U9M A;  3GXO A;  3RSN A;  2HFI A;  2Q2E A;  4PJJ A;  4J7Y A;  5L0J A;  1VQL I;  3F72 A;  1S6L A;  4XON A;  4QTR A;  1R49 A;  4WK8 F;  4NCQ A;  3DKX A;  4KT6 A;  2GLO A;  3BTC A;  4IHY A;  1HXD A;  4A3F J;  4M74 A;  1B1B A;  2GXG A;  2HR3 A;  1ZK8 A;  3KCC A;  5L3D A;  3Q7G A;  3HGG A;  4AM3 A;  2CV2 A;  5HLG A;  3BG6 A;  4BEH B;  3BG5 A;  5K5R A;  1ETK A;  3R4K A;  4UV9 A;  2JMW A;  2JQ7 A;  1ZHW A;  2XLE A;  1R4M B;  3PNY A;  3FHN A;  2XXA B;  1JTX A;  3G1L A;  3ITF A;  4YL1 A;  1UJ8 A;  4BGD A;  1L3P A;  4E7S A;  1A0B A;  5KCM A;  3AFH A;  3I59 B;  4ER9 A;  1Y8Q B;  1PUF B;  2RV8 A;  2VBZ A;  5KYY B;  3GAN A;  4MLO A;  3PO3 J;  2Z16 A;  4PR9 A;  1D1A A;  2KIS A;  4JYK A;  3A01 B;  2LDU A;  2ZCW A;  1RKC A;  1FIA A;  1D0Z A;  5HSW A;  2ZXI A;  2XSD C;  1ERD A;  2L7M P;  5FJ8 J;  1UB9 A;  3CUO A;  3LST A;  2Q1Z B;  5JLI A;  1IRX A;  4L9V A;  2L01 A;  4EJU A;  1FPQ A;  3F46 A;  4WXC A;  2Y3H A;  3U2M A;  3DTK A;  1KQ0 A;  2Z5U A;  3O8G A;  3O6X A;  3BJO A;  5GPC A;  1H7I A;  3RIP A;  4CZZ A;  3S90 A;  2JJ7 A;  3C2B A;  2ZXH A;  1YOV B;  1TNT A;  2IA1 A;  3ZQQ A;  1IF1 A;  2ISY A;  4HX4 A;  1ZR4 A;  5L3B A;  1K6Y A;  1OQY A;  3LES A;  5CQG A;  4U5H A;  4M71 A;  1YJN I;  5CJ9 A;  3B0U X;  4XEV A;  1IC8 A;  1MD0 A;  2V9V A;  2XF6 A;  5HDK A;  2LYC A;  2VCA A;  4I44 A;  1DU0 A;  3K2Z A;  4A3E J;  2YWA A;  2YX7 A;  3HOS A;  3N2Z B;  1TNS A;  4HPQ A;  2XSE A;  4ZYE A;  2DFF A;  2FUG 2;  2LSO A;  2H1L A;  3RKX A;  3QPL A;  2OCE A;  3HTS B;  2J9U A;  4A3B J;  3A02 A;  5DTD A;  4FAP B;  2VN2 A;  4A3D J;  1YA7 O;  1YAR O;  4N9H A;  2IYL D;  6PAX A;  4U7B A;  3M8J A;  1CQT A;  2IAI A;  3LOC A;  1W0T A;  1VMA A;  2XUB A;  3BJA A;  3FIW A;  1U89 A;  1VYK A;  4BY1 J;  1WOL A;  4GDF A;  3LSJ A;  5L3G A;  3QP6 A;  3RPU A;  3CP8 A;  4GFB A;  3EHN A;  1RMV A;  2C04 A;  4MVU A;  4UUS A;  1G6N A;  3CCQ I;  5GP9 A;  3SQN A;  1HA8 A;  2D1V A;  4EJV A;  3LAY A;  3MFN A;  1EH7 A;  4FCY A;  1Z1D A;  3M9A A;  4W1U A;  2EPL X;  3SDB A;  3IQC A;  2E7X A;  3PUB A;  4G7H F;  1ZAO A;  2DFE A;  1JUP A;  3TDZ C;  4KNV A;  2Y0S A;  1FYK A;  1UG7 A;  3NKE A;  4R1H A;  2QSH X;  2DB4 A;  2DT6 A;  3LMM A;  3Q7L A;  1SAU A;  4L5I A;  3RJP A;  4JOM A;  1VZ0 A;  3RDI A;  1ORK A;  2E1C A;  5ICG A;  1R7J A;  4RBO A;  3LA2 A;  2V79 A;  4A0X A;  3N24 A;  5J8F A;  3T9O A;  5JLX A;  4JKV A;  1JT6 A;  1Z7Q c;  1ETQ A;  2DA6 A;  1XSD A;  2HJM A;  2XM0 A;  5IP9 J;  2VOO A;  2KC3 A;  3LUT B;  4EQQ A;  2K3F A;  3EUH A;  5TJJ A;  1JMW A;  1K05 A;  1ZAR A;  3HKZ N;  1RR8 C;  1I5Z A;  2QM3 A;  3WTX C;  3JSZ A;  2DYR H;  3CP2 A;  1NBB A;  1Q0M A;  1WSU A;  2HZD A;  4U5F E;  4G78 A;  1Z3X A;  2R5Z B;  4FE4 A;  5BMZ A;  3AGU A;  2ZNZ A;  5BOX A;  4U5D E;  3BR0 A;  4D9J A;  2H7V C;  2EPM X;  2HUJ A;  1W5S A;  3OYC A;  2OJQ A;  3ZTZ A;  4LFU A;  2B0L A;  4Y3O A;  1OCP A;  5E79 C;  4BG0 A;  1LVA A;  5IYB J;  1SAX A;  1MBF A;  4AIH A;  1WFX A;  5E3N A;  3A0H C;  2HKO A;  3F8B A;  3JRD A;  1UZC A;  2JD3 A;  2DXI A;  2LSE A;  2XSJ C;  2CYD A;  1VQK I;  3HHH A;  3BR2 A;  4NHJ A;  2QBY B;  2H8A A;  2LR8 A;  3S28 A;  3CDI A;  2HDC A;  2CMP A;  2FU4 A;  2G3K A;  9ANT A;  2A07 F;  2KMU A;  5IY5 H;  4B44 A;  2EPF A;  2DFI A;  2L7Z A;  4I99 C;  4XR6 A;  1AUE A;  2XHK A;  1N75 A;  3S17 J;  2A5Y B;  1Z05 A;  2M9H A;  4I09 A;  2L6H A;  3DTE A;  2LTP A;  1QVT A;  2UXN A;  3BPX A;  3V7R A;  2ETS A;  3BCA A;  3S8P A;  5ILU A;  5DCF A;  2EJR A;  1CGM E;  4MFE A;  1J8Y F;  3GZN B;  1LEA A;  2JT1 A;  3AAF A;  2V3C C;  3EFO A;  3GWN A;  2HI3 A;  1HQC A;  2DT7 B;  1RIO H;  2BY1 A;  1MMG A;  1KU3 A;  4IQ4 A;  4PJM A;  4C30 A;  4BE1 A;  1IRG A;  1U0B B;  1LE8 A;  1PD1 A;  2NNN A;  2OAZ A;  1OJL A;  3TGN A;  4U5B E;  1X1C A;  1S7A A;  1W5T A;  1T38 A;  2MH9 A;  1HOM A;  3ZQG A;  2DOF A;  3IPM O;  4RDA A;  3LL7 A;  3KP2 A;  2ZSI B;  3DEE A;  3Q0U A;  5IT9 K;  2F48 A;  4XOT A;  4E7K A;  2CV1 A;  3NYM A;  3DWL E;  2KPM A;  1KU2 A;  1W7P A;  3OYB A;  1JAF A;  5EYR A;  5BPD A;  3MLG A;  4Q5S F;  3OIP A;  2FE3 A;  3ASN H;  2LBF B;  2DMP A;  3T1B A;  4EGZ A;  4CCL A;  5E1X A;  1BW6 A;  3JAM Z;  3A9C A;  4N6C A;  4CUG A;  4GXO A;  2H7B A;  3BDD A;  1JKR C;  2LY1 A;  4XIC A;  3J7A O;  3MMY B;  2GXA A;  4AC0 A;  5CI8 A;  1WKM A;  2DO7 A;  2X6W A;  2HOT A;  2FEZ A;  1V5F A;  3D1N I;  1A36 A;  3RKW A;  2PX3 A;  1M1E B;  3H36 A;  2XPV A;  2OC6 A;  2HVR A;  2O03 A;  1WQ2 A;  4MFD A;  4A6D A;  1K61 A;  2XRO A;  4RA2 A;  1I5N A;  2NSG A;  3GTM J;  3UGP A;  3JT1 A;  3E5Q A;  2VXD A;  3DU6 A;  3MWM A;  5HS9 A;  2YLI A;  1D0X A;  5BQI A;  3P9I A;  1IN6 A;  1HE1 A;  2R4G A;  1VQO I;  2W00 A;  4LDR A;  3MKW B;  3KLN A;  1ORS C;  2A1D D;  3G1M A;  1ZW2 A;  3FXK A;  2WVN A;  1O3Q A;  4CDA A;  1TWG J;  1OR3 A;  5B66 C;  2K9Q A;  5CIV A;  1S5L C;  2X0C A;  3Q0W A;  1F9N A;  3ABM H;  3GTQ J;  3K7D A;  2W57 A;  5CVV A;  4XWJ A;  2BHY A;  2DA5 A;  3MKY B;  3Q6M A;  4XLA A;  4X6A J;  2OTJ I;  1ZHF A;  4A5M A;  2XV4 S;  3KZZ A;  4UB8 C;  3U21 A;  5HLI A;  2ZPA A;  4DRI B;  3K4K A;  1KZH A;  1Q0K A;  4JVS A;  1RKE B;  3UNG C;  3MCZ A;  1SVM A;  4BKX A;  5K7Z A;  5A6B D;  1SFX A;  4M6V A;  2CGP A;  4BQA A;  3V5Z A;  2P6T A;  3AG2 H;  1VQ5 I;  5DS6 A;  1OIS A;  1R5G A;  4BBR J;  5JVE A;  1VND A;  4BHC A;  4CCN A;  2I15 A;  4I76 A;  3NMJ A;  2NAZ A;  3KEY A;  4F55 A;  2F5F A;  3TDU C;  2LK4 A;  4Y13 A;  2F5E A;  4E18 A;  4I0B A;  2X51 A;  5DCM B;  3ZQH A;  2QQ9 A;  1T08 B;  4GO1 A;  5AIP A;  1MIJ A;  4DRH B;  3S93 A;  4Z6Y A;  3KEO A;  2CU7 A;  4LG0 A;  2K7L A;  2DOA A;  2AVK A;  5JT4 A;  3K70 D;  1R22 A;  2BV6 A;  3KMI A;  1RKT A;  5M5X J;  1Z23 A;  3CEX A;  5EEA A;  4OD4 A;  2GFH A;  2BYV E;  3VYU B;  3V8J A;  2K9S A;  4RM2 A;  3ERM A;  2FOK A;  2CUE A;  2PMZ A;  1ETX A;  2CQN A;  3LNR A;  1ENH A;  1D3Y A;  3W2V A;  4O7G A;  5EZG A;  4HG2 A;  3SZP A;  4OMZ A;  4JTD B;  1TWC A;  2ZO4 A;  3PIP F;  4KIG A;  2J8W A;  4E7I A;  2DN0 A;  2ZNY A;  2UUZ A;  3MX3 A;  4RGR A;  1S3J A;  2EPK X;  2IVM A;  4BEH A;  4RB3 C;  3SFZ A;  2JN6 A;  2XXA A;  5KYW B;  4RAF A;  1ZU5 A;  3PNV A;  4JC7 A;  2DAO A;  2RQP A;  3DFG A;  5ICF A;  3DD7 A;  2XL6 A;  2VKH A;  3I59 A;  4JRZ A;  1PUF A;  3GOD A;  3RVY A;  3SZG A;  3MN2 A;  5KYY A;  3FMS A;  4G8X A;  1WH7 A;  3E6B A;  2EIJ H;  5F0F A;  1YW7 A;  2MD5 A;  3A01 A;  4LD5 A;  3SDG A;  2CSO A;  3R0A A;  4CYD A;  3T6G B;  3ML6 A;  2GXB A;  2ICW G;  3N4M A;  1E3O C;  2E87 A;  1DDN A;  1SYQ A;  2NS7 A;  4F7Z A;  3BQZ A;  3US6 A;  4E7Z A;  4UXN A;  5EZH A;  3I9V 2;  5EHH A;  1Q1H A;  1TC3 C;  2M30 A;  1E3H A;  4M3G A;  4LLC A;  5AON A;  1X2M A;  3HPH A;  1QU3 A;  4KI2 A;  3LLI A;  3JRC A;  4NTB A;  3OR1 C;  4Z9I A;  3PFI A;  1NG6 A;  1SFU A;  2M64 A;  2WZG A;  4IF4 A;  3WGI A;  1ORJ A;  2NSF A;  4HRI A;  1QBJ A;  3OIQ A;  3BT9 A;  2BGC A;  2XL4 A;  1IUY A;  1K83 J;  3IP4 B;  1TWH J;  2B0H A;  2PF4 E;  1S72 I;  1IGN A;  4JTA B;  1G3W A;  3CCJ I;  2ZME B;  1MH4 A;  5FKO A;  4LB6 B;  3GUD A;  2YL1 A;  2AWY A;  4CJG A;  2D1H A;  1XTA A;  3HZJ A;  3B29 A;  1W1W E;  4XLC A;  4CIH A;  4I1O B;  1Q1V A;  2EIN C;  2XDV A;  2GIZ A;  3CF2 A;  2K9L A;  1J8M F;  3E6C C;  4BJ5 C;  3B73 A;  3K1I C;  2ETH A;  1WJB A;  2GOM A;  2WB1 N;  4HQM A;  3ZQI A;  4CCM A;  2H8W A;  1T01 A;  2D5R B;  5AC5 A;  2V4J C;  5GTH C;  2HEO A;  1CPQ A;  1RNL A;  3R61 A;  2L9J A;  3SXZ A;  4EAT A;  4JIO A;  1YG2 A;  2E34 A;  2W48 A;  3ZXS A;  3FZV A;  4HBL A;  4EJT A;  3CAX A;  5A2Q K;  3L1M A;  2F5D A;  2HVQ A;  1WVR A;  1W5C C;  4WF2 A;  4BQO A;  3NWT A;  4LOC A;  3DF8 A;  2PJP A;  1UHM A;  3G2B A;  4A2U A;  3LSK A;  2DYR C;  2IW5 A;  3NKD A;  5F5H A;  3JRF A;  3WAQ A;  1JJ6 C;  2NUP B;  4U0V A;  3S15 J;  3S1Q J;  3FK6 A;  1JUM A;  1Z63 A;  3CCL I;  3DKY A;  1TKN A;  3OWT A;  1BI0 A;  4LG3 A;  2A3S A;  1IDZ A;  1LQ1 A;  4YFK F;  4JBA A;  3TJ6 A;  3L09 A;  3K1N A;  1IN7 A;  5D8K B;  1BI2 A;  4K0D A;  1FX7 A;  1G3S A;  1H88 C;  2ID3 A;  5LLQ A;  3RZD J;  3HDD A;  4XRS A;  3HHG A;  4XQF A;  4ZYG A;  4TV7 A;  2JRT A;  1Q0G A;  3JTG A;  5FFX A;  4EJO A;  5F28 E;  1KNY A;  1UCR A;  4E70 A;  1H6G A;  1IXS B;  3ZTM A;  4CYC B;  4KFC A;  3OYK A;  2VE9 A;  2R5Z A;  3HRS A;  3CMY A;  1H89 C;  3DWW A;  2HPI A;  4Y4R A;  3V42 A;  4A3J J;  1LEB A;  4CDG A;  2QLZ A;  3ZQV A;  3JTH A;  2ZFU A;  2DGJ A;  1KQ8 A;  1G3Y A;  2LLK A;  3CC7 I;  3FOP A;  1ZU4 A;  2V1X A;  1SMY F;  2J5P A;  5AIQ A;  2EA2 A;  4U0W A;  5D5V B;  3CLQ A;  1FWZ A;  2QSF X;  3AJM A;  3KKB A;  2HYG D;  5AGF A;  2P81 A;  5B1B C;  2R7Z J;  2QBY A;  3F47 A;  4QLC U;  3L2R A;  2ZME C;  5L3V A;  3LFK A;  3M1C B;  5COF A;  1SD5 A;  1D0Y A;  2LMD A;  1QNT A;  3E5X A;  3BQY A;  4YWQ A;  2GM4 A;  1OW7 A;  2XKP A;  4EVI A;  3FAP B;  1OCR H;  3ASN C;  2QWW A;  1K04 A;  1MQV A;  3CJQ B;  2WV0 A;  2W25 A;  5LEJ A;  3JRM O;  4HNU A;  1DOV A;  1LNW A;  1WI9 A;  1CF7 B;  2CQK A;  1YAU O;  2HXI A;  3L00 A;  2DDB A;  4XOR A;  3T8R A;  2DQR A;  1BN5 A;  5E3M A;  1MZB A;  3KYL A;  1JGG A;  4F52 A;  1FAP B;  2EFO A;  2QE9 A;  1BBH A;  2AXL A;  1X1A A;  4XQ1 A;  4AVP A;  5T1D B;  4N9I A;  4C2T A;  3CCE I;  1JHH A;  2VON A;  2ZKZ A;  4XN3 A;  2J45 A;  2HVS A;  4D4N A;  3DV8 A;  2M2E A;  1R1T A;  3WE2 A;  2ZXP A;  3EHM A;  2LF7 A;  1OPC A;  1EA3 A;  3CZ6 A;  1T95 A;  2YVK A;  5GAH J;  4KA4 A;  1FTS A;  2QKM B;  3RYP A;  2HPM A;  4CSA C;  4AL1 A;  3QVY A;  4XSZ F;  3ZMV A;  2LBF A;  2RNJ A;  2O61 A;  1VTM P;  1BIA A;  2G7U A;  1U78 A;  5HOO A;  3S16 J;  3ABM C;  2WAQ N;  3BTJ A;  4BS9 A;  3OYE A;  4OIR F;  3VYR B;  1VOM A;  4XM3 A;  2M8E A;  4QSH A;  3GLL A;  3NYL A;  3S1N J;  2TMV P;  1KYZ A;  4H0E A;  1LPQ A;  4YII A;  3Q9V A;  1LPE A;  1WAS A;  2W4M A;  1U8R A;  3I3L A;  5CVU A;  5DD8 A;  1MMA A;  4XMY A;  2RKH A;  2G0E A;  4JJG A;  3U8P A;  3AKZ A;  2NRA C;  4Z9J A;  2M7A A;  3EH1 A;  2ELJ A;  5IYD J;  2HFH A;  2Y0M A;  2HDW A;  3FXU A;  5GAD J;  1SD6 A;  2VOP A;  3NMK A;  3QTH A;  2IXO A;  5HS8 A;  3CD6 I;  2KRH A;  3VDX A;  2EZK A;  1CGO A;  3CQZ A;  5A69 A;  1VYI A;  3ESW B;  2X85 A;  5L3E A;  4C2U A;  1ORY A;  2STT A;  1I27 A;  1F36 A;  1SD4 A;  1M57 C;  4YT5 A;  2DMU A;  3AOU A;  1MGT A;  2PX9 A;  4CS7 A;  1P9Q C;  1HMO A;  2XAQ A;  2XAJ A;  4UV8 A;  3REO A;  1W0U A;  1GLN A;  1TR2 A;  2LIG A;  2VC1 A;  4EGY A;  4CX9 A;  5DYM A;  4BY7 J;  2MLG A;  4IQJ A;  5H20 A;  4MEX F;  2FFH A;  2YLG A;  2IGO A;  1R58 A;  1RKE A;  2YLD A;  2F2E A;  1DGW Y;  3A4C A;  3CJN A;  4DW6 A;  4H54 A;  1D1B A;  1MMD A;  2HYF A;  5A6K A;  1B9N A;  3M07 A;  4ABZ A;  5LD2 C;  2KYH A;  2RGV A;  3PCV A;  1LDK B;  3EPV A;  3K4N A;  3PJR A;  3T6J A;  3CCR I;  1UHS A;  1GVD A;  5K1Y A;  1XDS A;  3GCM A;  2D4U A;  2OEX A;  3B0V C;  3S2H J;  4U9E A;  2GDC A;  2IXP A;  4BJ5 A;  3HSF A;  2CGE A;  5FRM A;  3K1I A;  4U5E E;  5DCM A;  2HOS A;  3P5J A;  3LEO A;  1XGN A;  2BW3 A;  3CES A;  4M3E A;  4BDZ A;  3GM2 A;  3QQA A;  4XRM A;  4ZZD A;  2GOX B;  5GPG B;  2ZXJ A;  4JEB A;  2IRF G;  2M4E A;  1MH3 A;  3HOT A;  1FOY A;  3U3B A;  2LD6 A;  2FA5 A;  2HDD A;  4MTG A;  4H4K C;  5KAI C;  3C2H A;  2C6Y A;  3U8V A;  3G71 I;  4DVY P;  2QEN A;  5KYU B;  3M7G A;  4LIT A;  1P4X A;  2O5R A;  4C3H J;  4OD5 A;  2EIJ C;  2VT3 A;  2Y31 A;  4RGS A;  1K4T A;  2FQ4 A;  3TD7 A;  2YSR A;  3W6J B;  2OUM A;  3OYG A;  2JVG A;  2OJE D;  1HBX G;  3D5S C;  4PK4 A;  4A3M J;  2LFB A;  2VUM J;  2NG1 A;  2JA5 J;  1FBQ A;  4RB0 A;  3S3O A;  2R02 A;  4IAR A;  3QVZ A;  2KJC A;  2QVO A;  5LHH A;  4MHG A;  3LEV A;  2LKX A;  1XSX A;  1YYV A;  3IC7 A;  1ITY A;  3IV5 A;  4IOC F;  1YYX A;  1MBK A;  2VBY A;  3DPL C;  4BL0 B;  4KIS A;  1FTZ A;  1BI3 A;  2IGM A;  3CLO A;  3AGT A;  4CJO A;  4RDU A;  1YX5 A;  4MTD A;  5BUO A;  2L2O A;  2JA7 J;  5F64 A;  3I55 I;  1BM9 A;  3HSE A;  1S7E A;  2O9X A;  2HSB A;  3IAS 2;  2M1B A;  1HMD A;  5KAF C;  4HLX A;  2X1E A;  1DQU A;  5B1A H;  2QUP A;  4ON0 A;  3QW1 A;  4PGH A;  2XIG A;  2ME6 A;  2NNY A;  3LAJ A;  1NU9 C;  3IEE A;  3K66 A;  2E1N A;  1XDU A;  4IVN A;  4IZZ A;  2E19 A;  4OIN F;  2O7O A;  3ZPL A;  5GAE J;  3WGH A;  3RFY A;  1ODD A;  3F23 A;  2OOC A;  4KN4 X;  3E97 A;  1QA6 A;  2D2W A;  2IS2 A;  4Q47 A;  4EBK A;  2I5U A;  4NC3 A;  2A69 F;  2VI6 A;  4ZYD A;  1KU9 A;  1BL0 A;  1BR1 A;  1E0E A;  1TW2 A;  2ID6 A;  3VYS B;  4ANJ A;  2HJ3 A;  1SFK A;  1Z67 A;  3AG4 H;  3GLX A;  5FCL A;  3I56 I;  3R60 A;  1ZYR F;  3TO6 A;  5FLM J;  1I4Z A;  4A3K J;  1VQ8 I;  2Y3D A;  4ENM A;  2XAG A;  4NTA A;  1ZG3 A;  2ZME A;  3HOV J;  2VB6 A;  3MKZ A;  3JRT A;  1J2X A;  3F8C A;  1BC8 C;  3B0P A;  2L0K A;  3EGD B;  5FGM A;  3D5R C;  3RQF A;  1P4A A;  1A7E A;  3DJN B;  4A6E A;  1JE8 A;  1KU7 A;  4LLG F;  1QPU A;  4FET A;  2AWC A;  3BJ6 A;  3KFW X;  2DJN A;  3KP7 A;  4YT4 A;  2LY2 A;  2PMH A;  4C3B A;  2W4S A;  4M9S A;  5DQZ A;  1XCB A;  1ZKG A;  1V3F A;  1YJW I;  2F4O B;  4AIK A;  4B48 A;  1B9M A;  5L3F A;  4P55 A;  2XKO A;  5HNH A;  4UY8 I;  4UVB A;  2PFB A;  3HOY J;  2B0J A;  3X1O A;  3N97 A;  3WHN A;  1I4Y A;  2Y69 H;  5KYX B;  2EFN A;  2VT2 A;  3RH3 A;  3IWZ A;  3PHF 2;  3EDP A;  4AK9 A;  2UZK A;  2E2J J;  5HDG A;  2Z99 A;  4QPQ A;  4Y7N J;  4L18 B;  5EEH A;  3GFI A;  3ABK C;  1BC7 C;  2H6C A;  1GGQ A;  2NPU A;  3FF5 A;  4L5J A;  4CH7 A;  1KYW A;  2NUP A;  2NUT B;  3NG1 A;  4L9J A;  1M2V A;  3TUL A;  1DGR M;  2YZS A;  1YA9 A;  4ULV A;  3F3X A;  1I1S A;  2W7N A;  1A7D A;  1FYL A;  1R1U A;  2OQR A;  2XLO A;  4YT2 A;  2ASR A;  4CSA A;  2MW8 A;  4P1W A;  4FTH A;  1BR4 A;  2P0W A;  2VKD A;  2K4J A;  5FKL A;  3QP5 A;  4MQ9 F;  3T8T A;  2EV0 A;  4AD9 A;  2IM8 A;  2W45 A;  2DLL A;  1VI0 A;  1RXQ A;  1AEP A;  1MBG A;  2ESH A;  4DRJ B;  3R2P A;  2XGC A;  3HRU A;  1Y1W J;  1JJ8 C;  5A6B A;  2QQB A;  4R79 A;  3W6V A;  1O4X A;  1OKR A;  1X3Z B;  2VJ4 A;  2W24 A;  5JVG F;  1E83 A;  3L2W A;  3K69 A;  4PJN A;  3SJM A;  1NLX A;  1U5T B;  2JTV A;  3C8G D;  2YL0 A;  3J7Y J;  1YS7 A;  3RQE A;  3HL2 A;  1LS4 A;  2LC2 A;  3DXJ F;  2CUZ A;  4E7H A;  3NMI A;  3EQL F;  3U9G A;  4CYC A;  1YRN B;  4Y17 A;  4KMF A;  4C2M J;  1GV5 A;  4G9Y A;  4D0P A;  3H35 A;  1S8N A;  3H9G A;  3V8K A;  1OCR C;  4BH9 A;  4A4A A;  2DFH A;  2CRG A;  4F93 B;  2Y9Y A;  3CO7 C;  3RKQ A;  3I53 A;  3RYR A;  1HKQ A;  3IKV A;  4ZDO A;  2MYS A;  2XGD A;  3B6C A;  4G7Z F;  1EI7 A;  3JCU Q;  1VQN I;  3E5U A;  1F4K A;  5EGO B;  1TQM A;  1H9T A;  3LSH A;  1JGS A;  1I50 J;  3P9K A;  4BHB A;  1Z7L A;  3OL3 A;  2Y3B A;  4YL0 A;  1IW7 F;  2NVX J;  1IUF A;  1YW8 A;  5IP7 J;  1ZRF A;  4EIY A;  3GVA A;  1MW7 A;  4P6I C;  4WJ0 A;  1FBS A;  2CQX A;  3M1C A;  2EIN H;  4QWQ A;  2CDQ A;  3OYD A;  4XNF A;  3FHD A;  4X1E A;  1WTY A;  4NDL A;  3J81 Z;  2P5L C;  2RVC A;  4AID A;  4JX6 A;  3BCB A;  4LMY A;  4EWC A;  1QVU A;  5D4R A;  1ZRC A;  2WB7 A;  3GME A;  5IT9 Z;  3GYH X;  2HMZ A;  2WZL A;  3LLK A;  1XMA A;  4A3I J;  4NTF A;  1CF7 A;  3MEX A;  5D5X B;  3S0X A;  4F91 B;  4XOP A;  3HOZ J;  4HNV A;  2YKZ A;  1MMN A;  3U0C A;  3L1P A;  1HE9 A;  2IBF A;  3QW0 A;  4NC6 A;  3COA C;  3WOD F;  2L9V A;  1SF8 A;  3ATP A;  1K7A A;  4BBS J;  2K3P A;  3ABU A;  3QYE A;  5CI9 A;  1WGX A;  5FKK A;  5EDN A;  1U3E M;  1R71 A;  1IV6 A;  1U0J A;  4HZF A;  2YQY A;  2RN7 A;  4J19 A;  2C03 A;  4G6T B;  4U5G A;  2LCH A;  2V6E A;  3GEI A;  1UFM A;  4HEA 2;  1QRY A;  5F1J A;  3M4C A;  3LSR A;  3S3N A;  4AUX A;  1ZRD A;  1RJ9 B;  2HQA A;  3A2K A;  4HF2 A;  3EG9 B;  3G4S I;  3SXY A;  2PMU A;  1LM3 B;  4IAO A;  4IHX A;  2RNG A;  1UST A;  3TQO A;  3H92 A;  1DUX C;  3NRH A;  1R1V A;  2GAQ A;  2WY7 Q;  2I8B A;  4BXU A;  4FAS D;  4HV6 A;  3FOO A;  4J32 B;  4CO8 A;  1JPJ A;  1XWJ A;  2J9W A;  2HSQ A;  3DJU B;  1U5T C;  3MQ0 A;  2YRF A;  4MNU A;  1MBE A;  2JK3 A;  3SFI A;  3NEU A;  1T56 A;  1XGO A;  2DYS H;  3RVZ A;  4C7O B;  3RF3 A;  1QZY A;  1IN5 A;  3KIO A;  2WV1 A;  5T3W A;  1WJC A;  1YI2 I;  4BXF A;  1TL8 A;  2BHZ A;  3OOP A;  4U9D A;  5A6J A;  4YG2 F;  3IAM 2;  4KUM A;  4RB2 C;  3BZ6 A;  3GM3 A;  3CC2 I;  1IAW A;  3BR3 A;  3LNQ A;  2VPL A;  5E3C A;  2CFX A;  1E2X A;  2P8T A;  2R7W A;  4N4W A;  5B1B H;  3CCS I;  1FOK A;  3V7C A;  4HFK B;  3PL8 A;  1M6T A;  3JZ0 A;  1HKT A;  5LHG A;  3I58 A;  4ESB A;  4KIF A;  1SD7 A;  5KHD A;  5E18 F;  1MMS A;  3DAF A;  3FHZ A;  3VOD A;  4XKW A;  3F8F A;  2A05 A;  1QPI A;  3C18 A;  2Q0O A;  1R23 A;  1XMK A;  4CS8 C;  4ASN A;  4I2O A;  3JYH A;  2KFD A;  1XGS A;  2PX0 A;  1Z6T A;  2JX0 A;  1YX3 A;  1WJ5 A;  3GF2 A;  4S05 A;  1JTY A;  2JPC A;  2FRH A;  2JUC A;  3BPV A;  4WAB A;  2YU3 A;  5IOY A;  1VK5 A;  3HOX J;  3C8G B;  3DPU A;  1RI7 A;  2BBY A;  4M6Y A;  5DLJ A;  2M4G A;  3P7N A;  3T4R A;  3BZK A;  3QAH A;  4DQ2 A;  5KYU A;  1BOA A;  3GBG A;  3TBI A;  3O39 A;  3W8I A;  3Q3S A;  5B1A C;  2R7U A;  3OS2 A;  5J4V A;  3R6S A;  1OYW A;  1CGN A;  4A69 C;  1G8X A;  5DVW A;  3TW6 A;  1LI7 A;  1MNM C;  1Z77 A;  2JA6 J;  3E70 C;  3KP5 A;  1C02 A;  3K4L A;  1D1C A;  2X0L A;  2XS1 A;  1BIB A;  3L2C A;  4AE4 B;  5BS6 A;  2EIK H;  5A6A A;  4IRH A;  1K40 A;  5GTI C;  1B8I B;  1YTY A;  1MSE C;  3BTI A;  3UKG A;  1JXS A;  1TQI A;  1ON2 A;  4IHS A;  2FBH A;  4U7D A;  5CLS A;  5TJ5 E;  3K4J A;  3T0Y A;  3RKO F;  3TO7 A;  2Q4F A;  3AG4 C;  1F1Z A;  3ZDL A;  4BE2 A;  2R7S A;  3HOU J;  3GZ6 A;  2P1A A;  3IH3 A;  4YIF A;  4KIT B;  5FO5 A;  4XLE A;  4OU0 A;  3LWF A;  3DM9 B;  3G1O A;  1BI1 A;  3CF5 F;  2NVU B;  2DTZ A;  1UMQ A;  4Y33 A;  5H6R A;  2CNW D;  3G4Z A;  3KX2 A;  1MJ9 A;  1T6S A;  2VJI A;  2LRE A;  2X6Y A;  3N05 A;  2OTL I;  1GVJ A;  4RLF A;  2LP4 A;  2VL8 A;  2R7Q A;  1IJW C;  1O3S A;  2WZF A;  4OMY A;  3JRB A;  2CQ7 A;  2DCE A;  2R25 A;  3NDB B;  4W8K A;  2DA3 A;  3OSG A;  2LG4 A;  2MAB A;  3IHU A;  1O87 A;  2IA2 A;  3DBL B;  3E1S A;  4BEM J;  2Y69 C;  4W97 A;  2QLA A;  1FJL A;  3SEQ A;  1OKK D;  1Z3Y A;  3KZY A;  3K1M A;  4MTE A;  4KDP A;  2OG2 A;  1QPM A;  2R7F A;  4ENJ A;  4XSX F;  3H3V K;  4IB4 A;  1X2N A;  3PFY A;  2JWT A;  3EGD A;  3WU1 B;  1F43 A;  2AQE A;  1D5V A;  2CCY A;  1TFO B;  3WG7 C;  3CJR B;  5J1R A;  4L0Y B;  2KQ9 A;  2MGQ A;  5FD5 A;  4ZDL A;  2OCC C;  4IJJ A;  4AYB N;  5HNF A;  1QQI A;  4G6Q A;  3TOM A;  3QPT A;  2AP3 A;  2ZXW C;  3HB9 A;  1BJA A;  1S29 A;  2ECC A;  4YN0 B;  4DNC A;  3H0D A;  3H2V A;  2QUF A;  3O8H A;  5IP6 A;  2VH3 A;  1ULY A;  2M34 A;  1EKE A;  3DZA A;  3DEW A;  2J5O A;  4I02 A;  1O3U A;  3JAM K;  5KYX A;  3VAY A;  2XGE A;  1T6I A;  1IN4 A;  5D4S A;  4M63 A;  1PP8 F;  3VYT B;  3X2Q C;  1OXB A;  4IXA A;  1FNN A;  2QNL A;  2FOW A;  3U9J A;  2W85 A;  3GEH A;  1Y0N A;  3FKI J;  2LRD A;  4LK1 F;  3E9V A;  2E71 A;  3OYH A;  2NS8 A;  2NUT A;  3K4B A;  2IBD A;  3EUA A;  4XRS G;  2NVQ J;  2HQN A;  3OL4 A;  5FFZ A;  2VLA A;  5M5Y J;  1TQP A;  3LS1 A;  1HW5 A;  1Q0D A;  1GXQ A;  3PSF A;  4PAC A;  2KRC A;  4BHP A;  2K85 A;  3IRR A;  2DW4 A;  2L9S A;  4K7B A;  2O9L A;  1YLM A;  2DA2 A;  3K6G A;  4IHT A;  1G5Z A;  2ZSH B;  1R9T J;  2KGO A;  1C0W A;  1HC8 A;  1LDJ A;  1Y6I A;  2KK1 A;  4J00 A;  3U5S A;  5JRA A;  2DPD A;  2OU2 A;  1RC9 A;  4ENK A;  4DYR A;  4CZC A;  1U5T A;  3RW0 A;  5JHU A;  1B6A A;  1K78 B;  1LUJ B;  3HPG A;  3E6M A;  4XL9 A;  5E20 A;  4HQE A;  5E8I A;  1TWF J;  1RUN A;  1FFT C;  2KZV A;  2P5K A;  1FEX A;  3DAG A;  3ZQY A;  3EPZ A;  3S9O A;  1B72 B;  3T6B A;  5BQH A;  2ISZ A;  1N77 A;  1YLF A;  1YRN A;  4KIB A;  2HYJ A;  3LJB A;  3TK0 A;  3FXH A;  3DI5 A;  2K86 A;  1N78 A;  2OKU A;  1XMX A;  2XPW A;  2EV5 A;  3W3C A;  1APL C;  3H65 A;  4ETS A;  4DOZ A;  4MVS A;  3OIO A;  1RCP A;  3TL4 X;  4M73 A;  4O3M A;  3RKY A;  3IQT A;  4C3D A;  3CDL A;  3H9J A;  3IWF A;  3AG1 H;  2L5Q A;  2RRE A;  5EGO A;  4F92 B;  3I4N J;  3UGO A;  2BY0 A;  3VSL A;  2FML A;  2HOE A;  2VBX A;  3GWZ A;  3GTO J;  3QZC A;  4S0H B;  3B71 A;  1YIO A;  2FXA A;  1NG7 A;  5LRR A;  1VTN C;  2MHR A;  1X4P A;  1CPR A;  1WHU A;  3GM1 A;  2JA8 J;  5F08 A;  1A6I A;  4CIC A;  3R0J A;  2PEX A;  3DEU A;  1UFB A;  4A5N A;  3S27 A;  2KIQ A;  2KHM A;  1RES A;  4GCV A;  1FOW A;  2YX4 A;  1ZRE A;  3EJN A;  2OD5 A;  3C1D A;  4CS8 A;  3OYJ A;  1LFP A;  4KC9 A;  2LFF A;  1WCM J;  1TWC J;  2XB5 A;  3ZN0 A;  2E1M B;  1WJE A;  1K4S A;  1Z9C A;  3ZG1 A;  1OXK A;  2RQQ A;  1FMW A;  1FLI A;  2F5C A;  1XSV A;  3ZMD A;  1IRZ A;  5JVT A;  4N06 A;  4UDV A;  2OPT A;  4RLQ A;  3ZMZ A;  2P7C B;  3LA3 A;  1TW3 A;  1TLH B;  3OS0 A;  5J1U A;  1AOY A;  2GQQ A;  3ABK H;  4BE0 A;  1HW2 A;  1VLT A;  2PQ8 A;  5L0G A;  1BZ4 A;  1H9G A;  3MZY A;  2DYS C;  2Q9C A;  3BG9 A;  1Z6A A;  3G73 A;  1OR7 C;  3DM5 A;  3LAP A;  1YJG A;  1MNE A;  1RKW A;  3NAR A;  1IZM A;  4BEJ A;  1RPW A;  1SFE A;  3W6K B;  2XL8 A;  1RJ9 A;  5HS7 A;  4MTO A;  5DQT A;  4J01 A;  1P7I A;  2H27 A;  4YEL A;  3HEF A;  1XZP A;  3J06 A;  2CW7 A;  1BJZ A;  3ECH A;  1G2H A;  2IS1 A;  4NQW B;  4PUS A;  4MQV A;  3LSG A;  4JCH A;  4O79 A;  5JHF A;  1VFC A;  2A6E F;  1L7C A;  5K5O A;  3LNM B;  2KQR A;  2VC0 A;  2CG4 A;  3VPR A;  1DP3 A;  2VCB A;  3R7C A;  3K1P A;  2LNB A;  5CVR A;  1RZ4 A;  3ZMU A;  3JRI A;  3RI4 A;  2O8K A;  5HLH A;  2N8G A;  3NAU A;  1X1D A;  3ABL C;  5EG0 B;  3HTU A;  1VQ9 I;  3E6D A;  2R9R B;  2IXM A;  5B3S C;  5LGN A;  2ZXR A;  2HS5 A;  4C7O A;  3BP8 A;  2Y39 A;  2HTJ A;  2L4M A;  1ZHT A;  2YL7 A;  3SYT A;  2V7F A;  2CJJ A;  1YHQ I;  3F21 A;  2DU9 A;  3A0B C;  3PSI A;  4O6M A;  4XLP F;  5C44 J;  2L7F P;  1XN7 A;  4ULW A;  2CW0 F;  3HJC A;  2P4W A;  3FMR A;  1YYJ A;  1X1B A;  1O3R A;  2XLD A;  4EM2 A;  2F6C A;  1FYM A;  3H5R A;  2J9B A;  3EZI A;  3VB2 A;  1J0R A;  4A93 J;  3WTV C;  5E2Q A;  2EB7 A;  5EK0 A;  1Q0F A;  1L3L A;  3HNI A;  3RQG A;  4F4B A;  2L4A A;  1FR0 A;  2K5C A;  4P96 A;  3M1E A;  4R8H A;  2CH0 A;  2KRF A;  5M3M J;  1HLV A;  2Q9A A;  3CUQ B;  3F0C A;  3D0S A;  5E1Z B;  1SVL A;  4ESJ A;  5TRD A;  2R92 J;  2MC3 A;  1C17 M;  3KL4 A;  4D5C A;  4RMN A;  3V7O A;  5FKN A;  2LD5 A;  5HV9 A;  3J7Z I;  1QVX A;  3CMA I;  2QF7 A;  3S14 J;  2OV7 A;  3I5Q A;  2JA2 A;  4IX7 A;  3HRM A;  3EUK L;  4I6Z A;  4I3M A;  4EUK B;  4KNW A;  2EIK C;  4HSR A;  3LQQ A;  2M0C A;  1IO2 A;  4CHU A;  3LSM A;  3TKY A;  4O6J A;  5J47 A;  2E1M C;  3BLY A;  3J80 Z;  4D4X A;  4DIQ A;  3ZMT A;  2ZD9 A;  2WL8 A;  1ZTR A;  3C8G A;  4CCJ A;  2Z9O A;  2Z1D A;  3ZQ7 A;  2ECB A;  5D5W B;  3G6E I;  3H3Z A;  5E3O A;  2DA1 A;  2L81 A;  1ZR2 A;  2R3S A;  5FD6 A;  1R4T A;  1LDD A;  4UUT A;  5GPA A;  5KYN A;  5LFA A;  1ZN2 A;  1OCO H;  4Y15 A;  3CCV I;  4V19 K;  3ZOB A;  1IXR C;  5FLX Z;  2R7V A;  2JRM A;  2JZY A;  5CPR B;  2M5W A;  1WPK A;  1E3P A;  1POG A;  3KE2 A;  5LRS A;  1YQA A;  1BBY A;  4DBQ A;  3U3F A;  2E2I J;  3CCM I;  3I0T A;  4AE4 A;  1R6R A;  4EJW A;  5DUI A;  4XLF A;  2COB A;  3GTJ J;  1CGP A;  4Q48 A;  2E60 A;  3PM1 A;  2E35 A;  5BQT A;  4GYI A;  1B8I A;  2XLV A;  2OQM A;  3PUF A;  1APC A;  1HST A;  4UHT A;  2O6G E;  4M3B A;  2XPU A;  3QRF F;  3MZ8 A;  4NUB A;  2GA0 A;  4CA0 A;  3EYY A;  2A6H F;  2GWW A;  4AL0 A;  3ZQC A;  1SZI A;  4KIC A;  4QI2 A;  3G3Z A;  2QSG X;  1X3W B;  3BR6 A;  3NYJ A;  2KLO A;  5CVI A;  5JUA A;  2CWE A;  2VE8 A;  2VKV A;  3CCY A;  2WAE A;  1GHC A;  2A61 A;  2GWR A;  3L2Q A;  2KSF A;  1YS6 A;  2L7K A;  4B47 A;  1XGM A;  3FIS A;  4L9N A;  3DLL F;  1P6R A;  4ZC3 A;  1U8B A;  1JRA A;  2L02 A;  2J0X A;  3AG3 H;  2OEV A;  3L8J A;  2HV7 A;  2R7D A;  3FAJ A;  3C2G A;  1O5H A;  2E7W A;  3SEZ A;  5TGT A;  2XF5 A;  3U2L A;  3F9K A;  3RQI A;  1HDD C;  2V6C A;  4MW3 A;  2EV6 A;  1TWA A;  2ME0 A;  4MW8 A;  1FFH A;  4HX8 A;  4U87 A;  1EV7 A;  4IJA A;  1ZHY A;  2YEV A;  1YFH A;  2HGC A;  2V1D A;  4B43 A;  3WU2 C;  4U5C E;  2BEO A;  2FF4 A;  1I1G A;  3CUQ C;  4PSX A;  2AU5 A;  2XAS A;  5D92 A;  1JKO C;  1ON1 A;  2HNH A;  4ZYH A;  2AXT C;  4BPM A;  3AL0 B;  256B A;  3WTZ A;  5E3A A;  3BOQ A;  1GS9 A;  3FKJ A;  1G4D A;  4WCG A;  3O3K A;  5JI6 A;  2Y0S N;  2JSP A;  3ULQ B;  2ZJ2 A;  2DJI A;  1A35 A;  3SXM A;  3FXL A;  4X0G A;  1TT5 B;  2FBK A;  3EET A;  5KYW A;  3ZP5 A;  1ZH5 A;  4BJ6 C;  3ABT A;  2R05 A;  4HEA J;  4Y52 J;  4PDK A;  5HVQ C;  1XX5 A;  2J9V A;  5DS9 A;  2PNO A;  5K5Q A;  3HKK A;  3KPH A;  3QWL A;  3QMK A;  3RZO J;  3DU5 A;  1FOX A;  4CSW A;  2BY2 A;  4RAY A;  3C8Z A;  1QGP A;  3K4M A;  2CUF A;  3IQ6 A;  1FIP A;  1Z0X A;  3HJE A;  4YL3 A;  2XLW A;  2QA4 I;  4MO7 A;  2O0Y A;  2VKE A;  3KP3 A;  1OR7 A;  2DA4 A;  5CYV A;  3GTL J;  1Y6D A;  2LK2 A;  1WGW A;  1UAA A;  3BR5 A;  1GQA A;  1ZHX A;  1H8A C;  2K9M A;  1NZE A;  2R93 J;  1U9O A;  2LP0 A;  3WE3 A;  4WX9 A;  4HAM A;  3GZ5 A;  3KP4 A;  4BU2 A;  1HSJ A;  2TRT A;  3WHC A;  1NH3 A;  2VBW A;  2FAP B;  4XKB A;  3I54 A;  3MFK A;  1NK3 P;  3CQZ J;  3OSF A;  2CS3 A;  3ASO C;  3JR9 A;  1LE2 A;  3W8H A;  3AG1 C;  3HXL A;  1VQP I;  5IT3 A;  2DI3 A;  2GA2 A;  1ZGJ A;  2DOE A;  4BAY A;  1MDM B;  1AHD P;  4DXW A;  3WHB A;  2I8D A;  4MS2 A;  3IUO A;  4JX5 A;  1K78 A;  5J4Y A;  1D8J A;  4WXH A;  1OR2 A;  3C63 A;  3VM6 A;  1R36 A;  2PJR B;  4HE8 D;  2GZW A;  3S2D J;  3S84 A;  4XTK A;  2ZJQ F;  3FXJ A;  1B72 A;  4R32 A;  3EGX B;  1WJA A;  2MH2 A;  2W1O A;  1MKM A;  1P4W A;  3ZR8 X;  2MG4 A;  5GAG J;  1U6H A;  4IRG A;  2X9D A;  1FSH A;  3K1H A;  4QPO A;  3O55 A;  4BDY A;  1A5J A;  3QYB A;  4LLN A;  2OZU A;  3I4U A;  3PDM P;  4ITV A;  2L6F A;  4A3C J;  4XEF A;  3MAJ A;  3FXQ A;  1M2O A;  1OCZ C;  4KBL A;  3JRG A;  3EZH A;  4ZZL A;  1OW8 A;  2M3A A;  2BVM A;  2XLM A;  4MVZ A;  4IHW A;  4GYG A;  1NHA A;  1ETV A;  1XC5 A;  3JCU C;  1Y39 A;  3I5P A;  2P7V B;  1W4M A;  4G12 A;  1RR7 A;  3C62 A;  2H8R A;  2WAQ A;  4B09 A;  4LIV A;  1TWA J;  1X58 A;  2P0N A;  1LVK A;  1ZGA A;  2MWQ A;  3AL0 C;  1P2F A;  3WG7 H;  1TFK B;  4I98 B;  3KH2 A;  2OCC H;  4WGZ A;  3HUG B;  4DZJ A;  1REP C;  3JSE O;  3BRO A;  4KMU X;  2BY3 A;  5CKT A;  4O6Y A;  2R5Y B;  1B68 A;  2ZXW H;  2IPQ X;  4HST A;  4LK0 F;  2TDX A;  2DA7 A;  1K6O A;  1ZGW A;  2DPU A;  1DOW A;  3RYL A;  1FZP B;  3CMM A;  3HBL A;  1QSP A;  1T0F C;  2DQL A;  2LKS A;  2XGX A;  1EQ1 A;  1FSE A;  1JR8 A;  4IRU A;  4NB5 A;  3X2Q H;  1N1C A;  1OCC C;  2M7B A;  3L7W A;  1PP7 U;  3GFL A;  2J0W A;  3I64 A;  1W36 D;  3DPT A;  2CNW A;  3ZMS A;  4UUV A;  2OQG A;  2ZB9 A;  3OR2 C;  1YZA A;  5EF6 A;  3CC4 I;  2HMQ A;  2EA4 A;  3VSK A;  1Y56 A;  2V9P A;  3I71 A;  2YPR A;  4QDL A;  3RCO A;  5DDG A;  4LDQ A;  4D7M A;  1ZG5 A;  3ZVR A;  3O6B B;  4D5F A;  1JUS A;  2LH9 A;  1VQ6 I;  2X1D A;  3QPH A;  4M3F A;  3H1C A;  2HWV A;  5J6X A;  2XRL A;  3Q6N A;  2H7O A;  2KW3 C;  2L9R A;  1DPR A;  1K79 A;  1OKK A;  4NQW A;  1QZZ A;  4EM1 A;  2ZFW A;  2Q00 A;  3ZGK A;  2EQR A;  4DVZ A;  3SNH A;  4MVO A;  3ZN1 A;  1TP4 A;  1R5I D;  2BZT A;  3IL2 A;  1TQG A;  1XD7 A;  1ETW A;  4FIS A;  2EH3 A;  5EG0 A;  4AWX B;  1WRJ A;  2OZ6 A;  5DEQ A;  3GO5 A;  5JSL A;  4F3Q A;  1E84 A;  2OA4 A;  1YO5 C;  1GXP A;  3QU6 A;  1YJ9 I;  3LFU A;  2B63 J;  3GEE A;  2MLK A;  4P9F A;  2G62 A;  4YT8 A;  3S2W A;  3JSO A;  5EJC A;  3V5Y A;  3OEO A;  1B4A A;  2DT5 A;  2WAF A;  2VQG A;  3FBI B;  3HGY A;  4CCK A;  1ZLK A;  1KA8 A;  4RGU A;  3ZQF A;  3OV8 A;  3B02 A;  2KT0 A;  3H2U A;  3LS0 A;  2JPU A;  2XB0 X;  3QYF A;  4L0Z B;  1LE4 A;  1ZW3 A;  5DS4 A;  1E85 A;  5LGU A;  1WZ2 A;  3CO6 C;  4B1R A;  3ROU A;  3ECS A;  2J7P D;  3DTI A;  3IRQ A;  1FT9 A;  4PFP A;  3RTR A;  4BQN A;  5L3Q A;  3E7L A;  1OMI A;  3MD2 A;  3D5L A;  5CVJ A;  4JTC B;  1OCO C;  2WVQ A;  4XN0 A;  1KTM A;  1X3U A;  5COG A;  3CUQ A;  4A3L J;  4I7H A;  5D91 A;  1WWP A;  4YEJ A;  2VCC A;  4XLN F;  2PMZ N;  3I5U A;  1DU6 A;  2X4H A;  4NNJ A;  1AKH B;  1VQ7 I;  4LDK A;  3TP3 A;  4ZDP A;  3FDQ A;  3U1K A;  1U2W A;  4X0R A;  1SEU A;  3KLO A;  4BXX J;  1LS1 A;  3PQK A;  2QKL B;  2K40 A;  3CJT B;  3GFM A;  3SXK A;  3VFZ A;  2STW A;  3OYL A;  2BE5 F;  3FXM A;  3M15 A;  4ZJZ A;  4JZA A;  4A0Z A;  4B4C A;  1NFO A;  1MBH A;  3UMH A;  2WBM A;  4BJ6 A;  2VQL A;  4CS9 C;  2A68 F;  2R7O A;  3NQO A;  1TWG A;  3K6B A;  4GQH A;  3P9C A;  4PGG A;  3S3M A;  1V54 H;  4FX5 A;  2MC4 A;  2EFP A;  1IRF A;  4E0H A;  5LBQ A;  2XC7 A;  2ZJP F;  2ZJR F;  2YR2 A;  4E7L A;  2VOD A;  1ZG1 A;  3FX3 A;  1BOB A;  2CW8 A;  1BR2 A;  3K10 A;  1V5G A;  3RIR A;  4D1Q A;  4O5V A;  3ZQL A;  4A3G J;  2IA0 A;  1V74 B;  3HTK C;  2HOA A;  2IT0 A;  4J7T A;  1EF4 A;  3Q5F A;  2JVH A;  3U2R A;  1UG0 A;  2DOD A;  4LJZ F;  4HDV A;  2L6G A;  4DJ9 A;  2JPB A;  2PLY A;  2LQG A;  3KP6 A;  1S7O A;  3AG3 C;  5D5U B;  2VQH A;  3IQ5 A;  4QIW N;  5KK1 A;  2G3V A;  3L34 A;  4B3A A;  1R00 A;  1KON A;  4ENN A;  2R7X A;  3KET A;  1Z6R A;  2FQ3 A;  4XPX A;  2HQ5 A;  3CTA A;  4FT8 A;  4FE7 A;  4DJA A;  1ZLJ A;  5JLW A;  4Z2Y A;  1IN8 A;  4E0I A;  1QHH D;  3ABL H;  2RD9 A;  4BYY A;  4JQF A;  3RPQ A;  5B3S H;  3JRA A;  2VC9 A;  1UHW A;  1SFO J;  1GM5 A;  4PJ0 C;  1UG2 A;  5FZT A;  3K7A J;  4ZLD A;  1XB4 A;  2IXS A;  2KJG A; 
#chains in the Genus database with same CATH homology
 3KPH A;  2ICW G;  2OJE D;  1R5I D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...