2OJED

Mycoplasma arthritidis-derived mitogen complexed with class ii mhc molecule hla-dr1/ha complex in the presence of edta
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
214
structure length
214
Chain Sequence
b'SMKLRVENPKKAQKHFVQNLNNVVFTNKELEDIYNLSNKEETKEVLKLFKLKVNQFYRHAFGIVNDYNGLLEYKEIFNMMFLKLSVVFDTQRKEANNVEQIKRNIAILDEIMAKADNDLSYFISQNKNFQELWDKAVKLTKEMKIKLKGQKLDLRDGEVAINKVRELFGSDKNVKELWWFRSLLVKGVYLIKRYYEGDIELKTTSDFAKAVFED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain prec
publication title Zinc induces dimerization of the class II major histocompatibility complex molecule that leads to cooperative binding to a superantigen.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 81
structure length 214
sequence length 214
chains with identical sequence H
ec nomenclature
pdb deposition date 2007-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF09245 MA-Mit Mycoplasma arthritidis-derived mitogen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.530 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A mam-mhc complex, Chain D, Domain 2 2ojeD02
1.20.120.390 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hla class ii histocompatibility antigen, dr alpha chain. Chain D, domain 1 2ojeD01
3KPHA 2OJED 1R5ID 2ICWG
chains in the Genus database with same CATH superfamily
1FZPB 2EK5A 1IN8A 2HXOA 1WFXA 4M73A 1RR8C 2OEXA 2H94A 1STZA 2BE5F 2EIKH 3RKQA 4I99C 3KCCA 1X1AA 3AQCA 4ANJA 3M8EA 1OISA 4O6MA 1XC5A 2P6TA 3BR6A 3AFHA 5E79C 4V19K 4MEXF 3LNMB 2ZFUA 1EKEA 4HLYA 3GTGJ 5CQEA 2QSGX 3ZOBA 2PX3A 4FHTA 2G9WA 1KZHA 5FB2A 4E7KA 3JRFA 4A3MJ 4XONA 4N0BA 4BDYA 2JA7J 3L0IA 4WK8F 3EH2A 2JPUA 3JCUC 1ZH5A 3U1KA 1OCRH 4FISA 4RMNA 4NC7A 1YJNI 5IT9K 4I1OB 3H2VA 3ATPA 4D5CA 4P55A 1B8IB 4FTHA 1IUYA 3J80K 2R02A 3BZ6A 2XM0A 4XPXA 5JP7A 1Y8QB 3UMIA 2X1DA 3DPLC 3F8MA 4D9JA 4V2FA 2DOEA 3CC4I 1NFNA 4S04A 3ZQCA 2NS8A 2A5YB 3MCZA 5D6EA 3NG1A 1TW2A 2HKOA 1Y6DA 3K1IC 3OIPA 3ZXSA 1Y0UA 3BY6A 5A6KA 1J09A 1XCVA 2XM4A 1TFOB 4A2NB 3D5LA 4K0DA 3QW1A 2H1LA 4DBRA 5KAFC 5IY5H 3RF3A 4B6IA 3ITFA 1Z23A 3MFKA 2OEVA 1HY5A 3K4NA 5BNGA 2WZLA 4MTOA 1KTMA 4Q47A 3N05A 3HKKA 4AL0A 1YYJA 1FNNA 2CFXA 1MDMB 3ABMH 2KGOA 4BXUA 2FGYA 1T39A 1E3OC 4JEBA 4IRUA 2M8EA 4E4HA 5E33A 4HQEA 2IXNA 2RD9A 3EH1A 4NB5A 3NQOA 3SXMA 3ERED 3CLQA 3ESWB 3FKJA 3O10A 2QA4I 2WB7A 1OCCH 1ZGWA 4NBQA 2LP4A 1BIAA 3GTJJ 1W5SA 4A5NA 2V1UA 2DJNA 3BG6A 5DVWA 1R1UA 5HNFA 1VF9A 3KP2A 3SZTA 2IA1A 2ZMEB 3GM2A 2KMUA 2Z99A 1V55H 2L01A 1D0XA 3SEOA 2JVGA 1NK3P 2H27A 3GF2A 1ORSC 3CQZA 4N9HA 1FJLA 3ZG1A 3IQ6A 4L9JA 3SZPA 1ZG5A 4Q5SF 3E6MA 3S15J 3RYLA 4IRGA 4YT8A 4RM2A 2YU3A 5F08A 3ZMVA 4FASD 1K4SA 2IS4A 4KNYA 4ENJA 3MLGA 3D5SC 2KT0A 3K2AA 3T0YA 1BZ4A 1MBKA 2WL8A 4XICA 3H2UA 4N06A 2HKXA 3ABTA 2M34A 5CVVA 1TZLA 1JPJA 2LYCA 1EH8A 3S2WA 1WWPA 2G7HA 4Z9HA 4UV9A 1YG2A 2ID6A 5ICEA 3G4ZA 3NYLA 1ZW2A 4WGYA 3ZDLA 4JW1A 3GTQJ 2PF4E 2VJ4A 2ASRA 3AG4C 1LS4A 3CJQB 3PNVA 4AUXA 4RS8A 5EDNA 2VC1A 2HOEA 3OYMA 5JS5A 3G4XA 2R7WA 2PFDA 2LFDA 4L6RA 3IH4A 4HYEA 1BR4A 2G62A 5KCMA 2QEXI 3IQTA 4DYCA 2W57A 5E17F 3T6BA 2R0QC 3NARA 4F3QA 3IKTA 4F93B 1SZIA 1B8IA 1MW7A 2RSEB 2MYSA 1Y1WJ 3FXHA 3FMRA 4AYBN 3DTKA 4LFUA 4CA0A 1DU0A 3F22A 2P4WA 3FXRA 1WQ2A 1Z7Qc 3SQNA 3FHDA 3ZWIA 4JP0A 5TGTA 2Q00A 1U78A 2CRGA 1MD0A 2E2IJ 5D91A 5LD2C 3LNRA 2NG1A 4F7ZA 3T1BA 4FX0A 4U9DA 4KN4X 2DFEA 5L3BA 1QKRA 4I3MA 2DXIA 4GO1A 2IP2A 1P4XA 3PQKA 3NKDA 1D3YA 1FT9A 1UZCA 3A4CA 2YLGA 4EEFG 5KK1A 1MDMA 1AUEA 1LPEA 3BZCA 2FA5A 5ILVA 2XDVA 1S9HA 1Z7UA 3LESA 3EETA 5F0HA 2XKOA 5FFXA 1G5ZA 1WJEA 3KYDB 2I8DA 1VQ5I 4HX7A 3UGPA 4PSWA 1YITI 3NWSA 3LJBA 4PZJA 2WVQA 1B68A 3KL4A 1U0BB 3HM5A 1R00A 3V7RA 4GGGA 1D8KA 4J32B 2DYSH 1IUFA 2DTZA 2XLOA 3B0UX 3GORA 1ZZPA 3VOEA 1ON2A 5KYXA 1U6HA 3HRMA 3OYDA 5LEJA 1WJCA 2KZVA 2P5KA 4AU7A 1FBSA 3CO6C 3VODA 2ZMEA 4YRVA 1S72I 2XLHA 5T3WA 4WCGA 3PIOF 5TJJA 3W6JB 5HNHA 2H7BA 5DLJA 3S29A 1G4US 2HPIA 3HKZA 1F43A 4EM0B 2LKXA 3KX2A 2X6WA 3F3XA 3CUQC 3TO9A 4IL6C 2VPRA 2M4GA 2KHMA 3OV8A 3M07A 5DYMA 1A36A 1GHCA 3GVAA 2XLEA 4UB6C 1QHHD 1IGNA 1PUFB 2EA4A 1VQ7I 3NYMA 1RZ4A 5KYUB 3CCLI 3PUBA 2ICWG 1P2FA 4BNCA 4JCHA 5H6RA 3HEFA 5JLIA 3JREA 2AWYA 2OJED 3ZQQA 2IXPA 3ZQVA 3FF5A 2KSFA 1ETKA 2R7FA 1CGOA 3L09A 1K40A 2BBYA 3FMQA 3Q0VA 2CNWA 5J47A 1YS6A 2GLOA 3RSNA 3E3VA 4DZPA 2ADUA 3D0SA 2JA6J 1JI8A 2K9LA 1XZQA 3CTAA 2BL2A 3BJAA 4U0WA 5CLSA 3T9OA 2NVYJ 3NMKA 1OR2A 4YIFA 4U9EA 2W84A 2XB5A 3S0XA 2PJPA 2V6CA 4Y52J 1QO0D 2M45A 4IEJA 3NEUA 2RN7A 4IKFA 1JAFA 3WHNA 4LOCA 1R71A 3NWTA 3OWTA 4XLNF 2JUCA 4MW8A 4EBKA 2QM3A 3BP8A 3F6OA 1T98A 3TULA 2LK4A 3RCOA 1ZGAA 3RQEA 3FXOA 4RB3C 4AL1A 2PI0A 1LI5A 2DLLA 2JRMA 2NOJB 5B3SC 3JTHA 1QVUA 1SR2A 3H1CA 3HHHA 1MBFA 4AC0A 2LR8A 1R9TJ 4XSXF 2R5YB 1E84A 1W4MA 3FK6A 4CDVA 2IYLD 3EUAA 2V1XA 3S27A 3HRTA 4LERA 2DPDA 1FEXA 5DD4A 3NRHA 2DK5A 2Z5UA 4PUSA 1OJLA 3GUDA 1Z63A 2UZKA 2R7QA 1T33A 4BU2A 2G3KA 4UUSA 3LOCA 3MWMA 5DCMB 4FX5A 2JA2A 4W97A 1K6OA 2HDCA 3IQ5A 4XIDA 4LIUA 4DZJA 3GWLA 2EZLA 2YLIA 2WZFA 2RDPA 2XS8A 4XLEA 4YELA 5K7HA 1IXCA 1F9NA 3MAJA 3SEQA 2AS5F 4UDVA 4CH7A 1Z3XA 4Z9JA 1YX3A 1DGWY 4OMZA 4ZH4F 2VQCA 3MMYB 2CSOA 1FOKA 2QQ9A 3AKZA 3OIOA 1VQOI 2FF4A 2CWEA 3LS1A 4MVSA 3QAHA 1TP4A 1ETWA 4XORA 1FYMA 2ZJPF 2GXAA 1OLTA 1B9MA 4J19A 1PP7U 5FO5A 1MH4A 1R1TA 4BQOA 1R36A 4R79A 3ZQ7A 2DBBA 4ZLDA 3R0AA 2V9KA 4P96A 1QZYA 2HOSA 3FXMA 3CZ6A 1M2VB 1OXBA 3C18A 2M9HA 2ELKA 1W5CC 1VLTA 2DA7A 5FFZA 1K4TA 4G7OF 1EKYA 2JA5J 4D0PA 3A9CA 2G7UA 4BACA 1PUFA 2E5NA 4A3LJ 4JKVA 3UNGC 3K33A 1HW1A 4MLOA 3VFZA 3OR1C 4K1OA 3E5UA 3DM5A 4ZTFA 2L2OA 2Y9YA 2HYJA 1FBUA 4XLHA 2CH0A 4OOIA 1ZAOA 2ZJRF 3HPHA 4GFBA 1JUSA 4YFXF 2MGQA 5FLXZ 4A3DJ 2K4JA 3WHBA 1TT0A 4B3XA 4BJTA 1G3YA 5EGOA 3ZSUA 1EV7A 4ZDOA 4WWCA 1MMDA 5GAHJ 3ZC4A 3HKZN 5J4VA 4NCQA 3MKZA 4JRZA 4BDZA 2PP4A 2CW8A 1KU3A 1HA8A 3SFZA 1OCTC 3MX3A 4BH9A 1XGNA 2F5DA 3N24A 3FXLA 2M4KA 4LDQA 3BROA 3U0CA 1OYIA 2HSQA 2IBDA 4PJNA 2R5YA 5AC5A 4KITB 4DNCA 2NNYA 3S1MJ 4AVZA 1SD7A 2H8RA 3EYIA 2VXDA 4M3BA 2L9JA 4XPYA 2EIJH 3HTSB 4CXFA 5D5UB 2OG2A 1TLHB 1HXDA 4RGRA 3S3OA 1JMWA 4L0YB 3K1IA 3GO5A 3MYFA 1QSPA 1YX5A 5DCMA 3JSPA 1I50J 4UXNA 4M74A 1LB2A 1ZHYA 1YW8A 5CVJA 2M4EA 4B8XA 1BM9A 1T6IA 2Q9BA 2E7XA 3DM9B 1DPRA 2GWWA 1VQPI 2HTJA 5JFRA 2F5VA 2GDCA 1WJAA 5E1WA 3CC2I 5JT4A 5DS9A 2J9UA 1TL8A 4KIGA 1ZLJA 4IO9F 4CGZA 1IXSB 1YOVB 2F4OB 4RBNA 2I8BA 4BJ6C 2XXAB 2LKPA 3N2ZB 2Z15A 3VM6A 2LG4A 3H0GJ 4OAYA 2Y0MA 2W45A 2IS6A 1SVMA 4C3IJ 4HSRA 1LJ9A 2VJJA 1MMGA 3DKWA 2J9VA 3ZTMA 1S7OA 1VZ0A 2KYHA 2L9RA 3K0LA 5BOXA 4DVYP 1ZELA 3GMEA 1OKKA 3OL3A 2CGPA 3PJRA 1YYVA 1WH7A 2LRDA 1M2VA 2NPUA 2OU6A 4G78A 2XSEA 2VCCA 4M3EA 1W0TA 3GWNA 3KZIC 1BI0A 4G9YA 5K0IA 2QGUA 3DBHB 1RKCA 2W85A 5LLQA 2CJJA 4OIQF 1XGOA 4JE9A 3LSMA 4WXCA 2ZBKA 4MTGA 3GODA 4S05A 4YWQA 1K05A 4EM2A 3OYBA 2KIUA 3CUQB 1Y39A 2PMZA 2G3VA 3QPHA 2FE3A 4BHCA 1UELB 4IAOA 2L5QA 1XG1A 2YKZA 2R7OA 3BZKA 3M9AA 2XL6A 3L9FA 3TDUC 3KP7A 1WJ5A 1R58A 2RKHA 3Q6NA 2K5CA 2DODA 5B1AC 4MNDA 2MLKA 1KONA 4JX5A 1ORYA 1BBYA 1MJBA 2Q7RA 3L8JA 2A1DD 3JRIA 2ZO4A 4CICA 3V42A 2QKMB 2B0HA 3U2RA 4P9FA 1MBJA 3OMYA 3W6VA 2Q1ZB 5D8KB 3OYAA 2DGJA 1JTXA 3OYEA 5HS9A 1M1EB 2EFWA 3OSFA 2IOQA 4KT5C 2LLKA 1RKEB 3H3UA 2WVNA 2ELJA 3ISPA 2VKHA 5AONA 4IHXA 1UHSA 2BY1A 4BG0A 1BI3A 5EEGA 1XCBA 3LL7A 2QKLB 1U8BA 3JT1A 3U5SA 2F4IA 4LB6B 1TWAJ 1WCMJ 3QTHA 2DDBA 1QNTA 1WZ2A 4XEKA 3V4GA 1C17M 2OPTA 2DU9A 3QU6A 1TW3A 3B9QA 2KQRA 4Y4RA 3AG2H 4EIYA 3DWLE 4P6IC 2R5ZB 1EI7A 2NVTJ 4MFDA 3DKYA 3HSFA 4HPQA 2ECCA 2XASA 3I3LA 4L5EA 4CCMA 256BA 4O5VA 3G4SI 3DP7A 2L3DA 4I09A 4LG3A 2VKDA 4CJOA 3DU5A 2XF7A 1G59A 5JI6A 3TEDA 1W36C 4ENKA 4LLNA 2HMQA 4A69C 3TOAA 3GX4X 5DCFA 4U5EE 3HNIA 4KMFA 5D5XB 4XMYA 5M3MJ 1YARO 5L3VA 3S1QJ 4OIRF 4HA8A 1PDNC 2DAOA 3J81Z 3AG3C 3DPUA 5T1DB 1ZARA 4PJMA 2Z9OA 1YFHA 2BZTA 3K10A 2FX0A 4HF1A 5COGA 3L00A 4PFPA 3CCSI 3EZIA 3BG3A 3ZPLA 2XXAA 1MH3A 3HOXJ 1REPC 4JYKA 4M3FA 4ULWA 1NTCA 3IH3A 2ZXRA 2P8TA 1SAXA 2B63J 1E2XA 3WU1B 1V5FA 1PV3A 5FD5A 4EATA 2DOFA 3WU0A 2OTLI 5KVRA 3DQVC 2L81A 2ZFWA 4PSXA 5LGUA 3BTCA 3RIRA 3U3FA 2F5FA 4KYWA 2J8WA 4MVUA 4KNVA 3CO7C 5EG0A 4A93J 5DS6A 4G0HA 3BR3A 5A2QZ 3LSKA 5L0DA 2C04A 2MLGA 3CCEI 4BL0B 3WU2C 5IYDJ 1BR2A 3CUQA 3I0TA 4NUBA 2M3AA 4EJWA 3HNLA 2E1CA 4ASNA 3TOMA 1YJ9I 5LHGA 2L6HA 4J30B 3KEQA 5JUAA 4O6JA 2FFHA 4CS7A 3H35A 2B9SA 4O79A 2BEOA 1FP2A 2RGVA 1CPRA 5CKTA 2QF7A 1FPQA 4C30A 1L0OC 2VL8A 5DUKA 5GTHC 2DA2A 1VK5A 3ABKC 4KBLA 2VIXA 1T6UA 4KMUX 3I4PA 2HJ3A 2L7ZA 2R7UA 1W7PD 4LITA 1QQIA 3S8PA 3C8GD 3I9V2 1OYYA 2OF7A 3F8CA 1RKEA 2XGCA 2F2EA 2IGMA 1F4KA 2PLYA 1F1MA 3ZQLA 2GOXB 3DPTA 2B0LA 1JT6A 1G3WA 2HZTA 2DO7A 2IGKA 4KUMA 4IRIA 3VSLA 3GTOJ 4I0BA 3TJ6A 1HF0A 2Z2SB 3S84A 4D4XA 3ERMA 2Q2EB 2QUPA 4UY8I 1OCZH 4F55A 1WGXA 4BUPA 1RKWA 4M3DA 2FU4A 3OYLA 3I4UA 4BPMA 1RR7A 3M4BA 3ZR8X 4DJAA 5ICGA 1BW5A 2DA4A 2FQ4A 4XKBA 3KYJA 3FZVA 2HI3A 3GFIA 4XLFA 3HOVJ 2ETHA 3Q6MA 1VQ6I 3FBIB 3GFLA 3Q7GA 1RUOA 2J45A 4A12A 2PMZN 3GANA 1QVXA 4JOMA 2XV4S 1EF4A 3L2WA 1J8MF 3S90A 4X0RA 3RPQA 4U5FE 2BXYA 4Y17A 2ZJQF 1O3QA 4B44A 3B29A 5COFA 3K2ZA 1D1BA 1J0RA 3S9OA 4E7HA 3G1MA 4I2OA 1MBHA 2JPBA 2YVKA 4XOPA 1TR2A 5D4RA 3DKAA 2E19A 2OZ6A 2XB0X 5ILSA 4HRIA 1IDYA 3Q9VA 1CGNA 1NU7D 1V4AA 1R23A 4QIWN 3O8HA 3JAMK 3G2BA 4G6TB 4XKCA 3BTLA 4KJZA 1O4XA 3GZ5A 3T8TA 4OIOF 4Z2YA 1QRYA 1RCPA 2WZGA 2XL8A 1YDIA 1R5ID 3DE8A 2L4MA 2KRCA 5HSWA 3RQGA 1ZW3A 3RKOF 4PACA 1R6RA 1WJDA 3S2DJ 3BCAA 3S2HJ 5COMA 2VODA 2NRAC 2R3SA 1YVIA 4AIJA 1LIHA 3ML6A 3ASOH 5JHFA 1NG6A 4CYCB 3GCMA 3W4YA 4BKXA 2ZXHA 3TO7A 3VRCA 4RAFA 4QPQA 1A04A 1A7VA 1KNYA 1SC7A 4M72A 2L54A 5FROA 1UAAA 4GYIA 1Z3YA 1NU9C 3NMJA 2A6EF 3SDBA 1JJ6C 3HRSA 1S3JA 4WGZA 4L9TA 2IRFG 2DTRA 1H8AC 2CV1A 4WXHA 1IRFA 3D5RC 2AU5A 3WGIA 4IX7A 1FOXA 1V54C 4GDFA 4U5HA 5B3IA 4AIHA 2FSWA 2J5PA 4DVZA 5LGTA 1U5TA 3BG7A 2XAJA 1UG0A 5J4YA 4KNWA 3RPUA 2DYRC 3W8IA 1BW6A 2YRFA 4CCNA 1KGSA 1FOYA 2HPMA 3W2AA 1Z67A 2X6YA 2H6BA 4ZYDA 4LK0F 4II2A 3K66A 4LLEA 2CW0F 2JZYA 2CQQA 2LF8A 2N8GA 2HYFA 2VE8A 4G7HF 1FIPA 4E7LA 1HE9A 3E6CC 3RH3A 2Q2EA 2X1EA 4A3CJ 3MZ8A 3AG1H 3U9MA 5JVEA 4LD5A 2XAUA 1ULYA 1A35A 5CJ9A 3RZOJ 4BQQA 3V8KA 3E5QA 1XB4A 3QPTA 1FFHA 3JRDA 1Q0FA 3FOOA 2JUGA 5B1AH 5J8CA 2Z33A 2MWQA 1X2NA 1FC3A 2EILC 3PM1A 3BR2A 5CI9A 4XTKA 1ZGJA 3RKXA 1VMAA 4CDGA 3RQIA 2CG4A 2J0WA 4IWBA 2Z3YA 1K7AA 2A07F 1T01A 4U5BE 1QGPA 2HNHA 1K04A 2OCCC 3LA3A 5M5YJ 4LLGF 4M3GA 3TBIA 5FLMJ 5J1YA 4HFFB 1IRXA 3RDIA 3JYHA 3GLLA 3F23A 5J40A 3TD7A 2WADA 3POVA 3IL2A 1KA8A 3ASNC 4ZC3A 2EV6A 1Y1VJ 4CSAA 1UCRA 3TGNA 1J9IA 1ONVA 1SYQA 4CIPA 4HBLA 1HKQA 1HSTA 4HNUA 1DPUA 2VOPA 3HOYJ 4LDRA 1G6NA 2QYOA 3CAXA 4A2UA 2IBFA 4KC9A 5EGYA 1O5HA 1X3ZB 2IXMA 5E20A 1Z91A 5C4XJ 3S17J 1ZU4A 1DUXC 1TQIA 4HF0A 1O87A 4CYCA 4KICA 2PBEA 4BJ6A 4GEHA 3QP6A 5KYWB 5KYYB 1MNDA 1U9NA 2XLMA 1YJWI 1KU9A 1VTMP 3FDYA 3K4JA 3M4CA 4GYGA 4L9VA 3K1MA 2DK8A 1XMKA 1VQ9I 2YL7A 4I1MA 3ZMDA 3IC7A 3BPXA 1C0WA 2OKUA 3AOUA 1LE8A 5F0CA 5L0CA 2KRFA 1EH6A 2RC4A 4C2TA 3E1SA 2R7ZJ 2Q8KA 1SMTA 4KIFA 4MO7A 5ICCA 5F27A 3D1NI 4X6AJ 1U2WA 3C3WA 3US6A 2NSFA 2FJ1A 3KETA 3JRBA 1BC8C 1C02A 4YL3A 5L3QA 2X0LA 4JK1X 4RLQA 1MIJA 1DP3A 2FOKA 2NAZA 2LREA 1ORJA 2XAHA 3Q9SA 3PMRA 2H7VC 3FBNB 5L3GA 3FOPA 1T2KA 1BOBA 1QBJA 2R25A 3M79A 4B1RA 4BE0A 3BQYA 5J1UA 5JSLA 3WTWC 3U2LA 2DN0A 2R7VA 1R4MB 5DQTA 5KHDA 3HHGA 2ZKZA 1A41A 4LMYA 3EGDB 4JZAA 2HEOA 2RQQA 5IT9Z 5TJ5E 4I76A 1SFOJ 1K79A 4RBOA 3J80Z 1T6QA 3QVYA 5ERIA 1N78A 2HQ5A 2O9XA 4FE7A 2JQ7A 3E9VA 3JR9A 2HFHA 2DQLA 1EA8A 2XF6A 3GEIA 4JVSA 1GVDA 2ZSHB 3CQZJ 2ESHA 5AIPA 1T56A 4PCQA 2LY2A 4OIPF 5FRNA 2Z16A 3HOTA 3I4NJ 4MTFA 2CV0A 3CDIA 3G1OA 3K70D 2WB1N 1B1BA 2CNWD 3QOPA 1TKNA 1S5LC 1FOWA 5H2FC 3S14J 1I1SA 4YL1A 2YX4A 1VLSA 3LSGA 4PK4A 5HVQC 3GTLJ 2DOAA 1PUEE 2LBFB 3CC7I 3LA2A 4YT4A 1FNTc 1VQLI 2JPCA 5H6QA 1JOGA 3KYCB 3BTIA 4CCJA 1CPQA 3H9GA 1RPWA 2O8KA 2VPLA 2GIZA 2DA5A 3T4RA 3BR5A 4DYRA 1LVAA 5E3LA 2CUJA 4IAQA 4Y15A 1MKMA 1UMQA 1D5VA 3EPZA 3KMIA 1D0YA 1LFBA 5TRDA 4A0ZA 1WHUA 4HQMA 2IS2A 4ZLCA 3EJNA 1USSA 3K6BA 2OAZA 4JX4A 5FKKA 4ZDPA 3VDXA 4FE4A 1ST6A 2IJLA 3S3MA 2DW4A 2WAQA 4D7NA 1PP8F 4A3BJ 2HGCA 2B0JA 4LG0B 2E71A 4JC7A 2O7OA 3RJPA 3GTPJ 3HSRA 5KYWA 9ANTA 4RDAA 3HXLA 2L7FP 4XK4A 1QPIA 5KYYA 2M64A 4EHPA 1TQMA 1HE1A 3I4MJ 2JVHA 4U5GA 2E87A 3CMAI 2L6GA 2GOMA 1MNEA 3HTKC 3S32A 4C9YA 2ECBA 1V5EA 1RUNA 2IW5A 3MKLA 2STWA 2FMLA 1RJ9B 3KYIA 5F1RA 3LSIA 2ESNA 1H7IA 3QVZA 2HR3A 1X1BA 3V7SA 4C2MJ 3HRUA 1FLIA 4CX9A 4R1HA 3RI4A 1TWGA 3LFUA 4NNJA 2R7SA 2KKOA 5CIVA 1ZHFA 5F5FA 3B0VC 2CS3A 3HG9A 1ORKA 2VASA 4YIRX 3E97A 1ZTRA 2Z1DA 3WTYC 1ITYA 2D5RB 3MZHA 4CS9A 2YU9J 4G6DA 4CIHA 3F8FA 4LACB 3KH2A 2MA3A 2CCYA 2LTPA 2AQFA 3DU6A 3HOZJ 1ZREA 1ZU5A 2DCEA 2QENA 3TJ5A 4HW0A 1I27A 4QWQA 2CDQA 4MVQA 3R6SA 1HW5A 2IAIA 2VQGA 2WAFA 3I54A 1GS9A 3FHZA 3FXJA 1VQ8I 2PX0A 1O7FA 2M8GX 1A7DA 1IRGA 1I3QJ 1JHFA 3ABUA 1T95A 1IF1A 3IQCA 2DA6A 2ACJA 4CSWA 1O3TA 2VJ5A 2EJRA 2BV6A 2H09A 4KA4A 1Z77A 3NRVA 4CDAA 2XLWA 3VYUB 5FKNA 4M63A 5HDGA 1ODDA 1P6RA 1VNDA 2XSJC 3PQJA 4GRIA 4ITVA 4NDLA 5HLTA 3DLLF 3RVZA 5F5HA 2DT7B 5AC4A 1ZHWA 1WRJA 1TWGJ 3TOLA 2LBFA 4X0GA 1CGPA 3JTLO 3PNTA 5M3FJ 5IOZA 2STTA 2IEKA 5KAIC 3TDZC 3PCVA 4C3DA 2J7PA 2RNGA 4CBEA 5EF6A 5E2QA 3I53A 2QCOA 4BXFA 4UNOA 1K83J 1E17A 3J7AY 3L8IA 2X4HA 3I5PA 1S05A 2XS1A 2W4MA 3EHMA 5GPGB 1VB5A 1ETVA 1APCA 1A6IA 2EB7A 2HUJA 5IP7J 1MBEA 5CQGA 4DYQA 3KYLA 3EPVA 3NYJA 3U8VA 1IN5A 3DAFA 1XZPA 3JCUQ 2MC4A 1YYXA 2VKVA 1YZCA 1SANA 2BHZA 2PBIA 1WATA 3T6GB 2X0CA 4UHTA 4Q48A 3OA1A 1ETYA 4O3MA 4LG0A 3KPHA 2KC3A 2EILH 1LDDA 4IHWA 1B9NA 2XSDC 2R7RA 4GCVA 1UHWA 3JSOA 1Z1DA 2MHRA 1KQ0A 3FMSA 4BQAA 4HAMA 4ZJZA 4NC3A 5IT3A 4RLFA 4XRSA 2WWYA 1RJ9A 3HC7A 2K9NA 1JUPA 4S0HB 4EJVA 3CCQI 2XC7A 2FOWA 3B0PA 4EBBA 1NH3A 3I71A 5B5EC 1TWHA 1ZN2A 2M0MA 3ZMUA 4OINF 2J0XA 3JRGA 5KYUA 1BIBA 2DA3A 5LRRA 3RYRA 3V8JA 1XS9A 2BC5A 1A0BA 1TT5B 3DI5A 5EHHA 1SAUA 4G8XA 2VB6A 2CUZA 1GLNA 2VC0A 1GQAA 2VBZA 1WJBA 1P4WA 2KFDA 1YRNB 3F47A 4PJ0C 2DMTA 3RKWA 4A0YA 3ABLC 3DZAA 3OEOA 1ETOA 1XD7A 5HLGA 1OKKD 2WAQN 1OQCA 4I44A 3Q5FA 3K9TA 2UV1A 4D7MA 3HOUJ 3KP6A 2PMUA 3U2MA 1LEAA 3FAJA 1B59A 3KP4A 2YUSA 5LEKA 2L7AA 5HS8A 5BQHA 2J9WA 3WTZA 4RA2A 1S7ZA 1VTNC 2Y3DA 2VONA 2NOGA 2CV2A 1WGWA 3VEPA 4BJ5C 3RFYA 2D2WA 2E5ZA 4UUTA 2YWAA 3H3ZA 2JK3A 2MD5A 4BS9A 1A31A 4ZZLA 3N0TA 2ZC2A 4MS2A 4MHGA 2RNJA 1TWHJ 1IO2A 1L7CA 1ZR2A 1DQUA 3EDPA 5F28E 2A0UA 2LQGA 3WHCA 1YS7A 1NG1A 2NSGA 3JSZA 3WAQA 4G6QA 1VQNI 5L3FA 3AG4H 4AVPA 1XX5A 1FYLA 2V9VA 2IXOA 1LFUP 2GAQA 4TV7A 4H0EA 3C8ZA 4IQJA 4RGUA 3OSGA 3LEVA 3K4LA 4X1EA 2R03A 2FUG2 2ZNYA 4JTAB 1V74B 3CEXA 3TW6A 1PJRA 3TMOA 4HG2A 1TWFJ 3AAFA 5HV9A 3NAUA 4DQ2A 5DM6F 1HDPA 3WTUC 1ZRCA 1X1CA 5GADJ 5IP9J 3MKWB 1I4ZA 2H6CA 4MQ9F 4RAYA 1X3UA 3V8LA 3GTKJ 1QQ3A 3O6BB 4N4NB 4IPAA 4XLAA 4Y3OA 1X4OA 4GXOA 4A3JJ 4XWJA 1JXSA 4ABZA 3DBRB 1Z0XA 2D4UA 1TFKB 3VYWA 3RZDJ 3CJTB 3TP0A 2KK1A 1P9QC 4J01A 2CU7A 2M87A 3JRAA 2GM4A 3DEUA 4UVCA 3SYNA 4WJ0A 4BE2A 3B6CA 1XSXA 1V3FA 1Y0NA 3CUOA 3OR2C 5JVTA 2EIMC 5AGFA 5J3LA 4E17A 2XUBA 3DMDA 3QPSA 1TNTA 2L9SA 2J46A 2Q9CA 4M71A 1SFXA 1YLMA 5DS4A 3KP5A 4EJUA 4XRMA 1BJAA 2J9BA 3EG9B 1O3SA 3O6XA 1B6AA 1LDJA 1M56C 2WA0A 1UG7A 2QLAA 1FSEA 4UUVA 5FCLA 2KIQA 2AVKA 4JX6A 2Q0OA 2W4SA 1ZHZA 2QE9A 5E3NA 5J6XA 4BBSJ 1U6GA 1CGME 1LE4A 4YIIA 2XAGA 3W3CA 2EPOA 2OV7A 1MGTA 2JTVA 1J75A 1UHMA 1YRNA 3QW0A 3K1NA 2GZWA 3HUGB 5DS5A 1ZHTA 1WI9A 2NUTB 2MG4A 1I6XA 4IARA 1IDZA 3B73A 2R7XA 3OOUA 1LE2A 1ZVZA 3T5XA 2TMVP 1POGA 1UFBA 2Y3HA 3M15A 4IHVA 3WTTC 3JTGA 2KISA 3ECOA 3WG9A 4RB2C 3B6AA 2VUMJ 2PG4A 3QOEA 2HVSA 3OOPA 2NUPB 3E0JB 1OW8A 3AQBA 1H9GA 2XVCA 4I6ZA 2IA0A 2ZSIB 4CCOA 4DGWB 4ZZDA 1T0FC 1DP7P 2E2JJ 2W82A 1FTSA 3DCFA 3CDHA 1SVLA 5DTDA 1I4YA 3LSPA 4N6HA 4V2GA 3K1PA 2AXTC 2COMA 1IW7F 4YT2A 2YZSA 3MD2A 2IXSA 4XSZF 1VQKI 3A2KA 3OY9A 2KP6A 3L2UA 2FD5A 2Y0SA 1FFTC 2OZUA 1PYVA 2LP0A 1SMYF 1LNWA 2HYGD 4HFKB 2JT1A 1WWXA 5BQIA 1FAPB 1NK2P 2EZIA 1LUJB 2F5CA 2VCAA 5KNLA 3KIOA 2HMZA 2V1DA 1AKHB 3ABMC 4HZFA 3HTUA 1ENHA 1FX7A 3OYKA 4A3IJ 1BL0A 4BQNA 1NHAA 2M5WA 4M9XA 4IRHA 3TW7A 5C4JJ 2MD0A 1K78B 3KFWX 5EZGA 2TRTA 3WE2A 4E0IA 3F72A 3R7CA 3GM3A 3LQQA 4NHJA 1HKTA 3EUKL 3FX3A 5B3SH 2VT3A 3DJUB 3TK0A 4G94A 5EYRA 1LKXA 2EPFA 3EQLF 4ZYGA 3DWWA 1W5TA 2EFNA 1ZK8A 1Q1HA 4EM1A 1P7IA 2K9MA 1JE8A 3TO6A 1UB9A 3EHNA 4BEJA 2ZXOA 1ZRDA 1FBQA 2ZB9A 2EPKX 2L6FA 3R60A 1VQ4I 5IPAA 4IB4A 3EG9A 1HC8A 3U8PA 1KQ8A 5K1YA 2LH9A 1G3SA 2R93J 3DAGA 2JRTA 2KLOA 3F46A 1QA6A 2HZ8A 3I64A 3I58A 4PJJA 1JUMA 4XOTA 4PFOA 3GEEA 1BC7C 2VBYA 2VI6A 3A01B 4B43A 2EZHA 5D5VB 4FETA 4A3KJ 5D8LB 4XNFA 4MNUA 3HUGA 1GM5A 5GAGJ 5E3AA 4H4KC 1MBGA 2R7DA 2NUTA 4OU0A 1TWCA 1Z6AA 1MZBA 3SHFA 1WKMA 4CS8C 2CW7A 2JSPA 3LSTA 4RGSA 4CO8A 2Y48A 4BAYA 2QWWA 2R7TA 4OD5A 4W1UA 3CCUI 2MBFA 3HGGA 3ZRGA 3VF0A 1GUUA 3PO3J 3B71A 2BXZA 2W7NA 2LY1A 1I6HJ 4XKWA 3HOSA 2FAPB 4C7OB 3C63A 1JGSA 1SEUA 1LQ1A 4OAZA 1OPCA 3KEYA 2ZXWC 3BG9A 3GZNB 2NUPA 1OW7A 2E2HJ 4LJZF 1UJ8A 2QUFA 4A6EA 2UXNA 2RQPA 1FTZA 4MIMA 4IZZA 2L7MP 4E7ZA 1SFUA 2F5EA 2A61A 2R5ZA 3COAC 2A6TA 1I5ZA 2DMQA 2ID3A 3RQ4A 2VBXA 3ABLH 4RB1A 3EUHC 3RPUD 3CMYA 1AU7A 1Z3IX 1TNSA 2MABA 4ESBA 1NBBA 2GBYA 1QU3A 3BPVA 3CCVI 4P9TA 1HKSA 3DTIA 2CGEA 3Q3SA 3E5XA 2OU2A 2KIMA 2FBIA 2HS5A 3P7NA 1TWCJ 3BLYA 4R8HA 4Y33A 2UUHA 2YL3A 1AKHA 4D4NA 5LRSA 1U89A 1R4TA 4LB5A 4YL0A 2TCTA 2P6SA 4II3A 3LSHA 2X6XA 3A03A 3FM3A 3U3BA 3L7WA 3QZCA 1RKTA 3OYJA 1K78A 2COBA 2H8WA 4HSTA 2ZXPA 5K5QA 3GWZA 3R61A 2EBIA 3QYEA 2FNPA 3LFKA 4XLCA 4BEMJ 2K40A 5DQZA 4QTRA 4BJ1A 1WH5A 2XRLA 2JD3A 4YN0B 2KL4A 2PEXA 2OC6A 2Y75A 5ILUA 3EGXB 1NLXA 1Z6TA 1O3RA 2XROA 1Q0MA 2E60A 1O57A 1OCPA 5EEHA 2IM8A 2CQ7A 2NVUB 4EQQA 2B7EA 1H89C 4XR6A 1SD4A 5JHUA 4E7IA 4LLLA 3PUFA 4E18A 3K4CA 2QBYB 2OTJI 4Q4ZF 2Y0SN 3CP8A 1E85A 2DMNA 3F9KA 5DD8A 2XLVA 4HDUA 4M9SA 1NFOA 1Q0DA 4DIQA 4JIOA 3U9JA 4HX8A 3KLOA 3PFYA 3A01A 2W00A 1YW9A 4PJLA 4UVBA 4ZYEA 3BQZA 5E8IA 1RRJA 4P9UA 2O61A 3K4BA 2Q4FA 2WB1A 3OYHA 2EA2A 4IOCF 1LI7A 3W2WA 3O39A 3UKGA 1SFEA 2WY8Q 5DEQA 2NYXA 2W9YA 3CMEI 2MC3A 2HTSA 3CSKA 3G50A 3RIPA 1GGQA 3RYPA 4CZZA 1LEBA 4XEVA 4AM3A 3IKVA 2EIMH 5F0FA 2HZDA 2LF7A 4C7OA 2ZPAA 1IN7A 4KDPA 4XPWA 3KP3A 1OFCX 2MH2A 3HNJA 2OBPA 5D6FA 2HQNA 1JHHA 5L3DA 1F1ZA 5FD6A 1VQMI 2XHKA 1H6GA 4B4CA 2LDUA 4O6YA 3K6GA 2K7LA 3HB9A 5GAEJ 4JCZA 3J7YJ 1ZG1A 3X2QC 4N9IA 1L3LA 2ZJ2A 3GM1A 1UFMA 4B3AA 4U5DE 3SXKA 3KLNA 5FZTA 1N75A 4BJ5A 2Y9ZA 1F5TA 1Z5ZA 1YTYA 3CCYA 3QWLA 5DDGA 1J59A 2BGCA 5DV5A 1V4RA 4ZDLA 2J5OA 1U9OA 2O6GE 1IJWC 4ESFA 3SXYA 2DPUA 3PHF2 1E86A 4I01A 3L2CA 3AJMA 4MVMA 4MQVA 1K61A 5L0IA 4PDKA 4IHYA 3AL0C 5A6BA 3JRCA 2WY7Q 2AQEA 4M6XA 2H1KA 2Q3TA 4W8PA 4L18B 1Y56A 3JAMZ 1W1WE 4A4AA 5EZHA 4NTBA 2L0KA 3SNHA 2UUZA 4YK5A 3H3VK 3M1CB 3NMIA 2QZ8A 2WTEA 3L1PA 1HOMA 3FAPB 1OCOC 3WTSC 3JRMO 2P5VA 3W2VA 2BOLA 2G0EA 1FIAA 3HJEA 1Z6RA 2X85A 3EGXA 3FHNA 4O7GA 4A3GJ 3BR1A 5CVRA 4DOZA 2DFFA 3UMHA 2QY9A 3OS2A 3U1DA 1DGRM 2E35A 1ZHXA 4HNVA 1JKOC 2QBYA 3GLXA 5DM7F 1I39A 1M2OA 5BUOA 5LGNA 2CQNA 4BYYA 3UGOA 2CYDA 2W4BA 4A6DA 1FR0A 4E7JA 4ZYAA 3ZMSA 2D5VA 1AOYA 5L0GA 1JGGA 2EWNA 3ZMTA 2JA8J 4MVRA 2IVMA 1GXPA 3E70C 3HPGA 3ELKA 1W36D 3DF8A 1KQ9A 4FESA 1XWJA 1MMAA 1VYKA 2AWCA 3AG3H 2L9NA 3FIWA 1HMDA 4JTCB 3DV8A 2UUIA 3ZQFA 2EFOA 3BWGA 1RC9A 2HWVA 3KZZA 2EQRA 1AA7A 2EZKA 3S93A 2BW3B 3FK7A 4AX2A 5KYXB 3LMMA 2BVMA 2DT5A 1B4AA 3FVYA 3IUOA 1JTYA 4U87A 3PNYA 1MQVA 2D1HA 2V9PA 4B09A 1G4DA 2R9RB 2MW8A 3P9IA 3H5AA 4F92B 3K7AJ 1ZR4A 4U5CE 1X58A 1FYKA 1YIOA 2VC9A 4DRIB 3A11A 4J7YA 3CESA 1J5YA 3OYIA 3ZQGA 4MEYF 5K7ZA 1BBHA 2AP3A 2XGXA 4IXAA 3R2PA 3ZTZA 2PN6A 4IVNA 3C7JA 2BY0A 2L9VA 2LFFA 3J06A 1FTTA 4HEAJ 4N4WA 3ONQA 1LS1A 1BA5A 1PVEA 3LAPA 3WG7C 1RNLA 3V5ZA 2KZGA 4B48A 3CF5F 1BDJB 4E6KG 1OMIA 3QP5A 1JKPC 5F6FA 2WV1A 4YEJA 3PO2J 1Z05A 4HOBA 5E18F 1YJGA 2XL4A 4QI0A 2EIJC 4I98B 1T0FA 2YS9A 4ESJA 1XPXA 4JURI 1YLFA 3OYFA 2XGEA 3ABKH 2JX0A 3BEHA 3TQOA 5KYNA 3C62A 5L0JA 3E7LA 5CVUA 3ZN0A 3VWBA 4JQFA 3MVPA 3JZ0A 1BR1A 4CCLA 5C3EJ 1XDUA 2VQLA 1QVTA 2DFHA 2E7WA 3M1CA 1Q1VA 5EK0A 2V3CC 2E1NA 4IQ4A 2CFOA 1QHGA 4Y13A 4YFNF 1TQGA 1W2WA 4HLXA 1GVJA 3P9KA 2PJRB 2DFIA 3MQ0A 4IOAF 3B02A 1I5NA 2PMHA 3JYYA 1E83A 1IXRC 2YHSA 1Y4CA 4QI2A 4UV8A 4KT6A 2P0NA 3WTVC 4DXWA 3L2QA 2D1VA 3BOQA 1ACIA 2QSHX 2XLDA 3O2PE 4PGGA 5GTIC 4NC6A 2OJQA 2YL0A 3M4OJ 3IAM2 2E36A 2J7PD 5K5RA 2CUFA 2RVCA 3NKEA 1G4WR 1K6YA 4OMYA 1FP1D 1XSVA 2LD5A 1G8XA 4C3JJ 1QPMA 1G2HA 3C2GA 2XPWA 3TP3A 3M7GA 1WI3A 3VPRA 4UUSB 1JRAA 1VYIA 4AE4B 3M3YJ 2VQHA 4EV0A 3S1NJ 3IEEA 4E0HA 2CMPA 3U21A 3ZQHA 3OYNA 3S16J 3RQFA 3LSJA 2ME0A 4BGDA 3GYHX 3K1HA 4CZCA 3E6DA 1NSGB 5CVIA 2E1MC 5HODA 2QQ8A 4XRSG 5J8FA 4A0XA 2BW3A 4RDUA 5CI8A 2O0YA 5BS6A 5FLVA 1ZKGA 1TQPA 3EZHA 2PQ8A 1HBXG 2X9DA 4AWXB 2HV7A 1QZXA 5A6JA 2CQXA 1S7EA 2M7BA 3LLKA 1SD6A 1N77A 3IPMO 3GFMA 2ZCWA 3EGDA 2CO5A 2KJCA 3KEOA 2O8XA 2F22A 2I10A 3L2RA 3A1YA 2ISYA 3E6BA 4XQFA 1IC8A 2GQQA 4CS8A 2EPLX 2DB4A 5BPDA 3VAYA 1XMXA 5IYBJ 1M57C 1BJZA 3LSRA 5T3TA 2CQKA 2OQRA 4BHPA 1S7AA 2VN2A 3P9CA 3TOBA 1YQAA 1OXKA 1ZYRF 4J7TA 2MSYA 1SFKA 5IP6A 1VOMA 3MFNA 1ZG3A 4L0ZB 1L3PA 5BQGA 5A69A 2JMWA 3CCJI 1QZZA 2FMYA 3K69A 3N97A 2ETSA 1V54H 1MMNA 2VH3A 1YO5C 1D5YA 3MZYA 1XDSA 5HS7A 1MJ9A 4YG2F 4FX4A 1A7EA 2QNLA 1EH7A 3AG2C 3GEHA 4KFCA 4C2UA 1RI7A 4JJGA 4M6VA 3LNQA 1JT0A 1HMOA 3SDGA 3FDQA 1YW7A 1F36A 2DYRH 3SP1A 2YX7A 3PDMP 1NG7A 2LMDA 1YI2I 1OR7C 3NDBB 5E1ZB 2DA1A 4L5IA 4WABA 4P5OA 3ECSA 1USTA 3EUHA 3TKYA 5K5OA 5EGOB 1WSUA 3KE2A 5FLXK 5AIQA 3JW4A 5HDKA 2K85A 4L5JA 2XAFA 3H65A 4YT5A 2PJRA 4WX9A 2BVLA 4XQ1A 4MFEA 2DMPA 1J2XA 5GP9A 3P5JA 3X2QH 3AL0B 5CPRB 4RAZA 1T38A 4BBRJ 1WOLA 4FAPB 4J00A 4LLCA 2FXAA 4Z6YA 2HV6A 1M6TA 5B1BC 3H9QA 4QPOA 1FY7A 5BMZA 4KI2A 4NC8A 3ZP5A 4EJOA 3QODA 1HLVA 1IRZA 1GT0C 4G7ZF 1YA7O 2H8AA 2K3FA 5JR3A 3S28A 1Z21A 1BI1A 4K2EA 2R92J 1R4NB 3S3NA 3PL8A 2UWMA 2HXIA 1R49A 1TBXA 3RTRA 1JJ8C 1X2MA 2L7KA 3DEWA 1NZEA 2V6EA 2OCCH 2XRHA 2ISZA 4AE4A 2BY2A 2LNBA 5JRAA 1H9TA 1G3TA 4C3HJ 4L9NA 1RXQA 4CYDA 5C44J 1P92A 3ASNH 4OD4A 1OCOH 3GW2A 2KJBA 3Q7LA 5E3CA 1MSEC 1ERDA 3V5XA 1OR3A 3H5RA 2F4MB 2LFBA 3H92A 1DOWA 1WTYA 2K86A 1HSJA 3CJNA 3QYBA 3K4MA 1EA3A 3KZYA 3I55I 2LOOA 4NTFA 1T8IA 2EFPA 2P6VA 3O55A 3LS0A 3SEZA 1LFPA 1TTYA 2K02A 3GTMJ 3RW0A 2E1OA 1D1CA 4M6YA 1H0MA 5LHHA 2Y30A 2P7VB 2XGDA 5L3CA 4BXXJ 2W25A 3DFGA 1XGMA 2ZD9A 4W8KA 2OD5A 3J7AO 3FXQA 2A6HF 2RAEA 5IOYA 3JRHA 1H88C 1B72B 2OCEA 4EGYA 2FQ3A 2GA2A 3DE9A 3CJRB 2P7CB 2PNOA 3ROUA 3K7DA 2Y69C 4N4OB 2ZXIA 3Q0WA 1IN6A 2RREA 2EV0A 3WODF 1QZEA 5DUIA 1DDNA 2OOCA 3ZVRA 3M8JA 4BY1J 1U5TC 4IHSA 2XAQA 3EYYA 3TQNA 2W24A 2K3PA 4IJAA 4ON0A 2HDDA 5CYVA 1OCZC 4DW6A 5GPAA 4BY7J 1V5GA 2IGNA 2JWTA 3F6VA 1OQYA 3G3ZA 2JN6A 3IWZA 5F1JA 2IPQX 2XRNA 2KNHA 4HDVA 2V1NA 1IZMA 2CYYA 5HOOA 4MW3A 5A6AA 4AIDA 1ON1A 3IH2A 3H9JA 3K4KA 3MN2A 6PAXA 4U7DA 2EINC 2IA2A 2F6CA 1YIJI 1N1CA 5FJ8J 1W0UA 3VSKA 3JSEO 3O8GA 4Y7NJ 2UXXA 3WTXC 1VFCA 2M7AA 2YQYA 4P1WA 3HOWJ 4K7BA 4FCYA 2P81A 3GXOA 4UVAA 4HV6A 4DBQA 3WE3A 3BRJA 4MTDA 1TC3C 3C1DA 2WC2A 3F0CA 2M30A 3DBLB 1YHQI 2V26A 3WG7H 1FSHA 2P1AA 2BYVE 2LD6A 2FBHA 4IGGA 3DEEA 1MSFC 2GXGA 2R05A 1IV6A 2Y31A 1N25A 4C3BA 4YFKF 2AXLA 3R0JA 4I7HA 3OS0A 5BPIA 3DLAA 5GPCA 1RESA 3J7ZI 1JKRC 1CF7B 3REOA 2I15A 1IZ1A 4HEA2 1PD1A 5TISC 2NS7A 2K27A 2PFBA 5HDNA 1SVOA 1O3UA 2BY3A 4EGZA 4WF2A 5E3MA 3GFJA 3MBGA 2QQAA 1IG7A 2X6OA 3HL2A 2FRHA 4CSAC 3SZRA 2DI3A 3N4MA 3ASOC 3V7OA 1DOVA 1LM3B 4U88A 4XRFA 4ETSA 1IAWA 1WVRA 1ZLKA 1WN0A 4QDLA 1QPUA 4A3FJ 3A02A 1ZRFA 2O3FA 5FKOA 2WV0A 2AHQA 2X48A 5LBQA 1U8RA 2LSEA 3V5YA 3S1RJ 2WVOA 3H36A 3BCBA 3CCMI 3HSEA 5LFAA 2W48A 3LQRA 2GAUA 4GYTA 3OYCA 2Y3GA 3VYRB 4BHBA 3BG5A 1FMVA 2GXBA 2HSBA 3J81K 1AHDP 4JEAA 3CF2A 2FBKA 5ED4A 4EMSA 4XLPF 2VLAA 2X1CA 2HFIA 2EH3A 4EUKB 5L0FA 1C03A 2EPNA 3ZCOA 4E7SA 1KYZA 2P7VA 4JTDB 3ZN1A 4R32A 3F8NA 1P7JA 3HNKA 2OA4A 3KKBA 2EIKC 3OYGA 2C03A 1FMWA 2E1MB 1T08B 4ENNA 1ETXA 4RB0A 1S8NA 1X1PA 2HDWA 1Y6IA 3BT9A 2VBWA 5B66C 1AWCA 1B72A 1JPNA 1TWAA 1A5JA 3CP2A 1J8YF 3BTJA 2K4BA 4G12A 5EG0B 4MVZA 4IHTA 3M1EA 1OKRA 1LVKA 3BC8A 4M9ZA 2K9SA 4U7BA 4QSHA 1Y8RB 2HQRA 1MJAA 1R5HA 1S6LA 5K7FA 3AG1C 2MFZA 1X3WB 1OCRC 2TDXA 5A2QK 2C6YA 3FXUA 4EVIA 3CD6I 2VCBA 2ELHA 3HBLA 4XL9A 3DD7A 4IJJA 2BHYA 2OUMA 1HQCA 2A5WA 3QU3A 2EV5A 4HX4A 3VB2A 3RVYA 5E8GA 3SYTA 3SFIA 4QLCU 1XGSA 2NVQJ 2W1OA 2IS1A 1YZAA 2IGOA 3IWFA 1KYWA 5F64A 2P5LC 5H20A 3EFOB 2EFQA 5IY5C 1BN5A 3H5NA 3HGYA 3W6KB 3WGGA 4N6CA 2GWRA 1YE9A 3WGHA 3ZIBA 4CJGA 4HV5A 2RV8A 4NQFA 4A3EJ 3L1MA 3X1OA 1GV2A 2K9QA 3QQAA 1T9KA 2LC2A 2XPVA 4RD9A 3G6EI 2Y2ZA 1R22A 3CLOA 3DXJF 3LA7A 1LPQA 2CUEA 5FKLA 2EPMX 5BQTA 1KU2A 4C3EA 1T5OA 3QYFA 1CF7A 2KJGA 3DJNB 5F04A 2H7OA 1Q0GA 3HZJA 1X1DA 1D0ZA 4AIKA 1RETA 3LAJA 3FKIJ 4XEFA 3SJMA 2HVQA 2YSRA 5E3OA 1OCCC 5L0HA 3PSFA 1AEPA 5JLXA 3G71I 3T6JA 3UMKA 4XM3A 2LKSA 4CCKA 4DJ9A 3JRTA 3ZQYA 2QVOA 1R1VA 4NTAA 4WXDA 4KIBA 1IN4A 3QRFF 4EJTA 3H0DA 1Z7LA 2PX9A 1V55C 2V79A 3FXKA 1GXQA 4NQWB 2HKVA 4D5FA 1RIOH 4XKVA 2XPUA 5D92A 3OS1A 1U0JA 1QLEC 2O03A 1U3EM 2WBMA 1A6QA 2KW3C 2XKPA 2FNAA 2L4AA 4Q7CA 2A3SA 4CDYA 4I02A 3L34A 4OWRB 3HJCA 4LIVA 2ME6A 2KDOA 2ZMEC 4CUGA 1HCRA 1O7LA 5B1BH 2KPMA 4EBJA 1XMAA 4MTEA 2GIVA 4AD9A 3VYTB 1SF8A 4MGRA 2DDAA 3ULQB 3ECHA 3A0HC 3CMMA 1IV8A 5ICFA 3LLIA 2HU9A 1X19A 2VT2A 1GV5A 1SD5A 1X4PA 3LWFA 1WJFA 3PSIA 5D4SA 3PFIA 4GQHA 4EWCA 2VKEA 1CQTA 2A05A 4Z9IA 2HOAA 1JKQC 2NS0A 5M5XJ 1OYWA 2YPRA 2YEVA 4E70A 4KISA 3IHUA 4F4BA 3GBGA 4ER9A 2HVRA 4CS9C 3UR3C 1W7PB 1PD0A 1P4AA 3FM5A 2MH9A 3F8BA 3C8GB 4H54A 3I59B 4A5MA 2M1BA 2GA0A 3CCRI 3GEZA 2A69F 1OW6A 2DQRA 3K70C 1ETQA 3OL4A 2YL1A 3LAYA 3LEOA 2LY9A 3A0BC 2DT6A 3ZMZA 3HIFA 5JLWA 1RMVA 4BEHB 3W8HA 4JJFA 5E1XA 3T8RA 1J7KA 2M2EA 3BJ6A 2XIGA 2KQ9A 1XTAA 1U5TB 2YLDA 3MYIA 5HLHA 3EFOA 2E34A 3IAS2 3IRRA 4AK9A 4EKWA 2VXZA 4DRHB 4PR9A 3OIQA 1WPKA 1AVOB 3GZ6A 4NY3A 1E3PA 2DJIA 2JJ7A 2P0WA 3IP4B 4U0VA 3HYIA 4HNTA 4D1QA 2KRHA 2HQAA 2Y69H 2GFHA 4RAGA 4HE8D 5FGMA 4YJWA 2I5UA 1XSDA 2LVSA 2VJIA 2NVXJ 2V4JC 4ZTJA 1OR7A 2NXNB 2FEZA 4BE1A 2LK2A 2AO9A 3G1LA 1R5GA 5EEAA 1Q0KA 4O6NA 2YR2A 2IT0A 2HJMA 2X51A 3R4KA 3I56I 4XN0A 5J1RA 1MNMC 1ZQ3P 2O9LA 3RKYA 2QTVA 1EQ1A 4B47A 3F21A 3MKYB 2LIGA 4CHUA 2DYSC 2L02A 4U0YA 3Q0UA 3TL4X 5LHIA 2EINH 3IV5A 4ZYHA 4DRJB 1UG2A 2KDZA 4F91B 2QQBA 1E0EA 3DTEA 1HDDC 5M5WJ 1HW2A 3QMKA 1D8JA 5A6BD 2A0BA 3C2BA 4RM3A 1DU6A 4NQWA 2A68F 1GDTA 3M8FA 1WASA 4FWVA 4ULVA 4KN7X 3QPLA 2R4GA 1I3AA 4RGXA 1MMSA 2JSCA 1KU7A 3MEXA 2LSOA 5FKMA 5HLIA 1LDKB 2ZXJA 2GA1A 3FISA 3U9GA 3L2VA 4JBAA 4FQGA 3FWEA 2DMUA 1BOAA 2F48A 3ZGKA 4F52A 2ZXWH 2QSFX 2QLZA 2O5RA 4MVOA 1T6SA 2Q9AA 1E3HA 2WAEA 3IRQA 4LDKA 1VI0A 4PGHA 1FWZA 1S29A 3SZGA 2D45A 2M0CA 3HDDA 3I5QA 3ZQIA 4XBFA 2NNNA 3BDDA 4HF2A 3LUTB 3SXZA 2OQGA 2VOOA 5L3EA 1YAUO 1I1GA 4I0AA 1JR8A 4LK1F 2XF5A 2HOTA 1BI2A 1YA9A 1R7JA 3O3KA 1EJ9A 2OQMA 4UB8C 2P61A 1XN7A 2ZNZA 3PIPF 1PCXA 3AGTA 1W7PA 3CDLA 4IF4A 4AYBA 2LCHA 3HLZA 4FT8A 3C8GA 5D5WB 2VE9A 3I59A 4ONSA 3I5UA 4XN3A 5EJCA 5JVGF 3V7CA 1Z9CA 3AGUA 3BR0A 2KIFA 3BJOA 1LE8B 5FRMA 3G73A 1D1AA 3VYSB 1APLC 2Y39A 2Y3BA 4LGWA 4BEHA 4ENMA 3C2HA 5IYCJ 2V7FA 3DKXA
chains in the Genus database with same CATH topology
3KPHA 2OJED 1R5ID 2ICWG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KPH A;  2OJE D;  1R5I D;  2ICW G; 
#chains in the Genus database with same CATH topology
 1FZP B;  2EK5 A;  1IN8 A;  2HXO A;  1WFX A;  4M73 A;  1RR8 C;  2OEX A;  2H94 A;  1STZ A;  2BE5 F;  2EIK H;  3RKQ A;  4I99 C;  3KCC A;  1X1A A;  3AQC A;  4ANJ A;  3M8E A;  1OIS A;  4O6M A;  1XC5 A;  2P6T A;  3BR6 A;  3AFH A;  5E79 C;  4V19 K;  4MEX F;  3LNM B;  2ZFU A;  1EKE A;  4HLY A;  3GTG J;  5CQE A;  2QSG X;  3ZOB A;  2PX3 A;  4FHT A;  2G9W A;  1KZH A;  5FB2 A;  4E7K A;  3JRF A;  4A3M J;  4XON A;  4N0B A;  4BDY A;  2JA7 J;  3L0I A;  4WK8 F;  3EH2 A;  2JPU A;  3JCU C;  1ZH5 A;  3U1K A;  1OCR H;  4FIS A;  4RMN A;  4NC7 A;  1YJN I;  5IT9 K;  4I1O B;  3H2V A;  3ATP A;  4D5C A;  4P55 A;  1B8I B;  4FTH A;  1IUY A;  3J80 K;  2R02 A;  3BZ6 A;  2XM0 A;  4XPX A;  5JP7 A;  1Y8Q B;  3UMI A;  2X1D A;  3DPL C;  3F8M A;  4D9J A;  4V2F A;  2DOE A;  3CC4 I;  1NFN A;  4S04 A;  3ZQC A;  2NS8 A;  2A5Y B;  3MCZ A;  5D6E A;  3NG1 A;  1TW2 A;  2HKO A;  1Y6D A;  3K1I C;  3OIP A;  3ZXS A;  1Y0U A;  3BY6 A;  5A6K A;  1J09 A;  1XCV A;  2XM4 A;  1TFO B;  4A2N B;  3D5L A;  4K0D A;  3QW1 A;  2H1L A;  4DBR A;  5KAF C;  5IY5 H;  3RF3 A;  4B6I A;  3ITF A;  1Z23 A;  3MFK A;  2OEV A;  1HY5 A;  3K4N A;  5BNG A;  2WZL A;  4MTO A;  1KTM A;  4Q47 A;  3N05 A;  3HKK A;  4AL0 A;  1YYJ A;  1FNN A;  2CFX A;  1MDM B;  3ABM H;  2KGO A;  4BXU A;  2FGY A;  1T39 A;  1E3O C;  4JEB A;  4IRU A;  2M8E A;  4E4H A;  5E33 A;  4HQE A;  2IXN A;  2RD9 A;  3EH1 A;  4NB5 A;  3NQO A;  3SXM A;  3ERE D;  3CLQ A;  3ESW B;  3FKJ A;  3O10 A;  2QA4 I;  2WB7 A;  1OCC H;  1ZGW A;  4NBQ A;  2LP4 A;  1BIA A;  3GTJ J;  1W5S A;  4A5N A;  2V1U A;  2DJN A;  3BG6 A;  5DVW A;  1R1U A;  5HNF A;  1VF9 A;  3KP2 A;  3SZT A;  2IA1 A;  2ZME B;  3GM2 A;  2KMU A;  2Z99 A;  1V55 H;  2L01 A;  1D0X A;  3SEO A;  2JVG A;  1NK3 P;  2H27 A;  3GF2 A;  1ORS C;  3CQZ A;  4N9H A;  1FJL A;  3ZG1 A;  3IQ6 A;  4L9J A;  3SZP A;  1ZG5 A;  4Q5S F;  3E6M A;  3S15 J;  3RYL A;  4IRG A;  4YT8 A;  4RM2 A;  2YU3 A;  5F08 A;  3ZMV A;  4FAS D;  1K4S A;  2IS4 A;  4KNY A;  4ENJ A;  3MLG A;  3D5S C;  2KT0 A;  3K2A A;  3T0Y A;  1BZ4 A;  1MBK A;  2WL8 A;  4XIC A;  3H2U A;  4N06 A;  2HKX A;  3ABT A;  2M34 A;  5CVV A;  1TZL A;  1JPJ A;  2LYC A;  1EH8 A;  3S2W A;  1WWP A;  2G7H A;  4Z9H A;  4UV9 A;  1YG2 A;  2ID6 A;  5ICE A;  3G4Z A;  3NYL A;  1ZW2 A;  4WGY A;  3ZDL A;  4JW1 A;  3GTQ J;  2PF4 E;  2VJ4 A;  2ASR A;  3AG4 C;  1LS4 A;  3CJQ B;  3PNV A;  4AUX A;  4RS8 A;  5EDN A;  2VC1 A;  2HOE A;  3OYM A;  5JS5 A;  3G4X A;  2R7W A;  2PFD A;  2LFD A;  4L6R A;  3IH4 A;  4HYE A;  1BR4 A;  2G62 A;  5KCM A;  2QEX I;  3IQT A;  4DYC A;  2W57 A;  5E17 F;  3T6B A;  2R0Q C;  3NAR A;  4F3Q A;  3IKT A;  4F93 B;  1SZI A;  1B8I A;  1MW7 A;  2RSE B;  2MYS A;  1Y1W J;  3FXH A;  3FMR A;  4AYB N;  3DTK A;  4LFU A;  4CA0 A;  1DU0 A;  3F22 A;  2P4W A;  3FXR A;  1WQ2 A;  1Z7Q c;  3SQN A;  3FHD A;  3ZWI A;  4JP0 A;  5TGT A;  2Q00 A;  1U78 A;  2CRG A;  1MD0 A;  2E2I J;  5D91 A;  5LD2 C;  3LNR A;  2NG1 A;  4F7Z A;  3T1B A;  4FX0 A;  4U9D A;  4KN4 X;  2DFE A;  5L3B A;  1QKR A;  4I3M A;  2DXI A;  4GO1 A;  2IP2 A;  1P4X A;  3PQK A;  3NKD A;  1D3Y A;  1FT9 A;  1UZC A;  3A4C A;  2YLG A;  4EEF G;  5KK1 A;  1MDM A;  1AUE A;  1LPE A;  3BZC A;  2FA5 A;  5ILV A;  2XDV A;  1S9H A;  1Z7U A;  3LES A;  3EET A;  5F0H A;  2XKO A;  5FFX A;  1G5Z A;  1WJE A;  3KYD B;  2I8D A;  1VQ5 I;  4HX7 A;  3UGP A;  4PSW A;  1YIT I;  3NWS A;  3LJB A;  4PZJ A;  2WVQ A;  1B68 A;  3KL4 A;  1U0B B;  3HM5 A;  1R00 A;  3V7R A;  4GGG A;  1D8K A;  4J32 B;  2DYS H;  1IUF A;  2DTZ A;  2XLO A;  3B0U X;  3GOR A;  1ZZP A;  3VOE A;  1ON2 A;  5KYX A;  1U6H A;  3HRM A;  3OYD A;  5LEJ A;  1WJC A;  2KZV A;  2P5K A;  4AU7 A;  1FBS A;  3CO6 C;  3VOD A;  2ZME A;  4YRV A;  1S72 I;  2XLH A;  5T3W A;  4WCG A;  3PIO F;  5TJJ A;  3W6J B;  5HNH A;  2H7B A;  5DLJ A;  3S29 A;  1G4U S;  2HPI A;  3HKZ A;  1F43 A;  4EM0 B;  2LKX A;  3KX2 A;  2X6W A;  3F3X A;  3CUQ C;  3TO9 A;  4IL6 C;  2VPR A;  2M4G A;  2KHM A;  3OV8 A;  3M07 A;  5DYM A;  1A36 A;  1GHC A;  3GVA A;  2XLE A;  4UB6 C;  1QHH D;  1IGN A;  1PUF B;  2EA4 A;  1VQ7 I;  3NYM A;  1RZ4 A;  5KYU B;  3CCL I;  3PUB A;  2ICW G;  1P2F A;  4BNC A;  4JCH A;  5H6R A;  3HEF A;  5JLI A;  3JRE A;  2AWY A;  2OJE D;  3ZQQ A;  2IXP A;  3ZQV A;  3FF5 A;  2KSF A;  1ETK A;  2R7F A;  1CGO A;  3L09 A;  1K40 A;  2BBY A;  3FMQ A;  3Q0V A;  2CNW A;  5J47 A;  1YS6 A;  2GLO A;  3RSN A;  3E3V A;  4DZP A;  2ADU A;  3D0S A;  2JA6 J;  1JI8 A;  2K9L A;  1XZQ A;  3CTA A;  2BL2 A;  3BJA A;  4U0W A;  5CLS A;  3T9O A;  2NVY J;  3NMK A;  1OR2 A;  4YIF A;  4U9E A;  2W84 A;  2XB5 A;  3S0X A;  2PJP A;  2V6C A;  4Y52 J;  1QO0 D;  2M45 A;  4IEJ A;  3NEU A;  2RN7 A;  4IKF A;  1JAF A;  3WHN A;  4LOC A;  1R71 A;  3NWT A;  3OWT A;  4XLN F;  2JUC A;  4MW8 A;  4EBK A;  2QM3 A;  3BP8 A;  3F6O A;  1T98 A;  3TUL A;  2LK4 A;  3RCO A;  1ZGA A;  3RQE A;  3FXO A;  4RB3 C;  4AL1 A;  2PI0 A;  1LI5 A;  2DLL A;  2JRM A;  2NOJ B;  5B3S C;  3JTH A;  1QVU A;  1SR2 A;  3H1C A;  3HHH A;  1MBF A;  4AC0 A;  2LR8 A;  1R9T J;  4XSX F;  2R5Y B;  1E84 A;  1W4M A;  3FK6 A;  4CDV A;  2IYL D;  3EUA A;  2V1X A;  3S27 A;  3HRT A;  4LER A;  2DPD A;  1FEX A;  5DD4 A;  3NRH A;  2DK5 A;  2Z5U A;  4PUS A;  1OJL A;  3GUD A;  1Z63 A;  2UZK A;  2R7Q A;  1T33 A;  4BU2 A;  2G3K A;  4UUS A;  3LOC A;  3MWM A;  5DCM B;  4FX5 A;  2JA2 A;  4W97 A;  1K6O A;  2HDC A;  3IQ5 A;  4XID A;  4LIU A;  4DZJ A;  3GWL A;  2EZL A;  2YLI A;  2WZF A;  2RDP A;  2XS8 A;  4XLE A;  4YEL A;  5K7H A;  1IXC A;  1F9N A;  3MAJ A;  3SEQ A;  2AS5 F;  4UDV A;  4CH7 A;  1Z3X A;  4Z9J A;  1YX3 A;  1DGW Y;  4OMZ A;  4ZH4 F;  2VQC A;  3MMY B;  2CSO A;  1FOK A;  2QQ9 A;  3AKZ A;  3OIO A;  1VQO I;  2FF4 A;  2CWE A;  3LS1 A;  4MVS A;  3QAH A;  1TP4 A;  1ETW A;  4XOR A;  1FYM A;  2ZJP F;  2GXA A;  1OLT A;  1B9M A;  4J19 A;  1PP7 U;  5FO5 A;  1MH4 A;  1R1T A;  4BQO A;  1R36 A;  4R79 A;  3ZQ7 A;  2DBB A;  4ZLD A;  3R0A A;  2V9K A;  4P96 A;  1QZY A;  2HOS A;  3FXM A;  3CZ6 A;  1M2V B;  1OXB A;  3C18 A;  2M9H A;  2ELK A;  1W5C C;  1VLT A;  2DA7 A;  5FFZ A;  1K4T A;  4G7O F;  1EKY A;  2JA5 J;  4D0P A;  3A9C A;  2G7U A;  4BAC A;  1PUF A;  2E5N A;  4A3L J;  4JKV A;  3UNG C;  3K33 A;  1HW1 A;  4MLO A;  3VFZ A;  3OR1 C;  4K1O A;  3E5U A;  3DM5 A;  4ZTF A;  2L2O A;  2Y9Y A;  2HYJ A;  1FBU A;  4XLH A;  2CH0 A;  4OOI A;  1ZAO A;  2ZJR F;  3HPH A;  4GFB A;  1JUS A;  4YFX F;  2MGQ A;  5FLX Z;  4A3D J;  2K4J A;  3WHB A;  1TT0 A;  4B3X A;  4BJT A;  1G3Y A;  5EGO A;  3ZSU A;  1EV7 A;  4ZDO A;  4WWC A;  1MMD A;  5GAH J;  3ZC4 A;  3HKZ N;  5J4V A;  4NCQ A;  3MKZ A;  4JRZ A;  4BDZ A;  2PP4 A;  2CW8 A;  1KU3 A;  1HA8 A;  3SFZ A;  1OCT C;  3MX3 A;  4BH9 A;  1XGN A;  2F5D A;  3N24 A;  3FXL A;  2M4K A;  4LDQ A;  3BRO A;  3U0C A;  1OYI A;  2HSQ A;  2IBD A;  4PJN A;  2R5Y A;  5AC5 A;  4KIT B;  4DNC A;  2NNY A;  3S1M J;  4AVZ A;  1SD7 A;  2H8R A;  3EYI A;  2VXD A;  4M3B A;  2L9J A;  4XPY A;  2EIJ H;  3HTS B;  4CXF A;  5D5U B;  2OG2 A;  1TLH B;  1HXD A;  4RGR A;  3S3O A;  1JMW A;  4L0Y B;  3K1I A;  3GO5 A;  3MYF A;  1QSP A;  1YX5 A;  5DCM A;  3JSP A;  1I50 J;  4UXN A;  4M74 A;  1LB2 A;  1ZHY A;  1YW8 A;  5CVJ A;  2M4E A;  4B8X A;  1BM9 A;  1T6I A;  2Q9B A;  2E7X A;  3DM9 B;  1DPR A;  2GWW A;  1VQP I;  2HTJ A;  5JFR A;  2F5V A;  2GDC A;  1WJA A;  5E1W A;  3CC2 I;  5JT4 A;  5DS9 A;  2J9U A;  1TL8 A;  4KIG A;  1ZLJ A;  4IO9 F;  4CGZ A;  1IXS B;  1YOV B;  2F4O B;  4RBN A;  2I8B A;  4BJ6 C;  2XXA B;  2LKP A;  3N2Z B;  2Z15 A;  3VM6 A;  2LG4 A;  3H0G J;  4OAY A;  2Y0M A;  2W45 A;  2IS6 A;  1SVM A;  4C3I J;  4HSR A;  1LJ9 A;  2VJJ A;  1MMG A;  3DKW A;  2J9V A;  3ZTM A;  1S7O A;  1VZ0 A;  2KYH A;  2L9R A;  3K0L A;  5BOX A;  4DVY P;  1ZEL A;  3GME A;  1OKK A;  3OL3 A;  2CGP A;  3PJR A;  1YYV A;  1WH7 A;  2LRD A;  1M2V A;  2NPU A;  2OU6 A;  4G78 A;  2XSE A;  2VCC A;  4M3E A;  1W0T A;  3GWN A;  3KZI C;  1BI0 A;  4G9Y A;  5K0I A;  2QGU A;  3DBH B;  1RKC A;  2W85 A;  5LLQ A;  2CJJ A;  4OIQ F;  1XGO A;  4JE9 A;  3LSM A;  4WXC A;  2ZBK A;  4MTG A;  3GOD A;  4S05 A;  4YWQ A;  1K05 A;  4EM2 A;  3OYB A;  2KIU A;  3CUQ B;  1Y39 A;  2PMZ A;  2G3V A;  3QPH A;  2FE3 A;  4BHC A;  1UEL B;  4IAO A;  2L5Q A;  1XG1 A;  2YKZ A;  2R7O A;  3BZK A;  3M9A A;  2XL6 A;  3L9F A;  3TDU C;  3KP7 A;  1WJ5 A;  1R58 A;  2RKH A;  3Q6N A;  2K5C A;  2DOD A;  5B1A C;  4MND A;  2MLK A;  1KON A;  4JX5 A;  1ORY A;  1BBY A;  1MJB A;  2Q7R A;  3L8J A;  2A1D D;  3JRI A;  2ZO4 A;  4CIC A;  3V42 A;  2QKM B;  2B0H A;  3U2R A;  4P9F A;  1MBJ A;  3OMY A;  3W6V A;  2Q1Z B;  5D8K B;  3OYA A;  2DGJ A;  1JTX A;  3OYE A;  5HS9 A;  1M1E B;  2EFW A;  3OSF A;  2IOQ A;  4KT5 C;  2LLK A;  1RKE B;  3H3U A;  2WVN A;  2ELJ A;  3ISP A;  2VKH A;  5AON A;  4IHX A;  1UHS A;  2BY1 A;  4BG0 A;  1BI3 A;  5EEG A;  1XCB A;  3LL7 A;  2QKL B;  1U8B A;  3JT1 A;  3U5S A;  2F4I A;  4LB6 B;  1TWA J;  1WCM J;  3QTH A;  2DDB A;  1QNT A;  1WZ2 A;  4XEK A;  3V4G A;  1C17 M;  2OPT A;  2DU9 A;  3QU6 A;  1TW3 A;  3B9Q A;  2KQR A;  4Y4R A;  3AG2 H;  4EIY A;  3DWL E;  4P6I C;  2R5Z B;  1EI7 A;  2NVT J;  4MFD A;  3DKY A;  3HSF A;  4HPQ A;  2ECC A;  2XAS A;  3I3L A;  4L5E A;  4CCM A;  256B A;  4O5V A;  3G4S I;  3DP7 A;  2L3D A;  4I09 A;  4LG3 A;  2VKD A;  4CJO A;  3DU5 A;  2XF7 A;  1G59 A;  5JI6 A;  3TED A;  1W36 C;  4ENK A;  4LLN A;  2HMQ A;  4A69 C;  3TOA A;  3GX4 X;  5DCF A;  4U5E E;  3HNI A;  4KMF A;  5D5X B;  4XMY A;  5M3M J;  1YAR O;  5L3V A;  3S1Q J;  4OIR F;  4HA8 A;  1PDN C;  2DAO A;  3J81 Z;  3AG3 C;  3DPU A;  5T1D B;  1ZAR A;  4PJM A;  2Z9O A;  1YFH A;  2BZT A;  3K10 A;  2FX0 A;  4HF1 A;  5COG A;  3L00 A;  4PFP A;  3CCS I;  3EZI A;  3BG3 A;  3ZPL A;  2XXA A;  1MH3 A;  3HOX J;  1REP C;  4JYK A;  4M3F A;  4ULW A;  1NTC A;  3IH3 A;  2ZXR A;  2P8T A;  1SAX A;  2B63 J;  1E2X A;  3WU1 B;  1V5F A;  1PV3 A;  5FD5 A;  4EAT A;  2DOF A;  3WU0 A;  2OTL I;  5KVR A;  3DQV C;  2L81 A;  2ZFW A;  4PSX A;  5LGU A;  3BTC A;  3RIR A;  3U3F A;  2F5F A;  4KYW A;  2J8W A;  4MVU A;  4KNV A;  3CO7 C;  5EG0 A;  4A93 J;  5DS6 A;  4G0H A;  3BR3 A;  5A2Q Z;  3LSK A;  5L0D A;  2C04 A;  2MLG A;  3CCE I;  4BL0 B;  3WU2 C;  5IYD J;  1BR2 A;  3CUQ A;  3I0T A;  4NUB A;  2M3A A;  4EJW A;  3HNL A;  2E1C A;  4ASN A;  3TOM A;  1YJ9 I;  5LHG A;  2L6H A;  4J30 B;  3KEQ A;  5JUA A;  4O6J A;  2FFH A;  4CS7 A;  3H35 A;  2B9S A;  4O79 A;  2BEO A;  1FP2 A;  2RGV A;  1CPR A;  5CKT A;  2QF7 A;  1FPQ A;  4C30 A;  1L0O C;  2VL8 A;  5DUK A;  5GTH C;  2DA2 A;  1VK5 A;  3ABK C;  4KBL A;  2VIX A;  1T6U A;  4KMU X;  3I4P A;  2HJ3 A;  2L7Z A;  2R7U A;  1W7P D;  4LIT A;  1QQI A;  3S8P A;  3C8G D;  3I9V 2;  1OYY A;  2OF7 A;  3F8C A;  1RKE A;  2XGC A;  2F2E A;  2IGM A;  1F4K A;  2PLY A;  1F1M A;  3ZQL A;  2GOX B;  3DPT A;  2B0L A;  1JT6 A;  1G3W A;  2HZT A;  2DO7 A;  2IGK A;  4KUM A;  4IRI A;  3VSL A;  3GTO J;  4I0B A;  3TJ6 A;  1HF0 A;  2Z2S B;  3S84 A;  4D4X A;  3ERM A;  2Q2E B;  2QUP A;  4UY8 I;  1OCZ H;  4F55 A;  1WGX A;  4BUP A;  1RKW A;  4M3D A;  2FU4 A;  3OYL A;  3I4U A;  4BPM A;  1RR7 A;  3M4B A;  3ZR8 X;  4DJA A;  5ICG A;  1BW5 A;  2DA4 A;  2FQ4 A;  4XKB A;  3KYJ A;  3FZV A;  2HI3 A;  3GFI A;  4XLF A;  3HOV J;  2ETH A;  3Q6M A;  1VQ6 I;  3FBI B;  3GFL A;  3Q7G A;  1RUO A;  2J45 A;  4A12 A;  2PMZ N;  3GAN A;  1QVX A;  4JOM A;  2XV4 S;  1EF4 A;  3L2W A;  1J8M F;  3S90 A;  4X0R A;  3RPQ A;  4U5F E;  2BXY A;  4Y17 A;  2ZJQ F;  1O3Q A;  4B44 A;  3B29 A;  5COF A;  3K2Z A;  1D1B A;  1J0R A;  3S9O A;  4E7H A;  3G1M A;  4I2O A;  1MBH A;  2JPB A;  2YVK A;  4XOP A;  1TR2 A;  5D4R A;  3DKA A;  2E19 A;  2OZ6 A;  2XB0 X;  5ILS A;  4HRI A;  1IDY A;  3Q9V A;  1CGN A;  1NU7 D;  1V4A A;  1R23 A;  4QIW N;  3O8H A;  3JAM K;  3G2B A;  4G6T B;  4XKC A;  3BTL A;  4KJZ A;  1O4X A;  3GZ5 A;  3T8T A;  4OIO F;  4Z2Y A;  1QRY A;  1RCP A;  2WZG A;  2XL8 A;  1YDI A;  1R5I D;  3DE8 A;  2L4M A;  2KRC A;  5HSW A;  3RQG A;  1ZW3 A;  3RKO F;  4PAC A;  1R6R A;  1WJD A;  3S2D J;  3BCA A;  3S2H J;  5COM A;  2VOD A;  2NRA C;  2R3S A;  1YVI A;  4AIJ A;  1LIH A;  3ML6 A;  3ASO H;  5JHF A;  1NG6 A;  4CYC B;  3GCM A;  3W4Y A;  4BKX A;  2ZXH A;  3TO7 A;  3VRC A;  4RAF A;  4QPQ A;  1A04 A;  1A7V A;  1KNY A;  1SC7 A;  4M72 A;  2L54 A;  5FRO A;  1UAA A;  4GYI A;  1Z3Y A;  1NU9 C;  3NMJ A;  2A6E F;  3SDB A;  1JJ6 C;  3HRS A;  1S3J A;  4WGZ A;  4L9T A;  2IRF G;  2DTR A;  1H8A C;  2CV1 A;  4WXH A;  1IRF A;  3D5R C;  2AU5 A;  3WGI A;  4IX7 A;  1FOX A;  1V54 C;  4GDF A;  4U5H A;  5B3I A;  4AIH A;  2FSW A;  2J5P A;  4DVZ A;  5LGT A;  1U5T A;  3BG7 A;  2XAJ A;  1UG0 A;  5J4Y A;  4KNW A;  3RPU A;  2DYR C;  3W8I A;  1BW6 A;  2YRF A;  4CCN A;  1KGS A;  1FOY A;  2HPM A;  3W2A A;  1Z67 A;  2X6Y A;  2H6B A;  4ZYD A;  4LK0 F;  4II2 A;  3K66 A;  4LLE A;  2CW0 F;  2JZY A;  2CQQ A;  2LF8 A;  2N8G A;  2HYF A;  2VE8 A;  4G7H F;  1FIP A;  4E7L A;  1HE9 A;  3E6C C;  3RH3 A;  2Q2E A;  2X1E A;  4A3C J;  3MZ8 A;  3AG1 H;  3U9M A;  5JVE A;  4LD5 A;  2XAU A;  1ULY A;  1A35 A;  5CJ9 A;  3RZO J;  4BQQ A;  3V8K A;  3E5Q A;  1XB4 A;  3QPT A;  1FFH A;  3JRD A;  1Q0F A;  3FOO A;  2JUG A;  5B1A H;  5J8C A;  2Z33 A;  2MWQ A;  1X2N A;  1FC3 A;  2EIL C;  3PM1 A;  3BR2 A;  5CI9 A;  4XTK A;  1ZGJ A;  3RKX A;  1VMA A;  4CDG A;  3RQI A;  2CG4 A;  2J0W A;  4IWB A;  2Z3Y A;  1K7A A;  2A07 F;  1T01 A;  4U5B E;  1QGP A;  2HNH A;  1K04 A;  2OCC C;  3LA3 A;  5M5Y J;  4LLG F;  4M3G A;  3TBI A;  5FLM J;  5J1Y A;  4HFF B;  1IRX A;  3RDI A;  3JYH A;  3GLL A;  3F23 A;  5J40 A;  3TD7 A;  2WAD A;  3POV A;  3IL2 A;  1KA8 A;  3ASN C;  4ZC3 A;  2EV6 A;  1Y1V J;  4CSA A;  1UCR A;  3TGN A;  1J9I A;  1ONV A;  1SYQ A;  4CIP A;  4HBL A;  1HKQ A;  1HST A;  4HNU A;  1DPU A;  2VOP A;  3HOY J;  4LDR A;  1G6N A;  2QYO A;  3CAX A;  4A2U A;  2IBF A;  4KC9 A;  5EGY A;  1O5H A;  1X3Z B;  2IXM A;  5E20 A;  1Z91 A;  5C4X J;  3S17 J;  1ZU4 A;  1DUX C;  1TQI A;  4HF0 A;  1O87 A;  4CYC A;  4KIC A;  2PBE A;  4BJ6 A;  4GEH A;  3QP6 A;  5KYW B;  5KYY B;  1MND A;  1U9N A;  2XLM A;  1YJW I;  1KU9 A;  1VTM P;  3FDY A;  3K4J A;  3M4C A;  4GYG A;  4L9V A;  3K1M A;  2DK8 A;  1XMK A;  1VQ9 I;  2YL7 A;  4I1M A;  3ZMD A;  3IC7 A;  3BPX A;  1C0W A;  2OKU A;  3AOU A;  1LE8 A;  5F0C A;  5L0C A;  2KRF A;  1EH6 A;  2RC4 A;  4C2T A;  3E1S A;  2R7Z J;  2Q8K A;  1SMT A;  4KIF A;  4MO7 A;  5ICC A;  5F27 A;  3D1N I;  4X6A J;  1U2W A;  3C3W A;  3US6 A;  2NSF A;  2FJ1 A;  3KET A;  3JRB A;  1BC8 C;  1C02 A;  4YL3 A;  5L3Q A;  2X0L A;  4JK1 X;  4RLQ A;  1MIJ A;  1DP3 A;  2FOK A;  2NAZ A;  2LRE A;  1ORJ A;  2XAH A;  3Q9S A;  3PMR A;  2H7V C;  3FBN B;  5L3G A;  3FOP A;  1T2K A;  1BOB A;  1QBJ A;  2R25 A;  3M79 A;  4B1R A;  4BE0 A;  3BQY A;  5J1U A;  5JSL A;  3WTW C;  3U2L A;  2DN0 A;  2R7V A;  1R4M B;  5DQT A;  5KHD A;  3HHG A;  2ZKZ A;  1A41 A;  4LMY A;  3EGD B;  4JZA A;  2HEO A;  2RQQ A;  5IT9 Z;  5TJ5 E;  4I76 A;  1SFO J;  1K79 A;  4RBO A;  3J80 Z;  1T6Q A;  3QVY A;  5ERI A;  1N78 A;  2HQ5 A;  2O9X A;  4FE7 A;  2JQ7 A;  3E9V A;  3JR9 A;  2HFH A;  2DQL A;  1EA8 A;  2XF6 A;  3GEI A;  4JVS A;  1GVD A;  2ZSH B;  3CQZ J;  2ESH A;  5AIP A;  1T56 A;  4PCQ A;  2LY2 A;  4OIP F;  5FRN A;  2Z16 A;  3HOT A;  3I4N J;  4MTF A;  2CV0 A;  3CDI A;  3G1O A;  3K70 D;  2WB1 N;  1B1B A;  2CNW D;  3QOP A;  1TKN A;  1S5L C;  1FOW A;  5H2F C;  3S14 J;  1I1S A;  4YL1 A;  2YX4 A;  1VLS A;  3LSG A;  4PK4 A;  5HVQ C;  3GTL J;  2DOA A;  1PUE E;  2LBF B;  3CC7 I;  3LA2 A;  4YT4 A;  1FNT c;  1VQL I;  2JPC A;  5H6Q A;  1JOG A;  3KYC B;  3BTI A;  4CCJ A;  1CPQ A;  3H9G A;  1RPW A;  2O8K A;  2VPL A;  2GIZ A;  2DA5 A;  3T4R A;  3BR5 A;  4DYR A;  1LVA A;  5E3L A;  2CUJ A;  4IAQ A;  4Y15 A;  1MKM A;  1UMQ A;  1D5V A;  3EPZ A;  3KMI A;  1D0Y A;  1LFB A;  5TRD A;  4A0Z A;  1WHU A;  4HQM A;  2IS2 A;  4ZLC A;  3EJN A;  1USS A;  3K6B A;  2OAZ A;  4JX4 A;  5FKK A;  4ZDP A;  3VDX A;  4FE4 A;  1ST6 A;  2IJL A;  3S3M A;  2DW4 A;  2WAQ A;  4D7N A;  1PP8 F;  4A3B J;  2HGC A;  2B0J A;  4LG0 B;  2E71 A;  4JC7 A;  2O7O A;  3RJP A;  3GTP J;  3HSR A;  5KYW A;  9ANT A;  4RDA A;  3HXL A;  2L7F P;  4XK4 A;  1QPI A;  5KYY A;  2M64 A;  4EHP A;  1TQM A;  1HE1 A;  3I4M J;  2JVH A;  4U5G A;  2E87 A;  3CMA I;  2L6G A;  2GOM A;  1MNE A;  3HTK C;  3S32 A;  4C9Y A;  2ECB A;  1V5E A;  1RUN A;  2IW5 A;  3MKL A;  2STW A;  2FML A;  1RJ9 B;  3KYI A;  5F1R A;  3LSI A;  2ESN A;  1H7I A;  3QVZ A;  2HR3 A;  1X1B A;  3V7S A;  4C2M J;  3HRU A;  1FLI A;  4CX9 A;  4R1H A;  3RI4 A;  1TWG A;  3LFU A;  4NNJ A;  2R7S A;  2KKO A;  5CIV A;  1ZHF A;  5F5F A;  3B0V C;  2CS3 A;  3HG9 A;  1ORK A;  2VAS A;  4YIR X;  3E97 A;  1ZTR A;  2Z1D A;  3WTY C;  1ITY A;  2D5R B;  3MZH A;  4CS9 A;  2YU9 J;  4G6D A;  4CIH A;  3F8F A;  4LAC B;  3KH2 A;  2MA3 A;  2CCY A;  2LTP A;  2AQF A;  3DU6 A;  3HOZ J;  1ZRE A;  1ZU5 A;  2DCE A;  2QEN A;  3TJ5 A;  4HW0 A;  1I27 A;  4QWQ A;  2CDQ A;  4MVQ A;  3R6S A;  1HW5 A;  2IAI A;  2VQG A;  2WAF A;  3I54 A;  1GS9 A;  3FHZ A;  3FXJ A;  1VQ8 I;  2PX0 A;  1O7F A;  2M8G X;  1A7D A;  1IRG A;  1I3Q J;  1JHF A;  3ABU A;  1T95 A;  1IF1 A;  3IQC A;  2DA6 A;  2ACJ A;  4CSW A;  1O3T A;  2VJ5 A;  2EJR A;  2BV6 A;  2H09 A;  4KA4 A;  1Z77 A;  3NRV A;  4CDA A;  2XLW A;  3VYU B;  5FKN A;  4M63 A;  5HDG A;  1ODD A;  1P6R A;  1VND A;  2XSJ C;  3PQJ A;  4GRI A;  4ITV A;  4NDL A;  5HLT A;  3DLL F;  3RVZ A;  5F5H A;  2DT7 B;  5AC4 A;  1ZHW A;  1WRJ A;  1TWG J;  3TOL A;  2LBF A;  4X0G A;  1CGP A;  3JTL O;  3PNT A;  5M3F J;  5IOZ A;  2STT A;  2IEK A;  5KAI C;  3TDZ C;  3PCV A;  4C3D A;  2J7P A;  2RNG A;  4CBE A;  5EF6 A;  5E2Q A;  3I53 A;  2QCO A;  4BXF A;  4UNO A;  1K83 J;  1E17 A;  3J7A Y;  3L8I A;  2X4H A;  3I5P A;  1S05 A;  2XS1 A;  2W4M A;  3EHM A;  5GPG B;  1VB5 A;  1ETV A;  1APC A;  1A6I A;  2EB7 A;  2HUJ A;  5IP7 J;  1MBE A;  5CQG A;  4DYQ A;  3KYL A;  3EPV A;  3NYJ A;  3U8V A;  1IN5 A;  3DAF A;  1XZP A;  3JCU Q;  2MC4 A;  1YYX A;  2VKV A;  1YZC A;  1SAN A;  2BHZ A;  2PBI A;  1WAT A;  3T6G B;  2X0C A;  4UHT A;  4Q48 A;  3OA1 A;  1ETY A;  4O3M A;  4LG0 A;  3KPH A;  2KC3 A;  2EIL H;  1LDD A;  4IHW A;  1B9N A;  2XSD C;  2R7R A;  4GCV A;  1UHW A;  3JSO A;  1Z1D A;  2MHR A;  1KQ0 A;  3FMS A;  4BQA A;  4HAM A;  4ZJZ A;  4NC3 A;  5IT3 A;  4RLF A;  4XRS A;  2WWY A;  1RJ9 A;  3HC7 A;  2K9N A;  1JUP A;  4S0H B;  4EJV A;  3CCQ I;  2XC7 A;  2FOW A;  3B0P A;  4EBB A;  1NH3 A;  3I71 A;  5B5E C;  1TWH A;  1ZN2 A;  2M0M A;  3ZMU A;  4OIN F;  2J0X A;  3JRG A;  5KYU A;  1BIB A;  2DA3 A;  5LRR A;  3RYR A;  3V8J A;  1XS9 A;  2BC5 A;  1A0B A;  1TT5 B;  3DI5 A;  5EHH A;  1SAU A;  4G8X A;  2VB6 A;  2CUZ A;  1GLN A;  2VC0 A;  1GQA A;  2VBZ A;  1WJB A;  1P4W A;  2KFD A;  1YRN B;  3F47 A;  4PJ0 C;  2DMT A;  3RKW A;  4A0Y A;  3ABL C;  3DZA A;  3OEO A;  1ETO A;  1XD7 A;  5HLG A;  1OKK D;  2WAQ N;  1OQC A;  4I44 A;  3Q5F A;  3K9T A;  2UV1 A;  4D7M A;  3HOU J;  3KP6 A;  2PMU A;  3U2M A;  1LEA A;  3FAJ A;  1B59 A;  3KP4 A;  2YUS A;  5LEK A;  2L7A A;  5HS8 A;  5BQH A;  2J9W A;  3WTZ A;  4RA2 A;  1S7Z A;  1VTN C;  2Y3D A;  2VON A;  2NOG A;  2CV2 A;  1WGW A;  3VEP A;  4BJ5 C;  3RFY A;  2D2W A;  2E5Z A;  4UUT A;  2YWA A;  3H3Z A;  2JK3 A;  2MD5 A;  4BS9 A;  1A31 A;  4ZZL A;  3N0T A;  2ZC2 A;  4MS2 A;  4MHG A;  2RNJ A;  1TWH J;  1IO2 A;  1L7C A;  1ZR2 A;  1DQU A;  3EDP A;  5F28 E;  2A0U A;  2LQG A;  3WHC A;  1YS7 A;  1NG1 A;  2NSG A;  3JSZ A;  3WAQ A;  4G6Q A;  1VQN I;  5L3F A;  3AG4 H;  4AVP A;  1XX5 A;  1FYL A;  2V9V A;  2IXO A;  1LFU P;  2GAQ A;  4TV7 A;  4H0E A;  3C8Z A;  4IQJ A;  4RGU A;  3OSG A;  3LEV A;  3K4L A;  4X1E A;  2R03 A;  2FUG 2;  2ZNY A;  4JTA B;  1V74 B;  3CEX A;  3TW6 A;  1PJR A;  3TMO A;  4HG2 A;  1TWF J;  3AAF A;  5HV9 A;  3NAU A;  4DQ2 A;  5DM6 F;  1HDP A;  3WTU C;  1ZRC A;  1X1C A;  5GAD J;  5IP9 J;  3MKW B;  1I4Z A;  2H6C A;  4MQ9 F;  4RAY A;  1X3U A;  3V8L A;  3GTK J;  1QQ3 A;  3O6B B;  4N4N B;  4IPA A;  4XLA A;  4Y3O A;  1X4O A;  4GXO A;  4A3J J;  4XWJ A;  1JXS A;  4ABZ A;  3DBR B;  1Z0X A;  2D4U A;  1TFK B;  3VYW A;  3RZD J;  3CJT B;  3TP0 A;  2KK1 A;  1P9Q C;  4J01 A;  2CU7 A;  2M87 A;  3JRA A;  2GM4 A;  3DEU A;  4UVC A;  3SYN A;  4WJ0 A;  4BE2 A;  3B6C A;  1XSX A;  1V3F A;  1Y0N A;  3CUO A;  3OR2 C;  5JVT A;  2EIM C;  5AGF A;  5J3L A;  4E17 A;  2XUB A;  3DMD A;  3QPS A;  1TNT A;  2L9S A;  2J46 A;  2Q9C A;  4M71 A;  1SFX A;  1YLM A;  5DS4 A;  3KP5 A;  4EJU A;  4XRM A;  1BJA A;  2J9B A;  3EG9 B;  1O3S A;  3O6X A;  1B6A A;  1LDJ A;  1M56 C;  2WA0 A;  1UG7 A;  2QLA A;  1FSE A;  4UUV A;  5FCL A;  2KIQ A;  2AVK A;  4JX6 A;  2Q0O A;  2W4S A;  1ZHZ A;  2QE9 A;  5E3N A;  5J6X A;  4BBS J;  1U6G A;  1CGM E;  1LE4 A;  4YII A;  2XAG A;  3W3C A;  2EPO A;  2OV7 A;  1MGT A;  2JTV A;  1J75 A;  1UHM A;  1YRN A;  3QW0 A;  3K1N A;  2GZW A;  3HUG B;  5DS5 A;  1ZHT A;  1WI9 A;  2NUT B;  2MG4 A;  1I6X A;  4IAR A;  1IDZ A;  3B73 A;  2R7X A;  3OOU A;  1LE2 A;  1ZVZ A;  3T5X A;  2TMV P;  1POG A;  1UFB A;  2Y3H A;  3M15 A;  4IHV A;  3WTT C;  3JTG A;  2KIS A;  3ECO A;  3WG9 A;  4RB2 C;  3B6A A;  2VUM J;  2PG4 A;  3QOE A;  2HVS A;  3OOP A;  2NUP B;  3E0J B;  1OW8 A;  3AQB A;  1H9G A;  2XVC A;  4I6Z A;  2IA0 A;  2ZSI B;  4CCO A;  4DGW B;  4ZZD A;  1T0F C;  1DP7 P;  2E2J J;  2W82 A;  1FTS A;  3DCF A;  3CDH A;  1SVL A;  5DTD A;  1I4Y A;  3LSP A;  4N6H A;  4V2G A;  3K1P A;  2AXT C;  2COM A;  1IW7 F;  4YT2 A;  2YZS A;  3MD2 A;  2IXS A;  4XSZ F;  1VQK I;  3A2K A;  3OY9 A;  2KP6 A;  3L2U A;  2FD5 A;  2Y0S A;  1FFT C;  2OZU A;  1PYV A;  2LP0 A;  1SMY F;  1LNW A;  2HYG D;  4HFK B;  2JT1 A;  1WWX A;  5BQI A;  1FAP B;  1NK2 P;  2EZI A;  1LUJ B;  2F5C A;  2VCA A;  5KNL A;  3KIO A;  2HMZ A;  2V1D A;  1AKH B;  3ABM C;  4HZF A;  3HTU A;  1ENH A;  1FX7 A;  3OYK A;  4A3I J;  1BL0 A;  4BQN A;  1NHA A;  2M5W A;  4M9X A;  4IRH A;  3TW7 A;  5C4J J;  2MD0 A;  1K78 B;  3KFW X;  5EZG A;  2TRT A;  3WE2 A;  4E0I A;  3F72 A;  3R7C A;  3GM3 A;  3LQQ A;  4NHJ A;  1HKT A;  3EUK L;  3FX3 A;  5B3S H;  2VT3 A;  3DJU B;  3TK0 A;  4G94 A;  5EYR A;  1LKX A;  2EPF A;  3EQL F;  4ZYG A;  3DWW A;  1W5T A;  2EFN A;  1ZK8 A;  1Q1H A;  4EM1 A;  1P7I A;  2K9M A;  1JE8 A;  3TO6 A;  1UB9 A;  3EHN A;  4BEJ A;  2ZXO A;  1ZRD A;  1FBQ A;  2ZB9 A;  2EPK X;  2L6F A;  3R60 A;  1VQ4 I;  5IPA A;  4IB4 A;  3EG9 A;  1HC8 A;  3U8P A;  1KQ8 A;  5K1Y A;  2LH9 A;  1G3S A;  2R93 J;  3DAG A;  2JRT A;  2KLO A;  3F46 A;  1QA6 A;  2HZ8 A;  3I64 A;  3I58 A;  4PJJ A;  1JUM A;  4XOT A;  4PFO A;  3GEE A;  1BC7 C;  2VBY A;  2VI6 A;  3A01 B;  4B43 A;  2EZH A;  5D5V B;  4FET A;  4A3K J;  5D8L B;  4XNF A;  4MNU A;  3HUG A;  1GM5 A;  5GAG J;  5E3A A;  4H4K C;  1MBG A;  2R7D A;  2NUT A;  4OU0 A;  1TWC A;  1Z6A A;  1MZB A;  3SHF A;  1WKM A;  4CS8 C;  2CW7 A;  2JSP A;  3LST A;  4RGS A;  4CO8 A;  2Y48 A;  4BAY A;  2QWW A;  2R7T A;  4OD5 A;  4W1U A;  3CCU I;  2MBF A;  3HGG A;  3ZRG A;  3VF0 A;  1GUU A;  3PO3 J;  3B71 A;  2BXZ A;  2W7N A;  2LY1 A;  1I6H J;  4XKW A;  3HOS A;  2FAP B;  4C7O B;  3C63 A;  1JGS A;  1SEU A;  1LQ1 A;  4OAZ A;  1OPC A;  3KEY A;  2ZXW C;  3BG9 A;  3GZN B;  2NUP A;  1OW7 A;  2E2H J;  4LJZ F;  1UJ8 A;  2QUF A;  4A6E A;  2UXN A;  2RQP A;  1FTZ A;  4MIM A;  4IZZ A;  2L7M P;  4E7Z A;  1SFU A;  2F5E A;  2A61 A;  2R5Z A;  3COA C;  2A6T A;  1I5Z A;  2DMQ A;  2ID3 A;  3RQ4 A;  2VBX A;  3ABL H;  4RB1 A;  3EUH C;  3RPU D;  3CMY A;  1AU7 A;  1Z3I X;  1TNS A;  2MAB A;  4ESB A;  1NBB A;  2GBY A;  1QU3 A;  3BPV A;  3CCV I;  4P9T A;  1HKS A;  3DTI A;  2CGE A;  3Q3S A;  3E5X A;  2OU2 A;  2KIM A;  2FBI A;  2HS5 A;  3P7N A;  1TWC J;  3BLY A;  4R8H A;  4Y33 A;  2UUH A;  2YL3 A;  1AKH A;  4D4N A;  5LRS A;  1U89 A;  1R4T A;  4LB5 A;  4YL0 A;  2TCT A;  2P6S A;  4II3 A;  3LSH A;  2X6X A;  3A03 A;  3FM3 A;  3U3B A;  3L7W A;  3QZC A;  1RKT A;  3OYJ A;  1K78 A;  2COB A;  2H8W A;  4HST A;  2ZXP A;  5K5Q A;  3GWZ A;  3R61 A;  2EBI A;  3QYE A;  2FNP A;  3LFK A;  4XLC A;  4BEM J;  2K40 A;  5DQZ A;  4QTR A;  4BJ1 A;  1WH5 A;  2XRL A;  2JD3 A;  4YN0 B;  2KL4 A;  2PEX A;  2OC6 A;  2Y75 A;  5ILU A;  3EGX B;  1NLX A;  1Z6T A;  1O3R A;  2XRO A;  1Q0M A;  2E60 A;  1O57 A;  1OCP A;  5EEH A;  2IM8 A;  2CQ7 A;  2NVU B;  4EQQ A;  2B7E A;  1H89 C;  4XR6 A;  1SD4 A;  5JHU A;  4E7I A;  4LLL A;  3PUF A;  4E18 A;  3K4C A;  2QBY B;  2OTJ I;  4Q4Z F;  2Y0S N;  3CP8 A;  1E85 A;  2DMN A;  3F9K A;  5DD8 A;  2XLV A;  4HDU A;  4M9S A;  1NFO A;  1Q0D A;  4DIQ A;  4JIO A;  3U9J A;  4HX8 A;  3KLO A;  3PFY A;  3A01 A;  2W00 A;  1YW9 A;  4PJL A;  4UVB A;  4ZYE A;  3BQZ A;  5E8I A;  1RRJ A;  4P9U A;  2O61 A;  3K4B A;  2Q4F A;  2WB1 A;  3OYH A;  2EA2 A;  4IOC F;  1LI7 A;  3W2W A;  3O39 A;  3UKG A;  1SFE A;  2WY8 Q;  5DEQ A;  2NYX A;  2W9Y A;  3CME I;  2MC3 A;  2HTS A;  3CSK A;  3G50 A;  3RIP A;  1GGQ A;  3RYP A;  4CZZ A;  1LEB A;  4XEV A;  4AM3 A;  3IKV A;  2EIM H;  5F0F A;  2HZD A;  2LF7 A;  4C7O A;  2ZPA A;  1IN7 A;  4KDP A;  4XPW A;  3KP3 A;  1OFC X;  2MH2 A;  3HNJ A;  2OBP A;  5D6F A;  2HQN A;  1JHH A;  5L3D A;  1F1Z A;  5FD6 A;  1VQM I;  2XHK A;  1H6G A;  4B4C A;  2LDU A;  4O6Y A;  3K6G A;  2K7L A;  3HB9 A;  5GAE J;  4JCZ A;  3J7Y J;  1ZG1 A;  3X2Q C;  4N9I A;  1L3L A;  2ZJ2 A;  3GM1 A;  1UFM A;  4B3A A;  4U5D E;  3SXK A;  3KLN A;  5FZT A;  1N75 A;  4BJ5 A;  2Y9Z A;  1F5T A;  1Z5Z A;  1YTY A;  3CCY A;  3QWL A;  5DDG A;  1J59 A;  2BGC A;  5DV5 A;  1V4R A;  4ZDL A;  2J5O A;  1U9O A;  2O6G E;  1IJW C;  4ESF A;  3SXY A;  2DPU A;  3PHF 2;  1E86 A;  4I01 A;  3L2C A;  3AJM A;  4MVM A;  4MQV A;  1K61 A;  5L0I A;  4PDK A;  4IHY A;  3AL0 C;  5A6B A;  3JRC A;  2WY7 Q;  2AQE A;  4M6X A;  2H1K A;  2Q3T A;  4W8P A;  4L18 B;  1Y56 A;  3JAM Z;  1W1W E;  4A4A A;  5EZH A;  4NTB A;  2L0K A;  3SNH A;  2UUZ A;  4YK5 A;  3H3V K;  3M1C B;  3NMI A;  2QZ8 A;  2WTE A;  3L1P A;  1HOM A;  3FAP B;  1OCO C;  3WTS C;  3JRM O;  2P5V A;  3W2V A;  2BOL A;  2G0E A;  1FIA A;  3HJE A;  1Z6R A;  2X85 A;  3EGX A;  3FHN A;  4O7G A;  4A3G J;  3BR1 A;  5CVR A;  4DOZ A;  2DFF A;  3UMH A;  2QY9 A;  3OS2 A;  3U1D A;  1DGR M;  2E35 A;  1ZHX A;  4HNV A;  1JKO C;  2QBY A;  3GLX A;  5DM7 F;  1I39 A;  1M2O A;  5BUO A;  5LGN A;  2CQN A;  4BYY A;  3UGO A;  2CYD A;  2W4B A;  4A6D A;  1FR0 A;  4E7J A;  4ZYA A;  3ZMS A;  2D5V A;  1AOY A;  5L0G A;  1JGG A;  2EWN A;  3ZMT A;  2JA8 J;  4MVR A;  2IVM A;  1GXP A;  3E70 C;  3HPG A;  3ELK A;  1W36 D;  3DF8 A;  1KQ9 A;  4FES A;  1XWJ A;  1MMA A;  1VYK A;  2AWC A;  3AG3 H;  2L9N A;  3FIW A;  1HMD A;  4JTC B;  3DV8 A;  2UUI A;  3ZQF A;  2EFO A;  3BWG A;  1RC9 A;  2HWV A;  3KZZ A;  2EQR A;  1AA7 A;  2EZK A;  3S93 A;  2BW3 B;  3FK7 A;  4AX2 A;  5KYX B;  3LMM A;  2BVM A;  2DT5 A;  1B4A A;  3FVY A;  3IUO A;  1JTY A;  4U87 A;  3PNY A;  1MQV A;  2D1H A;  2V9P A;  4B09 A;  1G4D A;  2R9R B;  2MW8 A;  3P9I A;  3H5A A;  4F92 B;  3K7A J;  1ZR4 A;  4U5C E;  1X58 A;  1FYK A;  1YIO A;  2VC9 A;  4DRI B;  3A11 A;  4J7Y A;  3CES A;  1J5Y A;  3OYI A;  3ZQG A;  4MEY F;  5K7Z A;  1BBH A;  2AP3 A;  2XGX A;  4IXA A;  3R2P A;  3ZTZ A;  2PN6 A;  4IVN A;  3C7J A;  2BY0 A;  2L9V A;  2LFF A;  3J06 A;  1FTT A;  4HEA J;  4N4W A;  3ONQ A;  1LS1 A;  1BA5 A;  1PVE A;  3LAP A;  3WG7 C;  1RNL A;  3V5Z A;  2KZG A;  4B48 A;  3CF5 F;  1BDJ B;  4E6K G;  1OMI A;  3QP5 A;  1JKP C;  5F6F A;  2WV1 A;  4YEJ A;  3PO2 J;  1Z05 A;  4HOB A;  5E18 F;  1YJG A;  2XL4 A;  4QI0 A;  2EIJ C;  4I98 B;  1T0F A;  2YS9 A;  4ESJ A;  1XPX A;  4JUR I;  1YLF A;  3OYF A;  2XGE A;  3ABK H;  2JX0 A;  3BEH A;  3TQO A;  5KYN A;  3C62 A;  5L0J A;  3E7L A;  5CVU A;  3ZN0 A;  3VWB A;  4JQF A;  3MVP A;  3JZ0 A;  1BR1 A;  4CCL A;  5C3E J;  1XDU A;  2VQL A;  1QVT A;  2DFH A;  2E7W A;  3M1C A;  1Q1V A;  5EK0 A;  2V3C C;  2E1N A;  4IQ4 A;  2CFO A;  1QHG A;  4Y13 A;  4YFN F;  1TQG A;  1W2W A;  4HLX A;  1GVJ A;  3P9K A;  2PJR B;  2DFI A;  3MQ0 A;  4IOA F;  3B02 A;  1I5N A;  2PMH A;  3JYY A;  1E83 A;  1IXR C;  2YHS A;  1Y4C A;  4QI2 A;  4UV8 A;  4KT6 A;  2P0N A;  3WTV C;  4DXW A;  3L2Q A;  2D1V A;  3BOQ A;  1ACI A;  2QSH X;  2XLD A;  3O2P E;  4PGG A;  5GTI C;  4NC6 A;  2OJQ A;  2YL0 A;  3M4O J;  3IAM 2;  2E36 A;  2J7P D;  5K5R A;  2CUF A;  2RVC A;  3NKE A;  1G4W R;  1K6Y A;  4OMY A;  1FP1 D;  1XSV A;  2LD5 A;  1G8X A;  4C3J J;  1QPM A;  1G2H A;  3C2G A;  2XPW A;  3TP3 A;  3M7G A;  1WI3 A;  3VPR A;  4UUS B;  1JRA A;  1VYI A;  4AE4 B;  3M3Y J;  2VQH A;  4EV0 A;  3S1N J;  3IEE A;  4E0H A;  2CMP A;  3U21 A;  3ZQH A;  3OYN A;  3S16 J;  3RQF A;  3LSJ A;  2ME0 A;  4BGD A;  3GYH X;  3K1H A;  4CZC A;  3E6D A;  1NSG B;  5CVI A;  2E1M C;  5HOD A;  2QQ8 A;  4XRS G;  5J8F A;  4A0X A;  2BW3 A;  4RDU A;  5CI8 A;  2O0Y A;  5BS6 A;  5FLV A;  1ZKG A;  1TQP A;  3EZH A;  2PQ8 A;  1HBX G;  2X9D A;  4AWX B;  2HV7 A;  1QZX A;  5A6J A;  2CQX A;  1S7E A;  2M7B A;  3LLK A;  1SD6 A;  1N77 A;  3IPM O;  3GFM A;  2ZCW A;  3EGD A;  2CO5 A;  2KJC A;  3KEO A;  2O8X A;  2F22 A;  2I10 A;  3L2R A;  3A1Y A;  2ISY A;  3E6B A;  4XQF A;  1IC8 A;  2GQQ A;  4CS8 A;  2EPL X;  2DB4 A;  5BPD A;  3VAY A;  1XMX A;  5IYB J;  1M57 C;  1BJZ A;  3LSR A;  5T3T A;  2CQK A;  2OQR A;  4BHP A;  1S7A A;  2VN2 A;  3P9C A;  3TOB A;  1YQA A;  1OXK A;  1ZYR F;  4J7T A;  2MSY A;  1SFK A;  5IP6 A;  1VOM A;  3MFN A;  1ZG3 A;  4L0Z B;  1L3P A;  5BQG A;  5A69 A;  2JMW A;  3CCJ I;  1QZZ A;  2FMY A;  3K69 A;  3N97 A;  2ETS A;  1V54 H;  1MMN A;  2VH3 A;  1YO5 C;  1D5Y A;  3MZY A;  1XDS A;  5HS7 A;  1MJ9 A;  4YG2 F;  4FX4 A;  1A7E A;  2QNL A;  1EH7 A;  3AG2 C;  3GEH A;  4KFC A;  4C2U A;  1RI7 A;  4JJG A;  4M6V A;  3LNQ A;  1JT0 A;  1HMO A;  3SDG A;  3FDQ A;  1YW7 A;  1F36 A;  2DYR H;  3SP1 A;  2YX7 A;  3PDM P;  1NG7 A;  2LMD A;  1YI2 I;  1OR7 C;  3NDB B;  5E1Z B;  2DA1 A;  4L5I A;  4WAB A;  4P5O A;  3ECS A;  1UST A;  3EUH A;  3TKY A;  5K5O A;  5EGO B;  1WSU A;  3KE2 A;  5FLX K;  5AIQ A;  3JW4 A;  5HDK A;  2K85 A;  4L5J A;  2XAF A;  3H65 A;  4YT5 A;  2PJR A;  4WX9 A;  2BVL A;  4XQ1 A;  4MFE A;  2DMP A;  1J2X A;  5GP9 A;  3P5J A;  3X2Q H;  3AL0 B;  5CPR B;  4RAZ A;  1T38 A;  4BBR J;  1WOL A;  4FAP B;  4J00 A;  4LLC A;  2FXA A;  4Z6Y A;  2HV6 A;  1M6T A;  5B1B C;  3H9Q A;  4QPO A;  1FY7 A;  5BMZ A;  4KI2 A;  4NC8 A;  3ZP5 A;  4EJO A;  3QOD A;  1HLV A;  1IRZ A;  1GT0 C;  4G7Z F;  1YA7 O;  2H8A A;  2K3F A;  5JR3 A;  3S28 A;  1Z21 A;  1BI1 A;  4K2E A;  2R92 J;  1R4N B;  3S3N A;  3PL8 A;  2UWM A;  2HXI A;  1R49 A;  1TBX A;  3RTR A;  1JJ8 C;  1X2M A;  2L7K A;  3DEW A;  1NZE A;  2V6E A;  2OCC H;  2XRH A;  2ISZ A;  4AE4 A;  2BY2 A;  2LNB A;  5JRA A;  1H9T A;  1G3T A;  4C3H J;  4L9N A;  1RXQ A;  4CYD A;  5C44 J;  1P92 A;  3ASN H;  4OD4 A;  1OCO H;  3GW2 A;  2KJB A;  3Q7L A;  5E3C A;  1MSE C;  1ERD A;  3V5X A;  1OR3 A;  3H5R A;  2F4M B;  2LFB A;  3H92 A;  1DOW A;  1WTY A;  2K86 A;  1HSJ A;  3CJN A;  3QYB A;  3K4M A;  1EA3 A;  3KZY A;  3I55 I;  2LOO A;  4NTF A;  1T8I A;  2EFP A;  2P6V A;  3O55 A;  3LS0 A;  3SEZ A;  1LFP A;  1TTY A;  2K02 A;  3GTM J;  3RW0 A;  2E1O A;  1D1C A;  4M6Y A;  1H0M A;  5LHH A;  2Y30 A;  2P7V B;  2XGD A;  5L3C A;  4BXX J;  2W25 A;  3DFG A;  1XGM A;  2ZD9 A;  4W8K A;  2OD5 A;  3J7A O;  3FXQ A;  2A6H F;  2RAE A;  5IOY A;  3JRH A;  1H88 C;  1B72 B;  2OCE A;  4EGY A;  2FQ3 A;  2GA2 A;  3DE9 A;  3CJR B;  2P7C B;  2PNO A;  3ROU A;  3K7D A;  2Y69 C;  4N4O B;  2ZXI A;  3Q0W A;  1IN6 A;  2RRE A;  2EV0 A;  3WOD F;  1QZE A;  5DUI A;  1DDN A;  2OOC A;  3ZVR A;  3M8J A;  4BY1 J;  1U5T C;  4IHS A;  2XAQ A;  3EYY A;  3TQN A;  2W24 A;  2K3P A;  4IJA A;  4ON0 A;  2HDD A;  5CYV A;  1OCZ C;  4DW6 A;  5GPA A;  4BY7 J;  1V5G A;  2IGN A;  2JWT A;  3F6V A;  1OQY A;  3G3Z A;  2JN6 A;  3IWZ A;  5F1J A;  2IPQ X;  2XRN A;  2KNH A;  4HDV A;  2V1N A;  1IZM A;  2CYY A;  5HOO A;  4MW3 A;  5A6A A;  4AID A;  1ON1 A;  3IH2 A;  3H9J A;  3K4K A;  3MN2 A;  6PAX A;  4U7D A;  2EIN C;  2IA2 A;  2F6C A;  1YIJ I;  1N1C A;  5FJ8 J;  1W0U A;  3VSK A;  3JSE O;  3O8G A;  4Y7N J;  2UXX A;  3WTX C;  1VFC A;  2M7A A;  2YQY A;  4P1W A;  3HOW J;  4K7B A;  4FCY A;  2P81 A;  3GXO A;  4UVA A;  4HV6 A;  4DBQ A;  3WE3 A;  3BRJ A;  4MTD A;  1TC3 C;  3C1D A;  2WC2 A;  3F0C A;  2M30 A;  3DBL B;  1YHQ I;  2V26 A;  3WG7 H;  1FSH A;  2P1A A;  2BYV E;  2LD6 A;  2FBH A;  4IGG A;  3DEE A;  1MSF C;  2GXG A;  2R05 A;  1IV6 A;  2Y31 A;  1N25 A;  4C3B A;  4YFK F;  2AXL A;  3R0J A;  4I7H A;  3OS0 A;  5BPI A;  3DLA A;  5GPC A;  1RES A;  3J7Z I;  1JKR C;  1CF7 B;  3REO A;  2I15 A;  1IZ1 A;  4HEA 2;  1PD1 A;  5TIS C;  2NS7 A;  2K27 A;  2PFB A;  5HDN A;  1SVO A;  1O3U A;  2BY3 A;  4EGZ A;  4WF2 A;  5E3M A;  3GFJ A;  3MBG A;  2QQA A;  1IG7 A;  2X6O A;  3HL2 A;  2FRH A;  4CSA C;  3SZR A;  2DI3 A;  3N4M A;  3ASO C;  3V7O A;  1DOV A;  1LM3 B;  4U88 A;  4XRF A;  4ETS A;  1IAW A;  1WVR A;  1ZLK A;  1WN0 A;  4QDL A;  1QPU A;  4A3F J;  3A02 A;  1ZRF A;  2O3F A;  5FKO A;  2WV0 A;  2AHQ A;  2X48 A;  5LBQ A;  1U8R A;  2LSE A;  3V5Y A;  3S1R J;  2WVO A;  3H36 A;  3BCB A;  3CCM I;  3HSE A;  5LFA A;  2W48 A;  3LQR A;  2GAU A;  4GYT A;  3OYC A;  2Y3G A;  3VYR B;  4BHB A;  3BG5 A;  1FMV A;  2GXB A;  2HSB A;  3J81 K;  1AHD P;  4JEA A;  3CF2 A;  2FBK A;  5ED4 A;  4EMS A;  4XLP F;  2VLA A;  2X1C A;  2HFI A;  2EH3 A;  4EUK B;  5L0F A;  1C03 A;  2EPN A;  3ZCO A;  4E7S A;  1KYZ A;  2P7V A;  4JTD B;  3ZN1 A;  4R32 A;  3F8N A;  1P7J A;  3HNK A;  2OA4 A;  3KKB A;  2EIK C;  3OYG A;  2C03 A;  1FMW A;  2E1M B;  1T08 B;  4ENN A;  1ETX A;  4RB0 A;  1S8N A;  1X1P A;  2HDW A;  1Y6I A;  3BT9 A;  2VBW A;  5B66 C;  1AWC A;  1B72 A;  1JPN A;  1TWA A;  1A5J A;  3CP2 A;  1J8Y F;  3BTJ A;  2K4B A;  4G12 A;  5EG0 B;  4MVZ A;  4IHT A;  3M1E A;  1OKR A;  1LVK A;  3BC8 A;  4M9Z A;  2K9S A;  4U7B A;  4QSH A;  1Y8R B;  2HQR A;  1MJA A;  1R5H A;  1S6L A;  5K7F A;  3AG1 C;  2MFZ A;  1X3W B;  1OCR C;  2TDX A;  5A2Q K;  2C6Y A;  3FXU A;  4EVI A;  3CD6 I;  2VCB A;  2ELH A;  3HBL A;  4XL9 A;  3DD7 A;  4IJJ A;  2BHY A;  2OUM A;  1HQC A;  2A5W A;  3QU3 A;  2EV5 A;  4HX4 A;  3VB2 A;  3RVY A;  5E8G A;  3SYT A;  3SFI A;  4QLC U;  1XGS A;  2NVQ J;  2W1O A;  2IS1 A;  1YZA A;  2IGO A;  3IWF A;  1KYW A;  5F64 A;  2P5L C;  5H20 A;  3EFO B;  2EFQ A;  5IY5 C;  1BN5 A;  3H5N A;  3HGY A;  3W6K B;  3WGG A;  4N6C A;  2GWR A;  1YE9 A;  3WGH A;  3ZIB A;  4CJG A;  4HV5 A;  2RV8 A;  4NQF A;  4A3E J;  3L1M A;  3X1O A;  1GV2 A;  2K9Q A;  3QQA A;  1T9K A;  2LC2 A;  2XPV A;  4RD9 A;  3G6E I;  2Y2Z A;  1R22 A;  3CLO A;  3DXJ F;  3LA7 A;  1LPQ A;  2CUE A;  5FKL A;  2EPM X;  5BQT A;  1KU2 A;  4C3E A;  1T5O A;  3QYF A;  1CF7 A;  2KJG A;  3DJN B;  5F04 A;  2H7O A;  1Q0G A;  3HZJ A;  1X1D A;  1D0Z A;  4AIK A;  1RET A;  3LAJ A;  3FKI J;  4XEF A;  3SJM A;  2HVQ A;  2YSR A;  5E3O A;  1OCC C;  5L0H A;  3PSF A;  1AEP A;  5JLX A;  3G71 I;  3T6J A;  3UMK A;  4XM3 A;  2LKS A;  4CCK A;  4DJ9 A;  3JRT A;  3ZQY A;  2QVO A;  1R1V A;  4NTA A;  4WXD A;  4KIB A;  1IN4 A;  3QRF F;  4EJT A;  3H0D A;  1Z7L A;  2PX9 A;  1V55 C;  2V79 A;  3FXK A;  1GXQ A;  4NQW B;  2HKV A;  4D5F A;  1RIO H;  4XKV A;  2XPU A;  5D92 A;  3OS1 A;  1U0J A;  1QLE C;  2O03 A;  1U3E M;  2WBM A;  1A6Q A;  2KW3 C;  2XKP A;  2FNA A;  2L4A A;  4Q7C A;  2A3S A;  4CDY A;  4I02 A;  3L34 A;  4OWR B;  3HJC A;  4LIV A;  2ME6 A;  2KDO A;  2ZME C;  4CUG A;  1HCR A;  1O7L A;  5B1B H;  2KPM A;  4EBJ A;  1XMA A;  4MTE A;  2GIV A;  4AD9 A;  3VYT B;  1SF8 A;  4MGR A;  2DDA A;  3ULQ B;  3ECH A;  3A0H C;  3CMM A;  1IV8 A;  5ICF A;  3LLI A;  2HU9 A;  1X19 A;  2VT2 A;  1GV5 A;  1SD5 A;  1X4P A;  3LWF A;  1WJF A;  3PSI A;  5D4S A;  3PFI A;  4GQH A;  4EWC A;  2VKE A;  1CQT A;  2A05 A;  4Z9I A;  2HOA A;  1JKQ C;  2NS0 A;  5M5X J;  1OYW A;  2YPR A;  2YEV A;  4E70 A;  4KIS A;  3IHU A;  4F4B A;  3GBG A;  4ER9 A;  2HVR A;  4CS9 C;  3UR3 C;  1W7P B;  1PD0 A;  1P4A A;  3FM5 A;  2MH9 A;  3F8B A;  3C8G B;  4H54 A;  3I59 B;  4A5M A;  2M1B A;  2GA0 A;  3CCR I;  3GEZ A;  2A69 F;  1OW6 A;  2DQR A;  3K70 C;  1ETQ A;  3OL4 A;  2YL1 A;  3LAY A;  3LEO A;  2LY9 A;  3A0B C;  2DT6 A;  3ZMZ A;  3HIF A;  5JLW A;  1RMV A;  4BEH B;  3W8H A;  4JJF A;  5E1X A;  3T8R A;  1J7K A;  2M2E A;  3BJ6 A;  2XIG A;  2KQ9 A;  1XTA A;  1U5T B;  2YLD A;  3MYI A;  5HLH A;  3EFO A;  2E34 A;  3IAS 2;  3IRR A;  4AK9 A;  4EKW A;  2VXZ A;  4DRH B;  4PR9 A;  3OIQ A;  1WPK A;  1AVO B;  3GZ6 A;  4NY3 A;  1E3P A;  2DJI A;  2JJ7 A;  2P0W A;  3IP4 B;  4U0V A;  3HYI A;  4HNT A;  4D1Q A;  2KRH A;  2HQA A;  2Y69 H;  2GFH A;  4RAG A;  4HE8 D;  5FGM A;  4YJW A;  2I5U A;  1XSD A;  2LVS A;  2VJI A;  2NVX J;  2V4J C;  4ZTJ A;  1OR7 A;  2NXN B;  2FEZ A;  4BE1 A;  2LK2 A;  2AO9 A;  3G1L A;  1R5G A;  5EEA A;  1Q0K A;  4O6N A;  2YR2 A;  2IT0 A;  2HJM A;  2X51 A;  3R4K A;  3I56 I;  4XN0 A;  5J1R A;  1MNM C;  1ZQ3 P;  2O9L A;  3RKY A;  2QTV A;  1EQ1 A;  4B47 A;  3F21 A;  3MKY B;  2LIG A;  4CHU A;  2DYS C;  2L02 A;  4U0Y A;  3Q0U A;  3TL4 X;  5LHI A;  2EIN H;  3IV5 A;  4ZYH A;  4DRJ B;  1UG2 A;  2KDZ A;  4F91 B;  2QQB A;  1E0E A;  3DTE A;  1HDD C;  5M5W J;  1HW2 A;  3QMK A;  1D8J A;  5A6B D;  2A0B A;  3C2B A;  4RM3 A;  1DU6 A;  4NQW A;  2A68 F;  1GDT A;  3M8F A;  1WAS A;  4FWV A;  4ULV A;  4KN7 X;  3QPL A;  2R4G A;  1I3A A;  4RGX A;  1MMS A;  2JSC A;  1KU7 A;  3MEX A;  2LSO A;  5FKM A;  5HLI A;  1LDK B;  2ZXJ A;  2GA1 A;  3FIS A;  3U9G A;  3L2V A;  4JBA A;  4FQG A;  3FWE A;  2DMU A;  1BOA A;  2F48 A;  3ZGK A;  4F52 A;  2ZXW H;  2QSF X;  2QLZ A;  2O5R A;  4MVO A;  1T6S A;  2Q9A A;  1E3H A;  2WAE A;  3IRQ A;  4LDK A;  1VI0 A;  4PGH A;  1FWZ A;  1S29 A;  3SZG A;  2D45 A;  2M0C A;  3HDD A;  3I5Q A;  3ZQI A;  4XBF A;  2NNN A;  3BDD A;  4HF2 A;  3LUT B;  3SXZ A;  2OQG A;  2VOO A;  5L3E A;  1YAU O;  1I1G A;  4I0A A;  1JR8 A;  4LK1 F;  2XF5 A;  2HOT A;  1BI2 A;  1YA9 A;  1R7J A;  3O3K A;  1EJ9 A;  2OQM A;  4UB8 C;  2P61 A;  1XN7 A;  2ZNZ A;  3PIP F;  1PCX A;  3AGT A;  1W7P A;  3CDL A;  4IF4 A;  4AYB A;  2LCH A;  3HLZ A;  4FT8 A;  3C8G A;  5D5W B;  2VE9 A;  3I59 A;  4ONS A;  3I5U A;  4XN3 A;  5EJC A;  5JVG F;  3V7C A;  1Z9C A;  3AGU A;  3BR0 A;  2KIF A;  3BJO A;  1LE8 B;  5FRM A;  3G73 A;  1D1A A;  3VYS B;  1APL C;  2Y39 A;  2Y3B A;  4LGW A;  4BEH A;  4ENM A;  3C2H A;  5IYC J;  2V7F A;  3DKX A; 
#chains in the Genus database with same CATH homology
 3KPH A;  2OJE D;  1R5I D;  2ICW G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...