3A11A

Crystal structure of ribose-1,5-bisphosphate isomerase from thermococcus kodakaraensis kod1
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
320
structure length
320
Chain Sequence
b'VVKEVLEIAEKIKNMEIRGAGKIARSAAYALQLQAEKSKATNVDEFWKEMKQAAKILFETRPTAVSLPNALRYVMHRGKIAYSSGADLEQLRFVIINAAKEFIHNSEKALERIGEFGAKRIEDGDVIMTHCHSKAAISVMKTAWEQGKDIKVIVTETRPKWQGKITAKELASYGIPVIYVVDSAARHYMKMTDKVVMGADSITVNGAVINKIGTALIALTAKEHRVWTMIAAETYKFHPETMLGQLVEIEMRDPTEVIPEDELKTWPKNIEVWNPAFDVTPPEYVDVIITERGIIPPYAAIDILREEFGWALKYTEPWED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor eIF-2B, delta subunit
publication title Dynamic, ligand-dependent conformational change triggers reaction of ribose-1,5-bisphosphate isomerase from Thermococcus kodakarensis KOD1
pubmed doi rcsb
source organism Thermococcus kodakaraensis
molecule tags Isomerase
total genus 104
structure length 320
sequence length 320
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.3.1.29: Ribose 1,5-bisphosphate isomerase.
pdb deposition date 2009-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01008 IF-2B Initiation factor 2 subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.420 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) translation initiation factor eif-2b, domain 1 3a11A01
3.40.50.10470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Translation initiation factor eif-2b; domain 2 3a11A02
1VB5A 2A0UA 2YVKA 3A9CA 1W2WB 4ZEMA 3VM6A 4ZEOA 4LDQA 1T5OA 4LDRA 3ECSA 2YRFA 3A11A 5DBOA 1T9KA
chains in the Genus database with same CATH superfamily
3AOUA 3P0EA 3AONB 4ODIA 2R5NA 3RS0A 4J16C 1KH3A 1UC5B 1A4UA 2ID8A 2X0IA 4JODA 3G1TA 1KZ9A 5CUQA 4DARA 1R8XA 1ZHHA 4TVBA 1YKFA 1JNYA 1JXQA 2BY4A 2DR0A 5GP1A 4ECAA 4U2KA 4ZYWA 2VDUE 4FYPA 3TNJA 4CLRB 3IJRA 1IYZA 2W6OA 5JV5A 4C6SA 1KJWA 2WKSA 4BZPA 2IZ0A 4PPFA 3SX2A 2BLLA 2OD7A 3FI0A 3LTEA 4WMLA 2XBUA 4OAPA 3PX7A 2ZBPA 2RDMA 4LVOA 5FV4A 4HGNA 4YS6A 2YYYA 5F64A 3ZJYA 1KY2A 1YIAA 2OHFA 3A2NA 4BKQA 1YA9A 4MJ3A 3HU5A 4J2OA 4TYMA 3WQHA 1UOQA 3EGDA 3HB0A 4RDXA 3S4YA 4HPJB 5CITA 1KC3A 4B3CA 2VHQA 4BMZA 1E92A 3IPYA 4PYOA 3U1VA 3C1TA 4ZI7F 1UMDA 5KWIA 1C9MA 1I3MA 2GN2A 4KMOA 3H9BA 4MW0A 4UNPA 1EFPA 4TLCA 2CDBA 2DY1A 4LJ5A 1LLFA 2PSEA 3NBFA 1OZFA 3IOYA 4ILKA 4OHXA 2CY0A 4QICA 1FDWA 3LCJA 5AOAA 4WQMA 2MSEB 3L84A 4M7PA 1XA4A 3DE5X 1RYFA 4EVQA 1SU4A 1IHDA 3UCFA 1G5QA 4JJZA 3F97A 4K6HA 3GBVA 2I99A 2O8VA 3EH2A 1E7YA 3RFXA 5AQ1A 3UK2A 5DLPA 1N1CA 2PX3A 2JA2A 2PTGA 3WRXC 2O8DA 2VHXA 2V26A 1SIUA 5FBLB 4WABA 1GQQA 2L6HA 3C8MA 3GM1A 1J49A 4UMVA 4GLLA 5IDWA 3FDJA 4B31A 1YGPA 3ZCPA 1TMYA 4PGAA 1MO3A 4HVAA 3SC3A 5KBYA 1L5KA 3ESQA 1K5DA 1MPTA 5EKUA 4P7GA 2B4KA 3ELYA 3G7NA 2Y77A 4HNUA 3HCEA 1R6VA 2HWWA 3LHIA 5DTRA 4TL7A 3CRW1 4D98A 1XMVA 5BSWA 3BG5A 4Q21A 3P2EA 4KLAA 1XZMA 4KEAA 3FNHA 3VNSA 2F59A 4WGZA 3ISVA 4G4GA 3AWDA 3DLIA 3VPSA 1DKQA 2KC3A 3AK4A 4IJ6A 4J7TA 5HIKA 1NVTA 3UOGA 1IOLA 2B6NA 4FOLA 1SK9A 2PL1A 3KB2A 3MJVA 1DC5A 4BX0A 2PZEA 4H4DA 3BZUA 1ID1A 1E2JA 2XDWA 3GAAA 5B58C 1H0HA 4D8VA 4MLPA 3USZA 1C0EA 2YNMC 1J2YA 3LRTA 3K72B 1ZU4A 3TK1A 3EH1A 1X87A 1IU9A 3CLVA 3RF7A 4H1TA 1YU6A 2HQOA 1R6UA 1KK3A 4W8PA 3K4HA 2AG0A 3KYJA 1Z6ZA 3Q9LA 4MP6A 1KMHA 1ZX1A 4E46A 2G09A 4JX9A 3JSAA 1Q1AA 3IODA 4G78A 3LWZA 4DVYP 4X7MA 1EX1A 4V0SA 2N3ZA 4C6HA 5GQSA 4GGMX 1YSCA 4E09A 3DZGA 5CT8A 4ZT2A 4B09A 1VSBA 5LXTF 3GRUA 2AR0A 4D8TA 4HOYA 1W88B 1UQUA 2IQIA 1L1EA 1JR8A 4NK4A 2AK3A 3RRMA 3OE5A 2DC1A 1MB9A 1ENYA 1F1JA 2O6LA 4D0NA 5CDGA 2NZXA 3GJXC 1YS6A 1TW2A 2YY5A 2XYRA 4OX9B 2X0RA 2W22A 3B6JA 1FMWA 4L4XA 5FNVF 3DM9B 2DUUA 2DJ5A 2QLBA 3Q15C 3AKDA 2QNRA 1BKYA 1R5JA 1EVJA 4H15A 4ANFA 5KQRA 3KKZA 1XRSB 5IKMA 1D0VA 5JAUA 2QNIA 3I04M 3TKLA 2VHJA 4WOCA 1OAOA 2ZB8A 3QTHA 3KPUA 1KAHA 2VHUA 4N18A 3QGMA 2FSIA 5A1TA 5ESWA 1V45E 4YJDA 2WZLA 1HKHA 3CRRA 5T57A 2VPXA 4WKNA 5FI3A 2E5FA 1O5TA 4EYOA 3OQVA 3P9ZA 4MUYA 1X38A 1RKEA 3F4LA 1MC8A 3M4XA 3Q6NA 4DSAA 1Y5NA 2BE7A 4LV6A 4BEWA 1XWWA 2VEDA 1J8MF 5EUBA 2R6CA 1V8BA 3T9AA 3M82A 4V0NA 1T9HA 1L6IA 3T61A 3PSHA 5IK2D 3GPIA 1VB3A 4LK2A 1X7GA 3NHLA 3DF7A 4ZICA 2R05A 1IPFA 2YCLA 2AZDA 2P65A 3ZLJA 2GD0A 4PACA 2BTEA 2E0IA 5ALPA 1DXQA 4KXVA 5FWYA 4PNEA 4P22A 3LFUA 3TLBA 4IFBA 2ZITA 1MV5A 3EEQA 5DSXA 3ZBUA 3DFKA 2Y2VA 1ZCBA 4FHFA 1MXFA 1X42A 2X3YA 2VO1A 2CDQA 1VJ5A 3C1UA 1NMEA 3O8BA 1GSAA 1RWBA 3BD8A 3U9MA 1P4HA 3KTDA 1S01A 1NU9C 2QRMA 2JFYA 5IC5A 1K97A 3DULA 3K0AA 5L7YA 3U4QB 1SUDA 1DKNA 2X7JA 4DMKA 2YL7A 2ZIWB 1O5OA 1GITA 4KGDA 1SCQA 4JR0A 4S0ZA 4JI1B 2HJ3A 4NC9A 3GWLA 1L4LA 5CLIA 3EXIA 1NXPA 5LYJF 2GA8A 1HGXA 3OHSX 2X9QA 1KZ1A 1SU7A 4K05A 5C2JB 4HUQA 1QKJA 1RCFA 1X13A 1FE8A 1LI7A 2R5FA 1B4DA 1Y9AA 2P1RA 4ZV9A 1KRWA 4FWTA 1RXUA 2YWXA 1XZEA 1Y7PA 1KZ4A 3M1YA 1NOKA 3FH0A 1YR1A 2CDAA 3NC0C 1R00A 4NBNA 1C7JA 3TBHA 1J5EB 3KSMA 2K5UA 2Q6VA 1U7UA 2NSLA 3A1FA 4DUZB 2I29A 4QX6A 5LMNB 5EJGA 3ILYA 1PLJA 4MWCA 1NVVR 2YWAA 2R97A 3EF0A 1YHZA 2WF9A 4KQ1A 4U5GA 3MJRA 3SS7X 5DT9A 1ORRA 1QP4A 4CYMA 4U6NA 2VQFB 4N54A 3VUFA 1L7QA 3C3AA 3PC7A 4FFBB 5C8YF 1N34B 3Q3JB 2EIHA 1AUQA 5IVDA 3AW8A 1A0BA 1NBAA 2JLAA 1HFJA 3HXKA 3QTTA 1OW8A 2BH2A 5K3FB 3MYRA 2YMMA 3QBJA 3FRHA 4EUFA 5AUNB 5TX7A 1U7DA 1VGQA 1UUFA 2QT0A 4ITVA 1FUYB 5AMXA 4ML3A 3KKLA 3QUQA 4JB8A 1SU6A 1Q0UA 2DVMA 4X7RA 1TVCA 1DJLA 1NQXA 1KOFA 5E4FA 3D3WB 3EGCA 4K1XA 4HATA 1XTIA 4RDAA 2P4EA 4M0KA 1ST3A 2DBRA 2WK1A 1IOWA 4H35A 3R5HA 3ZZMA 2H1HA 1G2QA 4A8PA 1QVVA 2WJIA 2ZXOA 3GGOA 4XUEA 4Q9JA 2Q4EA 2Q5LA 1DB3A 1ISGA 2NSHA 3RYCA 3PD7A 3L8GA 1WB5A 5B7NA 2IUEA 3MMXA 3X1KA 1LF0A 2O5VA 4DHEA 5FD8A 2IXBA 4CTJA 4JYPA 2YFQA 4XX1A 3I2IA 3UW1A 1U8FO 3W2TA 3QXCA 2B94A 2CUZA 1E61A 4Z0HO 2XEDA 1V35A 1EFRD 3UHFA 4XR4A 3UC9A 3C4JA 3BUSA 4IQFA 1ZSNA 4RFLA 3VDRA 5EK0A 2P0EA 5LQNA 2AQ8A 1NBHA 3A0RB 4QBIA 4G0OA 2C0PA 2PS3A 4RS3A 4KRGA 1VI6A 4TKUA 4PZ9A 4TS4A 4ZCPA 2GOYA 5FCLA 4XRRA 4LDQA 4TSKA 2ZBEA 5LQAA 3U9TA 1UC9A 1Z8NA 4WEOA 1FZTA 3RD5A 1DHRA 3E9EA 3QXHA 3EUWA 2G3VA 5FTWA 4RTOA 1PQ4A 2WWXA 4JBHA 2UUHA 4U2BA 2XTMA 3CT4A 4XVHA 3BILA 3WG9A 2EHDA 2QS9A 1PVOA 3V5YA 2XUIA 4GUAA 1YARO 1W19A 1Q0ZA 2QLLA 1BC5A 3GGSA 3ONWA 4WOJA 3LNMB 1PYOA 1WBDA 4C03A 5KNCA 3QY0A 2C3OA 1VYIA 1EX6A 3U09A 3SXPA 2B5OA 1U2TA 2C78A 2XF8A 4Y1RA 1RQLA 4EJSC 5FP0A 3TGLA 1Q7EA 1N7IA 1V4VA 3S1SA 2REQA 1U2EA 1LD3A 3WODF 2XZOA 1QE0A 2BN4A 3IULA 3RC9A 4D1YA 2WINI 2ZRPA 4KH0A 4HQ0A 3JYYA 3SZGA 4B17A 3ZY4A 5F2EA 2C2MA 4CTMA 3FVRA 3EZLA 4O4HB 4UZEA 2RHJA 5KVSA 4F38A 1HNNA 3CAXA 2NGRA 1CR4A 4IM7A 4BGUA 2MHCA 3EPHA 1T5OA 1BXGA 2NU7A 3P0HA 2QGNA 1N32B 1WETA 2JJ2D 3TYXA 2QM3A 3ZXUB 4L8LA 1YOVB 3HKCA 2ZJYA 2WFMA 1DO0A 4QYWA 3W9SA 3VR2A 3N3AC 4M38A 4BO9A 1EVZA 3E5MA 5AVKA 4U7PB 3K66A 5AHKA 2GCNA 2Z98A 2X23A 2GEJA 4UUNA 3ESXA 2VRCD 3QEAZ 3AW9A 3IQXA 1F14A 3IERA 2V3VA 4IMPA 3S90A 5BOSB 1M83A 2GAQA 3COPA 4K9QA 1MFZA 3FMVA 4E2YA 3QKUA 2IXNA 4YRZA 1A5TA 2OTCA 4BQOA 3AY6A 2BFFB 4E7SA 2I7DA 1G8YA 1P7YA 4D4MA 1SD1A 2GM4A 1ZA2A 5F5XA 1XE3A 4CV1A 3RQGA 1LX6A 4ALMA 5DIZA 1T5DX 3NM6B 2R7XA 3LVQE 5IT9A 3ZEIA 1C3LA 4JLBA 1TOAA 3ESBA 1QYVA 1NVFA 2WF5A 3KVNA 4TN5A 3A6HA 4R1UA 5M5BA 4L2IA 4R8LA 3WAJA 2NT4A 1L5WA 1Z73A 3DXFA 4U2EA 3K0FA 1MA0A 5FEMA 2QTBA 2FQ1A 2L42A 1XZFA 3AF3A 3P5SA 5H68A 4Z1MA 4S1WA 1AT1A 5KYXB 1NJ1A 1R1DA 4MS1B 1H0KA 1AGNA 3X2SA 3H5VA 4FKZA 3EK2A 5LJLA 4CFZA 4ZU6X 1WXIA 2O20A 3SBOA 4QBTA 1FJGB 3OCVA 5C5DA 5JD5A 5KTPA 2GUWA 2ICAA 1N25A 2Y0BA 4MDYA 4Q16A 3A0UA 3UWSA 1PWZA 5JFOA 5KYUA 1V1RA 4HB3A 2I2CA 3ZLTA 4R84A 3OJWA 4C76A 3GXOA 1DJQA 3V1NA 4Y6LA 2FHPA 3CG4A 5HQTA 2NW6A 1U9ZA 3EFHA 3ROGA 1ZC3A 5L0DA 2DWOA 2HT1A 4LPKA 5ECGC 4GH5A 1F4VA 5BN5A 4I1OB 1P9LA 2A88A 4M87A 2YMLA 1LJ8A 5TQ2A 4BQPA 4UDVA 2JRCA 1YS1X 5IBQA 2IODA 3RWBA 5FORA 1SA0B 2IYFA 2D2IA 2VA9A 1EA7A 2BJHA 4JL5A 2VH2A 4G5GA 1GLVA 1PQUA 4TPKA 2FPLA 4Q9AA 1RIIA 4YUAA 1DFIA 5AW5A 3U40A 1XU7A 3UJBA 2E4VA 1ZHZA 4ARSA 1II0A 3B9PA 1WS6A 3PC2A 4MO2A 2HHLA 3KFLA 3QTBA 3CR3C 4TKMA 3FWYA 4JASB 1F2TB 3FCXA 3L7DA 4QO7A 1K92A 3WL5A 3LUFA 5KJFA 1TW3A 1TLLA 2VSYA 1UZNA 4JOSA 4PLPA 1E9EA 1OLUB 3NBKA 2BMVA 1S2GA 5AI6A 3EAGA 2DLCX 4QI2A 2VHVA 3UIEA 3A70A 1WPRA 1TEVA 1ZKDA 4KQFA 2VNSA 2QG6A 3MWFA 1W52X 3WOVA 1GYPA 4R6XA 2A58A 4FX5A 3M1AA 3V3TA 5F2OA 2DYSC 4B6RA 2JCSA 4L85A 4P9TA 3D59A 4PGHA 2BTOA 5DM0A 2I7CA 1E7WA 3B3FA 1GRQA 1E98A 7AT1A 4UARA 1JKXA 3MOSA 1R4TA 4XM1A 5C0OE 5DOVA 3UXHA 5A5DA 3RVOA 4EHIA 1ISHA 5BVGA 2HPAA 2P6PA 2B25A 1WOYA 3IKTA 1XAHA 4W8HA 1BE0A 1XCOA 5EHNA 3DF9A 3HNKA 4NBRA 9MHTA 1U0OC 1QH8A 1E86A 2WSLA 1GQFA 2W6IA 1XQVA 5AYVA 4B0OA 5HZGA 4BQIA 1D4ZA 2C5GA 1W5FA 3MTAA 1V8FA 1WWPA 2IYPA 5IANA 3MJ4A 5CH8A 2X3FA 4B7CA 5LPNA 1PQWA 5L0FA 3IGFA 1OXMA 2OR3A 3VOAA 1EXMA 1RHUA 1JYEA 1CYEA 1H2EA 2OV2A 3STXA 5DWVA 3DBRA 1OLSA 3RU9A 3AEKB 4N8DA 2RGAA 2XSZA 1SXJA 1N4DA 5D3MB 1M34A 5AHRA 4NMWA 2VLIA 1WDMA 2HCRA 3JWHA 1X1SA 4BNDB 2AH5A 3DMYA 3C2QA 4DDUA 3PQ3A 2HO5A 3H1GA 1CR1A 3CV3A 4YT4A 2DI3A 1QYRA 4WESA 2AMVA 3AM1A 1J2TA 4ZYTA 2KI5A 4W7HA 2PG3A 1P18A 2OQVA 4ZPJA 1NXTA 1E94E 2NADA 2C3PA 1O8BA 2O9XA 3MLGA 2OCCC 1M8JA 3GVPA 3PEFA 2UYYA 3SC2A 1YHYA 1BDIA 2WP8J 1X8LA 4PBTA 2HI0A 4H7IA 5FBHA 4L4YA 4Y2PA 2H4HA 2WT9A 4PC6A 3RYIA 5LFAA 1FYFA 3CX6A 1IE3A 1ISIA 4PICA 2NZVG 3VC2A 1M1XB 2O3RA 5M04A 3ZDAA 3RYTC 4LLEA 5KS2A 1FFAA 3RIEA 5CVTA 3S2IA 4QVGA 1H8HA 3AH8A 4JIGA 1P73A 1TO2E 1XXLA 5ICMA 2DM6A 2YIJA 5EKTA 3EIOA 2BVNA 3WAGA 3B7WA 1UADA 1P5FA 5KOJB 4OIMA 1HX7A 2KQ9A 16PKA 2DERA 3GJTA 2EIJC 1ESCA 1XNJA 1LUAA 1U3CA 2WM8A 3UW3A 2COEA 2GHTA 2BAGA 3U3BA 1O58A 1ZOIA 2VDLB 2DTXA 3B2NA 1KQGA 5ELXA 2N46A 2VAVA 4MVJH 3T35A 5FBQB 3ZZUA 1CFJA 4LXQA 4DCGA 1QDEA 2LVBA 2MINB 1DAEA 1GCIA 3OIDA 1PKXA 3SQOA 3EUAA 3GLFE 1GPAA 5J5VA 4EFMA 2YS7A 1ORTA 4X1YA 1KF0A 3ABSB 4HXFB 1JFFA 4FGSA 3IPRA 4OGGA 4AMVA 1V3VA 4D74A 3JYQA 3K6RA 3GDHA 1K75A 1O3UA 3PQ8A 3DLAA 1KS2A 4BN4A 3WLEA 4N3CA 2JS7A 4ZVVA 2NZ2A 3LGSA 1L4UA 2WB2A 1JLKA 3WHPA 1YDMA 256BA 3QVKA 5MGBA 2A5GA 2FRDA 3C14C 2NXJA 2B78A 1DPFA 3GCDA 2PSJA 4DR3B 1SUWA 4RAQA 5AJUA 2Z9BA 3QF4B 4G37A 1ZSVA 2DF8A 2HNKA 3GRFA 3FF4A 4E6EA 4JBNA 2C4HA 1XHEA 4TTVA 1OT5A 3IEEA 4ND1A 2ROQA 2HNBA 4IGFA 3TI7A 4WK2B 5DXFA 5FTNA 3RH0A 3HS3A 3PR3A 4YAOA 2ZIAA 3RYHB 4JS0A 4YRPA 1KFCB 2EQBA 5D84A 2CLSA 1Q0SA 3KKNA 5HKAA 3CLHA 4GRDA 4MV8A 3B13B 4EBFA 3MXOA 4ZGGA 3U81A 2JFGA 4WCFB 3P4YA 1RABA 1IUNA 1CS4C 3UOWA 1ELOA 2FPGA 1NWCA 1FCJA 1H23A 5TDHA 2QN6A 4FR5A 2FG5A 3O8LA 3BRQA 3F9RA 2B69A 1NX6A 1YAHA 4OYRA 1L7XA 3BQMB 2OFFA 3IT1A 4DCJA 4DYDA 4ZXPA 2YJ3A 2J3IA 5BUCA 1QQBA 3H3FA 3AR9A 4IDHA 3T1QA 1DZ3A 1Y1TA 4GMFA 3LTNC 3TR0A 1JRAA 1KVUA 3H3JA 4A26A 4ZQEA 3EDMA 5BSTA 4EFLA 2B5VA 3RBXA 3RKRA 1Q3KA 1IG3A 1F2UB 2GA9A 3KU1A 4URHA 4QWWA 1QHGA 5B1HA 4JLVA 4ALLA 2EX4A 3KP1A 3QI2A 2NU8A 2ZTHA 1YOBA 2JFQA 5JOQA 3ZI4A 4NAUA 5MN5A 3AUSA 1MIHA 2GH1A 2BSAA 4CLDA 3CUKA 2PCJA 1YZVA 3U4GA 5I7OA 4PZEA 1EVKA 5AKIA 3HV2A 1WR8A 5JXIA 4MO9A 3RTBA 2R47A 1HNZB 1FY2A 1Q95A 3MXTA 1PL0A 1LVHA 5GOZA 3PS9A 4GI3A 1M34E 3EN0A 1WCV1 3U17A 3K7EA 2H4ZA 1TTHA 1FUKA 4RA6B 5AGFA 2A8YA 1I2DA 2MYTA 2V7XA 5LYJA 1E5LA 3GJ8A 4DC1A 1RKCA 5CLFA 1XYGA 1COZA 4MGZR 3R9XB 3HDJA 4WKPA 2O8CA 4BNVA 3HB4X 1P0IA 3HYNA 3M1LA 1EJ2A 2ONZA 1E7QA 4J0GA 2OCGA 4TLEA 1XZNA 5IDYA 1FJHA 1DRVA 5DWDA 1KJJA 1GDDA 2LD6A 3ILHA 4IXNA 1A71A 3DLHA 3HZOA 4F4CA 3BGDA 4IHKA 2P9QA 1P62B 5L53A 1J8QA 3ZDRA 2Z2XA 2I9PA 1OYYA 3W1VA 3K0CA 2VSXA 4C7OA 1ULHA 1TYEB 2SKCA 2IGBA 4ND6A 3JSXA 4WLOA 2VJCA 2OQ2A 2ZQYA 3JQGB 3L93A 2DKFA 3CCCA 4HBGA 4DLRA 4GM1A 3S1LA 1E79D 1BJRE 4HD8A 2XKJE 4X0EA 5MFPA 1K6IA 4N5LA 3CC8A 2ZREA 4P5EA 3O5AA 4LLCA 1Y1RA 4MVJD 2HDOA 1YJ5A 1U8EA 2VCBA 1G0NA 1A8UA 2BFCB 1OZ0A 5ITZA 3PFWO 5DBHX 4HN2A 3EC2A 4G63A 3NIGB 3G2MA 1Y6GA 1I6MA 3WNZA 1T4DA 2QI9F 3WLLA 4MRRA 1AKYA 5SYMA 1HMOA 4ALKA 4NBLA 4F7DA 3CKMA 3IVRA 2PGXA 4LBVA 4EK9A 3H6HA 4FHDA 4OLFA 4FGLA 4S1OA 4N8SA 2H51A 4C4TA 3KSAC 2EX0A 3SKVA 3COJA 4RV9A 3AI7A 5HKOA 3O91A 4HQKA 1YBMA 1XLVA 4Z2YA 4TXHA 2MIIA 2XNHA 2F55A 4GKBA 5KQGA 1ECFA 4BL5A 2ZI4A 3PZBA 3EZFA 3GFVA 4IX9A 1L5FA 4P0QB 4YHBA 4A2QA 1MNQA 3SOPA 1HT0A 2JJYA 4CM3A 4Q1VA 4I9GA 5KSWB 3SXKA 4HEAJ 4ZCQA 2TMVP 2QZJA 4WY2A 2V7GA 1QU3A 3T5MA 3PUXA 4HNVA 4NECA 3AR4A 4PFPA 4D0RA 3NASA 1CUGA 4KQJA 1Q50A 4FXPA 1J2JA 4D3XA 2P2SA 4NQRA 2HQRA 2QN9A 1YNSA 1R0SA 4Q01A 4YRFA 2MU1A 5HIAA 2Q3DA 5CAEA 1ZN8A 3K09A 3VR2D 4QEKA 3L8ZA 1IG0A 4PX9A 4PO8A 1YE5A 2AWYA 2FAPB 4AJ4A 1E60A 2CEKA 2VNAA 4O4LB 3BIJA 4UUMA 3RJZA 1SIOA 4L4ZA 1NC3A 3CX8A 1TYZA 3TB6A 3OKCA 4FB4A 2AUMA 1NLXA 4KNWA 1K04A 2GEFA 3WKAA 2Y1CA 1BW9A 2I3DA 4AICA 1PW5A 3B6ZA 1XCLA 4J1TA 3LUCA 3UXYA 1JHUA 3RRJA 5AM1A 1WXEA 2LGJA 2R62A 2BGJA 1UK9A 3N5CA 2OEVA 4KDEA 3KXLA 4OJYA 2ON6A 1VPEA 1JKMA 1VIYA 3QW4B 1TVEA 1VL8A 3LH5A 4TYWA 1R4MA 1OE0A 2YZKA 4OPMA 4R2LA 2V4ZA 1XZBA 3CGWA 1FP7A 5JWHA 3A58B 1HSOA 2CHVA 4Q4HB 4DSZA 2NTNA 1GAEO 4P82A 2VJKA 5DI3B 3NHKA 5TR9A 5CB4B 4BPMA 3IVAA 4FLFA 2AEJA 2N0SA 4R16A 2ZOSA 1CEEA 4Z1MD 5HZMA 2Z1MA 4OQZA 1H1LA 4CV3A 5BQ5A 3F98A 4LK3A 2WNHA 1PJSA 3KHSA 1TRKA 1NMYA 3D6FA 2PGJA 1P9WA 3NKDA 2R6R1 1YRYE 4GPZA 3IEIA 2VWQA 1LVGA 1VXOA 4AZ3A 2QUPA 2VCCA 3T06B 3EA4A 4IIUA 3EGXB 5KC9A 1BDBA 5CLJA 3FFBA 4G24A 4QLBA 5D1NA 1XRNA 1VYVA 3U9LA 1I2BA 2ZSIA 1OILA 3KLBA 4AQYB 4RD4A 2FEOA 4ZKDA 3EOBI 4Q39A 5CW2A 2J9VA 3S68A 1PYGA 2QAGC 1ADBA 2PYDA 1PFWA 1J7KA 2VNHA 1T34A 1GTSA 2IIPA 1KNYA 4RXUA 4N7BA 5G0SA 4RETA 1AZWA 1SXIA 1NU8A 2B6HA 2XOEA 1DG9A 1EGVB 2FQQA 3COSA 4JL8A 2CCGA 3AJ9A 1SZPA 3C0KA 5BYJA 1ESNA 3B1YA 3CB4A 5D5PA 4Z9HA 1Y3DE 1BCSA 4KLNA 2RGBA 1NNUA 3AL3A 4QPDA 4CDMA 4HZGA 4ZCLA 1GU0A 2DKNA 5GM2A 3JQCA 4WH0A 1MBZA 3MSXA 3DE7X 1FDRA 4RHFA 2CL6X 4NFLA 4EGSA 4LJLA 2XWSA 4GDMA 3ABRB 4EELA 2N9UA 3HB7A 3W7AA 1LSUA 1QTNA 4AS2A 5J23A 1R0RE 4Z99A 1YONA 1ZMOA 3OESA 2AJLI 1KSGA 3QYJA 2MT9A 2J59A 2QROA 1KHTA 1ZWKA 2EKZA 5CP8A 2FYTA 4ZAXA 1KQFA 3NJ4A 2VJQA 4KKXB 4LZJA 1JG2A 4N48A 2OAEA 4LOIA 3MX3A 2FG6C 3V5NA 3VJRA 3QLEA 4XIJA 1UZAA 2H3EA 2IL1A 4Y9UA 4IUYA 1YULA 3D3JA 1BQ3A 1BXKA 3VR6A 4UMDA 2QAIA 2GJ9A 2G28A 1FDOA 4DJFC 2OHHA 5I7RA 4C0AC 5K8IA 1JTVA 4Y2TA 3TD9A 1V6AA 5CU7A 5DV9A 1C8VB 3TXXA 1KDPA 1T3ZA 1SY7A 2RGWA 4DBLE 1CY2A 4K7JA 4Z7OB 3P4XA 4E4TA 4L1KA 3DB1A 2X42A 4PS1A 4XTKA 3LUHA 1TI7A 5LZ9A 4JP3A 5K4AA 5B4TA 2XE4A 2R4TA 3M83A 3WFIA 2W6ID 4RH0A 1FTGA 2EW8A 4DTIA 3I09A 4LJ8A 1ZRHA 4XWGA 4IVQA 2RBGA 1MJ5A 3EQZA 3IT0A 3GFTA 2O2ZA 4ZHQA 1EE2A 1KRXA 4Q15A 3DFIA 4XAQA 4GL2A 1G8MA 2VCAA 3B6KA 4MQBA 1NLYA 5CJPA 2XIQA 1W2WB 4FWIB 4Q1FA 4XLPF 3ZI0A 2C5FA 5ILOA 3SBXA 4LX8A 5I5EA 1AKMA 4NCIA 3T9CA 5EJFA 4LNUB 2OV6A 4K6CA 3RNLA 3T7IA 4LHSA 4K2HA 5CTJA 1XN1A 4LERA 1ZMTA 5BR8B 5K3EA 2XSZD 1SXJD 1K5HA 1OCOC 2W37A 1OIVA 1L7PA 2WB7A 3JATA 1FPQA 2OXEA 2EW1A 5DYNA 4HX5A 3PG5A 2ZSHA 4CIWA 5BSFA 4XYBA 1IB0A 2GN9A 1V3UA 3WYNA 4UFOA 2C5AA 3E4DA 2XOXA 2FKNA 1RJ9A 5CJJA 3AFOA 1J99A 3OCYA 1LDYA 4J4BA 5F73A 4F04A 1RQNA 5F3DA 4X1IA 4QOIA 4A1FA 3ZIBA 4EUSA 1WKVA 3JTLO 3GCWA 3A9SA 4GLFA 4W5OA 4YRNA 5J47A 4MV5A 1KL7A 2M1XA 1W34A 2H4YA 3WJ1A 1I5RA 1FMVA 4R7GA 4TRRA 2R9VA 4AL1A 1A5ZA 2W6JA 5EIFA 4RPGA 4D6XA 1K8RA 3HEMA 3C7KA 2TECE 2NTVA 3H2IA 4IXMA 5FWAA 4REMA 2BR4A 1H8HD 3V4RA 1G21E 4IDDA 5BWCA 3LW8A 2XQFA 3FPEA 3DE4X 3ZZNA 1LSJA 2VHTA 1XXHE 2RBEA 4ISCA 2VPQA 5D86A 3UMKA 1GQYA 2JA1A 4EEZA 5GVRA 1R15A 4UOEA 3AVOA 4WFIA 3VI4B 5DOZA 2NU6A 5EOVA 3HO6A 1A9RA 2FZEA 2J3QA 1CSEE 3OE4A 5TQJA 2FZKA 4YXFA 3OLYA 1XI2A 4X3CA 2OLKA 3AUUA 2AU5A 1DIRA 1H85A 3DE8A 4EUEA 2J3MA 4QGBA 4M53A 4FK8A 1V6CA 1GR1A 2FMUA 3PPXA 3PMRA 1ZA1A 4RSRA 2FSUA 2LPMA 3HCFA 4ND3A 1DINA 3C3BA 4HQLA 1T15A 1UXGA 5JH7B 2X0DA 3HNOA 1RI5A 4GMGA 4R54A 5JSZB 1JFRA 5BQPA 4TWRA 3RV3A 4CI0B 1BEZA 4CQJA 4X24A 2EOAA 4D81A 4AW9A 1UK6A 2ECPA 3V8MA 3M79A 2A14A 1UFOA 3I5PA 5ECDA 4TL8A 5TMBA 4ZK2A 1YS2X 3K6BA 1GPJA 1Q6YA 2QRNA 1JDBC 4XCQA 3U3KA 1NF9A 1QO7A 3KKEA 1T0BA 2O14A 3ASOC 4MCJA 2QTCA 3O4FA 3F0TA 3IQTA 1FFBA 1DCMA 1CF4A 2ZD9A 4U02A 2PGDA 3SR0A 1Q0DA 3BTUA 4RXTA 5FL7A 2ZT8A 4JEUA 4MYUA 2EC5A 2PEZA 1MAWA 2PPLA 3NVMB 2TYSB 3DFZA 2R87A 4MVWA 4CIAA 4E5KA 4EY8A 1YJQA 2DHRA 1RQ2A 4I9UA 2Y4NA 1M2JA 4NC3A 3R7AA 1KOLA 3TJZA 6AT1A 5HYVA 1P1HA 4M6WA 3H5RA 4R31A 4RNDB 1PF7E 3UMIA 2EIMC 2YICA 1Z4KA 1S3GA 3OUTA 3P0JA 4BXOB 2BMEA 3CGGA 2QRVA 4G4SP 4E1AA 3FJYA 4J2TA 1L5HA 3UAVA 2ZTLA 3O3CA 4Q9IA 2CMKA 1KE2A 5DM2A 1TWCA 5A6SB 3IURA 4YDRA 2JFNA 3WK5A 1LPPA 3IHKA 6REQA 2IP2A 5GM1A 3TW6A 1QZXA 2C29D 1JTFA 3UWDA 3EQ7A 1EFKA 5FT9A 4BO7A 1DWPA 2UYGA 3LAYA 5EZ6B 1W75A 4G5RA 2WP0A 3GRAA 4M63A 1Z36A 4DA7A 1I7DA 2BPOA 4F5DA 1SQFA 3T5AA 1WXGA 1WZNA 4WINA 3L8JA 3IA2A 5BWOA 5I4KA 5LYYA 4JW1A 3TKYA 3L0CA 3ABMC 2XTNA 3PRHA 1PT6A 1BHO1 5FQNA 1ORHA 1JJFA 2H7VC 4B6QA 1SHTX 5KSPA 5E6UB 4M76B 3ZCQA 1L8XA 1WV1A 3JYLA 3IIIA 5KINB 4UVGA 3SEFA 4EA7A 2EL9A 3KMIA 4HDSB 4QM6A 4UOZA 4FB5A 1T0JB 2YWEA 1FRZA 2R96A 3LVBA 3U7HB 1PLKA 1RXSA 1N77A 1KO8A 3P2JA 4AFNA 5B1BC 3ROMA 4HDNB 3H75A 2VWHA 4TVKA 1IY8A 3B82A 1PR6A 1V55C 3LE8A 1PGPA 1C14A 2XYQA 1SO8A 1VL2A 3NYWA 2PBEA 2YMQA 2A0UA 1FYWA 1SPBS 4GLBA 1IZ9A 3FPBA 4F5ZA 3L92A 1SKUA 3MTBA 3PXUA 2VA8A 4JEIA 1TADA 4DMGA 4IY1A 3IQZA 1I5NA 2EJVA 1RBQA 5EPEA 4EPRA 5EGSA 1QHXA 1K3UB 5JSUA 3O74A 1X9HA 4KAAA 4G41A 4X63A 4N47A 1WU7A 3OPVA 3PQ6A 1G4AE 2FLVA 3KU4A 3IT2A 2Z6VA 2PZAA 2MSLA 4CNQA 3ZVKA 4KSCA 4NOMA 1ZM3A 4MIYA 4O2BB 2AUTA 3H7AA 3G0BA 3PDWA 1QQ6A 4BGVA 1VCOA 4I4TA 1XMPA 3BE4A 2NSYA 1VJGA 3QHPA 4XSGA 3IAS6 4EYKA 4NCJA 1KK1A 2R00A 3C3YA 1SKYB 4A0HA 3RLFA 3NBZC 3RSCA 2Q8PA 4EKDA 1NASA 1X7ZB 1W4LA 2AEFA 3IHUA 4JUFA 2Q8NA 4UEKA 4J29A 1OTXA 2A0XA 3MQFA 3HA3A 5JU6A 3PVCA 3B48A 4DDVA 3ZV6A 2PSFA 2QX4A 5ED4A 2GM5A 2VJDA 5FTKA 5TPWA 2O0HA 2EEPA 3VR6H 2B5WA 1QQ3A 1JH8A 3JASA 4O6NA 2KBFA 1IMOA 3CCBA 3K1AA 2DHQA 2WAOA 3ZBPA 1UFRA 3OTOB 2NVWA 4ZU3A 5KSYA 3Q3HA 5E6SB 3MJEA 4A16A 3BH0A 4KNVA 1TK3A 1BSVA 5K6RA 5K3AA 4CHTA 1JAYA 4N76A 4OI2A 3RF6A 1E3WB 3UJHA 1EKYA 3WLJA 5MGNA 2O19A 2D54A 1DDOA 4CT4B 5F1PA 4D99A 2FEAA 3GIWA 4EEKA 2O5EA 1TAQA 2C4UA 4WDRA 1SVNA 2WVAA 2D2XA 4H7PA 2XKAA 3JQDA 1VZ3A 1HNXB 4FLEA 4IJVA 2BKUA 3TL6A 3LNRA 4TKLA 3T3DA 3AUAA 2XB8A 4ZOAA 2Z8YA 5CYGA 3C24A 2ZI5A 2EFGA 5IYZB 3OQ1A 3H65A 2TMDA 1WSAA 1DBRA 4RK0A 2WU8A 3NVDA 4YJKA 2GZ3A 5TF0A 3JRTA 2PF4E 2YJGA 4YAJA 3N8DA 1IRIA 2AXEA 2JW5A 1RKXA 3QXGA 4ZALA 2I54A 4F7WA 3WSTA 4JK3A 2A0KA 2BBWA 4PAMA 5JDIA 3H4VA 4EEXA 3UJ6A 3W9UA 3HKEA 1TL7C 3GJRA 1P2UA 1WMDA 3MT7A 2VNKA 4EG5A 4QUEA 3R7SA 2OFWA 1YD7A 4OL9A 3RHZA 3G1UA 4MYSA 3LHSA 1VYKA 4DKJA 3M7IA 4E15A 1U0GA 3PGXA 3RS8A 2YWGA 5JXJA 1CPRA 1FTNA 2PMBA 4L73A 3GD7A 2G4VA 1L7CA 2PXCA 4LZZA 2PQ2A 4QLAA 3RAGA 2XZTA 5JZSA 4IIJF 3IOEA 2WV9A 3HTKC 1G5RA 1NNEA 4ZGBA 4ZD6A 3V4SA 2L18A 5DLDA 1AKTA 5JYCA 2DR3A 3W90A 4I50A 3MT9A 2BMAA 1UP6A 3V46A 1ACMA 3AF0A 2GKGA 2Y1GA 4D6YA 4F60A 1XX6A 4BC1A 3I9LA 5EERA 5CI9A 3CE9A 3GJSA 5J3JA 3ZD6A 5DMXA 2HREA 5AJVB 5A7HA 4CM1A 5FTLA 2PKCA 2LNDA 4XFDA 3L77A 4OFZA 4HDKB 4W5HA 3O82A 3INNA 4PINA 5AVJA 1RI3A 4KX3A 3W6PA 4ACBA 1AQ6A 3I6ZA 3ZXSA 4B47A 3R3SA 1WE2A 2YYZA 1W4RA 1AXEA 4UTZA 3WB2A 1VRVA 2V0NA 4MVSA 3OZFA 4KJZA 3EZ6A 1O9BA 2ODBA 3F5MA 4NBUA 5EP2A 3ND7A 1GFWA 1AA6A 4XQ1A 4DJTA 1HMDA 2PRIA 5C32A 3COYA 5FTJA 4CF5A 3U16A 4N0PA 3CHYA 1PBNA 5TY0A 4MPJA 2L82A 3TIFA 4PGFA 3FUCA 1KYWA 2BBOA 4S24A 1NVXQ 1DC6A 5I7SA 2GVZC 3G9UA 5ERGB 5FOSA 2WVHA 3CH7A 4GC5A 1CS0A 1EFTA 1UBJS 3VR6D 2HSQA 2Y39A 1JEYA 1MF7A 2WVNA 1C1HA 3BREA 4EJ0A 2O2YA 3E9DA 5JQWA 4WTOA 3BHJA 1HLFA 4FC7A 3OOWA 4KYIB 3WGLA 1P72A 4YGYA 4TXNA 1G8XA 3BZBA 4FD3A 3K0KA 4RXMA 2J33A 3O93A 2P9HA 5AXDA 1E1CB 4BU1A 4TN1A 1P77A 3UPDA 4P31A 4RUKA 4UU0A 1N3YA 2GD6A 1QQAA 3VKHA 1DDIA 4LF8B 1GAQA 4R8KA 1AKQA 3U9SA 3OUUA 1P9NA 1QF7A 3ZH2A 4G5OA 1UJCA 3WAQA 3OF3A 2F1IA 2HXSA 4TVSA 4LRQA 4OAQA 3W06A 1QCDA 3ZIUA 4PXYA 1FFYA 2XLMA 1U8XX 3PE3A 4CM7A 3VKFA 4KQEA 4D8UA 2FP4A 1KJ9A 2IX3A 4C3EA 3T7SA 1HA3A 2YVAA 5JEDA 1SCAA 4ZMSA 3L7OA 1XAIA 3A3KA 1HFEL 2Z6AA 2RK4A 3DJFA 3HDQA 3QUCA 4BOYA 2ZYAA 1W73A 3PJRA 4NBWA 1GPYA 1C7QA 4LWOA 4AXBA 4C30A 3TLMA 2OO7A 2EFHB 4BWVA 4WBXC 1XYVA 1HDYA 3BWYA 1RC0A 2G71A 4BEMJ 2H1LA 3K92A 1XMIA 4ZJYA 3H5NA 1NNSA 2C3YA 1T8UA 1USUA 4HZUB 2GEBA 1MMFB 1LCIA 4M99A 2NQTA 4KXWA 5IUNC 4LY6A 2BHNA 1TU0A 2C9ZA 1BAPA 1K88A 4IARA 1XCJA 1ZHXA 4BEJA 3KYDA 5I3ZA 1RPAA 1D2GA 1AA9A 1N92A 1ENOA 3RH3A 1JDNA 1NTOA 2V9ZA 4P34A 5THXA 1VA4A 1Z2AA 4RMHA 4YYEA 1C0LA 3U5TA 1MC5A 4FYVA 1Y6RA 1E1MA 2CFTA 4Z51A 4YRLA 3EHMA 5F2NA 2ZBGA 4E30A 5GIOE 1WOLA 1CC1S 2J46A 1QSGA 3TBKA 2AYZA 3ZNPA 5DM60 5AM4A 4KQIA 2C7OA 2MSNA 4NMMA 4UEQA 2XUOA 3MD9A 1RYBA 4V2UA 4EECA 1DC3A 5CEJA 2NUAA 3B9RA 4LKOA 4KQWA 4Q3BA 2WRZA 4GICA 3BORA 3SJ7A 2B3DA 4PG7A 2H2DA 1SHKA 1FQWA 1J90A 3F46A 3ZJTA 2O2JA 2PMWB 1K40A 3ITEA 2MJLA 1XG5A 1RRPA 1KY3A 3R41A 3D2AA 2EWVA 3BGVA 2C5LA 2HY7A 5JCOC 3OAAA 2VP5A 3AF6A 1RRVA 1J8FA 3FIJA 5CXUA 1C7RA 4ZHQF 3CEPB 3GLFA 1FFSA 1HI9A 3HWSA 5ALNA 4RZUA 4G0MA 4CN9A 3AG5A 4PPQA 3L0BA 3F71A 4P35A 1UKBA 5C4GB 4G6ZA 2ZP1A 2BE9A 3KRTA 1AKUA 2J5QA 1SIBE 1A5SB 2QVBA 4IOKA 2ERXA 3KCQA 5T64A 3O7WA 4MTGA 1KKMA 3RSZA 2BM0A 3JCUQ 5HIJA 1SVWA 2I55A 1MZPA 3U44B 1BX1A 4E22A 2XMQA 2AWOA 3PQ2A 1B6SA 1EX7A 3L7CA 4UJ5A 4NTBA 1OX4B 3RDPA 4ZZIA 5JSFA 3K7DA 4ZT7A 4LGMA 1OI2A 3AESA 4TWAA 4OOFA 4TZTA 5JJBA 2GXAA 1QQ7A 3S1AA 5KJ1A 1THMA 2HFJA 2TSYB 2W4MA 3EYAA 4AP9A 3V8NA 5BWMA 2IKSA 5LA6B 1EJBA 2YASA 4TRJA 4CLRA 1Q0PA 1C29B 4ZI3A 4ZEWA 4CLEA 1E20A 4MTFA 4HX9A 2DLNA 1JU9A 1RYEA 4E1BA 3CTPA 4AB1A 3GI1A 1RAEA 3IDOA 3QPUA 3I2GA 2I33A 3WYBA 5DE3A 5DP1A 1U2RA 4EKNB 5FL7D 1SVUA 3JZFA 1CXZA 2Q3CA 3DJUB 1CUEA 1HSZA 2IDJA 4AL0A 2VR1A 3HMKA 4WWHA 3PFBA 4I9FA 1T6QA 1ENZA 3DM5A 2O59A 1D1CA 2JLXA 1TUBB 4IJQA 3LFTA 1WJGA 1UJBA 2ZRFA 4R9SA 4LOJA 1RNLA 2ZZKA 1A9ZA 4PPYA 4ALIA 4YRQA 2B1QA 2IY8A 1QF9A 3X1MA 2HK8A 3WA7A 4DT1A 4GT1A 4G5QA 2CV0A 1JH9A 4YCSA 4HDQB 5E7IA 3UV7A 2XX3A 4BNLA 3KJXA 1GHTA 1P8JA 4L76A 3KEGA 3IH5A 1L5LA 1UKAA 3PP8A 1C4KA 3DQPA 4HFMA 4TMXA 1Y33E 3Q8XB 4BV2A 3THXB 5GOTA 2HPVA 2CZCA 4AN1A 1VB5A 1SXHA 2QR2A 1Q2UA 2WZBA 1T26A 3K2BA 3RKOF 1QMPA 3C8GB 4JH0A 2IVZA 1GUBA 8OHMA 3TLCA 2C83A 2HMWA 2BGMA 1WVMA 3ATPA 4IRUA 5HZHA 3I9FA 2C94A 1TA4A 1R9JA 1P7ZA 1KK0A 1OC2A 3G85A 4PYRA 4ERXA 5H7XA 4X94A 1OX6A 1OPXA 4IUDS 3IT3A 1LPAB 2F48A 5EIOA 1X3LA 3LCMA 3H0EA 3HFRA 4I7EA 5H4HA 4R1TA 2WPNA 2C4VA 1OWMA 1QHEA 3MC1A 4MHOA 4PYIA 2HWKA 1KEUA 3IMGA 1AKVA 3ZS8A 1JLRA 3JQRA 2AOTA 5ALRA 5AKEA 4W6QA 4PR9A 2Y3HA 1JKIA 2CNDA 3HEAA 3NANA 5HMMA 1IAQA 2C03A 4F2WA 3V3KA 2Q6LA 3VBCA 1H1TA 3AI1A 4JFRA 3VJLA 2AF3C 1LLQA 3WK7A 2J41A 3I1IA 3RI3A 2XGGA 3HGQA 1D7AA 4EHJA 3U7GA 1JDSA 3CWQA 4B32A 2XYHA 3WGYA 1S9HA 4XB6B 4NBSA 5JJKA 3C97A 4Y67A 1JHOA 3RE1A 3IP7A 2PX6A 2NSDA 4G36A 2H9YA 2I80A 4R1NA 2IBTA 1YAUO 1XO1A 3KJFA 3O7MA 3HUTA 3HMQA 3ACDA 4XYLA 3QKRA 5IJZA 3ESYA 4XYMA 4FDTA 1D2MA 2BKXA 3B70A 3ZTYA 3EGVA 3N0XA 4KXMA 1OUMA 4MROA 4MNDA 5CB6A 4HY3A 4YIHA 4PLFA 4WLFA 1DIHA 1YDEA 3WGJA 1A4IA 5EY5B 2QYHA 2CVZA 5EHIA 3L6RA 1XQYA 5A4AA 5JMPA 1YR7A 1R0XA 4J7UA 4MJ7A 1S8NA 1NL3A 3IRVA 4Q7MB 4FOSA 4YJGA 2DHEA 3U0CA 2JKYA 4I55B 4NR0A 1G8GA 2QQ5A 3A9WA 3E9RA 4RIEA 1J1IA 3FOCA 3DDWA 4IIFA 4J1SA 1L5ZA 4G0XA 5JAMA 4YT5A 3FPKA 3LX6A 3IBSA 3MTGA 4F4BA 4CL0A 4EW6A 3HO1A 3ZI7A 1XTQA 3JSEO 4D9EA 1NDUA 4R0VA 1K63A 4ETWA 1CY0A 1R4AA 2I78A 2QRKA 3FPSA 4JEMA 5KNCH 2O48X 5JDCA 3TNDA 1R10A 2C04A 1JPNA 4KI2A 2J85A 2X6RA 2CJYA 2JVJA 1YA6A 2QT1A 1QNLA 2J4FA 1T3SA 2EPKX 2GTIA 3CNOA 4PVCA 3TQIA 5DX1A 2V65A 3HN7A 4JV5B 3TR5A 1TT5A 1DEKA 3HCAA 4KWTA 2ZJ7A 1EXNA 4I4IA 2VPPA 3I01M 4I1PA 5COQA 1EFVB 4U7DA 1VJRA 4QUBA 3LY7A 1PAUA 1E2HA 1XP8A 3P96A 5L0GA 1A4XA 5EYPB 4U7HA 3LK6A 1FDUA 4IWYA 1FFDA 2BV3A 4AC9A 3DZCA 3AG2C 3O8NA 3NAZA 1ZGGA 4FE3A 1ZCZA 1G9SA 2ZRBA 4RV5A 2PLFA 3B6EA 5SV2A 4F1JA 5ELMA 5BRAA 4QDKA 3I5MA 4UHEA 5TT1A 2EDCA 3O3NB 1NIPA 3ZE8A 1PIWA 4ESEA 4Q4JA 1CQPA 2VTKA 3RC3A 2JFPA 1HO3A 3K6SB 3N24A 1KGDA 1JVBA 1R4NB 1PEKE 4KX5A 3HY3A 4QNNA 2Q0HA 3OJXA 3ZE6A 3H5OA 4ARUA 2LW7A 3S2YA 1T5BA 3WHNA 3U13A 2ZSEA 2FLKA 2PZFA 4CIBA 4KR3A 5THQA 4PEVA 1EZ4A 3W5CA 4EARA 4J0IA 1EZZA 3TLEA 4GSKA 4PBRA 4CEJB 3VHXB 1KNQA 2RHCA 2HUJA 1R5BA 4W9NA 2XPCA 3OLVA 2CDCA 4ANJA 5KC8A 1Z9BA 2P2LA 2D13A 4V0LA 4MWSA 4HAOA 4XARA 4DBZA 4DDKA 2L9JA 2P5YA 1PHRA 3VJMA 4J7CA 2PY6A 5K6TA 4HH1A 4I4TF 4BTLA 1SHLA 4BWFB 1XV5A 1KETA 3U4QA 4YRJA 3W7VA 2AN3A 4XD7A 1FF9A 1Z45A 2EZ8A 4NI5A 4JOBA 2CXHA 4KHPB 1T4MA 1TKRA 1V7CA 4EL5A 5JSYA 2ES4A 3AU9A 1UBHS 2CDNA 4NULA 3T3IA 1FP4B 1OF1A 3OMXA 3ORRA 3OCUA 3ZD8A 3LHKA 4NP6A 4RIFA 3QMVA 1X80B 2J8ZA 3Q2KA 1XCGB 3OPMA 3CEAA 5EINA 1JEEA 5E8JA 4BGIA 3MOGA 3CIFA 1SNYA 4AXXA 4C4AA 1QIGA 4B6GA 4LQ4A 3BL5A 3WP0A 3LXMA 3S28A 1QIKA 4MYTA 3FD8A 5LD2B 1CJKC 4LRSB 1XA3A 1U65A 2O52A 1NBIA 1Y6JA 1ZO8A 1N5MA 2D7JA 2FSSA 3DO6A 1Z6AA 1GG5A 2VG8A 5A4KA 4GKKB 4WFKA 3PLRA 7REQB 2OQIA 4LVUA 3OTQA 3R4VA 4CT0A 3PV0A 5EPOA 3QJGA 4MW3A 1E2IA 4JTAB 1DLIA 3G4ZA 1LDMA 2CNBA 2BEUA 2CHUA 4ZQGA 2QX8A 1M6VB 3K0CC 1U9IA 2DBVO 4OF4A 5LBUA 1ZY2A 4JNCA 1B42A 2GYUA 1JHZA 2VSNA 4MVJI 4N0MA 3G9XA 5B7PA 1WRBA 4JJGA 1F0PA 4HFKB 3JQAA 2M6LA 3OCWA 1KDOA 2H2IA 3CN9A 3MUNA 3ICWA 4KMSA 4I2VA 1LE4A 2I6GA 2HQ1A 5TMEA 5KYYB 3NCHA 3FJ1A 4HQFA 4WBNA 2J0XA 1CU1A 5CEEA 5DGTA 2EFJA 3ZE7A 4FMCB 3BTOA 4MV4A 4C0WA 4JEBA 4JKVA 1KYZA 2WUWE 4DV2B 1VIMA 2WMNB 1TZCA 4I3HA 3BXXA 1F60A 5EWJB 4GM0A 2PX8A 5K0JA 1ZD9A 2ZWMA 3D3WA 2ZIFA 1L5VA 5KNCD 3W0LB 1ZCJA 4DJJA 3G79A 4E1VA 4GR5A 1Q0GA 3HLYA 2E87A 3PDUA 1NMZA 1MB4A 1X2EA 5K8CA 3PYLA 3F78A 4BNMA 2IYRA 3T99A 3ZR4B 4LDKA 1VP9A 3TG8A 3R2PA 4YRAA 1GAXA 1W1UA 3DJNB 1E4VA 1JG3A 3LUDA 2WDZA 4R98A 4IIJA 3QELB 4K9PA 5CURA 4E5VA 2ZRAA 4C4YA 3P27A 3KL2A 3VPFA 4LCEA 1V2GA 4L7QA 3HY4A 5AVVA 4E2XA 4JENA 3FKQA 1QRSA 2OO3A 2EINC 3F9IA 2E55A 1Z7YA 4E7OA 5EJ4A 4GL4A 3TRDA 3Q88A 2QMZA 5DS4A 3K09C 2II6A 2FGJA 3H2SA 3VI3B 4AY5A 1Q57A 3M9XA 1PL8A 3RANA 3Q7GA 3QPVA 4XXHA 2JRLA 3T7JA 4I50F 4QNRA 3MJFA 4GI5A 4CLOB 4ZREA 3VX4A 4YRSA 3H13A 3AI2A 3NT5A 3PDIB 1DQYA 2YBEA 4HWKA 1YUMA 4XJVA 2M32A 4HNRA 1NU7D 2I1LA 4M9SA 5BMOA 4HEHA 2WG2A 1UFVA 2AK2A 1CQXA 2C1ZA 3BGIA 3AVVA 2PUDA 2PZBA 1RC8A 1LZLA 1XTJA 3NNNA 4IXWA 4D9CA 1KFBB 3WLIA 2CN1A 2UZ3A 3OURA 3R4CA 2L19A 4LYEA 4IZOA 1SUBA 2ID7A 3HUDA 3EAFA 2EJCA 3IX7A 3M6XA 5T6BA 3ZDBA 1EP1B 1HQCA 2DE0X 4QDJA 3PUZA 5LQDA 2PXHA 5B58T 3WIVA 1TCCA 1VHLA 4PC3A 4O4HA 1J0BA 1FTWA 4FOOA 1U11A 3ANXA 4X8LA 1SBNE 2RGUA 1G21A 2VQEB 4D3FA 1K89A 2ZANA 3MJCA 4YRIA 3SSOA 4MAMA 4A2CA 3NHJA 4OATA 1W9MA 3C6YA 1B6TA 4Q3OA 2B8EA 3VISA 1YOVA 1XXHA 2AZXA 1WG8A 4TX1A 1CERA 4L4RA 4AJ1A 3AGPA 4RZ3A 2WI8A 4D9JA 4XGNA 3PL1A 1EGMB 2ZTUA 2W2XA 1QKRA 2C5HA 1XEFA 1S2LA 5CD1A 1J2EA 1X94A 2ABWA 3GA0A 1CR0A 2GCEA 2JGJA 3U7QB 4KBGA 3MBIA 3FROA 4GI1A 2V45A 2IUSA 4OM7A 5ALYA 2C7PA 4YPFA 2OHVA 2WA2A 3IP1A 3SHVA 1O6BA 3LQ4A 5BOSA 1PGOA 3QVYA 2R1ZA 2DPHA 3EVGA 5BW4A 3R3VA 4OIPF 1HM5A 1RWVA 2REOA 4CBEA 4UPEA 5D6NA 1G7RA 2YKZA 3V6MA 3O1JC 2CNNA 4DLBA 4J91A 3IO3A 5J4LA 1V5FA 1VL0A 3INYA 3WIOA 4NE7A 1Y4AE 2OUKA 4IGGA 1RKQA 1OCEA 1PV2A 5K20A 3DT9A 1QE3A 4IIDA 2Y69C 1QB8A 3GUYA 2QN8A 3ANNA 3ZW7A 3I9V1 5BR1A 2PKEA 2EWWA 4C6TB 1Z8HA 5JROA 2D5CA 1VE6A 2HJSA 1Z2DA 4JIOA 1Q1GA 2QTZA 4EG0A 1TZJA 1YACA 3IPLA 3FXAA 2E49A 3EOZA 3OEWA 2ZB7A 3S2EA 5ERXA 2ZJOA 5JNTA 5KYXA 4XLNF 2VATA 4MS1A 3IAXA 4UOQA 4HEA6 1JU3A 2Q1SA 3P52A 4UBNA 1ESEA 1NMQA 1QFMA 2GI4A 3UK6A 3OECA 2ZE5A 5IS2A 2PU5A 1XTUA 3DOOA 3EUEA 4LV5B 3KBBA 3TCKA 2P9TA 1XOIA 3QLTA 3MAAC 4RY9A 3T4UA 3LUTB 2JFHA 1BROA 2YJ4A 3AHDA 3BA1A 3CX7A 1T36B 2V6GA 3WRYC 4OVKA 4EJFA 4L95C 1II8B 4B9EA 3HNLA 2AC2A 2WIKA 2OBXA 2GAIA 4HH4A 4F4JA 1SCNE 2CDRA 3VPBA 3ZTMA 1KA9H 3DNFA 2EBFX 3A1VA 4O8ZA 1EG2A 2WICA 3LLKA 2HCBA 4PN3A 3KVVA 4XZ3A 4NJEA 2HV7A 1I4DD 3NOOA 2O23A 3W2GA 1JMKC 2Y0PA 4NXMB 3IBGA 1SA0A 1IK6A 5J5AA 4CJGA 2BUBA 1DOHA 1HMPA 3SQLA 3T1YB 2Q4OA 5TEWA 1Z38A 5DVZA 2PMFA 4LSMA 4DM3A 4JLJA 3R7LA 4GGPA 2FW6A 1V9LA 1M76A 3QYAA 3WWEA 4BDSA 3OH8A 2UVPB 1H9TA 1O6CA 1TFKB 5J1SB 3WSWA 1PEAA 1RWPA 4IKEA 2HCFA 4FAPB 4I5GA 3PENA 4BB9A 1OWPA 13PKA 5C37A 4XIGS 1CP3A 4I6GA 3QIAA 5ABPA 3CQZA 1ZN9A 1FRQA 2AFIB 3RUIA 4CT5A 3JALB 3C15C 1E8DA 4R81A 2Z6QA 3CYFA 4TTJA 3VKGA 3H2JA 1DELA 3FTDA 4AN4A 5GPBA 2JLQA 3AB8A 4NIMA 2QNLA 4LYFA 5JXHA 2B0JA 3HDGA 3DOUA 4PTLA 5CH3A 1KAOA 4GNRA 5K0LA 3DZAA 2Y99A 1YQGA 5IJAA 2Z4TA 4KN8A 4BNIA 1VMEA 4ETNA 1F4LA 2GFIA 3EMDA 1D6JA 4ARVA 4H77A 3UK1A 3DUWA 2P7HA 1RC1A 4LRYA 4H3KB 4UTRA 3RAJA 1TFRA 4YMWA 2QN1A 4G81A 2Q4TA 2PH5A 3CWCA 3DYVA 4PYMA 1N8KA 5JS5A 1YASA 3WO0A 1N2XA 4DA4A 3LUKA 4C20A 1C9KA 2GNPA 2XE8A 2I2DA 1GGJA 1QANA 4P33A 3RFYA 4MQEB 1S4QA 5DO9A 1MMGA 1G4UR 3FOAA 1V11A 5KTYA 1B73A 2QXTA 1X6VA 1M5RA 5CI8A 1NIJA 1T1GA 5GAJA 5TIIA 4CL3A 5YASA 3P0FA 2Q9AA 2YXBA 2A9FA 1BQ4A 4KI7A 2AN4A 4K2AA 3DMDA 1E0JA 5C4IA 5CFOA 1Z7Qc 2C57A 2DPLA 3BYZA 3NTXA 1EXDA 3QX9A 1AXRA 1F9EA 1WZUA 4J03A 3ZCTA 1WPGA 1FVOA 3VV2A 3RB8A 1OT3A 4OHOA 4V0KA 5D3MA 3WZLA 4GWGA 1G5IA 3U80A 4LS3A 4O1IA 5HNKA 4BLQA 1WF3A 2VWGA 4ZQHA 2BR3A 1FP2A 2F9FA 1BVRA 1BD3A 2QRPA 3DTVB 3C3CA 5KTNA 3D6MA 2I0FA 1JWBB 4AMGA 3DWGA 4PFKA 3QJYA 4QKQA 4P4SB 3JR3A 3B1JA 4W82A 2PMEA 3GRYA 2XNCA 2QPLA 1G4WR 2PKYX 3QFFA 3QP9A 5DNAA 1ZK3A 4YNBA 4IVRA 5CT5A 1G20B 4FN4A 3TJ5A 3D2LA 2A59A 3RUEA 4UD2A 3DKAA 1I4YA 2H52A 5A6JA 3PT5A 4NZNA 4DADA 3KALA 4HGRA 1C0IA 4XJSA 5AJXA 3V80A 3L4SO 3IXMA 4D3ZA 2QD3A 4DWWA 4QOHA 4RTMA 2DH6A 3QTLA 2GTHA 3FNRA 3JVIA 2IXDA 1FQJA 5L3SB 3S8EA 1HEYA 4MGEA 3WLQA 1LNQA 2BM8A 1RD4A 4RVCA 2LZ0A 3QVGB 2E6KA 1UXOA 1P2DA 4ZAYA 3WFZA 3ZWKA 2D0DA 4KFSA 2FR0A 5KOJA 3HKDB 1P29A 4BP8A 1NJ2A 3FXHA 4E0IA 2ARKA 4UVHA 1RAAA 1VYTA 3E9YA 2DFTA 2VUSA 5BWBA 2IRWA 1H1DA 1HE9A 1E5TA 3I9NA 4I3GA 1BU8A 2RIPA 2H29A 1PD0A 4MA0A 3A9CA 3D0OA 3DTYA 1KZHA 2IDZA 3D6TB 3I53A 1TCBA 1KIFA 4YYZA 3VO2A 3MT8A 3IQ6A 3I8XA 3SY8A 1P81A 2RE8A 5B7GA 3H04A 4MW2A 3RRFA 1CUSA 4HPXB 2D2FA 3QU4A 2C8KA 2XVAA 1M72A 3VU9B 2NACA 1EQ2A 3LQRA 3F1LA 2DQSA 1LX7A 3UF0A 1H4QA 2D59A 2Q6KA 1BDHA 1LPBB 2ZRCA 4HPWA 4BPBA 2J6HA 5B5SA 4JB3A 2Z58A 4IHJA 5EIHA 2GN0A 4OA5A 5B2FA 2OPBA 5J4VA 4YP5A 4HLCA 2VJLA 1U99A 5L4NA 1CLUA 2ADFA 4IOJA 4ESOA 3QUAA 3NYIA 4BZXA 1P2FA 1HYHA 3LKDA 4Q9LA 4BRSA 5MDHA 4XD7D 1AQJA 1KVQA 5MHTA 1PZHA 3LM8A 2P6RA 3UMYA 3EXFA 3KOZA 4QPPA 5SY6A 1OKKA 4PNPA 2E4WA 4PNZA 2G9ZA 2H6EA 2VDOB 4G4JA 5GV8A 3T3HA 5IT0A 5JR3A 3DD1A 1XRPA 4G4IA 4NBVA 4X60A 1NW9B 3WMEA 4BHTA 4ZVRA 3I6BA 5TGZA 2RJ3A 1I30A 3VU0A 2I4RA 1YB1A 4RORA 1PYDA 1MB3A 2NTEA 1JSRA 3AQ4A 1A5BB 2IHBA 2HA6A 1JS1X 5JC1A 4HCJA 4YH1A 4WCFA 4FWVA 4PANA 1UC8A 2AUNA 5HDQA 3PC3A 1QV7A 2HS5A 2R2GA 4O2AA 1GPLA 3G3EA 2H06A 3EFEA 5KYWA 1S5PA 4WL0A 5HE8A 3GT7A 3UT5A 4G0YA 1OAOC 2ODEA 4IFTA 3N76A 1PS9A 4PM4A 3TLGB 2BHLA 4INJA 3OZCA 1G3QA 1DWQA 3KT8A 3T52A 1JE1A 1HEIA 3PPVA 2J32A 1WP4A 5K0SA 2F4VB 3JQAD 4ZVUA 2VEOA 4CF7A 4CF6A 4UNRA 1ORJA 1B0PA 3SP1A 3W6UA 4EG1A 2JAHA 2VHEA 3N39C 2I7VA 3Q9SA 1F2UA 2QM8A 2FWBA 2J45A 3QSYA 4EB6B 4QRDA 1U28A 1Z88A 2P1ZA 2ZATA 3DAYA 3E3OA 2A5LA 5EKXA 5LB4A 2G4CA 2NVOA 1JIKA 4P4NA 5LU8A 3TFWA 3GH1A 4FONA 1ZN7A 3ELWA 3V4PB 2ADOA 4UTVA 1GU1A 4RTSA 4OV6B 2UZ4A 3NIFB 4YRRA 2CL5A 1YI8A 5TC4A 2XB9A 2DRIA 1Z22A 4LHYA 4JTDB 1M2GA 2EAUA 3ZVMA 3JQEA 3QKSA 1TIKA 1U94A 4YT8A 5CVCA 2C82A 3GHYA 2O7QA 2VFAA 3U49A 1N7GA 1GPUA 3NMKA 1Z33A 1N5DA 2W2TA 3R9XA 5JNLA 1XB2A 3OTHA 2V7TA 4YR9A 2P9GA 3C43A 3M2TA 3F1KA 4HHEA 1V7QA 3UAWA 3V42A 2KJGA 4BCBA 1WUTA 1OVMA 1W85A 4UBIA 2XYVA 4QEDA 2CXUA 3GEMA 3IO5A 1XN4A 5LSAA 1EE1A 4YMTA 2JFBA 3QFRA 2FXVA 2BDTA 2C77A 4RPCA 5DLYA 1ENPA 4JLWA 1JJVA 1IIRA 4IG9A 3WB9A 1V4NA 1KEPA 1H2FA 3O03A 4PLVA 3H1EA 2WE8A 2QK4A 3OLQA 1FRFS 1HE3A 3F74A 2Y4OA 4CDAA 3A2LA 3RSFA 3CZMA 3ISJA 3JQGA 1MFPA 4X9XA 1Z56C 4DLNA 4L6IA 1Q1ZA 1L5NA 5EJ2A 4D96A 3L34A 1Z17A 1Y0BA 4R2JA 4BMPB 2O5RA 5K09A 2QYTA 4PZLA 2A4KA 2VLBA 4DDMA 1Y82A 4JB0A 2JPUA 3UAGA 4Y2VA 1BZ4A 5JEEA 1CDEA 1GJRA 4DLLA 3AT1A 4Z9AA 2HB6A 1OVGA 3GJ4A 2BFCA 3ZX4A 4CTKA 3MFQA 1TFUA 2JBHA 1GCUA 3WLTA 5KWVA 4NBTA 1P17A 1QLJA 2EPMX 4M4SA 4CJXA 1CJMA 2PJZA 3TSWA 4RVUA 3CSDA 2I3GA 1VHQA 3IAM1 3FMGA 1ZH4A 4BZZA 1CK4A 2I4NA 1G1AA 4KZPA 4WBNF 1XQ6A 5ALVA 2C2KA 4KWCA 3U61B 1D1TA 1V7ZA 2QI9C 1C1XA 3TIXB 4EW2A 1D1BA 1OYVA 3SAJA 2GVNA 3OWOA 4JCZA 2BD0A 3E9VA 2J5BA 4JLPA 3C3DA 2IXMA 2Q28A 3NC1C 2JG3A 3FHLA 1WGWA 4MYCA 4HAWA 5AH0A 3AVTA 1YRAA 1C0KA 3BKWA 4JLOA 2HMSA 4DA0A 2O3TA 4KE6A 3A31A 3IUYA 3ZYZA 1GV0A 2G82A 1LBEA 2FP3A 5H81A 1Z6PA 4LHZA 3O8DA 2NT3A 2VAPA 2QTGA 2LCFA 1XVAA 1TAGA 4MKIA 5KDLA 5E2IA 1PR3A 4NENB 1F48A 1I36A 3QH4A 2ZUEA 4OLBA 2PT7A 1EVQA 4XW2A 4AG6A 2ZI6A 1CBUA 1IZ0A 4ENRA 2VDWB 3R7DA 3EZXA 1IN8A 4MWTA 3CPEA 4G0UA 2OM6A 4U9HS 3WVNA 1CFZA 1HUQA 1NW3A 4HF7A 3U8PA 2ZRDA 1GEGA 4QASA 4DHWA 2CUTA 1NSFA 1U3TA 2VP2A 3DE3X 3W9YA 2R8XA 4EITA 1SF8A 2P68A 2GPJA 4RVNA 3A4TA 4B85A 1G9TA 4F6RB 4WNYA 3NHSA 1IEVA 1D6MA 2RGYA 2CVOA 2IH2A 5JZBA 4CEHB 1U7XA 5F1KA 1QCCA 1Z4OA 5AM0A 4JP1A 1ECCA 1Q91A 2UZ1B 1QC5B 2B82A 3KG2A 4PHTA 1IAVA 1DWUA 3O6VA 5K1ZA 1SWVA 1W87A 1R12A 2BZGA 3R23A 3HXPA 3MSCA 2Z04A 1QHSA 4KV9A 4DLZA 1GTG1 5DRTA 4JVSB 3K8ZA 5DI3A 3I4LA 4Z9FA 1ATZA 1DC8A 4CG3A 4M8LA 4F1WA 4GSLA 2IT1A 4HN4B 4D9FA 1CB0A 4EMBA 1ZYRF 1Y7HA 2OD9A 4ZIRB 3R8XA 1VPLA 3MRXA 2GPAA 2BTQA 2OSVA 1DKRA 3PR1A 2QRGA 5B12A 3VZRA 4U6QA 5JG7A 4Q3AA 1I14A 1P7VA 2CUKA 1IBCA 4CS9A 3RF3A 5FPYA 4WT7A 4JHXA 4RACA 1EXWA 2ZS9A 3ZV7A 2C9CA 2DB3A 5A71A 4O4HF 4NH0A 1TF2A 2EP8A 3MQ2A 3GUVA 4A0GA 2YV1A 1SC6A 1Z25A 4Q7EA 4B33A 4BAZA 2C2BA 2KSQA 1IW7F 2GWHA 2VH5R 1KMCA 1Q1QA 4RV4A 3L4JA 5DN9A 4BATA 1YVIA 4PLTA 2IHYA 2L6FA 3DMTA 1YJAA 1CYDA 5KDOA 1AGPA 3GM2A 4K40A 4LOKA 3HJUA 1T6IA 3WHLA 3H5AA 2D5RB 1UKYA 3T0GA 3OCJA 5BUOA 2RHDA 4QXPA 1NRXA 2E3JA 2ZWOA 2ATIA 3FDFA 3H17A 1DIOB 1LQTA 3NMJA 4PR3A 4ZN6A 2EZTA 1B1AA 5BUQA 3ZKAA 1TEZA 1IHXA 1VBNA 4H9GA 2GA0A 3LS0A 4OH1A 3HCWA 3THWB 1VHTA 2HSBA 4AKEA 1SCIA 1JQKA 4OYLA 3RS2A 4BNNA 3LLMA 1GO2A 3PYMA 2J9UA 5IF9A 4QI0A 4N1AA 2M6SA 2ZLBA 1PFKA 3FCSB 3PE4A 5BSMA 3CN7A 4ZAZA 3E15A 1XVIA 4J94A 3ZVLA 4H1WA 1GDTA 1WVIA 2IEAA 3FUTA 1NUUA 1E3JA 3K20A 2DYRC 1HDEA 1I5EA 4P3OA 4LJ6A 5AM2A 1WCXA 1M9NA 4KIJA 1B8PA 3RBAA 2YFHA 3I34X 3C6MA 3OZAA 4XYGA 4GZLA 4DEVA 3DV2A 2QP3A 4QU5A 5ALDA 4CETA 5A0TA 4DS3A 4MS3B 3IAFA 4AO6A 4B4DA 3V48A 3VVMA 5FBVB 3IA7A 2Z5GA 2PQ0A 3D1LA 3L5OA 3NW9A 2OK8A 5JZVA 2VRNA 5FWXB 3REQB 5HRUA 1X9IA 4ZZ1A 3I4FA 5GZ3A 3QKTA 5ES3A 4GHWA 4O0MA 3LNTA 4PQRA 4E7ZA 2CD9A 3MM4A 3KXKA 2DPGA 4RPKA 1D3AA 5KSZA 3CM0A 5E6RB 2GBLA 2W6JD 2ZSAA 4ZTZB 2V03A 2VT6A 3BWCA 3F8SA 4XQ0A 2PH1A 5HKKA 2V6MA 1KFJB 2ID4A 4B9AA 1ZI8A 3QM1A 4U4AA 3UB3A 3I72A 5C3MA 4DMHA 3IQWA 4LECA 3BRWA 4D02A 4RPLA 1ZRSA 4FIDA 2JCVA 3N86A 4LI0A 5LUBA 1WA5A 3TQCA 2IYXA 4WKOA 2BC5A 3FWKA 2P1AA 2AG5A 2SECE 1BXRB 3VR4A 3SMQA 3NPAA 1R0KA 3DHEA 3ZSUA 4M54A 1RLOA 3QYFA 3R7WB 2I2FA 1L4EA 3VSAA 2ACKA 1WXDA 4BLWA 4XASA 3BDAA 1E77A 2XSEA 4Z4HA 3D4PA 1JNXX 4WLUA 4ZRDA 4Y2XA 3VPCA 4AY6A 1OIXA 1P5HA 3AFNA 3L8IA 3VTZA 1BFUA 1MP0A 5L3QB 3S29A 5BN4B 1PZFA 1WXXA 5C4MA 4Y9DA 4QOJA 1DXOA 3K30A 2V55B 4HR7A 2Z43A 1OXSC 1KKLA 4UAGA 3C45A 1OSNA 1LQ2A 3CISA 5TPZA 4WLEA 1I32A 1E1RA 3LKVA 5JCZA 3LA8A 1WHTB 4PLYA 1SBQA 4ARCA 2BCEA 1KJIA 2DFNA 1M2VB 1MGPA 1QGDA 5CM8B 4CMIB 1MQ8B 3IIKA 1DOZA 2WTEA 2F3RA 4W1PA 4A5OA 3ZTWA 1J5PA 1AQNA 2FX2A 5F7JA 4NNOA 1DLJA 3AGQA 3HU3A 4C0BA 4DAEA 2P6OA 4GU5A 3U48A 2XGMA 1GN8A 2P7IA 1DHTA 1DC4A 2ZAGA 1CIPA 4K9NA 3EVAA 3M6UA 1NQWA 5HM8A 3HCPA 1GZ5A 1MH1A 4K6OA 4HBZA 2NOAA 4FR0A 5ALQA 2DCUA 1PUJA 3UJ9A 3W8DA 2NO5A 2PKQP 4RD0A 5ESDA 1R9GA 3E1KA 3MUEA 3PF9A 3SXMA 1MMAA 2ZUCA 5JJ5A 3MCWA 1F0YA 4OHBA 2W43A 1YA7O 4P4LA 3D3QA 6LDHA 1LVKA 1ISRA 3HKBB 3UK0A 4LOHA 2Z2IA 4EDFA 3WGHA 3ND5A 2BFBB 2YW9A 1G18A 1R7RA 3HVHA 4IIEA 4P4UA 5A9TA 1IUPA 4E5SA 3MWDB 5L45A 4WRRA 4ASUA 3GWZA 5ALWA 5BYKA 2PV7A 3EA0A 2V97A 2R7AA 1UDAA 5JSZA 5IVPA 3PWZA 3FMOB 4HXEB 2NZUG 5CNKA 3OHPA 4X7BA 3SDZA 1YH3A 2EF1A 5KTSA 2BH9A 1SXJC 3TMYA 2B0HA 2H31A 1S2MA 5ALSA 4AMZA 4LYYA 3L0IB 4H3VA 3SYTA 2VSQA 2R66A 4F96A 5M2QA 4JVMA 2ICWG 3TCXB 4HG2A 3P2OA 3UAOA 4XSVA 4ZOQI 3GAZA 1OFHA 1WEKA 5CCXA 4EWLA 5F5HA 1VJCA 4KPUB 4K8OA 4RE6A 5KYTA 4INZA 2ZJBA 4HNAB 1LH0A 1FJXA 5B53A 1X74A 4B34A 1KARA 5H3CA 1JXMA 2Q41A 3KLOA 4HI0E 3D7RA 3LBFA 3ODGA 1B6GA 3RQEA 1C81A 3NHFA 2JI9A 1OBCA 3CINA 3EPLA 3BGOS 3KB1A 3HBFA 2IWRA 1VJ1A 2F6RA 3R3UA 2P8JA 2FWPA 4QULA 1V74B 3QW0A 2Q6OA 3D7SA 5A6SA 1LV8A 3AQIA 4MI9A 1MJNA 3L79A 4Q34A 2B8TA 1UMKA 3RVQA 5AT1A 1PNRA 4BQNA 4C29A 2IHVA 5THKA 5F3WB 3KAKA 5GIPE 3Q7QA 4IG4A 2G17A 1V8ZA 1TLFA 4B2LA 1JOGA 4JX8A 1PFVA 4FZVA 1VECA 2QJRA 5EJIA 4Q66C 4F1KA 1YJBA 5IKPA 2O8EB 2ZK7A 5KTRA 1XHFA 2BBTA 3VO9A 2WWGA 2QVZX 3TTXA 2FQWA 4OI0A 2Q00A 3TFQA 1YK0A 1FUIA 4F4DA 3ZGYA 4MUKA 5IPFA 4GVPA 4DIOA 1L5GB 3HNJA 3NO4A 4H7HA 1A41A 4L27A 1PG5A 4Q82A 5E6UA 4AO7A 4Y18A 2AT1A 2F1HA 1Z4JA 1IK4A 2OCXA 3L8YA 4B5LA 2J0EA 3GP3A 3K1HA 1D5WA 5LQKA 1XPJA 4IHJF 1FA9A 5TSDA 4GS5A 4LF6B 1T0UA 4HDSA 4XM0A 1EGAA 1W88A 4DG5A 4DQUA 3FF1A 1QPGA 2MWMA 1ZGCA 4OX9Y 4IVNA 4RJ2A 1NTRA 1QKIA 5JDCC 4JBGA 4EZEA 1A95A 1RAIA 2XTZA 3K0EA 2F3PA 4WCDA 1DRWA 1J22A 4WV3A 5A7GA 3RTCA 3I9KA 3V5XA 4KSYA 3NBYC 5LWQA 3KZXA 1WWKA 3FYCA 4BVHA 3VQTA 2FRDC 2REBA 3KJZA 3STTA 1TO6A 4RIGA 3AUXA 3K35A 2YXLA 4JOQA 5DYGA 1UFQA 3WWCA 4PLCA 4JURI 2PDAA 4CU5A 5EMMA 4QTUB 2L6GA 2Q9BA 1P1KA 1AE1A 4BO6A 1MV8A 3FOOA 1HQYE 5I8PA 2RHOA 1GYRA 5JT1A 1Z37A 3TLAA 2Q0XA 2WUFA 2YCBA 1H66A 1G64A 5JT4A 1T2AA 1V25A 3WGNA 3WICA 4XPZA 5DJ5A 1ZD1A 2ZSDA 4BE9A 5DLEA 4HQ6A 1FFGA 4EA8A 4O2AF 4XVCA 4Y2UA 3HUUA 4FR2A 1ZICA 1N6OA 4HJRA 4MUFA 3Q0TA 4NV3A 5IKXA 2IU0A 4TQAA 1YQEA 2HIMA 3THOA 4O2BA 3BE8A 1HRKA 3MELA 1K86A 4CCSA 5E3IA 1IL0A 4KGXA 5DULA 5ES4B 1Z6YA 2RB5A 5TARA 1X7ZA 1L7RA 3SYLA 1C80A 2OAQ1 1CPQA 4CZ2A 4MVCA 2L17A 4LNAA 1T1IA 2ODPA 5GVSA 4AJOA 4EGFA 2MSWA 3KJIA 1HYQA 4Z7JA 1HLGA 1SCUB 3M8KA 3IHWA 1YQUA 4P6IC 1IQ0A 2OEPA 2PFGA 4U0KA 4ZU1X 2WHXA 4ARZB 2JGNA 2O57A 4YONB 3T6KA 3A3PA 4F46A 5GY7A 4CDVA 1TYDE 3HNIA 1NP6A 5COAA 1EWQA 1O3YA 4P3XA 2C3MA 3OC6A 4JUIA 5A06A 4B35A 4CMBA 3OJLA 1QLWA 4O0LA 2NWQA 3KWJA 4IFEA 2H8AA 3RSHA 1HY3A 3X2FA 1OBOA 5CHYA 5D85A 1X1EA 4L16A 4G5HA 5JZMA 3WGVA 4GWLA 3HXLA 2DU8A 4RKYA 2C2HA 1U0HC 1VOMA 1PJ2A 3R6WA 5BR7A 3NXSA 4YN0B 3UBMA 4J8PA 3RREA 4I2NA 1Q22A 1SULA 4DY4A 3JVEA 1WY5A 5FXMA 2WZQA 4LJ7A 5CT4A 5E7MA 4RYLA 5AKGA 2FFAA 2IZZA 4GEKA 3A05A 1PWXA 1GGEA 4BAUA 3AP1A 3TOZA 1NQOA 4DJAA 3DVQX 3PVZA 2E9SA 1QGED 3LGAA 3K8QA 3DL0A 3VR4H 3VKVA 5K0CA 2G1AA 4FFBA 1XJWA 1NG1A 2EIKC 3PHJA 1JT2A 1J70A 3V55A 2XS8A 3ASZA 1YR8A 4WZ6A 4R2HA 4HFRA 5K3FA 3NV7A 3SZMA 1MJHA 1FLNA 2EFCB 4WOPA 4KJXA 3FI9A 1JHXA 2KPOA 4PQEA 5I47A 4F0JA 5HCIA 1VFPA 1RYMA 2Q8QA 3GNLA 3VNVA 1Y5LA 4QXQA 2HQBA 2YIVX 4IP0A 4DR2B 2CLMB 2FEWB 2JZCA 1ZJ4A 2DP4E 3BICA 5IDQA 3P97A 2RMKA 1IATA 4Z3OA 1ZVJA 4ON9A 3G1WA 1UBTS 4DBLC 3KYIB 3HA7A 1XDUA 2QQGA 2PU7A 4DJDC 2OECA 3Q7PA 2H5LA 5HTOA 4QGAA 4JXZA 3N8KA 421PA 4L3VA 4QUDA 2XF2A 4G2TA 2ZTVA 3OT4A 2AJBA 2ZUFA 5DGXA 1HORA 1F7VA 5A1JA 1EK5A 1OV6A 2CB0A 3VVCA 4QA9A 3CVWA 4XWJA 4BC0A 1JZQA 4OMCA 2JKZA 1FP6A 3W8FA 4D9GA 4MV7A 3WLFA 1VQ1A 3R09A 4JQSA 2A9QA 4IF4A 5IKOA 2VZ8A 2GSDA 1POWA 3DWWA 1ODSA 4FJ2A 5CFNA 4QL3A 2QA5A 5IT4A 1K06A 4XKJA 3O2NA 2FXIA 1VMKA 3H9QA 4YRCA 4KGVA 1ZJ5A 1YTLA 4WXRA 1G8AA 3I9JA 4R7TA 2Y1XA 3LP6A 3VZPA 1GZ7A 4Y6RA 1LLDA 2BEVB 3HACA 3ZDZB 3A6EA 1RRKA 1HZZA 3QENA 3K96A 5L0HA 1KYIA 4DLVA 3SFZA 3AJDA 4GR4A 3JAKB 1ZWLA 4H60A 4M1EA 4RZQA 2FUG1 4MQMA 4BX9A 4J1TC 2QJOA 1H4TA 2CYCA 1FYXA 4E94A 1H8EA 1Q1NA 2H00A 3EB9A 4KW7A 1M5UA 2QX6A 1HL7A 4B79A 1JAZA 4KZKA 1QONA 3II6X 2ILTA 3H8WA 2C2YA 5IM4A 3HUEA 1MB0A 4C89A 5ELLA 2AKEA 3EYWA 4IEIA 2UZ0A 2P91A 1YZ3A 5CB4F 3CPSA 3EULA 4R41A 4ZP1A 2ETVA 4U5QA 3FUWA 1XVLA 4NXNB 1QGAA 2Q9CA 1SKYE 3VXKA 3JZDA 1EDDA 4G9EA 3BSWA 2P35A 5T6MA 3PL5A 1DQPA 1OFIA 3LCRA 3MCVA 4KU4A 5A2QA 1OW3B 1QAOA 3GZ4A 1BO6A 2C96A 5T5QA 3D7MA 1E1CA 1FU8A 4DSUA 2CL0X 3GEPA 4I6JA 1NBME 4EIYA 2NVUB 1RLIA 4TM7A 2QRLA 2MYUA 3P9RA 3RGGA 1GCAA 4W5RA 1DUSA 5HF9A 3G8CA 2BM1A 2FN9A 2ZTMA 1L3BA 2H11A 5C53B 1KTMA 1SEVA 2C2ZA 5HKKD 4KIGA 1TYBE 2R85A 5ECWA 3LPAA 4EPYA 4OGLA 3EUFA 4U63A 3BRWD 2PLAA 3GFFA 3VA7A 2CZGA 4DB4A 5DWQA 4QYXA 2BFEB 2B1JA 1PJAA 3IR5A 1IN4A 5IAJA 4KIFA 5A04A 2BFFA 4UDOA 4F5YA 3OAAD 5CG1A 3R3YA 4YJFB 5TMPA 2AOUB 3THYB 2AEEA 2I5PO 4DR4B 4DOMA 4DNPA 3VKWA 2QJWA 4FMDF 4AECA 5LDDC 3HU1A 2GERA 2F8TA 5LJIA 5CGZA 1ONNA 1HE2A 3VH3A 1NJ8A 3AG1C 3ER9A 4D8YA 4GX1A 4HNSA 1U8ZA 2EPLX 2WYIA 3AVUA 3GYBA 1HDCA 4ZVPA 1Q0LA 5AK5A 3L8FA 4BBZA 4RIHA 1CUWA 4PZDA 4B3MB 2AXQA 1IY1A 2Q0SA 5HS4A 1T9GS 5TPZD 1X0VA 1Y81A 1E1RD 1ZCFA 1JQAA 5LOVB 2E18A 2I3BA 1VMAA 4MHTA 3CF6R 3TLYA 1K4KA 1Y9EA 2WAMA 2JLYA 2IYLD 4H7KA 3UH0A 1BVUA 4BFWA 1T6BY 3PDHA 4OHVA 5AKZA 1ONOA 1ZMBA 3GN2A 1KGSA 4B3XA 1CZOA 3T4RA 4GRIA 2EJBA 4KV7A 4IKPA 4I3MA 3M1IA 5A4DA 1V16B 4E07A 3N87A 2JATA 2WVOA 4CN8A 1JVSA 1B8VA 3SHOA 4DRHB 4QBFA 3CMMA 1M2HA 1QH0A 3TPFA 3GNSA 2D2VA 2WZFA 4MGKR 3KHKA 3FTPA 4B7ZA 2CJXA 4JMLA 2OWEA 1YC5A 2JHAA 4HJXA 2ORYA 4I1OA 3GFBA 5GPGB 1YVUA 4N8EA 2C4TA 3J7AC 5LZ7A 4JT8A 3B6IA 5FLEX 1ZMRA 4C7JA 3GGCA 2ETSA 1KYQA 2ET6A 3SZOA 4R4JA 1QRAA 4ZVOA 1V1MB 3F8TA 3D0RA 3GCXA 1TCVA 1XKQA 2QP4A 1MTOA 2WA1A 4L75A 1OH7A 5F12A 2OMKA 5J2TB 4HS4A 3UCEA 3PCRB 2GK4A 1TK9A 2PX2A 2VIIA 1AZLA 3MQ4A 1F2TA 1ORDA 3SJBA 3EDYA 3U44A 5L3VA 4UQPA 2C54A 4O4JB 3PZRA 2YJ5A 4P1ZA 4ASUD 1AZTA 2O7NA 5JRAA 2ZVQX 1OLUA 4IZ6A 1VKRA 1T8TA 3IEXA 3P2MA 1FMLA 2NNWB 3SNKA 3HZRA 1O0CA 1OV4A 4NZYA 4YQFA 3U2LA 3RVSA 1O03A 2IHJA 3OM1A 5LA6A 3E82A 3EXEB 4GOMD 3EW7A 4PLWA 4EO7A 4PRYA 4ZO9A 3VU1A 2PUVA 3PD0A 1YVPA 3R0XA 1I1NA 2V3CC 3ENKA 1FVHA 1MG5A 4O8CA 3T38A 3W4KA 2V7WA 1GTRA 1FFXB 4CE6A 3LQYA 4CS8A 1TD1A 4BE7B 3DCIA 4ARAA 3N2YA 3EWAA 1NXWA 5C1IA 4LE2A 3WQSB