3A11A

Crystal structure of ribose-1,5-bisphosphate isomerase from thermococcus kodakaraensis kod1
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
320
structure length
320
Chain Sequence
VVKEVLEIAEKIKNMEIRGAGKIARSAAYALQLQAEKSKATNVDEFWKEMKQAAKILFETRPTAVSLPNALRYVMHRGKIAYSSGADLEQLRFVIINAAKEFIHNSEKALERIGEFGAKRIEDGDVIMTHCHSKAAISVMKTAWEQGKDIKVIVTETRPKWQGKITAKELASYGIPVIYVVDSAARHYMKMTDKVVMGADSITVNGAVINKIGTALIALTAKEHRVWTMIAAETYKFHPETMLGQLVEIEMRDPTEVIPEDELKTWPKNIEVWNPAFDVTPPEYVDVIITERGIIPPYAAIDILREEFGWALKYTEPWED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor eIF-2B, delta subunit
publication title Dynamic, ligand-dependent conformational change triggers reaction of ribose-1,5-bisphosphate isomerase from Thermococcus kodakarensis KOD1
pubmed doi rcsb
source organism Thermococcus kodakaraensis
molecule tags Isomerase
total genus 104
structure length 320
sequence length 320
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.3.1.29: Ribose 1,5-bisphosphate isomerase.
pdb deposition date 2009-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01008 IF-2B Initiation factor 2 subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.420 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) translation initiation factor eif-2b, domain 1 3a11A01
3.40.50.10470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Translation initiation factor eif-2b; domain 2 3a11A02
1T5OA 5DBOA 2YRFA 4ZEMA 3ECSA 1T9KA 2YVKA 4LDQA 1W2WB 3VM6A 3A11A 1VB5A 4ZEOA 3A9CA 2A0UA 4LDRA
chains in the Genus database with same CATH superfamily
2C5LA 1FMJA 5E6RA 4EL0A 4DJ9A 4F92B 2P78A 5BSRA 3J06A 2YFQA 2GD0A 3O91A 5LUBA 2QMHA 1KI6A 2CN1A 3HADA 4CQNA 2CVFA 4Q47A 5KYTA 2EL9A 2VUHB 2VCBA 4LLEA 4NBSA 3IPAA 1E6MA 1MC5A 1E1RD 3IEPA 1X87A 1I7LA 2BI4A 2XYQA 3KJXA 2HWWA 3EBPA 5D2CA 3G2LA 2XV1A 2OMEA 1PG2A 2C2GA 4J2HA 4UOZA 2AN9A 3P32A 3GJ3A 1HDXA 3EG9B 3VTKA 2BE9A 3LQQA 3KQKA 4EUEA 2OBYA 3QOXA 3PGXA 5LMUB 1JAHA 4BWVA 2JGDA 4FGJA 5G02A 1HKHA 4F8YA 4TKLA 5KAPA 2JFPA 3MWKA 2CL6X 4GDMA 2JKYA 4LRYA 1ZRHA 1WB9A 4ZZ0A 5LIRA 2O52A 1IN8A 1N78A 3C1TA 3PRKE 2VHTA 4HAOA 5C9ZA 4AZVA 5EJIA 4D9HA 1TFKB 1SUWA 1ZN7A 3EXFA 4HRVA 1EUQA 3PHJA 1FB5A 4RSMA 3TK1A 1JIJA 4OGLA 4J16A 2O1XA 2Y69C 3UYKA 4ER5A 1Z6GA 2X2PA 3K9LA 5JOQA 4IVPA 2EF1A 8GPBA 4RSHA 1UFVA 1NLMA 4JIMA 3A05A 3O90A 1Q7TA 2X4DA 2PRSA 4XD7D 5C51B 3S90A 3BMCB 2F59A 4JSTA 3M4JA 4X7RA 1X7HA 1ULBA 3FUUA 4HSGA 1NVGA 3K0FA 3GFQA 3HI4A 5IZCA 1LDMA 3NHJA 1KFBB 3RTGA 3EWSA 1DLJA 3O8RA 5AK4A 4B3FX 3A3KA 5JYCA 1B1CA 4NCIA 2UZ1A 2BP7A 4W8OA 5JHGB 3LQ2A 1EVLA 2Z95A 4B87A 4NP6A 4WCFB 1CTQA 4PLTA 5DYTA 1ULUA 3JYPA 1EA8A 1WUYA 5IDXA 3QQ5A 1FMLA 3G7UA 3MRXA 2MJLA 3R23A 3ZLBA 3I76A 3L7KA 4QFBA 2X0RA 3AETA 2NP7A 2ZRLA 2BGKA 2H3EA 4JC5A 3PYXA 4XD2A 5JBQA 2ARKA 2CLEB 2QG4A 2B4YA 1MH9A 3I4LA 3AONB 3CZQA 3L7IA 3RVQA 1Y3AA 3VFDA 3DEHA 4LY6A 3JALA 2WZCA 3LPCA 2Q8NA 1JLHA 2BMEA 1XRJA 3ZVRA 4NBTA 1NW5A 5EHGA 5B7QA 4OJKA 3H2GA 5LDHA 4REQA 1K92A 2NSGA 1TYEB 2DB3A 3A06A 3ABQB 3SHQA 1L8LA 2IEZA 3UHOA 4FCTA 4ZQFA 4PVCA 2I1VB 4E88A 4TVOA 4ZYTA 2M6KA 2ZT8A 4QPZA 3N6RA 1MG0A 2WA1A 2Q0HA 3GEEA 1XPUA 3OA0A 3QPVA 3WDMA 3GVPA 2O2IA 4LNUB 1DAOA 2CLOB 3OM0A 5BNWA 3DP7A 1L5YA 2Y0BA 3QELA 3OHSX 1H4TA 1BU5A 3B3JA 1JHUA 3ETLA 2H18A 2ZUVA 3WK9A 1G21A 3E4CA 3FFAA 1P7VA 3AB3A 2ZRIA 3L82B 4R9RA 4AZ3B 3BGSA 1FNMA 1MC1A 5F2OA 3RFUA 2KNHA 2WZQA 3IEUA 4PO1A 4EYQA 4G25A 4Q93A 5HGJA 4WBNB 1DNPA 3W5JA 5TJ9A 4I3HA 4BJHB 4AD8A 3PF8A 1E1YA 1O9BA 1NX9A 2VFAA 2W2KA 3ZN2A 2RJNA 3A3NA 3RT1A 2HA5A 1XTTA 2QKYA 2I76A 2I1QA 3STWA 4FLMA 2HV6A 2Y4OA 5KCZA 1U0BB 4RVDA 1D9XA 3QUSA 2H57A 1TUIA 1ENPA 2CXRA 1CERA 2BTOA 4ALNA 2YBDA 1JH8A 3KFLA 2RHMA 4I0WB 1C0PA 5JRZA 1ACLA 4ID9A 4YC7A 4B7CA 2Z1MA 3DZHA 2WD7B 3WX0A 1JHZA 5AQ1A 1G8AA 1TAHA 1R8SA 3JWGA 2BFNA 3SC4A 5DTIA 2O8NA 4R2HA 3SHVA 8ADHA 1K5PA 4GNKA 4AUEA 3VH1A 3QVOA 2QL6A 4IDBA 4MR9B 4WH0A 5D7BA 2J5BA 2WNIA 1M8GA 1UP6A 4ZVRA 4YRBA 4PJJA 1Z0JA 4PBTA 2NXCA 4QLOA 4LUCA 3ROXA 3EUEA 4L22A 1LDGA 3MAJA 2IW1A 1ADFA 3RAGA 4A3SA 4U8GA 3FB4A 4N39A 4Y6SA 4J4HA 2CLKB 4YMLA 1I2MA 3VZSA 3KJFA 3KRTA 4DEVA 3W4YA 2G76A 1M1NA 5TQVA 4MGHA 5IYZB 3KV3O 2X0CA 4ZCIA 1KSHA 4TN5A 2H4ZA 4F9EA 2YEVA 4O4JB 3MLBA 3BZBA 3WB9A 1R6TA 1YS9A 3C8GB 2OHGA 4GPAA 3LF1A 4B17A 4KK4A 5DGIA 2L6HA 4PXYA 3ER9A 2BGTA 1NAHA 5L40A 5B30A 6AT1A 4R54A 3SM9A 3EEIA 3JTLO 4JCOA 1QX3A 2JJ2A 3ZCXA 3R7WA 1VOMA 2W2LA 4ARBA 3ZY3A 2LRHA 3GELA 4MUIA 1CF4A 1C8BA 3G8DA 2IXNA 4K6MA 4EKGA 5JV5A 1YVDA 2BM1A 1R12A 1Z73A 3I04M 1R5NA 5SZHB 5K9ZA 4Q3KA 4OFWA 1RRGA 2RGUA 2ZJ7A 1XTZA 3LCRA 1E8DA 4J7XA 3CH5A 3C43A 3CZ5A 2CDAA 4RLHA 4AJIA 4YJFA 4AURA 1E3IA 3ZD8A 4H1TA 4RV4A 2IU0A 2ACKA 1WW3A 3WLJA 3KXPA 4BAGA 4EUKA 1N1EA 3OM9A 3HJBA 5BSFA 4GLLA 3ZWMA 1HH4A 5C8YA 1NYTA 1K1EA 5IXJA 2EX1A 1SVWA 3AQBA 3D4LA 1W76A 4RF5A 5JCOA 3PDWA 1W85A 5I7WA 1WUJS 4FMCF 1BX1A 5FBHA 2GPYA 1J8VA 4GI7A 1DC8A 4M8IA 1CUBA 5CDFA 1GZDA 5TMDA 4DY4A 1SWWA 2YNMA 1KOGA 1KY2A 4Z1OA 1XEFA 1W46A 1NNSA 4QT0A 1J6UA 4PX3A 3CF0A 1CR4A 2YYZA 3LDUA 1DC4A 3MLGA 3B89A 2DFVA 4BVGA 1PL7A 3MTQA 1NDQA 5EJ5A 5LP6C 4DJEC 3R3XA 3N2KA 4AQYB 4QE3A 3ZLUA 3ZDXB 2ICWG 4OK5A 1LPEA 1AT1A 1U90A 4P2BA 1B73A 4X66B 2DFPA 3CHYA 3WKAA 3AV0B 3BRWA 2X42A 4HXFB 3F9RA 4EM6A 4WJLA 2VRCA 3I0NA 1GKIA 2C5EA 3MTDA 2I4TA 2O0HA 2ZULA 4CGZA 4RTJA 2EPLX 3K71B 4O2BB 1J2EA 4N8EA 3ZEIA 2JHGA 1AQNA 2GZAA 2BRUC 16PKA 4Q6WA 4IH4A 3QSGA 4ON9A 1VKHA 2XCLA 1FFXB 4YN3A 4MS2A 3NGXA 4PG5A 4YCBA 1U0RA 3RVZA 3V8VA 3QNMA 4RJ2A 4HZUA 5BUZA 4QUKA 1P0PA 2WSMA 3CZPA 2NZ2A 5KNBA 4U5QA 1Z2PX 5EJ7A 2V4MA 3LSTA 1TLLA 4BASA 4UHDA 4IR7A 4AX4A 1C3LA 1X1BA 3V1UA 1VHLA 1H1LA 3GG9A 1N5IA 3PENA 4GL2A 5IS2A 2LIVA 3TW0A 4AWAA 3FMIA 4TTSA 1BBHA 1BDBA 1E83A 3EQLF 5H3CA 2AI1A 4L57A 1DXYA 2LIGA 2IWHA 2QVZX 4BNDB 4KQCA 2D3TA 2R7RA 2PT9A 5DTQA 5AMXA 3P52A 1G17A 4EBJA 3ZY2A 4LBYA 1UOQA 2XGMA 2ZWPA 2FX5A 5IVIA 4ZYVA 3T5GA 1XRNA 1EP1B 3QXGA 5EXSA 1K7CA 3HUEA 3S7TA 5ICMA 4MOWA 3PPXA 3VRHA 2D0DA 5ERXA 1MBZA 2OZEA 4KVAA 4I50F 3IQHX 1EUZA 1M6NA 3LUDA 3U1VA 3BSYA 4ZVQA 4BGUA 5JEDA 4NDAA 1IAQA 5B1IA 1EVEA 5LQJA 4WA8A 3OT1A 1GV1A 2ZCJA 3LPAA 3H2IA 1W8IA 3ASNC 3AOGA 5GGYA 4B82A 5K3CA 4E46A 4DA4A 1Y8RB 3SFZA 1FTNA 1Q0ZA 2E4XA 4MB6A 4HDCA 2QE6A 3HMKA 1F4LA 2GN4A 3N8KA 1B41A 3EWNA 3WVNA 3QF7A 2PK3A 1MVNA 1JIVA 4I1VA 2CSXA 5A9SA 1JKMA 3RTAA 5CG2A 3ATPA 2M6RA 1Q16A 4QO7A 3GUYA 5CYPA 1OQCA 2ZWOA 1T9BA 1EZ1A 1T3LA 4JTAB 4JL8A 4CLHA 2HH9A 5A4IS 4L85A 4UNPA 1R8JA 1NVXQ 4HWOA 4TYYA 3HVHA 5LZ2A 2IPXA 1KQNA 4GQHA 1SCNE 3D43A 3R3WA 3W7AA 2EWMA 3IUPA 1BE1A 3CSDA 2B4KA 5FEMA 4BZWA 4X0EA 4HLQB 1YVRA 2PM8A 3LK6A 5DBOA 1GARA 4BLOA 3J80A 2FWBA 1NONA 2R1ZA 1THGA 4DV1B 2ANBA 2FK8A 1R0KA 2CJPA 2IVZA 1R5BA 2HFKA 3C87A 1WEKA 3F6CA 4CFYA 2C5SA 4Y30A 4KYTA 4QFCA 5K0IA 3H2JA 3AR7A 1WULS 4D4MA 4C2UA 3WLFA 2VVTA 3I5XA 5B4UA 1PEKE 1M1UA 3PITA 3EDQA 1SXGA 3S44A 2KMLA 1C3EA 4M22A 3F7MA 2L7AA 4PZDA 4DG8A 1MMGA 3I23A 1N57A 4CM9D 1WDWB 2HF9A 4NMMA 3ZS9A 1YBHA 2AXNA 2XWQA 1TF2A 3CSKA 4KLRA 2VJKA 1C3XA 4A73A 1Z4NA 4OQ4A 3E1GA 1PGQA 4YCCA 4RTLA 1TQHA 4OATA 5CX1B 3I9FA 4DAEA 2ZCUA 2I22A 4AULA 2TMVP 4TWRA 4HN2A 2H59A 4YRQA 2YHAA 4ZWNA 4HQFA 3AG6A 4NBKA 3C5HA 2ZBFA 4I1UA 4YP6A 1GEGA 3L4BC 4Q7JB 3MRSA 4PONA 5KVAA 4X63A 121PA 1ZUNA 2NAPA 4EO7A 4Z4GA 3IYLW 4XUCA 3A1FA 4TROA 3MIZA 3ENKA 1LPOA 4F2WA 3AKEA 3HZZA 3NJ8A 2Y0PA 4FI3C 4UHHA 1JMWA 2OENG 1T2UA 3LDAA 4P81A 1ORHA 4E31A 3JQGB 3QOYA 4G8BA 4KAAA 1SA0A 4D0SA 2WE8A 3OCZA 4MLPA 4KDEA 3U17A 1XNRB 4QELA 3OY7A 2C2OA 5BUOA 1X7ZB 3RE1A 3ER8A 1LLQA 2NNWB 4DPLA 1PZHA 1NTOA 4ALIA 3DWFA 2V5AA 3VV3A 4MEAA 4CCYB 3CR3C 2VXBA 3W4IA 2WJZB 2X0FA 3FPAA 1GUDA 7REQA 1EWYA 3OCCA 4HAXA 4DMUB 4DA6A 3K1ZA 3GNSA 1I0LA 4PM4A 3DE5X 5LVAA 2SKEA 1OKKA 1Y9AA 1G7SA 2WSIA 2GJ4A 1SHUX 1S8FA 3AERA 4GUDA 2ZE5A 3IBSA 3RIGA 3EVCA 3A4MA 3M6IA 4JV5B 2VTEA 3SBOA 1NOJA 4BO2A 2WWWA 3GJZA 4IJUA 4B8YA 2H1OA 3ZUPA 1DKQA 4FZ3A 5L3ZA 4X61A 5LYJA 4CXMA 3BE5A 5F78A 1SMKA 3MS7A 1OXUA 2QLAA 4PLPA 4JP5A 4PPNA 3R5TA 4FGUA 1OLXB 2AQKA 2XBMA 2FR8C 1G5PA 4LJ9A 5CK4A 1MO6A 5LNK1 3UH0A 4N8SA 3CX8A 1TZ2A 3C3DA 3AVUA 1JHRA 2H7VA 1AZWA 3O3MB 1XU4A 4FFPA 2NSHA 4DC9A 4UXHA 2ZRDA 4OXYA 4DZTA 1S2NA 3FX2A 5D3MA 1DOVA 2P9BA 3Q88A 3RKSA 1JFVA 3MQFA 1EE2A 2ZI4A 3FSGD 5A6BD 4WESA 4W8KA 4FFVA 4CBVA 3B6MA 4V2UA 3S2EA 2C58A 1D2GA 2ZYIA 4YR9A 2OWEA 1XZAA 1EDBA 3R0IA 3AXSA 2BJHA 3F49S 2O8EB 1I3KA 2NT4A 3MTAA 3TW8B 3DE1X 1QC5A 4ROTA 1G7CA 4ECEA 1ZMTA 2XODA 1ESNA 1OI7A 2VA9A 3PDIA 3Q8LA 3O7WA 4WZAA 5FYQA 4BDSA 3CR7A 1RIFA 1P3DA 2GEFA 2F3SA 3S2SA 2YWRA 1LS1A 2C2XA 4DCCA 1OR8A 4CETA 1Q6YA 1ZNXA 2VP0A 3TL6A 4ZLCA 3LJKA 1N6RA 2RI6A 5KSYA 4Z8YA 4BO6A 1OCRC 3B9BA 3WWPA 4PTZA 5LYYA 3UKJA 1G4UR 3IS3A 3E18A 3WI7A 2YHSA 3P2IA 2XWPA 2JH9A 3G8YA 2A3RA 3AB7A 3H1FA 1QO0D 5AIAA 4YWHA 1F51E 3K9CA 2B78A 2OLKA 4CEJA 1LK0A 4GWLA 2QRVA 1UIMA 1U4OA 5JAQA 4W8HA 4R84A 1KNQA 2GN8A 1WUKS 3NIFB 4QBGB 1CR1A 5I4IA 4LHEA 3TXXA 4E5NA 2BGWA 1M54A 3JYYA 4ETWA 2I4NA 5AXCA 2OOKA 3HCRA 3AIMA 3G50A 5PNTA 1UANA 1SQ5A 4X1OA 3M79A 3PGVA 4DIOA 4I50B 2PZJA 2B20A 1LE4A 1S2MA 1ZBQA 1JTEA 1OBCA 2BDTA 2XUPA 4B7XA 2W0SA 1AGNA 1XJQA 4F4UA 1RM3A 4RJKA 1OFHA 1HYHA 4QTZA 1Z4JA 2P9GA 4EHIA 4CKEB 1EG7A 3UHPA 3DBHA 4RFSB 3UZUA 1QQAA 4YJHB 3H3JA 5BWOA 2ZS8A 4LISA 3TK0A 1QBKC 4U7WA 5KOHA 3W8FA 5A2QA 1VI6A 3PXXA 5DT2A 4IIFA 4GRIA 3RPEA 4E30A 1Y1TA 4RXUA 4RMJA 2FW1A 1OU0A 5L7YA 3VR5H 5JFTA 3TAXA 1ZXBA 2FSHA 1NI4A 3LYAA 3B20A 3MSCA 4BNFA 3SDZA 2C4UA 3UANA 1DTWB 3K0BA 3R0VA 3RS7A 1Y3DE 1O5IA 4Q7KA 4IXTA 3OHPA 2WJYA 4XWGA 5IRCD 2IV2X 3ZCRA 3HACA 4QQKA 1XD2B 4W5JA 3Q7RA 4XWAA 1NUHA 5B2FA 1A27A 3LW8A 4BLQA 4BLTA 5ALJA 3UUFA 1QNLA 2NZWA 2DQSA 4BX9A 3B1ZA 3B3FA 3U44B 4N3NA 3NJ4A 1P4HA 1YOVB 2PLFA 1SR2A 2NU6A 4LTDA 4UE3S 3RSHA 3ZV3A 3LT1A 3ROFA 2QW0X 2Q4BA 2LKDA 4MIEA 5B1EA 3PD0A 3LPNA 1BMQA 4YJGB 2HIGA 3OCWA 3FYHA 4PNHA 5K0EA 4NNJA 1YUNA 3UMVA 5F9FA 4XTCS 2Z8YA 2QYTA 2GM3A 3VPHA 3KTDA 2ZYSA 1KORA 4IFEA 2FLKA 2EZUA 4E33A 3TN7A 3F67A 3LS0A 2P35A 4RXMA 3AF6A 2VSNA 2Y05A 3IJRA 3T9EA 2OV8A 2P30A 4DA9A 3P9IA 2KI5A 4F6RB 2Z4TA 1YL6A 3QE4A 1PJRA 3O83A 4BMOB 4D98A 2UV8A 1NWCA 5J1TB 3FRIA 4LDKA 3HDGA 5DHPA 3FCEA 5ERGB 4ZT3A 5D6NA 1V16A 3EDRA 2B1IA 2OHJA 1YR9A 5E95A 1WLSA 1OIVA 2NIPA 2VZLA 1ZY2A 1IN5A 4NSNA 2CV0A 1P17A 4AJKA 1QVAA 1A04A 2VT2A 4E1AA 4EA8A 1JV2B 2B2CA 2JCSA 2AXQA 2P62A 5J2TB 1HMOA 2WIJA 1EP3B 1OYVA 5JD6A 3K1IA 1QKRA 4EA9A 3BRSA 3OFVA 1P18A 1VYTA 1Z6YA 4KO3S 1M73E 3KOOA 1MQSA 1FSGA 5GY7A 4HFRA 1RMVA 5EE9A 4WASA 3ABZA 1MVLA 4CL0A 1FNSA 4BFZA 2FWNA 1W2WB 3TQFA 3WKEA 5GJWC 3G2JA 4ARZA 3KSMA 1C7JA 4N8DA 3ISVA 5B37A 3WFJA 4RETA 2B21A 3DZFA 1FY2A 2K6GA 1PZNA 3K8YA 4KH0A 1ZL2A 4MVJH 2D1SA 2JFUA 3AHDA 4P54A 3OOHA 1C7RA 4QDXA 3H1TA 3RUCA 8ATCA 3Q5DA 5IC4A 4D46A 2D7CA 1E3EA 4MS4A 2A8YA 3HC7A 4E13A 2VCEA 3ZY5A 1FYDA 1KEEB 4CZ2A 4ZOQI 5L7TA 3ZJTA 1A82A 1LSOA 1CIPA 4HD8A 3PC8A 2VDWA 1I4WA 5HKBA 4FFMA 5JP7A 3LUCA 1CRPA 1BC5A 3Q7SA 4A2QA 2I78A 2IYNA 3HNIA 4AY3A 3U7RA 1P1IA 1R0RE 4FZJA 2ZYHA 3FVVA 1KL7A 4HWSA 1PJ8A 3R41A 1W2GA 2ICAA 1ORSC 3LESA 3N8GA 2C96A 5AI5A 1TKRA 3JD0A 1BD3A 3WIBA 1VKRA 1JG1A 1VYVA 1FYVA 1QVWA 2RDMA 2O2GA 1GAQA 5BR4A 4AKEA 3JVIA 3Q98A 2G3KA 1MVOA 3C6BA 3OEOA 3SYNA 3OE5A 1JEYA 3C3YA 1HL3A 5BUCA 2P3SA 4PG7A 2IKSA 4TYPA 1IMJA 2A67A 4US2R 4C4PA 1TMYA 3B9QA 1UMBB 3VI3B 2HK9A 3AB8A 2P1DA 2R1UA 2G7ZA 3OWXA 4BZPA 2ZFUA 3GQVA 5GP1A 3KOMA 3O0DA 4ER0A 3IAUA 3FWZA 3UUEA 2G9VA 2QSJA 3OKPA 3JQFA 4LSWA 2VNKA 3FROA 4M8SA 2V6GA 1G9SA 2AOUA 1E20A 3CT6A 4E1VA 5TSDA 4LOHA 2WFZA 4X65B 4WMLA 2AX4A 5EZ6B 2V74B 3DHWC 1FUEA 3SC2A 4I1IA 1O89A 3KZXA 2YICA 5E1MA 4AO8A 1MOQA 3M4NA 2FK7A 4MP6A 1WZCA 4J9VA 3Q72A 1SD1A 3BEOA 1ISMA 1KYTA 4IP0A 1JQDA 5FFNA 4C05A 2WP0A 2FH5B 3REQA 1DG1G 4LQCA 1MABA 3GUCA 1HDGO 1E1CB 4YMIA 1M6YA 3ZLVA 1PS9A 1LQUA 3HV2A 3AOUA 4NC9A 4C5AA 1UPBA 5TB5A 4U9HS 2P27A 1OIWA 5BWMA 1PGNA 3M2PA 4WZZA 1T25A 5AKZA 4OBEA 3LGXA 2J9UA 3G1TA 1I4OA 2FPKA 3GGCA 3L2OB 1ACJA 5TQ2A 7ADHA 2DYRC 4O2LA 3EIEA 3RU9A 5JRJA 3V2GA 5ICSA 3IJ5A 4BNGA 5KSPA 4DZZA 4EDHA 3TD7A 5KTKA 1YB6A 3L07A 1Z45A 2H7CA 4XJXA 2GJAA 3O82A 4GQBA 4QBFA 1SZDA 2VAWA 2I3DA 1I1NA 5CITA 3LBIA 3DI5A 3M4CA 1GZ6A 3NHLA 2R44A 3CRRA 3FWHA 1RXEA 3AUXA 2ECOA 1Q21A 1ORWA 2VATA 2A1IA 3C97A 3I1YA 4NBLA 1PNRA 2FSGA 1GTG1 3AJMA 4HFNA 2FZKA 4H7FA 3C41J 3KCNA 3NAMA 1CZUA 2J4CA 2C61A 5ICEA 2I1LA 3NTVA 2KQ9A 2XX3A 3TUIC 5K8JB 2KWIA 3ZHXA 1J1UA 2XB2A 3OOYA 1LDBA 1W9HA 1KY5A 1QWSA 4GT1A 4RVHA 2GBLC 2EVWX 4OQQA 1G21E 1Q0QA 2P4UA 1E61A 2Z5GA 1D04A 1RQ7A 3SOZA 4HVTA 4AJ9A 2QXYA 2DTDA 2BT4A 4YEDA 3HLKA 2QVCA 4DWOA 4EKIA 2J59A 2BZSA 4GH5A 2WTEA 2BLNA 1SHJA 3GLUA 3F6BX 4JJ6A 2X5XA 3H16A 5LD2B 4V0NA 5D85A 1QDEA 1Y6GA 1V1JA 4F4IA 1DFHA 1CDDA 3ROEA 5HA5A 3MSXA 3EPJA 5CFPA 3RV4A 3ZG6A 1IXYA 4YQZA 4C2AA 1UBRS 3N58A 2OPBA 4MVJP 4I6EA 3UKOA 1F06A 4GVPA 1NRWA 2I6UA 2Q1XA 2W6JA 1NQXA 2Z4SA 4B6IA 1DEXA 3AL0C 3HKCA 1P5RA 3ML1A 4AB1A 2E6KA 1G2QA 4LYJA 2LNDA 1M76A 4V3BA 3LEVA 5BV2P 1T9AA 3NRBA 3OQ6A 1PKEA 1Y8ZA 1KMNA 2I4IA 4BVBA 3TLCA 2BFFA 3UG7A 3TIVA 1XKLA 4DDVA 4MJLA 4DR7B 3U2LA 1E18A 1TJYA 4CIPA 4JW1A 4G4SP 2O2YA 4C6HA 2HB6A 1WHTB 2WFAA 1JEQB 3AHEA 2XXBA 3U3KA 1EA7A 4PNPA 3B53X 2YWAA 4YLGA 1S0UA 1CQWA 1W36D 5K4HA 4OLAA 1E9CA 3VYVA 1E59A 1E4EB 4PO9A 4IGKA 4J75A 1KMHA 2Z43A 4NFLA 3DA8A 5LQNA 1CYEA 1ISPA 3SZMA 2IDMA 3NYJA 1WCIB 1DKOA 5KJEA 5BR1A 3TRFA 1RAAA 4WEQA 2HRBA 4BZXA 2V5VA 2C2BA 4XPXA 3DMRA 4K8OA 2XCIA 1V3QE 1G6OA 2OILA 5JSYA 2BHRA 2EWVA 4II2A 4Q1DA 1ZNYA 4IVQA 2FKAA 2XCTB 3R7BA 4H77A 4TTIA 3K6RA 4I9FA 3F71A 4QNMA 3N6VA 4BQPA 4QGBA 3FFTA 4PGAA 1RSZA 4CDAA 4G1MB 3G82C 4LBWA 1GG2A 3W6NA 1WOMA 3PYMA 4M0FA 4PC7A 2BIFA 3MFQA 1CHDA 2GXQA 4HAWA 2A4MA 1Z2EA 4WAUA 1LNQA 2J0UA 4XB2A 2ZAMA 2NPOA 1AKWA 2EXXA 2CFSA 3H5OA 4LS3A 2QL7A 1OFUX 5F35A 4ZK2A 5A5DA 3BJMA 2XVXA 3NRHA 3TB6A 1JJAA 5EKTA 4TVSA 1FDVA 4PZYA 2FZCA 1U7ZA 5HRAA 3KWLA 2YMMA 5C8ZA 4DJFC 4BNYA 1R27A 1S96A 2QR3A 3NBQA 2I03A 4I6GA 4XM1A 4MQFB 4GX2A 1Y42X 3PVCA 3FYTA 2YWBA 4AO7A 4EBBA 4KX5A 4N7JA 2AW3A 1A2OA 2E82A 1DJPA 3CWQA 1D4OA 5EJMA 2PANA 4CW7A 5EIOA 3Q3CA 1KPGA 1CNFA 4TLCA 3DYBA 4KEAA 3KB1A 3DV0A 1OYOA 4MVJF 4KXYA 3GAZA 2JC3A 1R64A 4F3YA 5CT5A 3U19A 5JH7F 3WR5A 5CDFE 3NTLA 1P4SA 5LDGA 2RJ3A 3L7LA 5EFOA 5IKPA 4B74A 4UBOA 1ULAA 5DN9A 3U40A 1A7AA 5MFZA 3IURA 4Q4JB 2Z5FA 1T1GA 4N1AA 1L4HA 4R2KA 4DJAA 3AOEC 2BFCA 4PY2A 3Q0IA 4L5AA 5KDDA 3WHPA 3U5TA 2X0JA 3HWWA 1I3CA 1ZIXA 3O4VA 1KQPA 1ZK3A 13PKA 2AQ8A 1XMIA 1JBQA 1WW2A 1GQOA 2EJBA 3HNJA 1I4YA 4F5EA 3KPHA 4F86A 5C7YA 3ES9A 1X8JA 4IWYA 1NN5A 1HE3A 2FEOA 1KVTA 3BHJA 3WV4A 4RDXA 5LJIA 2QB5A 5JVEA 2GDJA 3UAVA 1LBTA 4WLVA 4HN4B 1OI4A 2FOIA 2DRIA 4PG8A 4J49A 1A4XA 4C4OA 3BMOA 1VHQA 3OJFA 5AO9A 3PD1A 4KI0A 4ES6A 2G6TA 3QE0A 2PH7A 2QP9X 4R16A 2GETA 4P7GA 1F2TA 2XNKA 1JQEA 3BA6A 3FB1A 1Y7PA 1ZAKA 4GM0A 4PE5B 1J56A 3ZGVA 5HGXA 1ZHFA 2H4HA 1IK4A 2REBA 1JXQA 5GV7A 3L77A 4MUJA 5A3RA 2DB4A 1VL2A 3BF7A 3QPDA 1UPFA 3KLOA 2E37A 1JFSA 4PC1A 5LOVB 1QH1B 4BX2A 4C3OB 4ZZ1A 3B48A 1SC6A 2MIIA 5HYVA 3HY4A 1EGAA 2D1RA 2AK3A 1FX0A 3FNFA 4TT8A 2XTNA 2Q3CA 5ALXA 2F43B 3NTQA 1GGNA 2ONYA 3A6PC 1AEPA 1W49A 1Z6PA 3USZA 4W5RA 4MRSA 4DCOA 4OU5A 2ANCA 2IEYA 5IH3A 3UMCA 1SZPA 3WDSA 1HORA 4OJQA 1D1SA 4FILA 3KYCB 1JF8A 2G63A 3RROA 1A0OA 2QV7A 4R1TA 3GLSA 4ZKEA 1WZNA 1HW2A 3IAM1 4QDTA 3TTXA 2BKLA 1GR1A 4OXQA 3PX2A 5B1HA 2NSJA 3ESBA 4WCVA 1QGAA 5CX4A 1PNVA 1WCWA 4UUMA 4ODIA 3NQ41 4XIGS 2LV8A 4L08A 4Q1FA 1SXJD 2JFNA 4U6NA 1Q0GA 1ZVZA 4A2WA 1DAMA 1XLTA 2C9BA 4BCCA 1VG8A 2I65A 3LHIA 4QPDA 2CBXA 2JARA 3JSXA 1TUEA 4CDMA 3T5TA 3EIQA 3KD2A 4UE6A 3VNSA 4PZAA 2A2ZA 3WP1B 4KQ6A 3FM9A 4FOSA 4BIMA 1YBFA 2Q1YA 4BMVA 4KTVE 2VK8A 3PFCA 3ND8A 4F5ZA 3NX4A 4RY8A 1EUDA 1TTTA 4JUAA 4KXMA 3A6HA 1SNYA 3FDFA 4BBAA 4Y2SA 5AXBA 2RHCA 4ED9A 3DH0A 1PL0A 2OMKA 2XLEA 1XJ0A 4RA6B 1E3QA 1U8TA 1YDWA 3JQAD 1PGPA 5KYKA 1RWKA 3L7JA 1IWPB 3ESXA 5HF6A 4GBJA 4ZOLB 4Q4HB 3BH0A 5FI5A 3CX6A 1TEZA 1E9DA 1U89A 1UMDA 4BCDA 5EMNA 3WJ2A 1L2TA 3KE9A 2P8SA 1BXGB 2GPTA 4RQTA 4RVGA 3JYQA 5BO5A 5L0CA 2QDXA 2PS1A 4WZBB 3L46A 5BW4A 4G97A 8OHMA 1SRQA 3L1KA 3DBRA 3TH5A 3A14A 3S1AA 4BAUA 1EDOA 4FESA 2XEXA 4I14A 3ZK7A 2I8AA 3A0RB 2QF7A 4HC4A 2PH1A 3BWXA 5ALSA 3ESYA 3WL4A 2F48A 4R6XA 4JITA 4OM7A 4JXXA 4N9QA 1A1VA 4JQCA 1LZKA 3IEXA 2CK3A 4P31A 5IKEA 3RS4A 4INAA 3B8EA 4L74A 4NARA 3W8IA 1OW7A 3ZBTA 1KHTA 4BNUA 1W5SA 4U5GA 4U3JA 4K0RA 2TMDA 3W2HA 4H6VA 4CWAA 2ZIFA 1V9CA 4MX8A 3GRPA 4P3OA 1V7ZA 3D8NA 3WB1A 3ICOA 3EXG2 5I8WA 1UBCA 3VR3D 2V7QD 1PDOA 4BJ6A 4DY6A 3GK3A 2YJ3A 3DKIA 2XCUA 2PS9A 4QUGA 2BBOA 3CKMA 2QTFA 4P4LA 1ML4A 1GRQA 2VNAA 2IEBA 1IG3A 1RXYA 2AMFA 3RLFA 1G1AA 4EJSA 2FSVC 2DBYA 1RR6A 4MVCA 1CFJA 3HSKA 1C4XA 3OKFA 3RUAA 3PCTA 2PQ2A 2FWPA 2PAAA 1HT0A 3PU6A 3UW1A 2AG1A 1Z6XA 3RQFA 1DFGA 1Z83A 3DEIA 4X84A 4I1OB 3U9TA 4MRNA 2I7CA 4L3WA 4KREA 4IMPA 3VC7A 3BE6A 3HI6A 2Q62A 1L8AA 3HDVA 3WC4A 5DYYA 4O8CA 1KF0A 3TOZA 4K9RA 3KP1A 4ZU3A 2QRZA 1T15A 1ZITA 4EJ2A 1XRPA 1M34E 3PEUA 4OH7A 1K9SA 3KXDA 3QLUC 3A6EA 4F06A 3EFOA 4ZCTA 3VKUA 1QHSA 1A41A 3KDAA 5CUQA 3MJFA 2GB4A 4IXNA 4FEEA 4CNBA 4A6PA 1U1EA 2QRJA 3GLTA 1DS6A 1A3CA 2OV3A 5A02A 2I6GA 4WNAB 2JH3A 2QQFA 2DXIA 4J0HA 3ZQ6A 4B6SA 1PWHA 3JQ7B 4HFMA 1PEYA 3I34X 5DWDA 3MPOA 4EA7A 4XX0A 5IAJA 2AZ4A 2PLAA 2PN1A 2HF7A 4GFDA 4MVUA 3JRNA 1D2RA 2FN3A 4WUTA 1JAZA 3GEDA 1GU0A 2BDUA 1JKIA 4E5MA 5JXHA 3X1YA 1QYIA 2QENA 1RXUA 1IMOA 3RVOA 4BWGA 4YAGA 3IALA 2EC5A 2GAQA 2RGDA 2ROQA 1ZM9A 5L3RA 2GN6A 4BDTA 4LRTB 3R7SA 4LF5B 5I5GA 1JILA 1IDN1 4UMEA 4MQEB 5AKYA 2MMCA 2NU7A 3UMMA 2KBEA 4NCAA 3RARA 1IK6A 4GMXA 3IJEB 4N0PA 5G1OA 3SICE 4GGPA 4B5KA 3DVRX 3F9IA 4JS0A 3TEFA 1N2XA 2P3OA 3M6LA 2CB9A 4WBSA 1A88A 2IHJA 2H07A 4L8WB 1JKJA 3VNAA 1NR1A 5FR1A 2B6HA 2R7VA 4Q82A 4C21A 1KO4A 4LNHA 2FB9A 3CLHA 3NOOA 4WZAE 4MKZA 2VC2B 5L6MB 2PJUA 1G18A 3U9SA 4A91A 4CSAA 2HZ8A 1X80B 2WHYA 2IXEA 2KLHA 4K87A 3ECCA 2PMCA 2XQFA 3RF7A 3WKDA 3CEHA 3LHFA 5AGFA 4HX5A 3K35A 5AK6A 3UENA 1CUYA 4V0QA 3K6KA 4B3HA 1EVQA 5CNMA 2FFRA 4BFUA 2ATVA 3AK4A 3EZ9A 2W4MA 2F1RA 4AF7A 3I5UA 3SJBA 2IUFA 2EZTA 4TL8A 4BVFA 1ID8A 2PKYX 1NLFA 5HIKA 2QDKA 4GZ3A 3D4IA 2HUJA 5C1DA 2EDAA 2WHRA 1FJGB 1GTMA 1K75A 1Y3BE 1MXFA 1TADA 3GI1A 3RYCB 1N5DA 2PQ6A 4HDNB 1B14A 2VJBA 4RS3A 4D9FA 1ZM4A 4IDPA 3AHJA 4FR0A 5I9IA 3LXMA 3LUTB 3FCOA 1SIUA 2W2TA 2Z15A 3NG1A 3HSYA 1YIOA 3ZHYA 5EE1A 1VPEA 4F60A 3D2LA 2Y1CA 3D7LA 3E5NA 5L9AA 4JBIA 2RSEB 4WN9B 2WFMA 1V48A 2WIGA 5F28E 2WUWE 3VSCA 4P33A 3QBDA 1OCOC 1SBIA 3GB9A 5THKA 3AY3A 4L2IB 1G9TA 4KI7A 2WKQA 3ABRB 5FPSA 4FQ8A 3W5AA 1XB2A 4XDYA 1E7WA 2J9RA 2XDYA 3NM4A 5B1DA 2Q49A 2YH2A 1N1CA 4DBRA 4Q02A 3ZJYA 3S8YA 1D1AA 3WJAA 1U9IC 3RTDA 4PJNA 1NUPA 2IHUA 1PHPA 1NBIA 4TSRA 1N2OA 5KHAA 1OJLA 4UBJA 3DEKA 4LZOA 2QTBA 2C4WA 1QHGA 3I04A 1ZW6A 2VF5X 1LVGA 1XXLA 3PGJA 2QJTA 2QJOA 2WSSA 1V8BA 2W2NA 2WHPA 1O2DA 4ADSG 2PJZA 3SS9X 3O10A 3BFVA 4NPCA 4HPXB 4JN6B 2E4UA 2BN4A 1VIDA 3DE7X 3Q3VA 4CIXA 1SQSA 4BJ3A 1Y4SA 3AEQB 2P5YA 1DAFA 4HT3B 3EJ6A 1BX3A 1ZMBA 2H2GA 1SKYB 1ZJ6A 2FPIB 3ACCA 2A6HF 2O48X 4HL6A 5EXEA 3EAGA 1EP9A 2H5LA 3DKKA 4HDOB 1G66A 1TZKA 1UDRA 4UEOA 3FNHA 2CD7A 3QMPA 4FFBA 3GIWA 2VNJA 4WD3A 1KZ1A 4OI1A 4GL4A 3AVPA 3UNGC 1SBCA 4DG5A 3BXHA 4AM8A 3W5HA 3ZTYA 5IEJA 3UGTA 4DVZA 5T41A 5EMJA 5AH0A 2C98A 2QRNA 2EP5A 1U6HA 2P0EA 5EXTA 2YY6A 5FPHA 2PFGA 1U3VA 3C3JA 1CR6A 2OQVA 4XOUA 3KOZA 4NDNE 3ISJA 1HQKA 2NSYA 4JELA 4TWJA 5KTRA 2QUHA 2EFJA 4OXXA 4MDHA 1B6GA 1JIQA 2OHVA 2H0AA 4U5BE 3KR1A 3HUUA 2Q45A 3BM5A 3ITDA 2CHFA 2XVYA 4I8IA 4Z0PA 4TWAA 1EFRD 2LP4Y 3IHWA 3R3JA 2DKFA 4R71A 3VVCA 4GWKA 4B34A 2BYTA 3DL4A 1T2FA 3LX6A 1P5HA 4QYMA 3WGKA 1Z2NX 4UNSA 1RLMA 3FOPA 1OXBB 1YR1A 1TM7E 4OIRF 2P2CA 3K70B 1ZZPA 2PPLA 3STVA 5CNKA 4EFMA 1NLUA 2K4MA 2RGNC 3PCVA 3NT5A 1VE3A 4KXUA 1CJKC 3WFIA 2VSOA 4X1KB 5BSMA 1JTVA 3ZWCA 3OP1A 1SKQA 5ES4B 5CXSA 3BJRA 4HAUA 4PC6A 3UVEA 4TM7A 4DANA 3FCXA 3W79A 1G8XA 1SOAA 2IT1A 1QBGA 1VA5A 3FE2A 2QEQA 1G42A 3M5PA 2LWIA 1GTL1 1LLFA 5I48A 1VKNA 3NFRA 3TLGB 4E4YA 2HK6A 4BO4A 4S04A 1QHNA 1ZU5A 3RGWS 1TO1E 1GG9A 2X9GA 3C3PA 4TL6A 4Q1VA 3H75A 5JISA 1G5TA 2C07A 2ZG6A 5JD4A 1I2ZA 3MRTA 4JVSA 3EQ8A 2PGNA 5CK5A 2QK4A 4LVOA 1I4DD 2O7SA 4CU2A 1A9TA 2LK4A 3HV0A 2WAOA 4Z1MA 3RC2A 1EYZA 1KO5A 1D8TA 4FU0A 3V7OA 4P0TA 2BC9A 2R8BA 1VLHA 3F3YA 5LXTA 3GCDA 5KNDD 3MOIA 5CIYA 5KX5A 3DL0A 3D6VA 4KWCA 5G0WA 4O4LF 3CNNA 2BFMA 1J0BA 3SF0A 2JFXA 4KUGA 1ODTC 1N0IA 3OE4A 3L01A 7MHTA 4KR7A 3D6FA 3MGBA 1GQFA 3JAWA 3ASZA 1JU4A 5DLYA 1GITA 3WWZA 3KE8A 1E1QD 3GBPA 4Y2YA 2Q1UA 3KO8A 2NT3A 3G2KA 2HV7A 4HDMA 4S0XA 2IP1A 2XADA 1T3HA 1PP4A 1CB7A 3AR6A 3K5IA 1Q0UA 2C9DA 1FTGA 3L4SO 1K9VF 2UUOA 4MW2A 3HYSA 4TT3A 3T5CA 2C7RA 5ICGA 1N25A 4XDGA 3WY9A 4C7VA 4JENA 5HM6A 1E2HA 2OJED 1NW9B 3FMFA 5EYPA 3GUUA 4WFQA 3CWZA 4OH1A 2PNOA 1NNUA 1JA9A 2AE2A 2HTFA 1RCPA 4B81A 4XASA 4RA9B 4TS9A 1P39A 1KDZA 4UEWA 1NF3A 1T5OA 2CMKA 3O21A 2PX3A 4QATA 1UPTA 1R0BA 1XVLA 2LFFA 1WD5A 5K09A 3B1YA 2WUEA 3VH3A 1SK9A 4O25A 1DJLA 4FS3A 2I1WA 4XYGA 4XJTA 2WAMA 4JGBA 2I6SA 3JQDA 4M0LA 4YACA 2PKRA 3REOA 5KKAA 1NNEA 2WJVA 2QRUA 4QSMA 3QI2A 1C02A 3UPTA 1M10A 5JARA 2W2MA 4XUDA 2ZUFA 4DTCA 1SC9A 2NTYC 3AX6A 2X4LA 3P71T 2YCLA 1L7CA 1WIWA 1T0IA 3EC2A 1XN1A 1GPKA 2XOKA 4FUQA 3H65A 5JO0A 4G1CA 1T4MA 2WINI 5D86A 1EI9A 4RMGA 3NZEA 3FHDA 4JXZA 2OXCA 3W34A 1O0CA 1MB2A 4PYIA 3EFEA 1M34A 1V35A 4DR3B 1T6UA 4PSUA 3P0EA 3U3BA 5DYNA 2OL4A 1T9KA 3QXHA 2VL7A 2HCRA 3AHGA 2MSEB 4FMCB 4O6MA 4L3VA 2IVFA 3UMHA 1YRWA 1R8QA 4N76A 3KEMA 3H9CA 4YRJA 2VH5R 4LBVA 3KQHA 4WSOA 1BD4A 2Y67A 4LQ4A 2X1MA 4MWCA 1HG1A 4MGKR 2DSTA 2FZVA 4OA8A 4J7YA 2I2XB 1SKMA 2J5KA 4J4TA 3PFGA 1GZUA 5EWLA 5DHTA 3KWMA 3PGA1 4N0QA 3GLHB 4AL1A 4F91B 3WHLA 3WSTA 3ZJ4A 1O87A 3CQZA 4GR5A 3UJ7A 4JC4A 4MW6A 3WBFA 4JLKA 4EZEA 4BNMA 2ZUUA 5FNVF 5DFAA 2J3KA 2R4TA 2GZ1A 4DIUA 3HKBA 3G9QA 1JB9A 5DIZA 3H7AA 1TUGA 3X1ZA 4IS2A 4PO8A 2VJMA 3D59A 5MF6A 4BKRA 1EM6A 2R8XA 3PKZA 2ZDGA 2XL4A 4B3GA 4WCDA 3BYZA 1L8XA 3IKMB 3SPXA 3QFTA 4MP3A 1BJRE 4D9BA 4UEJA 4EELA 3JXEA 3K09C 1JR3D 1JJ7A 1OAOC 4XYMA 1I3LA 3EULA 5GINE 1TTPB 2C94A 1JW9B 1Z5NA 1T1IA 4BEWA 3ESZA 5CIWA 3JZMA 4MVJG 4EO9A 1F8XA 2O3RA 4G24A 3T61A 3Q8WA 3UYLA 4RTPA 4D4NA 5K5EA 1Y80A 4HEJA 4MNTA 1SIWA 2WU3A 1FFBA 2V0NA 1PQWA 1YGPA 4DSOA 2WWTA 1KQ3A 4CM8A 4BXOB 3DBOB 3O6VA 1W44A 2PD4A 2JPDA 3HZHA 3AR9A 3SEZA 1XYYA 3P27A 4WV3A 4MS1A 2J9YB 2GAJA 1E9EA 4E5VA 2B9VA 3G1WA 1VLMA 3I53A 2Q6KA 1VBKA 4WTOA 3HZOA 1J06A 4ESVA 5EIHA 1IFXA 2WHEA 1V3UA 4DG9A 5IDYA 3D8RA 2FEPA 4Z99A 3OEHA 2VI5A 4YFYA 4E08A 3PQ6A 3KQTA 3EVBA 3O4RA 1T0PA 4IIJA 3K8ZA 4EHFA 3ESQA 3A4YA 2GK4A 4LK3A 5AVKA 3DKAA 4FHGA 1H2BA 3TZQA 2X8JB 5K0BA 2X8BA 3QE3A 1WB6A 3ZI7A 1UK9A 2IS1A 4C7BA 5J4LA 1KK2A 2DGDA 5CAEB 5TRTA 4RDIA 3KYBA 3WK5A 1PX0A 2EKQA 3WGNA 1KI8A 1C1DB 1I10A 3EIOA 3BUSA 4D9CA 3RC7A 2AJCA 1C9EA 5BURA 1GUAA 4L27A 1R66A 3FZYA 2PXXA 4MUNA 3NBXX 3GBVA 1BA2A 4Z4FA 2J3IA 4AYXA 4BQQA 2J7PA 1Y34E 3VYUB 3EZXA 4HNTA 4REMA 3WYDA 2BLLA 5LA6F 1V6CA 4A9AA 4WCFC 3A3PA 2Y1GA 2WWFA 4KRXA 3CM0A 3E9MA 3L40A 3NJRA 2PWPA 2GTIA 4DJ5X 4TMXA 1BN7A 1POWA 2V7WA 4BLWA 5LB4A 4EKWA 2AZXA 2X0IA 2JIPA 3OC6A 4O4LB 1K5GA 1S5PA 1RWWA 5KOIA 4ZOBA 2IBTA 2QAIA 1W5AA 4IQFA 2GILA 2ZIWB 5AUPB 3LC0A 1ISFA 2MSDB 3HGTA 4BVEA 4YV0A 1EU1A 1XU9A 3E82A 1KP9A 4R2LA 2ZAGA 1EFKA 1BS1A 4MIOA 1YQDA 1JJBA 2PSSA 4U2BA 1JBEA 3UK2A 4MVWA 2D5CA 3IT0A 3VAAA 3R8XA 1K98A 1B3RA 2B25A 4DNOA 3EZYA 2GM9A 1VDZA 2IHTA 2JAHA 4MJXA 3CRVA 2PFKA 5A6AA 1PFVA 2WY2D 1F2VA 4NENA 1CUFA 2PCJA 1DRWA 5A69A 2BM0A 2ZRGA 3WZ2A 4OP2A 3TZEA 5DTMA 3W3AA 3U26A 1RU3A 2QLJA 3GA7A 3NYMA 1P4GA 3QU9A 4RIHA 4P36A 3VAZA 1AM4D 4MDEA 4IKPA 3B52X 5K0TA 4INPA 2Q27A 1XMQB 1Z7GA 2CW0F 1ZVMA 1ULHA 3HZRA 1A7UA 5IM4F 2GT1A 4YX9A 4M8NE 1X7WA 1E9SA 1D2NA 1KIMA 2V5UA 4BX0A 1GZVA 4LYHA 1TT5A 1NN1A 2JFZA 4C7OA 1JEDA 1GA4A 2QTNA 4R1OA 4OJNA 3B2NA 4MLCA 4WFKA 3I6IA 1ZGBA 5FR2A 3PB3A 4BVLA 1IEXA 2E55A 5LP6A 1QS0B 2FR1A 4HYQA 3MUOA 3PYLA 3G3EA 3OJXA 4LOLA 1THMA 5DNYB 3P0JA 1FBNA 3HCPA 3P4UA 2QNBA 1IU9A 1P77A 1UKVY 2GFHA 1HMDA 3H84A 2AFHA 1SBHA 3ZU2A 3TPFA 4EO4A 4V38A 2PRJA 3BICA 2ZB8A 2OK7A 2I29A 1ECJA 3OO0A 3JWIA 1EK0A 4URUR 3OUUA 2CY0A 1V2HE 4Q7QA 5JMPA 1W87A 1IUKA 3KYIA 4UTOA 4YAUA 1NIJA 5DYIA 4IMJB 4N49A 5TPWB 3GLGE 4G65A 1KXJA 1Z4OA 1IQUA 4GMHA 4G37A 4DM7A 3A8TA 1VL5A 3UA3A 4R8RA 4Q3NA 4WY5A 2FPPB 1U7WA 5FNVB 2WU0A 1QFXA 4RUKA 2N3ZA 3A26A 4Y9DA 1F2UA 3GVHA 3B6JA 2Q2WA 1QHYA 3UV3A 4PIPA 5IWCA 3NEAA 3F97A 4X3OA 1H05A 1PSWA 1Q0KA 4MA5A 3GDWA 9GPBA 3A4VA 4EUNA 4LHZA 3LX4A 3IVMA 2YY7A 4HX2A 4MXDA 1TFRA 3DTVA 4N5MA 4ARSA 3LSYA 4W63A 3PFKA 2BI8A 1G3RA 1ZK4A 1O08A 4US1R 3TS1A 3HJUA 4QXOA 4P4NA 5ANRB 2YC2C 4N18A 4WDRA 5CDGA 3NDPA 3C98A 2D4HA 2NTJA 1ZH4A 1M1YB 3RFVA 4CR6A 2PZAA 3FOEC 2C29D 3DAHA 1JLLA 2MU1A 2XWJI 4UUAA 4LXUA 2ZVJA 3GUVA 2J8ZA 4PV7A 5EUCA 1XPOA 1E2EA 2HJ3A 2JH8A 2I4OA 3FOBA 5B1YA 5A5VA 3QU5A 2J0SA 1C3OA 1YE8A 3TTUA 3KOYA 4HQKA 3AILA 4LMPA 4HRXA 5E8RA 4ASUD 2E5LB 2QWXA 5AVTA 1L7AA 3BWMA 2ADMA 4KLNA 1ZR4A 4IV5A 2MYPA 2HO4A 1JFFB 5I9TA 5KHLB 1QFSA 3O95A 3RVPA 3NIGB 3SHFA 3WMGA 3TZ6A 4QLAA 3LFUA 4Y9TA 4J76A 4L5BA 1E3WA 3JARA 4TYWA 4DRXB 1RXVA 5GM1A 3A9WA 2PZFA 4FTWA 3E5HA 3PT9A 1DQZA 2RGXA 2WF7A 1GS9A 2C8LA 1BDJB 4C87A 4BU1A 1FDOA 2XSEA 1UBSB 3BMQA 3TQOA 4XIJA 1Z68A 1O4VA 5DLQC 2CNWA 2R1TA 4TSKA 1OPRA 3V32A 1FNBA 2JI4A 4PFQA 2IW3A 2VP4A 5JSUA 4OIMA 1P3Y1 4H7DA 2QL9A 5EJAA 4IFTA 1IXRC 3GP3A 2H1CA 1I2BA 1BFKA 5DM1A 5FFFA 1MORA 2HSJA 2NXJA 2QQGA 4J0DA 1PL8A 3RSFA 4JBHA 5HQ3B 4NU6A 2E21A 2GRUA 2YRXA 3ZWOA 4Z9YA 1UIRA 1LFDB 5FRDA 4IPTA 3L0IA 1HNNA 3CC8A 1H9CA 5AVQA 3PRJA 3DLPX 1XJ5A 5EK0A 2V96A 1Y3HA 4FX2A 4DIFA 3IOYA 1ZVQA 5B3LA 2ERXA 4TTJA 3DOFA 2JEZA 3GJSA 2VRBA 2GBFA 4DV2B 1V6SA 1NFNA 4JJ4A 4BP1A 1VI5A 3AVTA 2W90A 3HN6A 1LI4A 4GZ5A 1H5QA 1Z0KA 2OWDA 5DH9A 1XCJA 4YUWA 1E6KA 1VRCA 2R4QA 1GN9A 4V0LA 4XYBA 1JPNA 4KHPB 2D1TA 4EF4A 4X1YA 5LCXA 3AF2A 4OX9Y 4RO0A 4KBLA 1QG0A 3ZW8A 1ADCA 2BHLA 4CQMA 1TO2E 3IHUA 3GL9A 2OCCC 3HP7A 4EGFA 3LVRE 2GCNA 1EFHA 4WKCA 5ALHA 3QNWA 4PS0A 3T6GB 4LC1A 4AYTA 6REQA 2PGLA 2PUWA 4L4XA 5ES3A 2A33A 5DE3A 4NC3A 4K26A 3TMKA 2WWYA 4HFKB 4UZEA 4YONB 3GIDA 5CH8A 1HK7A 5KWIA 5EJFA 5FHRA 3O55A 1SOWA 3PGLA 1C8KA 1RWVA 1R7RA 2MYTA 2JLWA 2HSBA 1TQGA 4P9FA 3VTZA 4Q7CA 3BS4A 2C04A 2QLFA 3X2EA 4OQPA 2YKGA 3RYIA 1ZC3A 2Y1LA 2Y4NA 2XLWA 4XWWA 2A4KA 3LT2A 3SLKA 1N8TA 1YK1A 3F4LA 2RE8A 1M3SA 1KK1A 1USWA 1DAHA 4J6FA 1NZFA 1XDWA 4ZTUB 2SHKA 3L8DA 3H8JA 2QS9A 1LBSA 2OXTA 2IL1A 3UB4A 2HDOA 4ZMBA 1FMWA 1Q6ZA 4IZHA 3ON5A 4CDYA 4TXHA 4G5QA 2XR1A 4I55F 3OJ0A 3U3ZA 2ZYAA 2GI4A 3U60B 5DW3A 5EIWA 1THZA 1OHHA 1A7EA 2B7BA 4MWGA 4QJBA 3R5XA 4XFKA 3ZE7A 3I37X 4NBVA 4URXR 3I9V6 1NSGB 2H6EA 4N6HA 1W5TA 1V7PC 2HUNA 4NZMA 1BZ4A 1PZEA 1VSUA 3WXMA 1Z62A 2LUOA 3FDJA 4UCFA 1JUDA 3MTBA 2FR8A 1XKTA 5AVZA 1JG3A 2PVSA 4I99A 3RJTA 2VXOA 2ATCA 1X39A 3GFRA 5EHZA 4CLOA 2P9FA 5D1NA 3JVDA 1N9GA 5IABA 1R5OA 5L0FA 4L8VA 1SHKA 1SOMA 3ZX4A 2I2DA 5TXGA 4N5NA 1Y9DA 1XCLA 2XS8A 1U28C 2W48A 1HEIA 1G6KA 5SV2A 1ZM7A 4JR1A 3I5YA 2HIAA 3PNKA 1A9YA 5T57A 4RANA 4U63A 4W5NA 1XA0A 1T6ZA 2HHHB 3STXA 2DHDA 4OXRA 2E5FA 1JI0A 2L42A 2X0NA 2JCXA 3P9YA 5H7XA 3T1YB 2ZXEA 3KD3A 3AM1A 1YMQA 3RRXA 4DNPA 2JFBA 1KZ6A 2UYYA 4G4SO 2IF2A 1GA6A 4KU4A 1Z5PA 3EPLA 3U3MA 1KVUA 3EVFA 1D4AA 1A72A 3CX3A 4FIZA 3S68A 4QHYA 1JQKA 1GZHB 4G78A 3RS8A 3I5PA 4PAQA 1FP2A 3AESB 1ZYRF 2H9AA 3F78A 3STTA 4J43A 5KPJA 4Z9JA 2CLSA 1HL7A 2ZRNA 3IKJA 4G4IA 4IIHA 1ZISA 2IOFK 2W42A 1GA1A 4C0AC 3L41A 3KZ1E 3EUFA 1OZGA 4NCKA 3DZAA 2ZRAA 3JU3A 3UAYA 1DRVA 2GF9A 1AN0A 3UJDA 2XZOA 4LC0A 4Z7QB 5FEUA 4MMYB 2JIOA 1XFAA 1U8AA 2HLNA 2C7OA 1MGPA 3BGWA 2JAWA 3IBFA 4JBXA 3WP0A 5EZSA 1CE8A 2VT3A 5J4YA 4RH1A 4RAQA 4LDRA 4JOQA 4RK5A 3KHTA 5KMGA 1LC3A 2VA8A 4LRWA 3K0HA 4M83A 5IHPA 2EQBA 3V4LA 1WO8A 2FKNA 3M7IA 3C3BA 1OX5A 1MPXA 3NRCA 3MCVA 3NIBA 2OKUA 4TV8A 3R0QA 2VH3A 3EARA 1V95A 4N0EA 2CYDA 4EHBA 2V7VA 4ZEXA 4IH1A 3LBAA 1E1NA 3PE4A 1GGFA 2JAXA 3VU9A 4B40A 4YN0B 4S05A 5C8XA 4PR3A 3FNBA 3R7NA 3EPHA 4Q4CA 1T13A 2R5NA 1HT1E 4B6FA 4HVLA 4GYWA 1XZPA 2QUZA 5G53C 5B6IA 2H3HA 4XVHA 4BG0A 2QRQA 3LAYA 3L0YA 2VWPA 3QTTA 1SF8A 2BD0A 2H2IA 3WMXA 2IHNA 2FPUA 3V34A 2IPMA 3LUAA 2CT8A 4IEIA 3Q0TA 2HMQA 4W6ZA 2JI8A 1XDGA 3ZC4A 2R6R1 4ZC1A 3R3SA 2O07A 3USCS 4YP7A 4TV9F 5DWQA 4PWYA 2QYOA 4M1QA 2PSJA 4KIWA 2WB7A 3OESA 4RH0A 4MMXB 3DZJA 3F96A 1T8UA 1YFJA 2OBMA 3DBIA 3P94A 1CJTC 3VPBA 4A03A 3IJPA 4CTNA 2C20A 2DGJA 4E5KA 2C2ZA 3ZS8A 4PINA 1R4NA 2JZCA 4YP5A 4E2XA 1P0MA 1ZRMA 3PEYA 3PC4A 2GZRA 1P60A 2DBRA 4Y9RA 2D3WA 1P9OA 3RSOA 1GPBA 4XYLA 2BZGA 2R60A 1K6IA 4MUGA 1G0NA 2VP9A 3WB2A 4XZ3A 2PHZA 2R79A 3DMHA 4PLCA 4MRVA 1XJWA 2PMFA 3VF0A 2FAXA 3KV1A 5JZOA 1CBUA 2RGGA 1QHHB 4GEKA 1P0CA 4G1FA 2NMVA 2D5AA 4CM4A 4NFSA 1Q17A 3GLGA 2OG2A 1GUBA 4XI9A 5ED4A 1KRWA 3QQPA 1VM6A 1VB5A 1JDJA 1GCAA 2D0OB 3GFPA 3T7KA 1LX7A 5JALA 5FBWB 3RC1A 1ZYUA 2AKAB 3L34A 2O8BB 2HPHA 3OSUA 3ORHA 2PH3A 1D4FA 4J32B 4DLWA 3N3AC 5ALKA 1DI0A 4UTNA 2Q6OA 1TKBA 1JDUA 1DQNA 1C7ZA 3MQ4A 3ANNA 3VOBA 4HFFB 3FVYA 3FJ1A 4YJ3F 2ODQA 4R3WA 3AG1C 1LSUA 3CVXA 3T4UA 3T1QA 2GHTA 2ILVA 3AR5A 4W1PA 1MAHA 1I1QB 4OEHA 1TLTA 3VC3A 2EQ5A 1CQJB 4PSVA 3TPZA 1QV9A 5A4DA 1Q83A 2ZJOA 1BKDR 4W6QA 3HJNA 3I32A 3F5DA 5DU2A 1DT5A 5DNUA 3RVSA 2YC4C 5T3YA 4HQLA 3DF9A 2NXEA 2L17A 4COKA 3V5XA 1TFUA 1O95A 3TG2A 2AMJA 4GC5A 2GVNA 2IBSA 4BX8A 1TWGA 2FHSA 2G9QA 1RBYA 4A0QA 3QWHA 1EKYA 2CDBA 5BN5A 2HYDA 4FDLA 4CT5A 3TTTA 4XWOA 4JMLA 1SXPA 2V45A 2D06A 5FZTA 1Z5WA 2E85A 1UPXA 3O8QB 3KPJA 5HIMA 3IQ6A 3OF5A 4BP3A 2RH9B 3GJRA 3BBPA 3RVKA 5AHWA 1ZKDA 1X19A 4P38A 2EEZA 2YL1A 1MUUA 3GLVA 2PE5A 5JAMA 1YARO 3R3HA 1Y89A 5AW2A 4A10A 3PNPA 3TWOA 4E1BA 4Y1EA 2AN4A 1U3TA 1G98A 1K2WA 1DKNA 1IZYA 5CDUA 4MKXA 3ORRA 1RLUA 3AR2A 4G6ZA 4RZQA 5EWMB 3EE6A 1TM1E 3O8BA 4K9DA 3G5AA 4CKCA 1V3TA 2AUNA 2VP6A 4MINA 4KWIA 4IDOA 3QVUA 1WWKA 5GPBA 3OMLA 3QFRA 4OQDA 2RAVA 1XEXB 2HQ1A 2VDJA 3PZRA 2R03A 4BN0A 3DKPA 3NBZC 4G5YA 3GORA 1XQ6A 3FMVA 2I7DA 3US6A 5AVJA 2CNNA 1NYQA 1R4MA 2L69A 1E4OA 3ICEA 2UUIA 1N5OX 1I6MA 1P33A 4QDOA 1P91A 4JIGA 3ULKA 3AUAA 5HSGA 1JIXA 2CJFA 3UT0A 2RH4A 4YRRA 4D81A 2YJNA 4MV4A 2PGDA 1R5JA 1RPZA 2JLRA 3GQBB 3MQ2A 1NBAA 3KJIA 2V55B 4YIKA 3U3OA 5A4MS 2ZZMA 2HCBA 3JZFA 2RD2A 2NUAB 2OZLB 2ZXOA 4E5YA 3LECA 3ZIUA 1A2KC 5AWFC 4AP9A 3O6XA 1JG6A 4PS1A 1B42A 2XAAA 5JH7B 5F9HA 4O7GA 3AY7A 1JLMA 4IFBA 1G8YA 2XDAA 4XSVA 4BQIA 1W6UA 1EUYA 3MJHA 4EZBA 3L0DA 3HL4A 2R7AA 3AKZA 4G89A 5TQ0A 3UA4A 5KINB 1AQJA 3NDRA 1RE0A 4TL7A 2G1UA 4C07A 1GVNB 5CPFA 1ZLXA 1HT3A 3KKZA 2J5XA 1ZNQO 3AEKA 5G41A 3IGFA 3DMTC 4TM8A 1F2DA 4P7JA 4P5EA 5CB4F 3IAS6 4RY0A 2YJ5A 3AEZA 4WERA 4C7XA 1EE1A 4R1NA 2IOHA 2ZIGA 1PWEA 3ABLC 1YLMA 5E3AA 4M6WA 3K1AB 2Y3HA 2J9GA 1FZTA 5GONA 4RKQA 4EY3A 1IBLB 4X8MA 4L95C 1S3GA 1C3VA 3OIFA 1ZW1A 4DQXA 2W2VA 4B71A 4AIRA 5JRAA 1OC4A 5BQGA 2Q9AA 2VPWA 4YO8A 2LDXA 4LJ4A 3WKBA 2JS7A 4G2NA 5K4GA 1G4WR 4MR7A 4II3A 1OCCC 3GCXA 3DE9A 3R6TA 3AKDA 3URMA 2YL2A 4WXHA 2JIQA 1RP1A 1GGQA 4LNAA 4LTNA 2GBLA 2PF4E 4AJ1A 3M4ZA 4TV9B 3VTFA 5FWAA 2XE8A 1QHIA 1SPBS 4ZAZA 3UHFA 3OETA 2A6PA 2ZM5A 3C8UA 3BD7A 3BB4A 3DE3X 2VEDA 4DBQA 1XNQB 2BWJA 1H65A 3ST7A 1NJ5A 2VKTA 5C37A 4F96A 1UBMS 4MULA 3JR7A 5AVXA 5IMBA 2ZXPA 3AI7A 4E94A 5FAKA 2FPGA 1GCOA 4XW2A 1A4RA 2A78A 3HFSA 5CEJA 4WXYB 3BFJA 4MLZA 5BP7A 5I3ZA 3NT4A 5DTEA 3W4KA 3S55A 4ZP1A 2Y76A 2GYUA 1EJ0A 1D5WA 4D2IA 1FUKA 1A7VA 1YXMA 1NATA 2BDEA 1E4YA 2HEGA 4MGIR 2QNIA 1QP0A 3O4GA 3Q12A 3VKGA 3JQ6A 3BXGA 5LZ7A 2P1AA 2IE0A 2H5IA 3WOVA 1QE0A 3FSEA 3GV0A 4W9RA 2OYSA 3MHPA 4LACB 3T3OA 1A9ZA 3OLVA 4D6XA 4LDZA 2P0YA 4ER7A 1Y0BA 2X41A 4AP5A 2HRZA 1GPLA 4AYWA 1VSQA 4DQKA 1T8WA 4QASA 3V42A 5K0ZA 4OB7A 1U0OC 4XFDA 3KQNA 5HTKA 1D0VA 2ZUWA 4M1MA 2P7IA 3OIVA 3I3OA 2N47A 1IQPA 4CMIB 1RJ9B 2EG9A 2FDRA 4F4FA 2X15A 5IT5A 3RNLA 4QIHA 4MVOA 1FXSA 3IQXA 1UQUA 3UJNA 2V6MA 3WYCA 5DN6D 3C45A 1IB6A 1O6BA 3I45A 4FAPB 2C2WA 1FW8A 2C31A 5G40A 2OEXA 4RDHA 1H8HA 1RM5A 4D96A 1X14A 3UHAA 4GXTA 2Z9CA 2QTMA 4YT5A 2DJ5A 4ZVUA 1L5SA 4ZEOA 1NKTA 3AVXA 1TD1A 3JSEO 2FW9A 1JJFA 1C81A 5L3QB 3G2MA 4ND3A 4EAAA 3FBTA 2YJGA 4L6RA 3BWBA 3F8TA 3OZFA 2B7CA 4A82A 3G6KA 3BXXA 2ERYA 3EIUA 3FTDA 1UXJA 2TMYA 2IXGA 5LQKA 3TOLA 3K30A 2IY8A 2AG5A 1X0VA 4V0MA 1Z38A 3VO1A 4X9XA 1M0SA 4FDTA 4RKEA 1NF2A 5G1NA 4KODA 3FFXA 3QXCA 5KQSA 4Z0TA 3KIPA 3WS7A 2B98A 4CM5A 1N7GA 2O8FA 4QA9A 1HSOA 1Y1PA 3I62A 3CCBA 5C2JB 2TECE 4DDKA 3V55A 2O8VA 2Q5JA 3PC2A 3M6WA 4JC7A 5B3AA 4I4TF 5IX8A 3PVZA 1Y8QB 5ULLA 4N7RA 2CNOA 5MN6A 2H4YA 3HA5A 2P61A 4B47A 4W99A 1V96A 2ZTSA 1D7OA 1U2RA 4QQ8A 3W78A 1BXRB 4O4IF 1GWNA 3LK7A 3H17A 5EXXA 1UCFA 4X0RA 3NNNA 1I7NA 3I92A 3JQ9A 3VBEA 4JJ7A 4QJ4A 3S40A 9ABPA 3ZE8A 4HGNA 4ZEMA 4EMUA 4YXWA 2GAFA 2TYSB 1OREA 5ALVA 1GSOA 3NOQA 1HXHA 3RWBA 1PBTA 2HNKA 4B9EA 3U49A 2Y3BA 1ZUD1 5F1YA 4ARCA 3TL2A 1J09A 1PYDA 3AF0A 3G59A 2O8CB 3VU1A 1CLEA 4FKBA 5LD2C 2W8BA 3BE8A 4U39A 5LQSA 1J42A 4MR8B 1NE7A 4WN3A 1JEAA 3UMKA 2ZTUA 3UTCA 2PU7A 2FE4A 4GIBA 1BQ4A 3TR5A 5KUTA 2L18A 3PTLA 3DG9A 4OHUA 1KAHA 1SGWA 1OWOA 3VMMA 3JW8A 2O5CA 2IRWA 1SC4A 3AOEA 3EDOA 2QJRA 3Q40A 5JCXA 2ZBPA 4X5OA 5IAGA 1USIA 5BR7A 1APBA 3TINA 3EA4A 2W2QA 4K03A 3RABA 2C4MA 3OFND 2BFBA 1YR8A 4EPYA 4W5OA 4HNAB 5C1PA 2AJDA 3PTZA 4JL6A 5EGNA 3UV6A 3EVAA 5FBQB 2UUCB 3DOIA 4NFHA 4BGDA 2AFHE 3TSOA 4TKZA 5IAAA 2ZBVA 1A1SA 4LJLA 3GD7A 4C2TA 4YMWA 1RQGA 3T41A 2XLVA 4JI5B 2ZBRA 1N0VC 1Z5VA 3LHSA 1XLVA 1XBTA 5JZMA 3A6DA 3E0QA 3N76A 2H54A 3K8OE 2V1XA 4C4AA 1D2EA 2XUAA 3ZG1A 4B6QA 5KOYA 3I73A 3RB8A 1S2GA 5CFOA 3WNCA 3Q8MA 4JZAA 3T7SA 1PKXA 3DTTA 4M7WA 4BWYA 3F7NA 3OPXA 4DQVA 1DCTA 1HDCA 2BL2A 3MJRA 3L1IA 5EIAA 4KR0A 4Q4LA 3VAYA 4LDJA 4RE6A 1XQYA 3OZBA 4G4GA 2Z30A 4RTMA 1V7CA 2SCUB 2A88A 3M6MD 5DDIP 3MD0A 5SZJA 5KVSA 1G8SA 2Q4TA 4GP7A 4FZ5A 1S3FA 3U4QA 1P2SA 4TQUS 4KQ1A 1KKLA 4GPTA 4EGSA 3DO6A 1SCAA 2P1RA 3RIEA 5BV7A 4B1FA 4LKRA 2N1MA 2R8YA 3N8IA 1IHOA 3AM5A 4NV1A 2C5GA 3QVGA 5A4AA 3E3AA 5KSOA 1X7YA 4JFRA 4JB2A 4AQDA 1UZUA 4OSOA 3SEOA 2AFIB 1P1BA 4KXLA 4FW9A 4DC1A 1RWOA 1NFFA 5HQJA 2PLWA 4GMGA 2ZS7A 1A9PA 4UC0A 3V46A 3OWOA 3PUJA 5AW3A 5CGQB 1KEWA 3K0CC 2IX3A 1S3IA 5FXMA 5FUMA 4XVRA 1Q84A 1CV2A 4M8LA 1MB0A 4JP1A 3OG9A 2RHDA 3K6JA 1M1XB 4YALA 3VR4H 2G4VA 4L9WA 4C4SA 4DV7B 3NWJA 4GI1A 3INGA 1DJOA 4ESHA 2J0XA 4MQLA 4LZPA 1TWAA 4GI2A 1N2EA 3PI6A 1U7DA 2FWIA 3EODA 2R87A 3U7GA 1K5HA 1GKKA 1JQ5A 4BNTA 4S12A 5TT0A 3WL5A 2Q4RA 3CEPB 2YWXA 1JWBB 1C1HA 3HBFA 3GRZA 3LC2O 2GS9A 5AVYA 4DYHA 1YO6A 2IY7A 1X1EA 3I2HA 4R7ZA 2OGZA 4IUDS 1OTHA 2VZEA 3QENA 4G8DA 2EKLA 4JEBA 3QVXA 1S2LA 3DWGA 4MW1A 5COAA 1OIXA 5TMBA 2ZJ5A 4JSRA 1TECE 2HW8A 4N3BA 5T1DB 2W43A 4C9BA 5AM2A 3MTGA 1Z0AA 4CIDA 2RK6A 1II8A 2E0IA 1Q50A 2GWRA 1QVRA 1YA4A 3LCJA 5FTNA 3MYRA 1HY3A 2QZSA 2EZ4A 4JKYA 5JNTA 3BMNA 4YHHB 4WVLA 2LW7A 1FTSA 3NKDA 2OGTA 3N2EA 3AZQA 5DLEA 1NJ8A 3LX8A 4OGFA 3NEYA 4CS9C 2Z2XA 4PR9A 3NNDA 3REFA 1UDXA 3DT8A 1G5ZA 1PS0A 4GLJA 5CEEA 3H9BA 1L4KA 3KSRA 5DGDA 2FWRA 1BRTA 3FTQA 2F7SA 4FN4A 3C7KA 4ND6A 2JANA 2C9CA 5F98A 3CISA 3ASVA 3IBCA 3M1IA 2C2YA 3SHTA 3MK31 2PIDA 3WGOA 5FUVA 3WK8A 4M0PA 3VPAA 2CMHA 1IEVA 3RASA 2QN3A 3RW0A 2XZLA 1NC1A 2YIVX 4BNZA 4GKKB 3EYAA 4XGKA 1TRHA 3HKKA 4QARA 3NWEA 4RPIA 4XLLA 5IF3A 3R6DA 4C0QC 3F6YA 4MVZA 5JAZA 1K40A 1I1OA 5IAKA 1K05A 4GU5A 1FYFA 2ADFA 2X5NA 2OHIA 3EXEB 1D09A 4PQYA 3H5TA 3EGVA 4CHGA 1TK3A 2JVJA 4GPZA 2QTRA 1BDHA 1YS7A 3THOA 1EWQA 1Z6QA 1BTOA 4O4IB 1N6IA 1EGQA 5BYAA 1YRAA 2HPVA 3DQPA 3VU8A 4CYMA 2Z2KA 4KKXB 1UDAA 1J00A 3NHZA 3IUYA 3E9YA 3CX4A 1XZDA 3R8CA 5CFMA 3PX7A 4PLHA 3E9ZA 4RPLA 2YL7A 3C3AA 3IHKA 2R2GA 2VDMB 521PA 1NMEA 2I2WA 2A9FA 4IIYA 4DSZA 5KS2A 1SBNE 3SXJA 4L6AA 1N2CB 2HCFA 5M34A 3OIWA 5K99A 3RVNA 5LU9A 5JU6A 2JEYA 2XMPA 5FWXA 4TRJA 5HF9A 1V1RB 2ZRKA 2O1WA 4BRWA 2CC2A 4KI2A 3CO5A 2IYPA 1E98A 1SULA 3R24A 2C7BA 1DIRA 4F9GA 1RQRA 1KKMA 4RTNA 1T36A 1Q2XA 5BV1A 3OLYA 1YU9A 2VOJA 2O2EA 2XNHA 4MDYA 5AJYA 4EZIA 2RIPA 2G9NA 1X1RA 1CX9B 3GLRA 3C74A 4BVKA 2LE0A 2GEKA 1LJUA 1RLIA 3UT5A 2N1BA 1IXSB 3MB8A 3S27A 4WT7A 5BQHA 3VR2D 2PYIA 4AS1A 3UUGA 1J4AA 3E2IA 1QF6A 1N92A 2IZZA 3VNBA 4AX2A 3GWZA 1E2JA 4PK4A 3WJ1A 2KS6A 1S6YA 2O3SA 4B48A 2FQYA 3WLOA 1BE6A 2Y77A 3VHXB 1SELA 1QQ5A 1P3JA 1LH0A 4OGGA 1QH8A 2VHWA 1OGIA 4LPSA 3TSWA 3FVQA 1C2YA 5FOVA 5ADHA 5ECYA 4CG1A 2WYOA 1NBEA 3DCNA 1KWKA 4M53A 2Q7XA 5HBRA 4ZOCA 4YRGA 2JD1A 1ZRSA 1A7JA 2YVLA 5DPMA 1TCAA 1PHRA 3H0CA 3I28A 2H29A 3RSZA 3L7MA 2XIJA 4GOXA 3EZHA 2WYWA 4BFXA 2YRWA 3L0OA 2VHCA 3LUPA 1CUDA 4YCLA 1XWFA 3HJGA 4MRMB 3AV3A 1OE0A 1SBQA 5DP1A 2XYGA 3ZVLA 4C7JA 4E07A 1TUBB 2ZETA 1VLLA 3MA0A 1HLPA 3PCRB 4QICA 4KR6A 2BM8A 2NXNA 3NUZA 5BY2A 4MARA 1WP9A 4LYEA 1LRJA 2NW6A 3QLEA 3G1UA 2WV7A 1HF3A 3NWPA 2BEJA 4K6HA 1IB0A 2AIRA 2O05A 3J81A 5I7VA 4RZXA 3Q7IA 4Q66C 2X40A 4BAZA 2ZRCA 5I3CA 2PQ0A 2DECA 3I83A 2QN2A 4P4GA 2XRYA 1OI3A 4RLQA 3N7UA 1XAHA 3KQUA 2QTVA 4O4HF 2FPSA 5SY6A 4YP0A 4UZFA 3ELDA 1FEZA 3SZGA 3DHNA 3W8DA 3T4XA 5G2OA 2WT8A 5AUOB 3F5MA 4M9UA 5L0DA 5DBHX 4HG2A 3FJYA 1U8ZA 5HMLA 1CPQA 3Q3IA 3IVRA 5AJXA 2XXAA 4YR7A 4MI6A 1EFVA 1HQDA 1R4AA 3KWFA 2MYUA 3QKSB 2XT0A 4EG0A 1P7CA 1ETHA 2P77A 3ICCA 4J91A 5EJ4A 2ECQA 3GMTA 4DMGA 3HDYA 2H1VA 1U9IA 1ZCZA 4MS3B 4BJ1A 4BE9A 1YR6A 2X77A 2QE7A 3PLAE 5FA5A 2IODA 1YJ5A 3AT1A 4KXNA 5A1TA 3TXAA 2R66A 2WUVA 1XL1A 3P97A 3SEQA 3OM8A 3QOWA 3H6HA 3T7TA 1JDVA 2MSNA 5JSQA 4YRDA 3VR6A 2ZTMA 3QOFA 4DWWA 2R7MA 3UWKA 1Y5MA 3MBGA 5BQXA 1VBMA 4Z9HA 1RRCA 1E89A 5AW4A 1Z7BA 1ISRA 3NKFA 1CIVA 5KC9A 2JJ2D 1SG0A 1ZMOA 1NRJB 4H1HA 3FOOA 1W29A 1ZM2A 5AI6A 3C1AA 3JSAA 3T95A 5IHXA 1W581 4CG3A 4DMHA 1Q44A 2CMGA 3DLCA 5HKKA 1W4CA 2J3LA 2BRUA 4Q9AA 1H2WA 2G5CA 5CFZA 1H9AA 2EG5A 4JYPA 1DOAA 1OSNA 1Q1NA 4JZYA 4BNWA 2DPHA 3TM4A 5CPBA 3V9AA 1HE9A 4CUKA 3H97A 4CDRA 2GK6A 3WL7A 4D0LB 3VRCA 5IAOA 1XOIA 4LG1A 4LHXA 2OSBA 4YDSA 3RK1A 3BDAA 3EDCA 3NTXA 5JVDF 5KYNA 4GQIA 4Q7EA 2QPOA 2P1ZA 3A1WA 1RPTA 3LHKA 4EKDA 3GZJA 3LYHA 1T01A 5COGA 1ONBA 2FMUA 1ANKA 3HY3A 1S1MA 2KPOA 2Y1KA 1PLJA 2IXDA 1QOQB 3IV7A 3EIFA 2YNMD 2J46A 3EIXA 1RHRA 2VYVD 2FZ4A 1BGWA 4PG4A 2RGNA 4UFPA 1UF9A 1JLKA 2H8AA 1PT9A 4G7OF 3QMMA 4GOJA 3V8RA 3M1YA 5TEWA 1CGME 5JXGA 4JU9A 5LWHA 1J33A 4NEGA 2XAUA 4IZ6A 1QVZA 4QYXA 2M64A 3ILHA 1JYEA 1PJCA 1UXOA 1LE2A 1N2HA 4GKJB 3OKCA 4HTFB 1U81A 1WG8A 2CGEA 2XLHA 4KVFA 4JLUA 4NECA 3UBTA 3QYAA 1CUGA 4K3VA 3AZPA 3HBNA 1E0JA 3HO8A 4AZWA 4IY1A 2NPUA 2OK8A 4H4EA 2VRCD 3PJEA 1QM5A 2FHPA 4LRQA 3UUWA 5KTSA 2NP6A 4X97A 1QLHA 4HH3C 4EL5A 3TIXB 4E2YA 1M2VB 1A2QA 5FUWA 5K6AC 4PAGA 1QRSA 1GXSA 2HWXA 2FNAA 4MROA 2UVPA 4DCMA 4BMPB 2WFLB 1KYWA 3ND6A 1DPGA 3IVXA 4F04A 1V8FA 1HR0B 4XGIA 1EVIA 1D5CA 2HCJB 1CU1A 5IMSA 4H1WA 3DYVA 2J3HA 3DD7A 1D0IA 4YL0A 1MNDA 4FW8A 5FO1A 4NAVA 2AYYA 5HRCA 1I24A 1WXQA 2ID4A 5B2ZA 3ZKWB 1JQ3A 4UCWA 1TCBA 5C81A 4LJKA 4Q0MA 4ZIRA 1IBKB 1NVAA 2XM4A 1M2FA 4B3SB 4DCPA 4YUVA 4QTXA 4DQUA 4LF9B 3WGTA 4CLRB 1DBIA 2HYIC 2F8SA 5LA6B 3TE6A 5SYAA 3O1JC 1YZNA 3DDWA 5AESA 4MKFA 1WAMA 2FLWA 5JJLA 2JVIA 4FNOA 6PFKA 4D92A 2WUGA 4LERA 5HUQA 3EH2A 4Y2GA 1YVPA 2CV1A 1Z2OX 3Q1KA 4DMKA 1MA0A 4NBWA 1J2JA 2Q1SA 3ZDQA 5H82A 4ERNA 1W0CA 1CF2O 4FB5A 4FT4A 2ABWA 1T8SA 3MTIA 5D5HA 2CL7X 3HWRA 2B7LA 3Q9SA 3EYWA 2M1ZA 2J0QA 3S70A 5BT8A 4QGGA 4R8MA 2CEKA 3K0AB 4L6CA 2DTXA 7GPBA 4KUEA 3OM1A 2VOEA 3L4BA 2B8NA 3I2FA 3F7TA 3OA1A 4PG6A 4MKIA 1P7WA 2VAMA 3CG0A 4ZFNA 3KZMA 3QKUA 2Q0SA 5F3DA 3ELYA 5AJVB 5B64A 3VKWA 1A76A 2XJ9A 2VF2A 1UAGA 4I7EA 5COMA 4ZAFA 3KYJA 5CTJA 2BEUB 3K70C 2LFDA 7ABPA 4JNKA 3PQDA 1Q0FA 3CX7A 1PJ3A 3PXGA 2CF6A 3ED5A 3BTSA 1K97A 2Z08A 1RJGA 4O4HB 1SC1A 1ADBA 3KS9A 2BF7A 2HMUA 4OJTA 1EK6A 1LBIA 1EB9A 3RS5A 4RE5A 1UM9A 2WNSA 5AK5A 3M8KA 4EG8A 4QVIA 4LJ8A 1GPDG 5I9SA 5ARBA 3G88A 1AS2A 1Z6ZA 5IJ9B 3EZ2A 1U0EA 1H3NA 1AUEA 1UMCA 1GL7A 2Z56A 1I7DA 2EKDA 1K27A 1QZZA 4K0KB 3DAFA 3HCCA 4L16A 3LLVA 5FA6A 1XZQA 2AKEA 2G40A 5ITZA 1OFGA 3CMCO 5EMKA 4B76A 4HV4A 3IAFA 5C4MA 2FRXA 3ZU6A 2J41A 3PUKA 2X7HA 2WDZA 4LEIA 2IYWA 4MHTA 3FDQA 3ESRA 3U4DA 2CWWA 1LF0A 1KNYA 4X44A 1CUZA 3OO1A 1P45A 3QLVC 4QRDA 1JZSA 2WEKA 1KDRA 4ILEA 2JBAB 3OOJA 1GTRA 3VHLB 1ZESA 2JGKA 3NMUF 3I52A 2BMVA 4LSMA 2OFFA 1ZVJA 5TE9A 4LCEA 2AJBA 1RWQA 3E70C 3ZWVA 3L0BA 1NXTA 4J1TC 2VHJA 5M3BA 4IH9A 3OOWA 1KR2A 1SXIA 3QU7A 3B3QA 4P3NA 4YRPA 1VHWA 3KAPA 4QHTA 4MMZB 3FYDA 4IHJF 2HMSA 4UBMA 4B7AA 5CHEA 1XZGA 3CW2A 2CXQA 3IAXA 1WVMA 5DV9A 1NQ5A 1QHEA 4A0FA 4JVMA 3TZLA 3HNKA 2J9XB 4GRAA 4JR0A 3GJTA 2VCHA 4G9GA 4Z4QA 2XKJE 5A05A 4XM2A 3KHSA 3D8TA 4GPBA 5ALRA 2GO1A 3WWYA 5BNTA 2ZSIA 3WRXC 4M1EA 5BWNA 3CZ4A 1YONA 3C4QA 5LJLA 3EG9A 2ZWAA 4B4DA 4B46A 1FQKA 4C7MA 5JVDB 2WQ7A 4F5DA 1OKKD 3A0UA 4RX1A 4D45A 5DHQA 1IM5A 1IBSA 4Z8XA 4UNNA 2O2HA 4JLBA 3GDFA 2JJMA 4HNGA 3N0TA 1J70A 3DAYA 4M9ZA 4GNRA 2JJYA 1CK4A 1P9WA 4RIFA 4ZZ2A 1KJNA 1BAPA 1BYIA 4P5DA 2PLRA 3KR2A 7YASA 1TQDA 4ZO4A 2OCYC 2HGZA 1JDTA 5DTRA 2WG0A 1BW9B 1JDBB 1UEIA 2PZBA 3S3TA 2ZJFA 4PZZA 2JRLA 3EJNA 1ZCBA 4U2DA 4V02A 5B7PA 1DBVO 3FPGA 4UAVA 5CJ2A 4AROA 2H52A 1AK9A 3QY0A 5IVPA 3QTBA 1Q14A 4XM0A 3G49A 4UAJA 3BMCA 4E18A 3IVAA 3RW9A 3C4JA 1D3AA 2F6RA 5BN1A 3E5MA 3KTFA 4BMZA 2POQX 2GN9A 2C7QA 3SP1A 1ENYA 1Q57A 5AHRA 5CDYA 3BX1A 5T3UA 2W98A 4V0ME 2ZJZA 2QUBA 4A6DA 2FF7A 5GVSA 5KQMA 3UPDA 4MV7A 4A26A 3SY8A 3RUPA 3IIMA 4I1RA 4BGIA 3MMSA 4PQFA 2XY4A 1GL3A 4BP9A 3IELA 1HRKA 1XA3A 1C9NA 2UUPA 5ALWA 2VN8A 4JI8B 4X8HA 3BN3A 1RAIA 3L0SA 5JWOA 1EG2A 1XMVA 2X58A 1HLDA 4RADA 5LQCA 2JW5A 3MJDA 4KFUA 2J45A 2H4XA 1MIOB 5SZKB 4MVJI 4AG5A 1QHFA 3R5KA 1J5XA 4RIIA 1HDYA 4TXJA 4MWSA 3JRMO 2P9ZA 2XKBA 2RK3A 4BO9A 3GLIB 3CIFA 3CIOA 4NH0A 1P19A 3UCXA 2A57A 4H15A 4HQOA 1E58A 1MTOA 2E48A 5CURA 3EGXB 4WK4B 3RKOF 1WD7A 2EIXA 2H1LA 2A1TR 3R4VA