3A11A

Crystal structure of ribose-1,5-bisphosphate isomerase from thermococcus kodakaraensis kod1
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
320
structure length
320
Chain Sequence
VVKEVLEIAEKIKNMEIRGAGKIARSAAYALQLQAEKSKATNVDEFWKEMKQAAKILFETRPTAVSLPNALRYVMHRGKIAYSSGADLEQLRFVIINAAKEFIHNSEKALERIGEFGAKRIEDGDVIMTHCHSKAAISVMKTAWEQGKDIKVIVTETRPKWQGKITAKELASYGIPVIYVVDSAARHYMKMTDKVVMGADSITVNGAVINKIGTALIALTAKEHRVWTMIAAETYKFHPETMLGQLVEIEMRDPTEVIPEDELKTWPKNIEVWNPAFDVTPPEYVDVIITERGIIPPYAAIDILREEFGWALKYTEPWED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor eIF-2B, delta subunit
publication title Dynamic, ligand-dependent conformational change triggers reaction of ribose-1,5-bisphosphate isomerase from Thermococcus kodakarensis KOD1
pubmed doi rcsb
source organism Thermococcus kodakaraensis
molecule tags Isomerase
total genus 104
structure length 320
sequence length 320
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.3.1.29: Ribose 1,5-bisphosphate isomerase.
pdb deposition date 2009-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01008 IF-2B Initiation factor 2 subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.420 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) translation initiation factor eif-2b, domain 1 3a11A01
3.40.50.10470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Translation initiation factor eif-2b; domain 2 3a11A02
3A11A 1T5OA 2A0UA 2YVKA 1VB5A 4LDRA 4LDQA 3VM6A 1W2WB 3ECSA 5DBOA 4ZEOA 2YRFA 1T9KA 4ZEMA 3A9CA
chains in the Genus database with same CATH superfamily
2OZLA 3YASA 1P2VA 1YBAA 1N2JA 4JQYA 3A1DA 5B3SC 2VQ3A 1V8FA 1U0GA 2YV4A 3F97A 1HYHA 5TMPA 2C2WA 4MPDA 3KOUA 4DJFC 3KQOA 2JFPA 5EIBC 1S3SA 2I03A 3VR1A 2ECKA 4QGHA 2QR5A 2J3LA 3TNLA 3ZTYA 4OAPA 4LJAA 4RH0A 1DOAA 4WLUA 5C52B 4N18A 5ELXA 1EE1A 3KKBA 1C29B 3QTTA 4DS3A 4KBFA 2HFIA 2GFQA 2C1XA 3OZFA 1XXLA 4BUJA 4A0FA 4OI2A 5K8LA 2DJ5A 4S2UA 1K6EA 3B8EA 3JVEA 5ENDA 4YAGA 3KOMA 3L8EA 2WKWA 4M1TA 4XTKA 4N6HA 3ZWKA 3AJ9A 1FQKA 4IJVA 2VT7A 3IKMB 4YJ2A 2NQ2C 4ZVLA 1OAKA 4FUQA 2DB3A 4K6HA 3GUZA 3BZUA 1SBYA 3LLUA 2YTZA 4J75A 4K6GA 4K9DA 2KHZA 4PM4A 1MD9A 1K8QA 4JYCA 1TKAA 3A04A 1KC1A 2BUBA 2IS4A 2G77B 4M0LA 4HWOA 1SZJG 2L69A 3WBJA 3T9FA 3VU0A 2ATEA 5LPNA 1B0AA 4LN1A 1JBEA 1B1AA 3PEWA 2BEVA 3BWDD 3GUUA 1WNFA 1GNVA 1E1QA 5DT9A 1TI7A 2R1VA 4YIKA 4JA2A 3CF4A 2GAJA 3FDXA 3KUCA 3PRJA 5JJBA 5IJ0B 3AYXB 1EB9A 2J3EA 1GQAA 3AI7A 5D01A 3ZXIA 4ZEOA 5J23A 1HE8B 1S7ZA 3M4ZA 1MTOA 2HF2A 2R03A 3O8QB 4XI9A 5BWMA 2QE7D 3RRXA 1EVLA 3MQ4A 4ILEA 1Q91A 1RZUA 4JKIA 3NYRA 4DLYA 3HHPA 1UZNA 2O52A 5JLIA 1E5TA 3KR1A 2IXPA 3KLNA 1O5OA 1B26A 3DJYA 2WTBA 2W2QA 3T12A 1Y0BA 1L3PA 1E94E 3LZDA 1P2FA 4XQ9A 4TOIA 3WDMA 3ZHBA 3RRNA 5AVUA 5HF5A 5DISB 4A92A 1A7JA 1YOBA 4EUEA 1OFIA 5EZQA 5BWOA 3VR0A 4R81A 2Z5FA 4Q3DA 4B3BA 4R9UC 1I0IA 4TVBA 3K53A 1EINA 2WILA 2EFEB 3C7AA 4CSAA 3O1HB 1HKHA 1SHJA 1EUQA 2H3HA 5E2BA 2K4MA 3ZEIA 3NBZC 1IN6A 4ALJA 1ORHA 1J8VA 4IX1A 4I4NA 4PJJA 3MHTA 2FOIA 1S3GA 1GGVA 4LFAB 1NC1A 1WSWA 2HBRA 1ZN7A 2GI4A 3T0GA 1EXDA 4JLWA 1Z17A 4TN5A 1K75A 1R6AA 3WL4A 1TYDE 2Q4EA 2JHAA 1N3BA 5B1HA 2O2DA 1TLLA 3GLGE 1NJGA 2PV7A 4Q9DA 3TIGA 5E6RA 4ALIA 2G3VA 2JK0A 3UA3A 3NG1A 2PUFA 4BVKA 4QYMA 4QGGA 2C4VA 1O54A 1UDCA 3DD1A 4AZVA 2P7IA 1LBIA 3OX1A 1ADJA 3WGJA 5K03A 4F4CA 4RH1A 4XB2A 5HE8A 1UPBA 2B0CA 2CNDA 1AY0A 1YQDA 4F4DA 5JV5A 1YZFA 1JDSA 4XX0B 1R4NA 4RNCA 5A4DA 3UXYA 3L84A 3MG9A 1IRIA 2V6BA 3IQDB 2EVWX 3W34A 2HWYA 4XCVA 2ZI6A 2Q2OA 2XNDD 2D54A 2QE7A 3I05A 4NX2A 2ADFA 3ELWA 3KM0A 1M0SA 3D8RA 3BKWA 3TSYA 3QU7A 3HS3A 5AKXA 4IQGA 3AW9A 1WDTA 1KE1A 3FA2A 1LTQA 3L7OA 4X95A 5GP1A 2V59A 1P61B 4R8SA 2WNSA 5A0TA 4P84A 4QPCA 2VBCA 3Q0TA 4W7IA 4L07A 1Z06A 2FUCA 4JAVC 3WKBA 1KBOA 4HEAJ 2XMPA 3LBAA 5LQCA 3HG7A 1YD7A 2JVKA 4F04A 1YQ9A 4HQ6A 5FV4A 2ZSJA 3D5EA 1ZJJA 2GSDA 4I50A 1PG0A 3WODF 3LWDA 3A6LA 5AI4A 5K1ZA 2GD2A 2IUSA 2Y3GA 1JFFB 3ZZTA 2F7SA 3IA2A 3RR2A 2VYND 3UFBA 3IJRA 2Z30A 1PR9A 4GIBA 4MQEB 4LYAA 5J3JA 1UMCB 1CUJA 1Q0HA 4DMMA 4DUYB 2X77A 2QR2A 1XR3A 1FQJA 2UDPA 2QSYA 1NY6A 3B5IA 4ARSA 2O9XA 5HTOA 3G1UA 2WE7A 3WSTA 4E4YA 5EJ8A 1PZNA 4RHXA 2VHYA 1E1RD 13PKA 2GZ1A 4DLTA 4HDCA 3IDZA 3TR5A 2F8TA 3TM5A 3VTFA 2Y1DA 4DWOA 2GK3A 1LDEA 3D6FA 4HAVA 4K9QA 1NMEA 4G4SO 4FI3F 4IFBA 1IUKA 2GETA 1X74A 2HLDD 2HO4A 4NCIA 2OGSA 1NPYA 2QZPA 3DNPA 2OT3B 4OQXA 3DE9A 3FMVA 2QMQA 1JHMA 3JQGA 4A91A 5ALUA 3DDWA 4EHHA 1I1NA 4ONSA 2GHRA 2WD9A 1EFUA 3PNPA 5HJ2A 3QEOA 2AHRA 4PAMA 1J20A 2XNDA 2X4IA 4D43A 1ZGCA 4J4BA 1QRUA 4LZPA 5E8RA 4U7JA 4WZBA 2E3JA 3CW2A 2IY7A 3IAXA 3LESA 4IBOA 4XFKA 3SXKA 3I37X 3LPAA 2EJVA 1N2XA 4O4HB 3QPDA 1NXPA 3ITFA 2AFHE 5REQB 1BX1A 3EASA 3WGIA 3ONDA 3V7UA 2P1AA 3S2YA 5HSWA 3KQKA 3I64A 1I1OA 1ONBA 4AL1A 2V6MA 3R3YA 2AVDA 4WNAA 1LWNA 4EG8A 3RC2A 4CI0B 4Z51A 4ZJPA 2UZAA 3ROEA 1M8JA 2W43A 4G0OA 4NS1A 2VYNA 5DULA 2HDOA 3GJ6A 4LDAA 1ML3A 4ZT3A 2CEAA 1SIOA 3IEIA 4OXXA 2FWMX 2PSFA 1ATIA 4BE7B 1WCWA 4PNEA 2IOFK 1BMTA 1JZQA 3H5AA 3RH3A 5F28E 1IL0A 1UDWA 1XEWY 1IHUA 5FYQA 4TMXA 1TCVA 3TLCA 1JOGA 1QRDA 1FFAA 3HJHA 4ARCA 1E1RA 4WN3A 4WERA 2Q2WA 2VJLA 4XPZA 2H1VA 5M3BA 3JR3A 1F6DA 4ZU1X 1CJUC 3BIXA 4HDOB 1UP6A 2HLDA 3ZHUA 4V0RA 4RK0A 2QN3A 1BE6A 5E6SB 4QDLA 4CT5A 1TVKB 2MHCA 3DUFA 4O5OA 3PUYA 4DRHB 2GHQA 1UJ2A 3RT9A 4PO1A 5C0OE 1IK4A 1H0RA 1UDBA 2PZMA 3ZV3A 4FFSA 5G0VA 1G0NA 1LIHA 3PFWO 3FWYA 3IVRA 5HWSA 1N9GB 1AUVA 1DRJA 4RGQA 3GEPA 1B76A 4B35A 1SCIA 3FCCA 1FS4A 1T9ZA 2X3UA 5JAMA 3GG9A 2XGOA 3Q4GA 3G4XA 2Q5FA 1U1EA 4G1UC 1VE3A 3RW9A 3WB9A 1FFHA 4FPXA 4O2RA 5KQSA 5C1BA 4C4OA 4ZAYA 3AVVA 2TMDA 1RYNA 4WZAA 3M79A 4YJGA 3NNSA 4EKEA 4L4UA 1T8RA 3LF1A 3DAGA 3GRUA 4KLAA 1CY2A 4D02A 4TLDA 4EL5A 1BXKA 4OTZA 3QITA 5K6TA 3ANLA 4C1NA 1LPAB 3RRYA 5C34B 1ZW2A 4ZCQA 2VQFB 4I4TF 5CIWA 3M1CB 5E38A 3X1YA 4ETMA 1RAGA 3WMWA 1V5FA 1GXSA 4EB8A 1QTRA 3SFVA 3DBHA 5BVHA 3PC2A 2V03A 5FO1A 4XYBA 4KQ1A 2A67A 2GM5A 3CKYA 2N47A 1A4UA 4ZCRA 4JUFA 2H92A 3PBKA 3EEOA 3ABQB 2H1SA 2QG4A 4YP5A 4ITRC 4IHQA 3RBAA 3SC3A 1DL5A 5BUCA 3UJDA 3EXFB 2O8FA 1RPNA 1ZDMA 4IL5A 3SQOA 5LR6A 4RD3A 1Z56C 2VP4A 3PR3A 3ZCPA 4P83A 1XK7A 4I55F 4JWKA 1OKKD 4OM7A 4EI7A 4EQ6B 1E2DA 5FBVB 3ZUGA 4BQSA 3EAQA 3WIOA 3ZQVA 3A70A 5K3AA 4XB6B 2XZDA 3C63A 4CF7A 4G4SP 3R9WA 3D3JA 4QASA 1T91A 1SVKA 5EOVA 1GZHB 1K97A 4R4JA 3W4KA 4OXKA 2CV2A 4PG8A 4G5RA 2LZ0A 3IFSA 3RAGA 4E21A 1KEPA 1JMWA 4BNLA 2JL1A 1GFIA 4AQYB 2TECE 3P71T 4YO8A 3U56A 1GV1A 2YXNA 4MQ6A 1JUDA 3EPPA 3RNLA 1Z4LA 4JBGA 1JJAA 1NURA 1M5UA 2ZPAA 3A4MA 1BEZA 4UM7A 5A0VA 1JDTA 3RF7A 3HJCA 3TPZA 4TL8A 3A1FA 2W2XA 3TBHA 4KQ6A 2HPAA 1HRKA 3GZ4A 3R1IA 1YNOA 1YBFA 4NEQA 2A4KA 2G0NA 4C3BA 4O3FA 2R6GA 3DE8A 2OLKA 4CS9C 3JQ7A 4EYOA 2JFBA 2EWVA 4G4IA 4N3AA 3K9WA 4IGEA 4B43A 4N7JA 4N5HX 1FRNA 3TMKA 3RW0A 1GILA 5CW1A 3NONA 3QUCA 2V4ZA 3K8QA 2YN0A 2YWEA 1XTIA 1BWSA 3ICEA 3QUTA 2WIAA 1GPH1 3OBBA 4H17A 1VLTA 4MNTA 3VX4A 2COUA 3V6MA 4JX8A 1S6YA 4BP9A 3L8ZA 4AN4A 1KAMA 1PDOA 1XZ8A 2JD2A 4Z4QA 2ZREA 5C5IA 4RL6A 4Q18A 2RI1A 3EA5A 2QTBA 4D41A 1TKRA 4H9GA 3G0OA 3VPGA 2RJ3A 1Z82A 4FOSA 1OKKA 5KSOA 1Z0UA 1N8TA 3IT1A 1WM1A 1EX9A 2Z5GA 5DO9A 2XMGA 4DCCA 5EWLB 1NVVQ 5F76A 2OD2A 1QSPA 3JR7A 1I3OA 3FXAA 3VV2A 4KK4A 4XPIA 5LL6P 3ASZA 3EISA 4COOA 1LA2A 1T5DX 4TVOA 3W5HA 1G9SA 3TQQA 2J41A 1V1JA 3AM4A 4BPRA 2PGOA 3M6VA 2FK7A 2Y4NA 2CZCA 3K70D 5EJGA 3SZMA 1XVLA 3U49A 5JJKA 4K40A 3S68A 1Z23A 5IVDA 4QGAA 2G9QA 5KI6A 1XVUA 1E2IA 1Z62A 3IA7A 3K1AA 1E3MA 3GXOA 1KI6A 2G1JA 2WKQA 2E2WA 4KVGA 3U9JA 1TQGA 1PK9A 4BUCA 3P2MA 4EVRA 3PQ7A 1IHXA 1GKYA 2J0UA 1TEZA 2VDMB 2IYLD 1WVMA 3QVGB 1V5EA 4BC1A 1FC0A 2X8LA 2CE7A 3ZLBA 1VHQA 4QYIA 4MJXA 1XEXA 1V3UA 3FAKA 1QNFA 4GE3A 3TRDA 3C5WP 2ATCA 2VZ0A 3LZCA 4OMDA 4LRXA 3S5UA 4FYHA 3CEPB 4TRNA 2F1RA 4HH4A 4YCMA 4ABYA 2C9YA 3AOGA 3ZD8A 4AE4A 1R0WA 3AEUB 3THRA 1A3CA 4EI9A 4RTLA 5EAIA 4E6EA 4GRAA 1KVTA 5ETJA 5JS7A 3F71A 3O3CA 3GBVA 1J7JA 2Z57A 4IGKA 3TTYA 3ZNQA 3B52X 4LWQA 3ASOC 4DVJA 5IUKC 1GL9B 2R5NA 3DOHA 4RPGA 4NZMA 4RTPA 1ULZA 3QOXA 1N3YA 1XLWA 3C48A 1SKMA 3D2AA 4ZLCA 1D07A 4HYQA 3LO5A 3GMTA 1MORA 2AQHA 3MGGA 5FWXA 3E9CA 4KMOA 1FNMA 3FROA 3QEBZ 1V8PA 4MUGA 1KZHA 1DDIA 1KEEB 3V1YA 1ACMA 2PJDA 5B64A 1B73A 4GMDA 4J9UE 2P90A 1RJEA 3CH4B 4NOMA 4LVUA 2H1OA 2NYAA 5T4FA 1G5HA 1NM5C 1P45A 4CLRA 3L7LA 3OEOA 721PA 3S0XA 1K7SN 1Z6QA 3BJIC 1T4BA 1NT2A 3ZHOA 2ESRA 1UEJA 2G5TA 2YJ4A 3H1AA 3S0JA 2Z2XA 1WHSA 3I4UA 5HM6A 1NE7A 2JNWA 3A6ZA 2J0VA 2AOUB 1CY7A 1HY3A 5J2TA 4B1FA 2RJNA 3G2PA 4MS1A 3D0KA 4RJKA 2NW6A 3PZBA 3RRZA 1ONSA 3TNYA 2IUEA 2UVPB 3ML1A 4AYXA 2IJGX 3CCCA 3Q88A 3T0FA 4QICA 2DB4A 4OATA 2BFBB 4CM9D 5HBRA 3IAM6 3LC1O 4JODA 1SK8A 3T9BA 4HDKA 1MX3A 3UJHA 2P9FA 2O8BB 1CRLA 1AX9A 3NWBA 3KXDA 4EP1A 2V5UA 3RJ9A 3KEOA 1ZY2A 2XTMA 1O5IA 3P2JA 1SA0A 2LKCA 1T0HB 3W2WA 3FD8A 2YS6A 1QF6A 4X24A 2MSCB 3UMGA 5BMVB 3VR4H 1DTEA 1IQRA 1F8XA 4Y1RB 3QY9A 3JYYA 3ZWIA 5AVRA 1UZMA 4DOMA 3HU2A 4XVHA 2IWHA 3C24A 4FT2A 1X7WB 4YRLA 1VE7A 1AQ6A 5A3RA 1LK7A 1HNWB 3V7OA 4C08A 1AZTA 4HHEA 2CCYA 1R8QA 4M0PA 1C1YA 2R1ZA 4HWKA 4WIAA 3KAQA 1S7GA 3DMNA 4LMPA 1VPLA 1VKJA 1XNGA 2YN4A 3PHJA 3LSTA 4OHYA 1WQ1R 3OAAD 3JRTA 4RF3A 3GJ7A 1S8NA 3L92A 4AMGA 2X0CA 4YRDA 2JLVA 3B36A 3VDXA 4KLRA 1SCJA 4FFBB 5DTMA 1AXEA 1RPJA 1I1QB 2NYUA 3FDIA 1YDWA 3TW6A 4E07A 2ZWPA 1I1HA 1ISGA 3ZY6A 3CMCO 1ZVJA 1XA4A 3BCHA 1IDOA 2DXIA 3DW1X 3K73O 1H5UA 3AV3A 2ZCVA 4COKA 4CXMA 3TBKA 1T1GA 4CM9A 2QVXX 4D42A 1EWVA 2O2IA 2G1AA 4MWGA 5FWDA 4L0CA 5SYMA 5DLYA 2BMWA 1NMXA 3OY2A 3AEQA 3HJAA 1ZJ5A 3GIDA 3QSGA 1QKIA 1TF7A 3AERA 4QATA 2W6OA 1QDUA 4XYGA 4M76B 3OZ7A 2P9HA 5K0FA 1W85B 1EFDN 3MILA 4I3HA 2ATXA 1U8FO 3FI0A 1EJ6A 4AYWA 5K09A 2ZIUB 1UBGA 4BWGA 3PPYA 1DIBA 5ARCA 2SKCA 3Q40A 2FSGA 2FSFA 1RABA 4PZYA 3PC8C 1ESNA 3TCXB 2CLEB 2VJMA 2EIHA 4TYNA 1EUCA 3GLGA 3ZWAA 2R6ZA 5BYJA 1R0ZA 3S2IA 3LLCA 2ISQA 4BNXA 1D03A 1ADFA 5FI5A 5FR1A 4HXFB 3RKSA 3P0HA 1C30A 3KVYA 4B3GA 3AL2A 3M6IA 1V55C 3OAAA 4OB6A 3RSZA 1YL5A 1DVRA 4TRJA 1N5RA 1B42A 1TVMA 2LP4A 3FPHA 4JT8A 2ZJ4A 4IWYA 1XU7A 4JVLA 2VXCA 2IXMA 4OB8A 4DNXA 1MQSA 2R7AA 2H8GA 1BCRA 1TTQB 1E5VA 5T57A 1N5OX 3B60A 2HA3A 3GLKA 1TT5B 4YJ3F 4CMCA 3I3SR 4C7BA 1EDOA 3NC4A 1RKEA 4DG5A 1O9GA 1YONA 1NW9B 5DP2A 2XT9A 4N3NA 2Z6UA 4PPYA 1VLQA 2X1HA 4M1ZA 1TJ5A 2JGAA 1Y5LA 5LIRA 5IDYA 3SNHA 2C9MA 1JI3A 3HO6A 2JFHA 4JL5A 2CDQA 4LZAA 5L3ZA 1PFYA 4IJWA 4YQFA 3DZGA 4AK9A 4C5BA 5FFFA 5ADHA 4A4DA 4KQ2A 3C3YA 2NZVG 1V45E 2UXDB 4R8LA 5K0NA 2CT8A 3E9ZA 4A1OA 2DECA 1GTL1 3CH5A 2EU8A 2HGSA 3PD1A 4B71A 4EYGA 3ANYB 2NVWA 4RKYA 3CZPA 2VASA 1XWIA 1MXFA 5IY5C 1UPAA 3ZCQA 1PJAA 2PDAA 4WK2B 1EZ4A 1JHPA 1Y4ZA 2FPIA 2QMHA 2JKYA 1MPTA 4JI8B 2OBYA 3ON5A 5M34A 4Q5SF 1P7WA 1B6RA 3JVUA 1FR0A 3GT3A 3Q7PA 5LOVA 3M4YA 2GB4A 4YX9A 1UBMS 4ID3A 5DBEX 5JCXA 5FKJA 4OU4A 1UWCA 1NJ8A 3GEHA 4QXPA 4KKVA 3ZGXA 4XR9A 2IXBA 2H5IA 4C07A 3Q0EA 3ADOA 5BWBA 3GYBA 4B79A 1XZAA 4QAQA 4FQ7A 1K06A 4NTBA 3MJDA 1SCQA 3M1YA 1QHEA 5FNVA 5F78A 1ZLXA 2EXXA 3AEKA 3AR4A 1X77A 3CVUA 2VJOA 4K9NA 3WK8A 1KBQA 4DM3A 4JJZA 1MTZA 4K87A 1C0LA 4Z4EA 4TTTS 2YL0A 1G6KA 4P6IC 2AYZA 3NYLA 4GLLA 1GVNB 2WRZA 1Y5IA 2Z2JA 3OTOB 3GHYA 1RYHA 4R1MA 1W2GA 5J47A 3TL3A 2X0IA 4YP1A 1ZYUA 3UW1A 2YYSA 4CBEA 4L4YA 1ULHA 3O91A 1XAIA 3LDFA 3IQ6A 4EGSA 3ANMA 3R9IA 2HPHA 1S9DA 4Q4AA 3FWNA 3AJAA 5E0KB 3N6XA 1K2WA 1E2XA 1U2RA 1UQUA 1CY1A 1KI3A 4EIYA 3GLIB 3ZQ4A 1XQ9A 5A4IS 1FNSA 1W5TA 3VPXA 1WOYA 4US1R 4BJ5A 2J6HA 2A0BA 1B68A 3INNA 3Q9SA 4LNHA 5HS6A 2Y66A 4F3RA 1LPNA 1YB2A 5IVKA 4N6CA 2WJ4A 5AVWA 3TQTA 4HTAA 5AM0A 4DLUA 3HCEA 4DMFA 4GO1A 4EBBA 3U3XA 2BF4A 4BNYA 2FWIA 5DKFA 1YULA 3V1MA 2MMGA 1NUAA 2R6CA 2EKBA 4LHZA 4FFWA 3I8XA 4NHEA 2SNIE 1M2VB 2OEXA 2PH5A 4WPGA 3W79A 1FX0A 3HV2A 3I9MA 1GZ3A 3QV1A 4R7ZA 3H5IA 5KYGA 3GGSA 3R8CA 4PBRA 1XAJA 4JOQA 4IIFA 3PJGA 2K6GA 3HBLA 4RE6A 3UENA 2DQYA 4P1ZA 5K0EA 1SH7A 3RBZA 1VSQA 4MRMB 2W6JD 1G59A 4QJ4A 4BDTA 4GWLA 1ZC3A 2O20A 1U9YA 4TROA 4IIJB 4V2UA 2X86A 1W59A 1I6KA 3NNDA 4J0HA 1P1IA 2FMHA 2QTHA 4KO1S 3MWFA 4O2BB 3Q5DA 4D3SA 1GPKA 4G78A 1GADO 4B6GA 1P7YA 1VPWA 2XTJA 1ITZA 3SEAA 1SUIA 2ZETA 2YL7A 2DM6A 2C3PA 3KTDA 5IULC 3A1WA 2CXHA 4ZCTA 2FX2A 2O48X 3BJRA 3L43A 4N5LA 3L1MA 1B23P 2ZS8A 2HMTA 1NMSA 2YWRA 3C3AA 5B57C 4EH1A 1NATA 1GGEA 1VXOA 2A1UB 2F8MA 1USIA 4PHTA 3TX6A 3OPYA 4ZOLA 3A2NA 4CQLA 3MFYA 4V24A 2GF2A 1FLNA 4KI0A 5EXTA 2QZ4A 3WWCA 4FJ0A 4P9FA 2VS1A 1M54A 4DNFA 3RYHA 5GV8A 3U9LA 1T0BA 4IDBA 4Z9BA 2XIJA 4NFYA 3U7FB 3EC7A 1NRJB 1YJQA 2A84A 2WYOA 2X3FA 4V0NA 1DRVA 3L0PA 1B0UA 4TWRA 4II3A 2Z9BA 2BDEA 2E4ZA 4DF3A 4AKGA 1H2XA 4KSBA 1E9BA 4XDHA 1SXIA 3LJKA 4NP6A 4IJJA 4FXOA 2IZ5A 1B93A 1X39A 1K4YA 4UQLA 2F6RA 1JDZA 3FOWA 2QLLA 5K3CA 3QMWA 4DHWA 2WIFA 4FE3A 3GBPA 1W5FA 3K66A 1EG7A 4BAGA 1ST3A 1SULA 1JRAA 5D1NA 5IANA 5I9IA 1AEPA 2VUIB 2ZYIA 3KBOA 3DFUA 3Q8WA 3IAFA 4K9MA 3E7XA 1GA6A 2LWIA 3VYTB 4AJ9A 3V8VA 1J21A 2QN8A 2W6JA 3VHQA 3U3MA 3CPHA 5L45A 2EQAA 5JZSA 3HNOA 3K0AB 3ADKA 3EAGA 1HF3A 3RVPA 4FB4A 4MAMA 3C4VA 4AL0A 4RPJA 2PYIA 3SKXA 1A5ZA 5F51A 5LZ7A 3DMFA 5EQJB 4ZYUA 1RRCA 5CTJA 1I4DD 2RKWA 1VKHA 5EZ5A 3HLYA 4M53A 4XWOA 4UBJA 1QFZA 3U3DA 1H0KA 2MYTA 1Q20A 3PCXA 1P5RA 3KYBA 3RTCA 5L0DA 1PD0A 1M6NA 3GFOA 1LDMA 2CBZA 2C83A 1DI0A 1IY0A 3ORSA 2FOLA 4KZPA 3JYQA 3WK9A 1E5LA 3ZDDA 4RZQA 4QOIA 3DL7A 1DOZA 4D99A 2FSPA 1RWVA 5JEEA 2PGAA 5KNBH 5ALPA 4OD5A 3THWA 3CLSD 4X8MA 1J8YF 1WXIA 2VJDA 4F5ZA 4CF4A 1IY2A 3SJ7A 5AVSA 4BX0A 2YZGA 3AKCA 4NDZA 3G79A 4JFAA 4ZO8A 4PX2A 5E3IA 3FNRA 3OPYI 3GEEA 2GO7A 3U80A 1E89A 1ZHFA 1XZMA 2VOJA 4UTZA 2GT1A 3KQNA 2YJ3A 2XXJA 3VR5D 1IJFA 1E60A 2NU9B 1KH2A 3BCUA 3A3NA 1U2GA 3BJMA 3GVPA 1PFQA 4NL4H 2JFWA 4D4NA 1ZX1A 5G4KB 4I8IA 1NBWB 4I55B 1UM9B 1BYUA 2O3SA 2F1JA 4YP6A 4DLVA 4XWYA 4DY4A 2Y67A 3LYHA 2NO1A 5J2UB 3V4PB 3MX3A 4HZIA 1T34A 2PYZA 1G4HA 4X65B 2E85A 4Z86A 5G1NA 4X94A 4MV4A 3BB3A 4RSGA 2VT3A 3OFSA 5KWEA 4MPTA 4X00A 1R88A 2BFWA 4PK4A 4NECA 3T94A 4LEIA 1VMIA 2C92A 4LRTB 1VBNA 3U4QB 4C0KA 1YQEA 3SQWA 2DBZA 4LHYA 1YBVA 3DB2A 4EKDA 3I28A 1HYGA 3DXZA 1ST2A 1PYOA 5EIBD 4BVFA 5BUZA 1CB7A 4B7AA 4EG1A 4UE6A 1JFSA 4EBFA 3TZBA 1MA3A 1C81A 4JITA 1GKUB 5JXHA 5G3ZA 5F9MA 4RHUA 1JAXA 2WA1A 3TJ5A 2C5EA 4B45A 1E59A 1X7ZB 3PQ5A 4ITUA 4MGIR 4J30B 2M98A 3TOXA 1IPEA 4WHMA 4KTTE 1L5WA 3DTVB 3FMIA 2ZRGA 2PUDA 4CL2A 4HD8A 3CR7A 4UMDA 5ARDA 4DZZA 1O7JA 1T0JB 2IGBA 1I7QB 1Q0FA 4QPPA 2A3RA 5KJ1A 4J6FA 2FX5A 3NYQA 2GYVA 1O0CA 2C9DA 1AF4A 2O2HA 4CL3A 3E22B 3VR5A 2C4MA 5BMVF 4X20B 2AFIB 2B2NA 1HOXA 4LC1A 3M1AA 1JMKC 5LCXA 4OQQA 2C9CA 2QD2A 4CDGA 1EQ2A 3T38A 1ZK1A 1UKVY 3S27A 2RGRA 3HZRA 3IP3A 5AVQA 1US8A 1IY9A 1SU8A 4HDRB 1JEQA 1A5AB 2QMZA 4Q1DA 4WCDA 3PLRA 4LXUA 2GA9A 5JQGA 2BFDA 2XDWA 1M10A 1A8PA 4AMZA 5C2JB 2JAUA 3ADCA 3R9KA 2KLBA 3PQ8A 2OPHA 3DLCA 4RJ2A 1OW6A 4B09A 3MCUA 1U98A 4J3JA 4YLEA 3KBBA 3RU7A 3STTA 1KK2A 2IXTA 1H1TA 3TOLA 3EOAI 3H18A 2ZSFA 3KEQA 3SFTA 3WMGA 1YVRA 3DDNA 5C7YA 2J3JA 2CJWA 1NOKA 5BWNA 4J4TA 4B7ZA 2WVQA 4N5NA 3H0CA 4J76A 2C3YA 3BL8A 4JXZA 4K3VA 3ZWBA 5TC4A 2HYDA 3CVJA 4LK3A 1QCYA 4L7QA 3OJ0A 4NTZA 3FGZA 3GGDA 3DA8A 2CLSA 1HDYA 5LZ4A 1S89A 2AOWA 1DS6A 4I5FA 3KVOA 1KMIY 3NHRA 4RZ3A 5CCBA 2CXTA 3RV4A 4G85A 3WGOA 4AZ3A 3X0DA 3BIOA 1KSGA 3WQRA 1EJBA 1RT9A 4PLFA 4GP6A 3IELA 4P58A 2E87A 2GMWA 2IYYA 3JPWA 3NYMA 3IVXA 3GN1A 1KGSA 2JZCA 3KH2A 3MTBA 1YUBA 1YZQA 3NBXX 3B20A 2VXBA 3IP8A 1FNDA 3BEOA 4DQXA 4DSUA 4DCNA 2LCFA 5AK5A 3O3MB 5EHZA 3GHHA 2CUNA 3L1VA 5BR7A 3ZV5A 4OHXA 2JI9A 1OIVA 3DDSA 4EITA 1JHOA 5ERXA 3GYGA 5DHTA 3KQVA 3WNDA 1Q1BA 5FCDA 1MN6A 4URHA 1XZDA 1TAUA 2I9PA 2I6QA 1EP9A 4OKNA 4ZIRA 3UK7A 1GQ2A 3KK0A 4GZ6A 2IPMA 2J85A 2MINB 3K7DA 1X42A 2O2CA 5DNAA 3EIQA 4NXNB 4M89A 4XARA 2Q00A 4RVFA 5DI3B 4BFZA 2Z8ZA 4Y1GA 1DBQA 3FNGA 4ZHQB 1NDQA 3RE1A 4I36A 3O0DA 1GRNA 2D59A 5AKIA 1WUJS 2DY0A 4WESA 5TARA 2VTEA 4KWEA 1GNTA 4RL4A 4GI3A 3O55A 1NJFA 5IKXA 4XD2A 4EUKB 2R7UA 1VC2A 1KFCB 2H2HA 2FVYA 2HRCA 2W4IA 1TOAA 3M4JA 4RESA 1D7OA 5BR4A 4ADSG 1NFFA 1VOMA 1Z5ZA 3R5HA 2GPAA 1NF8A 4RAQA 1DC5A 2D1TA 3M3HA 1SQ6A 4E5KA 2UKDA 3O4RA 4LZLA 2OFOA 4DQDA 4NTAA 5KTNA 4CNQA 5A1JA 5JUAA 1C7JA 2N46A 4WJ0A 3KTAA 3O93A 1IOWA 2NXEA 1QGAA 2WDPA 4PFKA 1QIFA 1J00A 2X8JB 5BNFA 3WB2A 4FNAA 4DWVA 4URXR 1U3CA 4QFBA 2CYBA 2DX7A 4HG2A 1L7CA 4E31A 3O83A 3I45A 5LZ5A 4Q66C 1H22A 1IY8A 2Y1XA 4PG5A 1T5HX 2HNBA 1JXOA 1MO4A 4LNUB 2JVJA 3K9LA 2V65A 1LSUA 2P27A 4I1IA 4HB3A 3M9LA 1X9GA 3TIFA 3DC7A 2R6R1 5K3FB 3DGEC 5AKGA 3K6BA 4URYR 4Z0TA 1TO2E 5F5LA 1D6JA 3DFZA 3G9UA 4OU5A 4RJLA 5AM1A 4IUCS 1YZCA 4H1HA 1WMAA 3M4NA 1EGMB 1JQKA 3NUGA 1ZK0A 3QX7A 2N1BA 2X51A 2KJQA 2WJ3A 5GONB 2IIVA 3WBFA 4U5DE 3U1VA 2UYGA 5F77A 5KOIA 1NHGA 3M83A 5I7EA 3T1HB 3DWEX 2YOGA 1JA9A 1H6AA 3UUWA 4U5BE 4G0WA 3PVCA 5KVQA 2OC4A 1YMUA 4BLPA 2XB9A 1OWPA 1Z74A 1R4ZA 2QRKA 4YLYA 3NV7A 1SOMA 2ZM6B 1D09A 2WD8A 2O2GA 4Z49A 4UZSA 4PZUA 1U9JA 2H06A 3NVDA 3GFVA 4FFNA 3TEMA 3BMQB 4M9SA 4U7WA 4ND6A 4MS4A 4UMEA 1MOPA 4U4AA 1W29A 1BDBA 3SNKA 3KDSE 1G3MA 4A1FA 1J23A 1YDMA 3MMPA 3A6KA 1GA4A 4YCAA 1DBSA 2NZUG 2QGNA 3TE7A 1ZGJA 2ACKA 3K9GA 4ZRMA 4W5JA 3X1MA 4I3MA 2XYGA 4U5GA 3AEZA 4EGQA 3WV5A 3FG9A 3LT2A 5DB4A 1J42A 4M1MA 3HCAA 1T01A 1J2RA 4YL3A 3A11A 4PJNA 4LKRA 2GK7A 2HK6A 1Y1LA 1BBHA 3F7MA 4ZZ0A 1U7PA 1TQ2A 2XM4A 3GPIA 4PINA 3GF4A 1SBIA 2FK8A 4ZYWA 3UKOA 4JYAB 1A2OA 1PSDA 5HUJA 2PD4A 3BSWA 6Q21A 2P4UA 3K1HA 4WZ6A 4A36A 2FQQA 4Q1EA 2C5BA 4KN8A 5CH3A 4EIWA 4ZCMA 4IDNA 3K6KA 3KQWA 3DL4A 4C4TA 2P1ZA 2GUGA 2DFNA 1FMCA 3AI1A 3EPJA 2I29A 1L8QA 4KJXA 2E4VA 4YJ3B 3X2QC 4OHPA 5G1PA 3TZHA 5LXTA 4KXWA 1KP9A 1JHDA 4IIJF 4X1KB 4BNKA 1M1NB 3I83A 3LYAA 4OQYA 4OFBA 2VF4X 2QNBA 1XELA 4D92A 1RP7A 4O2BF 1MC1A 1S4MA 4LHVA 1LV7A 3L9WA 3TLKA 4DA0A 4C4ZA 2ODPA 3FCUB 1VHDA 4EHBA 4F5WA 3X1OA 1D6MA 1MG0A 4MWEA 3NGLA 1EA8A 4AZSA 3AGTA 2ZRDA 1IEVA 5HCIA 4CMJA 1K3UB 1MDFA 2X0DA 3T5CA 1KWGA 1OT5A 4WKCA 5KMGB 1JB9A 1F20A 4X91A 4OB7A 2DH5A 4EG0A 2Z2KA 1MX9A 4IXNA 4HN2A 4JLPA 3STXA 4C3VA 1QYVA 2FW9A 1ZD5A 4ZCIA 3D7MA 3NANA 5FQNA 1O96A 1B15A 1OOEA 4FFPA 4NENB 5LUBA 3H1BA 4Q4JA 3LQQA 4BC0A 1BS9A 3NDJA 4J0CA 4CG2A 5IAKA 1M1YE 4TPKA 3N2NA 4E5NA 4G1FA 3QXXA 5FI3A 2YWHA 1QHHB 4NJMB 4IH1A 2B20A 3M15A 5AHRA 5AHKA 2QTMA 2DWQA 1HMOA 3MNFA 1NR1A 3GRRA 2W71A 3F6EX 1Y7LA 1NKTA 2V6FA 3K6RA 4M55A 3FDQA 2YRFA 3HO1A 4ZC8A 4QD3A 3KZ1E 3D6NB 4YAJA 1A0OA 3WBKA 2Z3VA 5TF0A 3BICA 3UNXA 3G3EA 4F71A 2AMYA 4XXHA 4E12A 3PEEA 3U3FA 3HCFA 4XPYA 2BDTA 3LP6A 1F6BA 5JAQA 5EQFA 4L76A 3W06A 4IYJA 5LLTA 1P1KA 5EERA 1HQKA 1OX4B 4XTCS 1JAIA 5HDBB 3CZRA 3LPLA 5EIAA 4NVRA 4BO6A 3AF6A 5JPIA 4EY6A 1V37A 4ZVUA 2QUKA 2VJPA 1A97A 5ER6A 1UK6A 1U8ZA 1RZ3A 1RCFA 4RVCA 4EAQA 2QORA 2J0SA 1CPRA 1XD2B 1LSOA 3AG5A 5DTIA 2PKYX 3SYLA 3L6CA 1K04A 4DM4A 3D4IA 3V1TC 4MVOA 2FEXA 2AOTB 3NIDB 1GFWA 3D3QA 1EI7A 2ZQ5A 4K5QA 1I2AA 2WTMA 1Q50A 2JLSA 1PT5A 4HH3C 5AW3A 3LC2O 4OLBA 1C7EA 2HSJA 3HJTA 4C0LA 4DA7A 3BSFA 4PCAA 1MHTA 5EUBA 3T5DA 1ZVKA 1COZA 3ETEA 4NBRA 1EVYA 3W78A 1GPUA 2PL9A 4KQXA 1G6OA 1P1JA 4OPMA 1LX7A 3DW3X 3VDMA 3ZBQA 5EYPB 1YC5A 5SZJA 2IYXA 1WXWA 2HEIA 2H51A 1JIIA 3C7KA 4HDNB 3HVRA 5SZIA 1BHO1 1RJFA 5M2QA 1W6UA 1J0EA 4IR7A 1C3VA 1M2HA 1ZONA 4LLEA 2V6IA 2PFKA 4MWDA 4QEDA 3FNBA 4JLMA 2NU8B 3QKRB 3K2EA 4QOFA 4H60A 1RC8A 1R16A 1XTTA 2AG5A 2R68A 5CM8B 1PJQA 1WXDA 1TQ8A 1NVDA 1LPPA 4KO3S 1W36B 4O4LA 5J2UF 4LJYA 2YIVX 1CY4A 2AN5A 3QW0A 5D7NA 2O4UX 2B61A 4EO9A 1FFBA 1PT9A 1AQJA 2C9OA 4ESOA 1BFKA 4TZ0A 1KDYA 1KFBB 1CZUA 3UC9A 1BR1A 2Y0EA 3WL8A 4UFNA 3CLUC 3DZIA 4M7OA 4JIMA 1X9HA 2H4YA 2OVFA 3JQDA 1E0JA 4W6ZA 5BSFA 1PLLA 4KREA 1RDFA 3MUEA 2LP4Y 4UTXA 3LPCA 1KQPA 4TL7A 1U7UA 1V0JA 1KNQA 4GYJA 4XYLA 3UHFA 2DTEA 3OETA 4NYJQ 5LMUB 5ILQA 3UV7A 3IKVA 3K9BA 1UKAA 4DV2B 4DJAA 2GN6A 1PU2A 3T4UA 4CKWA 2GM4A 2AR7A 2G6BA 4CV0A 1JZSA 3TRFA 1ZHHA 2YR0A 2V55B 3M8KA 2P4QA 2E5LB 1DEKA 1UXIA 2BP7A 5TNXA 3VKHA 3QU9A 2YKZA 4X1OA 2EW2A 3H2SA 2M32A 2IM8A 1CY0A 2HL6A 1UQRA 3QTBA 2YKGA 4LF7B 3C39A 5CLQA 3MRXA 3RAPR 1U8XX 3D0RA 3DV9A 3HL4A 1FA9A 5G53C 3ZS9A 2A0FA 4HAZA 3SBEA 3E9VA 1SEPA 4OP1A 2PLRA 2GM9A 4Q3KA 3RREA 2FN3A 1RXEA 2HCBA 1W49A 3GLQA 5KYXA 1XCPA 4I1UA 3DZHA 4Q4HA 3QVUA 3LGSA 5HJ5A 2DPHA 4X54A 3E9YA 2XL8A 4RD4A 2BM8A 3NHMA 5L3SB 3PDUA 1OC2A 1O57A 3LUCA 4M0FA 3U40A 3IGFA 1PZGA 1QUEA 2AXEA 4KI2A 3B0PA 1ZOOA 5J5CA 1DUVG 2QZ9A 2VJNA 5B1SA 1NF9A 4WLOA 4ZYVA 4BGUA 2BZGA 2X8AA 4MW3A 3VJLA 1U2EA 3KQYA 4D1YA 3T5AA 1DBVO 4GQIA 3K0CC 2FW6A 3SBOA 3UGOA 2XTNA 1YDGA 3UMBA 1UWLA 2JKZA 5CH8A 5AW7A 2PMKA 1UT8A 4GMXA 2B8JA 2VI5A 3TAXA 1QHFA 1TQDA 1DZIA 2R44A 4S3MA 2JC3A 2ZULA 4TQUS 3IRVA 3KPWA 3F9IA 1Z2EA 3K0SA 3L01A 4RU1A 5FJJA 2WLTA 2GPTA 3TRKA 2W90A 8ADHA 5LQAA 3NORA 5I3CA 1AZSC 3D8NA 1WP4A 4GLJA 3PGLA 2RONA 1OW7A 3WI7A 3A9VA 3HY3A 4CGZA 4MS3A 4YDSA 1K98A 2XPCA 2WL8A 3H4MA 4LI0A 1ZD8A 1SCAA 1WXEA 1LWOA 4I3FA 3LKVA 2I8LA 3K32A 3GFBA 2ZSKA 2VPIA 3D7NA 2PKRA 4G5GA 1J2EA 2UXBB 2CHEA 2HMUA 3SU8A 4BX8A 2IH2A 1R66A 4JFRA 4FK8A 1NM5A 1M83A 1O6CA 1E1YA 1NBIA 3BRCA 1J33A 3GZJA 2Q50A 3CF2A 3QX9A 4E0HA 2HSGA 4DIEA 4EA9A 3PFCA 4O1MA 3JD4A 4PFPA 4GMFA 4LJ8A 3AM5A 4GOOD 3IMCA 1SVSA 3QX3A 4GWGA 4JU8A 1DFHA 4N5MA 3M82A 4RZXA 1F5SA 4B9AA 4ZHQF 5JG7A 3D6VA 3PJEA 1E98A 3N2KB 1C14A 3UH0A 1YZAA 4DMGA 1I7PA 2H5LA 3I2HA 4OOEA 2F3SA 3HVIA 1JB1A 2XUGA 5JSFA 4OYRA 1PK7A 4W8OA 2WFLA 5DS4A 1FFXB 2VN8A 5AXCA 3H1FA 5IT5A 1H85A 2QTNA 4WKNA 3OKFA 2OSBA 3NIWA 2VVTA 3CH7A 1JE0A 2ZSUA 2A6HF 4KQ9A 1BDIA 3IHKA 3Q15C 3JWHA 1RZVA 1T9GS 3PNBA 5JLAA 3BDIA 2ZEJA 5ALJA 2DSNA 1XMOB 1JR4A 1Z45A 3TLXA 3V48A 1Q1ZA 4WNIA 1G55A 3AR6A 1EK1A 1RXYA 4I1SA 3AYZB 1ISIA 1JQLB 4KIGA 2OM6A 3C8UA 1VFNA 4ENQA 5L4LA 4UOZA 3CZ9A 2W8BA 4IOKA 4MYTA 5EWMA 4JOBA 1BDJB 1UQTA 5DHPA 4U9HS 4PAQA 3O8RA 4RWZA 5CB6A 3BM5A 1L5OA 1F4LA 4WQMA 4Q9KA 4WX2B 4W1QA 3A2KA 2BRUC 3D4PA 1BZYA 3IVCA 4AJ4A 5FA5A 4GUDA 4B4VA 2TMGA 4KQCA 5FH9A 5CVDA 1ZCZA 1H1DA 1BJRE 4BCBA 5AHWA 1M9NA 5CYPA 2PSJA 1LJLA 1P7PA 2ZBFA 4LW8A 1PX0A 1F2DA 1K5PA 3RKUA 3FB4A 1TZCA 1IB6A 4WTOA 5JD4A 1XT6A 2RHGB 1AKWA 3U3KA 1ULUA 4I4LA 1NVFA 5DDIP 2WWGA 4B81A 1KAOA 5AM4A 1Y8QB 4ZAXA 3HO8A 4TKVB 2FJPA 2JBAA 4HQLA 1T25A 4PGHA 2F8LA 2XYVA 4QDKA 2L7AA 1KDOA 4U7FA 5GONF 3AIMA 2EG9A 3EVEA 3GUVA 3SAJA 1SIBE 4F8YA 3VPCA 3IIKA 1SBHA 4V3BA 2RCYA 2QTVA 2XA9A 2C2MA 2EKZA 2C78A 3NPMA 1Z0AA 3B8HA 2GOYA 3G23A 1MXHA 1ZGBA 5C8YA 2P9JA 4XJVA 4J8PA 2VPYA 1DUIA 2ANCA 4UNNA 2VA9A 5FIUA 3ANXA 3LD9A 4KE9A 5LD2C 3JVIA 4QTXA 5AQ1A 2KJGA 4UU8A 3FH0A 4MUAA 3PC8A 2YNMD 2IV7A 3OBIA 1SUWA 3DEJA 3MB8A 3ZBUA 5AW5A 3AONB 4ZVOA 2IOHA 1UMDB 1ABFA 3AHDA 2FU5C 5KTYA 2AYXA 3QU4A 3R5SA 1KJQA 4I19A 2AZXA 2G07A 5IM5A 1E0AA 3MOSA 3F67A 2MYNA 1LY1A 3U7QB 1ZVMA 2P3QA 3LVBA 1Z83A 2PCJA 1JTEA 2B2XA 2YXBA 5IHPA 1H6DA 1L7MA 1T2UA 5EJ2A 1U3WA 1XTJA 3KQSA 1A04A 3E6AA 2R4QA 2CCKA 3N8DA 2PS9A 4N6OA 2WU8A 3GRYA 3OZGA 1M8PA 2CXOA 1EFCA 4DBLC 3KOYA 1LTKA 4LYJA 4OHVA 3MBKA 1Z5GA 1VPDA 4OOFA 1DIRA 5AW6A 1GSIA 2GHIA 1Z68A 2OFXA 1AK9A 5DRTA 1DQNA 1LEHA 2Y92A 4EBKA 1N6LA 4YBZA 2ON6A 3I3OA 3K8ZA 2W4BA 3X1XA 2VEDA 9LDBA 4CLXA 1AH2A 3H5NA 4CIDA 4P35A 1OY1A 4TSKA 3AESB 4Y6PA 1YIDA 1UXKA 2VTVA 1XQ1A 3ZDRA 1Z3IX 3S2EA 1EP2B 4OBEA 1EGAA 1BYIA 4LZNA 1WDKA 1EFHA 5A71A 1G8AA 1QIIA 3QA3E 4F92B 5ALKA 1JQDA 3PHBE 2WWVD 4HGNA 3RVJA 4JJFA 3ORQA 1S3IA 5IWCA 3VM6A 1IQUA 4IPTA 2YNMA 4D4IA 1W46A 1AUPA 3B2QA 2ID7A 2BGGA 1OXKA 1IAVA 2BFPA 4I1PA 1ZL0A 2PXCA 4KPEC 1J49A 3HDYA 3BWVA 2EATA 2CCGA 1XZKA 2WAMA 3IT3A 2VEOA 1IOZA 4EEXA 4DV3B 1OILA 1SU7A 3DV0B 4Q7MB 5K0ZA 3RIGA 2X0NA 2CNWD 4ZVQA 2AJTA 2FN7A 1ODCA 1U6JA 2JIMA 4UUNA 5ECGC 4L6IA 2DLNA 2HAEA 1MEJA 4K46A 4NESA 3T61A 1KJWA 4HF7A 1JEYA 1MMAA 2GKSA 3PPIA 4NK4A 1Z4JA 2ZBEA 4OCZA 2XI4A 1KRHA 1X1RA 1V8DA 3SE7A 1NLUA 3P4XA 4DAEA 3NRBA 1O58A 3B89A 1M0EA 4HP8A 2C96A 3BX1A 2WB4A 3SM9A 2GS9A 1RXVA 1AKMA 1M75A 2YJGA 2E5FA 3IQZA 3KR2A 3EC1A 3PHF2 2XS1A 4TKZA 3TZCA 3IEUA 4UW9A 3EDMA 5HG0A 4ACBA 2D4UA 3C97A 2FE1A 3IUNA 5GIOE 4FFOA 5DNWA 1J7KA 3LQYA 2IYOA 5LMZA 3ODPA 1Q7EA 2EZ8A 2XL4A 5AW1A 5HCUA 4XWJA 1OCEA 1L4BA 2AFHA 4N7RA 2JI8A 2OV1A 4FKBA 3B6JA 1E3DA 4HDSA 2CXNA 1XYVA 2VFAA 1OIWA 3C8GD 3DKVA 1FDSA 2KSQA 4MQ9F 2HK8A 2VJKA 4L4XA 1W87A 2BDUA 2Y1EA 1Q1QA 4WW0A 2P2ZA 1N4DA 2B25A 3A06A 1U6KA 3T7TA 3AVXA 3EB9A 4IM7A 1JLRA 3UPDA 3V1NA 3AJRA 4DKJA 4KO2S 4ODIA 2ZIXA 3OOJA 2EDAA 4DABA 4E5VA 3U0CA 5GZ6A 3KOXA 3HKDB 1W48A 2CNWA 1KRXA 5ALVA 3WR5A 4YRSA 3PV0A 4TRMA 1KJZA 5JVDB 4ZI2A 1N1EA 1GGMA 4HWSA 1ZCJA 3RU3A 4YVFA 5CK4A 3OTIA 3TQRA 1RKBA 4BVJA 3G6KA 4FKMA 3IUEA 4LDNA 3UJ6A 3H4IA 4P7GA 1M1YA 5E8JA 1AOXA 2G80A 1W88B 3OFJA 5DCUA 2FZEA 2A5DA 2M2IA 2QN7A 2EHDA 2CXSA 2CNLA 3ABOB 3AH8A 2P0NA 4R6XA 3BIFA 1MKYA 5G41A 1Z5UA 1HFKA 2I33A 1E1CB 2TSYB 5KYUA 1GUFA 1RI5A 1MR3F 2XB6A 4Y2HA 1KXZA 3PLNA 4CEJA 3H9BA 1BQ3A 1YVPA 4J7TA 2KW5A 3WMXA 3L0YA 4F72A 4AN1A 3DDOA 4AG3A 1FPMA 2DLCX 3FW1A 4ER7A 5K9ZA 3HFGA 4EX6A 1JECA 1O6BA 5E6UB 3PTZA 1HDCA 1E2QA 3UB3A 3URKA 4H35A 4EF5A 1K4MA 5FUQA 1RM3A 2QD3A 2HM7A 3ZU3A 3Q7QA 5JO0A 3VO8A 3AVQA 3QF4A 3C8GA 2X0FA 2EKQA 1W2HA 3WC4A 1CHDA 1YI0A 4E13A 1E3JA 2OB1A 5FP0A 1V7CA 3IQWA 4KR0A 4NBWA 1KI2A 4AKTA 1F6WA 3ZG6A 3IVGA 3GGCA 3LS1A 2EOAA 2IXDA 3ZS8A 4MUEA 5BVGA 4N65A 1HTWA 3LNRA 3VZCA 3E9NA 2MYSA 3HU1A 2KB0A 1UBSB 1UM8A 2QX6A 1XI2A 3O5AA 2QM0A 4KNYA 4NDNE 3LE8A 3C8HA 1C7QA 4ZI7B 2AEFA 4MV5A 4W8PA 4WK0B 2EERA 3HGMA 2R2AA 4EA8A 3G9ZA 5FLXA 1NXSA 4KQMA 3K1TA 3WKCA 4UEWA 3R7FA 3ZHXA 3MT9A 4JT4A 1O3YA 3GLFB 5ALHA 4MWOA 1WY5A 1QH8A 1WMDA 3QFCA 3AEYA 1MX5A 3PUVA 1DKQA 4ARZB 5AUQA 4LGMA 5CXSA 3THOA 5CDTA 2ZJ7A 2Q8PA 3ZOZA 3H16A 4YV0A 1WHTA 3N2ZB 2RGUA 3EFEA 3TLYA 4MINA 4GR9A 4WXPA 2O6LA 3IT2A 4IDOA 5E7QA 2AK3A 5EIWA 4Y2PA 1YUNA 3K2QA 1R00A 1QAQA 4OUDA 4TQGA 3ESXA 2ALJA 3HUTA 3L4EA 4FCVA 4WINA 2E4UA 3Q98A 1K7XB 1Q0QA 1Q17A 1N7GA 1YI8A 3R7SA 3QHPA 3QTLA 3A8TA 3TVDA 3Q87B 1WZCA 4Q3EA 1BCSA 1Z8NA 1PJRA 4YYEA 2YW9A 2LIPA 3OJOA 3HNIA 4RX1A 3RBVA 2WHPB 2C5SA 5BSWA 2W45A 3OD5A 1CP3A 5DS5A 1NZEA 4UQPA 3DMDA 4UFOA 5LBTA 3QUAA 3FVWA 3QXJA 3UKJA 4W5HA 4KIJA 1UEIA 1STOA 2ENUA 2XKBA 3EY9A 1KEVA 1H2HA 4LSZA 5EKXA 1GZDA 4Y8VA 4RS3A 4RVOA 1O0BA 4AP6A 1H9GA 4V0KA 521PA 2V7GA 3PNQA 1WWKA 3VMMA 1KJ8A 1AUQA 3L8MA 1LVUA 3SDBA 5JCPA 3DBLA 2VATA 1FJ2A 1N5KA 3G9QA 1O9HA 4Y3UA 2CYDA 1KF0A 5HRUA 4DXWA 3EAFA 5TVGA 5LKAA 1V39A 3CCBA 2DULA 5KQRA 4H6WA 3OM0A 1S2GA 3LAWA 4C0WA 1UBUS 5JMPA 1ZWKA 1LDYA 3CX4A 5DS6A 2A5JA 4X62B 3CUYA 3BULA 1GPJA 3QXSA 2QTZA 2LFFA 5DGCA 4O59O 4ZQCB 3JQ8A 1R4TA 1VP3A 1TU4A 4OFZA 3WYNA 3X2SA 2ZT6A 5K2OA 4BVHA 3RTDA 1UF9A 3DEZA 3EGEA 4E03A 3D64A 4PYKA 1Q0TA 4YMHA 1Y1KE 4F46A 2WU3A 2PK3A 3JQBA 4ETIA 4JB0A 1VLLA 3FIUA 2HJVA 3N86A 2J46A 2G4LA 3PUXA 3I0MA 3K4QA 1T5OA 5K51A 5DNCA 8ABPA 2VBIA 2WYVA 3X43A 2J9ZB 5EWJA 5IBCA 1Y1RA 3BWBA 3NPAA 4PZEA 4QYTA 1Z4NA 5CFRA 4FYIA 1JKJB 2RGNA 3FOEC 4FINA 3GGPA 4A15A 4OO3A 1MJFA 5DM2A 1T5SA 3Q7TA 3U7GA 1QJ4A 2B8TA 4R9NA 1USKA 3QJYA 1JXQA 4A16A 3TB4A 2PRZA 1NVTA 1R1DA 4X1IB 2JLBA 1BVYF 4OF4A 3AJMA 4P3YA 1PUJA 3ER8A 4ZZ3A 1LXCA 4JLUA 3LBYA 4M9QA 2YH2A 1RPAA 3ZNOA 1YDHA 3BH6A 1HZZC 5CEJA 3MT7A 2HZ7A 1PTJC 3BL5A 2HXSA 3DE5X 2VC2B 3WJ1A 3SDSA 5D91A 2BFNA 1GCGA 1EP1B 2WA2A 3OF5A 1T2EA 1TMOA 4CTNA 5C81A 1JGTA 1O6FA 1KYTA 3T9DA 2QLNA 4M7PA 4I4IA 2Q4OA 1IXKA 1RKQA 3OIUA 4FSHA 2RE8A 3RYFA 1P2SA 5B1YA 2IA5A 5GVRA 4MK4A 3M4XA 4LDJA 4L7VA 4TWIA 4EARA 3ZJYA 3FYUB 4A73A 3A26A 4D45A 2B4YA 2VDLB 1CEQA 1XL0A 2QVZX 1YL6A 1CU1A 4AQ7A 5JFGA 1KO8A 4PRYA 4ZEWA 4CM4A 4ZGGA 3P0RA 4F3KA 1P74A 4ND4A 5EE5B 2Y1OA 4E7SA 1FYWA 3EXEA 3T3PB 1E0SA 2W42A 1G8XA 4YK7A 2ZIAA 3Q3JB 1Y9AA 5G0UA 5JTTA 2CXUA 2C82A 2WKSA 3TZLA 5FLEX 5CH5A 1PS9A 3NYWA 1M73E 3EVBA 3FKJA 3UGJA 3DS8A 2VAMA 2HMAA 3AHGA 1U7ZA 3AB7A 1LH0A 1SN7A 3TD9A 3NTLA 2VDQB 5CA1A 5EJ9A 4II7A 3U09A 4DYVA 5FCLA 3SMQA 3HR7A 1ECJA 4R0VA 2YZ2A 3VTAA 4G65A 4HQNA 3KYJB 4JEUA 3R9XB 4TLMB 4OGWA 4DR1B 2O8CA 4C2AA 4QBGB 5DXAA 4JHLA 1LDGA 2D4HA 5FF9A 1R27A 2HCFA 3Q1LA 3DE3X 4L50A 4HFJA 2UUCB 1DOWA 2BFFB 4F2WA 4G8DA 4HVLA 1XVVA 2GCGA 1CJVC 1E6LA 4MAAA 5EXSA 2XYRA 2ZJBA 3IEKA 2ZOSA 1D0YA 4OL0A 1D2CA 1HDIA 5JPDA 1ULSA 3CNQS 2GPBA 3G5TA 4YHHB 1EKXA 3T6GB 3FWZA 4HL6A 3D7LA 2RGYA 2PMBA 3U1TA 1UBRS 2ZBDA 2H59A 2IXAA 2Z1NA 2HDNB 2VCEA 3FF4A 2HWWA 3KXIA 4E2YA 2XT6A 2JCSA 3NZEA 4JJ8A 4MUFA 3FZNA 4HXYA 1LJ8A 4OJTA 3CVWA 1KNYA 4DANA 4YRMA 3HU3A 1K9SA 4UBIA 3SDZA 3LW7A 3DO8A 3HADA 4XOIA 4MPRA 3ZV4A 3KALA 3MXTA 3KQTA 2WQ7A 3STWA 1E9VA 3EXG1 3H2JA 2GFHA 4PNHA 1ZUWA 4DR3B 3HUUA 1MG5A 2BR4A 1OQAA 3CUKA 5JYDA 3WWOA 2Y27A 2V0CA 4MLZA 4R2HA 2NUPB 3ZI7A 5AGFA 2JHFA 3IS3A 2VNHA 2FZVA 1WW2A 2EIJC 2BM1A 4R54A 4BJ6C 1Q74A 3NXSA 2FCRA 3I2FA 4LV6A 2ZRNA 3T54A 3PXXA 5K7SA 2VIIA 1A7UA 1TB4A 4Y2TA 4GXTA 1Y8CA 3JWEA 4QI0A 2QL7A 4MVZA 1BMDA 1BQEA 2ZVQX 3AY7A 3QMVA 8LDHA 1Z9BA 1AU9A 4EFNA 2O8VA 4AJKA 1E84A 1E4EA 3CNEA 4TQAA 2HJ3A 4P2GA 3II6X 5BQHA 1QTNA 5HEKA 2WWWA 2P8SA 3ETJA 1R4MB 2OZKA 5DMXA 5D86A 1K7CA 3CX3A 4JMLA 4KQJA 1I4OA 1ZIOA 4DPLA 5AWFC 2B1JA 1SOUA 4DV4B 1NI4B 3TN7A 4YHBA 5KYYB 2PHZA 4QZVA 4U9DA 4S1OA 5E9AA 2ORYA 3UPTA 1SY7A 3LDAA 4RA6B 4EO4A 1EM8A 4BKRA 4MW8A 5L7YA 2F1KA 1M56C 4KLNA 4JJGA 2WFAA 1VKZA 2ZVDA 4CMKA 1IK6A 3TCNA 2L6GA 4PC6A 3KYIB 3GIWA 3N3AC 4M6WB 5KVCA 4EI8A 3KYDB 1KKMA 5FBRB 2COEA 3SHVA 4Q1AA 1PYDA 2VH5R 1KJYA 4YONB 1GUDA 1E3WA 5CT8A 1M2GA 4CMIB 2DWPA 3SJUA 4M46A 4CE6A 4RZIA 3UWSA 2PH3A 3WGYA 2Q28A 4PC2A 5B53A 3G2OA 3MA0A 3EVNA 4H27A 1OGYA 1VQ1A 5CG2A 1DBPA 4DBLE 1K63A 3JAKA 1Q0LA 4ZQIA 2X4LA 3A6EA 1G2PA 3ZTWA 3C3DA 4H2DA 3DEKA 4V3CA 2DR2A 1Y6FA 4YCNA 5KJFA 1YR7A 3NVKI 4MI6A 4Y67A 3AETB 2H65A 5EP4A 3P19A 3P9IA 4MGZR 4CCWA 4EECA 3GDHA 1SCUA 3QFFA 3IAEA 4MWZA 3G8BA 3C3EA 4DIMA 3U81A 3E3OA 4QXOA 1EBUA 1II8A 2O3TA 4FW8A 5IC5A 2E1RA 2BC5A 4HR7A 4PY2A 1YA8A 4Q1CA 3H1GA 1H4VB 4DY6A 2Q62A 5BQPA 1SXJB 3VSCA 1Y82A 1DV2A 5AOAA 4YASA 5AJZA 5K3SA 1VJ0A 4Z7QB 4EJ2A 4B87A 4RVGA 4B40A 1X7YB 2NTJA 3PEVA 4ZDKA 4D3ZA 4R9SA 3NO4A 1BXZA 1V71A 4EBJA 3I1IA 1WB9A 3GRCA 2NSGA 3TQCA 1GYRA 1SOAA 1X1TA 3PI6A 1ZSNA 2QDXA 3HNLA 4J94A 4QWWA 4D8YA 1QBKC 4MICA 3CHYA 5D1HA 3VNVA 1FNNA 2ACVA 3UMCA 2OCDA 5AO9A 1PFGA 1DU4A 2ZTMA 3H2YA 4GDFA 2VPZA 2YYYA 1YS7A 3PDJA 2EARA 4AULA 4BJ3A 3OWHA 3L8FA 1DJPA 1JALA 4R32A 4JBNA 3IALA 3BJEA 3SM3A 2I8AA 3WNVA 1VBMA 2VDOB 4UUOA 1L3CA 4LQLA 1RQXA 2IYAA 3T7KA 1L4FA 3RANA 3HXMA 4ZQGA 1RMTA 3S2ZA 1PR5A 2ODWA 3O74A 1NLFA 4BASA 2BHLA 2I3DA 4BUZA 1P18A 5ED0A 3DKAA 4CV3A 4OIMA 3CR8A 3ACBA 4XGIA 1MNEA 2HWXA 2CSXA 4ZT4A 5C46F 5JVDF 3CGWA 3BGOS 5HFJA 1QRRA 3U26A 4QOEA 1E96A 4LJ6A 1VECA 3WP0A 5EG5A 2BTQB 1DG1G 2P9CA 1P3DA 3K0FB 1GNQA 1YS2X 4G97A 2X9VA 3L41A 1YFLA 2JK1A 4RW0A 2D7JA 3ZIUA 3AO0B 2X1LA 2FX3A 3HSSA 4LHWA 1K7EB 3G88A 1JDNA 2DKFA 4NU5A 2DWUA 4M36A 4HB4A 2NSLA 1QR6A 1EFLA 3IAM1 1HPLA 3IAS6 3CLVA 4XD7D 1I9CA 2F22A 3HKCB 4B82A 4QFDA 3EIEA 1N57A 2C2YA 5ADVA 3OIWA 2IHJA 4R2WA 1BWQA 1F9EA 2Y1GA 3V2GA 3ABKC 2EQBA 4P92A 3QSYA 1XWJA 2HDWA 3D6MA 4LJSA 5A7GA 3QHAA 4ISBA 1P80A 1M7HA 2F2TA 3STHA 5ENVA 4WOCA 3ST7A 2UZ1B 4INPA 4J7XA 4JR2A 4PTYA 2R1TA 1A9TA 2YW2A 4JBWA 1BC5A 3KYCB 1B8UA 5JP7A 1DLJA 1RU3A 3PVSA 5GINE 5KWJA 2Z1DA 3DLHA 3N0TA 4QDJA 3SN6A 4GOJA 2WVOA 2GQ0A 5FBZA 1FUYB 5A4KA 2VR1A 2XA2A 3ECCA 3LWZA 2GAIA 2DR3A 2ZXFA 2XNCA 4FIDA 3RAEC 3KPYA 1HMDA 4GKVA 2UZ3A 3R0QA 3LKDA 1OLXB 4RULA 4RQTA 3KT0A 1J09A 3QWHA 2X8WA 4KDEA 1EGQA 2JI6A 4ZI7F 4FLFA 4FS3A 4N41A 1T15A 1ML4A 2E4WA 2VPTA 2R7MA 1N2OA 3I9FA 2GAAA 4X6XA 4BS9A 1SPBS 1CIVA 4IP0A 4OJQA 1VLSA 4QDZA 4P0TA 1H7IA 4WGZA 3FAZA 3O8CA 4MKIA 4UTNA 3DO5A 3ZHQA 4I6EA 5FOWA 4J2TA 4QOHA 4M38A 3S3TA 1ZJ4A 4M7WA 5FLKA 4JELA 4EZEA 3JAMA 3CRZA 3OURA 3ZWWA 2YQZA 2CDRA 3KT8A 3VMFA 4Q4ZF 2P9GA 4EGCB 2WYWA 3PE6A 4XD7A 4A8TA 5D84A 4CIYA 3TBFA 5EZ6B 1OWOA 1CZKA 4LRQA 1CUHA 4RMNA 4HUJA 4UVEA 1RTKA 1RAFA 3L1KA 4UXIA 4TL6A 4UOEA 3R8FA 4HS4A 3FZQA 2Q5LA 2Q3CA 2QN1A 3I53A 3IHUA 3C6XA 5CVCA 4HC4A 1B6SA 2B98A 3ICOA 1LGYA 5IJ9A 2VYQA 1FXUA 3C3CA 2YXDA 5JNUA 4R01A 1VRWA 4HVAA 1P75A 1IB0A 2WJ6A 3PXBA 1F0YA 1Z2AA 3VNQA 2ZSBA 4PYNA 2QGZA 3NU1A 1XEWX 4HN9A 2QQFA 1PNOA 1XPRA 5I51A 3VHXA 2F4NA 3B1XA 4OSPA 2J09A 5TY0A 2PGIA 3TRHA 4OX9B 3T9OA 4TT8A 2O06A 3QW2A 3DCIA 4UU7A 4IV8A 2EBFX 3V5NA 3HCDA 1SD5A 1ZO8A 5DYIA 4HVTA 5J4LA 5L3QB 3UR3C 4JC4A 4AECA 1A2BA 6GPBA 3HA2A 2QUIA 4YMUA 4K3UA 1M34B 5M29A 1YMVA 1IMJA 4IDCA 3S2UA 2EF0A 3BD9A 5B1AC 4O25A 3DNFA 1R37A 1NBME 2WLSA 2ZZKA 1ULAA 1JBKA 4U1RA 1TW2A 4A82A 3FVRA 5F5NA 2XNSA 4Q3OA 4RAOA 4CEIA 3WISA 2DPMA 5IUJC 1T1EA 4YMVA 1H23A 3LIPA 4M0DA 5ABPA 1R0LA 1CEEA 2EEPA 6AT1A 4ANJA 3SHOA 4NCBA 4DJJA 3IP1A 2A5YB 2PNJA 1JHUA 5HVNA 1U1IA 3TKLA 1ZL2A 3N0WA 2MTBA 5LQDA 3PHCA 1PJLA 4EF4A 1XA3A 2DE0X 1XTUA 5HOQA 3KAJA 3QW1A 4KWHA 2PRKA 3NETA 4CS9A 5HIKA 3L4JA 2NIPA 4QDUA 4MWBA 2VOEA 3PIDA 1JKIA 1W6RA 1C3EA 2XVMA 2JJQA 4W9RA 2IZ7A 1KY3A 1JHQA 3HK2A 3AGPA 3TD2A 4KMMA 2W98A 2NYRA 5BORA 1BA2A 1G60A 1VBFA 4PF1A 4GX0A 3K2BA 1IBMB 4F4IA 5EC8A 2OBMA 3H6KA 2O2ZA 3GY0A 1O95C 1DKUA 2C5FA 4OIOF 1UJBA 3QEMB 1DJMA 3GNQA 1NWHA 3GJXC 3S7TA 3UMVA 4PIVA 4BNHA 4KR6A 1V16B 1C3JA 1JG1A 1BW9B 2YL2A 4A8JB 3FI9A 1WGWA 3R2JA 3T06B 5A1TA 3OZSA 4RHCA 2PS1A 1JJBA 1C0PA 4CLDA 3IEPA 1ZXLA 1T8SA 5CLFA 4P4NA 3DVRX 5FRDA 4DDTA 3RTAA 2FN8A 4E7ZA 4TXLA 4NV3A 3LLMA 3SCZA 1XX6A 2X42A 3KETA 4QLBA 3P2YA 2WPDD 2IDMA 2W2NA 3ER6A 3I2GA 2P61A 3PE3A 2BEWA 5FWYA 1LZKA 1B1CA 4GPIB 5M7EA 3NOXA 3M34A 3A4LA 2NVBA 3KKLA 1HG1A 1G6HA 4QHYA 3JZ0A 3ZBPA 3IMFA 1CVLA 1XP8A 2GCOA 4U2DA 5AKHA 3HGTA 3KKZA 4KR3A 3JYPA 2XDAA 2VZEA 3DEAA 4AY6A 4I9FA 2O7SA 3P8ZA 4MTOA 3H8JA 3AG3C 2V9CA 2D06A 1Z88A 1NTOA 3HNKA 2ECQA 4YRFA 1ZD9A 5DNDA 4P7JA 1Z8FA 2CXXA 2CUTA 1V41E 2EGGA 3C4JA 3OVMA 4MLCA 1KAEA 1J1UA 3O4FA 2C2GA 1Y8RA 1XTVA 3PA6A 4M8KA 5BURA 2VKQA 2PY6A 1DWPA 3L40A 4QJ5A 3OZDA 1WXHA 3EXHB 1AN9A 5SY4A 1GGFA 2Y0PA 3I34X 4DDHA 1VRVA 3PMRA 3IB3A 4DHEA 1PIWA 1ZA2A 4PEVA 3RO7A 2NWQA 2VNKA 1PZEA 2CD9A 4QDOA 3NUQA 4F06A 2D5IA 1RYDA 1WPRA 4PYRA 2WQ6A 4CX9A 1RM5A 2PKXA 3D6HA 4HFKB 2QTLA 2JAQA 3QNMA 4YGYA 4FHCA 3W5CA 2VT2A 1A5TA 1QS0B 1Q7RA 1A7EA 3I6ZA 3B71A 4BZXA 4YYZA 1Z5OA 2BBOA 2BHTA 2OVBA 2KM1A 2GRJA 1XKQA 4O2LA 5IYZB 5EMJA 4JI7B 1DARA 5KDOA 2B5OA 2CLCX 5K01A 2CWDA 1RCUA 1SUEA 1RQPA 2XCQA 2WPDA 1A4RA 3I2KA 1LI4A 1JYFA 1O97C 1RJ9B 3UGTA 3EJNA 3LPDA 2NP6A 3N28A 4U0JA 4M8SA 1FP1D 4M1EA 3M2PA 1MABA 2WJIA 3T7EA 3QUSA 4PRLA 3VR6D 3OA1A 5CXUA 1CQIA 2ZYHA 2JA2A 3OEYA 4O29A 4OMUA 1ZHZA 4KRFA 3UAXA 4X44A 3M5CA 1Z4MA 1PG2A 2R85A 1QFJA 5FOQA 1ECPA 2QHXA 3OQIB 4MR7A 2X2OA 1P19A 1YASA 5K45A 1GEGA 2GJSA 3UT0A 1W1WA 5C7IO 4IMIB 5AKZA 4B76A 4IF4A 1DB3A 1YB6A 1JG4A 2OQIA 4Q4LA 3EY4A 3M6FA 3GI1A 1VSVA 1FAPB 3BA1A 2HYIC 4KRYA 2VDWB 1V1RA 4I2VA 2FAPB 2BKLA 3EQ7A 1NVBA 3Q7RA 1BN7A 2VZ8A 1OZHA 5EMLA 3GEGA 2NSJA 3T4PA 5H80A 2J31A 3DZ8A 1E2PA 3P26A 1RWNA 4B6JA 2BRUA 4JDUA 4BV9A 4PLWA 4DDMA 3U60B 5JIBA 3FPAA 1QG4A 2P9TA 1Y4CA 3AR9A 4IIEA 5L0CA 1L4KA 3RPEA 1ZCBA 1TE2A 4X71A 1DTWA 5AT1A 1XCOA 5AI9A 3DHWC 5MDHA 3UWMA 1I3KA 1G6Q1 3DFKA 2XD9A 1AKTA 2YQYA 1Z0DA 1WCIA 4KXUA 3GRPA 1G8SA 1HV8A 3MTQA 4JYMA 2CKDA 4L8LA 1TM1E 2HSDA 3C7CB 4QSHA 4DFDA 3RJ5A 1ZGZA 2C4KA 1V74B 1LS1A 2PUJA 4FYYA 5IN4A 2IIQA 1EUDA 1Y42X 2Q0QA 5JROA 2ICWG 3F6CA 3BA6A 2ETVA 4GP7A 2BMDA 4AZ0B 5BO5A 1KSHA 5FWNA 3ITNA 2VAVA 1Z6GA 4RTRA 2ECOA 2Z8YM 3VR6A 2AK2A 2NO4A 4GXQA 2QM7A 1Z35A 5HE9A 1S3FA 4RPLA 5FNZA 2W9YA 1UOPA 3CBGA 2OZVA 4ER3A 3KSDO 3M3DA 4D46A 2C57A 4NNOA 3FX2A 3VYSB 1P2DA 2WMOB 4BMDA 1EK2A 3EJ6A 3RK1A 4OQLA 1Z18A 3AF0A 4DLRA 4X9XA 3EGOA 3RC3A 2ZDGA 5K6AC 3ZXSA 5FYDA 3C4QA 3GCGA 2P6RA 1FF9A 4YR9A 4B34A 2XD4A 1IZMA 4N0QA 3LOPA 3LUBA 4RGVA 2IYRA 3FTNA 3USES 1P62B 1C9JA 3TMYA 3D7SA 2WMYA 4LXTA 4C0JA 1K05A 1HLFA 2FFQA 5ESXA 4KSCA 1Q84A 3IMGA 1BXGB 4MW0A 3WHKA 2ID9A 2CHVA 1CPYA 3P52A 3C6MA 1LDNA 4MV6A 2XLDA 1CCWA 3UMFA 4CKEA 3A28A 2YINC 2VO1A 2YMMA 2FETA 3NKEA 3GNSA 2QRVB 5CT6A 3LXMA 2WIBA 5IC4A 2DFKB 1M2OA 4YUZA 3I61A 2NU7B 4TXMA 4PZLA 4C7OB 4FGUA 2GZRA 1ZMXA 4LWPA 1HNXB 4P3OA 1YU6A 1Z5NA 2JIZD 2HGZA 3FWHA 1JLLB 4BRWA 3OWXA 3T7JA 1C3XA 3C43A 2RIRA 1E3EA 4IEEA 1X6VA 1FOEB 4TV9A 1PL7A 4F96A 5CVJA 2P6MA 1REQB 2CJFA 1HY5A 4JASB 4N5DA 2I6FA 5AW2A 3NHAA 3LBIA 4HMQA 1A96A 3SKVA 5JVEA 3LUJA 1HFWA 4OHCA 3EGDB 4Q47A 3OQMA 1H6GA 3DUWA 1F17A 3NEJA 2CDBA 4DLNA 2G1UA 2XOKD 4M9ZA 4IDQA 1PCXA 1SKUA 3SSNA 3ZDBA 2IHKA 1ECLA 3E8SA 5T3YA 3GG2A 2VLIA 2ZYTX 3VZBA 3O21A 3D3NA 2P6OA 4KO4S 1I4YA 1PEYA 4WA7A 1ORDA 2AXPA 2CHGA 4RDAA 1IBCA 1TUBB 4U9IS 3ZKWA 5GGXA 3ZHTA 2ANBA 3R7DA 4HGQA 4O2AB 1P44A 3GA7A 2HUJA 5ELLA 2DP4E 1DGQA 1MP0A 3H9CA 2OV3A 2FUKA 1VPVA 2IHNA 3ESZA 2FFAA 1X7GA 3SC2A 2C3UA 4L9RA 4G01B 3RQSA 4OXNA 3EW9A 4QU8A 5C5EA 4YI3A 4UQOA 1BGVA 2QSUA 1YACA 3IUYA 5B2ZA 2XTZA 1WETA 1P1BA 2V74B 1NU7D 2A6PA 1ADGA 2FPSA 4NBUA 1RQLA 8MHTA 1M74A 3WAJA 3GQVA 4GBED 3MIZA 1FYVA 4ZYTA 3TFQA 2Q9BA 2DCMA 4LX8A 4WGGA 2XBUA 4DG9A 2QU8A 1GT91 2BH2A 2XMSA 3RV3A 1OWMA 2ZBPA 5EVJA 3PHLA 3E27A 1C50A 1Y6ZA 1WA5A 4DRXB 2I62A 1DO8A 1X7XA 4JC5A 2JIZA 2RC5A 3Q10A 2E89A 1TA0A 2MSLA 3CNBA 3IP9A 1A4IA 2LDXA 2FMXA 2ZUDA 5J63A 1EE9A 2R7LA 4EEZA 4NCNA 1JLMA 4ZV4A 5LFAA 1J0DA 1K8XB 3GVXA 2B30A 2WKRA 1I01A 3JYLA 3CV3A 1XJCA 4HNAB 2PZGA 4FHDA 5ALXA 3FSJX 2B7BA 2NTNA 2BMVA 5TT0A 2XOKA 2W6NA 3SEFA 3K6SA 4F4UA 3VO9A 1M1UA 1XJ5A 1ZPDA 1VHTA 1DG9A 4Q16A 4Q4CA 1X1CA 3HNJA 2YRWA 1BZ4A 1DO0A 2EX1A 4OH7A 1IMOA 3DZJA 1ONPA 3MM4A 2CVPA 3W3AH 4KYTA 1QCZA 3IPYA 1QIMA 1OA1A 1MIHA 5DYTA 5DBOA 4NFLA 2RHHA 2QLBA 1GPMA 3EWSA 3ADPA 2QM8A 4GKJB 5JXIA 1SF8A 4JB3A 3QVMA 5TSDA 1KEKA 2JD0A 4NZNA 4FDMA 5EE9A 1X0XA 3EIUA 3LCJA 3PPWA 4NH4A 2Q2NA 1NXTA 1KH3A 4MVXA 3GEDA 3SMVA 3LI2A 3TOVA 3R4CA 3QVWA 3RSCA 1EIZA 1Y9JA 1J5XA 5AXAA 4EELA 3PTLA 4LE1A 5B7NA 3HP4A 2Y8EA 2OQRA 3V9AA 5AW8A 2ZB4A 5ITZA 4DAOA 2G17A 2G82A 5JC1A 1KQOA 3ROKA 1QR2A 4U7HA 5ICSA 5KOJA 2GN1A 2QTRA 2ZU6A 4G1CA 2XF8A 2JBHA 1OXXK 4JLJA 2O8NA 3TRIA 1FNTc 4KIUA 5EY5B 3T99A 5BXQC 6ADHA 4KBLA 3A6DA 5DM1A 1AGRA 1DAOA 4RK1A 1D6SA 3JD0A 1R50A 4NBTA 1O94C 1ZIXA 4JZKA 1RZRD 1C9MA 3E8XA 1SKYB 1WL8A 1JR2A 1HL3A 1GSAA 2FWJA 2QRNA 4DR7B 1NV9A 1S1CA 3R0VA 5BY2A 2VCYA 5BN4B 4FAPB 2W2LD 4MWTA 3L77A 4JN6B 2I8CA 5LA6B 1LF0A 4NZZA 2IWRA 5CM2Z 2Z58A 5ALTA 4JTDB 3IUJA 4C6HA 1E8MA 2AV6A 4L78A 1BH6A 1W30A 1E58A 2IY9A 2WZDA 3F5QA 4P5EA 4DA8A 3DHVA 1SHKA 1W44A 1J22A 4AY5A 4J7YA 2FWAA 2RH4A 2QL5A 4DNOA 1OX6A 4PR3A 2P11A 2CBXA 3PDCA 3P1JA 1IWPB 4JB2A 1VKOA 1C1DB 3RUAA 4E32A 4TUYA 5JW6A 1USUA 5HGXA 3QFTA 4LDZA 1TU0A 3IOBA 2B3TA 4CG3A 4QHTA 3O8BA 5TQ2B 1K08A 1Z8HA 1W94A 2PBLA 1P39A 4C0BA 2QUJA 5KSYA 2PKQO 1FTNA 3HBNA 2WKPA 3P0FA 3BMCA 1HM5A 4HWTA 3Q8XB 4U8GA 1Z4PX 3K30A 4IOLA 4EG5A 1H2YA 2BYTA 1ZK4A 4X1YA 2ORVA 3VU8A 3RSQA 5KYWA 3DHEA 4EKYA 4UTPA 3MWEA 1JIQA 3F73A 5T3TA 2YL3A 1SVLA 3FPSA 3GLRA 1FU7A 4O6MA 4IMRA 4MV8A 2FQXA 1RZRA 3QTHA 4BB5A 4Z9YA 1CQJB 3DJUB 3UMRA 3F46A 2D2EA 3KO8A 3H04A 3KJFA 1SXHA 2PX2A 1HFJA 4RBNA 3RASA 3UFXA 4MRSA 1IRXA 3BXEA 2F00A 2QAIA 1ZQ1A 4MUHA 1AV6A 4QI2A 3C87A 2W2LA 5B6IA 3JATB 2B21A 1OZFA 1A98A 2BTEA 4PICA 5MFZA 2RD2A 4ZANA 3QZUA 3I0NA 1XMXA 4LC9A 3CY6A 4KQGA 2Y69C 2PNOA 4MR8B 3G2KA 2EEZA 3EUFA 1U3VA 5AUNB 3RYLA 1U65A 5K05A 1ZGAA 3V2IA 1ZBDA 1DAEA 1E6MA 1CBUA 1XGKA 5L4NA 2J4CA 2PUCA 5J4KA 5A5FA 3QQPA 5KYKA 2I91A 1DKLA 1DC8A 3JYOA 1V11B 3A36A 2PL3A 3DFFA 5ALIA 3TD7A 3S84A 2OK7A 1ZUIA 4GOXA 3TIIA 2G7MC 1GQSA 4ZALA 3BRSA 2O2SA 3OUZA 2KYRA 3G4ZA 5J5VA 4RFSA 3TCKA 3W8EA 4OQNA 3WX0A 1ZUNA 1EIWA 4HFFB 4QTTB 3L0IA 1K3FA 1CV2A 1N0UA 3PQFA 1UG7A 3H1EA 2B4QA 1IBLB 4LOAA 5EFOA 5HDQA 4A23A 4Q21A 2HBZA 5CA0B 2Z6QA 2FPPA 2OCGA 3U31A 4M86A 2TRSB 2BBSA 5H3LA 1KNXA 1IQ0A 4NZOA 3MWJA 4F11A 4XDGA 4XVQA 1VE1A 3W9SA 4HJRA 5JSKA 2XGSA 4YC7A 1AVOB 2DETA 1I94B 3U3ZA 5KTKA 5AJHA 2REBA 2HLPA 2PZLA 3TJRA 2MSDB 3RVRA 4LVOA 4ES6A 4PACA 4QXAA 2M9MA 3FLAA 2D4AA 1NHWA 4F1JA 1IPHA 1GKIA 1VFPA 3R76A 3ELYA 4CTOA 1TVCA 4C0HA 1U0TA 2Q5JA 4XGKA 2FRXA 2J6BA 3WGNA 1C17M 4YUYA 4YRKA 4JI3B 1C0EA 2AG8A 4QTZA 5IYZF 1QFSA 5DCWA 1GUAA 3KEGA 3OOWA 3JCZA 4LYDA 4RHTA 1HWYA 2AU5A 3DTTA 1V96A 2AL7A 1LTHR 4TTIA 5CGQB 1Y6QA 3DLAA 2PR7A 4IFIA 5IVIA 2ZPTX 5I9NA 1XCLA 3CC8A 4N7BA 2OJQA 2X13A 1MQ8B 7MHTA 4XPWA 4LPKA 2WPNA 3B7PA 1HZZA 3KB2A 3KFXA 2XQIA 5GJBA 1AUEA 1PTJA 2Q7XA 4GGPA 3ZCUA 3ZK7A 4UOQA 4B6RA 4M22A 4IRUB 3Q8LA 3CUWA 2K2QB 2GZAA 3G9TA 1FQWA 4DC9A 3DHYA 2P91A 4U2FA 3GGJA 3HVKA 3LQ1A 4NYMQ 3DMPA 1RQNA 2PXAA 3WAQA 3IV6A 1IJBA 2YLGA 1SYQA 1QFYA 2W0MA 4ZRDA 3AV0B 3WL7A 4Y0VA 4HDAA 3K2IA 4CM8A 5BN5B 1FSSA 3MQFA 3MAJA 4LK2A 2DRIA 1SCNE 1NA5A 1LE2A 2Z4RA 4S2EA 4F6RB 4YDQA 2O8EB 3FM9A 3OG9A 3DE0X 1T2CA 4Q3AA 3WO1A 2EFHB 3KE8A 1TNDA 3R5FA 4KL8S 3KR0A 2ZR0A 5HIMA 1GAXA 4QOJA 3C0KA 1FFWA 3D31A 3VDQA 3JARB 4ICIA 5DM60 1IVSA 2XUJA 4RETA 1LLFA 2GCIA 4UEOA 3VFDA 2PKQP 4HFRA 4P5PA 4YFVA 3S1SA 2HJMA 2R8PA 1F4PA 4LOHA 4NE9A 3UJ9A 4QUHA 1Q16A 4HQFA 1A8UA 2ID8A 4FCTA 2QA5A 2G0TA 4AYTA 3G1TA 2QAGB 1KVRA 3NEPX 1ODLA 1NFNA 4ZWNA 2DWOA 3OCVA 1GYQA 2QS9A 1V3QE 5A3JA 4WGFA 2NO7A 4EA7A 3C3KA 1SHUX 2YASA 1SCKA 2FLWA 4ZHSA 3J06A 1QG2A 2O7NA 3PFIA 3MUFA 2IZ0A 5T67A 3K0EA 2C5HA 3NAGA 5ECYA 1XN1A 4X7RA 4H4EA 4KV9A 4QOSA 2ZXRA 4B5KA 2HSWA 4XEUA 1WQ4A 1AO3A 4J43A 4ZCLA 4MWSA 4G56A 4WXYB 1ENOA 1NONA 1N7IA 1KAHA 3PB3A 1TPZA 4FGZA 3IQXA 4D8XA 1D5CA 5KVAA 1CULC 3CE9A 1Z29A 1Q7BA 2OEPA 5SICE 4D25A 4V1CB 4WJLA 5H3CA 3PFKA 1K92A 4MQFA 1J2UA 3TUIC 3LDGA 4G89A 3CJTA 2GAFA 2ONJA 1BEUB 2Q5HA 4LVNA 2E48A 3M6LA 1QQBA 3LHDA 2OXFA 4UHHA 1IIRA 4UNPA 2Q21A 4L22A 1XRQA 4G0HA 1VHLA 2AN4A 3OCZA 1R5ID 4XWKA 3R6GA 1E2MA 1LVKA 1GRQA 3T4EA 3FTDA 3INGA 4N0PA 4RY2A 4ND3A 4WKPA 4UUBA 3V1UA 4W5NA 3R77A 4GDMA 2HIMA 1TLTA 4BJ6A 9ATCA 1MRSA 3IYLW 3CUTA 4I66A 5I9TA 5BW4A 2E7ZA 1FE8A 1NF2A 2LIGA 4GP9A 4FX2A 3GJ0A 1N1CA 4Z8YA 1L7VC 3E1GA 2XRZA 3KG2A 4K1XA 3ZE1B 3NASA 5TB5A 4JI0B 3OQOA 3MTGA 1T2AA 3P7MA 3RFXA 1J39A 2EP7A