3A11A

Crystal structure of ribose-1,5-bisphosphate isomerase from thermococcus kodakaraensis kod1
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
320
structure length
320
Chain Sequence
VVKEVLEIAEKIKNMEIRGAGKIARSAAYALQLQAEKSKATNVDEFWKEMKQAAKILFETRPTAVSLPNALRYVMHRGKIAYSSGADLEQLRFVIINAAKEFIHNSEKALERIGEFGAKRIEDGDVIMTHCHSKAAISVMKTAWEQGKDIKVIVTETRPKWQGKITAKELASYGIPVIYVVDSAARHYMKMTDKVVMGADSITVNGAVINKIGTALIALTAKEHRVWTMIAAETYKFHPETMLGQLVEIEMRDPTEVIPEDELKTWPKNIEVWNPAFDVTPPEYVDVIITERGIIPPYAAIDILREEFGWALKYTEPWED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Translation initiation factor eIF-2B, delta subunit
publication title Dynamic, ligand-dependent conformational change triggers reaction of ribose-1,5-bisphosphate isomerase from Thermococcus kodakarensis KOD1
pubmed doi rcsb
source organism Thermococcus kodakaraensis
total genus 104
structure length 320
sequence length 320
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.3.1.29: Ribose 1,5-bisphosphate isomerase.
pdb deposition date 2009-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01008 IF-2B Initiation factor 2 subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.420 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) translation initiation factor eif-2b, domain 1 3a11A01
3.40.50.10470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Translation initiation factor eif-2b; domain 2 3a11A02
2YVKA 5DBOA 4LDQA 1VB5A 4ZEOA 3ECSA 2YRFA 3A9CA 3A11A 1T9KA 1T5OA 4ZEMA 4LDRA 1W2WB 3VM6A 2A0UA
chains in the Genus database with same CATH superfamily
4R84A 2NQ2C 4EFDA 1E5TA 4D4KA 4GYWA 2OSBA 4ZI3A 2XYPA 2LD6A 4GGOA 4ZFNA 4L3OA 2V4UA 1CNFA 3NLLA 4C4TA 3JCUQ 3P5BA 5B2ZA 3JW8A 4RHTA 1FQJA 2RK6A 1IHDA 4ESEA 2VK8A 1QHSA 4AWBA 3VPCA 5LL6P 3KTFA 4IH1A 1RM0A 1N92A 1A7JA 2VH1A 4YLGA 2XHZA 3T5MA 3Q87B 1UKEA 3GANA 5F7OA 3CH5A 2R84A 3STVA 2YV1A 3L4EA 4BJ6A 1BH2A 5AOBA 3JARB 2QR5A 4NENB 1I7LA 1B73A 3LK6A 1WLYA 1IY8A 3T06B 4UCFA 3OUUA 5H9WA 4EB6B 4PSKA 4ZQHA 3O8LA 3DTVD 1UT5A 5TY0A 4DUGA 4DUPA 2PLNA 3IA2A 3STHA 4BMXA 2AUTA 3UAYA 1G42A 3WIEA 2QSUA 3JWEA 3M6VA 1XEWY 721PA 5JJKA 5DRYA 3ASNC 1W5EA 2NG1A 1NSGB 4R41A 2H1CA 3HU1A 4RETA 2ZB7A 2ILVA 1UWVA 3OIUA 4LOAA 1RR6A 2J3KA 2R9VA 3NXKA 3DO8A 1FTYA 4E5NA 3JYYA 3UOAB 3DD7A 3UMYA 1G1AA 1TM5E 3HCDA 4PAOA 4D8TA 1HNZB 2GR9A 3QU7A 4KXMA 3QOWA 1YZCA 2OMKA 1OFVA 3BRQA 4RHXA 1HE2A 1KI4A 3HDYA 2LIGA 4JFAA 3OPNA 1A4XA 4R1PA 3T1NA 1Y8QA 1SU4A 2JCGA 2GM9A 2A67A 2O8NA 2X5NA 1CUSA 3KWFA 4P6IC 3W8IA 1GPDG 2HPAA 4E18A 3F0TA 1QQAA 4RFVA 4R1QA 3T52A 5J2TA 2O5VA 4YCMA 3N2ZB 3NMKA 4AT1A 5TPZD 3VR4A 2EARA 3I5AA 4EUKB 5FA6A 1CY2A 3FGOA 3BJRA 2AW3A 2O7QA 3LNTA 2A0YA 2CDNA 3CB2A 5KZMB 1WOYA 4IKPA 1YDWA 4HDRB 2E1RA 2WVHA 4R1LA 4M0DA 4UBNA 3X0DA 2L2QA 5JSZA 2PJUA 1O3YA 3UT0A 2WPDD 5EKSA 2J87A 4QBKA 4DDMA 4UE3S 2UYGA 5LD2C 5I9NA 3RREA 2I4NA 5JIBA 2WF6A 4RPJA 1NC1A 3W7VA 2PXXA 4UM7A 2EPKX 2X9VA 1ZC3A 3CW8X 1P3JA 5TT1A 4BRUA 2DBRA 4ZOLA 2HA3A 1V3VA 3R1IA 4LYYA 2C5HA 4L0CA 2V3VA 4N76A 5C81A 5FPYA 3GGGA 3VYVA 3WFZA 3JD4A 1O0SA 4TWRA 4P9NA 3HMKA 4FEGA 2PKXA 1UP4A 1DV2A 1EFPA 1MQ9A 4F5WA 3QHAA 3T3EA 4W5HA 3DZIA 1YIAA 4KRFA 1K7YA 5KU7A 3GP3A 4F71A 4Q4ZF 4KJZA 4HB0A 3IQ5A 2WHRA 2VYFA 2KW3C 3AIOA 3KAPA 4DM4A 1YJXA 3BF8A 3NP7A 2FN9A 2NTVA 5FHQA 1GQRA 4EY3A 3PWKA 1LJUA 5ILOA 4YQFA 4Z9YA 4H4DA 2WWIA 3L7NA 2ABWA 2IH4A 3V9AA 4RAOA 3C5WP 2IRWA 1ST6A 2P4QA 1SU6A 3NYMA 3LXMA 3MMZA 2EFHB 1M7GA 5AI5A 3K2EA 3OF3A 5B3JC 3WQQA 4M9RA 1RYZA 2PS9A 1ZVQA 1H85A 2QAGB 3JYQA 3ZEIA 3GDOA 3I72A 1SJ9A 4S1OA 3VH4A 4QODA 2ATIA 5CW1A 2IYOA 1A5ZA 3JZ0A 1EI7A 4BP1A 5HS6A 1UJMA 3ZHVA 4Q3BA 4BPBA 4L76A 2VNSA 3QEAZ 4P35A 2ZXEA 1H3NA 1OH8A 2GLXA 3DBIA 4U2DA 2ZRFA 1GR1A 3L8DA 2ZIGA 2RARA 3O82A 4OI0A 2YHAA 3PCXA 5B6JA 2AK2A 4JB0A 4YV1A 2IYNA 1PF7E 5KSWB 2WAYA 5HIJA 4K28A 4MKXA 4CM4B 1BJKA 2QXUA 5EHGA 1ADFA 3T6BA 1TPYA 1HUQA 5E1OA 2ON6A 4MQ4A 1WABA 1JIXA 3CS3A 3W2VA 2XUZA 2IEZA 4U7JA 3VSBA 2EF0A 2DUNA 3INGA 5FLXA 4KXUA 3BL8A 4UATA 2Y69C 2TMGA 4ENVA 2ZWPA 1QVAA 4N12A 6GPBA 4DV4B 1YE5A 4HAOA 3GJTA 4DM3A 1EZZA 2TMYA 3AZQA 3NR2A 2Z2ZA 1Z5VA 1XV5A 3RT1A 2QUPA 1UWKA 2JGDA 1C7IA 1T2NA 1OLUA 4FNMA 4YUWA 3B82A 1VL0A 2J9ZB 4QVGA 4H0FA 1PNOA 2WJJA 1QC5B 5EL0A 4BC0A 1V5WA 2OHOA 4IHJB 1JMKC 2WB7A 4DRJB 1RS0A 2H1LA 4XLLA 2QL7A 4P3NA 3W4IA 4J7XA 4B3TB 3DV2A 3X1JA 2HLHA 3ILYA 1EVYA 4QDTA 3O4IA 1V9SA 2QUIA 5FB3A 1VMAA 1JE1A 2G83A 3T7SA 3Q88A 4R0NA 3HM9A 1ACMA 3IQGX 2IZ7A 2G36A 3CA8A 3D4IA 2ZFUA 5FZTA 3PL1A 5DN6A 3W6NA 4Y9UA 3W79A 4RWZA 3TLCA 4QFMA 2B4KA 1NU9C 1C7FA 4UHKA 4HH1A 1JEJA 2AKEA 4O5AA 4ZODA 2QNRA 3T1HB 1MHPA 1Q22A 2HF8A 1RLJA 3O55A 2H54A 4MVOA 3HKCB 4XPIA 4DBLE 3ILSA 5C9ZA 5EJ4A 4ZVPA 2AFIE 1JIJA 4ILKA 4Y2JA 5IEBA 1H9TA 3ICOA 2YLGA 4JQCA 1DLIA 3ROXA 4M9SA 3D3NA 4N0QA 2HA0A 1RZRD 4V2UA 1ZY2A 3UWSA 3CBGA 1TVCA 4IW3B 4M54A 3KQPA 3JALB 3QVYA 4MRNA 4I14A 4NJOA 3AF3A 3KOMA 4UE6A 4KBFA 5LKRA 4D8XA 4MEAA 4CM9D 5C46F 2GEUA 1MX3A 3RHTA 4ZYZA 1E86A 2RG7A 5A04A 2DWUA 4YO8A 4OINF 4B82A 3D9QX 2FPMA 3O8OA 5KDLA 4KGXA 3EG9B 4KDCA 2YL7A 4C3DA 3P26A 2WHPA 2W6CX 1ZICA 3OCYA 3OT1A 5FR2A 3RSGA 3PFHA 1N2ZA 1PZFA 3NM4A 3R3HA 3KVRA 1ZMRA 3TM5A 3JQQA 5L3QB 2VRNA 1BFUA 2VDPB 4ARSA 1E3LA 3PFWO 1L7PA 5M04A 3EGWA 4CN9A 2QLNA 2HU2A 2R5NA 2XQGA 1F8YA 1GUZA 2PSJA 3TD2A 3SF8B 1BKSB 1QHIA 1PP4A 4XXHA 1P2VA 4J94A 1T6YA 4R98A 3GPLA 3G6KA 4BZZA 1Q0MA 1L0BA 5CA1B 1QIFA 1ONBA 3QWIA 3VTAA 3E5MA 2OXTA 1BHSA 2XA2A 1E2PA 1M8JA 2A78A 4MB2A 1EH5A 1W73A 4X66B 4FXPA 2IYSA 2AOUA 3WLOA 1MA0A 3LZCA 1DIGA 4TQGA 3ENZA 5KOJB 2Y6VA 4WV3A 4OYRA 1SD2A 2J5QA 2D8AA 2B8EA 5LOVB 3K6SB 1LS4A 2R4UA 1IFXA 1DAMA 1KVSA 4Y6GB 5CK4A 4XUDA 1M57C 2WU1A 2XE6A 1DG3A 3HXOA 1NUQA 1O58A 2HD4A 4NBNA 2JGNA 4RTNA 4EBBA 1H69A 3W1VA 3ID6C 1D2NA 1NBEA 1KTVA 3DZGA 1YDFA 5E2QA 3K53A 4P5DA 2QE7D 2J46A 3PBKA 4LC9A 5IBRA 2BFMA 3T94A 1J06A 1MMGA 1IXSB 3I9KA 1XD2A 1SPBS 3HNOA 1KPIA 1ZD9A 2XM0A 1GPNA 2O2YA 5AOAA 1D07A 4V38A 3RKRA 3FHOA 3R0ZA 1ZHTA 1YR8A 2O1SA 1OMOA 3OPQA 3ZH2A 1FYFA 1ISSA 2X9GA 1ZHFA 2GRJA 1GZ3A 3EVBA 4HNAB 1XCOA 2GZMA 2HSQA 3QYPA 1ZD5A 2CLFB 1PDOA 3TRHA 4QM6A 1XVAA 2FPUA 1R5JA 5AM5A 1ZRSA 1AZWA 3E18A 4BNWA 2C94A 3CVVA 3VSAA 1E96A 2A84A 4F86A 4TRNA 3UC9A 1P0QA 1XZFA 2PX5A 4ESOA 1P1BA 3UJHA 3HCOA 3QBDA 2M4EA 4HLNA 2C03A 3GH1A 5L53A 1EDOA 1RW4A 2PR2A 4D46A 2PQ6A 3NBMA 5I45A 2FW6A 1OUMA 2JLUA 1O6FA 3ABQB 4RZHA 1EGHA 1NLYA 4RX1A 4G5SA 4CW7A 4EY8A 4C43A 4Q3CA 5LLSA 2MIIA 4DIEA 3R5SA 2FPPA 2COKA 4RYDA 4MIYA 3SDZA 1UJ2A 3AJ8A 3A10A 3IQTA 1VLHA 4FKBA 4D96A 2HWKA 3ICEA 1X0VA 1Q1EA 3CLRC 2AVNA 1GRNA 4ZCPA 5CFQA 4K81B 2ZSAA 1JEOA 4DA7A 1DAEA 5ALZA 5KYNA 3OCCA 4ZT5A 3DMDA 4DHWA 4NE9A 3FPFA 4G89A 2P9BA 2AD1A 4UOZA 4DDUA 5ALMA 1HX7A 2QUBA 1PJTA 1FP4B 3I4LA 4OSOA 1GPWB 3ZHSA 4FBLA 5IH3A 1NF2A 4UTXA 3ZJ4A 1FW8A 1VL2A 4TXHA 1QCCA 1G63A 3Q7IA 1QGYA 5I9BA 2EFDB 4JYPA 3TGWA 2ZSJA 3F49S 3KKLA 4FB5A 3AI7A 3LO5A 1PV3A 1GITA 4G4IA 2WJ4A 4QBFA 3GRKA 5DEIA 1S6YA 4B5KA 3FF1A 1QWOA 4ZQEA 3D7NA 3ET5A 2QXTA 2KBEA 2NZYA 3OZDA 1Z08A 1TE2A 4RPHA 4UXJA 2EV9A 4HXFB 1KBQA 1YZHA 2YL1A 3TZKA 5F1OA 5J4VA 4DZRA 1Y5IA 1L8XA 1S7GA 3DTVA 4L2IA 1X2EA 3SQNA 4HDQB 2NPUA 1KE2A 3W1EA 1BW9B 1DAFA 4XIFA 3HNRA 4KFCA 1AKUA 1ODLA 1KDZA 2VHUA 4FILA 1KERA 4R1NA 2BFWA 5FD8A 4GMDA 3TVDA 3ZTTA 5EINA 4BBZA 2FSHA 1E9VA 2MU1A 3NYLA 3JWHA 2VSYA 2CJWA 4KQ1A 1T35A 1LCIA 5KYGA 5ED0A 4N3AA 3VU9B 2ZTLA 3RUDA 2GH1A 4AK9A 1FJGB 1GKKA 1CR4A 1R6BX 1F8FA 5CUQA 1J25A 2ZSBA 5KYKA 1AHPA 4PYKA 2VSOA 3T4EA 3JS5A 5ITZA 2IHJA 4P2BA 2PT5A 4O2RA 3LBHA 2QQEA 2R00C 2D54A 1JV2B 3R7DA 3NWPA 5SZJA 2CCYA 2YBDA 3UO8B 3MHPA 1QIDA 3T4RA 2I33A 3GORA 1RAGA 1TJYA 1I2DA 3EWSA 4P22A 4E2WA 2NZUG 4CE6A 3LQ2A 2HCFA 7ADHA 4MUXA 1DRWA 5TPZA 1KI1A 1XBTA 1ZU4A 2Z56A 4D4MA 1O95D 4UTZA 3M6WA 1Z5PA 3F1KA 2V7PA 3NASA 2EJBA 1YZAA 4B4KA 3OD5A 4I1YA 1PZGA 2YFYA 3EHMA 1L7DA 3NGXA 4YJDA 2PFGA 1QQBA 5CGQB 4YTEA 1HFKA 2RHTA 1JDPA 3E84A 2LKDA 3T7KA 3DOHA 1B42A 3N6RA 3CVYA 3K16A 4TL8A 4F4FA 1TRHA 5SZKB 2WPDA 1QZXA 4X92A 5CXUA 3CKMA 2HV8A 3COPA 1NT2A 4EHHA 4F6LA 4JV5B 1C30A 3FD8A 3FYUA 3HNPA 2IHYA 3ZH9B 2BFCB 6PFKA 3G8AA 4ZV7A 1XDGA 3HDHA 2V6BA 1HE4A 4CIPA 3R0VA 2P9HA 3COYA 2LCIA 4TKVA 3MS7A 1DQYA 4MKGA 2JVIA 3UW1A 3EGEA 5KVQA 4JHXA 1MO5A 1OGJA 4UHCA 4N5LA 3WAGA 2W6ID 1K5PA 2BSXA 4E2XA 1SUEA 1I1OA 2C58A 4JENA 3OPMA 3B13B 2VH5R 4JYMA 2X1HA 4GYTA 3QVWA 1GNRA 1SBTA 2V55B 3OMXA 3HI6A 5BN4A 5HGXA 4OHPA 3WAQA 4XIYA 5A1TA 3NKLA 3E03A 1KIMA 1QX4A 3LT1A 3QVGB 1KU2A 2OORC 2OR3A 4C5CA 1ESEA 4BMVA 1EQUA 3AM3A 3PC2A 1WX1A 1OXSC 1DX9A 3RDPA 5DGIA 3G0BA 2FPKA 2WQ7A 3AUTA 4BNDA 2OV3A 3NBZC 3P9RA 4AY6A 3VR1A 1ADYA 4B43A 4LBWA 4JLBA 1XIVA 2HJMA 1W0CA 2ZRPA 4WCVA 1U5BA 3SPXA 1B0AA 3EXG1 4DBRA 4D5GA 2CKMA 1MNDA 3D5EA 3DFZA 1W88A 5AJUA 1X94A 4EELA 3U7IA 1ISRA 1T4CA 2OV2A 3H5LA 1N7JA 1N6HA 4JJZA 1GP2A 1IY2A 1CY8A 3OA2A 2F3QA 1KP3A 5E95A 5DNYB 3UUWA 4RELA 3DG9A 4UHFA 4UQLA 3DFFA 1LE2A 2IHVA 2PAFA 5G0WA 5KYTA 3T9OA 2QR3A 4Z9FA 2FK7A 1C7RA 1W6UA 3BGIA 4I4TF 4X6LA 2Z4TA 3JQRA 1T8WA 1X92A 4CQMD 5CLGA 5FJIA 3NGMA 3BIOA 2JIDA 3GT3A 4HAVA 4I1OA 5IFLA 4ZKEA 4IDNA 2WMYA 1VL1A 3L93A 3ZS9A 1YOVB 4J0QA 2X7JA 4AQDA 4ZWNA 5AKYA 1DIAA 1TKBA 5A4KA 3GPIA 5IH7A 5ES3A 3CPHA 5LA6F 2QSYA 4PVDA 1Z26A 3T95A 1KOFA 5IXYA 3UHAA 1CG6A 2PJDA 1P6UA 3OETA 3DV0B 3IEKA 4FIZA 4U7GA 4CBVA 5BNWA 4CS9C 1SRQA 2OQIA 4OBBA 3RIGA 1Y42X 3CKKA 2E4YA 2J9YB 4ESVA 5ADUS 1FYDA 3DBHA 4BO2A 4HMQA 2VBGA 1M1XB 2R6CA 4QDLA 4H3HB 1SXQA 3R76A 1OFIA 1Y5LA 4KRYA 4AG5A 4ZVVA 5HDQA 3WADA 1TLTA 4MKRA 1A9XA 2R6AA 1GQQA 1WAMA 2C78A 3DBOB 5G40A 1TT5B 1Z7GA 1NIJA 4GRAA 3ZW9A 2QZJA 1FUEA 1CB0A 1ESZA 4CI9A 1T3HA 1E0KA 4UHDA 4A0RA 2GSDA 3FOFC 2UUAB 3PFCA 3I9LA 3JQFC 4RV9A 3EVGA 3HFSA 3PHHA 2WZLA 1TM4E 2XM4A 3GRRA 2VP0A 1RZRA 3FMOB 4PYNA 4N5IX 2QPAA 2H1VA 1F2TA 2XLWA 1NJFA 4PYIA 3VPDA 3MCZA 4M7RA 2XTMA 2AI1A 4QRHA 5KTYA 1PTJC 2EBWA 1YNOA 1D2AA 1UXJA 1H23A 1X1EA 4CM9A 4FGWA 1XEXB 4M0LA 3V42A 4LGMA 5TIIA 4TLLB 2BYTA 1WJGA 3U3FA 2XMBA 1K89A 2A6HF 3EPPA 2F4NA 4Z3OA 3L07A 1E3DA 5FPTA 2EVWX 4B4UA 1RP1A 4DXHA 2E2WA 4DF3A 5JQGF 3WGTA 2R25B 4UMVA 4Z1MD 1CS0B 2WABA 3BTVA 1T0JB 5DFAA 2JA2A 1NATA 5BSEA 4LF4B 5A6SB 3UGOA 1QFSA 4HPWA 5HMMA 3IIJA 4EG3A 3U40A 4PLCA 3MWJA 3KVVA 4PFOA 3R8XA 2G0TA 3BMQB 4BNVA 1G6HA 1GGFA 3EAQA 3R3YA 2ENWA 4QO7A 1QH0A 1SKBA 3O8QB 1PZEA 3MXOA 4LXXA 1U1CA 1ID8A 2DFPA 4NYJR 5I7EA 1RXYA 3L1JA 3JQ7B 4DDKA 5LB4A 3VTFA 1H2AS 1IIBA 3WISA 5HFAA 2X22A 3HYNA 4K9NA 3A4IA 3HTKC 4RNDB 1YJAA 1K3FA 4BVFA 2KB0A 4YT2A 2WT4A 1Y4SA 3QQPA 2FEXA 3NTUA 4AP5A 3MQ4A 4A0HA 4IUYA 1G9SA 4C88A 1T0PA 2C59A 2HSWA 2C2XA 3RKOF 1NFRA 3PXUA 3UGQA 3S1AB 3TSZA 1POWA 4XEKA 2YXBA 4DRXA 5G1NA 2EJWA 2JIBA 1YE8A 1WKCA 5D3MA 1A9YA 3LDFA 2Y8EA 1WMAA 1SYQA 4QU5A 4Q9IA 2ZATA 3ZK9A 2QIOA 3TEJA 4ZTZB 2PUAA 3D7RA 5C1IA 2Q1WA 3BE4A 1IEWA 2BGNA 1MX1A 2QE7A 1EVEA 2Q0XA 4YJFB 4BV8A 1SKMA 1KVTA 1QUEA 3LX6A 2R6GA 4QVIA 5BRJA 1E32A 4WBSA 2XNJA 3M4CA 2GXAA 3U4GA 2A7QA 4Q82A 1W9HA 2I4OA 5B6PA 2ODQA 4WKOA 4UQOA 4C21A 4C06A 1BD4A 4HAIA 5DS6A 4RFSA 1VPDA 2ZJ2A 5LQCA 2A8YA 1VJTA 5HZMA 3N2YA 1PUJA 4HTFB 2IYUA 1DTWB 3NHBA 5LJIA 1P0PA 5E8RA 1H4TA 1UJ6A 3JQ8A 4KAFA 3G88A 2FPWA 3VHXB 5ERXA 4D43A 3AUXA 3DEYX 1ZD2P 1NQOA 4DMKA 1ECJA 2W00A 4Z5XA 4OQMA 2CXRA 3PGVA 3SC6A 1GQFA 4MUEA 3VO9A 3S2GA 2WAOA 3UJBA 2YWBA 3ZHZA 5A02A 3T0IA 1QB8A 5BNTA 1VKRA 1WM1A 2JIZA 4NONA 1KMHB 2EW2A 4CL0A 2RHLA 1ISJA 4F92B 1N1EA 3BB3A 2ARKA 2SKEA 4KU4A 4UNQA 2VP6A 1U89A 4YJGA 5CU7A 1PNQA 1OX4B 4M1TA 2ZJZA 2O3SA 2X42A 4WERA 2VT6A 3UJ9A 3HWRA 1JHVA 3PCRB 1JAXA 4I4NA 2C9OA 1Z0JA 3D6TB 4PC2A 4YJKA 1OB2A 3GJ6A 1S9HA 1R15A 1WDMA 1XELA 4TXMA 4Y0VA 3AJ9A 3M81A 1A27A 2V0GA 3CX3A 2L0XA 2EILC 2Y1DA 4MWGA 5TDHA 1T1EA 5F28E 5EHZA 2H9AA 1ZVMA 3S0XA 4G1EB 5LZ5A 3LJKA 4K6CA 1WQ4A 4JJFA 1EG7A 1W8DA 4GP9A 2ZE8A 1VLSA 4K87A 2FMKA 1N3YA 1ZUD1 4BZWA 3WYNA 2M1XA 2AKAB 4AE4A 2OHHA 2D4HA 1JHDA 4QGBA 5AUQA 4ABYA 1XTIA 2CEAA 3CVWA 2IBSA 1I13A 2JANA 1UZUA 3OLYA 4JLMA 1TVEA 2PX3A 4IO0A 2C42A 5LP1A 3WRXA 3ZY3A 2H06A 4TWZA 1C7EA 5PGMA 4PQGA 2Z6UA 1RADA 4Y8VA 4KO2S 1X80A 3DMYA 4U3JB 4QUAA 4JX8A 4E94A 1E7WA 3KYCB 4JP2A 2IITA 2BTEA 2XB9A 3GYGA 1LNSA 3HXKA 4Z3KA 2B0HA 3PWZA 3PEVA 3ZCQA 1N6RA 2VYVD 4KL8S 5GAJA 3L92A 2V7TA 1NVEA 2G62A 5T8KA 4BIIA 5M29A 1JIQA 1FFCA 3V7NA 4NXMB 3H1AA 5DM1A 3DBLB 1A04A 2DM6A 1WSWA 4UVGA 3FCSB 1J23A 3LEVA 4DVJA 2VWQA 1GZSA 2NSDA 1S4MA 1XAHA 2E1PA 4IIGA 1ZHHA 2L19A 4KYVA 3REGA 1U94A 2XVMA 3H6HA 4J7CA 3RVRA 2PX6A 5HKLA 2XUIA 1HZZC 5KTNA 1GY8A 1K08A 3Q0IA 5REQA 3TJMA 2EWMA 4Q05A 4QEZA 2FEAA 1QPZA 1X13A 1CZUA 1NTOA 5JQWA 2AF4C 3V32A 3VDMA 2BRUA 2WHYA 4WFQA 2YVUA 2AOWA 3OF2A 3LVQE 4M89A 1Y7LA 3MJVA 4YMUA 4HX9A 2Z58A 4D8WA 5AW0A 1NBMA 3EB9A 1O95A 4CG2A 4PLWA 1H6BA 5IBCA 4KQHA 1KJZA 4DLNA 2FSPA 1Z0KA 3ELDA 4LXQA 3VPBA 2F4VB 1QYDA 1KSJA 2QMEA 1UDRA 5A5VA 1GXSB 3RWBA 1O57A 2GPAA 5FBKA 3K5WA 2EZ4A 4FFSA 1PJ3A 4YO7A 5DYIA 3TLZA 4UOQA 2WM2A 3ZV5A 1YA4A 4G3XA 1EIWA 1AM4D 4PR9A 4RTJA 2JLZA 1TZMA 3D0QA 5HKBA 3HVIA 4R16A 2C54A 3RFTA 4WPGA 5K8VA 4GPIB 4JZKA 2OJQA 4Y7DA 5C1BA 2XADA 3RF6A 1A7VA 3ZKWB 2GTPA 5L3SB 1K6IA 4OQQA 4ZTBA 2ZSDA 1Y81A 3AJRA 3G7SA 2P75A 1E20A 1ORSC 1LB1B 4LHZA 2XVAA 3G5UA 2AGVA 3Q7RA 5HS4A 3O8DA 2IEYA 3RK0A 3PPVA 3DZCA 3T7RA 4V0OA 2CT8A 4YXFA 2W6IA 4BNKA 1SVUA 1RKBA 4OGKA 4EHDA 5CYOA 5ELMA 3FPJA 2KSQA 1Y1KE 4PLZA 1VYKA 4KLAA 1WNTA 1B2RA 1OAOA 1K8RA 1V11A 3RVDA 2JEZA 2ZZKA 1QYVA 1Z5NA 1BR2A 2XA1A 2Z8YA 3PPWA 5HMLA 2G0AA 2QVGA 3I04A 3K31A 2NSHA 4BE9A 4ZAGA 2GZHA 1JE0A 1XVIA 1OXTA 1KO4A 3DDWA 2DULA 2UYHA 1K3UB 4HEJA 3Q3GE 1AE1A 4LF8B 3AHJA 2O7NA 3RS7A 1GGNA 5DVZA 3GFSA 3COVA 5T67A 4R2WA 3T9BA 1L7EA 5JARA 4XFKA 3TGPA 3ZWBA 3P4UA 1US8A 2BKUA 4HUQB 1R9MA 4TV8F 4MGZR 4RZSA 3GUZA 1I0ZA 3BB1A 1NUHA 5A7HA 1A82A 3NWBA 3A7DA 4YQZA 4J2OA 2I4TA 3P96A 4KC0A 3KOZA 4B7UA 3V8VA 1F17A 4CLOA 1N8TA 1W85A 4GVPA 1NI3A 3GFOA 4B3BA 1IB0A 4WLFA 2X8AA 5LDHA 4X1IB 1ZJ4A 4MGYR 3LBYA 1IAVA 2REOA 4NU0A 4WXMA 4KFUA 1V41E 4AECA 1R00A 3BQ9A 1QIEA 1NW4A 3R75A 4CQMA 1R0SA 4UAJA 5JI2E 2YS7A 4XJXA 1EP2B 3C85A 1E3EA 4XGIA 3HJBA 5AJYA 1T13A 3M4BA 3CX6A 3TKAA 1Z5UA 4YP0A 3EPKA 3ZHXA 4V39A 4NCIA 2Q4TA 5FLYA 4LX8A 1FC0A 2XMDA 5C4GB 2WWTA 1U7DA 5H0IA 3O2JA 3AKZA 4AJEA 4I4TA 4UU0A 4ERNA 4G0HA 2K5UA 4P38A 3I1IA 4DDHA 1RQGA 1NFFA 2NZVG 3H4MA 3ZWAA 5EKTA 3D2BA 1XF1A 4CEJA 3N58A 4ER3A 2XGJA 3TTSA 2XD9A 2YJ6A 1H5NA 1D04A 4BEBA 1WTYA 4XGRA 2H4HA 1EEHA 4G7ZF 2ZI4A 2GAQA 3OFVA 4JB3A 4WXYB 3KE9A 4DVYP 1P77A 3VOTA 5LA6A 1E1LA 3DZFA 3MJHA 4DMFA 2FCRA 3EDOA 3S99A 4Y2UA 2X8WA 5K0JA 4LZNA 4QZVA 1QNLA 2PS3A 5LXTF 1WR8A 1DOAA 3VR3D 1LDYA 2YW2A 3FI0A 2G4VA 4NYMQ 1BSVA 4BFWA 4ZCIA 5HM6A 3V4OA 4TKUA 1L3IA 3QG5A 3QPCA 4KXVA 3K6BA 2X4GA 4YRRA 1TYDE 4WNAB 3JYNA 2HKIA 1WW2A 4OKSA 1Q50A 1ZGGA 2XUHA 1Z2AA 3VPHA 4R9NA 1XTRA 1YU9A 4BTEA 3PNBA 1P44A 4GR5A 2GKGA 1AS0A 4EHLA 1C3OA 4UD2A 4NZNA 4HGNA 4NX2A 3HKDA 1QIJA 4OFZA 3TQCA 2QY9A 1ZOOA 2IKSA 1FLAA 2XTZA 1WUYA 1P62B 4B46A 1YR2A 1TJ3A 3LGXA 5L8VA 5E4YA 1T0BA 3EK2A 4QO8A 4BVGA 3QXCA 2F2TA 3ACCA 3SS7X 1RM4A 4LJ6A 2HDWA 3N0XA 1FTQA 3ZWKA 4AJKA 3DWWA 1RXVA 2H2FA 1RQNA 2RIPA 1SD1A 5JSUA 3RSSA 2IZOA 3WSWA 1G5RA 2Z04A 1GFZA 3LLUA 4ZAVA 5DULA 3UMBA 3EEYA 1JOGA 3HR7A 3UXEA 2WVQA 4Z1MA 2WJHA 4QJIA 3AEZA 4N1AA 2CUZA 2W4QA 4XIJA 2O8DA 4DT1B 3HA3A 2QAGC 3C41J 4GX1A 5EWJB 3KVYA 4TZ6A 4UQPA 1MQ8B 2TSYB 3SLRA 2D2IA 4DGQA 2CLHB 3GLGA 3F97A 3NRCA 4EK9A 4IIJF 2P4SA 5JQGA 4YRTA 1NQAO 3CXUA 3H3FA 1LPMA 2QGZA 4LSMA 5AVUA 2EU8A 1UKAA 3FCYA 4PVCA 4MW6A 4GDMA 4X20A 4QLBA 4RW0A 2A1TR 5GONF 4UDOA 3USES 1XDSA 4FKMA 4WKPA 4DJJA 5IEJA 1IK4A 2R47A 4CQLB 1RKEB 5BVGA 4AYWA 1JWBB 1S1MA 4GNRA 2YNMD 1KY5A 4CKCA 3Q1KA 1EE9A 3LLSA 2ADMA 2QYSA 5EXXA 2VJLA 1CNMA 5EUMA 2I2BA 2JFPA 3A3YA 3G13A 5F7XA 1GG9A 2ID9A 3KSMA 4FYVA 4RZXA 4RCZA 3FX2A 3H2SA 3F3MA 4PAMA 4MVJE 4WZZA 2WVGA 2H4FA 3P9NA 3HTXA 2QRMA 3OC0A 1W75A 3PUWA 5DCLA 1PS9A 2OO5C 5FWYA 4JJ6A 1OASA 2PT7A 4QHSA 5F64A 4PZDA 4LDZA 3NKFA 1U90A 1RYNA 3PQ8A 4V0ME 4M9CA 4O8ZA 1DFHA 3WHIA 1VECA 3QRWA 1N2HA 4FHCA 3C39A 5G2OA 4NECA 4A91A 4O6MA 1TJ5A 4AJJA 5L0DA 3NW9A 1ZGBA 1B43A 2AZ4A 1D6JA 3OJWA 2WB2A 2QLLA 3ELBA 1E2KA 4IUDS 4RXMA 1ZHZA 4Q5SF 3BGOS 3JASB 3O94A 1QX3A 3SKVA 2WIJA 4ZLDA 2WVNA 3B85A 1KK1A 1GKLA 3KOUA 3L8MA 3Q8MA 5M5BA 3IEIA 5H3CA 2IY7A 1TEHA 1RAAA 1XXHA 3X1KA 1QKJA 4EYSA 3SHQA 4YHHB 3B6IA 3L9XA 4K9SA 1YZFA 1KSGA 5EZQA 4RKYA 1O5TA 4ZCTA 1V8PA 3IAHA 3NVDA 2Y93A 1EVJA 3VR2D 5D6NA 2Q49A 4U39A 1XZIA 3FJOA 4GOOD 2CB0A 4TTVA 3W04A 3OM0A 1BR4A 3DE3X 3O6XA 1RNLA 4A8JA 3ZHUA 1D2MA 3TZQA 3FLAA 5GPBA 1LTQA 4DLWA 2XR1A 5TRTA 4I4LA 2O57A 3AERB 5ALLA 4L08A 3B6KA 4S0ZA 1E64A 3RU7A 1CR1A 3BDVA 2AMLA 3IB6A 1FSZA 3GA5A 4DKJA 3L7CA 1O1YA 4GXRA 2VDQB 3DAFA 1N2OA 2Q7OE 1TX4B 3LUPA 2G5TA 1XLWA 3M2PA 1ZONA 2Z57A 3LO8A 4LIPD 1SD5A 3H83A 3W5BA 3KTAA 4HC4A 2FWJA 2DUJA 2Q8PA 4JDUA 1LTKA 1T6QA 3VKVA 4W5WA 4QBHA 4B3HA 3I5UA 1ISIA 1MCZA 4A2NB 3NYJA 2HAEA 1DARA 3GAAA 3LPDA 4DWWA 1RTTA 4IJ5A 2PLWA 5H8WA 4WK2B 2XYQA 1LF5A 3GROA 3PP8A 5DBGA 3HXTA 1NMSA 3C48A 4EX6A 1YVUA 1HYBA 1NAIA 5DLEA 3M15A 1JFFA 5B3AA 2OZLB 4JEBA 2ZUUA 2W8BA 3VZQA 1NFOA 2G5PA 3B0PA 5JDIC 1Y8AA 4C14A 4FNGA 8ABPA 1N5JA 3GX1A 4LY6A 3MBGA 1MC4A 3IQIX 2B94A 1FP6A 4V2IA 5BQIA 1JIIA 4DLXA 3B3FA 4JZAA 3ZOZA 1UMCB 2WD8A 4ENUA 3GUUA 2PGIA 4ATNA 3M34A 2B8TA 2A5FA 2IVZA 4FUTA 1IK6A 2I71A 5F7JA 4ND5A 3ORHA 1W2HA 4AY3A 4PY2A 5F5NA 2BBSA 1XG5A 2E7ZA 2RK3A 3EIOA 4AY2A 2Q28A 3FNRA 3D8TA 1KR5A 2ZJ6A 3E1KA 1UMDB 4M53A 1YCHA 3PSHA 2OBMA 1BS9A 4CODB 2VYVA 1YACA 3W8EA 3V8NA 4DG8A 5JLIA 3C8MA 4XTRA 1BEZA 1EVKA 4E09A 4M7PA 4DEXA 3UMMA 1S0UA 1OV6A 3IBYA 4KGDA 1XLUA 5TMDA 4W5JA 3IPLA 2GVDC 4KAJA 4O6NA 1RXQA 3L7AA 1MA3A 3B5IA 2PF4E 2J85A 4K3UA 4RKQA 3QFRA 4P31A 2CFSA 4YHBA 1E6LA 5ADVA 3RUFA 5FI1B 1P7ZA 1JT9A 4P58A 3U1BA 1B8OA 2M98A 4BOYA 2VH2A 4TMTA 3TJZA 3DB1A 4L27A 1RI2A 1I6KA 3SCZA 3HADA 4Q34A 1JQJC 2WSMA 4E70A 4I1MA 4XVHA 3WGNA 3VNRA 2HJ9A 1JBQA 2VJNA 4CLDA 4RQUA 3Q4GA 2ZI3A 1GPMA 5EFZA 3NOVA 2GN8A 4EMSA 5BSTA 1T3SA 4KR9A 2GEVA 4Q9KA 3VR5H 4KXYA 2PE5A 2E9SA 1G4HA 5HK9A 1B26A 4O2BF 2VDKB 1FK8A 4L3VA 4JC7A 3EA5A 4HDKA 4ZAXA 2H3EA 4F5EA 4GGPA 2MWMA 1RJ9A 4PR3A 1NFNA 1VG0B 5HIMA 3PVZA 4JCOA 1RBMA 4UTRA 4WSOA 5LMZA 5JUWA 1YO6A 2NU9B 3S7ZA 1AHHA 2IYLD 4NMHA 1AY0A 2HWYA 1BEUB 3IT2A 5EWMA 4C01A 3ZDLA 3F3KA 2WC1A 2Z2IA 1SR2A 3GN2A 2FX3A 4IMPA 2PMBA 4CDAA 3OOYA 2FTKE 3KTOA 1M75A 4RYLA 1OCRC 2YXDA 3AF2A 2XMZA 1OR2A 3CINA 1MP0A 4GFDA 4OM7A 4M8LA 2WZBA 3GGSA 3R0JA 3GJRA 3KZNA 3RRNA 2W8ZA 3MUFA 4C5AA 2ZIEA 4OIPF 1V26A 1EMDA 4DB2A 3N7UA 3C6YA 4PYOA 4U0JA 1GSOA 1P1RA 1RVV1 1JGTA 1ODCA 1PU2A 1KZYC 2ASVA 1AU9A 1TL7C 2VHTA 4GAEA 4XGQA 1SBYA 3AUKA 4EHFA 4C2BA 5ITSA 4LSGA 3L1VA 3H11B 1RTKA 1Q84A 2MSWA 2EYQA 4NQRA 2BFOA 4C22A 5A3JA 3GZNB 1J1ZA 3NBFA 1ZH0A 1QAQA 3VX3A 4JI7B 1V4NA 5H3HA 3T12A 2IS4A 2BEUB 4EBFA 4YAFA 3DPSA 2MR5A 1UEXC 1MMNA 4G4JA 4MUJA 2VNJA 2QJFA 4OLJA 4WEQA 3HKBA 3N7TA 1RRPA 1QZ3A 3NQ41 1IEVA 3HXMA 2ZUWA 4DCGA 4J1SA 3R8CA 1M2WA 3G2MA 3NVMB 5I5EA 1JAIA 2H7OA 5DTIA 4RVHA 1EZ4A 5HNKA 2J3DA 4RLFA 4ZMSA 2VUTA 1PZMA 2FQWA 3ZCTA 5BUOA 4TV8A 3EWIA 3PLRA 1I2CA 5KDOA 4DZZA 3DOIA 3OCZA 3QUSA 3GUYA 1UUFA 3I9MA 3LA8A 3KYIA 4RL6A 4EEXA 4CEIA 1DBRA 2P1AA 2HFIA 4URWR 1XMJA 4HXYA 3MT9A 4L72A 3AHIA 1M10A 2HBYA 1WCXA 3F5QA 2DWPA 4EJ2A 1SCAA 5DT2A 4DQKA 2Q0HA 3QKSA 3VHLB 2CLKB 1ORHA 4ZO6A 3ELUA 1WCV1 2Z09A 4YCNA 1N1CA 2YZKA 3PNSA 3KAQA 3UPUA 3SOZA 1FAPB 1I7DA 1YFZA 1YS6A 4H17A 1E2HA 2GZDA 4H7FA 3H2JA 5JV5A 2N3ZA 1CZNA 4HEHA 5ILQA 5KWVA 2OO3A 2FVYA 2LPMA 1ACJA 2EWWA 1VB5A 1U0OC 1C4WA 1ORVA 5AHKA 1IN1A 1UBMS 3FR8A 4DL9A 4FFBB 1N2IA 5CVUA 3K09C 1UPXA 3KQNA 1DOVA 4EGSA 3VR3A 2HXYA 1VIVA 2QL6A 4B9AA 1YFJA 1XMSA 1WY7A 3TK0A 1BCRB 2IX9A 2ASRA 3TTXA 3H8SA 3QHQA 4OQDA 4ARBA 3PDHA 2VRBA 4HF7A 3TI7A 2HWUA 2F67A 1Q0ZA 3WICA 3ZHYA 2VUUA 1I33A 1MRSA 4IMRA 1ZUNB 1O03A 5F1PA 5LXTA 1NULA 3TQQA 2WD9A 2WT8A 5BWLA 3DUWA 2PRZA 1RC1A 2FSSA 1NZFA 2B21A 3M3PA 1GTMA 3HE3A 4CSAC 5TSDA 4AL4A 2D59A 3DKAA 4OY3A 2BHRA 1R4ZA 2ZAIA 1NPDA 1UAYA 3RYFA 1U4OA 3K1AA 4NCXA 2R7UA 4X00A 4EJFA 1LBEA 3QX9A 3OFSA 4DXWA 2JGIA 4RZQA 3CUYA 1IOVA 4KZPA 1R88A 4QGFA 5C37A 4NC3A 3AHFA 3AINA 4LUCA 3VGPA 1U1DA 5DHRA 1GG2A 1GTRA 5EZ5A 4X97A 1NG1A 1LZLA 3R7FA 4X84A 3AR2A 3WRYA 3PEWA 1KXJA 4UCXA 3N24A 5KYXA 2X13A 3OQPA 3QF4A 3U60B 3EXEB 5CLIA 1N1DA 1V4VA 5BWMA 3AUYA 1I14A 4GUDA 3T0FA 2JBHA 5BYAA 4Q9LA 5J2UA 2EJTA 3FPHA 3EVEA 2JFYA 4MV0A 4W5RA 5KVAA 3UMHA 1ZEMA 2BSAA 2ZIAA 5CX4A 4J6FA 1TUBB 2X2FA 3QI2A 4MDHA 1TK2A 3B5EA 2UYQA 2D0PB 3I52A 2HSBA 2D5LA 1UH5A 5B1DA 3T7CA 3RIPA 1D7AA 2W2KA 4IIJA 4HDCA 5LR6A 4ALKA 2DB4A 4FT4A 2VHYA 1ZAKA 2YNMA 4TYPA 2VP3A 4R83A 5EZYB 4O4JB 4QLAA 4RPKA 4M6WB 1L4BA 1OH5A 4F12A 1JKXA 5JMWA 3K0CA 3HJTA 3C63A 5GONA 3NUQA 4FMDB 1HL7A 3MS2A 2D4UA 3STUA 4DR1B 3KIPA 4ZICA 5JOQA 3U0CA 3H1EA 4B6OA 4W8KA 2P8JA 1DB3A 3GFGA 3AFHA 1V37A 1J33A 2GJ9A 4V0KA 4CXMA 4YP5A 3FHTA 3UC5A 4LZOA 3WZLA 5HKKD 1XZBA 1SCUB 1NASA 1X9IA 3DXFA 5I8PA 1KJ8A 1E1NA 2LD4A 2ZK7A 4OQLA 3SE7A 5JMPA 4AKIA 2FG6C 1G7SA 1YB1A 1Z0IA 2EGUA 5B7QA 3RANA 1SMKA 3P94A 1XAJA 4HFJA 4CV1A 3IP3A 3OQVA 4LYHA 3AIKA 1TIKA 3PE3A 2WF9A 1ABBA 3DEFA 2P2LA 3VSDA 2QN9A 3COWA 2NT3A 1ZMBA 1C7QA 2XDQA 3OHSX 4OV6B 3FNBA 2ZSIA 3NUZA 1UBTS 3NALA 1E5QA 4V0LA 3DLTA 3KBOA 2Y0DA 3FFTA 5LBTA 1QKKA 3KB8A 4D9JA 4D0NA 3PDJA 1HSZA 5HSWA 3OOEA 1FTWA 1GNLA 4LJYA 3KYDB 1C29B 5B1EA 1A8UA 3CZAA 1PHRA 3U8VA 1RFLA 5GTDA 1NNUA 5JZOA 4E08A 2CLMB 1LU9A 3K0AB 3L8YA 3QPAA 2ZU6A 2OFPA 2RFLA 3QLUA 1E8NA 4UNIA 1JZQA 3JPWA 1SG0A 4EO9A 1ISGA 4DA9A 3LIIA 3FUCA 3RE1A 2FPOA 5FI3A 4DLSA 1BHJA 1WZIA 1QV7A 1Z7YA 2VYND 4BLSA 4PNZA 5CW2A 3W8HA 1K0UA 2C5GA 4LERA 1UFOA 1KEEB 4AS1A 5EPUA 1K66A 4DSUA 1EDZA 3AU9A 1VMEA 3F6PA 4X8MA 4XFJA 1CLUA 1ZZGA 3IQFA 5AK6A 4NEGA 3UB2A 1O4WA 1ZCFA 2FCAA 1R27A 1ECCA 2NVBA 1UFRA 4GSKA 3FOCA 3QITA 3RVJA 2CBGA 5LZ8A 2AKYA 2E18A 1YQEA 4RTQA 5E3CA 3CXRA 4PG5A 2QG4A 5JRAA 2GCGA 5G02A 3IAAA 4NF2A 3PI7A 4KE7A 5JXHA 4UM9B 4M1OA 3EZFA 3MK31 4JEIA 1UBHS 3EJ6A 3QFSA 4YRCA 2XJ9A 2NO0A 4YJHB 5L3RA 4D56A 5CEFA 4C0XA 2Q5JA 3G4XA 5SICE 1WQ1R 3MPUA 2FPGA 2AWOA 4IJQA 4IGEA 1V8OA 3VZCA 1ZIOA 2D0OB 1F1JA 5EE5B 1CUGA 2MSLA 2D8MA 4D0GA 1T5TA 5H16A 1TJPB 3HNLA 4JNKA 3ZWCA 3ETDA 1L5VA 4MV5A 4C3VA 1HWYA 5EKUA 1SAYA 3MCWA 4DN6A 5C7OO 4XX0B 1HTTA 4WXRA 1ZW6A 1B1CA 4X63A 2R6R1 1RJWA 1M2VB 3PDUA 2X3YA 3E7DA 5L40A 2VOEA 5CT4A 4UXIA 4RK0A 4ZOEA 3JAKB 4GX5A 5ALUA 2XRMA 4G0MA 1NPYA 1GRCA 3SYLA 2FJPA 1PDVA 4YX9A 2O3JA 3DCNA 1NMQA 4YAWA 2OQVA 1QH1A 5AUOB 4D0SA 1DRKA 1K88A 2H0QA 3WBBA 3B70A 4IIUA 3LVRE 1NXSA 3EZNA 2G1KA 1U04A 2VEDA 1G2OA 3NJ4A 1EXDA 4RK4A 4NZMA 3MIZA 4LAFA 2P9FA 4CKYA 1Z6QA 1S2LA 4DCJA 2B82A 3CTMA 4Z4IA 4GZ5A 5TMEA 5HX7A 5GINE 4IGGA 1IUPA 3H9QA 4W9NA 1F38A 2IUEA 1NR1A 1RACA 1V7QA 4I5DA 4CLHA 4F8JA 4S2EA 2BFPA 1P0MA 1TMYA 2IU6A 2D2FA 4JLOA 3SYRA 3K92A 5C8ZA 2WU4A 1FW6A 5L0IA 2GCOB 3FIUA 1J1IA 4I9FA 2WTAA 4MJXA 4MLZA 1RAEA 1BYUA 5I9TA 4B33A 2C8JA 1RBYA 3H2BA 1ZUWA 4MARA 1YFLA 5F52A 3VKFA 3O8RA 1S2OA 2ONCA 4O2BA 3VKHA 4ZI2A 3Q0TA 2JCYA 3QXJA 1MQAA 2EEPA 4P4SB 4YT8A 3GJ8A 3BAZA 1V3QE 3KM0A 4MO9A 2DH5A 4PR0A 2CNLA 3V8EA 4FNAA 1E1DA 1Z8FA 2A9FA 3LNMB 4PSDA 2JG3A 3OPYB 2GRUA 2VJMB 2DETA 2XUGA 4JC8A 1DKRA 4I46A 4IXNA 3VOSA 4FC6A 5EKXA 4B73A 4MQFA 1H65A 4MPRA 4C6SA 3JQGB 4HGYA 1UFBA 4DSOA 4Z2YA 1PSWA 3CF4G 3NJRA 1EUCA 5C5EA 1DEKA 2YQZA 1T9GR 4C2UA 2QTVB 4FMCF 3NHJA 4RMNA 2J7PD 1HURA 1PLKA 1AEPA 3RADC 1E6KA 2W4IA 3GNQA 4XRRA 3NT5A 5PNTA 2DY1A 4R8VA 2E82A 2MYUA 3QA9A 4L6CA 3ETLA 1E94E 1X87A 2NAPA 3K0KA 2O8CB 4LNHA 1TB4A 3E2MA 4KAAA 3GARA 5IPFA 2WJ3A 2X0KA 1SB8A 4XYLA 4MWZA 4MI9A 5E4FA 1AKTA 2BFEB 1R8QA 4O4IB 3ETGA 4XDYA 5BWNA 3F96A 2O5RA 2DUMA 2PK3A 3HBMA 2EHDA 5G0TA 1NMXA 2DPLA 4LEIA 1I8TA 2I22A 4US1R 4URVR 4ICIA 5EZSA 3U9SA 256BA 4GS5A 2NUAB 3W7AA 2ORED 1USWA 2LNDA 2D5BA 2NP7A 5KKNB 1JXMA 1KJNA 1CRWG 1RDFA 3T7TA 2QD4A 4GEHA 1P9LA 4XR9A 2CDAA 4B5LA 1T1RA 3GN1A 1D2GA 1JQLB 3RS9A 4C29A 1IHOA 1TOAA 4JUDX 1Z07A 1KAQA 4WZBB 4HWGA 5AM1A 1Q0UA 2XGMA 4UHHA 2BELA 1AN9A 1U7PA 4DM7A 3A37A 5A0VA 3QOYA 2NXNA 4I9NA 2GK3A 3NHMA 1GDTA 5B3JA 4J3FA 3AI2A 5AXCA 2PGLA 4H6VA 1U9JA 3FFBA 1ND6A 3LAWA 1MX5A 5AVTA 1KY4A 2P1ZA 3ITDA 3W2IA 1R0BA 5T41A 4L9SA 1QFJA 4M22A 2MJLA 1XX6A 2B5VA 2QM0A 3QKIA 4H7PA 3H65A 1IB6A 1DKUA 4JMLA 3N2KA 4GE0A 1LSOA 1EVIA 4EKDA 3LKZA 5FXMA 1UOEA 4J6EA 4I55A 4U2KA 3CH4B 1OFGA 4ARCA 3FOBA 3H2VA 4PZYA 2CLDX 2W45A 1BNCA 1YVEI 5FUVA 1Z0DA 1KH3A 1KEUA 2O06A 1CBUA 5HHTA 4L8WB 3Q41A 4OXKA 1SULA 1NT4A 1RSZA 3O0TA 3M1LA 2JLWA 3ZKAA 4KODA 3EOAI 5BV8A 1SCNE 3AEXA 3QE9Y 2VNHA 5H80A 1N6NA 3C8UA 3ZIUA 1PO7A 2W48A 1YRLA 2QSZA 1G3RA 3TW0A 4H1WA 4OMDA 4N40A 2O50A 2DG2A 1FJHA 2X5KO 1MIOA 4RS4A 2C2BA 4JP3A 5AW7A 3BTSA 4P83A 1AKEA 3K5PA 4AJIA 1Y9ZA 3FZYA 4PX5A 1HY5A 3BH6A 1P39A 2I0FA 1KK3A 1MMFB 2GT1A 2D13A 2NUPA 4EI7A 1M83A 3NETA 4IMIB 1XPOA 2F59A 1CHDA 3R3WA 3BMXA 3VU8A 4MPDA 3CPJB 2I66A 5LKAA 2G0NA 2ZVPX 3E3OA 1EWVA 2AWNA 3ZWDA 4JELA 3M4XA 4IQGA 1V1RB 1VI6A 3QMKA 5EXSA 3L18A 3E22B 5E9JA 3OICA 1W8IA 4QOJA 4JCCA 4O63O 3R6GA 3WL8A 3F2VA 1ILEA 4WMLA 3QOFA 1ZMXA 1I0IA 4RTKA 4HMOA 4J29A 4KBLA 1BWPA 4Z0NA 5E3HA 4KQWA 4ZAYA 5HM8A 3AXTA 3ZEAA 2H0RA 4JU8A 2XBMA 4H4CA 2GXSA 2J6CA 4PICA 1SUWA 3O3OB 2VHXA 2Z08A 3RSQA 1FRZA 4CU5A 1M2FA 1YRAA 2JX0A 4XVRA 1PNRA 1ONNA 3QOXA 4C7KA 1KO5A 1LWNA 1XHFA 3CH7A 5TJ5E 1ENZA 2NYAA 3ETHA 2XEXA 4Y6SA 1ZZEA 4NV0A 5EWLA 1RJDA 3AY0A 3SVLA 3VYRB 3HYRA 3NM5A 1O6GA 2XF2A 3HJCA 4Q4DA 4JYZA 4XPYA 1JKMA 3E81A 1G18A 1H9GA 2KHZA 4X7BA 1E9SA 5HUHA 1BZ4A 5AJZA 1YS4A 2ZR8A 3KT8A 2ZJBA 4KN8A 3CYFA 3EVDA 1O77A 2Q4OA 1U2SA 2XVXA 4HNGA 4OF4A 3N59A 1DRUA 5IWCA 1U3UA 3OVMA 3UA4A 2PFDA 5KVVA 5JRJA 1QONA 3MZ0A 3KHSA 2W71A 5CGZA 5DX0A 4F2GA 4S24A 2J41A 2NUTB 5ECWA 4AZ3B 4EP1A 2FY8A 1P2TA 2Q9CA 1U7WA 5IABA 1A8QA 3GWLA 2P5SA 3K2QA 1UC4B 1OI2A 2IPMA 3MS4A 4G36A 4GOMD 3ONWA 4IH9A 3SDSA 4LF6B 4H7EA 1Z0AA 3GBPA 3PL5A 4OXYA 2NV6A 3RIEA 5CNKA 1TF2A 1IQUA 1J0CA 4JC4A 2II6A 2BJVA 1FL9A 4DARA 2H65A 5JCOA 5CTJA 4X0RA 4B31A 5BUSA 4J0CA 5HKKA 4ECEA 1Z7BA 5CD9A 2OKUA 3WJ7A 3E1GA 3GLTA 4BFZA 2BMWA 4D8YA 4NJEB 2XQJA 1W25A 2ISQA 4QIHA 1XOIA 3A9UA 3THXB 2JJQA 3LI2A 2VB6A 5H5JA 3NHRA 4AN1A 1XQ9A 5HILA 3P0HA 4FBMA 1YZVA 4DBQA 1I2MA 4ZVQA 4K6MA 4I5IA 1WQ3A 1WDLA 5GV7A 1EFVB 1RABA 3SFZA 1JA1A 3MWEB 5JVDB 3ADCA 3R7LA 1UADA 3FWPA 3DE2X 3R7CA 4UEQA 2OFXA 3KU4A 4E13A 2HGSA 3CQ9A 2BMAA 3A26A 1P2SA 1QR6A 3I4FA 5LMCA 2UZ0A 4I81A 4PHHA 4K6KA 4I19A 1HDYA 1UBCA 1Z2PX 1T24A 2PZBA 3PXGA 1O8CA 1Y4AE 2BF7A 3RV3A 3GAMA 3EOZA 1ZNXA 4OBXA 3T5AA 2GN4A 4Q3DA 1OCZC 2GWRA 2I7TA 5NULA 2FZ4A 1BKYA 2VQSA 5KIAA 3O84A 2VYNA 4B6SA 4BN5A 5AESA 3IGFA 2PBFA 4IEIA 4JLWA 3ZE9A 2C2KA 2OBXA 4W8GA 4MPPA 1T2CA 4QYIB 3A70A 3RS3A 5SV2A 2PFKA 4AI6A 4XQEA 4CT0A 1V8BA 3IVXA 1QNFA 2O0JA 1RZ3A 2HHLA 4IDBA 3H05A 3UK6A 1W7AA 4MR8A 3DUFA 2YJ4A 3OZGA 4BWGA 3T7AA 3D3KA 4RD9A 1XNGA 2N9UA 1BE6A 1LDNA 1QDEA 1H22A 3HFGA 4CIXA 1L3CA 4TKMA 3WJ1A 1R4MB 1CQJA 2HRRA 2YKGA 3OHMA 2X7XA 1OLXA 3RWOA 1VHQA 3LC1O 3KUUA 4TKLA 4F4IA 5JAHA 2BGKA 2WY2D 3L6BA 3E8SA 2IXBA 4EHBA 1HQCA 2PNFA 1AKRA 3AO0B 3IKJA 1RHQA 1T36B 2QW0X 3BE8A 3A6LA 2ZKLA 4URZR 4A73A 2R1TA 3C0KA 3F90A 3A6FA 4S35A 1V25A 3F71A 2Y6UA 1CJMA 3VNSA 1IBMB 2G5CA 3I01A 2J5KA 2BFNA 3PFNA 1UBGA 3LWNA 4GPBA 2KGOA 3HDQA 3W78A 4A15A 2ZTMA 2OV6A 2VG8A 1EWTA 3AFNA 3LUHA 3PF8A 3AJMA 1YR3A 2A30A 4DA0A 4EUFA 2W0SA 4ASUD 4NOKA 1CK4A 5ALQA 4PC1A 2RHHA 1OBCA 3AOUA 4V03A 3ETNA 4KFSA 4FAPB 3ANSA 4BU0A 2J9WA 3T9AA 1B8UA 1HM5A 2JD0A 2H85A 3LCRA 2V74B 4CR7A 4ZJYA 3OP4A 1FNDA 1BWSA 1EP9A 3GF4A 4TOIA 4RANA 3FCUB 1KPGA 4OHXA 3KYJA 4I1UA 2FA9A 3CLSD 3BB4A 3R20A 3CMMA 2CJXA 4PFSA 4O1HA 5JE8A 2W6QA 4TQUS 1E92A 2VF8A 3R7WB 4FYMA 4US2R 1JS1X 4YK7A 4CMBA 4KFTA 2UUCB 2E4UA 4PG6A 1CP2A 3TN7A 4AJ2A 1R4TA 2Q00A 2IWRA 2ZUVA 3I34X 4MLDA 3U7RA 2F8TA 2C5SA 4IQFA 2N75A 4P7JA 1A9SA 5BN5B 4Q24A 1YJCA 4XB1A 4GMKA 4BVBA 2J48A 3KQMA 3ROEA 5KNDH 3FCOA 1JILA 4HVTA 4ZT2A 1CY0A 3AW9A 2GS9A 3ICVA 3UJCA 5F5HA 4X60A 2DCUA 5BT8A 2BDEA 1NSYA 1ZI6A 3E23A 3LPAA 3NZEA 1WIWA 2QRJA 4DVGA 3D8UA 1GCOA 1L5NA 2VS1A 5DTMA 5TLSA 1K86A 3DKRA 2VLIA 4N5HX 3TRFA 2IYZA 2GFHA 3E1SA 4F72A 4QUGA 1OA1A 2C9BA 1WUIS 4CS7A 3EYWA 3CVJA 1WSDA 2AXQA 3MPOA 1G66A 1JB9A 4Q9HA 3P0IA 4UREA 4EIYA 3O26A 1IMJA 1ABEA 2R8YA 1P1JA 3AL3A 3VYSB 3OJFA 3QSYA 1E2QA 1ZUIA 4MW7A 3LUTB 4YAEA 2VHJA 4QNRA 5JWHA 3H17A 4GC5A 1KI6B 3WB0A 4WZBE 2J7PA 5J2UF 5KMGA 2P78A 3FFWA 3ZY2A 4UUOA 5JFGA 2J32A 4RHFA 5CP8A 1SMYF 3RBVA 2VNAA 1KYXA 5DASA 3HY3A 4I50B 3IXMA 4PFPA 4JI8B 3U81A 3NNSA 4RVNA 3LC2O 1CX9B 4ADSG 2MMGA 4E7SA 3M70A 1GN8A 4RGVA 1TYCA 3RJ9A 5KQRA 5BXYA 2XV1A 2O07A 2PSDA 2VL7A 4QU8A 3VMMA 3CJQA 1XCJA 5K01A 2P27A 4BB5A 4BMNA 2CHUA 3A0UA 3AF1A 5DX8A 2IHBA 2M2IA 2E0IA 4OB8A 3KQYA 2NU6B 4L4UA 1XZDA 3JD0A 1XLVA 3M6LA 3HUEA 1XEFA 2H4JA 4FCVA 1CB7A 3VBCA 2AC7A 1ADGA 2OAQ1 4AZ0A 2XDYA 3DE7X 3NBQA 3UFXB 5KWSA 3IV9A 1BTOA 3H5OA 4UTPA 1M2NA 2AEJA 3GODA 4MV4A 2BGGA 3TNYA 1DDGA 3LQKA 4HAZA 2DAPA 1VLQA 1Y33E 4PHFA 4JOQA 3L7IA 3IQDB 3DAGA 4MUFA 4PONA 4K7BA 1IZMA 3KJQA 4GSYA 3YASA 5DI9A 3FTDA 1W30A 4LDJA 5ALTA 1YASA 4AX8A 3RTDA 1RBZA 1GRQA 3BXHA 1C0PA 5LYJB 4BKMA 3ROMA 4ECAA 1X7YB 5T3WA 2DPMA 2OORA 1NVVR 2Z5GA 2OHFA 4CMIB 4CFZA 4JC5A 3MT8A 5I9IA 1IPEA 4QARA 5KYVA 4CMGA 3PX7A 2YZMA 4XCXA 3WHPA 1TQ8A 5E1MA 1WU8A 1WOLA 1RXIA 3G4ZA 1JG7A 1M7HA 5M2QA 5CCBA 3QNWA 5H59A 3EJWA 2ZB4A 3CNEA 3FGZA 4HFNA 4PJMA 2YMPA 1SEPA 2R7LA 3NHSA 4KG7A 1N7HA 4AJ4A 4U9DA 3EUFA 3QU4A 3H1FA 4AX2A 1VKNA 4PC3A 4L78A 1SN7A 4BLRA 3IDSA 4QJ4A 5GOZA 5DMHA 5KOYA 5A4AA 4BJ5A 3ZLUA 1Z16A 2F6RA 3P4XA 2O23A 4AB1A 4I6EA 3JZDA 2ZYHA 2GJSA 4L8VA 2OQRA 4NAHA 1N2SA 1DAGA 2YS6A 2IOFA 1BU8A 1XLTA 3T9CA 3O10A 1KGSA 4II3A 1V74B 2WSBA 1FMVA 3HYCA 3SM3A 4JITA 2EZUA 1R0WA 2C8KA 2PTGA 2DOKA 4QECA 1RWBA 2R65A 1QIGA 3WYDA 1ZOSA 3SQMA 1A77A 4JLAA 4DV2B 1JAYA 3KR1A 1GPJA 1T6BY 3HBAA 1YB7A 2E89A 3D1VA 2UAGA 5K05A 3AETA 2VJDA 4ALIA 1T8UA 2JS7A 3ZI0A 3BHNA 3NI2A 2DTXA 3JQPA 1O6ZA 5MDHA 1R9NA 3BDIA 3PUHA 5JR3A 5D5PA 4MVJM 1ICIA 2V98A 1M5TA 1VC2A 2VPTA 4QOHA 1QCYA 1UPTA 5I5GA 1MC5A 3LECA 1M2OA 5JXWA 4ND3A 4NFSA 5CB4B 4C7OA 5TQJA 4MS2A 2JGLA 1L1QA 1IMOA 1QS0B 3OE5A 2OD9A 3IPMO 4RMGA 4Z2AA 4YRNA 4BLUA 2P9GA 2W4MA 1D2RA 3DDSA 1XFDA 4DWOA 4RF3A 1QR2A 2FFBA 1A7AA 2V3CC 1HT1E 4JXXA 1QZZA 5IANA 3JTMA 2H1HA 2BP7A 2I1QA 3O2SB 3CISA 4WH0A 3NH9A 2VRCD 3WRVA 4OH7A 1MDFA 3WWPA 2G3VA 3QG1A 5C35A 5FBVB 4WK4B 5DLYA 2OK8A 3IPXA 2XGGA 5DBFA 5HF6A 1MORA 4PW0A 5AM0A 1YUMA 4FZJA 4X54A 4BLOA 1M6WA 1NYTA 4P7KA 2HFJA 1AD2A 2VK1A 4Y2TA 3N8IA 2OOKA 3SC2B 1VI5A 1DEAA 5K8TA 1H6AA 3SXPA 3JPYA 1AVOB 3B20A 4W6ZA 2R96A 4HKTA 3IMKA 2B69A 4NV3A 2OG1A 2OXFA 1XMQB 1VP3A 1YVIA 2AWCA 4AZWA 3WGQA 3WGVA 1L4MA 1NR5A 1N4DA 3EPHA 2OCPA 2EC5A 3KWMA 2A92A 1KFEB 1H0HA 2WV7A 1U3DA 1W19A 2B7CA 5ECGC 3TZLA 4WVFA 1NYLA 4BFXA 2OGSA 4CIDA 1JHMA 3OWHA 5J4HA 4FI3C 1VCOA 5DZSA 4DV5B 2WLSA 3ORQA 4CPDA 2YIJA 4K1LA 2Z8ZA 4BP9A 2EJVA 3G9TA 3GPCA 4TGLA 5AXBA 5JZBA 2DXIA 3DWEX 1TXGA 1N32B 4X1KA 1SUIA 4RTLA 3ESXA 4ZLCA 4AM8A 1SHKA 3SVZA 5A3VA 4LYJA 4J1NA 4K0DA 3DAOA 4IJMA 1WHTB 5BPFA 2JEOA 4DR2B 3ZTZA 2XB6A 2Z3ZA 2Y9MB 3T54A 4K9KA 2WM3A 3LUGA 4FOPA 1EKXA 4D1YA 2J08A 1AXRA 5AW1A 2SICE 4R1TA 1FS4A 3TW6A 4CEHB 4X7MA 3CUTA 4QOGA 2H7BA 5I51A 2GZ3A 3KT6A 1GFWA 3WL7A 5DH9A 2IP4A 3DDNA 3O2QB 1CY1A 3UUEA 2Y66A 3MUNA 2WZDA 4BRSA 1C1XB 4HDOB 4XPXA 1TCUA 3RC9A 3WL5A 4EHNA 1WPQA 3ZUGA 2ORVA 3CM0A 5KU1A 2FPSA 4MYTA 3Q40A 1IATA 1R6TA 4N01A 3FE2A 2P1RA 3U61B 5ALNA 1APBA 4H54A 3X3HA 3UB3A 4XOUA 1QYIA 2R8PA 3TDKA 3HVRA 4TVOA 4FHZA 3RVOA 4HSEA 5IM5A 4WGGA 4NAVA 3O7WA 3HU5A 3M4NA 1PGOA 4PZ0A 1VLJA 2EXXA 1IXKA 3BH7A 4XARA 5BQ5A 2WU0A 3RFVA 4E03A 3EQ8A 4IHJF 3CG4A 4HH0A 5C5CA 3CIFA 5AK5A 2F3TA 2C2WA 2EYUA 4NQFA 4UEWA 4HB2A 3LPLA 4YNBA 1Z2EA 3OE1A 1F48A 2JIRA 3V7OA 3DT9A 1R7RA 1PGNA 1Y1RA 4NY3A 4YQYA 1VE3A 4DR6B 2QTCA 4QOIA 4G37A 3K4HA 2C07A 4IUBS 5TX7A 3ZDYB 3HLZA 5TMPA 4HK4A 2HNBA 5JP7A 3L8GA 1H5UA 1R6UA 2GO7A 4RM3A 4HP8A 1VJ0A 3UXYA 4GU5A 2ZWMA 2HRBA 3CNNA 3SZ3A 1WCWA 3QVKA 5EGYA 1X1BA 1NM5A 4F3YA 1GGMA 3UMRA 4MR9B 4RVUA 4XUEA 2BC9A 1CIPA 1S2NA 4MW9A 3HCEA 3WWEA 2VWPA 2APJA 1ZR2A 4YCAA 2LP4Y 1NN0A 5IVKA 3E2PA 3NIDB 4ROTA 3O1LA 3L02A 3K71B 2A0UA 1E9RA 2PL9A 4AXBA 1WDTA 4KR6A 1ZFNA 1XN1A 1GTL1 1X1RA 2G3KA 1KI8A 4RM2A 2QE9A 2H0AA 2GVZC 4XYBA 1VSQA 1OT5A 1N0HA 1SC4A 3OQIB 2L7AA 4PCUA 1KY2A 1XZCA 1LI5A 1ZUHA 3JRWA 4OI1A 1H7IA 2IBFA 1U4SA 3Q98A 4UJ5A 2ZT8A 2JZCA 5DGDA 2IYWA 2I55A 2WYOA 1XRQA 2QLAA 2SKDA 3TSAA 3KKPA 3G0IA 5KINB 4FYYA 5IHXA 1VE5A 3AEQB 4HYQA 4S05A 2R7QA 3QQ5A 3KOOA 2E49A 2HIAA 5EGSA 1X7GA 4HRAA 1XDUA 4ASUA 3U56A 4I55F 4G1MB 1KDTA 3NIFB 1WWPA 5CA1F 3T4PA 1UPUA 4AFNA 4KXLA 3UWPA 4EYGA 1C8VB 1O08A 1R50A 2CZQA 1NQUA 1JLSA 2I78A 4JH0A 4NCJA 4KTVE 3CW9A 4ZPJA 5JS7A 1S02A 1JWLA 1RRCA 1LFDB 3CF6R 4GYJA 2AFIA 3N0RA 1QBKC 3C7KA 3I45A 5LC1A 3LUFA 1LUAA 1KBZA 1T9DA 3IERA 5BOVA 4CMCA 1T5DX 1YGPA 4DUZB 1IM5A 4XB2A 4EFKA 2W22A 1QF7A 2Z9DA 5CVJA 3AM1A 3MT0A 3LEOA 3SQOA 2O1EA 2NVUA 3FGPA 3R4CA 4NYIR 3RSZA 2AMYA 3HDJA 1Z4PX 4JKYA 4ZK2A 3GVIA 3EXIA 1N9GA 5AC5A 1KDVA 1RI5A 3G3EA 3TPZA 2YRFA 3NTVA 4XIIA 2OLJA 3FI9A 1CJCA 4R40A 4AP9A 3ASOC 2P2CA 4OL9A 4Z7OB 1SZCA 5IDWA 4KQGA 2PUDA 3RHSA 1NLFA 1P81A 3UG6A 1HZZA 3L8EA 1NL3A 2QLTA 2W4BA 1RKQA 4AMGA 3TVYA 2FPIB 4LWZA 2QIPA 3AIIA 3SJZA 3VSCA 2MINB 2PYDA 4YASA 3PRJA 5MFZA 2J0SA 1SA0B 3N0TA 3LLVA 1ZITA 2BCEA 3HWX1 2QRPA 3TLYA 1PVVA 1LPNA 3G1TA 2EIHA 3SS9X 1EESA 4NJMB 2ACWA 4QUKA 5JDCC 1SHUX 1A2QA 4KLCA 3CUEF 3EC1A 3EBLA 1U2TA 2VFAA 5K3DA 3HN7A 7YASA 5AVWA 3ZNQA 1XZLA 1BBHA 3EHEA 1YS1X 1U2RA 1FX0A 1J97A 3BD8A 1RYEA 2A3RA 3QPVA 4FJ2A 5C7LO 4DLRA 2GAAA 4R1UA 4KV9A 2J3LA 3IE0A 2X0CA 2V0CA 2O8VA 3ZWWA 1D4FA 2UYYA 3CZ9A 4HQOA 6Q21A 2R0QC 1BVYF 1E69A 1EJ2A 3W3AH 6YASA 5AO9A 4R2HA 5BQPA 1DXOA 1E3JA 3VJLA 2VQFB 3L79A 5A4MS 2V58A 5AKEA 3VRHA 4R5HA 5E6RA 2QZSA 2HWXA 3MMSA 1LK0A 4CKBA 4MDYA 2Z98A 2QF7A 2X40A 1CJTC 5I48A 4B6PA 3L84A 2QSJA 4LLEA 3WKCA 1YJ5A 4DV3B 4PACA 1V7PC 4YRJA 4MEJA 2EF1A 4G9BA 1CRQA 2OCYC 4FQ7A 2MR6A 4TYMA 1L7NA 3LFUA 4B3FX 1EM6A 1A4RA 1Q1BA 2QGFA 1BGXT 3QV2A 1HGXA 4F6RB 4LECA 1DWPA 3V00A 3RAPR 3MFNA 3GRPA 4QQRA 3PDCA 4KWEA 1WEHA 4N8DA 2YHIA 1OT3A 3V80A 3W3ZB 2WICA 1Q0PA 5EUQB 1NHGA 2CWDA 1L5OA 4YP7A 1FDIA 4FM9A 5G1PA 3NHAA 2X0EA 3EXHB 2BR5A 1ZMOA 5AIBA 1PCXA 5BR1A 1J0BA 3D31A 4DSTA 3JARA 4NENA 2H59A 3MJSA 1APCA 2J9GA 5CT6A 2ZRJA 4EB6A 4O1MA 4O4LB 2RGYA 1YRHA 3I1YA 3RAFC 3JATB 4Z49A 2PUTA 1EWQA 3DO5A 5K4AA 2WKSA 1YXMA 2FK8A 3VR2A 1D7OA 3CCFA 1O9HA 3PJGA 4AJPA 2XTJA 3DZBA 4URFA 1I4LD 3AGUA 5JS8A 1FUIA 1M1NB 3OQBA 5A4JA 3R9WA 5F76A 3E5RA 5IDYA 4AKEA 5K20A 2DTEA 1NXPA 2IUFA 3O92A 4QXRA 2Q4FA 3V55A 1Y6QA 4MRPA 1F1MA 1G8MA 1C0KA 1MABB 1R5OA 1K3TA 1XI2A 4LXTA 1K5HA 3Q2IA 1TQDA 4LY0A 3INNA 2R48A 3P7MA 5JWRA 3HBNA 4RTOA 4S2UA 4D80A 1ORIA 1W0KD 3GRVA 2YY6A 5ALVA 1CYDA 2D1SA 3NP9A 4R05A 3OH8A 4WRRA 4XWAA 1PR6A 1U0EA 3X1MA 3WDMA 1D9XA 3C3EA 4Y2GA 2I6QA 3HRKA 2QYTA 4EHAA 4EUKA 3A8TA 3ZU2A 3HYSA 1SG6A 3KO8A 2BMJA 1XT6A 4P53A 4D3YA 5DS4A 3FBTA 1P8JA 2B61A 1M34B 4YN0B 2PUEA 1F0NA 3TRIA 1GU1A 4D3DA 3G9XA 4OP2A 4YPVA 5FBHA 4FDLA 2J0VA 4M63A 1T5BA 3M6FA 4I1SA 3G8DA 5AJXA 2VRCA 1P4GA 3GPDG 1NBBA 1W93A 3K2IA 4PC6A 4WKBA 1VFPA 4OHBA 2XHEA 1UAAA 3HB4X 5LQAA 4INJA 5AOCA 1VBFA 3KQSA 2BY4A 3QE2A 2SCUB 2BEWB 5T4HA 4BC1A 2CCJA 4BLVA 3QW0A 1Y9AA 2MDTA 4UUQA 2SKCA 4ZP1A 5D00A 4JI6B 1ACLA 3BSSA 3CLRD 2FWMX 3HA7A 2AZXA 3E35A 4X9XA 3S2ZA 4V0QA 1YZLA 3PB3A 4JWTA 4LFBB 2I8AA 4KIWA 3ORRA 3VI3B 2NP6A 2HEIA 1WLSA 3GEIA 2G3YA 1A5SB 1QRTA 1K92A 1XMXA 1SOUA 3URKA 1IBSA 1UDAA 2XVZA 1DC3A 4GXQA 1V48A 1F0YA 1QHFA 3HO6A 4UFNA 3ICQB 4QDXA 1KAOA 2ODWA 3CZRA 1VSUA 4J4BA 2P69A 2XODA 3D8SA 1LNQA 1EWRA 1U0NA 3HN6A 3MYYA 1VTKA 5K0TA 2HYDA 3BICA 3RSLA 2A0BA 1BC5A 4AKTA 4PCVA 4G4GA 5C18A 5F1KA 3T3GA 3KQKA 1Y3CE 1ZINA 2GPBA 2F3PA 3E9EA 3LRXA 2AN1A 3ABZA 4EJSC 4N0DA 4L75A 1FLNA 1VJDA 2JI7A 3S8MA 3B6ZA 3OCUA 2EPNA 1CE8B 2QVLA 5DK4A 1CUHA 2Y1CA 5L4SA 4N54A 1NR7A 4RO0A 1GL3A 3NYWA 3AP1A 2D00A 4CM4A 4BGIA 5C2JB 1DC7A 3CLUC 3WLHA 4U2GA 1KK2A 5TVGA 4B3MB 5DBEX 1FTGA 3GRZA 1A8IA 5JC8A 5FDFA 3I62A 1KXZA 3UVEA 4CDNA 2CDBA 1GPAA 1NIPA 3JCZA 4QXPA 4J2HA 4YUAA 4UUBA 2QKYA 4ZZ0A 5SY6A 4P4NA 1ZN9A 4G65A 1J8VA 2V97A 5FBZA 5IT4A 3ZHOA 3RQSA 3ZZUA 2CXOA 4DNPA 2QTAA 1I80A 1Y5NA 2A5DA 3NTOA 3AFIA 4UXHA 4TMFA 3OJEA 4FE4A 3DP9A 2V1XA 3X1YA 3LUKA 1EFUA 1DC5A 5EVJA 1M6TA 2NSJA 2XNHA 1QC5A 4TLEA 4CIHA 3AL2A 4IHJA 4AS3A 1U2GC 5T5QA 4G0WA 4ZKDA 1QDLB 4HLCA 3EHDA 4PJJA 3H8VA 1B2LA 4B6GA 4YRGA 4KOEC 3NDBB 3A3KA 3P9KA 2PMKA 1JJAA 3U5TA 1JEYB 1N3IA 4OMUA 1USUA 4HNVA 4Q15A 1NUUA 2OILA 2VT3A 4QNNA 1DKMA 1TW3A 5KPDA 2Q2VA 2BBOA 2LBPA 2LRHA 1YB5A 4UBJA 1ML3A 3LS1A 2I3DA 3BMOB 2I9PA 1BX1A 3WVNA 1JRAA 4G1VA 3KNZA 2IXEA 2HNAA 1WUTA 1WXIA 4ESHA 4WFJA 3HKCA 4NRDA 4UKDA 4FGUA 1WV1A 2IFTA 3IHKA 4CYMA 1WBJB 3M3HA 1MGOA 1SXJC 4X95A 4GDFA 1RXUA 3BXPA 1VXRA 4FOSA 4C4AA 2BI8A 3OQMA 5K0ZA 1C1YA 2QN7A 3ZZNA 2FSFA 4N5MA 1C50A 4N6CA 4K46A 1XNRB 1Z23A 2BE5F 4GL4A 1GTVA 4JIOA 3FVQA 3MOIA 1QG6A 4EG1A 2BKXA 3EG9A 2XCSB 3ABSB 5CVDA 3V4ZA 1ZJZA 4KWIA 1ZJYA 2QUZA 3H5AA 3AR6A 4PZZA 4DQLA 5CR9A 3SAJA 1V6AA 3UCEA 5DP1A 4NZ9A 4UZFA 5L3QA 4JI0B 4DIFA 5ALOA 3ZV6A 2VSXA 3IAFA 2P8SA 2FPRA 4R54A 5DF1A 4C4YA 4ER7A 3UHFA 5JDIA 1AGXA 2J4DA 3O31A 2FLKA 3E5NA 4DYHA 4EYKA 2JK1A 3IP5A 3SF8A 2ZYSA 2Y76A 2JATA 4QBIA 5K0CA 3D8RA 2XZLA 2Y99A 1L8AA 5CA1A 1VI2A 1V8DA 1LPAB 4D9IA 4EJSB 3H2KA 3I6YA 3QZUA 1X3LA 1S1CA 5EUBA 1LV8A 3FSJX 4K6OA 4F3CA 2AG1A 3PITA 3T38A 4YUXA 5KOJA 1UODA 4U4AA 5FJJA 3SZRA 5CPBA 1MLDA 4EG7A 5LOVA 3K6SA 3ZV7A 1R0XA 3NHYA 2LIVA 3DNPA 4FOTA 4F5DA 3SHOA 3FDJA 5B3LA 3BBPA 1QFZA 2Q2OA 4J7UA 2P1DA 3AK4A 4B76A 2F1KA 5HQJA 3TECE 1TYBE 5FAKA 4WN9A 3IUBA 3GI1A 1KRWA 4KRXA 2AYXA 4WK0B 3MINB 4R2XA 4DILA 2GPYA 1E83A 3FOAA 4F4UA 3DONA 2X0FA 5BUZA 2YC4C 4ENRA 4HQKA 5HQTA 3KVOA 1KAGA 1KO7A 1CZLA 2JLXA 3V7YA 3NTQA 3VH2A 5JC1A 4DLKA 3AI1A 5K2OA 4NTAA 4X1OA 5MGNA 2A14A 1P0FA 5C4MA 4TLMB 4HNAA 1TTHA 1J90A 3G02A 4U2FA 1N4AA 5JBQA 2I99A 3U9JA 3PGA1 1ZK1A 5A6KA 3ZVKA 3KEFA 1KQ3A 4R8LA 1JXOA 2QLBA 1DTEA 4MW3A 1UBJS 4WI1A 1TK9A 3VR6H 2MYPA 3VSEA 3DYBA 1QVZA 2AN9A 4IWNA 1CZHA 4TTTS 1C9JA 2LK4A 3IMEA 2HJ3A 3QWBA 3F5DA 2IYYA 3C3YA 1ZL0A 2HCBA 1S2IA 4DHEA 1G8FA 1PTKA 4NCQA 1DQNA 1KH2A 3L5KA 3LTNC 3UT5B 5D7BA 2G06A 1A88A 1IM8A 2OESA 3KQUA 4II7A 4MVJD 5DDIP 3WE7A 5IMBA 2Q6TA 5CLLA 4Y6PA 2UUBB 3AM5A 3IRUA 3WKEA 4N9WA 3KQQA 4MWCA 1SXJB 4REOA 3FAKA 1Y89A 2O6LA 2OP1A 2XQFA 1VXOA 3EIFA 4QUDA 4O8CA 5IRCD 2Y67A 2FAPB 2CE2X 4LSWA 4M87A 1FU4A 4C1BA 3I05A 4B7XA 2HWWA 2PRYA 3FIJA 2O05A 2SHKA 3KXDA 4UOEA 1VGRA 3DO6A 1PR5A 4RDXA 4YDRA 1S4QA 1Q1AA 2PEZA 3E0XA 4M9ZA 5BSFA 1Q15A 2GDZA 4LQLA 1GNQA 4EPWA 3M1YA 1RAHA 4RJLA 2IH5A 1G3UA 1MZPA 2PUFA 4KK4A 5FH9A 3RC3A 2ZVDA 3ZGOA 4WOJA 4WUTA 2DR0A 3T3MB 1H3FA 2QMYA 1EXNA 3D4PA 5HIKA 1LNZA 4LYFA 4FS8A 3TWOA 4D9BA 1I5RA 4R31A 4PHCA 4EWLA 1FSFA 4ZCLA 3Q10A 3WK4A 4HGRA 4EFMA 4PNPA 2DY0A 2JRLA 5JZMA 4MKFA 2BZ0A 2QT1A 3DOCA 1U9CA 4RZ2A 5ITVA 2ZIWB 3TLKA 4F1WA 5FL7D 3NCHA 1XZ8A 1K1EA 2WJYA 5EZ6B 3UKOA 1BW9A 4ZZ1A 3E3NA 3C1TA 4QEKA 3UJNA 3BSWA 2CCKA 1M34E 2ZCJA 4G67A 4G63A 4H9GA 4A9AA 5IF3A 4DSZA 1MBZA 3DXXA 1R3UA 1ZRMA 3UBMA 3ZWVA 5JNRA 1UAGA 3VU9A 3UTDA 4LE0A 1E2DA 5JSYA 4OIRF 1QLEC 3SJCA 1UBFA 1J00A 4E2FA 1KI2A 2WW8A 1PE0A 3ZHCA 7MHTA 4AMBA 1LJLA 2W70A 2CLCX 1DL5A 3T5PA 1YQ9A 4NKRA 5BR8B 4H7IA 4DPKA 1W0KA 5CXSA 4GPD1 5T3TA 1PJ8A 4WJ0A 3M9WA 1ZI9A 3PDWA 4CUJA 3ZVNA 2GCIA 1K7EB 2JCXA 1QV6A 2I1LA 1C2YA 4B80A 2VNKA 4NNPA 3AEUB 2XSZD 3WMWA 3O7MA 3R9KA 1T5OA 3IBGA 1H4SA 2IA5A 4PTYA 2WMDA 3DXYA 1DC6A 5DNWA 1Z5ZA 2VSQA 2GUGA 2GCPA 1HR0B 4E3WA 4FJ1A 2W2NA 3Q11A 4IG9A 1WA5A 2O52A 5TQ0B 2OGTA 2YVQA 1U1EA 1T0HB 1JQAA 4A92A 2IHKA 4Z9IA 5CLFA 4N7MA 3MJDA 3J06A 2Z2XA 2LTAA 3QKTA 1HETA 4ZJZA 1P8AA 2HA7A 4OUKX 4QDOA 3SYKA 1QHHB 1H2RS 1OILA 4XR4A 3VHQA 2RHJA 5CM2Z 3L6DA 2V45A 3RRMA 2BTQB 3JQAB 2BFCA 1XZHA 3H5VA 3BK7A 3L6RA 2PVCA 4J30B 4W9RA 2GK6A 2DGDA 3GBVA 3A4TA 4B35A 4YCCA 1DXHA 1VGVA 5K0GA 1GGVA 4M83A 4PINA 2ZR9A 2HK7A 1UM9B 1VYHA 2HI0A 4XQ1A 4IRUB 4IZIA 2G72A 1G5IA 3SMVA 4DA6A 1TKAA 3WGUA 1H2XA 2Q6LA 1V43A 3ODGA 2C2MA 1JHUA 1AB6A 3BHIA 1HE1C 3M89A 3WHLA 4PGFA 3SEZA 4CGYA 3G0DA 2ZANA 2QYHA 4JLNA 4BO6A 4BNMA 2VBIA 1AV6A 4A0QA 3QVGA 4ZQGA 3U9MA 3V1KA 3WX0A 2C3UA 4J7AA 2ONJA 4FLMA 2KMLA 2JIQA 2VF2A 4CCSA 1O94C 2REQA 2DT8A 4JBYA 2VTKA 1T2EA 2ZTUA 3AUFA 4LDPA 4LJ4A 4QDJA 1MEJA 3MRVA 3EDRA 3HGMA 5DK6A 4IFIA 1JQKA 1QTIA 4YDHB 4QI2A 2C4UA 1OREA 3NRHA 4QWWA 1AQJA 3ZYCA 5LP6B 4YAKA 2J30A 4RESA 1SCJA 1UL1X 3D2LA 4E17A 3ME5A 2EIJC 4TUYB 1C41A 1NTRA 4J90A 2CXPA 4OGWA 3RF3A 4DCSA 1CUYA 4F46A 4W8PA 5LLTA 1Z82A 4X64B 3FVWA 1IY0A 1II9A 5HF8A 3B1VA 5WRFA 3LFHA 1C0EA 4CR8A 2E3JA 3C2QA 3Q8KA 1AQUA 3QA3E 3V7UA 4DADA 4Q1DA 1D2HA 1YOVA 2R00A 2A9VA 2R1VB 5LU9A 2IZZA 4XCQA 2X5XA 2DECA 2X0DA 5DYGA 1OTXA 1ZKDA 3MCVA 4K0RA 1ESMA 2BE7A 4QAJA 3U7QB 3L8CA 5K3FB 3AJDA 1NVMB 1QORA 4BEJA 3OESA 4NFHA 4WEOA 2QYOA 2AXEA 5EEGA 3UGJA 4R9RA 3DV0A 3H0CA 1CFJA 4DRZA 4Y2RA 1JUDA 5KEIA 3QK7A 1VYIA 4UUMA 4KLRA 3BUSA 4E33A 1VYTA 3TULA 1OY1A 3D3JA 3H9JA 2BDTA 4CLEA 5SZHB 2PAAA 2WSIA 4ZEVA 3JV7A 4R1SA 2GF9A 2VA8A 3LW7A 3L7JA 3A4LA 4MWEA 3WKAA 1RQLA 1TZBA 2VYCA 1RWMA 3K5IA 3EIEA 1JSCA 3SR0A 1JQ3A 1W96A 3DGEC 2QN2A 1XAGA 4LRSB 2WOJA 3DDHA 3ONVA 1OOEA 3SXUB 2QMHA 2AQKA 2WF8A 3OI7A 1U6IA 4NATA 3IQCA 1TT5A 3GC6A 4OG2A 1FU8A 3OQOA 3QKRB 1T4GA 1XJ0A 2HSGA 4N7JA 3THWB 2JFFA 4RMIA 1TPZA 1OH7A 1CZOA 3NWEA 3W2EA 2IY8A 2AEFA 4MB0A 5D3KA 5EMMA 2QRGA 2YWRA 5BQXA 1XNQB 1E0DA 1WHSA 5GY7A 5HK8A 1TJ4A 4WNCA 4PRZA