4ZLCA

Crystal structure of the roq domain of human roquin-2
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
155
structure length
155
Chain Sequence
QNPQQLSANLWAAVRARGCQFLGPAMQEEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKTSIGHVVQLLYRASCFKVTKRDEDSSLMQLKEEFRSYEALRREHDAQIVHIAMEAGLRISPEQWSSLLYGDLAHKSHMQSIIDKLQSPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords Roquin-2
publication title Structure of human Roquin-2 and its complex with constitutive-decay element RNA
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 155
sequence length 155
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18386 ROQ_II Roquin II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1790 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4zlcA00
5F5HA 5F5FA 4ZLCA 4QI2A 4QI0A 3X1OA 4YWQA 4ZLDA 4ULWA
chains in the Genus database with same CATH superfamily
2J9WA 4LDKA 3LS1A 2XXAB 2JD3A 3JYHA 3PDMP 3EJNA 4JCHA 4I3MA 2Y3GA 1GQAA 1VOMA 4MW8A 1NFNA 3TJ5A 4FAPB 2Q7RA 2VCCA 4MVQA 3W8IA 3ZQYA 3LLIA 2F22A 3U2LA 1G4US 2ZPAA 4Z9JA 5DS5A 3Q6MA 4XLPF 2D4UA 3RVYA 3GORA 2GA0A 3X2QC 5KYXB 3M79A 4MVSA 3NYLA 3GWNA 3DWWA 5K0IA 5A6AA 4F4BA 2FGYA 1T6QA 2XLMA 3VAYA 4EIYA 1WGWA 3TK0A 3FMSA 1RXQA 4DBRA 1DOWA 2L6GA 5AC5A 3EGXA 3FXHA 3M4CA 1E2XA 2OJQA 1KTMA 3MBGA 2P6VA 1J8MF 3UMIA 3DZAA 3IQ6A 4L6RA 1Z23A 3FVYA 2JPUA 5DLJA 1EA8A 1YYJA 1WATA 1ZHXA 2ZXWC 4U5CE 3LNRA 4I44A 5T3WA 3RH3A 3SNHA 2C04A 4BJ5A 1SMYF 2HUJA 2KQ9A 5T1DB 4WJ0A 5KYUB 1TWCA 2W9YA 5AC4A 2YVKA 2KSFA 2R7OA 2DGJA 3NRHA 1YDIA 4J30B 4JW1A 1BR1A 2VASA 2W4MA 1I4YA 1A7DA 3TQOA 1Q0FA 2QUPA 4C3DA 4C7OA 1ZYRF 4ZLCA 2LD6A 4MS2A 1OW8A 3LESA 4NY3A 4CIHA 3PCVA 3LAYA 3IPMO 2MWQA 2XRHA 3CQZA 5L0CA 2WVOA 3OEOA 3FOOA 2YL1A 2XLEA 3V7OA 1YZCA 4PR9A 3ZG1A 4EKWA 3ZQVA 2ZD9A 1VK5A 3JTLO 1CGOA 3O10A 5A6JA 1FFTC 1OKKA 3Q6NA 4AL0A 4AE4B 1ORSC 4O6MA 2P7VA 3JT1A 4CS9A 3EGDA 3ECSA 3EZHA 3SXYA 4IAOA 2LIGA 3ABKC 1FMWA 3FAJA 3L8IA 4MTFA 4N4WA 4KC9A 4I1OB 1NG1A 3M15A 1Y4CA 2C03A 1KNYA 1RJ9B 1TQGA 4H4KC 3HJCA 3AJMA 1RMVA 4YL1A 1Z7Qc 5HV9A 1ORYA 2I15A 3UMKA 2UUIA 1YA9A 3DJUB 2NG1A 1M2OA 1DOVA 3DMDA 4D4NA 5JVEA 2A1DD 5L0FA 2AP3A 4EBBA 2WZGA 5BUOA 2EILC 2VH3A 2VC9A 3W2VA 4XPYA 5A6BA 1E84A 3AQCA 4Q7CA 1ZHZA 1QLEC 1AVOB 2RSEB 3ASOC 1HW1A 3K7DA 4FX5A 3WODF 4CDYA 1IW7F 3UR3C 4UDVA 2Q3TA 4JIOA 4RD9A 3DI5A 3IQ5A 5IY5C 3R7CA 4JVSA 4MW3A 2IBFA 1ZVZA 2BE5F 4XEVA 4A2NB 4DXWA 3EHMA 2IXNA 3ZTMA 3Q7LA 1QVXA 3NKDA 2NUPB 3B71A 4IGGA 1SZIA 2PBEA 3L1MA 3R2PA 2TMVP 3ZTZA 4XPWA 1Y6DA 2P0NA 4CX9A 4PFOA 4BJ6C 2NPUA 3IEEA 5EK0A 1S05A 4YWQA 1GS9A 3DE9A 4Q5SF 3DAGA 1I4ZA 3S0XA 5KYYA 3U3BA 4I1MA 4AX2A 4E0IA 2YL3A 2CGEA 2G62A 2Y39A 4HE8D 2HJMA 5JUAA 1YLMA 2XL4A 1CGME 3B0PA 1EKYA 4AK9A 1RKEB 1VYKA 2AWCA 2LP4A 3DD7A 3U5SA 3C18A 2GFHA 3CEXA 3FOPA 3RF3A 3U8VA 1EI7A 2B0JA 3B9QA 4CDVA 2R7WA 1Z63A 1LKXA 5KYWB 4BG0A 4CSAA 5GPGB 1Q0GA 2EINC 1OCRC 2EPNA 3S28A 2IOQA 2XLHA 1MQVA 2J9UA 3K1HA 1WASA 3JCUQ 3SXKA 3AGUA 4CS8C 2YKZA 1OW7A 1R5ID 4C7OB 4CS7A 3K33A 4Z9HA 3T4RA 3EFOA 5L0GA 4IB4A 3O6XA 4E18A 4QI2A 1S7ZA 5JT4A 1E83A 3SYNA 2NUTB 2BC5A 2PX0A 2OQMA 2IYLD 1B68A 1MMGA 1PCXA 5DQZA 4ANJA 4PACA 1M2VA 1L7CA 1HE9A 2WVQA 3QVZA 3E9VA 3RVZA 3G50A 1OCCC 2Q9BA 2B0HA 1NFOA 4G0HA 3TJ6A 3LNMB 5BQIA 3JRMO 2QY9A 3O39A 1JPJA 3RYLA 1ZHYA 4LERA 2XLDA 1JAFA 1FTSA 1OKKD 2LQGA 3NMKA 4PK4A 5EHHA 1G4WR 1J8YF 3I5PA 3JYYA 3KPHA 5DVWA 3S84A 2PNOA 4IJJA 4P6IC 3UNGC 2XL6A 4U5GA 3NYMA 2A68F 1D1AA 4PJMA 5HSWA 1LM3B 1A7EA 3U3FA 5B1BC 2R7RA 4YT5A 1HMDA 1K40A 1D0XA 3HTKC 3EHNA 4OD5A 1TWHA 1E85A 2EIKC 1FMVA 1W2WA 3DE8A 2R7QA 4MVZA 4LDRA 2H7BA 2O9XA 4N6CA 5A6KA 2XLWA 3OA1A 4BPMA 2HMZA 5E3AA 2VB6A 2DYRC 3GANA 3RQGA 1R4TA 1FFHA 3SEOA 3TD7A 5E3CA 2KYHA 3U2MA 5A6BD 2R7XA 4K1OA 5D91A 1Z3IX 3HNKA 1D1CA 2J45A 3H2VA 3TOLA 2J0WA 3ABMC 3ZC4A 1A7VA 4MVMA 5L0HA 2XL8A 4K7BA 1MMDA 1XZQA 2Z15A 3MYIA 1SR2A 2EIMC 3OWTA 1H7IA 2HMQA 2R05A 3F47A 1D0ZA 2OU6A 4XPXA 1PV3A 4O7GA 4J32B 2YL7A 4R32A 3U9JA 2WZFA 4Q4ZF 2YLIA 3IQTA 2J0XA 4CIPA 1BR4A 2DB4A 1VYIA 3JZ0A 2M64A 2LSEA 2P1AA 4OD4A 3Q7GA 3LUTB 4B6IA 3EH1A 2QE9A 3K1IA 1QSPA 3AG1C 1U6HA 1OW6A 2A0BA 2J8WA 3W2WA 1Z6AA 2G3KA 3S9OA 4NTFA 1UG7A 2W4BA 4JRZA 3X1OA 4O79A 1TWAA 3LEVA 2Q00A 1JRAA 4BJ5C 4BEJA 3ASNC 3MLGA 1ZZPA 4JE9A 1A41A 1PD1A 1Q0MA 1V54C 2A6EF 2XM4A 3ZVRA 5CIVA 3VRCA 3C8GA 1FAPB 4MTGA 2XS8A 4JCZA 3SXMA 4OIPF 3AGTA 5B3SC 3UGOA 3NMJA 1EQ1A 1JR8A 1NU9C 1YYXA 2CNWA 1CPQA 5EGYA 3FDQA 4DRIB 3O55A 1U89A 4KI2A 3PMRA 2YZSA 4W8KA 4CDAA 5L0JA 4XLNF 2DYSC 1ORJA 1LI5A 3G4ZA 4JTDB 2YLGA 3HKKA 4U9EA 2KK1A 3W8HA 2YLDA 1APCA 3B29A 2J9VA 3JRTA 4D4XA 2MHRA 2XXAA 1TFKB 1LVKA 2QLAA 1TWGA 1O5HA 2DI3A 2P61A 4JURI 4DVZA 1QQ3A 4XWJA 1F1MA 1ZU4A 1T6IA 3KYJA 4XQ1A 4YL3A 4DVYP 1OCOC 3WAQA 3J06A 3ZDLA 1Q0DA 4CS9C 3VYWA 3H2UA 4OIOF 3DKAA 5B3IA 3C7JA 5FCLA 2OKUA 1BR2A 4OIRF 1SF8A 2ETSA 2IXPA 3GEEA 2YWAA 4EUKB 1G8XA 4M63A 4GEHA 2XLVA 4E7ZA 2VCAA 3ZSUA 3AG3C 5KYXA 2ZXOA 3AG4C 1BDJB 4LDQA 4IRUA 1XZPA 4NTAA 2LFDA 1C17M 1KU2A 2R7TA 1MMAA 1NU7D 4EBKA 1T5OA 3L8JA 3AG2C 1AEPA 2OEXA 5T3TA 3K66A 3C63A 3EGXB 1FNTc 1T6UA 3JSEO 4MVOA 2R25A 3CSKA 4LACB 1O3UA 4DRHB 3RQFA 1NLXA 3H65A 3ABLC 1M6TA 3CAXA 2XLOA 2HZ8A 3EPVA 2KW3C 3KYIA 4PJJA 4MVRA 1ZU5A 3RKOF 3TOMA 2G3VA 4ER9A 4NC3A 5KYUA 2HV7A 4HFFB 3SP1A 5COMA 2YL0A 3FHDA 4LLCA 4FESA 2OJED 2XSEA 3V5YA 3AQBA 2PX3A 2R03A 2R7SA 1D0YA 1ST6A 2OOCA 1VTMP 4MNDA 4CJOA 3M4BA 1QKRA 4XEFA 1OR2A 2Y69C 2J7PA 3U8PA 2A0UA 1MNDA 2H8AA 1CGNA 1YJGA 4NCQA 1XWJA 3VF0A 4CS8A 1MNEA 3B0VC 2R7UA 1WN0A 3N2ZB 2GAQA 2I8BA 1M56C 4QDLA 4PJLA 1ZW2A 2EIJC 2GWWA 2WVNA 4IWBA 4AL1A 3KL4A 4AE4A 2NSGA 2MYSA 5F28E 4K0DA 1LPEA 3WHNA 3GODA 1Q0KA 4N06A 2LK4A 1K05A 5D92A 2FFHA 5BQHA 5JS5A 3EGDB 4CSAC 2PF4E 2QNLA 5L3QA 1RJ9A 3EG9A 3L34A 4DJ9A 4JEBA 3WG7C 2HJ3A 5BQGA 3FAPB 1AUEA 1V4AA 4ONSA 1VLTA 4G7OF 1GGQA 4JJGA 4X0RA 2J9BA 3QW1A 1OQCA 1D1BA 2CNWD 2NSFA 3LJBA 2EPOA 2Y3DA 1C03A 2IXOA 4H54A 1YZAA 5L0DA 3ATPA 3IHUA 2AU5A 1YVIA 3GM2A 3L0IA 1OCZC 2PP4A 2HS5A 3QMKA 4JEAA 3NG1A 1Z5ZA 256BA 4Z9IA 1TKNA 4JTAB 2ZXRA 1HY5A 1HE1A 1PD0A 3IQCA 3QTHA 4J7YA 3JSZA 3DM5A 3DJNB 3I4UA 4EBJA 2AVKA 3W4YA 1UFBA 3I5QA 2NUPA 2R7VA 5L0IA 3KH2A 1V55C 1H6GA 3RW0A 4U5HA 2Y3BA 3F46A 4FWVA 1RKCA 2UUHA 5CI8A 5B1AC 5F5HA 2OEVA 3TULA 4CBEA 4DOZA 3G4XA 4U5DE 3B0UX 4MTOA 4BJTA 3QW0A 4DRJB 1GM5A 1C02A 5KYYB 1TR2A 2CCYA 4U5FE 3V5XA 4BEMJ 2L7AA 1VB5A 4NTBA 3DAFA 4JJFA 2Q9AA 1RKEA 2QTVA 1ZW3A 1TFOB 3A11A 3CZ6A 3E70C 3V5ZA 4HFKB 3N0TA 4KBLA 4NQFA 3VM6A 2VCBA 1H9TA 4ZLDA 3UMHA 4JC7A 4GQHA 2KNHA 5KYWA 3M1CB 1OXKA 1SYQA 3LS0A 1BBHA 2R02A 2L6FA 3EZIA 4PJNA 5TJ5E 3MFNA 5E33A 4YT2A 2FAPB 2WZLA 3NYJA 5AGFA 2KJGA 2CYDA 1YA7O 2W45A 4YL0A 4MQ9F 1NBBA 1HMOA 4EWCA 1FR0A 2HSBA 2CW0F 3EFOB 2NUTA 1QPUA 2XM0A 3RQEA 3S29A 1E86A 4OIQF 4RBNA 4G78A 5A69A 3RFYA 2ASRA 4C3EA 2HKVA 2ICWG 3GEHA 3K1IC 4QI0A 3RIPA 3U0CA 3SXZA 4C3BA 2Q9CA 3C8ZA 4DBQA 1G5ZA 1IZMA 2J7PD 4XTKA 3GM3A 4MVUA 1M2VB 2CDQA 1T01A 4WABA 1LIHA 1N1CA 3DM9B 3S27A 3US6A 4O6NA 3HNJA 4ULVA 5E2QA 1A0BA 3U9MA 2A6HF 5CI9A 5DS4A 3EQLF 4LLEA 4ULWA 4E7SA 5L3VA 2KC3A 2YEVA 3EG9B 4G7ZF 3ITFA 3GEIA 2WB7A 5COFA 2HSQA 3LLKA 3MX3A 1BZ4A 3T9OA 2HV6A 2V26A 4YN0B 1CPRA 1V74B 1H9GA 4U5BE 4BJ6A 5DQTA 3GWLA 2H7VC 2YHSA 4CJGA 4G7HF 1NSGB 1RCPA 1LS1A 3T6GB 2Y3HA 1JPNA 3BRJA 3T6JA 3EH2A 3NMIA 2ZXPA 1ZHTA 2L81A 1VLSA 3DXJF 4YT8A 5JLIA 5JP7A 1YAUO 3S90A 1LS4A 4A4AA 3AOUA 1ZHWA 3SZRA 2YRFA 4U9DA 1VMAA 3LEOA 1I5NA 4KNWA 4JZAA 3PHF2 5KYNA 4JKVA 1K04A 2BL2A 2X51A 2IM8A 4W8PA 3MYFA 5JSLA 1WTYA 1NZEA 2A69F 4EHPA 5DS6A 2EPLX 2JX0A 2Q4FA 2HFIA 3HNLA 2LCHA 3NKEA 1LE4A 2L9JA 2M4EA 3HLZA 1QZXA 4IAQA 4E0HA 1YARO 4P9TA 4U5EE 2YQYA 3N24A 2KGOA 4GYTA 2IXMA 1JMWA 4J7TA 1OXBA 1T9KA 1M57C 3KKBA 5FZTA 2L6HA 2PFDA 3HNIA 1MMNA 3KMIA 4P9FA 4PFPA 1JOGA 4WGYA 4XEKA 4YT4A 4YJWA 3ZWIA 3T6BA 2EPMX 2V3CC 3C62A 1LI7A 2H7OA 2X0CA 5F5FA 4E17A 2WL8A 4WGZA 3K6BA 1LE2A 2EPKX 1WOLA 3ZIBA 2GDCA 2RD9A 4KNVA 3GM1A 4HEAJ 3C8GB 5JRAA 2AWYA 2XS1A 3NDBB 4OINF 2D5RB 4N6HA 2E87A 2OCCC 1OR3A 5COGA 1U0BB 3POVA 4RDAA 1HW2A 3C8GD 2OG2A 4IARA 2J46A 1WWPA 3QVYA 2R9RB 3QZCA 1O87A 4O6YA 4YK5A 4BJ1A 3BEHA 3A9CA 1L3PA 2LFFA 4JTCB 3UGPA
chains in the Genus database with same CATH topology
2J9WA 3LS1A 2XXAB 2JD3A 3JYHA 3EJNA 4JCHA 4I3MA 2Y3GA 1VOMA 3W8IA 3LLIA 5DS5A 2ZPAA 3Q6MA 4XLPF 3X2QC 5KYXB 3NYLA 4F4BA 2FGYA 3VAYA 1WGWA 4DBRA 3EGXA 2P6VA 1J8MF 3UMIA 3DZAA 1Z23A 3FVYA 5DLJA 2ZXWC 5T3WA 1ZHXA 4U5CE 3RH3A 3LNRA 4I44A 3SNHA 4BJ5A 2C04A 1SMYF 2KQ9A 5KYUB 4WJ0A 1TWCA 2W9YA 2R7OA 2DGJA 3NRHA 4JW1A 4J30B 1BR1A 2VASA 2W4MA 4C7OA 4C3DA 1ZYRF 4ZLCA 3LESA 4NY3A 4CIHA 3LAYA 2MWQA 2XRHA 3CQZA 2WVOA 3OEOA 3V7OA 3ZG1A 1VK5A 1FFTC 1OKKA 3Q6NA 4AE4B 4O6MA 2P7VA 3JT1A 4CS9A 3EGDA 3ECSA 3EZHA 4IAOA 3ABKC 1FMWA 3FAJA 4KC9A 4I1OB 1NG1A 4H4KC 2C03A 1RJ9B 3HJCA 3UMKA 3DJUB 2NG1A 1M2OA 3DMDA 2A1DD 4EBBA 2WZGA 5BUOA 2EILC 2VH3A 3W2VA 3AQCA 4Q7CA 1ZHZA 1QLEC 3ASOC 3K7DA 4FX5A 3WODF 1IW7F 3UR3C 2Q3TA 4RD9A 5IY5C 4JVSA 4A2NB 2BE5F 3EHMA 2IXNA 3Q7LA 3NKDA 2NUPB 1SZIA 4PFOA 4BJ6C 3IEEA 4YWQA 3DAGA 3S0XA 5KYYA 4I1MA 4AX2A 4HE8D 2CGEA 2Y39A 2G62A 2XL4A 3B0PA 4AK9A 1VYKA 3DD7A 2GFHA 2B0JA 3B9QA 1Z63A 2R7WA 1LKXA 5KYWB 4BG0A 4CSAA 2EINC 3S28A 1OCRC 2IOQA 2J9UA 3K1HA 3JCUQ 4CS8C 4C7OB 4CS7A 3K33A 3T4RA 3EFOA 3O6XA 4QI2A 1S7ZA 3SYNA 2NUTB 2PX0A 2IYLD 1MMGA 1PCXA 5DQZA 4ANJA 1M2VA 2WVQA 3E9VA 1OCCC 2Q9BA 4G0HA 3RYLA 2QY9A 3O39A 1JPJA 1ZHYA 4LERA 1FTSA 1OKKD 4PK4A 5EHHA 1J8YF 3I5PA 5DVWA 4P6IC 4IJJA 3UNGC 4U5GA 3NYMA 2A68F 1D1AA 4PJMA 5HSWA 5B1BC 2R7RA 1D0XA 3HTKC 3EHNA 4OD5A 1TWHA 2EIKC 1FMVA 1W2WA 2R7QA 2H7BA 2O9XA 3OA1A 5E3AA 2VB6A 2DYRC 3GANA 1FFHA 3SEOA 3TD7A 5E3CA 2R7XA 5D91A 1Z3IX 1D1CA 2J45A 2J0WA 3ABMC 3ZC4A 4K7BA 1MMDA 2Z15A 2EIMC 3OWTA 3F47A 1D0ZA 4O7GA 4J32B 2WZFA 4Q4ZF 2J0XA 1BR4A 1VYIA 2LSEA 4OD4A 3Q7GA 4B6IA 3EH1A 3AG1C 3W2WA 1Z6AA 2G3KA 2W4BA 3X1OA 4BJ5C 4O79A 1TWAA 3LEVA 4BEJA 3ASNC 3MLGA 3ZVRA 1PD1A 2A6EF 1V54C 4OIPF 5B3SC 3UGOA 1NU9C 2CNWA 5EGYA 3FDQA 4KI2A 3PMRA 2YZSA 4W8KA 4XLNF 2DYSC 3W8HA 3JRTA 2J9VA 2XXAA 1LVKA 1TWGA 1O5HA 4JURI 4DVZA 4XWJA 1ZU4A 4DVYP 1OCOC 4CS9C 3VYWA 4OIOF 5FCLA 1BR2A 4OIRF 1SF8A 2IXPA 1G8XA 4M63A 4GEHA 4E7ZA 3ZSUA 3AG3C 5KYXA 2ZXOA 3AG4C 4IRUA 2R7TA 1KU2A 1MMAA 1NU7D 3AG2C 5T3TA 3K66A 3EGXB 3CSKA 4LACB 3H65A 3ABLC 3EPVA 5T1DB 3RKOF 2KW3C 4PJJA 1ZU5A 2G3VA 5KYUA 2HV7A 4HFFB 3SP1A 4LLCA 3FHDA 4FESA 2XSEA 3AQBA 2PX3A 2R7SA 1D0YA 1ST6A 4MNDA 2Y69C 2J7PA 1MNDA 2R7UA 3B0VC 1MNEA 3N2ZB 2I8BA 1M56C 4QDLA 4PJLA 2EIJC 2WVNA 4IWBA 3KL4A 4AE4A 2MYSA 4K0DA 3GODA 4N06A 5D92A 2FFHA 3EGDB 4CSAC 2PF4E 5L3QA 1RJ9A 3EG9A 3L34A 3WG7C 4G7OF 4JJGA 4X0RA 2CNWD 1D1BA 3LJBA 2Y3DA 2IXOA 3L0IA 1OCZC 2PP4A 3QMKA 3NG1A 1Z5ZA 1TKNA 2ZXRA 1PD0A 3JSZA 3DM5A 3DJNB 3I4UA 3I5QA 2NUPA 2R7VA 3KH2A 1V55C 4U5HA 2Y3BA 3F46A 4FWVA 5CI8A 5B1AC 5F5HA 4CBEA 4DOZA 4U5DE 3B0UX 4BJTA 5KYYB 1TR2A 4U5FE 3DAFA 4JJFA 2Q9AA 2QTVA 3CZ6A 4HFKB 3N0TA 4KBLA 4ZLDA 3UMHA 2KNHA 5KYWA 3M1CB 3LS0A 3EZIA 4PJNA 5E33A 4YT2A 2WZLA 3NYJA 2KJGA 2W45A 4MQ9F 4EWCA 2CW0F 3EFOB 2NUTA 3S29A 4OIQF 4RBNA 3RFYA 4C3EA 3RIPA 3K1IC 4QI0A 4C3BA 2Q9CA 4DBQA 1IZMA 2J7PD 4XTKA 1M2VB 2CDQA 1N1CA 3DM9B 3S27A 4O6NA 5E2QA 5DS4A 2A6HF 5CI9A 3EQLF 4LLEA 4ULWA 4E7SA 5L3VA 2YEVA 3EG9B 4G7ZF 3ITFA 2WB7A 3LLKA 3MX3A 2HV6A 2V26A 4YN0B 4U5BE 4BJ6A 5DQTA 2H7VC 2YHSA 4G7HF 1LS1A 2Y3HA 1JPNA 3T6JA 3EH2A 2ZXPA 1ZHTA 2L81A 3DXJF 4YT8A 1ZHWA 3SZRA 1VMAA 4KNWA 4JZAA 3PHF2 5KYNA 2X51A 1NZEA 2A69F 5DS6A 4YT5A 3NKEA 4CS8A 4Q5SF 2M4EA 2L9JA 3HLZA 1QZXA 4U5EE 3N24A 2KGOA 4GYTA 2IXMA 1M57C 3KKBA 2PFDA 4PFPA 1MMNA 3KMIA 4YT4A 4YJWA 3T6BA 2V3CC 2H7OA 5F5FA 2WL8A 3K6BA 3ZIBA 4KNVA 4HEAJ 3NDBB 4OINF 2D5RB 2E87A 2OCCC 3POVA 4RDAA 2OG2A 2J46A 3QZCA 4O6YA 4BJ1A 1O87A 3E70C 3UGPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F5H A;  5F5F A;  4ZLC A;  4QI2 A;  4QI0 A;  3X1O A;  4YWQ A;  4ZLD A;  4ULW A; 
#chains in the Genus database with same CATH topology
 2J9W A;  4LDK A;  3LS1 A;  2XXA B;  2JD3 A;  3JYH A;  3PDM P;  3EJN A;  4JCH A;  4I3M A;  2Y3G A;  1GQA A;  1VOM A;  4MW8 A;  1NFN A;  3TJ5 A;  4FAP B;  2Q7R A;  2VCC A;  4MVQ A;  3W8I A;  3ZQY A;  3LLI A;  2F22 A;  3U2L A;  1G4U S;  2ZPA A;  4Z9J A;  5DS5 A;  3Q6M A;  4XLP F;  2D4U A;  3RVY A;  3GOR A;  2GA0 A;  3X2Q C;  5KYX B;  3M79 A;  4MVS A;  3NYL A;  3GWN A;  3DWW A;  5K0I A;  5A6A A;  4F4B A;  2FGY A;  1T6Q A;  2XLM A;  3VAY A;  4EIY A;  1WGW A;  3TK0 A;  3FMS A;  1RXQ A;  4DBR A;  1DOW A;  2L6G A;  5AC5 A;  3EGX A;  3FXH A;  3M4C A;  1E2X A;  2OJQ A;  1KTM A;  3MBG A;  2P6V A;  1J8M F;  3UMI A;  3DZA A;  3IQ6 A;  4L6R A;  1Z23 A;  3FVY A;  2JPU A;  5DLJ A;  1EA8 A;  1YYJ A;  1WAT A;  1ZHX A;  2ZXW C;  4U5C E;  3LNR A;  4I44 A;  5T3W A;  3RH3 A;  3SNH A;  2C04 A;  4BJ5 A;  1SMY F;  2HUJ A;  2KQ9 A;  5T1D B;  4WJ0 A;  5KYU B;  1TWC A;  2W9Y A;  5AC4 A;  2YVK A;  2KSF A;  2R7O A;  2DGJ A;  3NRH A;  1YDI A;  4J30 B;  4JW1 A;  1BR1 A;  2VAS A;  2W4M A;  1I4Y A;  1A7D A;  3TQO A;  1Q0F A;  2QUP A;  4C3D A;  4C7O A;  1ZYR F;  4ZLC A;  2LD6 A;  4MS2 A;  1OW8 A;  3LES A;  4NY3 A;  4CIH A;  3PCV A;  3LAY A;  3IPM O;  2MWQ A;  2XRH A;  3CQZ A;  5L0C A;  2WVO A;  3OEO A;  3FOO A;  2YL1 A;  2XLE A;  3V7O A;  1YZC A;  4PR9 A;  3ZG1 A;  4EKW A;  3ZQV A;  2ZD9 A;  1VK5 A;  3JTL O;  1CGO A;  3O10 A;  5A6J A;  1FFT C;  1OKK A;  3Q6N A;  4AL0 A;  4AE4 B;  1ORS C;  4O6M A;  2P7V A;  3JT1 A;  4CS9 A;  3EGD A;  3ECS A;  3EZH A;  3SXY A;  4IAO A;  2LIG A;  3ABK C;  1FMW A;  3FAJ A;  3L8I A;  4MTF A;  4N4W A;  4KC9 A;  4I1O B;  1NG1 A;  3M15 A;  1Y4C A;  2C03 A;  1KNY A;  1RJ9 B;  1TQG A;  4H4K C;  3HJC A;  3AJM A;  1RMV A;  4YL1 A;  1Z7Q c;  5HV9 A;  1ORY A;  2I15 A;  3UMK A;  2UUI A;  1YA9 A;  3DJU B;  2NG1 A;  1M2O A;  1DOV A;  3DMD A;  4D4N A;  5JVE A;  2A1D D;  5L0F A;  2AP3 A;  4EBB A;  2WZG A;  5BUO A;  2EIL C;  2VH3 A;  2VC9 A;  3W2V A;  4XPY A;  5A6B A;  1E84 A;  3AQC A;  4Q7C A;  1ZHZ A;  1QLE C;  1AVO B;  2RSE B;  3ASO C;  1HW1 A;  3K7D A;  4FX5 A;  3WOD F;  4CDY A;  1IW7 F;  3UR3 C;  4UDV A;  2Q3T A;  4JIO A;  4RD9 A;  3DI5 A;  3IQ5 A;  5IY5 C;  3R7C A;  4JVS A;  4MW3 A;  2IBF A;  1ZVZ A;  2BE5 F;  4XEV A;  4A2N B;  4DXW A;  3EHM A;  2IXN A;  3ZTM A;  3Q7L A;  1QVX A;  3NKD A;  2NUP B;  3B71 A;  4IGG A;  1SZI A;  2PBE A;  3L1M A;  3R2P A;  2TMV P;  3ZTZ A;  4XPW A;  1Y6D A;  2P0N A;  4CX9 A;  4PFO A;  4BJ6 C;  2NPU A;  3IEE A;  5EK0 A;  1S05 A;  4YWQ A;  1GS9 A;  3DE9 A;  4Q5S F;  3DAG A;  1I4Z A;  3S0X A;  5KYY A;  3U3B A;  4I1M A;  4AX2 A;  4E0I A;  2YL3 A;  2CGE A;  2G62 A;  2Y39 A;  4HE8 D;  2HJM A;  5JUA A;  1YLM A;  2XL4 A;  1CGM E;  3B0P A;  1EKY A;  4AK9 A;  1RKE B;  1VYK A;  2AWC A;  2LP4 A;  3DD7 A;  3U5S A;  3C18 A;  2GFH A;  3CEX A;  3FOP A;  3RF3 A;  3U8V A;  1EI7 A;  2B0J A;  3B9Q A;  4CDV A;  2R7W A;  1Z63 A;  1LKX A;  5KYW B;  4BG0 A;  4CSA A;  5GPG B;  1Q0G A;  2EIN C;  1OCR C;  2EPN A;  3S28 A;  2IOQ A;  2XLH A;  1MQV A;  2J9U A;  3K1H A;  1WAS A;  3JCU Q;  3SXK A;  3AGU A;  4CS8 C;  2YKZ A;  1OW7 A;  1R5I D;  4C7O B;  4CS7 A;  3K33 A;  4Z9H A;  3T4R A;  3EFO A;  5L0G A;  4IB4 A;  3O6X A;  4E18 A;  4QI2 A;  1S7Z A;  5JT4 A;  1E83 A;  3SYN A;  2NUT B;  2BC5 A;  2PX0 A;  2OQM A;  2IYL D;  1B68 A;  1MMG A;  1PCX A;  5DQZ A;  4ANJ A;  4PAC A;  1M2V A;  1L7C A;  1HE9 A;  2WVQ A;  3QVZ A;  3E9V A;  3RVZ A;  3G50 A;  1OCC C;  2Q9B A;  2B0H A;  1NFO A;  4G0H A;  3TJ6 A;  3LNM B;  5BQI A;  3JRM O;  2QY9 A;  3O39 A;  1JPJ A;  3RYL A;  1ZHY A;  4LER A;  2XLD A;  1JAF A;  1FTS A;  1OKK D;  2LQG A;  3NMK A;  4PK4 A;  5EHH A;  1G4W R;  1J8Y F;  3I5P A;  3JYY A;  3KPH A;  5DVW A;  3S84 A;  2PNO A;  4IJJ A;  4P6I C;  3UNG C;  2XL6 A;  4U5G A;  3NYM A;  2A68 F;  1D1A A;  4PJM A;  5HSW A;  1LM3 B;  1A7E A;  3U3F A;  5B1B C;  2R7R A;  4YT5 A;  1HMD A;  1K40 A;  1D0X A;  3HTK C;  3EHN A;  4OD5 A;  1TWH A;  1E85 A;  2EIK C;  1FMV A;  1W2W A;  3DE8 A;  2R7Q A;  4MVZ A;  4LDR A;  2H7B A;  2O9X A;  4N6C A;  5A6K A;  2XLW A;  3OA1 A;  4BPM A;  2HMZ A;  5E3A A;  2VB6 A;  2DYR C;  3GAN A;  3RQG A;  1R4T A;  1FFH A;  3SEO A;  3TD7 A;  5E3C A;  2KYH A;  3U2M A;  5A6B D;  2R7X A;  4K1O A;  5D91 A;  1Z3I X;  3HNK A;  1D1C A;  2J45 A;  3H2V A;  3TOL A;  2J0W A;  3ABM C;  3ZC4 A;  1A7V A;  4MVM A;  5L0H A;  2XL8 A;  4K7B A;  1MMD A;  1XZQ A;  2Z15 A;  3MYI A;  1SR2 A;  2EIM C;  3OWT A;  1H7I A;  2HMQ A;  2R05 A;  3F47 A;  1D0Z A;  2OU6 A;  4XPX A;  1PV3 A;  4O7G A;  4J32 B;  2YL7 A;  4R32 A;  3U9J A;  2WZF A;  4Q4Z F;  2YLI A;  3IQT A;  2J0X A;  4CIP A;  1BR4 A;  2DB4 A;  1VYI A;  3JZ0 A;  2M64 A;  2LSE A;  2P1A A;  4OD4 A;  3Q7G A;  3LUT B;  4B6I A;  3EH1 A;  2QE9 A;  3K1I A;  1QSP A;  3AG1 C;  1U6H A;  1OW6 A;  2A0B A;  2J8W A;  3W2W A;  1Z6A A;  2G3K A;  3S9O A;  4NTF A;  1UG7 A;  2W4B A;  4JRZ A;  3X1O A;  4O79 A;  1TWA A;  3LEV A;  2Q00 A;  1JRA A;  4BJ5 C;  4BEJ A;  3ASN C;  3MLG A;  1ZZP A;  4JE9 A;  1A41 A;  1PD1 A;  1Q0M A;  1V54 C;  2A6E F;  2XM4 A;  3ZVR A;  5CIV A;  3VRC A;  3C8G A;  1FAP B;  4MTG A;  2XS8 A;  4JCZ A;  3SXM A;  4OIP F;  3AGT A;  5B3S C;  3UGO A;  3NMJ A;  1EQ1 A;  1JR8 A;  1NU9 C;  1YYX A;  2CNW A;  1CPQ A;  5EGY A;  3FDQ A;  4DRI B;  3O55 A;  1U89 A;  4KI2 A;  3PMR A;  2YZS A;  4W8K A;  4CDA A;  5L0J A;  4XLN F;  2DYS C;  1ORJ A;  1LI5 A;  3G4Z A;  4JTD B;  2YLG A;  3HKK A;  4U9E A;  2KK1 A;  3W8H A;  2YLD A;  1APC A;  3B29 A;  2J9V A;  3JRT A;  4D4X A;  2MHR A;  2XXA A;  1TFK B;  1LVK A;  2QLA A;  1TWG A;  1O5H A;  2DI3 A;  2P61 A;  4JUR I;  4DVZ A;  1QQ3 A;  4XWJ A;  1F1M A;  1ZU4 A;  1T6I A;  3KYJ A;  4XQ1 A;  4YL3 A;  4DVY P;  1OCO C;  3WAQ A;  3J06 A;  3ZDL A;  1Q0D A;  4CS9 C;  3VYW A;  3H2U A;  4OIO F;  3DKA A;  5B3I A;  3C7J A;  5FCL A;  2OKU A;  1BR2 A;  4OIR F;  1SF8 A;  2ETS A;  2IXP A;  3GEE A;  2YWA A;  4EUK B;  1G8X A;  4M63 A;  4GEH A;  2XLV A;  4E7Z A;  2VCA A;  3ZSU A;  3AG3 C;  5KYX A;  2ZXO A;  3AG4 C;  1BDJ B;  4LDQ A;  4IRU A;  1XZP A;  4NTA A;  2LFD A;  1C17 M;  1KU2 A;  2R7T A;  1MMA A;  1NU7 D;  4EBK A;  1T5O A;  3L8J A;  3AG2 C;  1AEP A;  2OEX A;  5T3T A;  3K66 A;  3C63 A;  3EGX B;  1FNT c;  1T6U A;  3JSE O;  4MVO A;  2R25 A;  3CSK A;  4LAC B;  1O3U A;  4DRH B;  3RQF A;  1NLX A;  3H65 A;  3ABL C;  1M6T A;  3CAX A;  2XLO A;  2HZ8 A;  3EPV A;  2KW3 C;  3KYI A;  4PJJ A;  4MVR A;  1ZU5 A;  3RKO F;  3TOM A;  2G3V A;  4ER9 A;  4NC3 A;  5KYU A;  2HV7 A;  4HFF B;  3SP1 A;  5COM A;  2YL0 A;  3FHD A;  4LLC A;  4FES A;  2OJE D;  2XSE A;  3V5Y A;  3AQB A;  2PX3 A;  2R03 A;  2R7S A;  1D0Y A;  1ST6 A;  2OOC A;  1VTM P;  4MND A;  4CJO A;  3M4B A;  1QKR A;  4XEF A;  1OR2 A;  2Y69 C;  2J7P A;  3U8P A;  2A0U A;  1MND A;  2H8A A;  1CGN A;  1YJG A;  4NCQ A;  1XWJ A;  3VF0 A;  4CS8 A;  1MNE A;  3B0V C;  2R7U A;  1WN0 A;  3N2Z B;  2GAQ A;  2I8B A;  1M56 C;  4QDL A;  4PJL A;  1ZW2 A;  2EIJ C;  2GWW A;  2WVN A;  4IWB A;  4AL1 A;  3KL4 A;  4AE4 A;  2NSG A;  2MYS A;  5F28 E;  4K0D A;  1LPE A;  3WHN A;  3GOD A;  1Q0K A;  4N06 A;  2LK4 A;  1K05 A;  5D92 A;  2FFH A;  5BQH A;  5JS5 A;  3EGD B;  4CSA C;  2PF4 E;  2QNL A;  5L3Q A;  1RJ9 A;  3EG9 A;  3L34 A;  4DJ9 A;  4JEB A;  3WG7 C;  2HJ3 A;  5BQG A;  3FAP B;  1AUE A;  1V4A A;  4ONS A;  1VLT A;  4G7O F;  1GGQ A;  4JJG A;  4X0R A;  2J9B A;  3QW1 A;  1OQC A;  1D1B A;  2CNW D;  2NSF A;  3LJB A;  2EPO A;  2Y3D A;  1C03 A;  2IXO A;  4H54 A;  1YZA A;  5L0D A;  3ATP A;  3IHU A;  2AU5 A;  1YVI A;  3GM2 A;  3L0I A;  1OCZ C;  2PP4 A;  2HS5 A;  3QMK A;  4JEA A;  3NG1 A;  1Z5Z A;  256B A;  4Z9I A;  1TKN A;  4JTA B;  2ZXR A;  1HY5 A;  1HE1 A;  1PD0 A;  3IQC A;  3QTH A;  4J7Y A;  3JSZ A;  3DM5 A;  3DJN B;  3I4U A;  4EBJ A;  2AVK A;  3W4Y A;  1UFB A;  3I5Q A;  2NUP A;  2R7V A;  5L0I A;  3KH2 A;  1V55 C;  1H6G A;  3RW0 A;  4U5H A;  2Y3B A;  3F46 A;  4FWV A;  1RKC A;  2UUH A;  5CI8 A;  5B1A C;  5F5H A;  2OEV A;  3TUL A;  4CBE A;  4DOZ A;  3G4X A;  4U5D E;  3B0U X;  4MTO A;  4BJT A;  3QW0 A;  4DRJ B;  1GM5 A;  1C02 A;  5KYY B;  1TR2 A;  2CCY A;  4U5F E;  3V5X A;  4BEM J;  2L7A A;  1VB5 A;  4NTB A;  3DAF A;  4JJF A;  2Q9A A;  1RKE A;  2QTV A;  1ZW3 A;  1TFO B;  3A11 A;  3CZ6 A;  3E70 C;  3V5Z A;  4HFK B;  3N0T A;  4KBL A;  4NQF A;  3VM6 A;  2VCB A;  1H9T A;  4ZLD A;  3UMH A;  4JC7 A;  4GQH A;  2KNH A;  5KYW A;  3M1C B;  1OXK A;  1SYQ A;  3LS0 A;  1BBH A;  2R02 A;  2L6F A;  3EZI A;  4PJN A;  5TJ5 E;  3MFN A;  5E33 A;  4YT2 A;  2FAP B;  2WZL A;  3NYJ A;  5AGF A;  2KJG A;  2CYD A;  1YA7 O;  2W45 A;  4YL0 A;  4MQ9 F;  1NBB A;  1HMO A;  4EWC A;  1FR0 A;  2HSB A;  2CW0 F;  3EFO B;  2NUT A;  1QPU A;  2XM0 A;  3RQE A;  3S29 A;  1E86 A;  4OIQ F;  4RBN A;  4G78 A;  5A69 A;  3RFY A;  2ASR A;  4C3E A;  2HKV A;  2ICW G;  3GEH A;  3K1I C;  4QI0 A;  3RIP A;  3U0C A;  3SXZ A;  4C3B A;  2Q9C A;  3C8Z A;  4DBQ A;  1G5Z A;  1IZM A;  2J7P D;  4XTK A;  3GM3 A;  4MVU A;  1M2V B;  2CDQ A;  1T01 A;  4WAB A;  1LIH A;  1N1C A;  3DM9 B;  3S27 A;  3US6 A;  4O6N A;  3HNJ A;  4ULV A;  5E2Q A;  1A0B A;  3U9M A;  2A6H F;  5CI9 A;  5DS4 A;  3EQL F;  4LLE A;  4ULW A;  4E7S A;  5L3V A;  2KC3 A;  2YEV A;  3EG9 B;  4G7Z F;  3ITF A;  3GEI A;  2WB7 A;  5COF A;  2HSQ A;  3LLK A;  3MX3 A;  1BZ4 A;  3T9O A;  2HV6 A;  2V26 A;  4YN0 B;  1CPR A;  1V74 B;  1H9G A;  4U5B E;  4BJ6 A;  5DQT A;  3GWL A;  2H7V C;  2YHS A;  4CJG A;  4G7H F;  1NSG B;  1RCP A;  1LS1 A;  3T6G B;  2Y3H A;  1JPN A;  3BRJ A;  3T6J A;  3EH2 A;  3NMI A;  2ZXP A;  1ZHT A;  2L81 A;  1VLS A;  3DXJ F;  4YT8 A;  5JLI A;  5JP7 A;  1YAU O;  3S90 A;  1LS4 A;  4A4A A;  3AOU A;  1ZHW A;  3SZR A;  2YRF A;  4U9D A;  1VMA A;  3LEO A;  1I5N A;  4KNW A;  4JZA A;  3PHF 2;  5KYN A;  4JKV A;  1K04 A;  2BL2 A;  2X51 A;  2IM8 A;  4W8P A;  3MYF A;  5JSL A;  1WTY A;  1NZE A;  2A69 F;  4EHP A;  5DS6 A;  2EPL X;  2JX0 A;  2Q4F A;  2HFI A;  3HNL A;  2LCH A;  3NKE A;  1LE4 A;  2L9J A;  2M4E A;  3HLZ A;  1QZX A;  4IAQ A;  4E0H A;  1YAR O;  4P9T A;  4U5E E;  2YQY A;  3N24 A;  2KGO A;  4GYT A;  2IXM A;  1JMW A;  4J7T A;  1OXB A;  1T9K A;  1M57 C;  3KKB A;  5FZT A;  2L6H A;  2PFD A;  3HNI A;  1MMN A;  3KMI A;  4P9F A;  4PFP A;  1JOG A;  4WGY A;  4XEK A;  4YT4 A;  4YJW A;  3ZWI A;  3T6B A;  2EPM X;  2V3C C;  3C62 A;  1LI7 A;  2H7O A;  2X0C A;  5F5F A;  4E17 A;  2WL8 A;  4WGZ A;  3K6B A;  1LE2 A;  2EPK X;  1WOL A;  3ZIB A;  2GDC A;  2RD9 A;  4KNV A;  3GM1 A;  4HEA J;  3C8G B;  5JRA A;  2AWY A;  2XS1 A;  3NDB B;  4OIN F;  2D5R B;  4N6H A;  2E87 A;  2OCC C;  1OR3 A;  5COG A;  1U0B B;  3POV A;  4RDA A;  1HW2 A;  3C8G D;  2OG2 A;  4IAR A;  2J46 A;  1WWP A;  3QVY A;  2R9R B;  3QZC A;  1O87 A;  4O6Y A;  4YK5 A;  4BJ1 A;  3BEH A;  3A9C A;  1L3P A;  2LFF A;  4JTC B;  3UGP A; 
#chains in the Genus database with same CATH homology
 2J9W A;  3LS1 A;  2XXA B;  2JD3 A;  3JYH A;  3EJN A;  4JCH A;  4I3M A;  2Y3G A;  1VOM A;  3W8I A;  3LLI A;  5DS5 A;  2ZPA A;  3Q6M A;  4XLP F;  3X2Q C;  5KYX B;  3NYL A;  4F4B A;  2FGY A;  3VAY A;  1WGW A;  4DBR A;  3EGX A;  2P6V A;  1J8M F;  3UMI A;  3DZA A;  1Z23 A;  3FVY A;  5DLJ A;  2ZXW C;  5T3W A;  1ZHX A;  4U5C E;  3RH3 A;  3LNR A;  4I44 A;  3SNH A;  4BJ5 A;  2C04 A;  1SMY F;  2KQ9 A;  5KYU B;  4WJ0 A;  1TWC A;  2W9Y A;  2R7O A;  2DGJ A;  3NRH A;  4JW1 A;  4J30 B;  1BR1 A;  2VAS A;  2W4M A;  4C7O A;  4C3D A;  1ZYR F;  4ZLC A;  3LES A;  4NY3 A;  4CIH A;  3LAY A;  2MWQ A;  2XRH A;  3CQZ A;  2WVO A;  3OEO A;  3V7O A;  3ZG1 A;  1VK5 A;  1FFT C;  1OKK A;  3Q6N A;  4AE4 B;  4O6M A;  2P7V A;  3JT1 A;  4CS9 A;  3EGD A;  3ECS A;  3EZH A;  4IAO A;  3ABK C;  1FMW A;  3FAJ A;  4KC9 A;  4I1O B;  1NG1 A;  4H4K C;  2C03 A;  1RJ9 B;  3HJC A;  3UMK A;  3DJU B;  2NG1 A;  1M2O A;  3DMD A;  2A1D D;  4EBB A;  2WZG A;  5BUO A;  2EIL C;  2VH3 A;  3W2V A;  3AQC A;  4Q7C A;  1ZHZ A;  1QLE C;  3ASO C;  3K7D A;  4FX5 A;  3WOD F;  1IW7 F;  3UR3 C;  2Q3T A;  4RD9 A;  5IY5 C;  4JVS A;  4A2N B;  2BE5 F;  3EHM A;  2IXN A;  3Q7L A;  3NKD A;  2NUP B;  1SZI A;  4PFO A;  4BJ6 C;  3IEE A;  4YWQ A;  3DAG A;  3S0X A;  5KYY A;  4I1M A;  4AX2 A;  4HE8 D;  2CGE A;  2Y39 A;  2G62 A;  2XL4 A;  3B0P A;  4AK9 A;  1VYK A;  3DD7 A;  2GFH A;  2B0J A;  3B9Q A;  1Z63 A;  2R7W A;  1LKX A;  5KYW B;  4BG0 A;  4CSA A;  2EIN C;  3S28 A;  1OCR C;  2IOQ A;  2J9U A;  3K1H A;  3JCU Q;  4CS8 C;  4C7O B;  4CS7 A;  3K33 A;  3T4R A;  3EFO A;  3O6X A;  4QI2 A;  1S7Z A;  3SYN A;  2NUT B;  2PX0 A;  2IYL D;  1MMG A;  1PCX A;  5DQZ A;  4ANJ A;  1M2V A;  2WVQ A;  3E9V A;  1OCC C;  2Q9B A;  4G0H A;  3RYL A;  2QY9 A;  3O39 A;  1JPJ A;  1ZHY A;  4LER A;  1FTS A;  1OKK D;  4PK4 A;  5EHH A;  1J8Y F;  3I5P A;  5DVW A;  4P6I C;  4IJJ A;  3UNG C;  4U5G A;  3NYM A;  2A68 F;  1D1A A;  4PJM A;  5HSW A;  5B1B C;  2R7R A;  1D0X A;  3HTK C;  3EHN A;  4OD5 A;  1TWH A;  2EIK C;  1FMV A;  1W2W A;  2R7Q A;  2H7B A;  2O9X A;  3OA1 A;  5E3A A;  2VB6 A;  2DYR C;  3GAN A;  1FFH A;  3SEO A;  3TD7 A;  5E3C A;  2R7X A;  5D91 A;  1Z3I X;  1D1C A;  2J45 A;  2J0W A;  3ABM C;  3ZC4 A;  4K7B A;  1MMD A;  2Z15 A;  2EIM C;  3OWT A;  3F47 A;  1D0Z A;  4O7G A;  4J32 B;  2WZF A;  4Q4Z F;  2J0X A;  1BR4 A;  1VYI A;  2LSE A;  4OD4 A;  3Q7G A;  4B6I A;  3EH1 A;  3AG1 C;  3W2W A;  1Z6A A;  2G3K A;  2W4B A;  3X1O A;  4BJ5 C;  4O79 A;  1TWA A;  3LEV A;  4BEJ A;  3ASN C;  3MLG A;  3ZVR A;  1PD1 A;  2A6E F;  1V54 C;  4OIP F;  5B3S C;  3UGO A;  1NU9 C;  2CNW A;  5EGY A;  3FDQ A;  4KI2 A;  3PMR A;  2YZS A;  4W8K A;  4XLN F;  2DYS C;  3W8H A;  3JRT A;  2J9V A;  2XXA A;  1LVK A;  1TWG A;  1O5H A;  4JUR I;  4DVZ A;  4XWJ A;  1ZU4 A;  4DVY P;  1OCO C;  4CS9 C;  3VYW A;  4OIO F;  5FCL A;  1BR2 A;  4OIR F;  1SF8 A;  2IXP A;  1G8X A;  4M63 A;  4GEH A;  4E7Z A;  3ZSU A;  3AG3 C;  5KYX A;  2ZXO A;  3AG4 C;  4IRU A;  2R7T A;  1KU2 A;  1MMA A;  1NU7 D;  3AG2 C;  5T3T A;  3K66 A;  3EGX B;  3CSK A;  4LAC B;  3H65 A;  3ABL C;  3EPV A;  5T1D B;  3RKO F;  2KW3 C;  4PJJ A;  1ZU5 A;  2G3V A;  5KYU A;  2HV7 A;  4HFF B;  3SP1 A;  4LLC A;  3FHD A;  4FES A;  2XSE A;  3AQB A;  2PX3 A;  2R7S A;  1D0Y A;  1ST6 A;  4MND A;  2Y69 C;  2J7P A;  1MND A;  2R7U A;  3B0V C;  1MNE A;  3N2Z B;  2I8B A;  1M56 C;  4QDL A;  4PJL A;  2EIJ C;  2WVN A;  4IWB A;  3KL4 A;  4AE4 A;  2MYS A;  4K0D A;  3GOD A;  4N06 A;  5D92 A;  2FFH A;  3EGD B;  4CSA C;  2PF4 E;  5L3Q A;  1RJ9 A;  3EG9 A;  3L34 A;  3WG7 C;  4G7O F;  4JJG A;  4X0R A;  2CNW D;  1D1B A;  3LJB A;  2Y3D A;  2IXO A;  3L0I A;  1OCZ C;  2PP4 A;  3QMK A;  3NG1 A;  1Z5Z A;  1TKN A;  2ZXR A;  1PD0 A;  3JSZ A;  3DM5 A;  3DJN B;  3I4U A;  3I5Q A;  2NUP A;  2R7V A;  3KH2 A;  1V55 C;  4U5H A;  2Y3B A;  3F46 A;  4FWV A;  5CI8 A;  5B1A C;  5F5H A;  4CBE A;  4DOZ A;  4U5D E;  3B0U X;  4BJT A;  5KYY B;  1TR2 A;  4U5F E;  3DAF A;  4JJF A;  2Q9A A;  2QTV A;  3CZ6 A;  4HFK B;  3N0T A;  4KBL A;  4ZLD A;  3UMH A;  2KNH A;  5KYW A;  3M1C B;  3LS0 A;  3EZI A;  4PJN A;  5E33 A;  4YT2 A;  2WZL A;  3NYJ A;  2KJG A;  2W45 A;  4MQ9 F;  4EWC A;  2CW0 F;  3EFO B;  2NUT A;  3S29 A;  4OIQ F;  4RBN A;  3RFY A;  4C3E A;  3RIP A;  3K1I C;  4QI0 A;  4C3B A;  2Q9C A;  4DBQ A;  1IZM A;  2J7P D;  4XTK A;  1M2V B;  2CDQ A;  1N1C A;  3DM9 B;  3S27 A;  4O6N A;  5E2Q A;  5DS4 A;  2A6H F;  5CI9 A;  3EQL F;  4LLE A;  4ULW A;  4E7S A;  5L3V A;  2YEV A;  3EG9 B;  4G7Z F;  3ITF A;  2WB7 A;  3LLK A;  3MX3 A;  2HV6 A;  2V26 A;  4YN0 B;  4U5B E;  4BJ6 A;  5DQT A;  2H7V C;  2YHS A;  4G7H F;  1LS1 A;  2Y3H A;  1JPN A;  3T6J A;  3EH2 A;  2ZXP A;  1ZHT A;  2L81 A;  3DXJ F;  4YT8 A;  1ZHW A;  3SZR A;  1VMA A;  4KNW A;  4JZA A;  3PHF 2;  5KYN A;  2X51 A;  1NZE A;  2A69 F;  5DS6 A;  4YT5 A;  3NKE A;  4CS8 A;  4Q5S F;  2M4E A;  2L9J A;  3HLZ A;  1QZX A;  4U5E E;  3N24 A;  2KGO A;  4GYT A;  2IXM A;  1M57 C;  3KKB A;  2PFD A;  4PFP A;  1MMN A;  3KMI A;  4YT4 A;  4YJW A;  3T6B A;  2V3C C;  2H7O A;  5F5F A;  2WL8 A;  3K6B A;  3ZIB A;  4KNV A;  4HEA J;  3NDB B;  4OIN F;  2D5R B;  2E87 A;  2OCC C;  3POV A;  4RDA A;  2OG2 A;  2J46 A;  3QZC A;  4O6Y A;  4BJ1 A;  1O87 A;  3E70 C;  3UGP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...