4ZLCA

Crystal structure of the roq domain of human roquin-2
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
155
structure length
155
Chain Sequence
QNPQQLSANLWAAVRARGCQFLGPAMQEEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKTSIGHVVQLLYRASCFKVTKRDEDSSLMQLKEEFRSYEALRREHDAQIVHIAMEAGLRISPEQWSSLLYGDLAHKSHMQSIIDKLQSPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Roquin-2
publication title Structure of human Roquin-2 and its complex with constitutive-decay element RNA
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 54
structure length 155
sequence length 155
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18386 ROQ_II Roquin II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1790 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4zlcA00
4QI2A 4ZLDA 5F5FA 5F5HA 4QI0A 4YWQA 3X1OA 4ZLCA 4ULWA
chains in the Genus database with same CATH superfamily
3FVYA 3FXHA 2H7VC 2X0CA 3K7DA 3J06A 3A9CA 2ZXOA 2QTVA 4JJFA 4MNDA 1FFHA 4IGGA 1NLXA 4RD9A 5KYUA 1CGME 4ZLDA 2LFFA 3ZDLA 1EI7A 4ULWA 5L3VA 1IZMA 4OD4A 2YLGA 2CYDA 2HZ8A 5JLIA 2YHSA 3U8PA 1VMAA 1YARO 1TFOB 2EPNA 2KYHA 3JSZA 5CI8A 2KNHA 4LDKA 2W4MA 2VCCA 1GGQA 4C3DA 2VB6A 4CDYA 3T9OA 2EINC 4P9TA 3M4BA 4QI2A 2RD9A 4XTKA 5JRAA 3QVZA 4U5HA 4J7TA 4IAQA 3O10A 2CCYA 3RIPA 3JSEO 5AGFA 5BUOA 2Q3TA 3CQZA 4WGYA 4DRJB 5L3QA 5T3WA 1L3PA 4JKVA 3ZC4A 4DBQA 3UGOA 4A2NB 4CDAA 3DWWA 2UUHA 3IEEA 2NUTA 5KYYB 1QLEC 3LJBA 2YL3A 1XZQA 1OKKD 2VASA 2YL7A 3K1IC 1GQAA 3KYIA 3ZVRA 4FAPB 5JVEA 1PCXA 4Z9JA 2L6FA 3SZRA 1LIHA 5IY5C 2ETSA 3POVA 3JYYA 3IQTA 3KL4A 2CW0F 2L9JA 3DAFA 3NKDA 4MVUA 3L0IA 4PJJA 1EKYA 1E2XA 2F22A 1I4YA 2HUJA 3CAXA 3GORA 2DB4A 4CSAA 3R2PA 1JAFA 2Y3HA 1AUEA 3N24A 4ULVA 2XLEA 3SNHA 2WZLA 4MW3A 3N2ZB 3NYMA 1CPRA 5F5HA 3ZWIA 4KNVA 2MWQA 2JPUA 1NU7D 2HS5A 1MMGA 5E3AA 1J8YF 2AWYA 3U5SA 3EH2A 3K66A 4WABA 1ZZPA 1VLSA 4XLNF 2XL6A 3RQEA 5AC4A 1M2OA 1CGNA 2OCCC 1WN0A 2Q00A 2HFIA 3KKBA 3O39A 3QVYA 4XEVA 4E0HA 1WWPA 2EIMC 4JE9A 5B1AC 1KU2A 1ORJA 2XL4A 3DJNB 2XLDA 4U9EA 5A6JA 4PR9A 2QNLA 3GM3A 2HSBA 2XRHA 2DYRC 4YL0A 1TQGA 1RJ9B 4HFFB 1MMDA 2FFHA 2HSQA 4DRIB 3SP1A 4Q4ZF 2EILC 2HMQA 4K0DA 1E85A 2WVQA 1YVIA 3SXKA 1OKKA 2P6VA 1FAPB 1AEPA 1HMDA 1JR8A 1RXQA 2QY9A 3DI5A 4X0RA 4AE4A 3EZHA 3L34A 1Z3IX 4CS7A 1BR4A 2NPUA 3LESA 1U0BB 2GAQA 2L7AA 1VK5A 3O6XA 2OJQA 3T6GB 5D91A 1NFNA 3GEIA 3RW0A 5K0IA 3AGTA 2BC5A 3HLZA 2V3CC 1Y4CA 4D4XA 4EUKB 2G3VA 2Q9AA 3AG3C 2AP3A 4K7BA 3EHMA 1M6TA 2HKVA 1M2VB 1TWGA 2NG1A 3EJNA 3SEOA 3PHF2 4KNWA 1APCA 4I1MA 1VYKA 1FNTc 3V5XA 3T6JA 3LS0A 2QUPA 4O79A 2R7TA 4MW8A 3I4UA 3TK0A 4IB4A 1EA8A 4NTAA 2C03A 4IRUA 4FWVA 3TOMA 3L8IA 3VF0A 1E83A 2E87A 1OW8A 2W45A 2XLWA 3U9JA 3ATPA 2A0UA 3DAGA 3EG9A 4GQHA 3K33A 4EBBA 4NY3A 1Q0FA 2YLDA 2OEXA 1C17M 4CBEA 2CNWA 4K1OA 3HJCA 1OCOC 3C18A 3QZCA 4C7OB 2B0HA 1SYQA 1A7DA 3S9OA 2R02A 5T3TA 1ZU5A 5DQTA 1HE9A 4CX9A 3AG1C 3RVYA 3M79A 1TWCA 5KYUB 1VTMP 4MVMA 3GEEA 1PD1A 4JURI 3SXZA 3DXJF 3S90A 4LERA 2HJMA 3ASNC 3U2LA 1Z63A 3GANA 3DE9A 2YKZA 1Q0GA 5A6BA 3FAPB 4CIHA 2AU5A 5DLJA 3H65A 5CIVA 1LS1A 3DM9B 1K40A 3KYJA 2YZSA 256BA 3K6BA 4N6CA 4XEFA 5DQZA 5A69A 2WVOA 4CSAC 3GM1A 4U5GA 1YLMA 2PNOA 3ABKC 1PD0A 3MLGA 4I44A 4Q7CA 1G8XA 3U8VA 3MFNA 1RCPA 4KC9A 3JYHA 1ZVZA 2YRFA 2KK1A 3LS1A 2LFDA 2A6EF 3SYNA 4E17A 1Y6DA 2ZXRA 4EIYA 4EBKA 1O5HA 2LQGA 2EPOA 2R25A 4G0HA 4J32B 2WVNA 1NSGB 5E2QA 3GEHA 5DVWA 5BQHA 3C63A 1UG7A 5JSLA 4MVSA 5EGYA 1BDJB 1ORSC 1BR1A 2HJ3A 2J7PA 4PACA 2VH3A 3NMIA 5F5FA 4YK5A 2DYSC 2ICWG 1V4AA 2XLHA 1T01A 3EPVA 3LEVA 4H54A 5COFA 2Q7RA 1IW7F 1YYJA 3RKOF 1OR2A 3JRTA 4PJMA 3UNGC 4ER9A 1MNDA 1HY5A 3RQFA 1S7ZA 5E3CA 1BZ4A 1I4ZA 2J0WA 4A4AA 3NDBB 3GWNA 2WZFA 2J9WA 4JCHA 1SR2A 1FMVA 4L6RA 3QTHA 4DXWA 4AK9A 3G4ZA 2D5RB 1K05A 2H8AA 3WG7C 4DVZA 3EGDB 5JP7A 2ZD9A 3FAJA 1CGOA 1WATA 3JT1A 3RYLA 1Q0DA 3B71A 1MMAA 3PCVA 4U5EE 3WODF 2IXPA 3E9VA 4HFKB 4JRZA 1RMVA 3Q6MA 3FOPA 2ZPAA 2MHRA 3V5ZA 2TMVP 3RF3A 2Q9BA 2XS1A 1YJGA 1ZHTA 4AX2A 4EWCA 4IAOA 1JPJA 4LLEA 2R7OA 2OEVA 3W2WA 3OEOA 3FHDA 1OXKA 2DI3A 3C8GB 3G50A 3JCUQ 2LCHA 2O9XA 2PF4E 3ZTZA 5B3SC 4MTOA 3JTLO 3S28A 5KYWA 2Q9CA 2R7UA 2UUIA 1NBBA 2P7VA 3JZ0A 3EQLF 4HE8D 1OW7A 1NG1A 4NQFA 1T6UA 4C3EA 3F46A 3QW0A 3AJMA 2AWCA 2L81A 3KMIA 2FAPB 2R7VA 3LLKA 1VOMA 3MX3A 3H2UA 1Q0KA 4W8PA 4BJ6C 1TFKB 2PP4A 2L6HA 3A11A 1HW1A 3H2VA 3MYIA 4G78A 4P6IC 3ECSA 3W2VA 2P0NA 5DS6A 3GODA 4YJWA 2OG2A 2JX0A 5A6AA 2EPMX 1FMWA 2OKUA 4LDRA 4U5FE 5KYNA 1LE2A 1LE4A 2EIJC 4NTFA 4OIQF 3GWLA 2J0XA 4GEHA 1RKEA 4IARA 4ANJA 2IOQA 3MYFA 2EPLX 1QVXA 4XPYA 3DM5A 4U5DE 2XLVA 3DE8A 1VB5A 2LIGA 3NYJA 3PMRA 4F4BA 5KYYA 2PX0A 1Z23A 4JTCB 5JT4A 1KTMA 2V26A 2GDCA 1OCRC 2YWAA 1VLTA 2LK4A 2NSFA 2D4UA 2EIKC 1C03A 3ITFA 2R03A 1WTYA 3ABMC 5HSWA 2QLAA 1WGWA 1B68A 4O7GA 4U5CE 2CDQA 1HW2A 2A6HF 4MVZA 3UR3C 5T1DB 4O6NA 2L6GA 4EHPA 4QDLA 3S29A 2Z15A 1RKCA 2YEVA 3EGXA 3UGPA 3ZG1A 2GA0A 3HTKC 1HE1A 2XM0A 5B1BC 3V5YA 1ZHXA 1A41A 1PV3A 4ONSA 1Z7Qc 3R7CA 1T5OA 4BPMA 3B29A 3PDMP 5EHHA 4N06A 1GS9A 2XXAB 4XPWA 4CJGA 3M15A 1LI7A 4E18A 2KQ9A 3KPHA 2ZXWC 1E86A 2J45A 3GM2A 1Z5ZA 2NUPB 2H7OA 4NTBA 2P61A 3BEHA 4WJ0A 4YT4A 5D92A 4JC7A 2R7WA 5BQGA 1TWAA 3TULA 4OIPF 3WAQA 1JOGA 4BJ6A 1O87A 3LUTB 2KGOA 5KYXA 4I3MA 3HKKA 4E7SA 1QSPA 1U89A 1C02A 2QE9A 2YVKA 3IQ5A 1RJ9A 2BL2A 3AG2C 3IPMO 4DOZA 4CS8A 1WASA 2LSEA 1BR2A 2Y3DA 3NG1A 2WB7A 4BEMJ 3EFOA 4OIRF 3LAYA 4Q5SF 1E84A 3I5PA 1YDIA 5GPGB 3US6A 2G62A 1G4WR 1ZHWA 3HNIA 2Q4FA 1EQ1A 3TOLA 3M1CB 4LDQA 4YWQA 3G4XA 4CIPA 1WOLA 3C7JA 5EK0A 1D0YA 2J8WA 4WGZA 2R7XA 3Q6NA 1A7EA 1BBHA 2YL0A 1A7VA 3E70C 4FX5A 4JCZA 3Q7LA 4QI0A 3U2MA 2M4EA 1V74B 2B0JA 3K1HA 2DGJA 2IBFA 3ABLC 2NUTB 1DOWA 1FTSA 4D4NA 2A1DD 2YL1A 5JUAA 1G5ZA 3ZTMA 1M2VA 2HV6A 2J9VA 4XPXA 5AC5A 4MVRA 2XM4A 1NFOA 4PJNA 1W2WA 1K04A 3B0PA 1ORYA 2RSEB 5L0CA 3QW1A 2J9BA 3FOOA 2XSEA 2YQYA 3HNKA 3U3FA 4H4KC 3IQCA 3W8IA 5FCLA 1UFBA 1TR2A 1D0XA 1H6GA 4P9FA 1T6IA 1TWHA 3LNRA 1M57C 5L0HA 1D1CA 5DS5A 1MMNA 3WHNA 2OQMA 3U9MA 2M64A 1D0ZA 4IWBA 4JTDB 1ZW2A 4HEAJ 1ST6A 2HV7A 2IXNA 3T4RA 1ZW3A 5KYWB 4PJLA 1ZYRF 2R7QA 4EBJA 3T6BA 5FZTA 2W4BA 4N4WA 2XL8A 4BJTA 3ASOC 1CPQA 1ZHZA 1JPNA 3VAYA 3L1MA 2I8BA 3AGUA 1F1MA 2G3KA 3RFYA 3VRCA 3VYWA 2AVKA 5L0JA 4FESA 4UDVA 1I5NA 4JVSA 5COMA 3TJ6A 3M4CA 1O3UA 4JEAA 3TJ5A 2OOCA 1JRAA 1SZIA 1V55C 3HNLA 2GFHA 2JD3A 2IYLD 4IJJA 3F47A 3LEOA 4MS2A 4MTGA 1KNYA 3TD7A 3ZQVA 5HV9A 2MYSA 4AE4B 4B6IA 1RKEB 3B0VC 4NC3A 3L8JA 4KI2A 5L0FA 2Y69C 1LI5A 3AG4C 3KH2A 2VCBA 2VC9A 3ZIBA 4MVQA 4YL1A 1LKXA 3EHNA 3SXYA 4BJ5A 5BQIA 1YZCA 4YT8A 2A0BA 3DKAA 1SMYF 3EZIA 3DJUB 4O6YA 4Z9IA 3C8GD 5TJ5E 2Y3GA 4OIOF 1MNEA 1Z6AA 1QQ3A 2J46A 4XLPF 3DMDA 4NCQA 1NU9C 4JEBA 3EGXB 1FFTC 2IXMA 3VM6A 1G4US 1YAUO 3UMHA 4CS8C 2ZXPA 3CEXA 4J30B 3CZ6A 4OD5A 2P1AA 2X51A 4CS9A 3LLIA 1V54C 1TKNA 2VCAA 2WL8A 3ZQYA 4G7HF 2LP4A 2R9RB 4J7YA 5F28E 3EG9B 3S27A 4DVYP 3U0CA 1OXBA 4LACB 3ZSUA 3B0UX 3EGDA 5B3IA 2NSGA 5KYXB 1T9KA 2EPKX 1XZPA 2Y39A 4BJ1A 1HMOA 4PK4A 1M56C 2IXOA 1A0BA 1OW6A 4MQ9F 1ZHYA 3V7OA 4W8KA 1R4TA 2CNWD 2GWWA 1L7CA 3HNJA 3NKEA 1D1BA 1QPUA 3EFOB 4CDVA 3LNMB 4CJOA 3AOUA 1N1CA 1D1AA 2IM8A 4E7ZA 1OQCA 4N6HA 2KC3A 2PBEA 3QMKA 2CGEA 2J9UA 3C8GA 4YN0B 5DS4A 3SXMA 4U9DA 2R7SA 3C62A 1NZEA 1AVOB 4JIOA 3W8HA 4JW1A 1U6HA 2KJGA 1ZU4A 3K1IA 2KW3C 3FDQA 5A6BD 3NMKA 5L0GA 5CI9A 1LS4A 2PFDA 1LPEA 4JJGA 4AL1A 4XEKA 3W4YA 5JS5A 1H9TA 3Q7GA 1OR3A 3UMIA 2OJED 4XWJA 1JMWA 3RQGA 4YT2A 3S0XA 4KBLA 4LLCA 4XQ1A 3NYLA 4JZAA 1XWJA 4BEJA 2H7BA 1LM3B 3NRHA 3RVZA 3AQCA 1Q0MA 1H9GA 4M63A 1OCZC 2OU6A 2PX3A 1GM5A 1FR0A 2I15A 5E33A 2XLOA 4MVOA 1DOVA 4R32A 4MTFA 4JTAB 3RH3A 1MQVA 3AQBA 3S84A 2A68F 2XS8A 2XLMA 1OCCC 3N0TA 2KSFA 3I5QA 1YZAA 1YYXA 2W9YA 2J7PD 1SF8A 2R05A 3IQ6A 2R7RA 4G7OF 1VYIA 4DBRA 4AL0A 3CSKA 3OA1A 4YT5A 3BRJA 1YA7O 5A6KA 3O55A 4I1OB 3U3BA 3NMJA 4EKWA 2FGYA 4G7ZF 3FMSA 1LVKA 3C8ZA 2ASRA 4U5BE 5COGA 3DD7A 4BJ5C 1YA9A 4PFPA 1QKRA 2A69F 4GYTA 4YL3A 4E0IA 5L0DA 1J8MF 3X1OA 1H7IA 4ZLCA 4Z9HA 2XXAA 4C3BA 4OINF 2LD6A 2YLIA 3DZAA 4O6MA 4DJ9A 4DRHB 2Y3BA 3X2QC 2C04A 2HMZA 2NUPA 3EH1A 4BG0A 2WZGA 1T6QA 1S05A 3OWTA 1R5ID 4RBNA 3JRMO 4PFOA 5L0IA 4C7OA 3TQOA 3MBGA 4CS9C 2BE5F 3UMKA 3B9QA 4RDAA 3IHUA 1QZXA
chains in the Genus database with same CATH topology
3FVYA 2H7VC 3K7DA 2ZXOA 2QTVA 4JJFA 4MNDA 1FFHA 4RD9A 5KYUA 5L3VA 4ULWA 1IZMA 2YHSA 1VMAA 3JSZA 5CI8A 2KNHA 2W4MA 4C3DA 2VB6A 2EINC 4QI2A 4XTKA 4U5HA 3RIPA 5BUOA 2Q3TA 3CQZA 5L3QA 5T3WA 3ZC4A 4DBQA 3UGOA 4A2NB 3IEEA 2NUTA 5KYYB 1QLEC 3LJBA 1OKKD 2VASA 3K1IC 3ZVRA 1PCXA 3SZRA 5IY5C 3POVA 3KL4A 2CW0F 2L9JA 3DAFA 3NKDA 4PJJA 3L0IA 4CSAA 2Y3HA 3N24A 3SNHA 2WZLA 3N2ZB 3NYMA 5F5HA 4KNVA 2MWQA 1NU7D 5E3AA 1MMGA 1J8YF 3EH2A 3K66A 4XLNF 4ZLDA 1M2OA 2OCCC 3KKBA 3O39A 2EIMC 5B1AC 1KU2A 2XL4A 3DJNB 2XRHA 2DYRC 1RJ9B 4HFFB 1MMDA 2FFHA 4Q4ZF 3SP1A 2EILC 4K0DA 2WVQA 1OKKA 2P6VA 4AE4A 2QY9A 4X0RA 3EZHA 3L34A 1Z3IX 4CS7A 1BR4A 3LESA 1VK5A 3O6XA 5D91A 3HLZA 2V3CC 2G3VA 2Q9AA 3AG3C 4K7BA 3EHMA 1M2VB 1TWGA 2NG1A 3EJNA 3SEOA 3PHF2 4KNWA 4I1MA 1VYKA 3T6JA 3LS0A 4O79A 2R7TA 3I4UA 2C03A 4IRUA 4FWVA 2E87A 2W45A 3DAGA 3EG9A 3K33A 4EBBA 4NY3A 4CBEA 2CNWA 3HJCA 1OCOC 4C7OB 3QZCA 5T3TA 1ZU5A 5DQTA 3AG1C 1TWCA 5KYUB 1PD1A 4JURI 3DXJF 4LERA 1Z63A 3ASNC 3GANA 4CIHA 5DLJA 3H65A 1LS1A 3DM9B 2YZSA 3K6BA 5DQZA 2WVOA 4CSAC 4U5GA 3ABKC 1PD0A 3MLGA 4I44A 4Q7CA 1G8XA 4KC9A 3JYHA 3LS1A 3SYNA 2A6EF 2ZXRA 1O5HA 4G0HA 4J32B 2WVNA 5E2QA 5DVWA 5EGYA 1BR1A 2J7PA 2VH3A 5F5FA 2DYSC 3EPVA 2R7SA 3LEVA 3UNGC 3RKOF 1IW7F 4PJMA 3JRTA 1MNDA 1S7ZA 5E3CA 2J0WA 3NDBB 2WZFA 2J9WA 4JCHA 1FMVA 4AK9A 2D5RB 3WG7C 4DVZA 3EGDB 3FAJA 3JT1A 3RYLA 4U5EE 1MMAA 3WODF 2IXPA 3E9VA 4HFKB 3Q6MA 2ZPAA 2Q9BA 4AX2A 1ZHTA 4EWCA 4IAOA 1JPJA 4LLEA 2R7OA 3W2WA 3OEOA 3FHDA 3JCUQ 2O9XA 2PF4E 5B3SC 3S28A 5KYWA 2Q9CA 2R7UA 2P7VA 4HE8D 3EQLF 1NG1A 4C3EA 3F46A 2L81A 3KMIA 2R7VA 3LLKA 1VOMA 3MX3A 4BJ6C 2PP4A 4P6IC 3W2VA 5DS6A 3ECSA 3GODA 4YJWA 2OG2A 1FMWA 5KYNA 4U5FE 2EIJC 4OIQF 4GEHA 2J0XA 4ANJA 2IOQA 3DM5A 4U5DE 4F4BA 3PMRA 3NYJA 5KYYA 2PX0A 1Z23A 2V26A 3ITFA 1OCRC 2EIKC 3ABMC 5HSWA 1WGWA 4O7GA 4U5CE 2CDQA 2A6HF 3UR3C 5T1DB 4O6NA 4QDLA 3S29A 2Z15A 2YEVA 3EGXA 3UGPA 3ZG1A 3HTKC 5B1BC 1ZHXA 5EHHA 4N06A 2XXAB 2KQ9A 2ZXWC 2J45A 1Z5ZA 2NUPB 2H7OA 4WJ0A 4YT4A 5D92A 4OIPF 2R7WA 1TWAA 4BJ6A 5KYXA 1O87A 2KGOA 4I3MA 4E7SA 1RJ9A 3AG2C 4DOZA 4CS8A 2LSEA 1BR2A 2Y3DA 3NG1A 2WB7A 3EFOA 4OIRF 3LAYA 4Q5SF 3I5PA 2G62A 1ZHWA 3M1CB 4YWQA 1D0YA 2R7XA 3Q6NA 3E70C 4FX5A 4QI0A 3Q7LA 2M4EA 2B0JA 3K1HA 2DGJA 3ABLC 2NUTB 1FTSA 2A1DD 1M2VA 2HV6A 2J9VA 4PJNA 1W2WA 3B0PA 2XSEA 4H4KC 3W8IA 5FCLA 1D0XA 1TR2A 1TWHA 5DS5A 3LNRA 1M57C 1D1CA 1MMNA 4IWBA 1D0ZA 4HEAJ 1ST6A 2HV7A 2IXNA 3T4RA 5KYWB 4PJLA 1ZYRF 2R7QA 3T6BA 2W4BA 4BJTA 3ASOC 1ZHZA 1JPNA 3VAYA 2I8BA 2G3KA 3RFYA 3VYWA 4FESA 4JVSA 1SZIA 1V55C 4OD4A 2GFHA 2JD3A 2IYLD 4IJJA 3F47A 3TD7A 2MYSA 4AE4B 4B6IA 3B0VC 4KI2A 2Y69C 3AG4C 3KH2A 3ZIBA 1LKXA 3EHNA 4BJ5A 4YT8A 3EZIA 1SMYF 3DJUB 4O6YA 2Y3GA 4OIOF 1MNEA 1Z6AA 2J46A 4XLPF 3DMDA 1NU9C 3EGXB 1FFTC 2IXMA 3UMHA 4CS8C 2ZXPA 4J30B 3CZ6A 4OD5A 2X51A 4CS9A 3LLIA 1V54C 1TKNA 2WL8A 4G7HF 3EG9B 3S27A 4DVYP 4LACB 3ZSUA 3B0UX 3EGDA 5KYXB 4BJ1A 2Y39A 4PK4A 1M56C 2IXOA 4MQ9F 1ZHYA 3V7OA 4W8KA 2CNWD 3NKEA 1D1BA 3EFOB 1N1CA 1D1AA 4E7ZA 3QMKA 2CGEA 2J9UA 4YN0B 5DS4A 1NZEA 3W8HA 4JW1A 2KJGA 1ZU4A 2KW3C 3FDQA 5CI9A 2PFDA 4JJGA 3Q7GA 3UMIA 4XWJA 4YT2A 3S0XA 4KBLA 4LLCA 3NYLA 4JZAA 4BEJA 2H7BA 3NRHA 3AQCA 4M63A 1OCZC 2PX3A 5E33A 3RH3A 3AQBA 2A68F 1OCCC 3N0TA 3I5QA 2W9YA 2J7PD 1SF8A 2R7RA 4G7OF 1VYIA 4DBRA 3CSKA 3OA1A 4YT5A 4I1OB 2FGYA 4G7ZF 1LVKA 4U5BE 3DD7A 4BJ5C 4PFPA 2A69F 4GYTA 1J8MF 3X1OA 4ZLCA 2XXAA 4C3BA 4OINF 3DZAA 4O6MA 2Y3BA 3X2QC 2C04A 2NUPA 3EH1A 4BG0A 2WZGA 3OWTA 4RBNA 4PFOA 4C7OA 4CS9C 2BE5F 3UMKA 3B9QA 4RDAA 1QZXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QI2 A;  4ZLD A;  5F5F A;  5F5H A;  4QI0 A;  4YWQ A;  3X1O A;  4ZLC A;  4ULW A; 
#chains in the Genus database with same CATH topology
 3FVY A;  3FXH A;  2H7V C;  2X0C A;  3K7D A;  3J06 A;  3A9C A;  2ZXO A;  2QTV A;  4JJF A;  4MND A;  1FFH A;  4IGG A;  1NLX A;  4RD9 A;  5KYU A;  1CGM E;  4ZLD A;  2LFF A;  3ZDL A;  1EI7 A;  4ULW A;  5L3V A;  1IZM A;  4OD4 A;  2YLG A;  2CYD A;  2HZ8 A;  5JLI A;  2YHS A;  3U8P A;  1VMA A;  1YAR O;  1TFO B;  2EPN A;  2KYH A;  3JSZ A;  5CI8 A;  2KNH A;  4LDK A;  2W4M A;  2VCC A;  1GGQ A;  4C3D A;  2VB6 A;  4CDY A;  3T9O A;  2EIN C;  4P9T A;  3M4B A;  4QI2 A;  2RD9 A;  4XTK A;  5JRA A;  3QVZ A;  4U5H A;  4J7T A;  4IAQ A;  3O10 A;  2CCY A;  3RIP A;  3JSE O;  5AGF A;  5BUO A;  2Q3T A;  3CQZ A;  4WGY A;  4DRJ B;  5L3Q A;  5T3W A;  1L3P A;  4JKV A;  3ZC4 A;  4DBQ A;  3UGO A;  4A2N B;  4CDA A;  3DWW A;  2UUH A;  3IEE A;  2NUT A;  5KYY B;  1QLE C;  3LJB A;  2YL3 A;  1XZQ A;  1OKK D;  2VAS A;  2YL7 A;  3K1I C;  1GQA A;  3KYI A;  3ZVR A;  4FAP B;  5JVE A;  1PCX A;  4Z9J A;  2L6F A;  3SZR A;  1LIH A;  5IY5 C;  2ETS A;  3POV A;  3JYY A;  3IQT A;  3KL4 A;  2CW0 F;  2L9J A;  3DAF A;  3NKD A;  4MVU A;  3L0I A;  4PJJ A;  1EKY A;  1E2X A;  2F22 A;  1I4Y A;  2HUJ A;  3CAX A;  3GOR A;  2DB4 A;  4CSA A;  3R2P A;  1JAF A;  2Y3H A;  1AUE A;  3N24 A;  4ULV A;  2XLE A;  3SNH A;  2WZL A;  4MW3 A;  3N2Z B;  3NYM A;  1CPR A;  5F5H A;  3ZWI A;  4KNV A;  2MWQ A;  2JPU A;  1NU7 D;  2HS5 A;  1MMG A;  5E3A A;  1J8Y F;  2AWY A;  3U5S A;  3EH2 A;  3K66 A;  4WAB A;  1ZZP A;  1VLS A;  4XLN F;  2XL6 A;  3RQE A;  5AC4 A;  1M2O A;  1CGN A;  2OCC C;  1WN0 A;  2Q00 A;  2HFI A;  3KKB A;  3O39 A;  3QVY A;  4XEV A;  4E0H A;  1WWP A;  2EIM C;  4JE9 A;  5B1A C;  1KU2 A;  1ORJ A;  2XL4 A;  3DJN B;  2XLD A;  4U9E A;  5A6J A;  4PR9 A;  2QNL A;  3GM3 A;  2HSB A;  2XRH A;  2DYR C;  4YL0 A;  1TQG A;  1RJ9 B;  4HFF B;  1MMD A;  2FFH A;  2HSQ A;  4DRI B;  3SP1 A;  4Q4Z F;  2EIL C;  2HMQ A;  4K0D A;  1E85 A;  2WVQ A;  1YVI A;  3SXK A;  1OKK A;  2P6V A;  1FAP B;  1AEP A;  1HMD A;  1JR8 A;  1RXQ A;  2QY9 A;  3DI5 A;  4X0R A;  4AE4 A;  3EZH A;  3L34 A;  1Z3I X;  4CS7 A;  1BR4 A;  2NPU A;  3LES A;  1U0B B;  2GAQ A;  2L7A A;  1VK5 A;  3O6X A;  2OJQ A;  3T6G B;  5D91 A;  1NFN A;  3GEI A;  3RW0 A;  5K0I A;  3AGT A;  2BC5 A;  3HLZ A;  2V3C C;  1Y4C A;  4D4X A;  4EUK B;  2G3V A;  2Q9A A;  3AG3 C;  2AP3 A;  4K7B A;  3EHM A;  1M6T A;  2HKV A;  1M2V B;  1TWG A;  2NG1 A;  3EJN A;  3SEO A;  3PHF 2;  4KNW A;  1APC A;  4I1M A;  1VYK A;  1FNT c;  3V5X A;  3T6J A;  3LS0 A;  2QUP A;  4O79 A;  2R7T A;  4MW8 A;  3I4U A;  3TK0 A;  4IB4 A;  1EA8 A;  4NTA A;  2C03 A;  4IRU A;  4FWV A;  3TOM A;  3L8I A;  3VF0 A;  1E83 A;  2E87 A;  1OW8 A;  2W45 A;  2XLW A;  3U9J A;  3ATP A;  2A0U A;  3DAG A;  3EG9 A;  4GQH A;  3K33 A;  4EBB A;  4NY3 A;  1Q0F A;  2YLD A;  2OEX A;  1C17 M;  4CBE A;  2CNW A;  4K1O A;  3HJC A;  1OCO C;  3C18 A;  3QZC A;  4C7O B;  2B0H A;  1SYQ A;  1A7D A;  3S9O A;  2R02 A;  5T3T A;  1ZU5 A;  5DQT A;  1HE9 A;  4CX9 A;  3AG1 C;  3RVY A;  3M79 A;  1TWC A;  5KYU B;  1VTM P;  4MVM A;  3GEE A;  1PD1 A;  4JUR I;  3SXZ A;  3DXJ F;  3S90 A;  4LER A;  2HJM A;  3ASN C;  3U2L A;  1Z63 A;  3GAN A;  3DE9 A;  2YKZ A;  1Q0G A;  5A6B A;  3FAP B;  4CIH A;  2AU5 A;  5DLJ A;  3H65 A;  5CIV A;  1LS1 A;  3DM9 B;  1K40 A;  3KYJ A;  2YZS A;  256B A;  3K6B A;  4N6C A;  4XEF A;  5DQZ A;  5A69 A;  2WVO A;  4CSA C;  3GM1 A;  4U5G A;  1YLM A;  2PNO A;  3ABK C;  1PD0 A;  3MLG A;  4I44 A;  4Q7C A;  1G8X A;  3U8V A;  3MFN A;  1RCP A;  4KC9 A;  3JYH A;  1ZVZ A;  2YRF A;  2KK1 A;  3LS1 A;  2LFD A;  2A6E F;  3SYN A;  4E17 A;  1Y6D A;  2ZXR A;  4EIY A;  4EBK A;  1O5H A;  2LQG A;  2EPO A;  2R25 A;  4G0H A;  4J32 B;  2WVN A;  1NSG B;  5E2Q A;  3GEH A;  5DVW A;  5BQH A;  3C63 A;  1UG7 A;  5JSL A;  4MVS A;  5EGY A;  1BDJ B;  1ORS C;  1BR1 A;  2HJ3 A;  2J7P A;  4PAC A;  2VH3 A;  3NMI A;  5F5F A;  4YK5 A;  2DYS C;  2ICW G;  1V4A A;  2XLH A;  1T01 A;  3EPV A;  3LEV A;  4H54 A;  5COF A;  2Q7R A;  1IW7 F;  1YYJ A;  3RKO F;  1OR2 A;  3JRT A;  4PJM A;  3UNG C;  4ER9 A;  1MND A;  1HY5 A;  3RQF A;  1S7Z A;  5E3C A;  1BZ4 A;  1I4Z A;  2J0W A;  4A4A A;  3NDB B;  3GWN A;  2WZF A;  2J9W A;  4JCH A;  1SR2 A;  1FMV A;  4L6R A;  3QTH A;  4DXW A;  4AK9 A;  3G4Z A;  2D5R B;  1K05 A;  2H8A A;  3WG7 C;  4DVZ A;  3EGD B;  5JP7 A;  2ZD9 A;  3FAJ A;  1CGO A;  1WAT A;  3JT1 A;  3RYL A;  1Q0D A;  3B71 A;  1MMA A;  3PCV A;  4U5E E;  3WOD F;  2IXP A;  3E9V A;  4HFK B;  4JRZ A;  1RMV A;  3Q6M A;  3FOP A;  2ZPA A;  2MHR A;  3V5Z A;  2TMV P;  3RF3 A;  2Q9B A;  2XS1 A;  1YJG A;  1ZHT A;  4AX2 A;  4EWC A;  4IAO A;  1JPJ A;  4LLE A;  2R7O A;  2OEV A;  3W2W A;  3OEO A;  3FHD A;  1OXK A;  2DI3 A;  3C8G B;  3G50 A;  3JCU Q;  2LCH A;  2O9X A;  2PF4 E;  3ZTZ A;  5B3S C;  4MTO A;  3JTL O;  3S28 A;  5KYW A;  2Q9C A;  2R7U A;  2UUI A;  1NBB A;  2P7V A;  3JZ0 A;  3EQL F;  4HE8 D;  1OW7 A;  1NG1 A;  4NQF A;  1T6U A;  4C3E A;  3F46 A;  3QW0 A;  3AJM A;  2AWC A;  2L81 A;  3KMI A;  2FAP B;  2R7V A;  3LLK A;  1VOM A;  3MX3 A;  3H2U A;  1Q0K A;  4W8P A;  4BJ6 C;  1TFK B;  2PP4 A;  2L6H A;  3A11 A;  1HW1 A;  3H2V A;  3MYI A;  4G78 A;  4P6I C;  3ECS A;  3W2V A;  2P0N A;  5DS6 A;  3GOD A;  4YJW A;  2OG2 A;  2JX0 A;  5A6A A;  2EPM X;  1FMW A;  2OKU A;  4LDR A;  4U5F E;  5KYN A;  1LE2 A;  1LE4 A;  2EIJ C;  4NTF A;  4OIQ F;  3GWL A;  2J0X A;  4GEH A;  1RKE A;  4IAR A;  4ANJ A;  2IOQ A;  3MYF A;  2EPL X;  1QVX A;  4XPY A;  3DM5 A;  4U5D E;  2XLV A;  3DE8 A;  1VB5 A;  2LIG A;  3NYJ A;  3PMR A;  4F4B A;  5KYY A;  2PX0 A;  1Z23 A;  4JTC B;  5JT4 A;  1KTM A;  2V26 A;  2GDC A;  1OCR C;  2YWA A;  1VLT A;  2LK4 A;  2NSF A;  2D4U A;  2EIK C;  1C03 A;  3ITF A;  2R03 A;  1WTY A;  3ABM C;  5HSW A;  2QLA A;  1WGW A;  1B68 A;  4O7G A;  4U5C E;  2CDQ A;  1HW2 A;  2A6H F;  4MVZ A;  3UR3 C;  5T1D B;  4O6N A;  2L6G A;  4EHP A;  4QDL A;  3S29 A;  2Z15 A;  1RKC A;  2YEV A;  3EGX A;  3UGP A;  3ZG1 A;  2GA0 A;  3HTK C;  1HE1 A;  2XM0 A;  5B1B C;  3V5Y A;  1ZHX A;  1A41 A;  1PV3 A;  4ONS A;  1Z7Q c;  3R7C A;  1T5O A;  4BPM A;  3B29 A;  3PDM P;  5EHH A;  4N06 A;  1GS9 A;  2XXA B;  4XPW A;  4CJG A;  3M15 A;  1LI7 A;  4E18 A;  2KQ9 A;  3KPH A;  2ZXW C;  1E86 A;  2J45 A;  3GM2 A;  1Z5Z A;  2NUP B;  2H7O A;  4NTB A;  2P61 A;  3BEH A;  4WJ0 A;  4YT4 A;  5D92 A;  4JC7 A;  2R7W A;  5BQG A;  1TWA A;  3TUL A;  4OIP F;  3WAQ A;  1JOG A;  4BJ6 A;  1O87 A;  3LUT B;  2KGO A;  5KYX A;  4I3M A;  3HKK A;  4E7S A;  1QSP A;  1U89 A;  1C02 A;  2QE9 A;  2YVK A;  3IQ5 A;  1RJ9 A;  2BL2 A;  3AG2 C;  3IPM O;  4DOZ A;  4CS8 A;  1WAS A;  2LSE A;  1BR2 A;  2Y3D A;  3NG1 A;  2WB7 A;  4BEM J;  3EFO A;  4OIR F;  3LAY A;  4Q5S F;  1E84 A;  3I5P A;  1YDI A;  5GPG B;  3US6 A;  2G62 A;  1G4W R;  1ZHW A;  3HNI A;  2Q4F A;  1EQ1 A;  3TOL A;  3M1C B;  4LDQ A;  4YWQ A;  3G4X A;  4CIP A;  1WOL A;  3C7J A;  5EK0 A;  1D0Y A;  2J8W A;  4WGZ A;  2R7X A;  3Q6N A;  1A7E A;  1BBH A;  2YL0 A;  1A7V A;  3E70 C;  4FX5 A;  4JCZ A;  3Q7L A;  4QI0 A;  3U2M A;  2M4E A;  1V74 B;  2B0J A;  3K1H A;  2DGJ A;  2IBF A;  3ABL C;  2NUT B;  1DOW A;  1FTS A;  4D4N A;  2A1D D;  2YL1 A;  5JUA A;  1G5Z A;  3ZTM A;  1M2V A;  2HV6 A;  2J9V A;  4XPX A;  5AC5 A;  4MVR A;  2XM4 A;  1NFO A;  4PJN A;  1W2W A;  1K04 A;  3B0P A;  1ORY A;  2RSE B;  5L0C A;  3QW1 A;  2J9B A;  3FOO A;  2XSE A;  2YQY A;  3HNK A;  3U3F A;  4H4K C;  3IQC A;  3W8I A;  5FCL A;  1UFB A;  1TR2 A;  1D0X A;  1H6G A;  4P9F A;  1T6I A;  1TWH A;  3LNR A;  1M57 C;  5L0H A;  1D1C A;  5DS5 A;  1MMN A;  3WHN A;  2OQM A;  3U9M A;  2M64 A;  1D0Z A;  4IWB A;  4JTD B;  1ZW2 A;  4HEA J;  1ST6 A;  2HV7 A;  2IXN A;  3T4R A;  1ZW3 A;  5KYW B;  4PJL A;  1ZYR F;  2R7Q A;  4EBJ A;  3T6B A;  5FZT A;  2W4B A;  4N4W A;  2XL8 A;  4BJT A;  3ASO C;  1CPQ A;  1ZHZ A;  1JPN A;  3VAY A;  3L1M A;  2I8B A;  3AGU A;  1F1M A;  2G3K A;  3RFY A;  3VRC A;  3VYW A;  2AVK A;  5L0J A;  4FES A;  4UDV A;  1I5N A;  4JVS A;  5COM A;  3TJ6 A;  3M4C A;  1O3U A;  4JEA A;  3TJ5 A;  2OOC A;  1JRA A;  1SZI A;  1V55 C;  3HNL A;  2GFH A;  2JD3 A;  2IYL D;  4IJJ A;  3F47 A;  3LEO A;  4MS2 A;  4MTG A;  1KNY A;  3TD7 A;  3ZQV A;  5HV9 A;  2MYS A;  4AE4 B;  4B6I A;  1RKE B;  3B0V C;  4NC3 A;  3L8J A;  4KI2 A;  5L0F A;  2Y69 C;  1LI5 A;  3AG4 C;  3KH2 A;  2VCB A;  2VC9 A;  3ZIB A;  4MVQ A;  4YL1 A;  1LKX A;  3EHN A;  3SXY A;  4BJ5 A;  5BQI A;  1YZC A;  4YT8 A;  2A0B A;  3DKA A;  1SMY F;  3EZI A;  3DJU B;  4O6Y A;  4Z9I A;  3C8G D;  5TJ5 E;  2Y3G A;  4OIO F;  1MNE A;  1Z6A A;  1QQ3 A;  2J46 A;  4XLP F;  3DMD A;  4NCQ A;  1NU9 C;  4JEB A;  3EGX B;  1FFT C;  2IXM A;  3VM6 A;  1G4U S;  1YAU O;  3UMH A;  4CS8 C;  2ZXP A;  3CEX A;  4J30 B;  3CZ6 A;  4OD5 A;  2P1A A;  2X51 A;  4CS9 A;  3LLI A;  1V54 C;  1TKN A;  2VCA A;  2WL8 A;  3ZQY A;  4G7H F;  2LP4 A;  2R9R B;  4J7Y A;  5F28 E;  3EG9 B;  3S27 A;  4DVY P;  3U0C A;  1OXB A;  4LAC B;  3ZSU A;  3B0U X;  3EGD A;  5B3I A;  2NSG A;  5KYX B;  1T9K A;  2EPK X;  1XZP A;  2Y39 A;  4BJ1 A;  1HMO A;  4PK4 A;  1M56 C;  2IXO A;  1A0B A;  1OW6 A;  4MQ9 F;  1ZHY A;  3V7O A;  4W8K A;  1R4T A;  2CNW D;  2GWW A;  1L7C A;  3HNJ A;  3NKE A;  1D1B A;  1QPU A;  3EFO B;  4CDV A;  3LNM B;  4CJO A;  3AOU A;  1N1C A;  1D1A A;  2IM8 A;  4E7Z A;  1OQC A;  4N6H A;  2KC3 A;  2PBE A;  3QMK A;  2CGE A;  2J9U A;  3C8G A;  4YN0 B;  5DS4 A;  3SXM A;  4U9D A;  2R7S A;  3C62 A;  1NZE A;  1AVO B;  4JIO A;  3W8H A;  4JW1 A;  1U6H A;  2KJG A;  1ZU4 A;  3K1I A;  2KW3 C;  3FDQ A;  5A6B D;  3NMK A;  5L0G A;  5CI9 A;  1LS4 A;  2PFD A;  1LPE A;  4JJG A;  4AL1 A;  4XEK A;  3W4Y A;  5JS5 A;  1H9T A;  3Q7G A;  1OR3 A;  3UMI A;  2OJE D;  4XWJ A;  1JMW A;  3RQG A;  4YT2 A;  3S0X A;  4KBL A;  4LLC A;  4XQ1 A;  3NYL A;  4JZA A;  1XWJ A;  4BEJ A;  2H7B A;  1LM3 B;  3NRH A;  3RVZ A;  3AQC A;  1Q0M A;  1H9G A;  4M63 A;  1OCZ C;  2OU6 A;  2PX3 A;  1GM5 A;  1FR0 A;  2I15 A;  5E33 A;  2XLO A;  4MVO A;  1DOV A;  4R32 A;  4MTF A;  4JTA B;  3RH3 A;  1MQV A;  3AQB A;  3S84 A;  2A68 F;  2XS8 A;  2XLM A;  1OCC C;  3N0T A;  2KSF A;  3I5Q A;  1YZA A;  1YYX A;  2W9Y A;  2J7P D;  1SF8 A;  2R05 A;  3IQ6 A;  2R7R A;  4G7O F;  1VYI A;  4DBR A;  4AL0 A;  3CSK A;  3OA1 A;  4YT5 A;  3BRJ A;  1YA7 O;  5A6K A;  3O55 A;  4I1O B;  3U3B A;  3NMJ A;  4EKW A;  2FGY A;  4G7Z F;  3FMS A;  1LVK A;  3C8Z A;  2ASR A;  4U5B E;  5COG A;  3DD7 A;  4BJ5 C;  1YA9 A;  4PFP A;  1QKR A;  2A69 F;  4GYT A;  4YL3 A;  4E0I A;  5L0D A;  1J8M F;  3X1O A;  1H7I A;  4ZLC A;  4Z9H A;  2XXA A;  4C3B A;  4OIN F;  2LD6 A;  2YLI A;  3DZA A;  4O6M A;  4DJ9 A;  4DRH B;  2Y3B A;  3X2Q C;  2C04 A;  2HMZ A;  2NUP A;  3EH1 A;  4BG0 A;  2WZG A;  1T6Q A;  1S05 A;  3OWT A;  1R5I D;  4RBN A;  3JRM O;  4PFO A;  5L0I A;  4C7O A;  3TQO A;  3MBG A;  4CS9 C;  2BE5 F;  3UMK A;  3B9Q A;  4RDA A;  3IHU A;  1QZX A; 
#chains in the Genus database with same CATH homology
 3FVY A;  2H7V C;  3K7D A;  2ZXO A;  2QTV A;  4JJF A;  4MND A;  1FFH A;  4RD9 A;  5KYU A;  5L3V A;  4ULW A;  1IZM A;  2YHS A;  1VMA A;  3JSZ A;  5CI8 A;  2KNH A;  2W4M A;  4C3D A;  2VB6 A;  2EIN C;  4QI2 A;  4XTK A;  4U5H A;  3RIP A;  5BUO A;  2Q3T A;  3CQZ A;  5L3Q A;  5T3W A;  3ZC4 A;  4DBQ A;  3UGO A;  4A2N B;  3IEE A;  2NUT A;  5KYY B;  1QLE C;  3LJB A;  1OKK D;  2VAS A;  3K1I C;  3ZVR A;  1PCX A;  3SZR A;  5IY5 C;  3POV A;  3KL4 A;  2CW0 F;  2L9J A;  3DAF A;  3NKD A;  4PJJ A;  3L0I A;  4CSA A;  2Y3H A;  3N24 A;  3SNH A;  2WZL A;  3N2Z B;  3NYM A;  5F5H A;  4KNV A;  2MWQ A;  1NU7 D;  5E3A A;  1MMG A;  1J8Y F;  3EH2 A;  3K66 A;  4XLN F;  4ZLD A;  1M2O A;  2OCC C;  3KKB A;  3O39 A;  2EIM C;  5B1A C;  1KU2 A;  2XL4 A;  3DJN B;  2XRH A;  2DYR C;  1RJ9 B;  4HFF B;  1MMD A;  2FFH A;  4Q4Z F;  3SP1 A;  2EIL C;  4K0D A;  2WVQ A;  1OKK A;  2P6V A;  4AE4 A;  2QY9 A;  4X0R A;  3EZH A;  3L34 A;  1Z3I X;  4CS7 A;  1BR4 A;  3LES A;  1VK5 A;  3O6X A;  5D91 A;  3HLZ A;  2V3C C;  2G3V A;  2Q9A A;  3AG3 C;  4K7B A;  3EHM A;  1M2V B;  1TWG A;  2NG1 A;  3EJN A;  3SEO A;  3PHF 2;  4KNW A;  4I1M A;  1VYK A;  3T6J A;  3LS0 A;  4O79 A;  2R7T A;  3I4U A;  2C03 A;  4IRU A;  4FWV A;  2E87 A;  2W45 A;  3DAG A;  3EG9 A;  3K33 A;  4EBB A;  4NY3 A;  4CBE A;  2CNW A;  3HJC A;  1OCO C;  4C7O B;  3QZC A;  5T3T A;  1ZU5 A;  5DQT A;  3AG1 C;  1TWC A;  5KYU B;  1PD1 A;  4JUR I;  3DXJ F;  4LER A;  1Z63 A;  3ASN C;  3GAN A;  4CIH A;  5DLJ A;  3H65 A;  1LS1 A;  3DM9 B;  2YZS A;  3K6B A;  5DQZ A;  2WVO A;  4CSA C;  4U5G A;  3ABK C;  1PD0 A;  3MLG A;  4I44 A;  4Q7C A;  1G8X A;  4KC9 A;  3JYH A;  3LS1 A;  3SYN A;  2A6E F;  2ZXR A;  1O5H A;  4G0H A;  4J32 B;  2WVN A;  5E2Q A;  5DVW A;  5EGY A;  1BR1 A;  2J7P A;  2VH3 A;  5F5F A;  2DYS C;  3EPV A;  2R7S A;  3LEV A;  3UNG C;  3RKO F;  1IW7 F;  4PJM A;  3JRT A;  1MND A;  1S7Z A;  5E3C A;  2J0W A;  3NDB B;  2WZF A;  2J9W A;  4JCH A;  1FMV A;  4AK9 A;  2D5R B;  3WG7 C;  4DVZ A;  3EGD B;  3FAJ A;  3JT1 A;  3RYL A;  4U5E E;  1MMA A;  3WOD F;  2IXP A;  3E9V A;  4HFK B;  3Q6M A;  2ZPA A;  2Q9B A;  4AX2 A;  1ZHT A;  4EWC A;  4IAO A;  1JPJ A;  4LLE A;  2R7O A;  3W2W A;  3OEO A;  3FHD A;  3JCU Q;  2O9X A;  2PF4 E;  5B3S C;  3S28 A;  5KYW A;  2Q9C A;  2R7U A;  2P7V A;  4HE8 D;  3EQL F;  1NG1 A;  4C3E A;  3F46 A;  2L81 A;  3KMI A;  2R7V A;  3LLK A;  1VOM A;  3MX3 A;  4BJ6 C;  2PP4 A;  4P6I C;  3W2V A;  5DS6 A;  3ECS A;  3GOD A;  4YJW A;  2OG2 A;  1FMW A;  5KYN A;  4U5F E;  2EIJ C;  4OIQ F;  4GEH A;  2J0X A;  4ANJ A;  2IOQ A;  3DM5 A;  4U5D E;  4F4B A;  3PMR A;  3NYJ A;  5KYY A;  2PX0 A;  1Z23 A;  2V26 A;  3ITF A;  1OCR C;  2EIK C;  3ABM C;  5HSW A;  1WGW A;  4O7G A;  4U5C E;  2CDQ A;  2A6H F;  3UR3 C;  5T1D B;  4O6N A;  4QDL A;  3S29 A;  2Z15 A;  2YEV A;  3EGX A;  3UGP A;  3ZG1 A;  3HTK C;  5B1B C;  1ZHX A;  5EHH A;  4N06 A;  2XXA B;  2KQ9 A;  2ZXW C;  2J45 A;  1Z5Z A;  2NUP B;  2H7O A;  4WJ0 A;  4YT4 A;  5D92 A;  4OIP F;  2R7W A;  1TWA A;  4BJ6 A;  5KYX A;  1O87 A;  2KGO A;  4I3M A;  4E7S A;  1RJ9 A;  3AG2 C;  4DOZ A;  4CS8 A;  2LSE A;  1BR2 A;  2Y3D A;  3NG1 A;  2WB7 A;  3EFO A;  4OIR F;  3LAY A;  4Q5S F;  3I5P A;  2G62 A;  1ZHW A;  3M1C B;  4YWQ A;  1D0Y A;  2R7X A;  3Q6N A;  3E70 C;  4FX5 A;  4QI0 A;  3Q7L A;  2M4E A;  2B0J A;  3K1H A;  2DGJ A;  3ABL C;  2NUT B;  1FTS A;  2A1D D;  1M2V A;  2HV6 A;  2J9V A;  4PJN A;  1W2W A;  3B0P A;  2XSE A;  4H4K C;  3W8I A;  5FCL A;  1D0X A;  1TR2 A;  1TWH A;  5DS5 A;  3LNR A;  1M57 C;  1D1C A;  1MMN A;  4IWB A;  1D0Z A;  4HEA J;  1ST6 A;  2HV7 A;  2IXN A;  3T4R A;  5KYW B;  4PJL A;  1ZYR F;  2R7Q A;  3T6B A;  2W4B A;  4BJT A;  3ASO C;  1ZHZ A;  1JPN A;  3VAY A;  2I8B A;  2G3K A;  3RFY A;  3VYW A;  4FES A;  4JVS A;  1SZI A;  1V55 C;  4OD4 A;  2GFH A;  2JD3 A;  2IYL D;  4IJJ A;  3F47 A;  3TD7 A;  2MYS A;  4AE4 B;  4B6I A;  3B0V C;  4KI2 A;  2Y69 C;  3AG4 C;  3KH2 A;  3ZIB A;  1LKX A;  3EHN A;  4BJ5 A;  4YT8 A;  3EZI A;  1SMY F;  3DJU B;  4O6Y A;  2Y3G A;  4OIO F;  1MNE A;  1Z6A A;  2J46 A;  4XLP F;  3DMD A;  1NU9 C;  3EGX B;  1FFT C;  2IXM A;  3UMH A;  4CS8 C;  2ZXP A;  4J30 B;  3CZ6 A;  4OD5 A;  2X51 A;  4CS9 A;  3LLI A;  1V54 C;  1TKN A;  2WL8 A;  4G7H F;  3EG9 B;  3S27 A;  4DVY P;  4LAC B;  3ZSU A;  3B0U X;  3EGD A;  5KYX B;  4BJ1 A;  2Y39 A;  4PK4 A;  1M56 C;  2IXO A;  4MQ9 F;  1ZHY A;  3V7O A;  4W8K A;  2CNW D;  3NKE A;  1D1B A;  3EFO B;  1N1C A;  1D1A A;  4E7Z A;  3QMK A;  2CGE A;  2J9U A;  4YN0 B;  5DS4 A;  1NZE A;  3W8H A;  4JW1 A;  2KJG A;  1ZU4 A;  2KW3 C;  3FDQ A;  5CI9 A;  2PFD A;  4JJG A;  3Q7G A;  3UMI A;  4XWJ A;  4YT2 A;  3S0X A;  4KBL A;  4LLC A;  3NYL A;  4JZA A;  4BEJ A;  2H7B A;  3NRH A;  3AQC A;  4M63 A;  1OCZ C;  2PX3 A;  5E33 A;  3RH3 A;  3AQB A;  2A68 F;  1OCC C;  3N0T A;  3I5Q A;  2W9Y A;  2J7P D;  1SF8 A;  2R7R A;  4G7O F;  1VYI A;  4DBR A;  3CSK A;  3OA1 A;  4YT5 A;  4I1O B;  2FGY A;  4G7Z F;  1LVK A;  4U5B E;  3DD7 A;  4BJ5 C;  4PFP A;  2A69 F;  4GYT A;  1J8M F;  3X1O A;  4ZLC A;  2XXA A;  4C3B A;  4OIN F;  3DZA A;  4O6M A;  2Y3B A;  3X2Q C;  2C04 A;  2NUP A;  3EH1 A;  4BG0 A;  2WZG A;  3OWT A;  4RBN A;  4PFO A;  4C7O A;  4CS9 C;  2BE5 F;  3UMK A;  3B9Q A;  4RDA A;  1QZX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...