2HSBA

Crystal structure of a hepn domain containing protein (af_0298) from archaeoglobus fulgidus at 1.95 a resolution
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
126
structure length
126
Chain Sequence
b'GMDELELRIRKAEKLVQDAKKEFEMGLYERCCSTAYYAMFHAAKAMLLGYGRDSKTHRGTIYLIWECREELGLSDDDCSKLSRAFDLREESDYGIYKEVSKDLAIKILKDAEIFVQKAKNAVNKNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical UPF0332 protein AF0298
publication title Crystal structure of hypothetical protein (NP_069135.1) from Archaeoglobus Fulgidus at 1.95 A resolution
rcsb
source organism Archaeoglobus fulgidus
molecule tags Unknown function
total genus 50
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2006-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05168 HEPN HEPN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 2hsbA00
3K7DA 3TULA 3GM2A 3C8GA 2PBEA 1O3UA 1JOGA 4EBJA 1K05A 4R32A 1ZZPA 2JX0A 1KNYA 2L6HA 2YWAA 3U0CA 1QVXA 5F28E 1WOLA 1K04A 3C8GB 4XEFA 1OW8A 4XEKA 2LK4A 1PV3A 1UFBA 3C8GD 3L8JA 1V4AA 1K40A 1OW6A 1WWPA 1KTMA 3RQFA 3U3FA 2KK1A 2JPUA 3JYYA 4EBKA 1WTYA 3AJMA 4XEVA 2L6FA 3RQEA 2Q00A 3BRJA 3L8IA 3GM3A 2L6GA 3JZ0A 3S9OA 3B71A 3MFNA 3O10A 3GM1A 2HSBA 3C18A 4NQFA 3RQGA 1OW7A
chains in the Genus database with same CATH superfamily
4I3MA 3JSEO 2IXMA 3Q6MA 2L9JA 3EG9A 5L0HA 1E86A 3V7OA 4EBJA 4PFPA 3TOMA 5BQHA 4U5GA 1FNTc 3ITFA 3UGOA 3DWWA 2IBFA 3TQOA 1JRAA 1VB5A 3C8GB 3QVZA 5HV9A 5KYYA 1OQCA 1G4WR 2ETSA 2V26A 3UMHA 1JPJA 2H8AA 2A0UA 3AG3C 3ZDLA 3C7JA 3UGPA 3UMIA 3DI5A 1G4US 2XL6A 4CS9C 4DOZA 4C7OB 3EH2A 3SXKA 1FR0A 1B68A 2Q00A 4U5FE 3EFOB 2VCBA 4X0RA 5EK0A 1Z23A 4RD9A 2R25A 1OCCC 2XXAB 2Y3DA 2ZXPA 3RQGA 2IOQA 2E87A 1C17M 5BQIA 3WODF 2Q7RA 4XLPF 1XWJA 4QI0A 3U8PA 4H54A 4ULWA 3VM6A 3AQCA 3B9QA 3IPMO 3IEEA 1VOMA 4MTOA 2G3VA 5A6BA 2NUTB 4W8PA 1U6HA 5DQZA 1G5ZA 3KPHA 1NG1A 2Y69C 1SYQA 4DJ9A 4AE4B 1I4ZA 4ULVA 2HJ3A 3DM5A 2EPMX 2HSQA 3ZC4A 1OW6A 2J7PA 2XL8A 4MVMA 3U3FA 4JJGA 4ZLCA 4G7OF 2AWYA 3DZAA 1NLXA 1QZXA 3OEOA 2J45A 2G62A 1GGQA 3O6XA 3S0XA 3JZ0A 2UUHA 2R7WA 3DE8A 3EZHA 2HUJA 1TFKB 4YT4A 3KMIA 2J9WA 3AG4C 4C3BA 3K7DA 3EZIA 4AK9A 1SR2A 2LQGA 3MYFA 5KYUA 5L0IA 4CSAA 2VASA 2QY9A 2XLMA 1OCRC 4DRIB 4N4WA 2GWWA 4F4BA 1FTSA 3G50A 2L6HA 2XLVA 2DGJA 2FGYA 2IXOA 1LS4A 2H7OA 2Q9AA 3PDMP 4OIQF 1GQAA 2HZ8A 1U0BB 2Z15A 3GEHA 2NPUA 4A2NB 1EKYA 2ZXWC 1TWHA 2CNWD 5A6AA 1LI5A 1AUEA 2V3CC 2YLDA 2HFIA 1FFHA 1TWAA 3NYMA 3AQBA 4XPWA 4NTFA 2HSBA 2L81A 2P61A 3ABLC 1ORSC 3NG1A 3C8ZA 3QTHA 4MTFA 4NY3A 2W4BA 2OQMA 3T6BA 3ZVRA 2J0WA 1Z6AA 2HKVA 4O79A 2W4MA 2NG1A 4CS8C 2CDQA 5E3AA 2WVNA 2C03A 4FX5A 1K05A 2R7VA 2L7AA 4I1MA 2G3KA 4GYTA 2YWAA 3F47A 3SNHA 3FAPB 3NYJA 2R03A 2EILC 1M6TA 1OW8A 4XEKA 5COFA 5FZTA 4YK5A 3K6BA 1PV3A 4CDVA 4DVZA 2RD9A 1I4YA 2A1DD 1ZW3A 2HV6A 3PMRA 3UMKA 1BR1A 4NTAA 2VH3A 1YYXA 1ORJA 4G0HA 4XEVA 3L1MA 5COGA 1NU9C 2NSFA 5IY5C 1VK5A 2VCCA 3JSZA 5B1BC 4RDAA 3X2QC 3B71A 1C02A 3W4YA 2GA0A 3C62A 3HNLA 4GEHA 4CBEA 1WN0A 1NU7D 3U2LA 1MMDA 1M2VB 2DYSC 4LDQA 4N6CA 5T3WA 1QQ3A 2PX3A 1TKNA 3GM2A 1PD0A 1YARO 3DKAA 3FAJA 1FAPB 3ASNC 2OEVA 3O55A 3WG7C 4E18A 3NYLA 3H2VA 1NFNA 5D91A 4C7OA 2X51A 1ZVZA 3JRTA 4XPXA 1WATA 2ZXRA 4XLNF 3U3BA 3VRCA 1ZHZA 3EFOA 4YN0B 3ZTZA 2YZSA 4JW1A 2FAPB 1RKEB 4AL1A 3GODA 4YL1A 2R7RA 3ZIBA 2XLOA 4Z9IA 1A0BA 1K40A 4WGYA 1YJGA 5CIVA 2XM4A 3V5XA 4IARA 3K66A 4JTAB 5AC4A 2GDCA 4JEAA 4CIPA 5KYWB 1D1BA 2WZFA 4IWBA 2LP4A 2JD3A 2NUTA 3T4RA 3LEOA 4J30B 3U8VA 2Q9CA 2W9YA 2PX0A 3A11A 1SMYF 1YVIA 3QW1A 4AE4A 4YWQA 3NKDA 5E3CA 2R7XA 2F22A 1O3UA 3ECSA 3SXYA 1G8XA 3X1OA 4LDKA 1ZU4A 1XZQA 2Y3GA 1HMDA 2J0XA 3ABKC 4R32A 1L3PA 1QLEC 3SP1A 3HNKA 3S90A 4H4KC 1OXBA 2OJQA 3FOPA 4WGZA 2J9BA 2OOCA 5CI8A 1UFBA 4EBBA 4MW3A 3H65A 4OD4A 3CEXA 3FXHA 4CS9A 3K1IC 1WGWA 1CPQA 1GM5A 2L6FA 5L0JA 1OR3A 4O7GA 3GM3A 2YL3A 1DOWA 4C3DA 3U9MA 4DBQA 4HEAJ 1VTMP 3MYIA 3NKEA 3ZSUA 3LEVA 5L3VA 1E85A 2XRHA 5GPGB 3E70C 2BE5F 5KYNA 2MHRA 2YL1A 3HLZA 3QMKA 2D5RB 3DAGA 1D1CA 1H9GA 1YZAA 1KNYA 3EHNA 1ZYRF 3M79A 5T1DB 3HNIA 2R9RB 3LS0A 4K7BA 5F28E 2WB7A 2OEXA 5JLIA 2C04A 2YL0A 2EPKX 4YT2A 4P9FA 3G4ZA 2JPUA 3VF0A 4I44A 3ASOC 2DI3A 2IYLD 1RXQA 4K0DA 3ZWIA 1OCZC 5JP7A 1MNDA 1H6GA 1PD1A 1ST6A 1XZPA 2Y3BA 3F46A 4JIOA 4EKWA 2CCYA 2HMZA 2HMQA 1E2XA 2LCHA 2IXNA 1OR2A 1YA9A 2VB6A 3AGTA 3FOOA 3LLIA 4XPYA 4RBNA 1APCA 2R7QA 3V5YA 4JTCB 3CSKA 1RCPA 1BR4A 1T5OA 2CW0F 3DXJF 2YLGA 3SEOA 5EHHA 1FMWA 4Q4ZF 1CGME 3MBGA 5B1AC 2R7UA 4XQ1A 4YJWA 2CNWA 3N2ZB 1T6IA 3FVYA 3LS1A 4MNDA 1QKRA 3C63A 5JRAA 1RJ9B 2LK4A 2WZGA 1LVKA 1TFOB 4JKVA 1YZCA 3L8JA 4NC3A 3T6GB 3EGDB 4EWCA 4WABA 2EIMC 5L0CA 4BG0A 3QZCA 2IXPA 1HE1A 5DLJA 1H9TA 1NFOA 3S9OA 2R7OA 3MFNA 3B0PA 2WVOA 3SZRA 3LNMB 1U89A 1A7EA 2LSEA 3LUTB 3PHF2 3MLGA 4PFOA 4D4XA 1RKEA 2GAQA 4JTDB 2OKUA 1I5NA 4G7ZF 3E9VA 4N06A 4Z9HA 5DS4A 1CPRA 2H7BA 3Q7LA 2GFHA 1YAUO 3NMIA 5KYXB 3M4BA 4QI2A 3K33A 2AP3A 4JRZA 4DRHB 1D0XA 3HJCA 1RMVA 1PCXA 5KYWA 1LKXA 1K04A 4C3EA 3J06A 2R02A 3TK0A 3CQZA 4EUKB 2O9XA 1BBHA 1R4TA 2LFFA 2HS5A 5B3SC 4EBKA 4XWJA 3DJNB 4DVYP 2B0HA 3I5QA 4YL3A 1ZHYA 2WVQA 5DS6A 1VYKA 1KU2A 3AG1C 5JT4A 2PFDA 1LM3B 2YEVA 2HV7A 2DYRC 3AG2C 3EH1A 3NDBB 3IQTA 4ANJA 2EIKC 3CZ6A 2LFDA 4LACB 4ER9A 2CGEA 2R05A 2UUIA 3C8GA 5BUOA 2R7TA 3GWNA 1JOGA 2P7VA 1ZHXA 4U5BE 4G78A 4MW8A 2XSEA 1A41A 2XLHA 3EGXB 4HE8D 1JMWA 2AU5A 2ZD9A 3EQLF 3LLKA 4PJLA 3TOLA 2EPOA 4XEFA 3UR3C 3G4XA 3VYWA 4AX2A 1V55C 2VC9A 2XS8A 2KJGA 2WL8A 3HKKA 1T9KA 4IB4A 4U9DA 1LI7A 4EIYA 3A9CA 3MX3A 5DQTA 4JCZA 3O39A 4MVZA 2KK1A 4BJ6C 2XXAA 4XTKA 256BA 2XM0A 3WHNA 1CGNA 3SXZA 2OG2A 1M57C 3ZQYA 4E7ZA 3NMKA 3QW0A 3W2WA 2J46A 4E0IA 1S7ZA 4KI2A 5BQGA 3R7CA 1MNEA 5A69A 3PCVA 4JC7A 4MTGA 4BJ5C 4LLCA 2QTVA 3TULA 1F1MA 2BL2A 3KH2A 4J7YA 3RFYA 2YHSA 1CGOA 4YT8A 4OIOF 2YRFA 3W2VA 1W2WA 2LD6A 4J32B 4JURI 2XS1A 1EA8A 3ZTMA 2WZLA 3GANA 1EI7A 1QVXA 2YQYA 2YLIA 1MMNA 3W8HA 3K1IA 1J8MF 3U9JA 1YA7O 2XL4A 5AC5A 1LE4A 4ZLDA 4CX9A 4CDYA 1Z63A 1WASA 1NZEA 2KQ9A 3AGUA 1OKKD 2P6VA 1MQVA 1HW2A 5L0DA 2Q4FA 3ATPA 1Z7Qc 2R7SA 3C18A 3KL4A 5CI9A 3JTLO 1SF8A 4GQHA 2ASRA 4IJJA 2A68F 1RJ9A 3L0IA 2W45A 1VYIA 3EJNA 3AOUA 4CJOA 2EINC 1OCOC 4JEBA 2J9VA 2MYSA 3EGDA 3OWTA 3M15A 3QVYA 2B0JA 4DXWA 5DVWA 3LNRA 3T6JA 5E2QA 2YVKA 2AWCA 3R2PA 2LIGA 1LE2A 4ONSA 1HE9A 5D92A 1ORYA 4DBRA 1Q0FA 1WWPA 1Z3IX 3EPVA 3RH3A 4BEMJ 4FAPB 5B3IA 5JUAA 4FWVA 4K1OA 2A6HF 4CJGA 2XLWA 2FFHA 4JJFA 4BEJA 3AJMA 2OCCC 1FFTC 3RQEA 4UDVA 4JCHA 3BRJA 4Q7CA 2KNHA 2PP4A 3N24A 4CIHA 2PF4E 1QPUA 1JPNA 1L7CA 3GM1A 3RIPA 5KYXA 5F5FA 4Z9JA 2I15A 3IHUA 1O5HA 2YKZA 2CYDA 1TQGA 1JAFA 4AL0A 1AVOB 4MVOA 1LPEA 2NUPB 3U5SA 5A6JA 3RVZA 1NSGB 2QNLA 5EGYA 1Q0DA 4NTBA 4FESA 3S27A 1Y6DA 3DE9A 4LDRA 2JX0A 2DB4A 3IQCA 4LERA 1HW1A 4B6IA 1WOLA 5JVEA 3NMJA 3EG9B 1RKCA 3DD7A 2EPLX 2YL7A 1YDIA 3GEIA 2H7VC 2J8WA 3I5PA 4JZAA 3DM9B 4BJ1A 3S28A 3ZQVA 5AGFA 5A6BD 4A4AA 1NBBA 3M1CB 1M2VA 1TWCA 5T3TA 4LLEA 2L6GA 5KYYB 3ABMC 1DOVA 3O10A 3UNGC 4WJ0A 3JYHA 3GWLA 3EGXA 2QE9A 3K1HA 4IAOA 1OW7A 4KBLA 4O6YA 2J7PD 1MMAA 2KGOA 1MMGA 4W8KA 3POVA 1Q0GA 2Q3TA 4PK4A 4NCQA 1IW7F 4CS8A 4CSAC 1EQ1A 3US6A 1Z5ZA 3H2UA 3Q6NA 3HNJA 3Q7GA 3S29A 4CS7A 5E33A 3DAFA 1ZZPA 4PJMA 2EPNA 4IGGA 4IAQA 3LJBA 4U5DE 1HMOA 2ZXOA 1Q0KA 3TD7A 3FDQA 3SXMA 1D0YA 1KTMA 1SZIA 2Q9BA 2J9UA 4KNWA 4L6RA 4E7SA 4P6IC 3KKBA 4U5HA 1WTYA 3VAYA 1BZ4A 4BJTA 4BPMA 2KSFA 1S05A 1H7IA 2M4EA 3KYIA 3M4CA 3L8IA 4EHPA 1VLTA 1E84A 1A7VA 1YYJA 2VCAA 4HFFB 1M2OA 3OA1A 3RKOF 1FMVA 5JS5A 1AEPA 2X0CA 3RYLA 4CDAA 2XLEA 2IM8A 2A0BA 4PJJA 3T9OA 5A6KA 4Q5SF 1VLSA 4U9EA 2PBEA 2Y39A 2P0NA 5L0GA 1BDJB 4G7HF 3NRHA 1A7DA 1TWGA 1ZW2A 3JCUQ 1ZHTA 3I4UA 2RSEB 4KC9A 4U5EE 3RW0A 2MWQA 3B29A 5COMA 3TJ6A 3ZG1A 4DRJB 3B0UX 1Q0MA 3W8IA 5KYUB 4U5CE 2TMVP 1V4AA 4BJ6A 3S84A 4M63A 2I8BA 3KYJA 3JT1A 3N0TA 3JYYA 4OIPF 1D0ZA 4O6NA 2D4UA 3GEEA 4MS2A 5K0IA 3SYNA 3LAYA 1ZU5A 4IRUA 2NSGA 4OIRF 1OXKA 3V5ZA 1VMAA 3FMSA 1BR2A 3RF3A 1R5ID 3BEHA 1T6QA 1HY5A 1J8YF 2OJED 2P1AA 4NQFA 3WAQA 4BJ5A 5HSWA 4D4NA 1E83A 3FHDA 4JVSA 3JRMO 4MVSA 4OINF 4I1OB 4PR9A 5L0FA 3B0VC 4MVQA 3HTKC 3DMDA 3GORA 4MQ9F 4YT5A 4E17A 2BC5A 2QLAA 1Y4CA 1OKKA 1V74B 2Y3HA 1ZHWA 4HFKB 4PJNA 3IQ5A 1LS1A 2KC3A 1V54C 4KNVA 4OD5A 4O6MA 4P9TA 1C03A 2XLDA 1LIHA 3U0CA 3IQ6A 2QUPA 2PNOA 4N6HA 2KYHA 3U2MA 5L3QA 1O87A 3C8GD 3RQFA 4JE9A 4MVRA 1QSPA 1T01A 1JR8A 2OU6A 2ZPAA 3RVYA 1YLMA 5F5HA 5DS5A 1IZMA 5FCLA 1UG7A 2KW3C 2NUPA 2EIJC 2M64A 3TJ5A 1GS9A 1D1AA 3DJUB 3EHMA 2AVKA 1TR2A 3CAXA 4QDLA 2HJMA 2A69F 1M56C 4YL0A 2ICWG 4J7TA 3LESA 1N1CA 4MVUA 3L34A 5JSLA 1T6UA 5TJ5E 4E0HA 4PACA 2A6EF
chains in the Genus database with same CATH topology
3K7DA 3TULA 3GM2A 3C8GA 2PBEA 1O3UA 1JOGA 4EBJA 1K05A 4R32A 1ZZPA 2JX0A 1KNYA 2L6HA 2YWAA 3U0CA 1QVXA 5F28E 1WOLA 1K04A 3C8GB 4XEFA 1OW8A 4XEKA 2LK4A 1PV3A 1UFBA 3C8GD 3L8JA 1V4AA 1K40A 1OW6A 1WWPA 1KTMA 3RQFA 3U3FA 2KK1A 2JPUA 3JYYA 4EBKA 1WTYA 3AJMA 4XEVA 2L6FA 3RQEA 2Q00A 3BRJA 3L8IA 3GM3A 2L6GA 3JZ0A 3S9OA 3B71A 3MFNA 3O10A 3GM1A 2HSBA 3C18A 4NQFA 3RQGA 1OW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K7D A;  3TUL A;  3GM2 A;  3C8G A;  2PBE A;  1O3U A;  1JOG A;  4EBJ A;  1K05 A;  4R32 A;  1ZZP A;  2JX0 A;  1KNY A;  2L6H A;  2YWA A;  3U0C A;  1QVX A;  5F28 E;  1WOL A;  1K04 A;  3C8G B;  4XEF A;  1OW8 A;  4XEK A;  2LK4 A;  1PV3 A;  1UFB A;  3C8G D;  3L8J A;  1V4A A;  1K40 A;  1OW6 A;  1WWP A;  1KTM A;  3RQF A;  3U3F A;  2KK1 A;  2JPU A;  3JYY A;  4EBK A;  1WTY A;  3AJM A;  4XEV A;  2L6F A;  3RQE A;  2Q00 A;  3BRJ A;  3L8I A;  3GM3 A;  2L6G A;  3JZ0 A;  3S9O A;  3B71 A;  3MFN A;  3O10 A;  3GM1 A;  2HSB A;  3C18 A;  4NQF A;  3RQG A;  1OW7 A; 
#chains in the Genus database with same CATH topology
 4I3M A;  3JSE O;  2IXM A;  3Q6M A;  2L9J A;  3EG9 A;  5L0H A;  1E86 A;  3V7O A;  4EBJ A;  4PFP A;  3TOM A;  5BQH A;  4U5G A;  1FNT c;  3ITF A;  3UGO A;  3DWW A;  2IBF A;  3TQO A;  1JRA A;  1VB5 A;  3C8G B;  3QVZ A;  5HV9 A;  5KYY A;  1OQC A;  1G4W R;  2ETS A;  2V26 A;  3UMH A;  1JPJ A;  2H8A A;  2A0U A;  3AG3 C;  3ZDL A;  3C7J A;  3UGP A;  3UMI A;  3DI5 A;  1G4U S;  2XL6 A;  4CS9 C;  4DOZ A;  4C7O B;  3EH2 A;  3SXK A;  1FR0 A;  1B68 A;  2Q00 A;  4U5F E;  3EFO B;  2VCB A;  4X0R A;  5EK0 A;  1Z23 A;  4RD9 A;  2R25 A;  1OCC C;  2XXA B;  2Y3D A;  2ZXP A;  3RQG A;  2IOQ A;  2E87 A;  1C17 M;  5BQI A;  3WOD F;  2Q7R A;  4XLP F;  1XWJ A;  4QI0 A;  3U8P A;  4H54 A;  4ULW A;  3VM6 A;  3AQC A;  3B9Q A;  3IPM O;  3IEE A;  1VOM A;  4MTO A;  2G3V A;  5A6B A;  2NUT B;  4W8P A;  1U6H A;  5DQZ A;  1G5Z A;  3KPH A;  1NG1 A;  2Y69 C;  1SYQ A;  4DJ9 A;  4AE4 B;  1I4Z A;  4ULV A;  2HJ3 A;  3DM5 A;  2EPM X;  2HSQ A;  3ZC4 A;  1OW6 A;  2J7P A;  2XL8 A;  4MVM A;  3U3F A;  4JJG A;  4ZLC A;  4G7O F;  2AWY A;  3DZA A;  1NLX A;  1QZX A;  3OEO A;  2J45 A;  2G62 A;  1GGQ A;  3O6X A;  3S0X A;  3JZ0 A;  2UUH A;  2R7W A;  3DE8 A;  3EZH A;  2HUJ A;  1TFK B;  4YT4 A;  3KMI A;  2J9W A;  3AG4 C;  4C3B A;  3K7D A;  3EZI A;  4AK9 A;  1SR2 A;  2LQG A;  3MYF A;  5KYU A;  5L0I A;  4CSA A;  2VAS A;  2QY9 A;  2XLM A;  1OCR C;  4DRI B;  4N4W A;  2GWW A;  4F4B A;  1FTS A;  3G50 A;  2L6H A;  2XLV A;  2DGJ A;  2FGY A;  2IXO A;  1LS4 A;  2H7O A;  2Q9A A;  3PDM P;  4OIQ F;  1GQA A;  2HZ8 A;  1U0B B;  2Z15 A;  3GEH A;  2NPU A;  4A2N B;  1EKY A;  2ZXW C;  1TWH A;  2CNW D;  5A6A A;  1LI5 A;  1AUE A;  2V3C C;  2YLD A;  2HFI A;  1FFH A;  1TWA A;  3NYM A;  3AQB A;  4XPW A;  4NTF A;  2HSB A;  2L81 A;  2P61 A;  3ABL C;  1ORS C;  3NG1 A;  3C8Z A;  3QTH A;  4MTF A;  4NY3 A;  2W4B A;  2OQM A;  3T6B A;  3ZVR A;  2J0W A;  1Z6A A;  2HKV A;  4O79 A;  2W4M A;  2NG1 A;  4CS8 C;  2CDQ A;  5E3A A;  2WVN A;  2C03 A;  4FX5 A;  1K05 A;  2R7V A;  2L7A A;  4I1M A;  2G3K A;  4GYT A;  2YWA A;  3F47 A;  3SNH A;  3FAP B;  3NYJ A;  2R03 A;  2EIL C;  1M6T A;  1OW8 A;  4XEK A;  5COF A;  5FZT A;  4YK5 A;  3K6B A;  1PV3 A;  4CDV A;  4DVZ A;  2RD9 A;  1I4Y A;  2A1D D;  1ZW3 A;  2HV6 A;  3PMR A;  3UMK A;  1BR1 A;  4NTA A;  2VH3 A;  1YYX A;  1ORJ A;  4G0H A;  4XEV A;  3L1M A;  5COG A;  1NU9 C;  2NSF A;  5IY5 C;  1VK5 A;  2VCC A;  3JSZ A;  5B1B C;  4RDA A;  3X2Q C;  3B71 A;  1C02 A;  3W4Y A;  2GA0 A;  3C62 A;  3HNL A;  4GEH A;  4CBE A;  1WN0 A;  1NU7 D;  3U2L A;  1MMD A;  1M2V B;  2DYS C;  4LDQ A;  4N6C A;  5T3W A;  1QQ3 A;  2PX3 A;  1TKN A;  3GM2 A;  1PD0 A;  1YAR O;  3DKA A;  3FAJ A;  1FAP B;  3ASN C;  2OEV A;  3O55 A;  3WG7 C;  4E18 A;  3NYL A;  3H2V A;  1NFN A;  5D91 A;  4C7O A;  2X51 A;  1ZVZ A;  3JRT A;  4XPX A;  1WAT A;  2ZXR A;  4XLN F;  3U3B A;  3VRC A;  1ZHZ A;  3EFO A;  4YN0 B;  3ZTZ A;  2YZS A;  4JW1 A;  2FAP B;  1RKE B;  4AL1 A;  3GOD A;  4YL1 A;  2R7R A;  3ZIB A;  2XLO A;  4Z9I A;  1A0B A;  1K40 A;  4WGY A;  1YJG A;  5CIV A;  2XM4 A;  3V5X A;  4IAR A;  3K66 A;  4JTA B;  5AC4 A;  2GDC A;  4JEA A;  4CIP A;  5KYW B;  1D1B A;  2WZF A;  4IWB A;  2LP4 A;  2JD3 A;  2NUT A;  3T4R A;  3LEO A;  4J30 B;  3U8V A;  2Q9C A;  2W9Y A;  2PX0 A;  3A11 A;  1SMY F;  1YVI A;  3QW1 A;  4AE4 A;  4YWQ A;  3NKD A;  5E3C A;  2R7X A;  2F22 A;  1O3U A;  3ECS A;  3SXY A;  1G8X A;  3X1O A;  4LDK A;  1ZU4 A;  1XZQ A;  2Y3G A;  1HMD A;  2J0X A;  3ABK C;  4R32 A;  1L3P A;  1QLE C;  3SP1 A;  3HNK A;  3S90 A;  4H4K C;  1OXB A;  2OJQ A;  3FOP A;  4WGZ A;  2J9B A;  2OOC A;  5CI8 A;  1UFB A;  4EBB A;  4MW3 A;  3H65 A;  4OD4 A;  3CEX A;  3FXH A;  4CS9 A;  3K1I C;  1WGW A;  1CPQ A;  1GM5 A;  2L6F A;  5L0J A;  1OR3 A;  4O7G A;  3GM3 A;  2YL3 A;  1DOW A;  4C3D A;  3U9M A;  4DBQ A;  4HEA J;  1VTM P;  3MYI A;  3NKE A;  3ZSU A;  3LEV A;  5L3V A;  1E85 A;  2XRH A;  5GPG B;  3E70 C;  2BE5 F;  5KYN A;  2MHR A;  2YL1 A;  3HLZ A;  3QMK A;  2D5R B;  3DAG A;  1D1C A;  1H9G A;  1YZA A;  1KNY A;  3EHN A;  1ZYR F;  3M79 A;  5T1D B;  3HNI A;  2R9R B;  3LS0 A;  4K7B A;  5F28 E;  2WB7 A;  2OEX A;  5JLI A;  2C04 A;  2YL0 A;  2EPK X;  4YT2 A;  4P9F A;  3G4Z A;  2JPU A;  3VF0 A;  4I44 A;  3ASO C;  2DI3 A;  2IYL D;  1RXQ A;  4K0D A;  3ZWI A;  1OCZ C;  5JP7 A;  1MND A;  1H6G A;  1PD1 A;  1ST6 A;  1XZP A;  2Y3B A;  3F46 A;  4JIO A;  4EKW A;  2CCY A;  2HMZ A;  2HMQ A;  1E2X A;  2LCH A;  2IXN A;  1OR2 A;  1YA9 A;  2VB6 A;  3AGT A;  3FOO A;  3LLI A;  4XPY A;  4RBN A;  1APC A;  2R7Q A;  3V5Y A;  4JTC B;  3CSK A;  1RCP A;  1BR4 A;  1T5O A;  2CW0 F;  3DXJ F;  2YLG A;  3SEO A;  5EHH A;  1FMW A;  4Q4Z F;  1CGM E;  3MBG A;  5B1A C;  2R7U A;  4XQ1 A;  4YJW A;  2CNW A;  3N2Z B;  1T6I A;  3FVY A;  3LS1 A;  4MND A;  1QKR A;  3C63 A;  5JRA A;  1RJ9 B;  2LK4 A;  2WZG A;  1LVK A;  1TFO B;  4JKV A;  1YZC A;  3L8J A;  4NC3 A;  3T6G B;  3EGD B;  4EWC A;  4WAB A;  2EIM C;  5L0C A;  4BG0 A;  3QZC A;  2IXP A;  1HE1 A;  5DLJ A;  1H9T A;  1NFO A;  3S9O A;  2R7O A;  3MFN A;  3B0P A;  2WVO A;  3SZR A;  3LNM B;  1U89 A;  1A7E A;  2LSE A;  3LUT B;  3PHF 2;  3MLG A;  4PFO A;  4D4X A;  1RKE A;  2GAQ A;  4JTD B;  2OKU A;  1I5N A;  4G7Z F;  3E9V A;  4N06 A;  4Z9H A;  5DS4 A;  1CPR A;  2H7B A;  3Q7L A;  2GFH A;  1YAU O;  3NMI A;  5KYX B;  3M4B A;  4QI2 A;  3K33 A;  2AP3 A;  4JRZ A;  4DRH B;  1D0X A;  3HJC A;  1RMV A;  1PCX A;  5KYW A;  1LKX A;  1K04 A;  4C3E A;  3J06 A;  2R02 A;  3TK0 A;  3CQZ A;  4EUK B;  2O9X A;  1BBH A;  1R4T A;  2LFF A;  2HS5 A;  5B3S C;  4EBK A;  4XWJ A;  3DJN B;  4DVY P;  2B0H A;  3I5Q A;  4YL3 A;  1ZHY A;  2WVQ A;  5DS6 A;  1VYK A;  1KU2 A;  3AG1 C;  5JT4 A;  2PFD A;  1LM3 B;  2YEV A;  2HV7 A;  2DYR C;  3AG2 C;  3EH1 A;  3NDB B;  3IQT A;  4ANJ A;  2EIK C;  3CZ6 A;  2LFD A;  4LAC B;  4ER9 A;  2CGE A;  2R05 A;  2UUI A;  3C8G A;  5BUO A;  2R7T A;  3GWN A;  1JOG A;  2P7V A;  1ZHX A;  4U5B E;  4G78 A;  4MW8 A;  2XSE A;  1A41 A;  2XLH A;  3EGX B;  4HE8 D;  1JMW A;  2AU5 A;  2ZD9 A;  3EQL F;  3LLK A;  4PJL A;  3TOL A;  2EPO A;  4XEF A;  3UR3 C;  3G4X A;  3VYW A;  4AX2 A;  1V55 C;  2VC9 A;  2XS8 A;  2KJG A;  2WL8 A;  3HKK A;  1T9K A;  4IB4 A;  4U9D A;  1LI7 A;  4EIY A;  3A9C A;  3MX3 A;  5DQT A;  4JCZ A;  3O39 A;  4MVZ A;  2KK1 A;  4BJ6 C;  2XXA A;  4XTK A;  256B A;  2XM0 A;  3WHN A;  1CGN A;  3SXZ A;  2OG2 A;  1M57 C;  3ZQY A;  4E7Z A;  3NMK A;  3QW0 A;  3W2W A;  2J46 A;  4E0I A;  1S7Z A;  4KI2 A;  5BQG A;  3R7C A;  1MNE A;  5A69 A;  3PCV A;  4JC7 A;  4MTG A;  4BJ5 C;  4LLC A;  2QTV A;  3TUL A;  1F1M A;  2BL2 A;  3KH2 A;  4J7Y A;  3RFY A;  2YHS A;  1CGO A;  4YT8 A;  4OIO F;  2YRF A;  3W2V A;  1W2W A;  2LD6 A;  4J32 B;  4JUR I;  2XS1 A;  1EA8 A;  3ZTM A;  2WZL A;  3GAN A;  1EI7 A;  1QVX A;  2YQY A;  2YLI A;  1MMN A;  3W8H A;  3K1I A;  1J8M F;  3U9J A;  1YA7 O;  2XL4 A;  5AC5 A;  1LE4 A;  4ZLD A;  4CX9 A;  4CDY A;  1Z63 A;  1WAS A;  1NZE A;  2KQ9 A;  3AGU A;  1OKK D;  2P6V A;  1MQV A;  1HW2 A;  5L0D A;  2Q4F A;  3ATP A;  1Z7Q c;  2R7S A;  3C18 A;  3KL4 A;  5CI9 A;  3JTL O;  1SF8 A;  4GQH A;  2ASR A;  4IJJ A;  2A68 F;  1RJ9 A;  3L0I A;  2W45 A;  1VYI A;  3EJN A;  3AOU A;  4CJO A;  2EIN C;  1OCO C;  4JEB A;  2J9V A;  2MYS A;  3EGD A;  3OWT A;  3M15 A;  3QVY A;  2B0J A;  4DXW A;  5DVW A;  3LNR A;  3T6J A;  5E2Q A;  2YVK A;  2AWC A;  3R2P A;  2LIG A;  1LE2 A;  4ONS A;  1HE9 A;  5D92 A;  1ORY A;  4DBR A;  1Q0F A;  1WWP A;  1Z3I X;  3EPV A;  3RH3 A;  4BEM J;  4FAP B;  5B3I A;  5JUA A;  4FWV A;  4K1O A;  2A6H F;  4CJG A;  2XLW A;  2FFH A;  4JJF A;  4BEJ A;  3AJM A;  2OCC C;  1FFT C;  3RQE A;  4UDV A;  4JCH A;  3BRJ A;  4Q7C A;  2KNH A;  2PP4 A;  3N24 A;  4CIH A;  2PF4 E;  1QPU A;  1JPN A;  1L7C A;  3GM1 A;  3RIP A;  5KYX A;  5F5F A;  4Z9J A;  2I15 A;  3IHU A;  1O5H A;  2YKZ A;  2CYD A;  1TQG A;  1JAF A;  4AL0 A;  1AVO B;  4MVO A;  1LPE A;  2NUP B;  3U5S A;  5A6J A;  3RVZ A;  1NSG B;  2QNL A;  5EGY A;  1Q0D A;  4NTB A;  4FES A;  3S27 A;  1Y6D A;  3DE9 A;  4LDR A;  2JX0 A;  2DB4 A;  3IQC A;  4LER A;  1HW1 A;  4B6I A;  1WOL A;  5JVE A;  3NMJ A;  3EG9 B;  1RKC A;  3DD7 A;  2EPL X;  2YL7 A;  1YDI A;  3GEI A;  2H7V C;  2J8W A;  3I5P A;  4JZA A;  3DM9 B;  4BJ1 A;  3S28 A;  3ZQV A;  5AGF A;  5A6B D;  4A4A A;  1NBB A;  3M1C B;  1M2V A;  1TWC A;  5T3T A;  4LLE A;  2L6G A;  5KYY B;  3ABM C;  1DOV A;  3O10 A;  3UNG C;  4WJ0 A;  3JYH A;  3GWL A;  3EGX A;  2QE9 A;  3K1H A;  4IAO A;  1OW7 A;  4KBL A;  4O6Y A;  2J7P D;  1MMA A;  2KGO A;  1MMG A;  4W8K A;  3POV A;  1Q0G A;  2Q3T A;  4PK4 A;  4NCQ A;  1IW7 F;  4CS8 A;  4CSA C;  1EQ1 A;  3US6 A;  1Z5Z A;  3H2U A;  3Q6N A;  3HNJ A;  3Q7G A;  3S29 A;  4CS7 A;  5E33 A;  3DAF A;  1ZZP A;  4PJM A;  2EPN A;  4IGG A;  4IAQ A;  3LJB A;  4U5D E;  1HMO A;  2ZXO A;  1Q0K A;  3TD7 A;  3FDQ A;  3SXM A;  1D0Y A;  1KTM A;  1SZI A;  2Q9B A;  2J9U A;  4KNW A;  4L6R A;  4E7S A;  4P6I C;  3KKB A;  4U5H A;  1WTY A;  3VAY A;  1BZ4 A;  4BJT A;  4BPM A;  2KSF A;  1S05 A;  1H7I A;  2M4E A;  3KYI A;  3M4C A;  3L8I A;  4EHP A;  1VLT A;  1E84 A;  1A7V A;  1YYJ A;  2VCA A;  4HFF B;  1M2O A;  3OA1 A;  3RKO F;  1FMV A;  5JS5 A;  1AEP A;  2X0C A;  3RYL A;  4CDA A;  2XLE A;  2IM8 A;  2A0B A;  4PJJ A;  3T9O A;  5A6K A;  4Q5S F;  1VLS A;  4U9E A;  2PBE A;  2Y39 A;  2P0N A;  5L0G A;  1BDJ B;  4G7H F;  3NRH A;  1A7D A;  1TWG A;  1ZW2 A;  3JCU Q;  1ZHT A;  3I4U A;  2RSE B;  4KC9 A;  4U5E E;  3RW0 A;  2MWQ A;  3B29 A;  5COM A;  3TJ6 A;  3ZG1 A;  4DRJ B;  3B0U X;  1Q0M A;  3W8I A;  5KYU B;  4U5C E;  2TMV P;  1V4A A;  4BJ6 A;  3S84 A;  4M63 A;  2I8B A;  3KYJ A;  3JT1 A;  3N0T A;  3JYY A;  4OIP F;  1D0Z A;  4O6N A;  2D4U A;  3GEE A;  4MS2 A;  5K0I A;  3SYN A;  3LAY A;  1ZU5 A;  4IRU A;  2NSG A;  4OIR F;  1OXK A;  3V5Z A;  1VMA A;  3FMS A;  1BR2 A;  3RF3 A;  1R5I D;  3BEH A;  1T6Q A;  1HY5 A;  1J8Y F;  2OJE D;  2P1A A;  4NQF A;  3WAQ A;  4BJ5 A;  5HSW A;  4D4N A;  1E83 A;  3FHD A;  4JVS A;  3JRM O;  4MVS A;  4OIN F;  4I1O B;  4PR9 A;  5L0F A;  3B0V C;  4MVQ A;  3HTK C;  3DMD A;  3GOR A;  4MQ9 F;  4YT5 A;  4E17 A;  2BC5 A;  2QLA A;  1Y4C A;  1OKK A;  1V74 B;  2Y3H A;  1ZHW A;  4HFK B;  4PJN A;  3IQ5 A;  1LS1 A;  2KC3 A;  1V54 C;  4KNV A;  4OD5 A;  4O6M A;  4P9T A;  1C03 A;  2XLD A;  1LIH A;  3U0C A;  3IQ6 A;  2QUP A;  2PNO A;  4N6H A;  2KYH A;  3U2M A;  5L3Q A;  1O87 A;  3C8G D;  3RQF A;  4JE9 A;  4MVR A;  1QSP A;  1T01 A;  1JR8 A;  2OU6 A;  2ZPA A;  3RVY A;  1YLM A;  5F5H A;  5DS5 A;  1IZM A;  5FCL A;  1UG7 A;  2KW3 C;  2NUP A;  2EIJ C;  2M64 A;  3TJ5 A;  1GS9 A;  1D1A A;  3DJU B;  3EHM A;  2AVK A;  1TR2 A;  3CAX A;  4QDL A;  2HJM A;  2A69 F;  1M56 C;  4YL0 A;  2ICW G;  4J7T A;  3LES A;  1N1C A;  4MVU A;  3L34 A;  5JSL A;  1T6U A;  5TJ5 E;  4E0H A;  4PAC A;  2A6E F; 
#chains in the Genus database with same CATH homology
 3K7D A;  3TUL A;  3GM2 A;  3C8G A;  2PBE A;  1O3U A;  1JOG A;  4EBJ A;  1K05 A;  4R32 A;  1ZZP A;  2JX0 A;  1KNY A;  2L6H A;  2YWA A;  3U0C A;  1QVX A;  5F28 E;  1WOL A;  1K04 A;  3C8G B;  4XEF A;  1OW8 A;  4XEK A;  2LK4 A;  1PV3 A;  1UFB A;  3C8G D;  3L8J A;  1V4A A;  1K40 A;  1OW6 A;  1WWP A;  1KTM A;  3RQF A;  3U3F A;  2KK1 A;  2JPU A;  3JYY A;  4EBK A;  1WTY A;  3AJM A;  4XEV A;  2L6F A;  3RQE A;  2Q00 A;  3BRJ A;  3L8I A;  3GM3 A;  2L6G A;  3JZ0 A;  3S9O A;  3B71 A;  3MFN A;  3O10 A;  3GM1 A;  2HSB A;  3C18 A;  4NQF A;  3RQG A;  1OW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...