2HSBA

Crystal structure of a hepn domain containing protein (af_0298) from archaeoglobus fulgidus at 1.95 a resolution
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
126
structure length
126
Chain Sequence
GMDELELRIRKAEKLVQDAKKEFEMGLYERCCSTAYYAMFHAAKAMLLGYGRDSKTHRGTIYLIWECREELGLSDDDCSKLSRAFDLREESDYGIYKEVSKDLAIKILKDAEIFVQKAKNAVNKNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Hypothetical UPF0332 protein AF0298
publication title Crystal structure of hypothetical protein (NP_069135.1) from Archaeoglobus Fulgidus at 1.95 A resolution
rcsb
source organism Archaeoglobus fulgidus
total genus 50
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2006-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05168 HEPN HEPN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 2hsbA00
1K05A 1QVXA 4XEKA 1KNYA 2L6HA 3GM2A 3GM3A 3C18A 1O3UA 3C8GB 4XEFA 3L8JA 2YWAA 3U0CA 2PBEA 3RQGA 3TULA 3RQEA 1JOGA 1OW8A 2L6FA 4EBJA 3C8GA 3RQFA 3AJMA 3C8GD 1OW7A 1WWPA 4NQFA 2L6GA 5F28E 1K04A 2JX0A 3GM1A 3S9OA 1KTMA 1WTYA 2HSBA 3B71A 1V4AA 1PV3A 1OW6A 3BRJA 4EBKA 3U3FA 3MFNA 4R32A 1UFBA 2JPUA 4XEVA 1K40A 3L8IA 3O10A 3K7DA 2Q00A 2KK1A 2LK4A 1WOLA 3JYYA 1ZZPA 3JZ0A
chains in the Genus database with same CATH superfamily
1D0YA 5COGA 2XS1A 5K0IA 4CSAA 1QQ3A 3U2MA 4YT5A 3DE8A 4DJ9A 2XLVA 2QLAA 2BL2A 3ABKC 2KSFA 3BEHA 2A6HF 1A7VA 3JSZA 4JURI 3WHNA 3EGXB 3U0CA 4XLNF 2XS8A 3DJUB 3PCVA 3RKOF 1M6TA 3RQEA 3PDMP 2M4EA 3ASOC 4MVMA 3ZQVA 1OW7A 1M2VA 1WWPA 1YA9A 3AGUA 1LS4A 3IEEA 4PJJA 2HV6A 4HFFB 3TK0A 3W8HA 2OCCC 3LNMB 1Z3IX 4D4XA 3RW0A 3T4RA 4AX2A 2R7SA 2BC5A 3S84A 2A68F 4IJJA 1RKCA 2RSEB 1S05A 1PD1A 4MTOA 2E87A 4N6CA 2IYLD 3MBGA 3K7DA 3ZSUA 4A4AA 1XWJA 1ORYA 1PCXA 3U9JA 256BA 1JMWA 2NUTA 3IQ6A 3NYMA 2WZLA 4E7SA 1ZHYA 1NU9C 1RMVA 4Q5SF 1FMVA 2Y3DA 3H2UA 1TWHA 1QPUA 1M57C 1YDIA 2A69F 4LLCA 1LE2A 2X0CA 1KNYA 4CS7A 4U9DA 1GM5A 1H7IA 1SMYF 2PBEA 2I8BA 2PP4A 5T3WA 3ZDLA 2ZXPA 4YJWA 5EK0A 3RH3A 1L7CA 1JOGA 1LI5A 3LNRA 2XSEA 3EGXA 5A69A 4KBLA 4WGYA 1HMDA 4MVOA 3QZCA 2LSEA 3G50A 4U9EA 3CEXA 4Q7CA 3F46A 3QVYA 4BJ6C 1NG1A 1TWCA 3O39A 2J0WA 2YLDA 1A41A 2XLMA 3N0TA 3IQCA 3T6BA 5BQHA 4Z9HA 1E85A 3I5PA 2H8AA 3B0UX 1VTMP 2R7TA 4QI2A 1VB5A 2GA0A 1T5OA 3B0PA 3U3BA 4U5EE 1E83A 1PD0A 5JLIA 2L6HA 3SXYA 4CSAC 3NYLA 1F1MA 1O3UA 1ZU5A 1LM3B 3DMDA 3M79A 4O6MA 2IXPA 2XLWA 4PJMA 1APCA 3TQOA 4YK5A 3SXZA 1M56C 1A7EA 2Z15A 4HFKB 4QDLA 4CS9A 5DS4A 3RF3A 1FFHA 2L6GA 2H7OA 4IARA 4X0RA 2DB4A 2GDCA 2HZ8A 2VC9A 4DVYP 1XZPA 4JTAB 4U5FE 1DOWA 3SP1A 2GWWA 4G7HF 5D92A 2Q3TA 5DLJA 1W2WA 5DQZA 5A6BD 1ZYRF 3G4XA 4MW8A 4NTAA 3UMHA 1ORJA 3UMKA 3JYYA 4B6IA 1ZW3A 1V74B 2NSFA 4OINF 5CIVA 3U5SA 1KTMA 1B68A 3FOOA 2EPNA 3FXHA 4JCHA 3VYWA 4O79A 2YQYA 1TWGA 2FGYA 4DRJB 1GQAA 2HFIA 4YL3A 1JR8A 1Q0KA 3ABLC 3FOPA 3KYJA 4XWJA 1VK5A 2OJQA 3C7JA 4IRUA 4WABA 4CS8A 1EQ1A 1I4YA 3JT1A 2EPOA 3JSEO 1Y6DA 4PACA 2LQGA 1CPRA 3GM1A 3PMRA 3CAXA 3S9OA 2XRHA 1Z23A 3N2ZB 4MW3A 3BRJA 3T9OA 2XLOA 2ASRA 5AC5A 3KKBA 4D4NA 4BG0A 2FFHA 3ZG1A 1YYXA 2J9BA 1R5ID 4M63A 2XL4A 4QI0A 3RVYA 2V26A 3CQZA 4J7YA 1VLSA 4NCQA 2V3CC 1MMNA 3K66A 1OQCA 3AG3C 4EUKB 1CGME 5B3IA 3NMIA 5BQIA 1N1CA 3C8GA 3RQFA 4DOZA 2IXOA 1OCOC 4H54A 2EINC 4JKVA 1UG7A 5DS5A 5HV9A 1YJGA 1Q0DA 1E2XA 1YARO 4K1OA 4LACB 2LFFA 4C3DA 1PV3A 4H4KC 3SXKA 4EBKA 3GORA 1UFBA 3GEIA 3MYFA 1Q0FA 4JEBA 1I5NA 3QTHA 3UMIA 3LESA 2YVKA 4YT2A 1BR4A 5B1BC 4XPWA 2R05A 2EPMX 4LDRA 2IBFA 2QTVA 3GANA 3EHNA 5T3TA 1J8MF 3QMKA 1AEPA 2EIJC 3JCUQ 2FAPB 4FWVA 2W9YA 3E9VA 4MVZA 4XPXA 5IY5C 2DYSC 4G7OF 2JD3A 2OJED 2UUHA 2HMZA 3DAFA 3QW1A 1FTSA 2EPLX 3X1OA 4BJ1A 2L7AA 1D0XA 2BE5F 2CW0F 1K04A 1YA7O 3DM5A 3GWNA 3JTLO 1IZMA 2XL8A 1YYJA 3Q7GA 4BJ5A 3VRCA 3W2VA 2HSBA 2QE9A 2KJGA 3AG1C 2LIGA 3IQTA 3LS0A 3FAJA 4OD4A 1SZIA 4K0DA 2KQ9A 1NSGB 3H2VA 3K1IA 2KC3A 3US6A 4OIRF 3UNGC 2KK1A 3B0VC 4GYTA 2KYHA 2LK4A 3J06A 2R7OA 3M15A 1ZZPA 3M1CB 4Z9JA 4E7ZA 4JTDB 5B3SC 1GGQA 4MQ9F 2XLHA 1RJ9B 1QKRA 4KC9A 3OEOA 4PFPA 3VF0A 4EWCA 2LP4A 4CX9A 4A2NB 4DRIB 3L8JA 1H9GA 2YL3A 3VAYA 2HJMA 3ABMC 2J0XA 4XTKA 2OEXA 1HW2A 3WODF 1BZ4A 2D5RB 2KW3C 4JE9A 3TULA 2J7PD 2YL0A 2ZXRA 2PFDA 3AJMA 1OCRC 3FMSA 4NQFA 2A0BA 2YHSA 2EIMC 1OR3A 2P0NA 3HKKA 5L0DA 1G4WR 3ZC4A 1L3PA 2J8WA 3RVZA 2WL8A 4J30B 3UR3C 5JUAA 4E0IA 4EHPA 4Q4ZF 4JIOA 3LAYA 2OEVA 3EGDB 5E33A 5L0JA 1OXKA 1NZEA 2QNLA 3GWLA 5FCLA 2R7UA 2DYRC 5JVEA 2I15A 1E84A 1A0BA 2Y39A 3M4BA 2PX0A 2CNWA 3Q6NA 1FNTc 4G7ZF 2R02A 2NSGA 2Y69C 3F47A 1TR2A 1Q0GA 3ATPA 4G78A 4BEMJ 2PNOA 3LEOA 4XEFA 1RJ9A 1C17M 5L0GA 1D1AA 2OQMA 1ZHWA 2Q4FA 2R25A 1EI7A 4U5DE 3FHDA 4JCZA 1T6QA 4JJGA 5DQTA 1QSPA 2IOQA 3A11A 3R7CA 4KI2A 2L81A 4JC7A 4LDKA 4EIYA 4DRHB 1OW6A 3W8IA 1OXBA 3TD7A 2XL6A 1VOMA 4PJLA 4XEVA 1K40A 5KYYB 2ETSA 1T6IA 2GAQA 3EGDA 4ZLCA 2B0JA 1VYIA 1Z63A 2B0HA 1AUEA 3M4CA 2WVOA 5E3CA 2PX3A 3JZ0A 2R7VA 3POVA 1QVXA 4O7GA 2DI3A 3AGTA 3LLIA 2W4MA 1CGNA 2G62A 4YN0B 2YWAA 2LFDA 2AU5A 2AWCA 2F22A 1I4ZA 1TFOB 5JT4A 5KYXB 1RCPA 2O9XA 2OKUA 4CBEA 3C8GD 2ICWG 1WASA 2VH3A 2CYDA 4U5BE 5L0FA 4MVSA 2X51A 4ANJA 5JS5A 3EHMA 1D0ZA 3LEVA 3G4ZA 3S28A 2HS5A 1BR2A 1OKKA 1WTYA 3ZQYA 3LS1A 4HE8D 4CIPA 5F5FA 1SR2A 2AVKA 1ZHTA 2P1AA 3SXMA 4EBBA 5D91A 4AK9A 1TKNA 1NU7D 2Q9AA 2VB6A 1Y4CA 2WB7A 3AQBA 2AP3A 3E70C 3UGPA 3DD7A 4LDQA 1ST6A 4MVUA 4CS8C 5KYYA 2YKZA 2J45A 1ZW2A 2OU6A 3S90A 1D1BA 4C3EA 4E18A 2XM4A 2YLGA 4HEAJ 1J8YF 5KYWB 2MWQA 3AG2C 3S0XA 3K33A 4P9TA 3EH1A 3NG1A 2L9JA 2MYSA 4JJFA 2L6FA 2H7VC 3KH2A 4KNWA 4JTCB 1Z5ZA 1O87A 4JRZA 1RXQA 5JSLA 5E3AA 5KYXA 3LUTB 3HNJA 1VYKA 1G5ZA 4PFOA 4OIOF 1C03A 2IXMA 2XM0A 4ULWA 3B71A 3ZIBA 1V4AA 2NG1A 4N4WA 3EPVA 5L0CA 2YZSA 4OIQF 5A6BA 3UGOA 4ZLDA 3DAGA 4G0HA 2NUPB 3KMIA 3ZTZA 3WAQA 1WGWA 1TQGA 3PHF2 3T6JA 2J46A 2CGEA 1H9TA 5L3VA 1ZHZA 1LS1A 3C8ZA 5L3QA 1K05A 1D1CA 1YLMA 1BBHA 3GODA 4J32B 3S27A 2NPUA 2YL7A 3ZTMA 1HE9A 1ZVZA 2CCYA 1OCCC 1S7ZA 4IB4A 3DJNB 1HE1A 4I1OB 1U0BB 1M2VB 5KYWA 5BUOA 2R7RA 1H6GA 2LCHA 3EZHA 3Q6MA 4JVSA 3X2QC 4EBJA 4YL0A 4ONSA 1ORSC 1YAUO 4N06A 2RD9A 4NC3A 4BEJA 2LD6A 1RKEB 3GEHA 4AE4B 1JAFA 4ULVA 2ZXOA 3I4UA 1AVOB 5KYNA 2G3VA 3K1HA 5AGFA 4XLPF 2KGOA 2VCCA 1LE4A 4K7BA 4MVRA 2P6VA 3HLZA 4JW1A 3I5QA 3O10A 5CI9A 4RBNA 2NUPA 2HMQA 2J9VA 2IM8A 3IQ5A 4GQHA 4P9FA 1TWAA 5GPGB 4E17A 1KU2A 2CNWD 2R7WA 4BJ5C 4XEKA 1MQVA 2ZPAA 4O6YA 3GM2A 3CZ6A 1A7DA 1Q0MA 2EILC 3HTKC 2XXAB 3TOLA 3GEEA 3JYHA 1NFNA 3K1IC 1V54C 4YT4A 1CGOA 1JRAA 3FAPB 3NMJA 3Q7LA 1T01A 4CIHA 2VCAA 3IPMO 2GFHA 5KYUB 2AWYA 2Y3GA 3R2PA 1DOVA 3A9CA 1Z7Qc 3EG9B 1LI7A 1RKEA 4ER9A 3MYIA 4AE4A 4CDYA 4UDVA 3NRHA 1FR0A 1G4US 4EKWA 2JPUA 4W8KA 3NKEA 1EA8A 1JPJA 3DZAA 1MNEA 4LERA 4FAPB 2Q7RA 5JRAA 4U5CE 3S29A 2XLEA 3KYIA 3TJ5A 4BPMA 5COFA 3CSKA 4AL1A 1FAPB 4DBRA 1YVIA 3DWWA 3GM3A 4BJ6A 5FZTA 3C18A 1HW1A 4C3BA 5F5HA 4CDVA 1Z6AA 3HNKA 1CPQA 2Y3HA 2OG2A 3N24A 4IGGA 3ZWIA 4PJNA 4F4BA 3OA1A 2XXAA 4JZAA 5L0HA 4NY3A 2ZXWC 4MS2A 3DI5A 5EGYA 1NBBA 3MX3A 5BQGA 3EJNA 4YWQA 1BDJB 3HNLA 4RD9A 1NLXA 3QW0A 3SEOA 1OKKD 2R03A 3O55A 1M2OA 5KYUA 1EKYA 2D4UA 2DGJA 2VASA 3EG9A 3AQCA 2EPKX 3VM6A 1R4TA 3V7OA 3QVZA 3AOUA 1VLTA 4CS9C 3WG7C 1ZU4A 1LKXA 1FMWA 1T6UA 1MNDA 3DXJF 1HY5A 1XZQA 5EHHA 2Q9BA 2HKVA 4O6NA 3JRTA 1U89A 1LIHA 3KL4A 3DE9A 2EIKC 1OCZC 2J7PA 1BR1A 4DBQA 2HJ3A 3RQGA 3EZIA 5T1DB 2CDQA 1OW8A 4WGZA 3EFOB 1E86A 2QUPA 4Z9IA 3W4YA 3NDBB 2TMVP 1C02A 1U6HA 1G8XA 2VCBA 2UUIA 2YLIA 3O6XA 4MTFA 3RIPA 2G3KA 2WVNA 2XLDA 5DVWA 3V5ZA 5AC4A 3DKAA 3SYNA 3EH2A 3MFNA 3SNHA 3V5XA 1MMDA 1MMGA 2J9UA 3LJBA 4W8PA 3OWTA 1ZHXA 3B9QA 4YT8A 2WZGA 2A6EF 2Q00A 2P61A 4IWBA 4NTBA 1WOLA 1IW7F 2HSQA 5JP7A 3ZVRA 1YZCA 1LPEA 4XPYA 4BJTA 4P6IC 2W4BA 2ZD9A 4I1MA 3EQLF 3C8GB 4CJGA 2R7XA 3NKDA 5L0IA 2W45A 2H7BA 4E0HA 4MTGA 3TJ6A 5A6JA 1HMOA 3U8PA 3JRMO 1JPNA 2C04A 2C03A 4FESA 4DVZA 3EFOA 5A6AA 3HJCA 4LLEA 3K6BA 3FDQA 4L6RA 3TOMA 4AL0A 2J9WA 4C7OB 1FFTC 4I3MA 2A1DD 3AG4C 2P7VA 4U5HA 4YL1A 4R32A 3W2WA 2R9RB 3ECSA 5HSWA 1NFOA 4MNDA 2Q9CA 3L8IA 2WVQA 4KNVA 2HV7A 1YZAA 4RDAA 1V55C 5CI8A 5B1AC 3V5YA 4N6HA 5TJ5E 5COMA 3U9MA 4MVQA 4DXWA 3L1MA 3H65A 4I44A 3C63A 1WN0A 3ASNC 4IAOA 1QLEC 3DM9B 1OR2A 4FX5A 4JEAA 2YL1A 3B29A 3KPHA 1TFKB 3L0IA 3NYJA 3FVYA 1MMAA 4J7TA 4XQ1A 3RFYA 3IHUA 4IAQA 3MLGA 4OD5A 4U5GA 4NTFA 1LVKA 4GEHA 3RYLA 1GS9A 1WATA 2WZFA 2QY9A 2IXNA 3U2LA 1O5HA 1VMAA 5A6KA 2PF4E 3C62A 4WJ0A 2A0UA 3L34A 3ITFA 5F28E 5DS6A 2JX0A 2Y3BA 3LLKA 2YEVA 4PR9A 1SYQA 3NMKA 2R7QA 3U3FA 3T6GB 4OIPF 1T9KA 2MHRA 4C7OA 4CDAA 2NUTB 2YRFA 2KNHA 1QZXA 2HUJA 5E2QA 3HNIA 3U8VA 1SF8A 4PK4A 4CJOA 2OOCA 3SZRA 2M64A
chains in the Genus database with same CATH topology
1K05A 1QVXA 4XEKA 1KNYA 2L6HA 3GM2A 3GM3A 3C18A 1O3UA 3C8GB 4XEFA 3L8JA 2YWAA 3U0CA 2PBEA 3RQGA 3TULA 3RQEA 1JOGA 1OW8A 2L6FA 4EBJA 3C8GA 3RQFA 3AJMA 3C8GD 1OW7A 1WWPA 4NQFA 2L6GA 5F28E 1K04A 2JX0A 3GM1A 3S9OA 1KTMA 1WTYA 2HSBA 3B71A 1V4AA 1PV3A 1OW6A 3BRJA 4EBKA 3U3FA 3MFNA 4R32A 1UFBA 2JPUA 4XEVA 1K40A 3L8IA 3O10A 3K7DA 2Q00A 2KK1A 2LK4A 1WOLA 3JYYA 1ZZPA 3JZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K05 A;  1QVX A;  4XEK A;  1KNY A;  2L6H A;  3GM2 A;  3GM3 A;  3C18 A;  1O3U A;  3C8G B;  4XEF A;  3L8J A;  2YWA A;  3U0C A;  2PBE A;  3RQG A;  3TUL A;  3RQE A;  1JOG A;  1OW8 A;  2L6F A;  4EBJ A;  3C8G A;  3RQF A;  3AJM A;  3C8G D;  1OW7 A;  1WWP A;  4NQF A;  2L6G A;  5F28 E;  1K04 A;  2JX0 A;  3GM1 A;  3S9O A;  1KTM A;  1WTY A;  2HSB A;  3B71 A;  1V4A A;  1PV3 A;  1OW6 A;  3BRJ A;  4EBK A;  3U3F A;  3MFN A;  4R32 A;  1UFB A;  2JPU A;  4XEV A;  1K40 A;  3L8I A;  3O10 A;  3K7D A;  2Q00 A;  2KK1 A;  2LK4 A;  1WOL A;  3JYY A;  1ZZP A;  3JZ0 A; 
#chains in the Genus database with same CATH topology
 1D0Y A;  5COG A;  2XS1 A;  5K0I A;  4CSA A;  1QQ3 A;  3U2M A;  4YT5 A;  3DE8 A;  4DJ9 A;  2XLV A;  2QLA A;  2BL2 A;  3ABK C;  2KSF A;  3BEH A;  2A6H F;  1A7V A;  3JSZ A;  4JUR I;  3WHN A;  3EGX B;  3U0C A;  4XLN F;  2XS8 A;  3DJU B;  3PCV A;  3RKO F;  1M6T A;  3RQE A;  3PDM P;  2M4E A;  3ASO C;  4MVM A;  3ZQV A;  1OW7 A;  1M2V A;  1WWP A;  1YA9 A;  3AGU A;  1LS4 A;  3IEE A;  4PJJ A;  2HV6 A;  4HFF B;  3TK0 A;  3W8H A;  2OCC C;  3LNM B;  1Z3I X;  4D4X A;  3RW0 A;  3T4R A;  4AX2 A;  2R7S A;  2BC5 A;  3S84 A;  2A68 F;  4IJJ A;  1RKC A;  2RSE B;  1S05 A;  1PD1 A;  4MTO A;  2E87 A;  4N6C A;  2IYL D;  3MBG A;  3K7D A;  3ZSU A;  4A4A A;  1XWJ A;  1ORY A;  1PCX A;  3U9J A;  256B A;  1JMW A;  2NUT A;  3IQ6 A;  3NYM A;  2WZL A;  4E7S A;  1ZHY A;  1NU9 C;  1RMV A;  4Q5S F;  1FMV A;  2Y3D A;  3H2U A;  1TWH A;  1QPU A;  1M57 C;  1YDI A;  2A69 F;  4LLC A;  1LE2 A;  2X0C A;  1KNY A;  4CS7 A;  4U9D A;  1GM5 A;  1H7I A;  1SMY F;  2PBE A;  2I8B A;  2PP4 A;  5T3W A;  3ZDL A;  2ZXP A;  4YJW A;  5EK0 A;  3RH3 A;  1L7C A;  1JOG A;  1LI5 A;  3LNR A;  2XSE A;  3EGX A;  5A69 A;  4KBL A;  4WGY A;  1HMD A;  4MVO A;  3QZC A;  2LSE A;  3G50 A;  4U9E A;  3CEX A;  4Q7C A;  3F46 A;  3QVY A;  4BJ6 C;  1NG1 A;  1TWC A;  3O39 A;  2J0W A;  2YLD A;  1A41 A;  2XLM A;  3N0T A;  3IQC A;  3T6B A;  5BQH A;  4Z9H A;  1E85 A;  3I5P A;  2H8A A;  3B0U X;  1VTM P;  2R7T A;  4QI2 A;  1VB5 A;  2GA0 A;  1T5O A;  3B0P A;  3U3B A;  4U5E E;  1E83 A;  1PD0 A;  5JLI A;  2L6H A;  3SXY A;  4CSA C;  3NYL A;  1F1M A;  1O3U A;  1ZU5 A;  1LM3 B;  3DMD A;  3M79 A;  4O6M A;  2IXP A;  2XLW A;  4PJM A;  1APC A;  3TQO A;  4YK5 A;  3SXZ A;  1M56 C;  1A7E A;  2Z15 A;  4HFK B;  4QDL A;  4CS9 A;  5DS4 A;  3RF3 A;  1FFH A;  2L6G A;  2H7O A;  4IAR A;  4X0R A;  2DB4 A;  2GDC A;  2HZ8 A;  2VC9 A;  4DVY P;  1XZP A;  4JTA B;  4U5F E;  1DOW A;  3SP1 A;  2GWW A;  4G7H F;  5D92 A;  2Q3T A;  5DLJ A;  1W2W A;  5DQZ A;  5A6B D;  1ZYR F;  3G4X A;  4MW8 A;  4NTA A;  3UMH A;  1ORJ A;  3UMK A;  3JYY A;  4B6I A;  1ZW3 A;  1V74 B;  2NSF A;  4OIN F;  5CIV A;  3U5S A;  1KTM A;  1B68 A;  3FOO A;  2EPN A;  3FXH A;  4JCH A;  3VYW A;  4O79 A;  2YQY A;  1TWG A;  2FGY A;  4DRJ B;  1GQA A;  2HFI A;  4YL3 A;  1JR8 A;  1Q0K A;  3ABL C;  3FOP A;  3KYJ A;  4XWJ A;  1VK5 A;  2OJQ A;  3C7J A;  4IRU A;  4WAB A;  4CS8 A;  1EQ1 A;  1I4Y A;  3JT1 A;  2EPO A;  3JSE O;  1Y6D A;  4PAC A;  2LQG A;  1CPR A;  3GM1 A;  3PMR A;  3CAX A;  3S9O A;  2XRH A;  1Z23 A;  3N2Z B;  4MW3 A;  3BRJ A;  3T9O A;  2XLO A;  2ASR A;  5AC5 A;  3KKB A;  4D4N A;  4BG0 A;  2FFH A;  3ZG1 A;  1YYX A;  2J9B A;  1R5I D;  4M63 A;  2XL4 A;  4QI0 A;  3RVY A;  2V26 A;  3CQZ A;  4J7Y A;  1VLS A;  4NCQ A;  2V3C C;  1MMN A;  3K66 A;  1OQC A;  3AG3 C;  4EUK B;  1CGM E;  5B3I A;  3NMI A;  5BQI A;  1N1C A;  3C8G A;  3RQF A;  4DOZ A;  2IXO A;  1OCO C;  4H54 A;  2EIN C;  4JKV A;  1UG7 A;  5DS5 A;  5HV9 A;  1YJG A;  1Q0D A;  1E2X A;  1YAR O;  4K1O A;  4LAC B;  2LFF A;  4C3D A;  1PV3 A;  4H4K C;  3SXK A;  4EBK A;  3GOR A;  1UFB A;  3GEI A;  3MYF A;  1Q0F A;  4JEB A;  1I5N A;  3QTH A;  3UMI A;  3LES A;  2YVK A;  4YT2 A;  1BR4 A;  5B1B C;  4XPW A;  2R05 A;  2EPM X;  4LDR A;  2IBF A;  2QTV A;  3GAN A;  3EHN A;  5T3T A;  1J8M F;  3QMK A;  1AEP A;  2EIJ C;  3JCU Q;  2FAP B;  4FWV A;  2W9Y A;  3E9V A;  4MVZ A;  4XPX A;  5IY5 C;  2DYS C;  4G7O F;  2JD3 A;  2OJE D;  2UUH A;  2HMZ A;  3DAF A;  3QW1 A;  1FTS A;  2EPL X;  3X1O A;  4BJ1 A;  2L7A A;  1D0X A;  2BE5 F;  2CW0 F;  1K04 A;  1YA7 O;  3DM5 A;  3GWN A;  3JTL O;  1IZM A;  2XL8 A;  1YYJ A;  3Q7G A;  4BJ5 A;  3VRC A;  3W2V A;  2HSB A;  2QE9 A;  2KJG A;  3AG1 C;  2LIG A;  3IQT A;  3LS0 A;  3FAJ A;  4OD4 A;  1SZI A;  4K0D A;  2KQ9 A;  1NSG B;  3H2V A;  3K1I A;  2KC3 A;  3US6 A;  4OIR F;  3UNG C;  2KK1 A;  3B0V C;  4GYT A;  2KYH A;  2LK4 A;  3J06 A;  2R7O A;  3M15 A;  1ZZP A;  3M1C B;  4Z9J A;  4E7Z A;  4JTD B;  5B3S C;  1GGQ A;  4MQ9 F;  2XLH A;  1RJ9 B;  1QKR A;  4KC9 A;  3OEO A;  4PFP A;  3VF0 A;  4EWC A;  2LP4 A;  4CX9 A;  4A2N B;  4DRI B;  3L8J A;  1H9G A;  2YL3 A;  3VAY A;  2HJM A;  3ABM C;  2J0X A;  4XTK A;  2OEX A;  1HW2 A;  3WOD F;  1BZ4 A;  2D5R B;  2KW3 C;  4JE9 A;  3TUL A;  2J7P D;  2YL0 A;  2ZXR A;  2PFD A;  3AJM A;  1OCR C;  3FMS A;  4NQF A;  2A0B A;  2YHS A;  2EIM C;  1OR3 A;  2P0N A;  3HKK A;  5L0D A;  1G4W R;  3ZC4 A;  1L3P A;  2J8W A;  3RVZ A;  2WL8 A;  4J30 B;  3UR3 C;  5JUA A;  4E0I A;  4EHP A;  4Q4Z F;  4JIO A;  3LAY A;  2OEV A;  3EGD B;  5E33 A;  5L0J A;  1OXK A;  1NZE A;  2QNL A;  3GWL A;  5FCL A;  2R7U A;  2DYR C;  5JVE A;  2I15 A;  1E84 A;  1A0B A;  2Y39 A;  3M4B A;  2PX0 A;  2CNW A;  3Q6N A;  1FNT c;  4G7Z F;  2R02 A;  2NSG A;  2Y69 C;  3F47 A;  1TR2 A;  1Q0G A;  3ATP A;  4G78 A;  4BEM J;  2PNO A;  3LEO A;  4XEF A;  1RJ9 A;  1C17 M;  5L0G A;  1D1A A;  2OQM A;  1ZHW A;  2Q4F A;  2R25 A;  1EI7 A;  4U5D E;  3FHD A;  4JCZ A;  1T6Q A;  4JJG A;  5DQT A;  1QSP A;  2IOQ A;  3A11 A;  3R7C A;  4KI2 A;  2L81 A;  4JC7 A;  4LDK A;  4EIY A;  4DRH B;  1OW6 A;  3W8I A;  1OXB A;  3TD7 A;  2XL6 A;  1VOM A;  4PJL A;  4XEV A;  1K40 A;  5KYY B;  2ETS A;  1T6I A;  2GAQ A;  3EGD A;  4ZLC A;  2B0J A;  1VYI A;  1Z63 A;  2B0H A;  1AUE A;  3M4C A;  2WVO A;  5E3C A;  2PX3 A;  3JZ0 A;  2R7V A;  3POV A;  1QVX A;  4O7G A;  2DI3 A;  3AGT A;  3LLI A;  2W4M A;  1CGN A;  2G62 A;  4YN0 B;  2YWA A;  2LFD A;  2AU5 A;  2AWC A;  2F22 A;  1I4Z A;  1TFO B;  5JT4 A;  5KYX B;  1RCP A;  2O9X A;  2OKU A;  4CBE A;  3C8G D;  2ICW G;  1WAS A;  2VH3 A;  2CYD A;  4U5B E;  5L0F A;  4MVS A;  2X51 A;  4ANJ A;  5JS5 A;  3EHM A;  1D0Z A;  3LEV A;  3G4Z A;  3S28 A;  2HS5 A;  1BR2 A;  1OKK A;  1WTY A;  3ZQY A;  3LS1 A;  4HE8 D;  4CIP A;  5F5F A;  1SR2 A;  2AVK A;  1ZHT A;  2P1A A;  3SXM A;  4EBB A;  5D91 A;  4AK9 A;  1TKN A;  1NU7 D;  2Q9A A;  2VB6 A;  1Y4C A;  2WB7 A;  3AQB A;  2AP3 A;  3E70 C;  3UGP A;  3DD7 A;  4LDQ A;  1ST6 A;  4MVU A;  4CS8 C;  5KYY A;  2YKZ A;  2J45 A;  1ZW2 A;  2OU6 A;  3S90 A;  1D1B A;  4C3E A;  4E18 A;  2XM4 A;  2YLG A;  4HEA J;  1J8Y F;  5KYW B;  2MWQ A;  3AG2 C;  3S0X A;  3K33 A;  4P9T A;  3EH1 A;  3NG1 A;  2L9J A;  2MYS A;  4JJF A;  2L6F A;  2H7V C;  3KH2 A;  4KNW A;  4JTC B;  1Z5Z A;  1O87 A;  4JRZ A;  1RXQ A;  5JSL A;  5E3A A;  5KYX A;  3LUT B;  3HNJ A;  1VYK A;  1G5Z A;  4PFO A;  4OIO F;  1C03 A;  2IXM A;  2XM0 A;  4ULW A;  3B71 A;  3ZIB A;  1V4A A;  2NG1 A;  4N4W A;  3EPV A;  5L0C A;  2YZS A;  4OIQ F;  5A6B A;  3UGO A;  4ZLD A;  3DAG A;  4G0H A;  2NUP B;  3KMI A;  3ZTZ A;  3WAQ A;  1WGW A;  1TQG A;  3PHF 2;  3T6J A;  2J46 A;  2CGE A;  1H9T A;  5L3V A;  1ZHZ A;  1LS1 A;  3C8Z A;  5L3Q A;  1K05 A;  1D1C A;  1YLM A;  1BBH A;  3GOD A;  4J32 B;  3S27 A;  2NPU A;  2YL7 A;  3ZTM A;  1HE9 A;  1ZVZ A;  2CCY A;  1OCC C;  1S7Z A;  4IB4 A;  3DJN B;  1HE1 A;  4I1O B;  1U0B B;  1M2V B;  5KYW A;  5BUO A;  2R7R A;  1H6G A;  2LCH A;  3EZH A;  3Q6M A;  4JVS A;  3X2Q C;  4EBJ A;  4YL0 A;  4ONS A;  1ORS C;  1YAU O;  4N06 A;  2RD9 A;  4NC3 A;  4BEJ A;  2LD6 A;  1RKE B;  3GEH A;  4AE4 B;  1JAF A;  4ULV A;  2ZXO A;  3I4U A;  1AVO B;  5KYN A;  2G3V A;  3K1H A;  5AGF A;  4XLP F;  2KGO A;  2VCC A;  1LE4 A;  4K7B A;  4MVR A;  2P6V A;  3HLZ A;  4JW1 A;  3I5Q A;  3O10 A;  5CI9 A;  4RBN A;  2NUP A;  2HMQ A;  2J9V A;  2IM8 A;  3IQ5 A;  4GQH A;  4P9F A;  1TWA A;  5GPG B;  4E17 A;  1KU2 A;  2CNW D;  2R7W A;  4BJ5 C;  4XEK A;  1MQV A;  2ZPA A;  4O6Y A;  3GM2 A;  3CZ6 A;  1A7D A;  1Q0M A;  2EIL C;  3HTK C;  2XXA B;  3TOL A;  3GEE A;  3JYH A;  1NFN A;  3K1I C;  1V54 C;  4YT4 A;  1CGO A;  1JRA A;  3FAP B;  3NMJ A;  3Q7L A;  1T01 A;  4CIH A;  2VCA A;  3IPM O;  2GFH A;  5KYU B;  2AWY A;  2Y3G A;  3R2P A;  1DOV A;  3A9C A;  1Z7Q c;  3EG9 B;  1LI7 A;  1RKE A;  4ER9 A;  3MYI A;  4AE4 A;  4CDY A;  4UDV A;  3NRH A;  1FR0 A;  1G4U S;  4EKW A;  2JPU A;  4W8K A;  3NKE A;  1EA8 A;  1JPJ A;  3DZA A;  1MNE A;  4LER A;  4FAP B;  2Q7R A;  5JRA A;  4U5C E;  3S29 A;  2XLE A;  3KYI A;  3TJ5 A;  4BPM A;  5COF A;  3CSK A;  4AL1 A;  1FAP B;  4DBR A;  1YVI A;  3DWW A;  3GM3 A;  4BJ6 A;  5FZT A;  3C18 A;  1HW1 A;  4C3B A;  5F5H A;  4CDV A;  1Z6A A;  3HNK A;  1CPQ A;  2Y3H A;  2OG2 A;  3N24 A;  4IGG A;  3ZWI A;  4PJN A;  4F4B A;  3OA1 A;  2XXA A;  4JZA A;  5L0H A;  4NY3 A;  2ZXW C;  4MS2 A;  3DI5 A;  5EGY A;  1NBB A;  3MX3 A;  5BQG A;  3EJN A;  4YWQ A;  1BDJ B;  3HNL A;  4RD9 A;  1NLX A;  3QW0 A;  3SEO A;  1OKK D;  2R03 A;  3O55 A;  1M2O A;  5KYU A;  1EKY A;  2D4U A;  2DGJ A;  2VAS A;  3EG9 A;  3AQC A;  2EPK X;  3VM6 A;  1R4T A;  3V7O A;  3QVZ A;  3AOU A;  1VLT A;  4CS9 C;  3WG7 C;  1ZU4 A;  1LKX A;  1FMW A;  1T6U A;  1MND A;  3DXJ F;  1HY5 A;  1XZQ A;  5EHH A;  2Q9B A;  2HKV A;  4O6N A;  3JRT A;  1U89 A;  1LIH A;  3KL4 A;  3DE9 A;  2EIK C;  1OCZ C;  2J7P A;  1BR1 A;  4DBQ A;  2HJ3 A;  3RQG A;  3EZI A;  5T1D B;  2CDQ A;  1OW8 A;  4WGZ A;  3EFO B;  1E86 A;  2QUP A;  4Z9I A;  3W4Y A;  3NDB B;  2TMV P;  1C02 A;  1U6H A;  1G8X A;  2VCB A;  2UUI A;  2YLI A;  3O6X A;  4MTF A;  3RIP A;  2G3K A;  2WVN A;  2XLD A;  5DVW A;  3V5Z A;  5AC4 A;  3DKA A;  3SYN A;  3EH2 A;  3MFN A;  3SNH A;  3V5X A;  1MMD A;  1MMG A;  2J9U A;  3LJB A;  4W8P A;  3OWT A;  1ZHX A;  3B9Q A;  4YT8 A;  2WZG A;  2A6E F;  2Q00 A;  2P61 A;  4IWB A;  4NTB A;  1WOL A;  1IW7 F;  2HSQ A;  5JP7 A;  3ZVR A;  1YZC A;  1LPE A;  4XPY A;  4BJT A;  4P6I C;  2W4B A;  2ZD9 A;  4I1M A;  3EQL F;  3C8G B;  4CJG A;  2R7X A;  3NKD A;  5L0I A;  2W45 A;  2H7B A;  4E0H A;  4MTG A;  3TJ6 A;  5A6J A;  1HMO A;  3U8P A;  3JRM O;  1JPN A;  2C04 A;  2C03 A;  4FES A;  4DVZ A;  3EFO A;  5A6A A;  3HJC A;  4LLE A;  3K6B A;  3FDQ A;  4L6R A;  3TOM A;  4AL0 A;  2J9W A;  4C7O B;  1FFT C;  4I3M A;  2A1D D;  3AG4 C;  2P7V A;  4U5H A;  4YL1 A;  4R32 A;  3W2W A;  2R9R B;  3ECS A;  5HSW A;  1NFO A;  4MND A;  2Q9C A;  3L8I A;  2WVQ A;  4KNV A;  2HV7 A;  1YZA A;  4RDA A;  1V55 C;  5CI8 A;  5B1A C;  3V5Y A;  4N6H A;  5TJ5 E;  5COM A;  3U9M A;  4MVQ A;  4DXW A;  3L1M A;  3H65 A;  4I44 A;  3C63 A;  1WN0 A;  3ASN C;  4IAO A;  1QLE C;  3DM9 B;  1OR2 A;  4FX5 A;  4JEA A;  2YL1 A;  3B29 A;  3KPH A;  1TFK B;  3L0I A;  3NYJ A;  3FVY A;  1MMA A;  4J7T A;  4XQ1 A;  3RFY A;  3IHU A;  4IAQ A;  3MLG A;  4OD5 A;  4U5G A;  4NTF A;  1LVK A;  4GEH A;  3RYL A;  1GS9 A;  1WAT A;  2WZF A;  2QY9 A;  2IXN A;  3U2L A;  1O5H A;  1VMA A;  5A6K A;  2PF4 E;  3C62 A;  4WJ0 A;  2A0U A;  3L34 A;  3ITF A;  5F28 E;  5DS6 A;  2JX0 A;  2Y3B A;  3LLK A;  2YEV A;  4PR9 A;  1SYQ A;  3NMK A;  2R7Q A;  3U3F A;  3T6G B;  4OIP F;  1T9K A;  2MHR A;  4C7O A;  4CDA A;  2NUT B;  2YRF A;  2KNH A;  1QZX A;  2HUJ A;  5E2Q A;  3HNI A;  3U8V A;  1SF8 A;  4PK4 A;  4CJO A;  2OOC A;  3SZR A;  2M64 A; 
#chains in the Genus database with same CATH homology
 1K05 A;  1QVX A;  4XEK A;  1KNY A;  2L6H A;  3GM2 A;  3GM3 A;  3C18 A;  1O3U A;  3C8G B;  4XEF A;  3L8J A;  2YWA A;  3U0C A;  2PBE A;  3RQG A;  3TUL A;  3RQE A;  1JOG A;  1OW8 A;  2L6F A;  4EBJ A;  3C8G A;  3RQF A;  3AJM A;  3C8G D;  1OW7 A;  1WWP A;  4NQF A;  2L6G A;  5F28 E;  1K04 A;  2JX0 A;  3GM1 A;  3S9O A;  1KTM A;  1WTY A;  2HSB A;  3B71 A;  1V4A A;  1PV3 A;  1OW6 A;  3BRJ A;  4EBK A;  3U3F A;  3MFN A;  4R32 A;  1UFB A;  2JPU A;  4XEV A;  1K40 A;  3L8I A;  3O10 A;  3K7D A;  2Q00 A;  2KK1 A;  2LK4 A;  1WOL A;  3JYY A;  1ZZP A;  3JZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...