2HSBA

Crystal structure of a hepn domain containing protein (af_0298) from archaeoglobus fulgidus at 1.95 a resolution
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
126
structure length
126
Chain Sequence
GMDELELRIRKAEKLVQDAKKEFEMGLYERCCSTAYYAMFHAAKAMLLGYGRDSKTHRGTIYLIWECREELGLSDDDCSKLSRAFDLREESDYGIYKEVSKDLAIKILKDAEIFVQKAKNAVNKNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical UPF0332 protein AF0298
publication title Crystal structure of hypothetical protein (NP_069135.1) from Archaeoglobus Fulgidus at 1.95 A resolution
rcsb
source organism Archaeoglobus fulgidus
molecule tags Unknown function
total genus 50
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2006-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05168 HEPN HEPN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 2hsbA00
3AJMA 1ZZPA 2LK4A 2JPUA 3C8GA 4R32A 3RQFA 3C18A 3JZ0A 2L6HA 3MFNA 4EBKA 4EBJA 3U0CA 2Q00A 1WTYA 1V4AA 2YWAA 1OW6A 1JOGA 1K04A 1OW8A 1WWPA 1KTMA 3S9OA 1KNYA 2JX0A 1PV3A 4XEKA 4XEVA 1UFBA 3B71A 3BRJA 2L6FA 3RQEA 3RQGA 3TULA 1K05A 2L6GA 3C8GD 3JYYA 3L8JA 3L8IA 1OW7A 3O10A 3GM2A 4XEFA 2PBEA 3U3FA 1O3UA 1WOLA 3GM1A 2KK1A 1K40A 3C8GB 5F28E 2HSBA 3K7DA 1QVXA 3GM3A 4NQFA
chains in the Genus database with same CATH superfamily
2CNWD 3K1IA 3S28A 3SYNA 3EPVA 1U89A 2EPLX 4DRJB 3U3BA 5L0JA 2Q00A 1VB5A 2BE5F 2UUHA 1V4AA 2YWAA 1VK5A 3QVZA 1DOVA 1JRAA 4IB4A 1FAPB 3T6GB 1GM5A 4Q5SF 1ORJA 3ATPA 4D4XA 1NG1A 1Z5ZA 1V55C 2HJMA 3A11A 5DQZA 1R4TA 2DYRC 5E3CA 4A2NB 4G0HA 3BEHA 1OCOC 4YK5A 5B3SC 2UUIA 3O10A 3FOOA 3ZQVA 1FMWA 4UDVA 3DE9A 1RKCA 2PF4E 1ZHZA 1J8MF 2LD6A 2AU5A 2QUPA 3I5QA 1HW1A 2A68F 1QQ3A 3HNIA 2WVOA 3DM5A 4LDQA 4NQFA 2IXOA 1R5ID 1S05A 2NSGA 2QTVA 3IQTA 4JRZA 3RQFA 3SXZA 1HE1A 1V54C 4OIOF 4JZAA 2EPKX 4EBJA 3RH3A 1PD1A 1OW6A 2CYDA 3HKKA 4HFFB 4Z9HA 3S9OA 1C03A 4E18A 2O9XA 1RMVA 3M4CA 3S29A 2L6FA 3EGXB 4JC7A 4I3MA 3TQOA 5D92A 5B3IA 3V5ZA 1LI5A 2F22A 5L0GA 3DJUB 1A0BA 4PACA 2CCYA 3WODF 4J7TA 3SP1A 5KYYB 4PJMA 4U5GA 4K0DA 3WAQA 3ZTZA 2HMQA 2ICWG 2J9VA 2CNWA 3MYIA 3TOLA 2L81A 4E0IA 2YZSA 3EH2A 4P9TA 5A6JA 5JP7A 1WOLA 3GM1A 1WN0A 1EI7A 4PJLA 4WGYA 4EBBA 2KJGA 2YLDA 1LM3B 1LVKA 3QW1A 4B6IA 1TQGA 2X51A 2R7QA 4GQHA 5COMA 2R7XA 1JR8A 1D0ZA 1KTMA 2R7OA 2BC5A 2HFIA 2VC9A 2MWQA 2W4MA 2YKZA 3AJMA 1NU9C 4E0HA 4R32A 4PJJA 5TJ5E 4CIPA 1HY5A 2CW0F 1BR4A 1D1CA 1H7IA 1VYIA 4JW1A 4XTKA 1NFOA 4MVOA 4PFOA 1B68A 1KNYA 1L3PA 2WB7A 5F5FA 3CQZA 2OU6A 4FX5A 4DJ9A 4C3BA 5KYWA 2IBFA 1YJGA 3HJCA 4DVYP 2IOQA 1Z63A 3AQCA 4HE8D 3AG2C 3LAYA 2IM8A 2LSEA 5DVWA 3S90A 2G3VA 2NSFA 1IZMA 3HTKC 3L8IA 3E9VA 3SXKA 2LIGA 2YQYA 3F47A 3H65A 2R7RA 3DWWA 4HEAJ 4RBNA 3GWNA 1MMDA 5A69A 4I1MA 5F28E 3K7DA 3LS1A 3GM3A 3T6BA 3JRTA 3EG9B 1IW7F 3NMJA 1YYJA 2D5RB 2EPMX 4AK9A 1SMYF 3IQ5A 2G62A 1G5ZA 4H4KC 2ZXRA 1MNDA 5B1AC 2CDQA 4EIYA 5K0IA 1M2OA 1T9KA 1MMGA 2H7BA 2XLMA 1SZIA 4G7HF 3GEIA 3DAGA 3VRCA 1AVOB 3EGXA 3W2VA 3JTLO 4AE4B 1BZ4A 3ZG1A 1OW7A 2J9UA 2J7PA 2V26A 2QY9A 2EIKC 3EZIA 4BJ5C 1M2VB 1A7DA 2H7VC 4N6HA 1D1AA 3ZWIA 5BQHA 3FVYA 2I8BA 1RCPA 3FMSA 1C17M 3C63A 5DS6A 1K40A 4PJNA 2XXAA 2EILC 4OD5A 5T1DB 2ZPAA 1KU2A 3VF0A 4IRUA 4Z9IA 3NKEA 1YZCA 2B0JA 3H2VA 3U9JA 3Q7LA 3R2PA 1TWGA 4KNVA 3EGDA 3GORA 1UFBA 5E3AA 2NPUA 3X2QC 5COFA 4CJGA 1E86A 4MQ9F 4G7ZF 3U2MA 1Z23A 4K1OA 4JTAB 4XQ1A 1YAUO 2DI3A 4XWJA 3N0TA 4YL0A 2KNHA 2VH3A 2WZGA 2NUPB 1T6IA 3GM2A 2XLEA 1CGNA 1FFTC 1ZW3A 2EIJC 3V5XA 5JS5A 1VMAA 4JEAA 5E2QA 2OKUA 2HUJA 1ZHYA 2Y3DA 3TD7A 1WATA 2FAPB 5BQIA 1V74B 2Q4FA 4IAOA 1RXQA 3JSZA 4CBEA 4O6MA 2VCBA 3K33A 1VOMA 2LK4A 2P0NA 2YVKA 3HLZA 2M4EA 3KKBA 3US6A 2GAQA 3W2WA 4AL0A 4BEMJ 2P6VA 4LDRA 4LLCA 4JJFA 3EG9A 3O39A 3H2UA 1I4ZA 1Y6DA 4BJ5A 4WABA 2R05A 5KYWB 4OIQF 3DM9B 4U5BE 4MTOA 3X1OA 2W4BA 3MX3A 3OEOA 4JTDB 2WVQA 1G4WR 1LS1A 3V5YA 2L7AA 4DVZA 1U6HA 3FOPA 4IAQA 2XLVA 3GEHA 2EPOA 4E7SA 5HV9A 5JRAA 4BJTA 5A6BA 2GFHA 4YWQA 1YA9A 3S27A 2PBEA 2GDCA 3KPHA 2L9JA 3MLGA 3EZHA 4Z9JA 4AE4A 4Q4ZF 5JT4A 3B0UX 4ANJA 1HMOA 1TWCA 2A6HF 1M2VA 2HJ3A 2KSFA 4ZLDA 3FDQA 4OIRF 5BUOA 1PCXA 1ZVZA 1Q0MA 3JT1A 4I44A 4XPXA 1XWJA 3DZAA 3NMKA 2CGEA 4ER9A 4ZLCA 2VASA 2DYSC 2YEVA 2XLDA 1PV3A 4ONSA 5FCLA 1OQCA 3JSEO 3V7OA 1LPEA 1OR2A 1TFKB 3M1CB 3K6BA 3DJNB 4LLEA 1D1BA 3GODA 3L8JA 1NLXA 3IHUA 4FWVA 4NCQA 1A7VA 3SXMA 4YL3A 1RKEB 3B0PA 1E83A 4YJWA 4ULVA 3EHMA 4D4NA 2Y39A 1LIHA 1JPJA 3ZDLA 2WL8A 3IPMO 2IYLD 5BQGA 4E17A 2V3CC 2EPNA 3DKAA 2XXAB 5AGFA 2OCCC 2NUPA 4I1OB 2BL2A 2KW3C 2WZLA 3UGOA 2M64A 3E70C 4EHPA 1M6TA 3O6XA 1UG7A 3U8VA 3VM6A 4XPYA 2HV6A 1MNEA 2JPUA 3HNKA 2PNOA 2J7PD 1DOWA 5CI8A 3PDMP 3B0VC 3EGDB 1CPQA 1WTYA 2YLGA 3CZ6A 3LNMB 3RF3A 1WASA 1NU7D 3AGUA 4DBQA 1YZAA 3MBGA 5IY5C 2Y69C 3DE8A 3SZRA 3VAYA 5HSWA 1NZEA 2R9RB 1YLMA 4JKVA 4U5DE 4FESA 3AG4C 2P61A 3R7CA 1OKKD 3IQ6A 3K1HA 3FAPB 1H6GA 4MTFA 1VLTA 4JVSA 3Q6NA 4XPWA 5DS4A 2RSEB 3C62A 2YL0A 3HNJA 2Y3HA 3OWTA 3CSKA 3QTHA 2AP3A 2OG2A 1PD0A 1ZZPA 3B29A 3SXYA 3AGTA 4P9FA 5L3VA 2EINC 3TK0A 5GPGB 3F46A 4BJ1A 1FNTc 4JURI 3U0CA 4F4BA 3G50A 3GWLA 1G4US 2Y3BA 4CS8C 3UNGC 2GWWA 1ZU4A 2XS1A 3L0IA 2JX0A 3SEOA 3B71A 2HS5A 3B9QA 2XRHA 3OA1A 3RQGA 1I5NA 1XZQA 1TR2A 5KYUB 1CPRA 4KNWA 4JTCB 3TJ6A 2OQMA 2HMZA 2R02A 3N24A 3JCUQ 2QNLA 2YLIA 1L7CA 4YT4A 5L0FA 2HZ8A 1BDJB 256BA 1NSGB 1M57C 2OEXA 1ZHTA 3ABMC 4XLPF 3IEEA 1RKEA 2KK1A 3L1MA 3W8IA 3KYJA 2Q9BA 4C3EA 4N4WA 4PR9A 1O5HA 4H54A 1EKYA 4IJJA 3RVYA 4CS9C 3C18A 3JZ0A 1E84A 5A6BD 3ITFA 3M15A 5L0DA 4CDVA 4AX2A 2ZD9A 1T5OA 1BR2A 2A0UA 4EKWA 1CGME 1WWPA 1H9TA 3KYIA 1OKKA 3RW0A 4MNDA 3BRJA 4LACB 4BJ6C 3PCVA 3W8HA 5COGA 2FGYA 4BJ6A 2PX3A 2VCAA 3NG1A 4CX9A 1SYQA 2EIMC 3JYYA 4IWBA 4MS2A 2X0CA 3T4RA 2A0BA 1JAFA 2Q9AA 3FHDA 3RIPA 4E7ZA 2ZXOA 1YVIA 2HSQA 1ST6A 2ZXPA 1AEPA 4MVRA 5EGYA 3JRMO 4JCHA 1T6UA 2Z15A 1SR2A 4CS8A 3QMKA 4GEHA 2B0HA 4CS7A 3C8GB 5L0CA 4PK4A 3EJNA 2MHRA 3NDBB 2XL8A 5EK0A 3TJ5A 3C8ZA 3UMKA 4CDAA 2J0WA 2XLOA 3ABLC 1YYXA 3QVYA 1ORYA 2OJQA 3LNRA 5KYNA 2XL4A 4O7GA 2LP4A 4MW3A 5A6AA 3UGPA 1HW2A 1Z3IX 4FAPB 1JOGA 2XM0A 2OOCA 4LERA 4JIOA 2A69F 1CGOA 2J0XA 1TWAA 2YL7A 2OEVA 1M56C 4J32B 4CSAC 2R25A 3C8GD 1NBBA 1APCA 2AWCA 2YRFA 3IQCA 4HFKB 1LKXA 4RDAA 4MVZA 4BPMA 2R7UA 2J9BA 5KYUA 4CJOA 3UMIA 4CS9A 4EWCA 3LJBA 3POVA 1YA7O 3EQLF 4J7YA 3T6JA 3ZTMA 1ORSC 1D0XA 1YDIA 1J8YF 3I4UA 3KL4A 1QKRA 2VCCA 4KI2A 4CDYA 3RFYA 1E2XA 4L6RA 1HE9A 4A4AA 3ZIBA 4O6NA 3LLKA 1QPUA 1W2WA 1T01A 2OJED 3LUTB 4G78A 4YT2A 2C03A 3LLIA 2I15A 4J30B 4MVQA 4MVMA 1Z6AA 4MTGA 5CIVA 3AG3C 4G7OF 1ZHXA 5CI9A 3ASNC 3UMHA 4NC3A 3W4YA 1K05A 4BEJA 3EHNA 5EHHA 5E33A 1G8XA 2Q7RA 4WJ0A 1A7EA 3LESA 1QZXA 2QE9A 3RYLA 2XLWA 4DOZA 2GA0A 1A41A 3FAJA 4C7OB 4RD9A 2NUTB 4QDLA 1BBHA 2E87A 3T9OA 5DLJA 4BG0A 1TKNA 4KC9A 4WGZA 2J8WA 1LS4A 1T6QA 4N06A 3UR3C 3PHF2 3A9CA 3EFOA 3DI5A 3ECSA 3QW0A 4GYTA 1GQAA 2HSBA 3GEEA 4K7BA 4X0RA 3N2ZB 2H8AA 4U5CE 1LE4A 1OR3A 4CSAA 3NKDA 4NTFA 3C8GA 4QI0A 3J06A 1ZW2A 5JLIA 3MFNA 2C04A 1QSPA 4U5HA 3RVZA 3K66A 1NFNA 3M4BA 3AOUA 3TULA 4O79A 3KH2A 3RQEA 1Q0KA 2WZFA 3PMRA 4PFPA 2R7VA 1VLSA 1N1CA 2XL6A 2L6GA 2LQGA 1MMAA 4W8PA 1OCRC 1RJ9A 1ZHWA 3U8PA 3ZSUA 4DXWA 3S84A 2J45A 3NRHA 2NG1A 2R7WA 2IXMA 1FTSA 4W8KA 1EQ1A 2HKVA 3NYJA 1Y4CA 1OXBA 3M79A 4MVSA 5B1BC 1O3UA 2W45A 3U3FA 2A6EF 4CIHA 1OXKA 3S0XA 1C02A 2FFHA 3CEXA 1OCCC 4NTAA 5AC5A 2PP4A 2RD9A 4JCZA 4JEBA 3GANA 2ETSA 2P7VA 4U9DA 4YL1A 2LCHA 4O6YA 3VYWA 3DMDA 4NTBA 4Q7CA 2TMVP 1LI7A 2DB4A 1JMWA 1Q0DA 1ZYRF 4ULWA 3RKOF 1HMDA 1GGQA 2KYHA 3U5SA 4U9EA 2KC3A 1TWHA 5KYXB 2HV7A 5T3WA 1S7ZA 4DRHB 2XS8A 4C3DA 2R03A 5D91A 1LE2A 2XSEA 3C7JA 2J46A 2A1DD 3ABKC 2W9YA 1QLEC 3DXJF 5F5HA 3FXHA 2YL1A 1TFOB 1Q0GA 4C7OA 1VYKA 2DGJA 2Q9CA 2H7OA 3EH1A 2PFDA 2NUTA 2J9WA 5AC4A 3WHNA 3LEVA 5L0IA 3Q6MA 3U9MA 3G4XA 2R7TA 1BR1A 2PX0A 3JYHA 1U0BB 5JVEA 1JPNA 2Q3TA 1Q0FA 3AG1C 2JD3A 3Q7GA 4MW8A 4QI2A 1EA8A 4YT5A 5A6KA 3LEOA 4EUKB 2KGOA 3MYFA 3NYMA 1FMVA 4LDKA 4AL1A 1F1MA 4JE9A 1Z7Qc 3K1IC 4NY3A 1GS9A 2KQ9A 4M63A 2IXNA 5L0HA 4JJGA 5KYYA 4IARA 2ZXWC 3HNLA 1O87A 1MQVA 3EFOB 5JUAA 3ZVRA 2YHSA 5JSLA 2WVNA 2IXPA 2AWYA 2XM4A 3AQBA 1QVXA 2R7SA 1FR0A 2YL3A 1XZPA 4U5FE 2Y3GA 5FZTA 3NYLA 2L6HA 4EBKA 1ZU5A 3I5PA 1FFHA 2D4UA 4OIPF 3G4ZA 3L34A 1I4YA 3LS0A 3ZC4A 1OW8A 1K04A 2LFFA 3O55A 2XLHA 3DAFA 4N6CA 1RJ9B 4XEVA 3QZCA 4XEKA 3NMIA 2P1AA 4OINF 1MMNA 1H9GA 1YARO 1OCZC 2QLAA 5KYXA 4DRIB 1E85A 5DS5A 2VB6A 2LFDA 5DQTA 4DBRA 2G3KA 4OD4A 1VTMP 2AVKA 4KBLA 1AUEA 2MYSA 1WGWA 4P6IC 4XEFA 5T3TA 4XLNF 1SF8A 4YN0B 3TOMA 3SNHA 4YT8A 4IGGA 4MVUA 5L3QA 3DD7A 2ASRA 3CAXA 4U5EE 3KMIA 3ASOC 3WG7C 1D0YA 3U2LA 3ZQYA
chains in the Genus database with same CATH topology
3AJMA 1ZZPA 2LK4A 2JPUA 3C8GA 4R32A 3RQFA 3C18A 3JZ0A 2L6HA 3MFNA 4EBKA 4EBJA 3U0CA 2Q00A 1WTYA 1V4AA 2YWAA 1OW6A 1JOGA 1K04A 1OW8A 1WWPA 1KTMA 3S9OA 1KNYA 2JX0A 1PV3A 4XEKA 4XEVA 1UFBA 3B71A 3BRJA 2L6FA 3RQEA 3RQGA 3TULA 1K05A 2L6GA 3C8GD 3JYYA 3L8JA 3L8IA 1OW7A 3O10A 3GM2A 4XEFA 2PBEA 3U3FA 1O3UA 1WOLA 3GM1A 2KK1A 1K40A 3C8GB 5F28E 2HSBA 3K7DA 1QVXA 3GM3A 4NQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AJM A;  1ZZP A;  2LK4 A;  2JPU A;  3C8G A;  4R32 A;  3RQF A;  3C18 A;  3JZ0 A;  2L6H A;  3MFN A;  4EBK A;  4EBJ A;  3U0C A;  2Q00 A;  1WTY A;  1V4A A;  2YWA A;  1OW6 A;  1JOG A;  1K04 A;  1OW8 A;  1WWP A;  1KTM A;  3S9O A;  1KNY A;  2JX0 A;  1PV3 A;  4XEK A;  4XEV A;  1UFB A;  3B71 A;  3BRJ A;  2L6F A;  3RQE A;  3RQG A;  3TUL A;  1K05 A;  2L6G A;  3C8G D;  3JYY A;  3L8J A;  3L8I A;  1OW7 A;  3O10 A;  3GM2 A;  4XEF A;  2PBE A;  3U3F A;  1O3U A;  1WOL A;  3GM1 A;  2KK1 A;  1K40 A;  3C8G B;  5F28 E;  2HSB A;  3K7D A;  1QVX A;  3GM3 A;  4NQF A; 
#chains in the Genus database with same CATH topology
 2CNW D;  3K1I A;  3S28 A;  3SYN A;  3EPV A;  1U89 A;  2EPL X;  4DRJ B;  3U3B A;  5L0J A;  2Q00 A;  1VB5 A;  2BE5 F;  2UUH A;  1V4A A;  2YWA A;  1VK5 A;  3QVZ A;  1DOV A;  1JRA A;  4IB4 A;  1FAP B;  3T6G B;  1GM5 A;  4Q5S F;  1ORJ A;  3ATP A;  4D4X A;  1NG1 A;  1Z5Z A;  1V55 C;  2HJM A;  3A11 A;  5DQZ A;  1R4T A;  2DYR C;  5E3C A;  4A2N B;  4G0H A;  3BEH A;  1OCO C;  4YK5 A;  5B3S C;  2UUI A;  3O10 A;  3FOO A;  3ZQV A;  1FMW A;  4UDV A;  3DE9 A;  1RKC A;  2PF4 E;  1ZHZ A;  1J8M F;  2LD6 A;  2AU5 A;  2QUP A;  3I5Q A;  1HW1 A;  2A68 F;  1QQ3 A;  3HNI A;  2WVO A;  3DM5 A;  4LDQ A;  4NQF A;  2IXO A;  1R5I D;  1S05 A;  2NSG A;  2QTV A;  3IQT A;  4JRZ A;  3RQF A;  3SXZ A;  1HE1 A;  1V54 C;  4OIO F;  4JZA A;  2EPK X;  4EBJ A;  3RH3 A;  1PD1 A;  1OW6 A;  2CYD A;  3HKK A;  4HFF B;  4Z9H A;  3S9O A;  1C03 A;  4E18 A;  2O9X A;  1RMV A;  3M4C A;  3S29 A;  2L6F A;  3EGX B;  4JC7 A;  4I3M A;  3TQO A;  5D92 A;  5B3I A;  3V5Z A;  1LI5 A;  2F22 A;  5L0G A;  3DJU B;  1A0B A;  4PAC A;  2CCY A;  3WOD F;  4J7T A;  3SP1 A;  5KYY B;  4PJM A;  4U5G A;  4K0D A;  3WAQ A;  3ZTZ A;  2HMQ A;  2ICW G;  2J9V A;  2CNW A;  3MYI A;  3TOL A;  2L81 A;  4E0I A;  2YZS A;  3EH2 A;  4P9T A;  5A6J A;  5JP7 A;  1WOL A;  3GM1 A;  1WN0 A;  1EI7 A;  4PJL A;  4WGY A;  4EBB A;  2KJG A;  2YLD A;  1LM3 B;  1LVK A;  3QW1 A;  4B6I A;  1TQG A;  2X51 A;  2R7Q A;  4GQH A;  5COM A;  2R7X A;  1JR8 A;  1D0Z A;  1KTM A;  2R7O A;  2BC5 A;  2HFI A;  2VC9 A;  2MWQ A;  2W4M A;  2YKZ A;  3AJM A;  1NU9 C;  4E0H A;  4R32 A;  4PJJ A;  5TJ5 E;  4CIP A;  1HY5 A;  2CW0 F;  1BR4 A;  1D1C A;  1H7I A;  1VYI A;  4JW1 A;  4XTK A;  1NFO A;  4MVO A;  4PFO A;  1B68 A;  1KNY A;  1L3P A;  2WB7 A;  5F5F A;  3CQZ A;  2OU6 A;  4FX5 A;  4DJ9 A;  4C3B A;  5KYW A;  2IBF A;  1YJG A;  3HJC A;  4DVY P;  2IOQ A;  1Z63 A;  3AQC A;  4HE8 D;  3AG2 C;  3LAY A;  2IM8 A;  2LSE A;  5DVW A;  3S90 A;  2G3V A;  2NSF A;  1IZM A;  3HTK C;  3L8I A;  3E9V A;  3SXK A;  2LIG A;  2YQY A;  3F47 A;  3H65 A;  2R7R A;  3DWW A;  4HEA J;  4RBN A;  3GWN A;  1MMD A;  5A69 A;  4I1M A;  5F28 E;  3K7D A;  3LS1 A;  3GM3 A;  3T6B A;  3JRT A;  3EG9 B;  1IW7 F;  3NMJ A;  1YYJ A;  2D5R B;  2EPM X;  4AK9 A;  1SMY F;  3IQ5 A;  2G62 A;  1G5Z A;  4H4K C;  2ZXR A;  1MND A;  5B1A C;  2CDQ A;  4EIY A;  5K0I A;  1M2O A;  1T9K A;  1MMG A;  2H7B A;  2XLM A;  1SZI A;  4G7H F;  3GEI A;  3DAG A;  3VRC A;  1AVO B;  3EGX A;  3W2V A;  3JTL O;  4AE4 B;  1BZ4 A;  3ZG1 A;  1OW7 A;  2J9U A;  2J7P A;  2V26 A;  2QY9 A;  2EIK C;  3EZI A;  4BJ5 C;  1M2V B;  1A7D A;  2H7V C;  4N6H A;  1D1A A;  3ZWI A;  5BQH A;  3FVY A;  2I8B A;  1RCP A;  3FMS A;  1C17 M;  3C63 A;  5DS6 A;  1K40 A;  4PJN A;  2XXA A;  2EIL C;  4OD5 A;  5T1D B;  2ZPA A;  1KU2 A;  3VF0 A;  4IRU A;  4Z9I A;  3NKE A;  1YZC A;  2B0J A;  3H2V A;  3U9J A;  3Q7L A;  3R2P A;  1TWG A;  4KNV A;  3EGD A;  3GOR A;  1UFB A;  5E3A A;  2NPU A;  3X2Q C;  5COF A;  4CJG A;  1E86 A;  4MQ9 F;  4G7Z F;  3U2M A;  1Z23 A;  4K1O A;  4JTA B;  4XQ1 A;  1YAU O;  2DI3 A;  4XWJ A;  3N0T A;  4YL0 A;  2KNH A;  2VH3 A;  2WZG A;  2NUP B;  1T6I A;  3GM2 A;  2XLE A;  1CGN A;  1FFT C;  1ZW3 A;  2EIJ C;  3V5X A;  5JS5 A;  1VMA A;  4JEA A;  5E2Q A;  2OKU A;  2HUJ A;  1ZHY A;  2Y3D A;  3TD7 A;  1WAT A;  2FAP B;  5BQI A;  1V74 B;  2Q4F A;  4IAO A;  1RXQ A;  3JSZ A;  4CBE A;  4O6M A;  2VCB A;  3K33 A;  1VOM A;  2LK4 A;  2P0N A;  2YVK A;  3HLZ A;  2M4E A;  3KKB A;  3US6 A;  2GAQ A;  3W2W A;  4AL0 A;  4BEM J;  2P6V A;  4LDR A;  4LLC A;  4JJF A;  3EG9 A;  3O39 A;  3H2U A;  1I4Z A;  1Y6D A;  4BJ5 A;  4WAB A;  2R05 A;  5KYW B;  4OIQ F;  3DM9 B;  4U5B E;  4MTO A;  3X1O A;  2W4B A;  3MX3 A;  3OEO A;  4JTD B;  2WVQ A;  1G4W R;  1LS1 A;  3V5Y A;  2L7A A;  4DVZ A;  1U6H A;  3FOP A;  4IAQ A;  2XLV A;  3GEH A;  2EPO A;  4E7S A;  5HV9 A;  5JRA A;  4BJT A;  5A6B A;  2GFH A;  4YWQ A;  1YA9 A;  3S27 A;  2PBE A;  2GDC A;  3KPH A;  2L9J A;  3MLG A;  3EZH A;  4Z9J A;  4AE4 A;  4Q4Z F;  5JT4 A;  3B0U X;  4ANJ A;  1HMO A;  1TWC A;  2A6H F;  1M2V A;  2HJ3 A;  2KSF A;  4ZLD A;  3FDQ A;  4OIR F;  5BUO A;  1PCX A;  1ZVZ A;  1Q0M A;  3JT1 A;  4I44 A;  4XPX A;  1XWJ A;  3DZA A;  3NMK A;  2CGE A;  4ER9 A;  4ZLC A;  2VAS A;  2DYS C;  2YEV A;  2XLD A;  1PV3 A;  4ONS A;  5FCL A;  1OQC A;  3JSE O;  3V7O A;  1LPE A;  1OR2 A;  1TFK B;  3M1C B;  3K6B A;  3DJN B;  4LLE A;  1D1B A;  3GOD A;  3L8J A;  1NLX A;  3IHU A;  4FWV A;  4NCQ A;  1A7V A;  3SXM A;  4YL3 A;  1RKE B;  3B0P A;  1E83 A;  4YJW A;  4ULV A;  3EHM A;  4D4N A;  2Y39 A;  1LIH A;  1JPJ A;  3ZDL A;  2WL8 A;  3IPM O;  2IYL D;  5BQG A;  4E17 A;  2V3C C;  2EPN A;  3DKA A;  2XXA B;  5AGF A;  2OCC C;  2NUP A;  4I1O B;  2BL2 A;  2KW3 C;  2WZL A;  3UGO A;  2M64 A;  3E70 C;  4EHP A;  1M6T A;  3O6X A;  1UG7 A;  3U8V A;  3VM6 A;  4XPY A;  2HV6 A;  1MNE A;  2JPU A;  3HNK A;  2PNO A;  2J7P D;  1DOW A;  5CI8 A;  3PDM P;  3B0V C;  3EGD B;  1CPQ A;  1WTY A;  2YLG A;  3CZ6 A;  3LNM B;  3RF3 A;  1WAS A;  1NU7 D;  3AGU A;  4DBQ A;  1YZA A;  3MBG A;  5IY5 C;  2Y69 C;  3DE8 A;  3SZR A;  3VAY A;  5HSW A;  1NZE A;  2R9R B;  1YLM A;  4JKV A;  4U5D E;  4FES A;  3AG4 C;  2P61 A;  3R7C A;  1OKK D;  3IQ6 A;  3K1H A;  3FAP B;  1H6G A;  4MTF A;  1VLT A;  4JVS A;  3Q6N A;  4XPW A;  5DS4 A;  2RSE B;  3C62 A;  2YL0 A;  3HNJ A;  2Y3H A;  3OWT A;  3CSK A;  3QTH A;  2AP3 A;  2OG2 A;  1PD0 A;  1ZZP A;  3B29 A;  3SXY A;  3AGT A;  4P9F A;  5L3V A;  2EIN C;  3TK0 A;  5GPG B;  3F46 A;  4BJ1 A;  1FNT c;  4JUR I;  3U0C A;  4F4B A;  3G50 A;  3GWL A;  1G4U S;  2Y3B A;  4CS8 C;  3UNG C;  2GWW A;  1ZU4 A;  2XS1 A;  3L0I A;  2JX0 A;  3SEO A;  3B71 A;  2HS5 A;  3B9Q A;  2XRH A;  3OA1 A;  3RQG A;  1I5N A;  1XZQ A;  1TR2 A;  5KYU B;  1CPR A;  4KNW A;  4JTC B;  3TJ6 A;  2OQM A;  2HMZ A;  2R02 A;  3N24 A;  3JCU Q;  2QNL A;  2YLI A;  1L7C A;  4YT4 A;  5L0F A;  2HZ8 A;  1BDJ B;  256B A;  1NSG B;  1M57 C;  2OEX A;  1ZHT A;  3ABM C;  4XLP F;  3IEE A;  1RKE A;  2KK1 A;  3L1M A;  3W8I A;  3KYJ A;  2Q9B A;  4C3E A;  4N4W A;  4PR9 A;  1O5H A;  4H54 A;  1EKY A;  4IJJ A;  3RVY A;  4CS9 C;  3C18 A;  3JZ0 A;  1E84 A;  5A6B D;  3ITF A;  3M15 A;  5L0D A;  4CDV A;  4AX2 A;  2ZD9 A;  1T5O A;  1BR2 A;  2A0U A;  4EKW A;  1CGM E;  1WWP A;  1H9T A;  3KYI A;  1OKK A;  3RW0 A;  4MND A;  3BRJ A;  4LAC B;  4BJ6 C;  3PCV A;  3W8H A;  5COG A;  2FGY A;  4BJ6 A;  2PX3 A;  2VCA A;  3NG1 A;  4CX9 A;  1SYQ A;  2EIM C;  3JYY A;  4IWB A;  4MS2 A;  2X0C A;  3T4R A;  2A0B A;  1JAF A;  2Q9A A;  3FHD A;  3RIP A;  4E7Z A;  2ZXO A;  1YVI A;  2HSQ A;  1ST6 A;  2ZXP A;  1AEP A;  4MVR A;  5EGY A;  3JRM O;  4JCH A;  1T6U A;  2Z15 A;  1SR2 A;  4CS8 A;  3QMK A;  4GEH A;  2B0H A;  4CS7 A;  3C8G B;  5L0C A;  4PK4 A;  3EJN A;  2MHR A;  3NDB B;  2XL8 A;  5EK0 A;  3TJ5 A;  3C8Z A;  3UMK A;  4CDA A;  2J0W A;  2XLO A;  3ABL C;  1YYX A;  3QVY A;  1ORY A;  2OJQ A;  3LNR A;  5KYN A;  2XL4 A;  4O7G A;  2LP4 A;  4MW3 A;  5A6A A;  3UGP A;  1HW2 A;  1Z3I X;  4FAP B;  1JOG A;  2XM0 A;  2OOC A;  4LER A;  4JIO A;  2A69 F;  1CGO A;  2J0X A;  1TWA A;  2YL7 A;  2OEV A;  1M56 C;  4J32 B;  4CSA C;  2R25 A;  3C8G D;  1NBB A;  1APC A;  2AWC A;  2YRF A;  3IQC A;  4HFK B;  1LKX A;  4RDA A;  4MVZ A;  4BPM A;  2R7U A;  2J9B A;  5KYU A;  4CJO A;  3UMI A;  4CS9 A;  4EWC A;  3LJB A;  3POV A;  1YA7 O;  3EQL F;  4J7Y A;  3T6J A;  3ZTM A;  1ORS C;  1D0X A;  1YDI A;  1J8Y F;  3I4U A;  3KL4 A;  1QKR A;  2VCC A;  4KI2 A;  4CDY A;  3RFY A;  1E2X A;  4L6R A;  1HE9 A;  4A4A A;  3ZIB A;  4O6N A;  3LLK A;  1QPU A;  1W2W A;  1T01 A;  2OJE D;  3LUT B;  4G78 A;  4YT2 A;  2C03 A;  3LLI A;  2I15 A;  4J30 B;  4MVQ A;  4MVM A;  1Z6A A;  4MTG A;  5CIV A;  3AG3 C;  4G7O F;  1ZHX A;  5CI9 A;  3ASN C;  3UMH A;  4NC3 A;  3W4Y A;  1K05 A;  4BEJ A;  3EHN A;  5EHH A;  5E33 A;  1G8X A;  2Q7R A;  4WJ0 A;  1A7E A;  3LES A;  1QZX A;  2QE9 A;  3RYL A;  2XLW A;  4DOZ A;  2GA0 A;  1A41 A;  3FAJ A;  4C7O B;  4RD9 A;  2NUT B;  4QDL A;  1BBH A;  2E87 A;  3T9O A;  5DLJ A;  4BG0 A;  1TKN A;  4KC9 A;  4WGZ A;  2J8W A;  1LS4 A;  1T6Q A;  4N06 A;  3UR3 C;  3PHF 2;  3A9C A;  3EFO A;  3DI5 A;  3ECS A;  3QW0 A;  4GYT A;  1GQA A;  2HSB A;  3GEE A;  4K7B A;  4X0R A;  3N2Z B;  2H8A A;  4U5C E;  1LE4 A;  1OR3 A;  4CSA A;  3NKD A;  4NTF A;  3C8G A;  4QI0 A;  3J06 A;  1ZW2 A;  5JLI A;  3MFN A;  2C04 A;  1QSP A;  4U5H A;  3RVZ A;  3K66 A;  1NFN A;  3M4B A;  3AOU A;  3TUL A;  4O79 A;  3KH2 A;  3RQE A;  1Q0K A;  2WZF A;  3PMR A;  4PFP A;  2R7V A;  1VLS A;  1N1C A;  2XL6 A;  2L6G A;  2LQG A;  1MMA A;  4W8P A;  1OCR C;  1RJ9 A;  1ZHW A;  3U8P A;  3ZSU A;  4DXW A;  3S84 A;  2J45 A;  3NRH A;  2NG1 A;  2R7W A;  2IXM A;  1FTS A;  4W8K A;  1EQ1 A;  2HKV A;  3NYJ A;  1Y4C A;  1OXB A;  3M79 A;  4MVS A;  5B1B C;  1O3U A;  2W45 A;  3U3F A;  2A6E F;  4CIH A;  1OXK A;  3S0X A;  1C02 A;  2FFH A;  3CEX A;  1OCC C;  4NTA A;  5AC5 A;  2PP4 A;  2RD9 A;  4JCZ A;  4JEB A;  3GAN A;  2ETS A;  2P7V A;  4U9D A;  4YL1 A;  2LCH A;  4O6Y A;  3VYW A;  3DMD A;  4NTB A;  4Q7C A;  2TMV P;  1LI7 A;  2DB4 A;  1JMW A;  1Q0D A;  1ZYR F;  4ULW A;  3RKO F;  1HMD A;  1GGQ A;  2KYH A;  3U5S A;  4U9E A;  2KC3 A;  1TWH A;  5KYX B;  2HV7 A;  5T3W A;  1S7Z A;  4DRH B;  2XS8 A;  4C3D A;  2R03 A;  5D91 A;  1LE2 A;  2XSE A;  3C7J A;  2J46 A;  2A1D D;  3ABK C;  2W9Y A;  1QLE C;  3DXJ F;  5F5H A;  3FXH A;  2YL1 A;  1TFO B;  1Q0G A;  4C7O A;  1VYK A;  2DGJ A;  2Q9C A;  2H7O A;  3EH1 A;  2PFD A;  2NUT A;  2J9W A;  5AC4 A;  3WHN A;  3LEV A;  5L0I A;  3Q6M A;  3U9M A;  3G4X A;  2R7T A;  1BR1 A;  2PX0 A;  3JYH A;  1U0B B;  5JVE A;  1JPN A;  2Q3T A;  1Q0F A;  3AG1 C;  2JD3 A;  3Q7G A;  4MW8 A;  4QI2 A;  1EA8 A;  4YT5 A;  5A6K A;  3LEO A;  4EUK B;  2KGO A;  3MYF A;  3NYM A;  1FMV A;  4LDK A;  4AL1 A;  1F1M A;  4JE9 A;  1Z7Q c;  3K1I C;  4NY3 A;  1GS9 A;  2KQ9 A;  4M63 A;  2IXN A;  5L0H A;  4JJG A;  5KYY A;  4IAR A;  2ZXW C;  3HNL A;  1O87 A;  1MQV A;  3EFO B;  5JUA A;  3ZVR A;  2YHS A;  5JSL A;  2WVN A;  2IXP A;  2AWY A;  2XM4 A;  3AQB A;  1QVX A;  2R7S A;  1FR0 A;  2YL3 A;  1XZP A;  4U5F E;  2Y3G A;  5FZT A;  3NYL A;  2L6H A;  4EBK A;  1ZU5 A;  3I5P A;  1FFH A;  2D4U A;  4OIP F;  3G4Z A;  3L34 A;  1I4Y A;  3LS0 A;  3ZC4 A;  1OW8 A;  1K04 A;  2LFF A;  3O55 A;  2XLH A;  3DAF A;  4N6C A;  1RJ9 B;  4XEV A;  3QZC A;  4XEK A;  3NMI A;  2P1A A;  4OIN F;  1MMN A;  1H9G A;  1YAR O;  1OCZ C;  2QLA A;  5KYX A;  4DRI B;  1E85 A;  5DS5 A;  2VB6 A;  2LFD A;  5DQT A;  4DBR A;  2G3K A;  4OD4 A;  1VTM P;  2AVK A;  4KBL A;  1AUE A;  2MYS A;  1WGW A;  4P6I C;  4XEF A;  5T3T A;  4XLN F;  1SF8 A;  4YN0 B;  3TOM A;  3SNH A;  4YT8 A;  4IGG A;  4MVU A;  5L3Q A;  3DD7 A;  2ASR A;  3CAX A;  4U5E E;  3KMI A;  3ASO C;  3WG7 C;  1D0Y A;  3U2L A;  3ZQY A; 
#chains in the Genus database with same CATH homology
 3AJM A;  1ZZP A;  2LK4 A;  2JPU A;  3C8G A;  4R32 A;  3RQF A;  3C18 A;  3JZ0 A;  2L6H A;  3MFN A;  4EBK A;  4EBJ A;  3U0C A;  2Q00 A;  1WTY A;  1V4A A;  2YWA A;  1OW6 A;  1JOG A;  1K04 A;  1OW8 A;  1WWP A;  1KTM A;  3S9O A;  1KNY A;  2JX0 A;  1PV3 A;  4XEK A;  4XEV A;  1UFB A;  3B71 A;  3BRJ A;  2L6F A;  3RQE A;  3RQG A;  3TUL A;  1K05 A;  2L6G A;  3C8G D;  3JYY A;  3L8J A;  3L8I A;  1OW7 A;  3O10 A;  3GM2 A;  4XEF A;  2PBE A;  3U3F A;  1O3U A;  1WOL A;  3GM1 A;  2KK1 A;  1K40 A;  3C8G B;  5F28 E;  2HSB A;  3K7D A;  1QVX A;  3GM3 A;  4NQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...