4YL0A

Crystal structures of mpges-1 inhibitor complexes
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
148
structure length
147
Chain Sequence
SLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prostaglandin E synthase
publication title Crystal Structures of mPGES-1 Inhibitor Complexes Form a Basis for the Rational Design of Potent Analgesic and Anti-Inflammatory Therapeutics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/isomerase inhibitor
total genus 64
structure length 147
sequence length 148
ec nomenclature ec 5.3.99.3: Prostaglandin-E synthase.
pdb deposition date 2015-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4yl0A00
2UUHA 3HKKA 4AL1A 4JCZA 3PCVA 4NTFA 4JC7A 2H8AA 3B29A 5K0IA 2PNOA 4YK5A 3LEOA 4WABA 2Q7RA 4AL0A 4BPMA 4NTBA 4YL1A 5BQIA 5BQGA 4YL3A 4NTAA 4J7YA 4J7TA 3DWWA 4YL0A 4JRZA 5BQHA 5HV9A 2UUIA
chains in the Genus database with same CATH superfamily
1NLXA 1M2VB 1QSPA 2UUHA 3GANA 2LCHA 4WGZA 4CJOA 2ZD9A 2OCCC 1JOGA 3EZHA 3W2VA 3GWNA 1M57C 3IEEA 4C7OA 3EPVA 4U5GA 3AJMA 5L0JA 4U9EA 3IPMO 3L34A 1E84A 1FMVA 2FAPB 2XSEA 3EH2A 3N24A 4G7HF 4JZAA 1M6TA 3DJUB 3SZRA 3UGPA 2P6VA 3FXHA 2Y69C 2YLDA 3B0PA 5DS4A 4LDQA 1VLSA 2PFDA 5B1AC 3NMKA 2X0CA 1JRAA 1T9KA 2EIMC 2P0NA 1U0BB 2E87A 4FX5A 3LUTB 2VCAA 2YL3A 1DOWA 1ST6A 1YYXA 3G50A 3Q7LA 4U9DA 4CIPA 3TJ6A 3S27A 4N6CA 4K0DA 4HFKB 1QKRA 2ZXPA 4AE4B 1EKYA 4HFFB 1KNYA 3U8VA 3H65A 4JE9A 4AK9A 1WTYA 1NBBA 2C04A 3S9OA 1KU2A 2WVQA 4EKWA 3LS1A 4MW3A 1Q0MA 3IQTA 4IB4A 4YN0B 4AL1A 1QQ3A 4XPYA 3H2VA 1CGOA 4N06A 2NUTA 1G5ZA 3NMIA 4YWQA 3S28A 1VTMP 2H7VC 1ZHTA 4XEKA 1Z23A 2IXNA 4JVSA 4J30B 5T3TA 1MMAA 1RKEA 1ZHXA 4WABA 3SXYA 2QY9A 1TWGA 1Q0GA 4IWBA 1OKKD 3N0TA 3TOLA 5L0IA 2R7WA 4YT5A 3UMHA 3JTLO 3C8GD 1OW6A 3EGDB 5DLJA 3QW0A 1R4TA 5EK0A 3ASOC 1FR0A 1K40A 2WZFA 2A6EF 2KK1A 4MS2A 2L6HA 1LM3B 2J9WA 1Y4CA 3FAPB 3HKKA 1K04A 1SMYF 2M4EA 4ZLDA 5A6JA 2R7VA 5JVEA 1EI7A 4XPWA 1CPRA 3U2LA 2KC3A 1G8XA 3ABLC 3ATPA 1SR2A 5CIVA 2FGYA 2A0BA 4MTOA 4CDAA 2YQYA 1OKKA 3LEVA 4E7ZA 3LJBA 2CYDA 4IJJA 1V74B 4G0HA 1M2VA 1M2OA 3C8GA 2WZGA 1MQVA 4J7TA 3U3FA 4XLPF 1VK5A 2KQ9A 2WZLA 2XLOA 3MBGA 4GEHA 3X2QC 5EGYA 3GEEA 3UGOA 4EBJA 2D4UA 4LLCA 1OR2A 3AGUA 1YJGA 2UUIA 3ABMC 3C7JA 256BA 2ETSA 4JURI 2Q9CA 2HUJA 2A1DD 3DKAA 3EHMA 2PBEA 1HE1A 1RKCA 4GYTA 4DRHB 3L0IA 3UMIA 2R7SA 2H8AA 2XM0A 5B3IA 3ZVRA 2XLVA 4I3MA 4K7BA 3WAQA 3T6JA 5JLIA 2HMQA 1YA9A 4JTCB 4AE4A 4JTDB 3MFNA 3M1CB 1OCZC 2VASA 5COGA 4LDKA 4XLNF 3HNKA 4K1OA 3LNRA 5COFA 4NY3A 4CJGA 2RD9A 2MWQA 1BZ4A 4I1MA 4JIOA 3O39A 4N6HA 3W4YA 1JPNA 3C8ZA 3LESA 1BBHA 1UFBA 2YLIA 3K1IA 3EGXA 3A11A 1ZYRF 1Z3IX 2CNWD 1I4ZA 3EHNA 4MVRA 2XS8A 1LI5A 2HJ3A 1PCXA 2Q4FA 1VMAA 4CS9A 5F5FA 2CGEA 4EBBA 3BEHA 3U9MA 2XLEA 3LLIA 3SXZA 1OW8A 1EQ1A 2WVNA 3EG9B 4ZLCA 3EGDA 5L0HA 2Q3TA 5CI8A 3KMIA 4P9TA 4JC7A 3TJ5A 3HJCA 4BJTA 1A41A 3DE9A 5DS5A 2J9VA 5A6BD 1HE9A 2XL8A 4RD9A 4EUKB 4IAOA 4PJMA 2Q7RA 2XL4A 3C63A 3FVYA 3JT1A 3RIPA 3VAYA 4AX2A 3U0CA 2Z15A 3U2MA 4WJ0A 1TWHA 1WN0A 4JJGA 2OKUA 4YL3A 4BG0A 1UG7A 2KNHA 1K05A 3K33A 1LI7A 4L6RA 1TFKB 4N4WA 4PR9A 4U5BE 1E85A 2NUPA 2VH3A 1QLEC 3NKDA 3UMKA 3VRCA 5JP7A 3GORA 2CCYA 3IHUA 3QMKA 4G7ZF 1LVKA 4F4BA 4ANJA 3FMSA 1H6GA 1ORJA 2CNWA 2KGOA 3S0XA 1AVOB 3ITFA 1WOLA 1ZW2A 4Z9HA 2DYRC 3TK0A 1WWPA 1D1CA 1FTSA 1ORYA 4G78A 3W8HA 3ZSUA 2YHSA 4BJ1A 5AC5A 2XXAB 4JTAB 2OQMA 3NRHA 1TKNA 3MYFA 4YT2A 2R9RB 5L0DA 1NU9C 1T5OA 2H7BA 3DE8A 4EIYA 2ASRA 3KYJA 2EPMX 2R7UA 1YAUO 2QNLA 3WG7C 1IW7F 3TULA 5KYUB 1V55C 1XZPA 4MVOA 4QI2A 1J8MF 2O9XA 2IOQA 2XLMA 3T4RA 1BR4A 3T6GB 4P9FA 5DQZA 2EPNA 3EJNA 4NC3A 2W4MA 4NTAA 2AP3A 1OXBA 2NG1A 2KYHA 3HTKC 2JD3A 3LLKA 1A7DA 2A68F 1OCCC 2AVKA 2G3KA 2BL2A 2OOCA 1MMGA 2VB6A 4KI2A 4LDRA 2A6HF 1O5HA 1YYJA 2QUPA 1JPJA 1BR2A 1LE2A 3HNLA 3JZ0A 1YVIA 1LKXA 2NPUA 1Y6DA 3B71A 3F47A 1W2WA 1FFHA 1CPQA 3LAYA 4HE8D 3ECSA 4DJ9A 1SF8A 4IARA 1KTMA 3RYLA 1XZQA 3ABKC 2GA0A 4A4AA 3FDQA 3SEOA 3MYIA 2XM4A 2HFIA 1MMNA 3WHNA 4O7GA 4I44A 3S90A 4MVQA 1LPEA 1OCRC 2GFHA 2J9UA 5BQGA 5JT4A 3T6BA 3VF0A 4W8KA 3A9CA 3GODA 2ZXRA 4CS8A 3GM3A 4CS7A 3E70C 3MX3A 3DZAA 1F1MA 2VC9A 4Z9JA 3NG1A 2VCCA 5AGFA 4MVSA 5HV9A 1BDJB 1MMDA 3SXMA 3AG2C 2WL8A 4MVZA 4O6YA 2F22A 5FCLA 3EZIA 3GEIA 5A6KA 2HSQA 4G7OF 4PJLA 2HJMA 3RQGA 3Q7GA 2C03A 2LSEA 1JR8A 1T6UA 3ZIBA 4E0HA 3JYHA 3LS0A 4OIRF 1Z6AA 1HW1A 4C3EA 4DRJB 1Q0KA 1C02A 4YT4A 5L0CA 1Z7Qc 3W8IA 4ULWA 1ORSC 5KYWA 4KC9A 1S7ZA 1T6QA 3W2WA 1MNEA 4OIPF 2KW3C 1S05A 4CDYA 1BR1A 5B3SC 2XXAA 5DS6A 1R5ID 1NFNA 4JEAA 1CGME 1LS4A 3CEXA 4MW8A 3FOPA 4QDLA 4ONSA 4A2NB 5KYUA 2RSEB 2Y39A 1ZW3A 4Z9IA 2R03A 3T9OA 3CQZA 2TMVP 2EIKC 2G3VA 3FAJA 5DVWA 3E9VA 1O87A 5E33A 3HLZA 3V5ZA 4RBNA 2Y3GA 1G4US 2GDCA 4U5CE 5KYYB 3U9JA 4IAQA 3IQCA 4JJFA 3K1IC 3S84A 1A0BA 2QLAA 2W4BA 2PNOA 2ZPAA 1AEPA 4MVMA 2R25A 4CS9C 3ZWIA 3CSKA 1MNDA 4BJ6C 1VYIA 2XS1A 5D92A 5JSLA 4CDVA 2G62A 1C03A 1YZAA 2Y3DA 2IM8A 2WVOA 4ULVA 4PACA 3ZTMA 4BEJA 4DRIB 3SYNA 2ICWG 3IQ5A 1PV3A 1HMOA 1WASA 3O6XA 4JRZA 4PFPA 4YJWA 2X51A 2HV6A 3QTHA 4DBQA 2YEVA 2LP4A 3OWTA 1D1AA 1VYKA 2Y3BA 3KYIA 3M4CA 3M4BA 1JMWA 3O10A 4MTFA 2GAQA 3AQCA 4BJ6A 5JS5A 1PD1A 3S29A 2L9JA 3RH3A 2LFDA 3AG3C 1T01A 1JAFA 2HV7A 2L81A 3POVA 2CW0F 3GM2A 2LK4A 2IBFA 4XQ1A 2AWYA 5E3CA 3NDBB 4LACB 1D0XA 3Q6NA 3LEOA 3K66A 3C18A 3DM5A 3I4UA 3NYJA 3M79A 4YL1A 3L8IA 3M15A 1WGWA 4E0IA 2HS5A 3NMJA 4PFOA 2XLDA 2KSFA 3V5XA 4D4NA 4H4KC 1L7CA 4YL0A 2P61A 3QVZA 1RKEB 4B6IA 3MLGA 1SYQA 3JCUQ 3EFOB 3RVZA 3ZQVA 5BQHA 1OR3A 1YZCA 4JW1A 2YWAA 3BRJA 2J46A 1I5NA 4IRUA 2LIGA 3SP1A 2OJQA 2Q00A 4PJNA 2J0WA 3AG1C 3B0VC 2XRHA 5AC4A 4FWVA 4JCZA 1U6HA 1IZMA 3WODF 1TR2A 2OG2A 3KH2A 4XWJA 3ZG1A 5T3WA 1VOMA 4XEFA 3TOMA 4C3DA 5A6BA 1A7VA 2R7QA 1C17M 2AWCA 2MHRA 3HNJA 1RCPA 3DAGA 1QPUA 3GM1A 4H54A 4XPXA 1GM5A 3F46A 4J7YA 2HZ8A 1OW7A 2JPUA 2W45A 3IQ6A 3V7OA 2V26A 4M63A 2OJED 4DVYP 3K6BA 2IXOA 4DOZA 4FESA 2YKZA 3DI5A 3I5PA 2JX0A 3C8GB 3N2ZB 1HMDA 5IY5C 4JKVA 1G4WR 1RJ9B 1LIHA 3JRTA 3DM9B 3RW0A 2IYLD 3H2UA 2M64A 3DAFA 4OIOF 2V3CC 4CS8C 3PCVA 4NTFA 2YL0A 4U5HA 4IGGA 2NSGA 5KYNA 1Z5ZA 1NSGB 2P7VA 1FNTc 2LQGA 3AOUA 3CAXA 1TWAA 3R7CA 3U8PA 4NTBA 2P1AA 2ZXOA 3PDMP 3ZTZA 2A0UA 2CDQA 5L0GA 5TJ5E 4XEVA 1TQGA 4E18A 4DBRA 2L6FA 3J06A 4CX9A 2W9YA 2YL7A 3Q6MA 1ZHZA 2R02A 1H9GA 3EG9A 3R2PA 5DQTA 4EBKA 4EHPA 1T6IA 2YZSA 5T1DB 2GWWA 3B9QA 1V4AA 2J8WA 4MQ9F 3QZCA 1YARO 2OEXA 4CSAA 3EH1A 4PJJA 4JCHA 1VLTA 1GQAA 2WB7A 4X0RA 3RFYA 5KYXB 4BEMJ 3JYYA 2I8BA 3RF3A 2ZXWC 5CI9A 3EGXB 1D0ZA 4XTKA 5FZTA 4Q4ZF 1NU7D 3I5QA 3U5SA 5L0FA 1V54C 3JRMO 2HKVA 2YLGA 3QVYA 4CBEA 5K0IA 3G4XA 3FHDA 3EFOA 3JSEO 1VB5A 2J0XA 4U5EE 4R32A 4KNWA 3DJNB 3ZDLA 5BQIA 3LNMB 5GPGB 2DGJA 1Q0FA 1FMWA 2LFFA 1TFOB 3DMDA 4QI0A 3ZQYA 4BJ5C 1ZU5A 2AU5A 2IXPA 2PF4E 3PHF2 2L7AA 2R7RA 5D91A 2BE5F 3L8JA 5B1BC 2R05A 4WGYA 4JEBA 3SNHA 2J45A 2PX3A 2Y3HA 3CZ6A 4O6NA 2B0HA 5A69A 1Z63A 2R7OA 2NUPB 1H9TA 1E86A 4D4XA 1RMVA 1EA8A 1OCOC 1XWJA 5F5HA 4PK4A 2Q9BA 3TQOA 1H7IA 2J9BA 1FAPB 3ZC4A 4BJ5A 3FOOA 1M56C 5HSWA 4O6MA 2OEVA 2LD6A 4GQHA 1APCA 3NKEA 2BC5A 1D1BA 3TD7A 4RDAA 1B68A 3KPHA 3UR3C 3KKBA 1DOVA 1YA7O 4W8PA 1J8YF 5JUAA 3G4ZA 2DYSC 2MYSA 3GEHA 3AGTA 2QE9A 3PMRA 2R7TA 1LE4A 4C7OB 1AUEA 1OQCA 1RJ9A 2EIJC 2OU6A 2J7PD 3ASNC 2QTVA 2R7XA 2IXMA 2NSFA 1RXQA 2XLWA 3C62A 3JSZA 1NZEA 4O79A 1NG1A 1ZVZA 2XLHA 4MNDA 1YLMA 1LS1A 2HSBA 4OD4A 4Q7CA 5E2QA 3OA1A 4Q5SF 3HNIA 5EHHA 2H7OA 1E83A 4P6IC 4UDVA 4LLEA 1WATA 3RQEA 1ZHWA 3RQFA 5A6AA 3DXJF 2D5RB 1E2XA 1GS9A 3B29A 3O55A 1A7EA 1ZU4A 3DD7A 2YRFA 4MVUA 4KBLA 1NFOA 1OXKA 3QW1A 3OEOA 5JRAA 4NCQA 1HW2A 4BPMA 4I1OB 4U5DE 4J32B 3U3BA 3NYMA 4CIHA 1PD0A 2NUTB 2I15A 5L3QA 4EWCA 2YVKA 3DWWA 5KYXA 2J7PA 2HMZA 2EILC 1YDIA 4DVZA 5F28E 3K1HA 4E17A 1CGNA 1QVXA 1HY5A 1U89A 1ZHYA 3AG4C 4LERA 5BUOA 5E3AA 4HEAJ 2EINC 4CSAC 4OIQF 4MTGA 1ZZPA 1Q0DA 3KL4A 3NYLA 3US6A 3EQLF 3SXKA 4KNVA 5L3VA 2EPOA 2KJGA 2L6GA 3GWLA 4YT8A 2EPLX 4E7SA 2VCBA 1FFTC 3K7DA 3V5YA 1D0YA 4FAPB 4NQFA 3X1OA 3L1MA 4OD5A 4YK5A 2XL6A 4C3BA 5COMA 4AL0A 1O3UA 2DI3A 2DB4A 1TWCA 2PX0A 1L3PA 2FFHA 2Q9AA 4DXWA 3AQBA 3UNGC 4ER9A 1QZXA 2A69F 2EPKX 1N1CA 3RKOF 3VYWA 1I4YA 4OINF 3B0UX 2YL1A 2B0JA 1GGQA 4U5FE 3RVYA 5KYYA 5KYWB 1SZIA 2PP4A 3VM6A
chains in the Genus database with same CATH topology
2UUHA 3HKKA 4AL1A 4JCZA 3PCVA 4NTFA 4JC7A 2H8AA 3B29A 5K0IA 2PNOA 4YK5A 3LEOA 4WABA 2Q7RA 4AL0A 4BPMA 4NTBA 4YL1A 5BQIA 5BQGA 4YL3A 4NTAA 4J7YA 4J7TA 3DWWA 4YL0A 4JRZA 5BQHA 5HV9A 2UUIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUH A;  3HKK A;  4AL1 A;  4JCZ A;  3PCV A;  4NTF A;  4JC7 A;  2H8A A;  3B29 A;  5K0I A;  2PNO A;  4YK5 A;  3LEO A;  4WAB A;  2Q7R A;  4AL0 A;  4BPM A;  4NTB A;  4YL1 A;  5BQI A;  5BQG A;  4YL3 A;  4NTA A;  4J7Y A;  4J7T A;  3DWW A;  4YL0 A;  4JRZ A;  5BQH A;  5HV9 A;  2UUI A; 
#chains in the Genus database with same CATH topology
 1NLX A;  1M2V B;  1QSP A;  2UUH A;  3GAN A;  2LCH A;  4WGZ A;  4CJO A;  2ZD9 A;  2OCC C;  1JOG A;  3EZH A;  3W2V A;  3GWN A;  1M57 C;  3IEE A;  4C7O A;  3EPV A;  4U5G A;  3AJM A;  5L0J A;  4U9E A;  3IPM O;  3L34 A;  1E84 A;  1FMV A;  2FAP B;  2XSE A;  3EH2 A;  3N24 A;  4G7H F;  4JZA A;  1M6T A;  3DJU B;  3SZR A;  3UGP A;  2P6V A;  3FXH A;  2Y69 C;  2YLD A;  3B0P A;  5DS4 A;  4LDQ A;  1VLS A;  2PFD A;  5B1A C;  3NMK A;  2X0C A;  1JRA A;  1T9K A;  2EIM C;  2P0N A;  1U0B B;  2E87 A;  4FX5 A;  3LUT B;  2VCA A;  2YL3 A;  1DOW A;  1ST6 A;  1YYX A;  3G50 A;  3Q7L A;  4U9D A;  4CIP A;  3TJ6 A;  3S27 A;  4N6C A;  4K0D A;  4HFK B;  1QKR A;  2ZXP A;  4AE4 B;  1EKY A;  4HFF B;  1KNY A;  3U8V A;  3H65 A;  4JE9 A;  4AK9 A;  1WTY A;  1NBB A;  2C04 A;  3S9O A;  1KU2 A;  2WVQ A;  4EKW A;  3LS1 A;  4MW3 A;  1Q0M A;  3IQT A;  4IB4 A;  4YN0 B;  4AL1 A;  1QQ3 A;  4XPY A;  3H2V A;  1CGO A;  4N06 A;  2NUT A;  1G5Z A;  3NMI A;  4YWQ A;  3S28 A;  1VTM P;  2H7V C;  1ZHT A;  4XEK A;  1Z23 A;  2IXN A;  4JVS A;  4J30 B;  5T3T A;  1MMA A;  1RKE A;  1ZHX A;  4WAB A;  3SXY A;  2QY9 A;  1TWG A;  1Q0G A;  4IWB A;  1OKK D;  3N0T A;  3TOL A;  5L0I A;  2R7W A;  4YT5 A;  3UMH A;  3JTL O;  3C8G D;  1OW6 A;  3EGD B;  5DLJ A;  3QW0 A;  1R4T A;  5EK0 A;  3ASO C;  1FR0 A;  1K40 A;  2WZF A;  2A6E F;  2KK1 A;  4MS2 A;  2L6H A;  1LM3 B;  2J9W A;  1Y4C A;  3FAP B;  3HKK A;  1K04 A;  1SMY F;  2M4E A;  4ZLD A;  5A6J A;  2R7V A;  5JVE A;  1EI7 A;  4XPW A;  1CPR A;  3U2L A;  2KC3 A;  1G8X A;  3ABL C;  3ATP A;  1SR2 A;  5CIV A;  2FGY A;  2A0B A;  4MTO A;  4CDA A;  2YQY A;  1OKK A;  3LEV A;  4E7Z A;  3LJB A;  2CYD A;  4IJJ A;  1V74 B;  4G0H A;  1M2V A;  1M2O A;  3C8G A;  2WZG A;  1MQV A;  4J7T A;  3U3F A;  4XLP F;  1VK5 A;  2KQ9 A;  2WZL A;  2XLO A;  3MBG A;  4GEH A;  3X2Q C;  5EGY A;  3GEE A;  3UGO A;  4EBJ A;  2D4U A;  4LLC A;  1OR2 A;  3AGU A;  1YJG A;  2UUI A;  3ABM C;  3C7J A;  256B A;  2ETS A;  4JUR I;  2Q9C A;  2HUJ A;  2A1D D;  3DKA A;  3EHM A;  2PBE A;  1HE1 A;  1RKC A;  4GYT A;  4DRH B;  3L0I A;  3UMI A;  2R7S A;  2H8A A;  2XM0 A;  5B3I A;  3ZVR A;  2XLV A;  4I3M A;  4K7B A;  3WAQ A;  3T6J A;  5JLI A;  2HMQ A;  1YA9 A;  4JTC B;  4AE4 A;  4JTD B;  3MFN A;  3M1C B;  1OCZ C;  2VAS A;  5COG A;  4LDK A;  4XLN F;  3HNK A;  4K1O A;  3LNR A;  5COF A;  4NY3 A;  4CJG A;  2RD9 A;  2MWQ A;  1BZ4 A;  4I1M A;  4JIO A;  3O39 A;  4N6H A;  3W4Y A;  1JPN A;  3C8Z A;  3LES A;  1BBH A;  1UFB A;  2YLI A;  3K1I A;  3EGX A;  3A11 A;  1ZYR F;  1Z3I X;  2CNW D;  1I4Z A;  3EHN A;  4MVR A;  2XS8 A;  1LI5 A;  2HJ3 A;  1PCX A;  2Q4F A;  1VMA A;  4CS9 A;  5F5F A;  2CGE A;  4EBB A;  3BEH A;  3U9M A;  2XLE A;  3LLI A;  3SXZ A;  1OW8 A;  1EQ1 A;  2WVN A;  3EG9 B;  4ZLC A;  3EGD A;  5L0H A;  2Q3T A;  5CI8 A;  3KMI A;  4P9T A;  4JC7 A;  3TJ5 A;  3HJC A;  4BJT A;  1A41 A;  3DE9 A;  5DS5 A;  2J9V A;  5A6B D;  1HE9 A;  2XL8 A;  4RD9 A;  4EUK B;  4IAO A;  4PJM A;  2Q7R A;  2XL4 A;  3C63 A;  3FVY A;  3JT1 A;  3RIP A;  3VAY A;  4AX2 A;  3U0C A;  2Z15 A;  3U2M A;  4WJ0 A;  1TWH A;  1WN0 A;  4JJG A;  2OKU A;  4YL3 A;  4BG0 A;  1UG7 A;  2KNH A;  1K05 A;  3K33 A;  1LI7 A;  4L6R A;  1TFK B;  4N4W A;  4PR9 A;  4U5B E;  1E85 A;  2NUP A;  2VH3 A;  1QLE C;  3NKD A;  3UMK A;  3VRC A;  5JP7 A;  3GOR A;  2CCY A;  3IHU A;  3QMK A;  4G7Z F;  1LVK A;  4F4B A;  4ANJ A;  3FMS A;  1H6G A;  1ORJ A;  2CNW A;  2KGO A;  3S0X A;  1AVO B;  3ITF A;  1WOL A;  1ZW2 A;  4Z9H A;  2DYR C;  3TK0 A;  1WWP A;  1D1C A;  1FTS A;  1ORY A;  4G78 A;  3W8H A;  3ZSU A;  2YHS A;  4BJ1 A;  5AC5 A;  2XXA B;  4JTA B;  2OQM A;  3NRH A;  1TKN A;  3MYF A;  4YT2 A;  2R9R B;  5L0D A;  1NU9 C;  1T5O A;  2H7B A;  3DE8 A;  4EIY A;  2ASR A;  3KYJ A;  2EPM X;  2R7U A;  1YAU O;  2QNL A;  3WG7 C;  1IW7 F;  3TUL A;  5KYU B;  1V55 C;  1XZP A;  4MVO A;  4QI2 A;  1J8M F;  2O9X A;  2IOQ A;  2XLM A;  3T4R A;  1BR4 A;  3T6G B;  4P9F A;  5DQZ A;  2EPN A;  3EJN A;  4NC3 A;  2W4M A;  4NTA A;  2AP3 A;  1OXB A;  2NG1 A;  2KYH A;  3HTK C;  2JD3 A;  3LLK A;  1A7D A;  2A68 F;  1OCC C;  2AVK A;  2G3K A;  2BL2 A;  2OOC A;  1MMG A;  2VB6 A;  4KI2 A;  4LDR A;  2A6H F;  1O5H A;  1YYJ A;  2QUP A;  1JPJ A;  1BR2 A;  1LE2 A;  3HNL A;  3JZ0 A;  1YVI A;  1LKX A;  2NPU A;  1Y6D A;  3B71 A;  3F47 A;  1W2W A;  1FFH A;  1CPQ A;  3LAY A;  4HE8 D;  3ECS A;  4DJ9 A;  1SF8 A;  4IAR A;  1KTM A;  3RYL A;  1XZQ A;  3ABK C;  2GA0 A;  4A4A A;  3FDQ A;  3SEO A;  3MYI A;  2XM4 A;  2HFI A;  1MMN A;  3WHN A;  4O7G A;  4I44 A;  3S90 A;  4MVQ A;  1LPE A;  1OCR C;  2GFH A;  2J9U A;  5BQG A;  5JT4 A;  3T6B A;  3VF0 A;  4W8K A;  3A9C A;  3GOD A;  2ZXR A;  4CS8 A;  3GM3 A;  4CS7 A;  3E70 C;  3MX3 A;  3DZA A;  1F1M A;  2VC9 A;  4Z9J A;  3NG1 A;  2VCC A;  5AGF A;  4MVS A;  5HV9 A;  1BDJ B;  1MMD A;  3SXM A;  3AG2 C;  2WL8 A;  4MVZ A;  4O6Y A;  2F22 A;  5FCL A;  3EZI A;  3GEI A;  5A6K A;  2HSQ A;  4G7O F;  4PJL A;  2HJM A;  3RQG A;  3Q7G A;  2C03 A;  2LSE A;  1JR8 A;  1T6U A;  3ZIB A;  4E0H A;  3JYH A;  3LS0 A;  4OIR F;  1Z6A A;  1HW1 A;  4C3E A;  4DRJ B;  1Q0K A;  1C02 A;  4YT4 A;  5L0C A;  1Z7Q c;  3W8I A;  4ULW A;  1ORS C;  5KYW A;  4KC9 A;  1S7Z A;  1T6Q A;  3W2W A;  1MNE A;  4OIP F;  2KW3 C;  1S05 A;  4CDY A;  1BR1 A;  5B3S C;  2XXA A;  5DS6 A;  1R5I D;  1NFN A;  4JEA A;  1CGM E;  1LS4 A;  3CEX A;  4MW8 A;  3FOP A;  4QDL A;  4ONS A;  4A2N B;  5KYU A;  2RSE B;  2Y39 A;  1ZW3 A;  4Z9I A;  2R03 A;  3T9O A;  3CQZ A;  2TMV P;  2EIK C;  2G3V A;  3FAJ A;  5DVW A;  3E9V A;  1O87 A;  5E33 A;  3HLZ A;  3V5Z A;  4RBN A;  2Y3G A;  1G4U S;  2GDC A;  4U5C E;  5KYY B;  3U9J A;  4IAQ A;  3IQC A;  4JJF A;  3K1I C;  3S84 A;  1A0B A;  2QLA A;  2W4B A;  2PNO A;  2ZPA A;  1AEP A;  4MVM A;  2R25 A;  4CS9 C;  3ZWI A;  3CSK A;  1MND A;  4BJ6 C;  1VYI A;  2XS1 A;  5D92 A;  5JSL A;  4CDV A;  2G62 A;  1C03 A;  1YZA A;  2Y3D A;  2IM8 A;  2WVO A;  4ULV A;  4PAC A;  3ZTM A;  4BEJ A;  4DRI B;  3SYN A;  2ICW G;  3IQ5 A;  1PV3 A;  1HMO A;  1WAS A;  3O6X A;  4JRZ A;  4PFP A;  4YJW A;  2X51 A;  2HV6 A;  3QTH A;  4DBQ A;  2YEV A;  2LP4 A;  3OWT A;  1D1A A;  1VYK A;  2Y3B A;  3KYI A;  3M4C A;  3M4B A;  1JMW A;  3O10 A;  4MTF A;  2GAQ A;  3AQC A;  4BJ6 A;  5JS5 A;  1PD1 A;  3S29 A;  2L9J A;  3RH3 A;  2LFD A;  3AG3 C;  1T01 A;  1JAF A;  2HV7 A;  2L81 A;  3POV A;  2CW0 F;  3GM2 A;  2LK4 A;  2IBF A;  4XQ1 A;  2AWY A;  5E3C A;  3NDB B;  4LAC B;  1D0X A;  3Q6N A;  3LEO A;  3K66 A;  3C18 A;  3DM5 A;  3I4U A;  3NYJ A;  3M79 A;  4YL1 A;  3L8I A;  3M15 A;  1WGW A;  4E0I A;  2HS5 A;  3NMJ A;  4PFO A;  2XLD A;  2KSF A;  3V5X A;  4D4N A;  4H4K C;  1L7C A;  4YL0 A;  2P61 A;  3QVZ A;  1RKE B;  4B6I A;  3MLG A;  1SYQ A;  3JCU Q;  3EFO B;  3RVZ A;  3ZQV A;  5BQH A;  1OR3 A;  1YZC A;  4JW1 A;  2YWA A;  3BRJ A;  2J46 A;  1I5N A;  4IRU A;  2LIG A;  3SP1 A;  2OJQ A;  2Q00 A;  4PJN A;  2J0W A;  3AG1 C;  3B0V C;  2XRH A;  5AC4 A;  4FWV A;  4JCZ A;  1U6H A;  1IZM A;  3WOD F;  1TR2 A;  2OG2 A;  3KH2 A;  4XWJ A;  3ZG1 A;  5T3W A;  1VOM A;  4XEF A;  3TOM A;  4C3D A;  5A6B A;  1A7V A;  2R7Q A;  1C17 M;  2AWC A;  2MHR A;  3HNJ A;  1RCP A;  3DAG A;  1QPU A;  3GM1 A;  4H54 A;  4XPX A;  1GM5 A;  3F46 A;  4J7Y A;  2HZ8 A;  1OW7 A;  2JPU A;  2W45 A;  3IQ6 A;  3V7O A;  2V26 A;  4M63 A;  2OJE D;  4DVY P;  3K6B A;  2IXO A;  4DOZ A;  4FES A;  2YKZ A;  3DI5 A;  3I5P A;  2JX0 A;  3C8G B;  3N2Z B;  1HMD A;  5IY5 C;  4JKV A;  1G4W R;  1RJ9 B;  1LIH A;  3JRT A;  3DM9 B;  3RW0 A;  2IYL D;  3H2U A;  2M64 A;  3DAF A;  4OIO F;  2V3C C;  4CS8 C;  3PCV A;  4NTF A;  2YL0 A;  4U5H A;  4IGG A;  2NSG A;  5KYN A;  1Z5Z A;  1NSG B;  2P7V A;  1FNT c;  2LQG A;  3AOU A;  3CAX A;  1TWA A;  3R7C A;  3U8P A;  4NTB A;  2P1A A;  2ZXO A;  3PDM P;  3ZTZ A;  2A0U A;  2CDQ A;  5L0G A;  5TJ5 E;  4XEV A;  1TQG A;  4E18 A;  4DBR A;  2L6F A;  3J06 A;  4CX9 A;  2W9Y A;  2YL7 A;  3Q6M A;  1ZHZ A;  2R02 A;  1H9G A;  3EG9 A;  3R2P A;  5DQT A;  4EBK A;  4EHP A;  1T6I A;  2YZS A;  5T1D B;  2GWW A;  3B9Q A;  1V4A A;  2J8W A;  4MQ9 F;  3QZC A;  1YAR O;  2OEX A;  4CSA A;  3EH1 A;  4PJJ A;  4JCH A;  1VLT A;  1GQA A;  2WB7 A;  4X0R A;  3RFY A;  5KYX B;  4BEM J;  3JYY A;  2I8B A;  3RF3 A;  2ZXW C;  5CI9 A;  3EGX B;  1D0Z A;  4XTK A;  5FZT A;  4Q4Z F;  1NU7 D;  3I5Q A;  3U5S A;  5L0F A;  1V54 C;  3JRM O;  2HKV A;  2YLG A;  3QVY A;  4CBE A;  5K0I A;  3G4X A;  3FHD A;  3EFO A;  3JSE O;  1VB5 A;  2J0X A;  4U5E E;  4R32 A;  4KNW A;  3DJN B;  3ZDL A;  5BQI A;  3LNM B;  5GPG B;  2DGJ A;  1Q0F A;  1FMW A;  2LFF A;  1TFO B;  3DMD A;  4QI0 A;  3ZQY A;  4BJ5 C;  1ZU5 A;  2AU5 A;  2IXP A;  2PF4 E;  3PHF 2;  2L7A A;  2R7R A;  5D91 A;  2BE5 F;  3L8J A;  5B1B C;  2R05 A;  4WGY A;  4JEB A;  3SNH A;  2J45 A;  2PX3 A;  2Y3H A;  3CZ6 A;  4O6N A;  2B0H A;  5A69 A;  1Z63 A;  2R7O A;  2NUP B;  1H9T A;  1E86 A;  4D4X A;  1RMV A;  1EA8 A;  1OCO C;  1XWJ A;  5F5H A;  4PK4 A;  2Q9B A;  3TQO A;  1H7I A;  2J9B A;  1FAP B;  3ZC4 A;  4BJ5 A;  3FOO A;  1M56 C;  5HSW A;  4O6M A;  2OEV A;  2LD6 A;  4GQH A;  1APC A;  3NKE A;  2BC5 A;  1D1B A;  3TD7 A;  4RDA A;  1B68 A;  3KPH A;  3UR3 C;  3KKB A;  1DOV A;  1YA7 O;  4W8P A;  1J8Y F;  5JUA A;  3G4Z A;  2DYS C;  2MYS A;  3GEH A;  3AGT A;  2QE9 A;  3PMR A;  2R7T A;  1LE4 A;  4C7O B;  1AUE A;  1OQC A;  1RJ9 A;  2EIJ C;  2OU6 A;  2J7P D;  3ASN C;  2QTV A;  2R7X A;  2IXM A;  2NSF A;  1RXQ A;  2XLW A;  3C62 A;  3JSZ A;  1NZE A;  4O79 A;  1NG1 A;  1ZVZ A;  2XLH A;  4MND A;  1YLM A;  1LS1 A;  2HSB A;  4OD4 A;  4Q7C A;  5E2Q A;  3OA1 A;  4Q5S F;  3HNI A;  5EHH A;  2H7O A;  1E83 A;  4P6I C;  4UDV A;  4LLE A;  1WAT A;  3RQE A;  1ZHW A;  3RQF A;  5A6A A;  3DXJ F;  2D5R B;  1E2X A;  1GS9 A;  3B29 A;  3O55 A;  1A7E A;  1ZU4 A;  3DD7 A;  2YRF A;  4MVU A;  4KBL A;  1NFO A;  1OXK A;  3QW1 A;  3OEO A;  5JRA A;  4NCQ A;  1HW2 A;  4BPM A;  4I1O B;  4U5D E;  4J32 B;  3U3B A;  3NYM A;  4CIH A;  1PD0 A;  2NUT B;  2I15 A;  5L3Q A;  4EWC A;  2YVK A;  3DWW A;  5KYX A;  2J7P A;  2HMZ A;  2EIL C;  1YDI A;  4DVZ A;  5F28 E;  3K1H A;  4E17 A;  1CGN A;  1QVX A;  1HY5 A;  1U89 A;  1ZHY A;  3AG4 C;  4LER A;  5BUO A;  5E3A A;  4HEA J;  2EIN C;  4CSA C;  4OIQ F;  4MTG A;  1ZZP A;  1Q0D A;  3KL4 A;  3NYL A;  3US6 A;  3EQL F;  3SXK A;  4KNV A;  5L3V A;  2EPO A;  2KJG A;  2L6G A;  3GWL A;  4YT8 A;  2EPL X;  4E7S A;  2VCB A;  1FFT C;  3K7D A;  3V5Y A;  1D0Y A;  4FAP B;  4NQF A;  3X1O A;  3L1M A;  4OD5 A;  4YK5 A;  2XL6 A;  4C3B A;  5COM A;  4AL0 A;  1O3U A;  2DI3 A;  2DB4 A;  1TWC A;  2PX0 A;  1L3P A;  2FFH A;  2Q9A A;  4DXW A;  3AQB A;  3UNG C;  4ER9 A;  1QZX A;  2A69 F;  2EPK X;  1N1C A;  3RKO F;  3VYW A;  1I4Y A;  4OIN F;  3B0U X;  2YL1 A;  2B0J A;  1GGQ A;  4U5F E;  3RVY A;  5KYY A;  5KYW B;  1SZI A;  2PP4 A;  3VM6 A; 
#chains in the Genus database with same CATH homology
 2UUH A;  3HKK A;  4AL1 A;  4JCZ A;  3PCV A;  4NTF A;  4JC7 A;  2H8A A;  3B29 A;  5K0I A;  2PNO A;  4YK5 A;  3LEO A;  4WAB A;  2Q7R A;  4AL0 A;  4BPM A;  4NTB A;  4YL1 A;  5BQI A;  5BQG A;  4YL3 A;  4NTA A;  4J7Y A;  4J7T A;  3DWW A;  4YL0 A;  4JRZ A;  5BQH A;  5HV9 A;  2UUI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...