2YWAA

Crystal structure of uncharacterized conserved protein from thermus thermophilus hb8
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
115
structure length
115
Chain Sequence
ASLARAVERLKAALERPKDEFIRDSAIQRFEFTFELAWKTLKTFLELQGLEARSPRAAIRGAFQVGLLPEDPFWLEMLELRNLTNHTYDEALAERIYAELPKALERFQELLRRLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of uncharacterized conserved protein from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein TTHA0048
total genus 41
structure length 115
sequence length 115
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08780 NTase_sub_bind Nucleotidyltransferase substrate binding protein like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 2ywaA00
3C8GB 1PV3A 1O3UA 4R32A 3B71A 3JZ0A 3BRJA 3RQEA 2PBEA 3S9OA 1V4AA 3C18A 2LK4A 3GM1A 1KTMA 3L8JA 1ZZPA 1KNYA 3JYYA 2L6FA 3RQGA 1OW7A 3U0CA 4NQFA 4EBKA 1K05A 2Q00A 1K40A 2L6GA 2KK1A 4XEFA 3GM2A 1WOLA 1QVXA 2JX0A 1WWPA 3O10A 1WTYA 1OW8A 2YWAA 1K04A 3RQFA 1OW6A 3TULA 2JPUA 1UFBA 3C8GA 1JOGA 3C8GD 3MFNA 4XEVA 3U3FA 4EBJA 3L8IA 3GM3A 2HSBA 2L6HA 5F28E 3AJMA 3K7DA 4XEKA
chains in the Genus database with same CATH superfamily
3UMKA 3CSKA 3F47A 4FX5A 4ONSA 3V5YA 1HMOA 3C18A 3OWTA 3DE9A 4JTDB 3B0PA 3SZRA 4CX9A 2YEVA 3NMKA 5E33A 2L7AA 3JT1A 1MNDA 1YLMA 1D0YA 3L34A 4Q4ZF 1U6HA 3Q7LA 3TOMA 3U3BA 4MW3A 4BJ5A 1Q0KA 4ULWA 2R7XA 2RSEB 2A6EF 4LLEA 3GEHA 1ZHYA 3KKBA 4IWBA 2BE5F 4DBQA 2R7WA 2UUIA 5L0CA 1M56C 4K0DA 3N0TA 1GS9A 1A7EA 4QDLA 3TULA 1QLEC 4KBLA 1MMDA 2J45A 4U9EA 2XS1A 4J7YA 3ZDLA 3ZTMA 1QKRA 3DM9B 5L3QA 4U5EE 4GQHA 3JYHA 2WVNA 4OIPF 1N1CA 4DBRA 2FGYA 3QTHA 2HJMA 5CIVA 3M4BA 1DOVA 2LFFA 3ABMC 3QVYA 3IEEA 3PCVA 4NTAA 2A68F 3U8PA 2DB4A 3O39A 4J32B 4XLNF 5L0GA 2J9VA 2XLHA 1J8YF 5T3TA 2B0JA 3LUTB 3FVYA 2AWYA 3O55A 4OIOF 1E86A 4E0HA 1ZW3A 1TWCA 4I1OB 4MVUA 1M2VA 1Q0DA 2ZD9A 3G4ZA 2JX0A 5EK0A 3SEOA 3ZWIA 4JZAA 1K04A 3HJCA 4JE9A 2IOQA 4UDVA 4MVZA 1G4US 1W2WA 2Q9BA 3NYJA 4MS2A 5CI9A 4CS9C 5B3SC 2WVQA 2GA0A 2FFHA 2X51A 3EGXA 1S05A 2AWCA 3U3FA 4XWJA 3B0VC 2LSEA 1G8XA 2Q7RA 3NMIA 3Q6MA 1UG7A 4AE4A 1GGQA 3WODF 5L0IA 3UGPA 1H6GA 3EHMA 3DAGA 3DXJF 3V5XA 4BJ6C 2HMQA 3BRJA 3JZ0A 5KYXB 4O79A 2W9YA 3NRHA 1Q0FA 3SXKA 4MVOA 3VF0A 4E0IA 2Z15A 2KJGA 2VH3A 1G4WR 2HKVA 2MWQA 1OR2A 3AG3C 3ASNC 3FAPB 2OJQA 4CS7A 4QI2A 3H65A 2YKZA 4XPYA 2ZXRA 3DZAA 1FNTc 3JCUQ 2R25A 3K6BA 2AP3A 2Y3DA 5DLJA 1LS1A 2R7UA 4CSAC 1QPUA 3RKOF 2DGJA 2XL4A 2IXOA 3ABLC 3NKEA 1I4ZA 2YL7A 4MNDA 4Z9HA 4PJJA 5JS5A 3C63A 3BEHA 2QY9A 2VB6A 4HEAJ 3SXZA 4XEVA 1LM3B 3Q7GA 4K1OA 3GM3A 4WABA 5F28E 4U5BE 4YT5A 2D4UA 1JAFA 1T6IA 2D5RB 2R03A 4C3BA 1PD1A 2P0NA 1ORYA 4ULVA 5HV9A 1HMDA 2VCCA 3EG9B 4IB4A 3K66A 4BJ1A 2IXMA 1CGME 3E9VA 1ZYRF 3HTKC 5CI8A 2Q00A 2R7OA 5AC4A 2NG1A 2ZXWC 3UMHA 3B29A 1ZW2A 4NY3A 1SMYF 3ZC4A 2QTVA 2XXAB 2Q3TA 5A6AA 1TFKB 1PCXA 2CNWA 2KC3A 2Y3BA 4JIOA 3FMSA 1RCPA 1VK5A 4AX2A 2DYSC 1T9KA 4MQ9F 4KI2A 2KSFA 1WN0A 4P9TA 1OXBA 4W8KA 2EPMX 1TQGA 4A4AA 5L0JA 2C03A 4XLPF 1Q0MA 1A0BA 3W2VA 2LQGA 4XTKA 1EKYA 1O87A 3U2MA 3ZQYA 2HV6A 2XLWA 3LEVA 1OKKD 2KNHA 2OCCC 3FXHA 3JSEO 1YYXA 4BEMJ 1C02A 4G7OF 3B71A 3RIPA 2XLMA 4P9FA 3S9OA 1Z5ZA 3EQLF 5F5FA 2V3CC 4JEBA 2KGOA 5E2QA 3HNIA 3W8HA 4EHPA 1KTMA 2CNWD 3SXYA 1HE1A 1TKNA 2G3KA 3EZIA 2FAPB 3K1IA 3UMIA 5KYWB 4D4NA 1D1BA 2F22A 4LDQA 5B1BC 3IQTA 1U89A 2J9WA 3T6JA 3UR3C 1WOLA 2AVKA 2IXPA 3EGDB 4EIYA 1D1AA 2MHRA 1OW8A 2YWAA 1YZAA 3MX3A 5JLIA 1NZEA 4AL1A 5B3IA 5FCLA 1S7ZA 1VB5A 5EHHA 1RKEB 3R7CA 3VYWA 2R7VA 1CPRA 1JOGA 3S29A 4U5CE 3IQCA 4HE8D 3IHUA 3DJUB 2L6HA 4H54A 3EJNA 5KYYB 2BL2A 1Y6DA 3AG1C 1F1MA 1O5HA 2LFDA 3LESA 2I8BA 4ZLCA 3LAYA 2X0CA 1A7VA 3PMRA 3SYNA 1RJ9A 4CDYA 2NUPA 3GM1A 3EZHA 3DM5A 1FFTC 2CYDA 3KH2A 2R7RA 2PX3A 1CGNA 3B9QA 4K7BA 5DVWA 3T6GB 3UGOA 3E70C 1T5OA 3L0IA 3U9JA 2EPLX 5A6BA 1RMVA 1OCOC 1TFOB 1TWHA 3W2WA 1Y4CA 1L7CA 3ASOC 3EGDA 3O10A 1QSPA 1T6QA 3CZ6A 2J0XA 3QVZA 4D4XA 1TR2A 2OEVA 3GODA 3RYLA 3KMIA 3W4YA 3RVYA 1UFBA 3RW0A 3C8GD 3U9MA 1TWAA 3KL4A 4MVRA 2ETSA 2GAQA 5A6JA 5KYYA 2R7SA 3VRCA 4YT8A 4WGZA 4G7HF 3EHNA 3M1CB 5COGA 3T9OA 1LIHA 3GWNA 1RKEA 5F5HA 2KW3C 3N24A 3EFOA 4LERA 2OU6A 3I4UA 2Q9AA 3US6A 2Y3HA 3JTLO 1Z6AA 2CGEA 3AG2C 2XLVA 3A9CA 4C3DA 2WZLA 4JJGA 4DVZA 2J0WA 4HFFB 5TJ5E 1WTYA 2W4MA 3WG7C 3ZQVA 1C17M 2VC9A 1NFOA 2J9BA 2Q4FA 3M79A 3TD7A 3V7OA 5DS6A 4OD4A 5E3CA 2C04A 3PHF2 3EGXB 3I5PA 5BUOA 3LNMB 3U5SA 3EH1A 1KU2A 4RBNA 3L8IA 1NU9C 4I1MA 1FTSA 3CAXA 4N06A 3NG1A 4JCZA 2G3VA 4C7OA 4W8PA 4PFPA 1LI5A 2GDCA 1I5NA 2GWWA 1V54C 3S84A 1MQVA 1OQCA 2WZFA 2HSQA 3AQCA 3DKAA 1FFHA 2KYHA 1BR1A 4U9DA 1BDJB 3V5ZA 2M64A 3ATPA 2VCBA 3F46A 1K40A 1R5ID 1YA7O 2A6HF 2CDQA 4IAOA 1SYQA 5D92A 1Z3IX 2JD3A 3DMDA 3LLIA 2ZPAA 3FOPA 5DQTA 4DVYP 3C8ZA 4E7ZA 3GEIA 2G62A 4O6MA 4YT2A 1MMAA 2HJ3A 1M2VB 3MFNA 3MYIA 4EBJA 4O6NA 2YLIA 2J46A 3QMKA 4YJWA 3S27A 1YA9A 3K7DA 3NYMA 4J30B 4XEKA 3GANA 3SP1A 1WGWA 3JRMO 3AGUA 3IPMO 4NTFA 3RQEA 4LDKA 5DQZA 5JVEA 3DE8A 2EIKC 4CDVA 3MLGA 2R02A 1A7DA 3M15A 3HNLA 4PACA 1NLXA 2J7PA 4N6HA 1JMWA 4ZLDA 2M4EA 4BEJA 2CCYA 2R7TA 4JJFA 4PR9A 4BPMA 2XSEA 5DS5A 2WVOA 1DOWA 3OEOA 2PFDA 1E2XA 1AEPA 1J8MF 2EIMC 3DI5A 4MVSA 2WB7A 1APCA 3MYFA 4MW8A 1YDIA 1AUEA 3H2VA 1ORJA 1HE9A 2A1DD 3LLKA 1C03A 4BG0A 4CIHA 4DRIB 1Z63A 2XM0A 4YK5A 5JRAA 4PK4A 2NSGA 2PBEA 1V4AA 3NYLA 5L0FA 3T4RA 4YWQA 2HFIA 4G78A 4JRZA 3QZCA 2EINC 1NBBA 1YAUO 2OQMA 2XLOA 4JKVA 1OCZC 3DAFA 4E7SA 5KYWA 2L6GA 1YARO 3B0UX 2HUJA 4E18A 1MNEA 1JPJA 1OCRC 1SF8A 1ORSC 1AVOB 1QVXA 1T6UA 2BC5A 3A11A 2ZXPA 4JEAA 3ZVRA 4OIQF 4P6IC 4JW1A 3NDBB 1IW7F 2XRHA 1M2OA 2H7VC 2XXAA 4PJLA 2YVKA 4KNWA 2J8WA 3ZG1A 1YYJA 4E17A 1MMGA 2IXNA 1TWGA 2EIJC 3AJMA 1NG1A 3DWWA 3HNJA 2W45A 4IJJA 3TQOA 2WL8A 4A2NB 4HFKB 1ZHXA 4B6IA 3WHNA 3C7JA 4JCHA 2PF4E 4G0HA 4Z9IA 3JYYA 2YHSA 4N4WA 1D0XA 1LE2A 1JRAA 1WATA 3ECSA 3C62A 3DJNB 3G4XA 1M57C 4XPXA 1U0BB 3TJ5A 1NSGB 1ST6A 5GPGB 3TOLA 2IBFA 2YZSA 3J06A 3U2LA 3LEOA 3POVA 3HKKA 4BJTA 3DD7A 3L1MA 2L81A 2QE9A 1OCCC 2UUHA 5L0HA 4O7GA 1YZCA 4LACB 3C8GA 3FHDA 5JSLA 2WZGA 1ZU4A 2YL0A 3LNRA 3GWLA 1VMAA 5T1DB 3H2UA 5D91A 3S90A 2KQ9A 5AGFA 2XL8A 4IRUA 4J7TA 3NMJA 1VYIA 3U8VA 2P61A 4BJ6A 1H9GA 2OG2A 2PP4A 1WASA 2NPUA 4CIPA 5JUAA 1VOMA 1SZIA 1EI7A 4N6CA 3SXMA 5A6BD 1OW7A 5COFA 1K05A 1T01A 3K1IC 4U5GA 3SNHA 4YL0A 3W8IA 1RJ9B 1H9TA 4O6YA 3RFYA 3G50A 3ZSUA 4NTBA 2YLDA 1B68A 3GM2A 2DI3A 256BA 1E85A 3O6XA 5A6KA 1EQ1A 3KPHA 3RQFA 2YRFA 3QW0A 4IARA 1Z7Qc 3LS0A 2EPKX 2QNLA 4MTOA 4YN0B 4OINF 3UNGC 3S0XA 2R7QA 1LI7A 2Y3GA 3AGTA 1CGOA 3NKDA 4LLCA 4RDAA 5A69A 1XZQA 5KYUA 2RD9A 1VYKA 1EA8A 2W4BA 2YL1A 3Q6NA 1PV3A 2OEXA 4MVQA 4OD5A 4MTFA 4OIRF 1YVIA 3JSZA 4GYTA 4YL1A 5L0DA 2LK4A 2PX0A 2Y69C 1ZZPA 3L8JA 1R4TA 3LS1A 2VASA 2XS8A 4M63A 1QQ3A 3N2ZB 5B1AC 1GQAA 2QLAA 4WJ0A 3EFOB 4EUKB 2L9JA 1OR3A 1ZVZA 3VAYA 3CQZA 4JVSA 4GEHA 2PNOA 1FMWA 1QZXA 1OKKA 1BR4A 3VM6A 4DOZA 2NUTA 1IZMA 4C3EA 3AQBA 2I15A 4PJMA 2B0HA 4IGGA 2ICWG 3RVZA 1JR8A 4CS8C 5DS4A 1A41A 1BBHA 3WAQA 2A69F 1D0ZA 2HSBA 2OKUA 1RXQA 3GORA 4FWVA 2HZ8A 2V26A 5COMA 4AL0A 4ER9A 5EGYA 2DYRC 1V74B 1H7IA 3C8GB 1O3UA 2OJED 2XLEA 3CEXA 3EG9A 2YLGA 3T6BA 2HMZA 4NC3A 5KYXA 1RKCA 4I3MA 5JT4A 4I44A 3HNKA 4YT4A 2L6FA 3FAJA 2H7OA 2P7VA 4C7OB 4EBBA 4KNVA 1HW2A 4Q7CA 4JC7A 4BJ5C 2QUPA 1I4YA 2EPOA 3IQ6A 2KK1A 5K0IA 1ZHZA 4Z9JA 4H4KC 2XM4A 4JURI 2IYLD 2ASRA 5AC5A 1LKXA 1LVKA 2XL6A 2YL3A 1L3PA 1YJGA 1ZU5A 2O9XA 3MBGA 4CDAA 2GFHA 3X1OA 1ZHWA 3PDMP 4PFOA 4CJOA 2H8AA 3KYJA 1MMNA 1BZ4A 2HS5A 4U5HA 5BQHA 1OXKA 4PJNA 4DRHB 2Y39A 3ZIBA 2A0BA 4JTCB 3HLZA 2NUTB 4F4BA 2A0UA 4L6RA 1JPNA 4R32A 1PD0A 4FAPB 2NSFA 4ANJA 2E87A 5KYUB 1G5ZA 1GM5A 3M4CA 3TK0A 4MTGA 3RQGA 1NU7D 3U0CA 3OA1A 1V55C 1LPEA 2Q9CA 3RF3A 4EBKA 2TMVP 1Q0GA 2LIGA 1VTMP 3K1HA 2VCAA 5BQGA 3K33A 4G7ZF 5JP7A 1M6TA 3AOUA 4IAQA 1CPQA 3I5QA 1LS4A 2OOCA 4U5DE 3EPVA 1OW6A 2H7BA 4CS9A 4DJ9A 3X2QC 3TJ6A 4Q5SF 3GEEA 2HV7A 4EKWA 5E3AA 4YL3A 2MYSA 4XQ1A 1SR2A 2NUPB 3ABKC 4FESA 1BR2A 1E83A 3JRTA 3KYIA 4MVMA 4QI0A 3RH3A 1FR0A 1LE4A 1FMVA 4CJGA 1XWJA 4JTAB 1HY5A 3EH2A 3AG4C 3S28A 1KNYA 1NFNA 3FOOA 2CW0F 1ZHTA 1E84A 3LJBA 2LCHA 4NQFA 2LD6A 2EILC 4NCQA 4AE4B 1FAPB 2XLDA 4CBEA 4DXWA 3R2PA 3IQ5A 3ITFA 4XEFA 4XPWA 2R05A 5HSWA 4CSAA 4RD9A 2J7PD 1WWPA 4DRJB 3QW1A 4X0RA 5KYNA 3FDQA 2R9RB 2YQYA 2P6VA 4LDRA 4U5FE 1HW1A 1D1CA 2AU5A 2JPUA 2IM8A 1XZPA 4WGYA 4KC9A 5FZTA 4CS8A 5L3VA 2J9UA 4AK9A 3ZTZA 4EWCA 5T3WA 5IY5C 1VLSA 2P1AA 1VLTA 2ZXOA 2EPNA 2LP4A 1Z23A 5BQIA
chains in the Genus database with same CATH topology
3C8GB 1PV3A 1O3UA 4R32A 3B71A 3JZ0A 3BRJA 3RQEA 2PBEA 3S9OA 1V4AA 3C18A 2LK4A 3GM1A 1KTMA 3L8JA 1ZZPA 1KNYA 3JYYA 2L6FA 3RQGA 1OW7A 3U0CA 4NQFA 4EBKA 1K05A 2Q00A 1K40A 2L6GA 2KK1A 4XEFA 3GM2A 1WOLA 1QVXA 2JX0A 1WWPA 3O10A 1WTYA 1OW8A 2YWAA 1K04A 3RQFA 1OW6A 3TULA 2JPUA 1UFBA 3C8GA 1JOGA 3C8GD 3MFNA 4XEVA 3U3FA 4EBJA 3L8IA 3GM3A 2HSBA 2L6HA 5F28E 3AJMA 3K7DA 4XEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C8G B;  1PV3 A;  1O3U A;  4R32 A;  3B71 A;  3JZ0 A;  3BRJ A;  3RQE A;  2PBE A;  3S9O A;  1V4A A;  3C18 A;  2LK4 A;  3GM1 A;  1KTM A;  3L8J A;  1ZZP A;  1KNY A;  3JYY A;  2L6F A;  3RQG A;  1OW7 A;  3U0C A;  4NQF A;  4EBK A;  1K05 A;  2Q00 A;  1K40 A;  2L6G A;  2KK1 A;  4XEF A;  3GM2 A;  1WOL A;  1QVX A;  2JX0 A;  1WWP A;  3O10 A;  1WTY A;  1OW8 A;  2YWA A;  1K04 A;  3RQF A;  1OW6 A;  3TUL A;  2JPU A;  1UFB A;  3C8G A;  1JOG A;  3C8G D;  3MFN A;  4XEV A;  3U3F A;  4EBJ A;  3L8I A;  3GM3 A;  2HSB A;  2L6H A;  5F28 E;  3AJM A;  3K7D A;  4XEK A; 
#chains in the Genus database with same CATH topology
 3UMK A;  3CSK A;  3F47 A;  4FX5 A;  4ONS A;  3V5Y A;  1HMO A;  3C18 A;  3OWT A;  3DE9 A;  4JTD B;  3B0P A;  3SZR A;  4CX9 A;  2YEV A;  3NMK A;  5E33 A;  2L7A A;  3JT1 A;  1MND A;  1YLM A;  1D0Y A;  3L34 A;  4Q4Z F;  1U6H A;  3Q7L A;  3TOM A;  3U3B A;  4MW3 A;  4BJ5 A;  1Q0K A;  4ULW A;  2R7X A;  2RSE B;  2A6E F;  4LLE A;  3GEH A;  1ZHY A;  3KKB A;  4IWB A;  2BE5 F;  4DBQ A;  2R7W A;  2UUI A;  5L0C A;  1M56 C;  4K0D A;  3N0T A;  1GS9 A;  1A7E A;  4QDL A;  3TUL A;  1QLE C;  4KBL A;  1MMD A;  2J45 A;  4U9E A;  2XS1 A;  4J7Y A;  3ZDL A;  3ZTM A;  1QKR A;  3DM9 B;  5L3Q A;  4U5E E;  4GQH A;  3JYH A;  2WVN A;  4OIP F;  1N1C A;  4DBR A;  2FGY A;  3QTH A;  2HJM A;  5CIV A;  3M4B A;  1DOV A;  2LFF A;  3ABM C;  3QVY A;  3IEE A;  3PCV A;  4NTA A;  2A68 F;  3U8P A;  2DB4 A;  3O39 A;  4J32 B;  4XLN F;  5L0G A;  2J9V A;  2XLH A;  1J8Y F;  5T3T A;  2B0J A;  3LUT B;  3FVY A;  2AWY A;  3O55 A;  4OIO F;  1E86 A;  4E0H A;  1ZW3 A;  1TWC A;  4I1O B;  4MVU A;  1M2V A;  1Q0D A;  2ZD9 A;  3G4Z A;  2JX0 A;  5EK0 A;  3SEO A;  3ZWI A;  4JZA A;  1K04 A;  3HJC A;  4JE9 A;  2IOQ A;  4UDV A;  4MVZ A;  1G4U S;  1W2W A;  2Q9B A;  3NYJ A;  4MS2 A;  5CI9 A;  4CS9 C;  5B3S C;  2WVQ A;  2GA0 A;  2FFH A;  2X51 A;  3EGX A;  1S05 A;  2AWC A;  3U3F A;  4XWJ A;  3B0V C;  2LSE A;  1G8X A;  2Q7R A;  3NMI A;  3Q6M A;  1UG7 A;  4AE4 A;  1GGQ A;  3WOD F;  5L0I A;  3UGP A;  1H6G A;  3EHM A;  3DAG A;  3DXJ F;  3V5X A;  4BJ6 C;  2HMQ A;  3BRJ A;  3JZ0 A;  5KYX B;  4O79 A;  2W9Y A;  3NRH A;  1Q0F A;  3SXK A;  4MVO A;  3VF0 A;  4E0I A;  2Z15 A;  2KJG A;  2VH3 A;  1G4W R;  2HKV A;  2MWQ A;  1OR2 A;  3AG3 C;  3ASN C;  3FAP B;  2OJQ A;  4CS7 A;  4QI2 A;  3H65 A;  2YKZ A;  4XPY A;  2ZXR A;  3DZA A;  1FNT c;  3JCU Q;  2R25 A;  3K6B A;  2AP3 A;  2Y3D A;  5DLJ A;  1LS1 A;  2R7U A;  4CSA C;  1QPU A;  3RKO F;  2DGJ A;  2XL4 A;  2IXO A;  3ABL C;  3NKE A;  1I4Z A;  2YL7 A;  4MND A;  4Z9H A;  4PJJ A;  5JS5 A;  3C63 A;  3BEH A;  2QY9 A;  2VB6 A;  4HEA J;  3SXZ A;  4XEV A;  1LM3 B;  3Q7G A;  4K1O A;  3GM3 A;  4WAB A;  5F28 E;  4U5B E;  4YT5 A;  2D4U A;  1JAF A;  1T6I A;  2D5R B;  2R03 A;  4C3B A;  1PD1 A;  2P0N A;  1ORY A;  4ULV A;  5HV9 A;  1HMD A;  2VCC A;  3EG9 B;  4IB4 A;  3K66 A;  4BJ1 A;  2IXM A;  1CGM E;  3E9V A;  1ZYR F;  3HTK C;  5CI8 A;  2Q00 A;  2R7O A;  5AC4 A;  2NG1 A;  2ZXW C;  3UMH A;  3B29 A;  1ZW2 A;  4NY3 A;  1SMY F;  3ZC4 A;  2QTV A;  2XXA B;  2Q3T A;  5A6A A;  1TFK B;  1PCX A;  2CNW A;  2KC3 A;  2Y3B A;  4JIO A;  3FMS A;  1RCP A;  1VK5 A;  4AX2 A;  2DYS C;  1T9K A;  4MQ9 F;  4KI2 A;  2KSF A;  1WN0 A;  4P9T A;  1OXB A;  4W8K A;  2EPM X;  1TQG A;  4A4A A;  5L0J A;  2C03 A;  4XLP F;  1Q0M A;  1A0B A;  3W2V A;  2LQG A;  4XTK A;  1EKY A;  1O87 A;  3U2M A;  3ZQY A;  2HV6 A;  2XLW A;  3LEV A;  1OKK D;  2KNH A;  2OCC C;  3FXH A;  3JSE O;  1YYX A;  4BEM J;  1C02 A;  4G7O F;  3B71 A;  3RIP A;  2XLM A;  4P9F A;  3S9O A;  1Z5Z A;  3EQL F;  5F5F A;  2V3C C;  4JEB A;  2KGO A;  5E2Q A;  3HNI A;  3W8H A;  4EHP A;  1KTM A;  2CNW D;  3SXY A;  1HE1 A;  1TKN A;  2G3K A;  3EZI A;  2FAP B;  3K1I A;  3UMI A;  5KYW B;  4D4N A;  1D1B A;  2F22 A;  4LDQ A;  5B1B C;  3IQT A;  1U89 A;  2J9W A;  3T6J A;  3UR3 C;  1WOL A;  2AVK A;  2IXP A;  3EGD B;  4EIY A;  1D1A A;  2MHR A;  1OW8 A;  2YWA A;  1YZA A;  3MX3 A;  5JLI A;  1NZE A;  4AL1 A;  5B3I A;  5FCL A;  1S7Z A;  1VB5 A;  5EHH A;  1RKE B;  3R7C A;  3VYW A;  2R7V A;  1CPR A;  1JOG A;  3S29 A;  4U5C E;  3IQC A;  4HE8 D;  3IHU A;  3DJU B;  2L6H A;  4H54 A;  3EJN A;  5KYY B;  2BL2 A;  1Y6D A;  3AG1 C;  1F1M A;  1O5H A;  2LFD A;  3LES A;  2I8B A;  4ZLC A;  3LAY A;  2X0C A;  1A7V A;  3PMR A;  3SYN A;  1RJ9 A;  4CDY A;  2NUP A;  3GM1 A;  3EZH A;  3DM5 A;  1FFT C;  2CYD A;  3KH2 A;  2R7R A;  2PX3 A;  1CGN A;  3B9Q A;  4K7B A;  5DVW A;  3T6G B;  3UGO A;  3E70 C;  1T5O A;  3L0I A;  3U9J A;  2EPL X;  5A6B A;  1RMV A;  1OCO C;  1TFO B;  1TWH A;  3W2W A;  1Y4C A;  1L7C A;  3ASO C;  3EGD A;  3O10 A;  1QSP A;  1T6Q A;  3CZ6 A;  2J0X A;  3QVZ A;  4D4X A;  1TR2 A;  2OEV A;  3GOD A;  3RYL A;  3KMI A;  3W4Y A;  3RVY A;  1UFB A;  3RW0 A;  3C8G D;  3U9M A;  1TWA A;  3KL4 A;  4MVR A;  2ETS A;  2GAQ A;  5A6J A;  5KYY A;  2R7S A;  3VRC A;  4YT8 A;  4WGZ A;  4G7H F;  3EHN A;  3M1C B;  5COG A;  3T9O A;  1LIH A;  3GWN A;  1RKE A;  5F5H A;  2KW3 C;  3N24 A;  3EFO A;  4LER A;  2OU6 A;  3I4U A;  2Q9A A;  3US6 A;  2Y3H A;  3JTL O;  1Z6A A;  2CGE A;  3AG2 C;  2XLV A;  3A9C A;  4C3D A;  2WZL A;  4JJG A;  4DVZ A;  2J0W A;  4HFF B;  5TJ5 E;  1WTY A;  2W4M A;  3WG7 C;  3ZQV A;  1C17 M;  2VC9 A;  1NFO A;  2J9B A;  2Q4F A;  3M79 A;  3TD7 A;  3V7O A;  5DS6 A;  4OD4 A;  5E3C A;  2C04 A;  3PHF 2;  3EGX B;  3I5P A;  5BUO A;  3LNM B;  3U5S A;  3EH1 A;  1KU2 A;  4RBN A;  3L8I A;  1NU9 C;  4I1M A;  1FTS A;  3CAX A;  4N06 A;  3NG1 A;  4JCZ A;  2G3V A;  4C7O A;  4W8P A;  4PFP A;  1LI5 A;  2GDC A;  1I5N A;  2GWW A;  1V54 C;  3S84 A;  1MQV A;  1OQC A;  2WZF A;  2HSQ A;  3AQC A;  3DKA A;  1FFH A;  2KYH A;  1BR1 A;  4U9D A;  1BDJ B;  3V5Z A;  2M64 A;  3ATP A;  2VCB A;  3F46 A;  1K40 A;  1R5I D;  1YA7 O;  2A6H F;  2CDQ A;  4IAO A;  1SYQ A;  5D92 A;  1Z3I X;  2JD3 A;  3DMD A;  3LLI A;  2ZPA A;  3FOP A;  5DQT A;  4DVY P;  3C8Z A;  4E7Z A;  3GEI A;  2G62 A;  4O6M A;  4YT2 A;  1MMA A;  2HJ3 A;  1M2V B;  3MFN A;  3MYI A;  4EBJ A;  4O6N A;  2YLI A;  2J46 A;  3QMK A;  4YJW A;  3S27 A;  1YA9 A;  3K7D A;  3NYM A;  4J30 B;  4XEK A;  3GAN A;  3SP1 A;  1WGW A;  3JRM O;  3AGU A;  3IPM O;  4NTF A;  3RQE A;  4LDK A;  5DQZ A;  5JVE A;  3DE8 A;  2EIK C;  4CDV A;  3MLG A;  2R02 A;  1A7D A;  3M15 A;  3HNL A;  4PAC A;  1NLX A;  2J7P A;  4N6H A;  1JMW A;  4ZLD A;  2M4E A;  4BEJ A;  2CCY A;  2R7T A;  4JJF A;  4PR9 A;  4BPM A;  2XSE A;  5DS5 A;  2WVO A;  1DOW A;  3OEO A;  2PFD A;  1E2X A;  1AEP A;  1J8M F;  2EIM C;  3DI5 A;  4MVS A;  2WB7 A;  1APC A;  3MYF A;  4MW8 A;  1YDI A;  1AUE A;  3H2V A;  1ORJ A;  1HE9 A;  2A1D D;  3LLK A;  1C03 A;  4BG0 A;  4CIH A;  4DRI B;  1Z63 A;  2XM0 A;  4YK5 A;  5JRA A;  4PK4 A;  2NSG A;  2PBE A;  1V4A A;  3NYL A;  5L0F A;  3T4R A;  4YWQ A;  2HFI A;  4G78 A;  4JRZ A;  3QZC A;  2EIN C;  1NBB A;  1YAU O;  2OQM A;  2XLO A;  4JKV A;  1OCZ C;  3DAF A;  4E7S A;  5KYW A;  2L6G A;  1YAR O;  3B0U X;  2HUJ A;  4E18 A;  1MNE A;  1JPJ A;  1OCR C;  1SF8 A;  1ORS C;  1AVO B;  1QVX A;  1T6U A;  2BC5 A;  3A11 A;  2ZXP A;  4JEA A;  3ZVR A;  4OIQ F;  4P6I C;  4JW1 A;  3NDB B;  1IW7 F;  2XRH A;  1M2O A;  2H7V C;  2XXA A;  4PJL A;  2YVK A;  4KNW A;  2J8W A;  3ZG1 A;  1YYJ A;  4E17 A;  1MMG A;  2IXN A;  1TWG A;  2EIJ C;  3AJM A;  1NG1 A;  3DWW A;  3HNJ A;  2W45 A;  4IJJ A;  3TQO A;  2WL8 A;  4A2N B;  4HFK B;  1ZHX A;  4B6I A;  3WHN A;  3C7J A;  4JCH A;  2PF4 E;  4G0H A;  4Z9I A;  3JYY A;  2YHS A;  4N4W A;  1D0X A;  1LE2 A;  1JRA A;  1WAT A;  3ECS A;  3C62 A;  3DJN B;  3G4X A;  1M57 C;  4XPX A;  1U0B B;  3TJ5 A;  1NSG B;  1ST6 A;  5GPG B;  3TOL A;  2IBF A;  2YZS A;  3J06 A;  3U2L A;  3LEO A;  3POV A;  3HKK A;  4BJT A;  3DD7 A;  3L1M A;  2L81 A;  2QE9 A;  1OCC C;  2UUH A;  5L0H A;  4O7G A;  1YZC A;  4LAC B;  3C8G A;  3FHD A;  5JSL A;  2WZG A;  1ZU4 A;  2YL0 A;  3LNR A;  3GWL A;  1VMA A;  5T1D B;  3H2U A;  5D91 A;  3S90 A;  2KQ9 A;  5AGF A;  2XL8 A;  4IRU A;  4J7T A;  3NMJ A;  1VYI A;  3U8V A;  2P61 A;  4BJ6 A;  1H9G A;  2OG2 A;  2PP4 A;  1WAS A;  2NPU A;  4CIP A;  5JUA A;  1VOM A;  1SZI A;  1EI7 A;  4N6C A;  3SXM A;  5A6B D;  1OW7 A;  5COF A;  1K05 A;  1T01 A;  3K1I C;  4U5G A;  3SNH A;  4YL0 A;  3W8I A;  1RJ9 B;  1H9T A;  4O6Y A;  3RFY A;  3G50 A;  3ZSU A;  4NTB A;  2YLD A;  1B68 A;  3GM2 A;  2DI3 A;  256B A;  1E85 A;  3O6X A;  5A6K A;  1EQ1 A;  3KPH A;  3RQF A;  2YRF A;  3QW0 A;  4IAR A;  1Z7Q c;  3LS0 A;  2EPK X;  2QNL A;  4MTO A;  4YN0 B;  4OIN F;  3UNG C;  3S0X A;  2R7Q A;  1LI7 A;  2Y3G A;  3AGT A;  1CGO A;  3NKD A;  4LLC A;  4RDA A;  5A69 A;  1XZQ A;  5KYU A;  2RD9 A;  1VYK A;  1EA8 A;  2W4B A;  2YL1 A;  3Q6N A;  1PV3 A;  2OEX A;  4MVQ A;  4OD5 A;  4MTF A;  4OIR F;  1YVI A;  3JSZ A;  4GYT A;  4YL1 A;  5L0D A;  2LK4 A;  2PX0 A;  2Y69 C;  1ZZP A;  3L8J A;  1R4T A;  3LS1 A;  2VAS A;  2XS8 A;  4M63 A;  1QQ3 A;  3N2Z B;  5B1A C;  1GQA A;  2QLA A;  4WJ0 A;  3EFO B;  4EUK B;  2L9J A;  1OR3 A;  1ZVZ A;  3VAY A;  3CQZ A;  4JVS A;  4GEH A;  2PNO A;  1FMW A;  1QZX A;  1OKK A;  1BR4 A;  3VM6 A;  4DOZ A;  2NUT A;  1IZM A;  4C3E A;  3AQB A;  2I15 A;  4PJM A;  2B0H A;  4IGG A;  2ICW G;  3RVZ A;  1JR8 A;  4CS8 C;  5DS4 A;  1A41 A;  1BBH A;  3WAQ A;  2A69 F;  1D0Z A;  2HSB A;  2OKU A;  1RXQ A;  3GOR A;  4FWV A;  2HZ8 A;  2V26 A;  5COM A;  4AL0 A;  4ER9 A;  5EGY A;  2DYR C;  1V74 B;  1H7I A;  3C8G B;  1O3U A;  2OJE D;  2XLE A;  3CEX A;  3EG9 A;  2YLG A;  3T6B A;  2HMZ A;  4NC3 A;  5KYX A;  1RKC A;  4I3M A;  5JT4 A;  4I44 A;  3HNK A;  4YT4 A;  2L6F A;  3FAJ A;  2H7O A;  2P7V A;  4C7O B;  4EBB A;  4KNV A;  1HW2 A;  4Q7C A;  4JC7 A;  4BJ5 C;  2QUP A;  1I4Y A;  2EPO A;  3IQ6 A;  2KK1 A;  5K0I A;  1ZHZ A;  4Z9J A;  4H4K C;  2XM4 A;  4JUR I;  2IYL D;  2ASR A;  5AC5 A;  1LKX A;  1LVK A;  2XL6 A;  2YL3 A;  1L3P A;  1YJG A;  1ZU5 A;  2O9X A;  3MBG A;  4CDA A;  2GFH A;  3X1O A;  1ZHW A;  3PDM P;  4PFO A;  4CJO A;  2H8A A;  3KYJ A;  1MMN A;  1BZ4 A;  2HS5 A;  4U5H A;  5BQH A;  1OXK A;  4PJN A;  4DRH B;  2Y39 A;  3ZIB A;  2A0B A;  4JTC B;  3HLZ A;  2NUT B;  4F4B A;  2A0U A;  4L6R A;  1JPN A;  4R32 A;  1PD0 A;  4FAP B;  2NSF A;  4ANJ A;  2E87 A;  5KYU B;  1G5Z A;  1GM5 A;  3M4C A;  3TK0 A;  4MTG A;  3RQG A;  1NU7 D;  3U0C A;  3OA1 A;  1V55 C;  1LPE A;  2Q9C A;  3RF3 A;  4EBK A;  2TMV P;  1Q0G A;  2LIG A;  1VTM P;  3K1H A;  2VCA A;  5BQG A;  3K33 A;  4G7Z F;  5JP7 A;  1M6T A;  3AOU A;  4IAQ A;  1CPQ A;  3I5Q A;  1LS4 A;  2OOC A;  4U5D E;  3EPV A;  1OW6 A;  2H7B A;  4CS9 A;  4DJ9 A;  3X2Q C;  3TJ6 A;  4Q5S F;  3GEE A;  2HV7 A;  4EKW A;  5E3A A;  4YL3 A;  2MYS A;  4XQ1 A;  1SR2 A;  2NUP B;  3ABK C;  4FES A;  1BR2 A;  1E83 A;  3JRT A;  3KYI A;  4MVM A;  4QI0 A;  3RH3 A;  1FR0 A;  1LE4 A;  1FMV A;  4CJG A;  1XWJ A;  4JTA B;  1HY5 A;  3EH2 A;  3AG4 C;  3S28 A;  1KNY A;  1NFN A;  3FOO A;  2CW0 F;  1ZHT A;  1E84 A;  3LJB A;  2LCH A;  4NQF A;  2LD6 A;  2EIL C;  4NCQ A;  4AE4 B;  1FAP B;  2XLD A;  4CBE A;  4DXW A;  3R2P A;  3IQ5 A;  3ITF A;  4XEF A;  4XPW A;  2R05 A;  5HSW A;  4CSA A;  4RD9 A;  2J7P D;  1WWP A;  4DRJ B;  3QW1 A;  4X0R A;  5KYN A;  3FDQ A;  2R9R B;  2YQY A;  2P6V A;  4LDR A;  4U5F E;  1HW1 A;  1D1C A;  2AU5 A;  2JPU A;  2IM8 A;  1XZP A;  4WGY A;  4KC9 A;  5FZT A;  4CS8 A;  5L3V A;  2J9U A;  4AK9 A;  3ZTZ A;  4EWC A;  5T3W A;  5IY5 C;  1VLS A;  2P1A A;  1VLT A;  2ZXO A;  2EPN A;  2LP4 A;  1Z23 A;  5BQI A; 
#chains in the Genus database with same CATH homology
 3C8G B;  1PV3 A;  1O3U A;  4R32 A;  3B71 A;  3JZ0 A;  3BRJ A;  3RQE A;  2PBE A;  3S9O A;  1V4A A;  3C18 A;  2LK4 A;  3GM1 A;  1KTM A;  3L8J A;  1ZZP A;  1KNY A;  3JYY A;  2L6F A;  3RQG A;  1OW7 A;  3U0C A;  4NQF A;  4EBK A;  1K05 A;  2Q00 A;  1K40 A;  2L6G A;  2KK1 A;  4XEF A;  3GM2 A;  1WOL A;  1QVX A;  2JX0 A;  1WWP A;  3O10 A;  1WTY A;  1OW8 A;  2YWA A;  1K04 A;  3RQF A;  1OW6 A;  3TUL A;  2JPU A;  1UFB A;  3C8G A;  1JOG A;  3C8G D;  3MFN A;  4XEV A;  3U3F A;  4EBJ A;  3L8I A;  3GM3 A;  2HSB A;  2L6H A;  5F28 E;  3AJM A;  3K7D A;  4XEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...