2YWAA

Crystal structure of uncharacterized conserved protein from thermus thermophilus hb8
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
115
structure length
115
Chain Sequence
ASLARAVERLKAALERPKDEFIRDSAIQRFEFTFELAWKTLKTFLELQGLEARSPRAAIRGAFQVGLLPEDPFWLEMLELRNLTNHTYDEALAERIYAELPKALERFQELLRRLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein TTHA0048
publication title Crystal structure of uncharacterized conserved protein from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
total genus 41
structure length 115
sequence length 115
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08780 NTase_sub_bind Nucleotidyltransferase substrate binding protein like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 2ywaA00
3S9OA 1OW6A 1ZZPA 5F28E 3TULA 2YWAA 3AJMA 3GM2A 1QVXA 3BRJA 3C8GD 2HSBA 2Q00A 3K7DA 2LK4A 1PV3A 3RQGA 3GM1A 1WOLA 3JYYA 3U0CA 2L6HA 4R32A 4XEKA 3RQFA 2PBEA 1K40A 1V4AA 1UFBA 3L8JA 1WTYA 3RQEA 3C18A 1KNYA 1K04A 3B71A 1KTMA 3U3FA 1WWPA 3C8GA 4EBJA 3O10A 1OW8A 4NQFA 3MFNA 1OW7A 3JZ0A 2L6FA 2JPUA 3C8GB 3GM3A 4XEVA 2KK1A 1JOGA 3L8IA 1K05A 4XEFA 1O3UA 2L6GA 2JX0A 4EBKA
chains in the Genus database with same CATH superfamily
3JRMO 2H8AA 2G3KA 1T01A 1QVXA 1YYJA 1VYIA 3BRJA 1HE9A 5T3WA 2NG1A 4CJGA 2QE9A 4G7HF 3ABLC 4MVSA 4I1MA 3S84A 1C02A 3U0CA 4KNWA 2J0XA 2CW0F 1L7CA 1E83A 3U8PA 3ATPA 4CS8A 4C3BA 1QQ3A 5CI8A 4K0DA 4G0HA 1WASA 2QUPA 2QTVA 4UDVA 1C17M 1D1AA 1RKCA 5CI9A 3C8GA 3J06A 4XLPF 2C04A 2Q9AA 2XLHA 5HV9A 2X51A 2KK1A 4WGZA 4OIOF 2XXAB 1M56C 4M63A 2EPMX 2R7TA 3RYLA 4JZAA 1OKKD 3TOMA 3K33A 3RW0A 3QVZA 1PD1A 2R7XA 3GM2A 4MVUA 2R25A 2BE5F 2ZXRA 3EG9A 4JKVA 3W4YA 1JAFA 2LFFA 2R7RA 1G4WR 3H2UA 5E3CA 1GS9A 3DE8A 1PV3A 3KPHA 3TD7A 3SXZA 3G4XA 2AVKA 2CDQA 2IXMA 4JURI 4AL1A 5IY5C 3L1MA 2XL4A 3HKKA 2PF4E 5L0IA 3KMIA 4CDVA 1HMDA 2YLIA 3S28A 2GA0A 2LD6A 1Z6AA 4U5CE 3CSKA 3ZG1A 2EPKX 1CGOA 2XM0A 2XLWA 4MVRA 3IQTA 3UR3C 5A6AA 1HW1A 4DBRA 3DJNB 3N24A 4NQFA 3HNLA 3H65A 3VM6A 3U3BA 4C7OA 3VYWA 3FOOA 1LKXA 1MNEA 3AQBA 3GANA 2OCCC 1ORJA 2JD3A 3MBGA 2EPLX 1FTSA 3PHF2 1A0BA 4MS2A 2WB7A 1D0YA 2OJQA 1ZW3A 3C7JA 4N06A 4FX5A 4O6YA 4EWCA 2LQGA 2VC9A 1Z3IX 3E9VA 3NYJA 2TMVP 1FMVA 2IXNA 4DJ9A 4CS9A 5K0IA 1TFOB 4PACA 4U5EE 1A7DA 4R32A 1APCA 2KSFA 2YHSA 1D1CA 4HE8D 1KTMA 2I8BA 2VASA 3DD7A 3ASNC 4CDAA 2P0NA 1ZYRF 3U8VA 3FDQA 1RJ9B 2VCAA 2O9XA 3T6BA 4N4WA 1VYKA 3JRTA 3W2WA 5L0FA 5L0HA 1E85A 3S0XA 3T9OA 3DM9B 1EKYA 1MMNA 5T1DB 4P9FA 3V5ZA 4C3DA 2YRFA 1NLXA 3O55A 3EH1A 2X0CA 5D92A 2AWYA 2OOCA 2YL0A 5JP7A 1R5ID 4I3MA 3R2PA 1HW2A 4OIPF 1OCOC 2Y3GA 5FZTA 3VAYA 1JMWA 4U5BE 2HFIA 3AG3C 2I15A 3MYIA 2H7OA 2PBEA 2XM4A 3LJBA 1V4AA 4FWVA 4PJNA 3LEOA 3NMIA 1KNYA 2FAPB 4IARA 5AC5A 2J9BA 3K1IC 2XLEA 3U2MA 3ZSUA 2Q9CA 2R7VA 2J46A 3C8GB 3LNRA 1O5HA 4D4XA 3G4ZA 3S29A 4YT2A 1ZHZA 4IAQA 2Y69C 1J8MF 4IWBA 4XQ1A 5AGFA 2AU5A 4E7ZA 3KL4A 3L34A 1ZZPA 5F28E 4MVZA 3GEEA 5B1BC 2HJMA 3WHNA 3O39A 3L0IA 2WZFA 3SYNA 2PNOA 2W9YA 4XPYA 1V55C 1D1BA 1ZHYA 3EGDA 4CS9C 2HS5A 3EG9B 4MQ9F 1OR2A 256BA 2NPUA 3JYYA 3DE9A 3DXJF 3QW0A 1M57C 4E17A 1TWAA 5JUAA 2ICWG 3IQ5A 3R7CA 4H4KC 4K7BA 2DYSC 5T3TA 2M64A 3EZHA 1QLEC 3EGXA 3RVYA 1JPJA 2H7VC 1OKKA 3RVZA 3IPMO 3FXHA 4PFPA 4XWJA 3U9JA 3T6JA 2B0HA 3U3FA 2OEXA 3OA1A 2ASRA 5F5FA 4EBJA 2J7PD 1OW8A 4DRJB 3JT1A 2V3CC 3ZC4A 2Y3BA 2CNWD 4BEJA 1K05A 2LCHA 3DI5A 3CAXA 1IZMA 1LPEA 1NFOA 2J9WA 2L6HA 2WZGA 4DVYP 4YT8A 2Q3TA 4XPXA 1KU2A 2QY9A 3IEEA 4Q4ZF 2Z15A 1E2XA 1IW7F 3FAJA 3UMKA 3AGTA 1H6GA 3A9CA 1Q0KA 2L7AA 1VTMP 1OXKA 1NU7D 5COFA 2CGEA 4A4AA 3LNMB 3GODA 5DS6A 2BL2A 3AG2C 4O7GA 1GM5A 1UFBA 1YAUO 1I4YA 2XLVA 3RFYA 2IOQA 3WG7C 5A6BD 1YA9A 3HNJA 3ZQYA 2YZSA 3G50A 4U9EA 1CGNA 3K1HA 1ZU4A 3U5SA 4WABA 2EINC 3DWWA 1OXBA 2Y3HA 3US6A 1TR2A 2LSEA 3NG1A 4JTCB 3MFNA 1T6IA 2WVNA 4Z9HA 2HMZA 4U5GA 3Q6NA 1T5OA 3L8IA 1TQGA 2MWQA 3CZ6A 1YDIA 2XS8A 2PFDA 1SF8A 3AGUA 2KGOA 1NBBA 1MMDA 4KNVA 4XTKA 4DBQA 5DS5A 1H9GA 2PP4A 3AJMA 2RD9A 1Z7Qc 1FFHA 2OQMA 2HSBA 3ABMC 4U5HA 2HUJA 4LDRA 3JYHA 4JTAB 3UMHA 2LK4A 5A6KA 2VCBA 1VK5A 3POVA 5DS4A 3JSZA 3LLIA 5KYYA 3VRCA 4QI2A 2NUPA 2YEVA 5B3IA 3RQFA 3NMJA 3EPVA 3K6BA 3VF0A 1EI7A 4DOZA 4OIQF 1HY5A 1OCRC 2CYDA 4ULWA 4XLNF 3Q7GA 1GQAA 1BR1A 5B1AC 4AX2A 2J0WA 2OU6A 2HV6A 2LP4A 1D0XA 2G62A 2L9JA 1SZIA 2A69F 4WGYA 3W8IA 4KC9A 3SXYA 2EPNA 3FHDA 2PX3A 3AQCA 4MVMA 3V7OA 2L6FA 4GQHA 3WODF 4HEAJ 2NSGA 3PCVA 1T6QA 1NG1A 3AG1C 3EHNA 4Q7CA 3GWNA 3LESA 1YYXA 2XS1A 3QMKA 5L0GA 2IBFA 3HNKA 5GPGB 2C03A 3U9MA 4BJ5C 2WVQA 1Z23A 5E2QA 3TULA 3LUTB 2Q7RA 3NKEA 1SYQA 3OEOA 2HKVA 1TFKB 3HJCA 3N0TA 3LLKA 1J8YF 2OJED 4E18A 2QNLA 3M15A 3RQGA 4CIPA 1CPQA 1ZU5A 1JPNA 3EGDB 2D4UA 2EIKC 3GM1A 3KYJA 2IXOA 1LE2A 3NYMA 3QW1A 4YJWA 4Z9IA 4EUKB 4GYTA 4MNDA 4BJ5A 1BR4A 2KW3C 2A6EF 2YKZA 4JRZA 4MW8A 3M4BA 4JEBA 4DVZA 3EGXB 3RH3A 5KYXA 4C3EA 2FFHA 3ZVRA 5KYWA 2R05A 4J30B 1MMGA 2M4EA 4L6RA 3O6XA 1BZ4A 1JOGA 4O6NA 1FNTc 1LIHA 4IGGA 4J7YA 3NDBB 2JX0A 4QI0A 1SR2A 3M1CB 5DQZA 3T6GB 3KKBA 4YN0B 5BQGA 2R7SA 2HJ3A 1HMOA 2HZ8A 4IAOA 4XPWA 1D0ZA 1VLSA 5TJ5E 1ZHWA 2EIMC 2XLDA 4EBBA 3EQLF 4CIHA 1AUEA 2XL6A 3SEOA 4C7OB 3C63A 2PX0A 1YLMA 1Z5ZA 4H54A 4JCZA 4BG0A 4AL0A 1WGWA 3FOPA 2CNWA 4YT5A 1RMVA 4YL3A 4KBLA 4RBNA 4WJ0A 5COMA 1EA8A 3EFOA 1G8XA 3GEIA 1I5NA 1H9TA 1NZEA 3KYIA 1OCZC 2R02A 3I5PA 4JJFA 4ZLDA 3ZWIA 3HNIA 1NU9C 1A41A 3GM3A 2AP3A 2VH3A 5A6JA 2HV7A 2NUTA 1QSPA 2UUHA 3SXMA 4I1OB 3X1OA 4DRHB 3B0VC 2IXPA 4QDLA 5FCLA 1ST6A 4JE9A 1Y6DA 5E33A 3IQ6A 3DZAA 3W2VA 2YWAA 4N6HA 1GGQA 1ZVZA 3ITFA 1RKEA 2P61A 2YLDA 2Q00A 3JSEO 1VMAA 1FR0A 2B0JA 3K1IA 1G5ZA 1S7ZA 4RD9A 3V5YA 4E7SA 2LIGA 4AE4A 1VOMA 1Y4CA 5DLJA 1OQCA 3S90A 1QZXA 1ZW2A 3UGOA 4YL0A 4N6CA 5KYYB 3DAGA 2NUPB 2J9VA 4MW3A 1K04A 4U9DA 3M4CA 2EPOA 4MTOA 1A7EA 2KNHA 4B6IA 1MQVA 4LDKA 2RSEB 5L0DA 1JRAA 1NSGB 4U5FE 1RCPA 3WAQA 3SNHA 2YL1A 3TK0A 4U5DE 4I44A 3X2QC 2L6GA 3K66A 3OWTA 4AK9A 4YT4A 1G4US 3F46A 4G7ZF 2XL8A 3TJ5A 3MYFA 4CJOA 4JVSA 3B29A 2Y39A 4ULVA 4ER9A 1DOWA 5BQIA 1BBHA 1VLTA 1ORYA 3LEVA 3NYLA 3Q6MA 5D91A 3F47A 3DAFA 3UMIA 4YWQA 3E70C 4F4BA 1FMWA 2XLMA 5COGA 3AG4C 2A0UA 3SP1A 1K40A 4ONSA 1YVIA 2EIJC 2P1AA 2DYRC 2UUIA 3L8JA 2DI3A 4JEAA 3ZTMA 5HSWA 3C18A 1C03A 4PJMA 1T6UA 1QPUA 1XZPA 2MYSA 2V26A 1LS1A 3V5XA 5BUOA 2KYHA 3ZTZA 3O10A 3ASOC 5E3AA 3JCUQ 5KYXB 2EILC 2KJGA 2F22A 3EZIA 3I5QA 1UG7A 3A11A 5KYWB 5AC4A 2H7BA 1PCXA 4XEFA 1U0BB 5BQHA 2Q4FA 2MHRA 1U6HA 1BDJB 1HE1A 2LFDA 3LS0A 3CQZA 3RKOF 5A69A 1M2VA 4O6MA 3B0PA 2DGJA 4NTAA 1U89A 5CIVA 2R7OA 3UNGC 1AEPA 2ETSA 1NFNA 4JCHA 3TQOA 4NCQA 4E0HA 4LERA 4KI2A 2ZD9A 4XEKA 3BEHA 4HFFB 5JLIA 4Z9JA 1LVKA 1L3PA 5KYNA 5KYUA 3EJNA 1FAPB 4OD5A 5B3SC 2XRHA 4FAPB 2R7WA 3FVYA 3NKDA 1QKRA 5DQTA 2G3VA 2WL8A 1OCCC 3EFOB 4LACB 2OKUA 3MX3A 1TWCA 4GEHA 2IM8A 2GWWA 1DOVA 1M2OA 2QLAA 2NUTB 1LE4A 1OW6A 4BPMA 2HMQA 1BR2A 4YL1A 3FAPB 1Q0FA 4CX9A 1A7VA 4BEMJ 1RKEB 2BC5A 1H7IA 3IQCA 1Q0DA 3C8ZA 2VCCA 1OR3A 1I4ZA 3EHMA 2J8WA 4AE4B 1PD0A 2A1DD 4EHPA 1MMAA 1XWJA 3B0UX 4ZLCA 4W8PA 4G7OF 2R03A 4RDAA 1B68A 2NSFA 4JC7A 3B71A 5EHHA 1LS4A 3IHUA 3CEXA 4MVOA 1OW7A 1FFTC 4X0RA 3DJUB 2JPUA 3KH2A 1JR8A 3NRHA 4CS7A 5JSLA 2R7UA 4PJJA 2WVOA 2YL3A 2W45A 1TKNA 1O3UA 1MNDA 3LS1A 4NTBA 3S9OA 5L3VA 1S05A 5EK0A 4MTGA 1AVOB 3C8GD 4LLEA 1W2WA 2HSQA 4MVQA 2YLGA 3PMRA 4OD4A 1WN0A 1R4TA 2GFHA 3GORA 1T9KA 4JW1A 1TWHA 2J7PA 4LDQA 2ZXWC 3RIPA 3S27A 4CBEA 1E84A 1E86A 1ZHTA 4A2NB 2IYLD 2W4MA 2AWCA 3UGPA 1YA7O 4K1OA 3EH2A 4NC3A 3RQEA 5JT4A 2GDCA 2A68F 2OEVA 4IJJA 2ZXOA 4DXWA 3QZCA 4PR9A 4LLCA 2D5RB 3GWLA 1YZAA 2XLOA 4D4NA 3ZQVA 5L0JA 1V74B 2XXAA 4G78A 1EQ1A 5L0CA 3I4UA 3JTLO 3FMSA 3HTKC 3LAYA 1V54C 2FGYA 2L81A 4EIYA 4CSAC 4W8KA 1SMYF 2YVKA 3B9QA 3M79A 3DKAA 2WZLA 2J9UA 3H2VA 2KC3A 4OIRF 5A6BA 3C62A 4J32B 1LI5A 3K7DA 4E0IA 1M2VB 1CGME 1VB5A 4PK4A 4MTFA 1LM3B 2ZPAA 1N1CA 2KQ9A 2ZXPA 4CSAA 3SXKA 3N2ZB 1YJGA 1M6TA 2DB4A 1WTYA 2VB6A 4JIOA 3Q7LA 1O87A 3QVYA 3T4RA 3PDMP 3RF3A 2YQYA 2OG2A 5KYUB 3ABKC 4JTDB 2P7VA 2J45A 2XSEA 5DVWA 4Q5SF 2W4BA 3JZ0A 4HFKB 4XEVA 3MLGA 4ANJA 4J7TA 4PFOA 2R7QA 3HLZA 4IRUA 5F5HA 4EBKA 5JVEA 4P9TA 3ECSA 1Z63A 3U2LA 3W8HA 2Q9BA 4BJ6C 4NY3A 4CDYA 3SZRA 2YL7A 5JRAA 3AOUA 3GEHA 1XZQA 2E87A 5JS5A 5EGYA 4EKWA 3DM5A 1F1MA 1ZHXA 1WOLA 4JJGA 4YK5A 2Y3DA 4NTFA 4OINF 2CCYA 4O79A 1CPRA 3QTHA 4FESA 3TOLA 2A0BA 1ORSC 4BJ6A 1YARO 2R9RB 1TWGA 1WATA 4IB4A 4PJLA 1RJ9A 1WWPA 3TJ6A 4DRIB 4BJTA 3NMKA 1YZCA 2P6VA 5L3QA 1Q0MA 2A6HF 1RXQA 3DMDA 3ZIBA 4BJ1A 3ZDLA 1Q0GA 1LI7A 4P6IC 2GAQA 4CS8C
chains in the Genus database with same CATH topology
3S9OA 1OW6A 1ZZPA 5F28E 3TULA 2YWAA 3AJMA 3GM2A 1QVXA 3BRJA 3C8GD 2HSBA 2Q00A 3K7DA 2LK4A 1PV3A 3RQGA 3GM1A 1WOLA 3JYYA 3U0CA 2L6HA 4R32A 4XEKA 3RQFA 2PBEA 1K40A 1V4AA 1UFBA 3L8JA 1WTYA 3RQEA 3C18A 1KNYA 1K04A 3B71A 1KTMA 3U3FA 1WWPA 3C8GA 4EBJA 3O10A 1OW8A 4NQFA 3MFNA 1OW7A 3JZ0A 2L6FA 2JPUA 3C8GB 3GM3A 4XEVA 2KK1A 1JOGA 3L8IA 1K05A 4XEFA 1O3UA 2L6GA 2JX0A 4EBKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S9O A;  1OW6 A;  1ZZP A;  5F28 E;  3TUL A;  2YWA A;  3AJM A;  3GM2 A;  1QVX A;  3BRJ A;  3C8G D;  2HSB A;  2Q00 A;  3K7D A;  2LK4 A;  1PV3 A;  3RQG A;  3GM1 A;  1WOL A;  3JYY A;  3U0C A;  2L6H A;  4R32 A;  4XEK A;  3RQF A;  2PBE A;  1K40 A;  1V4A A;  1UFB A;  3L8J A;  1WTY A;  3RQE A;  3C18 A;  1KNY A;  1K04 A;  3B71 A;  1KTM A;  3U3F A;  1WWP A;  3C8G A;  4EBJ A;  3O10 A;  1OW8 A;  4NQF A;  3MFN A;  1OW7 A;  3JZ0 A;  2L6F A;  2JPU A;  3C8G B;  3GM3 A;  4XEV A;  2KK1 A;  1JOG A;  3L8I A;  1K05 A;  4XEF A;  1O3U A;  2L6G A;  2JX0 A;  4EBK A; 
#chains in the Genus database with same CATH topology
 3JRM O;  2H8A A;  2G3K A;  1T01 A;  1QVX A;  1YYJ A;  1VYI A;  3BRJ A;  1HE9 A;  5T3W A;  2NG1 A;  4CJG A;  2QE9 A;  4G7H F;  3ABL C;  4MVS A;  4I1M A;  3S84 A;  1C02 A;  3U0C A;  4KNW A;  2J0X A;  2CW0 F;  1L7C A;  1E83 A;  3U8P A;  3ATP A;  4CS8 A;  4C3B A;  1QQ3 A;  5CI8 A;  4K0D A;  4G0H A;  1WAS A;  2QUP A;  2QTV A;  4UDV A;  1C17 M;  1D1A A;  1RKC A;  5CI9 A;  3C8G A;  3J06 A;  4XLP F;  2C04 A;  2Q9A A;  2XLH A;  5HV9 A;  2X51 A;  2KK1 A;  4WGZ A;  4OIO F;  2XXA B;  1M56 C;  4M63 A;  2EPM X;  2R7T A;  3RYL A;  4JZA A;  1OKK D;  3TOM A;  3K33 A;  3RW0 A;  3QVZ A;  1PD1 A;  2R7X A;  3GM2 A;  4MVU A;  2R25 A;  2BE5 F;  2ZXR A;  3EG9 A;  4JKV A;  3W4Y A;  1JAF A;  2LFF A;  2R7R A;  1G4W R;  3H2U A;  5E3C A;  1GS9 A;  3DE8 A;  1PV3 A;  3KPH A;  3TD7 A;  3SXZ A;  3G4X A;  2AVK A;  2CDQ A;  2IXM A;  4JUR I;  4AL1 A;  5IY5 C;  3L1M A;  2XL4 A;  3HKK A;  2PF4 E;  5L0I A;  3KMI A;  4CDV A;  1HMD A;  2YLI A;  3S28 A;  2GA0 A;  2LD6 A;  1Z6A A;  4U5C E;  3CSK A;  3ZG1 A;  2EPK X;  1CGO A;  2XM0 A;  2XLW A;  4MVR A;  3IQT A;  3UR3 C;  5A6A A;  1HW1 A;  4DBR A;  3DJN B;  3N24 A;  4NQF A;  3HNL A;  3H65 A;  3VM6 A;  3U3B A;  4C7O A;  3VYW A;  3FOO A;  1LKX A;  1MNE A;  3AQB A;  3GAN A;  2OCC C;  1ORJ A;  2JD3 A;  3MBG A;  2EPL X;  1FTS A;  3PHF 2;  1A0B A;  4MS2 A;  2WB7 A;  1D0Y A;  2OJQ A;  1ZW3 A;  3C7J A;  4N06 A;  4FX5 A;  4O6Y A;  4EWC A;  2LQG A;  2VC9 A;  1Z3I X;  3E9V A;  3NYJ A;  2TMV P;  1FMV A;  2IXN A;  4DJ9 A;  4CS9 A;  5K0I A;  1TFO B;  4PAC A;  4U5E E;  1A7D A;  4R32 A;  1APC A;  2KSF A;  2YHS A;  1D1C A;  4HE8 D;  1KTM A;  2I8B A;  2VAS A;  3DD7 A;  3ASN C;  4CDA A;  2P0N A;  1ZYR F;  3U8V A;  3FDQ A;  1RJ9 B;  2VCA A;  2O9X A;  3T6B A;  4N4W A;  1VYK A;  3JRT A;  3W2W A;  5L0F A;  5L0H A;  1E85 A;  3S0X A;  3T9O A;  3DM9 B;  1EKY A;  1MMN A;  5T1D B;  4P9F A;  3V5Z A;  4C3D A;  2YRF A;  1NLX A;  3O55 A;  3EH1 A;  2X0C A;  5D92 A;  2AWY A;  2OOC A;  2YL0 A;  5JP7 A;  1R5I D;  4I3M A;  3R2P A;  1HW2 A;  4OIP F;  1OCO C;  2Y3G A;  5FZT A;  3VAY A;  1JMW A;  4U5B E;  2HFI A;  3AG3 C;  2I15 A;  3MYI A;  2H7O A;  2PBE A;  2XM4 A;  3LJB A;  1V4A A;  4FWV A;  4PJN A;  3LEO A;  3NMI A;  1KNY A;  2FAP B;  4IAR A;  5AC5 A;  2J9B A;  3K1I C;  2XLE A;  3U2M A;  3ZSU A;  2Q9C A;  2R7V A;  2J46 A;  3C8G B;  3LNR A;  1O5H A;  4D4X A;  3G4Z A;  3S29 A;  4YT2 A;  1ZHZ A;  4IAQ A;  2Y69 C;  1J8M F;  4IWB A;  4XQ1 A;  5AGF A;  2AU5 A;  4E7Z A;  3KL4 A;  3L34 A;  1ZZP A;  5F28 E;  4MVZ A;  3GEE A;  5B1B C;  2HJM A;  3WHN A;  3O39 A;  3L0I A;  2WZF A;  3SYN A;  2PNO A;  2W9Y A;  4XPY A;  1V55 C;  1D1B A;  1ZHY A;  3EGD A;  4CS9 C;  2HS5 A;  3EG9 B;  4MQ9 F;  1OR2 A;  256B A;  2NPU A;  3JYY A;  3DE9 A;  3DXJ F;  3QW0 A;  1M57 C;  4E17 A;  1TWA A;  5JUA A;  2ICW G;  3IQ5 A;  3R7C A;  4H4K C;  4K7B A;  2DYS C;  5T3T A;  2M64 A;  3EZH A;  1QLE C;  3EGX A;  3RVY A;  1JPJ A;  2H7V C;  1OKK A;  3RVZ A;  3IPM O;  3FXH A;  4PFP A;  4XWJ A;  3U9J A;  3T6J A;  2B0H A;  3U3F A;  2OEX A;  3OA1 A;  2ASR A;  5F5F A;  4EBJ A;  2J7P D;  1OW8 A;  4DRJ B;  3JT1 A;  2V3C C;  3ZC4 A;  2Y3B A;  2CNW D;  4BEJ A;  1K05 A;  2LCH A;  3DI5 A;  3CAX A;  1IZM A;  1LPE A;  1NFO A;  2J9W A;  2L6H A;  2WZG A;  4DVY P;  4YT8 A;  2Q3T A;  4XPX A;  1KU2 A;  2QY9 A;  3IEE A;  4Q4Z F;  2Z15 A;  1E2X A;  1IW7 F;  3FAJ A;  3UMK A;  3AGT A;  1H6G A;  3A9C A;  1Q0K A;  2L7A A;  1VTM P;  1OXK A;  1NU7 D;  5COF A;  2CGE A;  4A4A A;  3LNM B;  3GOD A;  5DS6 A;  2BL2 A;  3AG2 C;  4O7G A;  1GM5 A;  1UFB A;  1YAU O;  1I4Y A;  2XLV A;  3RFY A;  2IOQ A;  3WG7 C;  5A6B D;  1YA9 A;  3HNJ A;  3ZQY A;  2YZS A;  3G50 A;  4U9E A;  1CGN A;  3K1H A;  1ZU4 A;  3U5S A;  4WAB A;  2EIN C;  3DWW A;  1OXB A;  2Y3H A;  3US6 A;  1TR2 A;  2LSE A;  3NG1 A;  4JTC B;  3MFN A;  1T6I A;  2WVN A;  4Z9H A;  2HMZ A;  4U5G A;  3Q6N A;  1T5O A;  3L8I A;  1TQG A;  2MWQ A;  3CZ6 A;  1YDI A;  2XS8 A;  2PFD A;  1SF8 A;  3AGU A;  2KGO A;  1NBB A;  1MMD A;  4KNV A;  4XTK A;  4DBQ A;  5DS5 A;  1H9G A;  2PP4 A;  3AJM A;  2RD9 A;  1Z7Q c;  1FFH A;  2OQM A;  2HSB A;  3ABM C;  4U5H A;  2HUJ A;  4LDR A;  3JYH A;  4JTA B;  3UMH A;  2LK4 A;  5A6K A;  2VCB A;  1VK5 A;  3POV A;  5DS4 A;  3JSZ A;  3LLI A;  5KYY A;  3VRC A;  4QI2 A;  2NUP A;  2YEV A;  5B3I A;  3RQF A;  3NMJ A;  3EPV A;  3K6B A;  3VF0 A;  1EI7 A;  4DOZ A;  4OIQ F;  1HY5 A;  1OCR C;  2CYD A;  4ULW A;  4XLN F;  3Q7G A;  1GQA A;  1BR1 A;  5B1A C;  4AX2 A;  2J0W A;  2OU6 A;  2HV6 A;  2LP4 A;  1D0X A;  2G62 A;  2L9J A;  1SZI A;  2A69 F;  4WGY A;  3W8I A;  4KC9 A;  3SXY A;  2EPN A;  3FHD A;  2PX3 A;  3AQC A;  4MVM A;  3V7O A;  2L6F A;  4GQH A;  3WOD F;  4HEA J;  2NSG A;  3PCV A;  1T6Q A;  1NG1 A;  3AG1 C;  3EHN A;  4Q7C A;  3GWN A;  3LES A;  1YYX A;  2XS1 A;  3QMK A;  5L0G A;  2IBF A;  3HNK A;  5GPG B;  2C03 A;  3U9M A;  4BJ5 C;  2WVQ A;  1Z23 A;  5E2Q A;  3TUL A;  3LUT B;  2Q7R A;  3NKE A;  1SYQ A;  3OEO A;  2HKV A;  1TFK B;  3HJC A;  3N0T A;  3LLK A;  1J8Y F;  2OJE D;  4E18 A;  2QNL A;  3M15 A;  3RQG A;  4CIP A;  1CPQ A;  1ZU5 A;  1JPN A;  3EGD B;  2D4U A;  2EIK C;  3GM1 A;  3KYJ A;  2IXO A;  1LE2 A;  3NYM A;  3QW1 A;  4YJW A;  4Z9I A;  4EUK B;  4GYT A;  4MND A;  4BJ5 A;  1BR4 A;  2KW3 C;  2A6E F;  2YKZ A;  4JRZ A;  4MW8 A;  3M4B A;  4JEB A;  4DVZ A;  3EGX B;  3RH3 A;  5KYX A;  4C3E A;  2FFH A;  3ZVR A;  5KYW A;  2R05 A;  4J30 B;  1MMG A;  2M4E A;  4L6R A;  3O6X A;  1BZ4 A;  1JOG A;  4O6N A;  1FNT c;  1LIH A;  4IGG A;  4J7Y A;  3NDB B;  2JX0 A;  4QI0 A;  1SR2 A;  3M1C B;  5DQZ A;  3T6G B;  3KKB A;  4YN0 B;  5BQG A;  2R7S A;  2HJ3 A;  1HMO A;  2HZ8 A;  4IAO A;  4XPW A;  1D0Z A;  1VLS A;  5TJ5 E;  1ZHW A;  2EIM C;  2XLD A;  4EBB A;  3EQL F;  4CIH A;  1AUE A;  2XL6 A;  3SEO A;  4C7O B;  3C63 A;  2PX0 A;  1YLM A;  1Z5Z A;  4H54 A;  4JCZ A;  4BG0 A;  4AL0 A;  1WGW A;  3FOP A;  2CNW A;  4YT5 A;  1RMV A;  4YL3 A;  4KBL A;  4RBN A;  4WJ0 A;  5COM A;  1EA8 A;  3EFO A;  1G8X A;  3GEI A;  1I5N A;  1H9T A;  1NZE A;  3KYI A;  1OCZ C;  2R02 A;  3I5P A;  4JJF A;  4ZLD A;  3ZWI A;  3HNI A;  1NU9 C;  1A41 A;  3GM3 A;  2AP3 A;  2VH3 A;  5A6J A;  2HV7 A;  2NUT A;  1QSP A;  2UUH A;  3SXM A;  4I1O B;  3X1O A;  4DRH B;  3B0V C;  2IXP A;  4QDL A;  5FCL A;  1ST6 A;  4JE9 A;  1Y6D A;  5E33 A;  3IQ6 A;  3DZA A;  3W2V A;  2YWA A;  4N6H A;  1GGQ A;  1ZVZ A;  3ITF A;  1RKE A;  2P61 A;  2YLD A;  2Q00 A;  3JSE O;  1VMA A;  1FR0 A;  2B0J A;  3K1I A;  1G5Z A;  1S7Z A;  4RD9 A;  3V5Y A;  4E7S A;  2LIG A;  4AE4 A;  1VOM A;  1Y4C A;  5DLJ A;  1OQC A;  3S90 A;  1QZX A;  1ZW2 A;  3UGO A;  4YL0 A;  4N6C A;  5KYY B;  3DAG A;  2NUP B;  2J9V A;  4MW3 A;  1K04 A;  4U9D A;  3M4C A;  2EPO A;  4MTO A;  1A7E A;  2KNH A;  4B6I A;  1MQV A;  4LDK A;  2RSE B;  5L0D A;  1JRA A;  1NSG B;  4U5F E;  1RCP A;  3WAQ A;  3SNH A;  2YL1 A;  3TK0 A;  4U5D E;  4I44 A;  3X2Q C;  2L6G A;  3K66 A;  3OWT A;  4AK9 A;  4YT4 A;  1G4U S;  3F46 A;  4G7Z F;  2XL8 A;  3TJ5 A;  3MYF A;  4CJO A;  4JVS A;  3B29 A;  2Y39 A;  4ULV A;  4ER9 A;  1DOW A;  5BQI A;  1BBH A;  1VLT A;  1ORY A;  3LEV A;  3NYL A;  3Q6M A;  5D91 A;  3F47 A;  3DAF A;  3UMI A;  4YWQ A;  3E70 C;  4F4B A;  1FMW A;  2XLM A;  5COG A;  3AG4 C;  2A0U A;  3SP1 A;  1K40 A;  4ONS A;  1YVI A;  2EIJ C;  2P1A A;  2DYR C;  2UUI A;  3L8J A;  2DI3 A;  4JEA A;  3ZTM A;  5HSW A;  3C18 A;  1C03 A;  4PJM A;  1T6U A;  1QPU A;  1XZP A;  2MYS A;  2V26 A;  1LS1 A;  3V5X A;  5BUO A;  2KYH A;  3ZTZ A;  3O10 A;  3ASO C;  5E3A A;  3JCU Q;  5KYX B;  2EIL C;  2KJG A;  2F22 A;  3EZI A;  3I5Q A;  1UG7 A;  3A11 A;  5KYW B;  5AC4 A;  2H7B A;  1PCX A;  4XEF A;  1U0B B;  5BQH A;  2Q4F A;  2MHR A;  1U6H A;  1BDJ B;  1HE1 A;  2LFD A;  3LS0 A;  3CQZ A;  3RKO F;  5A69 A;  1M2V A;  4O6M A;  3B0P A;  2DGJ A;  4NTA A;  1U89 A;  5CIV A;  2R7O A;  3UNG C;  1AEP A;  2ETS A;  1NFN A;  4JCH A;  3TQO A;  4NCQ A;  4E0H A;  4LER A;  4KI2 A;  2ZD9 A;  4XEK A;  3BEH A;  4HFF B;  5JLI A;  4Z9J A;  1LVK A;  1L3P A;  5KYN A;  5KYU A;  3EJN A;  1FAP B;  4OD5 A;  5B3S C;  2XRH A;  4FAP B;  2R7W A;  3FVY A;  3NKD A;  1QKR A;  5DQT A;  2G3V A;  2WL8 A;  1OCC C;  3EFO B;  4LAC B;  2OKU A;  3MX3 A;  1TWC A;  4GEH A;  2IM8 A;  2GWW A;  1DOV A;  1M2O A;  2QLA A;  2NUT B;  1LE4 A;  1OW6 A;  4BPM A;  2HMQ A;  1BR2 A;  4YL1 A;  3FAP B;  1Q0F A;  4CX9 A;  1A7V A;  4BEM J;  1RKE B;  2BC5 A;  1H7I A;  3IQC A;  1Q0D A;  3C8Z A;  2VCC A;  1OR3 A;  1I4Z A;  3EHM A;  2J8W A;  4AE4 B;  1PD0 A;  2A1D D;  4EHP A;  1MMA A;  1XWJ A;  3B0U X;  4ZLC A;  4W8P A;  4G7O F;  2R03 A;  4RDA A;  1B68 A;  2NSF A;  4JC7 A;  3B71 A;  5EHH A;  1LS4 A;  3IHU A;  3CEX A;  4MVO A;  1OW7 A;  1FFT C;  4X0R A;  3DJU B;  2JPU A;  3KH2 A;  1JR8 A;  3NRH A;  4CS7 A;  5JSL A;  2R7U A;  4PJJ A;  2WVO A;  2YL3 A;  2W45 A;  1TKN A;  1O3U A;  1MND A;  3LS1 A;  4NTB A;  3S9O A;  5L3V A;  1S05 A;  5EK0 A;  4MTG A;  1AVO B;  3C8G D;  4LLE A;  1W2W A;  2HSQ A;  4MVQ A;  2YLG A;  3PMR A;  4OD4 A;  1WN0 A;  1R4T A;  2GFH A;  3GOR A;  1T9K A;  4JW1 A;  1TWH A;  2J7P A;  4LDQ A;  2ZXW C;  3RIP A;  3S27 A;  4CBE A;  1E84 A;  1E86 A;  1ZHT A;  4A2N B;  2IYL D;  2W4M A;  2AWC A;  3UGP A;  1YA7 O;  4K1O A;  3EH2 A;  4NC3 A;  3RQE A;  5JT4 A;  2GDC A;  2A68 F;  2OEV A;  4IJJ A;  2ZXO A;  4DXW A;  3QZC A;  4PR9 A;  4LLC A;  2D5R B;  3GWL A;  1YZA A;  2XLO A;  4D4N A;  3ZQV A;  5L0J A;  1V74 B;  2XXA A;  4G78 A;  1EQ1 A;  5L0C A;  3I4U A;  3JTL O;  3FMS A;  3HTK C;  3LAY A;  1V54 C;  2FGY A;  2L81 A;  4EIY A;  4CSA C;  4W8K A;  1SMY F;  2YVK A;  3B9Q A;  3M79 A;  3DKA A;  2WZL A;  2J9U A;  3H2V A;  2KC3 A;  4OIR F;  5A6B A;  3C62 A;  4J32 B;  1LI5 A;  3K7D A;  4E0I A;  1M2V B;  1CGM E;  1VB5 A;  4PK4 A;  4MTF A;  1LM3 B;  2ZPA A;  1N1C A;  2KQ9 A;  2ZXP A;  4CSA A;  3SXK A;  3N2Z B;  1YJG A;  1M6T A;  2DB4 A;  1WTY A;  2VB6 A;  4JIO A;  3Q7L A;  1O87 A;  3QVY A;  3T4R A;  3PDM P;  3RF3 A;  2YQY A;  2OG2 A;  5KYU B;  3ABK C;  4JTD B;  2P7V A;  2J45 A;  2XSE A;  5DVW A;  4Q5S F;  2W4B A;  3JZ0 A;  4HFK B;  4XEV A;  3MLG A;  4ANJ A;  4J7T A;  4PFO A;  2R7Q A;  3HLZ A;  4IRU A;  5F5H A;  4EBK A;  5JVE A;  4P9T A;  3ECS A;  1Z63 A;  3U2L A;  3W8H A;  2Q9B A;  4BJ6 C;  4NY3 A;  4CDY A;  3SZR A;  2YL7 A;  5JRA A;  3AOU A;  3GEH A;  1XZQ A;  2E87 A;  5JS5 A;  5EGY A;  4EKW A;  3DM5 A;  1F1M A;  1ZHX A;  1WOL A;  4JJG A;  4YK5 A;  2Y3D A;  4NTF A;  4OIN F;  2CCY A;  4O79 A;  1CPR A;  3QTH A;  4FES A;  3TOL A;  2A0B A;  1ORS C;  4BJ6 A;  1YAR O;  2R9R B;  1TWG A;  1WAT A;  4IB4 A;  4PJL A;  1RJ9 A;  1WWP A;  3TJ6 A;  4DRI B;  4BJT A;  3NMK A;  1YZC A;  2P6V A;  5L3Q A;  1Q0M A;  2A6H F;  1RXQ A;  3DMD A;  3ZIB A;  4BJ1 A;  3ZDL A;  1Q0G A;  1LI7 A;  4P6I C;  2GAQ A;  4CS8 C; 
#chains in the Genus database with same CATH homology
 3S9O A;  1OW6 A;  1ZZP A;  5F28 E;  3TUL A;  2YWA A;  3AJM A;  3GM2 A;  1QVX A;  3BRJ A;  3C8G D;  2HSB A;  2Q00 A;  3K7D A;  2LK4 A;  1PV3 A;  3RQG A;  3GM1 A;  1WOL A;  3JYY A;  3U0C A;  2L6H A;  4R32 A;  4XEK A;  3RQF A;  2PBE A;  1K40 A;  1V4A A;  1UFB A;  3L8J A;  1WTY A;  3RQE A;  3C18 A;  1KNY A;  1K04 A;  3B71 A;  1KTM A;  3U3F A;  1WWP A;  3C8G A;  4EBJ A;  3O10 A;  1OW8 A;  4NQF A;  3MFN A;  1OW7 A;  3JZ0 A;  2L6F A;  2JPU A;  3C8G B;  3GM3 A;  4XEV A;  2KK1 A;  1JOG A;  3L8I A;  1K05 A;  4XEF A;  1O3U A;  2L6G A;  2JX0 A;  4EBK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...