2YWAA

Crystal structure of uncharacterized conserved protein from thermus thermophilus hb8
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
115
structure length
115
Chain Sequence
ASLARAVERLKAALERPKDEFIRDSAIQRFEFTFELAWKTLKTFLELQGLEARSPRAAIRGAFQVGLLPEDPFWLEMLELRNLTNHTYDEALAERIYAELPKALERFQELLRRLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein TTHA0048
publication title Crystal structure of uncharacterized conserved protein from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
total genus 41
structure length 115
sequence length 115
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08780 NTase_sub_bind Nucleotidyltransferase substrate binding protein like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 2ywaA00
1WTYA 3MFNA 3C8GD 2KK1A 1O3UA 2JPUA 3B71A 1QVXA 3L8JA 1JOGA 4NQFA 1K40A 3JYYA 4XEKA 2Q00A 4XEFA 2L6HA 1PV3A 3C18A 3K7DA 2JX0A 3TULA 3AJMA 1WOLA 2PBEA 1K05A 3O10A 1WWPA 3C8GA 1OW8A 3GM2A 1KTMA 5F28E 3U0CA 3BRJA 4XEVA 1KNYA 2LK4A 1ZZPA 2L6FA 3RQGA 3U3FA 1V4AA 2HSBA 1OW7A 1K04A 3GM1A 3GM3A 3JZ0A 3S9OA 3L8IA 3RQEA 2L6GA 3RQFA 4EBKA 4R32A 4EBJA 1OW6A 1UFBA 2YWAA 3C8GB
chains in the Genus database with same CATH superfamily
3UR3C 1VLTA 2WVQA 2KNHA 3B9QA 3NMKA 4ULWA 2QNLA 2X51A 3B71A 3KH2A 1J8YF 1NU9C 4D4NA 4WGZA 3DMDA 4MS2A 3IHUA 4XQ1A 2NPUA 3QVYA 2O9XA 2HV7A 2B0HA 3G50A 3QW0A 3RFYA 4P9FA 1GQAA 1BZ4A 2JX0A 3LEOA 1U0BB 1V74B 2PBEA 3LUTB 2A6EF 2CNWA 3N24A 3EH1A 3EHMA 4I3MA 2NUTA 2MYSA 4BEMJ 5KYXA 2R7QA 4QI0A 4XEVA 3UGOA 1MNDA 1A0BA 3EH2A 4XPYA 1WASA 3ZG1A 4GEHA 2A6HF 2LCHA 5L0GA 4ER9A 3GM1A 4BJ6C 1CGME 2R7VA 1TWHA 2ZXPA 2R05A 5KYWB 5DQTA 3OEOA 1OR2A 4J30B 5E3CA 3SZRA 1ZYRF 5T3TA 1TWAA 3U2MA 1NBBA 4BJ6A 2F22A 1R4TA 2W4MA 1E2XA 1YYXA 2OOCA 5KYNA 5BQHA 3KYJA 3M79A 2LFFA 2CW0F 4JVSA 3IPMO 4HE8D 4PFOA 3ZTZA 2D5RB 5F5FA 1SR2A 2NSGA 4QDLA 3EQLF 1YZCA 2M64A 2XLHA 4I1OB 4G78A 3TQOA 1A7VA 2IM8A 3GEEA 1K05A 2XL4A 3ASNC 3NKDA 1HMOA 1C17M 4MVOA 4MTGA 2LK4A 3VM6A 1JR8A 4FESA 2H7VC 4RD9A 1ZZPA 3GANA 3FVYA 1D0ZA 1LE4A 4OIOF 4N6HA 3Q6MA 3LJBA 5L0FA 2XXAB 4EBKA 1Q0KA 1VB5A 3EJNA 3SXYA 1ZHZA 1FAPB 4C3BA 5JRAA 4Q5SF 2J9WA 4YL0A 4OINF 4J32B 1QKRA 3W8HA 3LAYA 4IJJA 3RW0A 1RJ9B 2J7PD 4KI2A 5T3WA 3ZIBA 3NYLA 3RH3A 3B29A 1RCPA 3FXHA 4FX5A 1Q0FA 2G62A 1MNEA 2HJ3A 4NTBA 5BQGA 3T6BA 1A7DA 1T6UA 1NG1A 1YZAA 3CSKA 2VCCA 3KKBA 2PP4A 2XM0A 3C63A 3RQGA 3U3FA 1K04A 2VC9A 3ITFA 4XLPF 3PMRA 2YKZA 2ZXRA 2QUPA 2CDQA 2LIGA 3HNKA 4IAQA 2CYDA 1B68A 1YARO 1UFBA 1YA9A 3ABKC 2GAQA 2NUPA 2P6VA 2PX0A 5JLIA 2R7RA 1YLMA 2HZ8A 1G8XA 2J9UA 3LESA 4JE9A 3WODF 3QVZA 2R03A 3EPVA 2OEVA 3ZQYA 3S0XA 1D1CA 5BQIA 2HMZA 2HSQA 2XRHA 3S84A 4U5BE 1M56C 4CDAA 1RKEA 1G5ZA 1BR4A 3GEHA 4YT4A 1OXKA 4B6IA 2DYRC 2ASRA 4MW3A 2H7BA 2YLDA 3V5ZA 4E7ZA 3U0CA 4JW1A 3L0IA 3A11A 3S90A 2D4UA 2NSFA 4BG0A 2IXPA 2HSBA 3GEIA 2DB4A 2ZD9A 2XL8A 3JZ0A 4IRUA 1YA7O 1NU7D 1SF8A 3TJ6A 2H8AA 1TWGA 1FTSA 2R9RB 3BEHA 2R7WA 2W45A 5K0IA 3ZQVA 4MVUA 3US6A 1OR3A 4MTOA 3IQCA 3RIPA 4A2NB 2QY9A 3PCVA 4N4WA 5E3AA 3UMHA 2R25A 2J0XA 5L0HA 1CGOA 3ATPA 4U5GA 1FNTc 3GWNA 4OIPF 5F5HA 2XL6A 2Q7RA 2L6HA 3E70C 2EPMX 4LDQA 2OCCC 3K1IC 5KYWA 1LS4A 1Q0MA 3DJNB 4OD5A 3W4YA 5DLJA 1OKKD 2OEXA 3AJMA 5A6BA 4BJ1A 1WWPA 1ZHYA 2J8WA 4K7BA 1M57C 3GODA 1ZW3A 3K1IA 3OA1A 3N0TA 3UMIA 1MMGA 4U5CE 2W9YA 4E7SA 2YRFA 1S7ZA 1QQ3A 3EGXB 3PHF2 2XSEA 3S9OA 2Y39A 4W8PA 1T6IA 2EILC 2AP3A 5B1AC 4EUKB 2Q4FA 1SZIA 3LEVA 1T6QA 2IXNA 2V3CC 2Q9BA 3Q6NA 2TMVP 1GS9A 1VLSA 1TR2A 1FMVA 1HE9A 4I44A 4CJOA 5HSWA 3B0VC 1EKYA 3L8JA 1LS1A 3U9JA 3Q7GA 2OJQA 2G3KA 4IARA 5KYYA 3RVYA 1QPUA 4XEFA 1DOVA 5JP7A 4CBEA 1HW2A 3J06A 4YT2A 2C03A 4CS7A 1XZQA 3C18A 2XXAA 4E0IA 2UUHA 4YT8A 1LE2A 1AVOB 3O39A 5EK0A 1GGQA 3K33A 5CI8A 3AG3C 5JSLA 2CGEA 5EGYA 3U2LA 2C04A 1T9KA 1Z3IX 3IEEA 2J0WA 2Y3BA 1RJ9A 3V5YA 1E84A 2DYSC 4K0DA 2MHRA 2VH3A 3EZHA 1YVIA 3KPHA 1T01A 1HW1A 3H65A 2QLAA 4JEAA 5DQZA 2ICWG 2DGJA 4DBQA 5L0JA 4XPWA 4NY3A 3FDQA 5FZTA 2KK1A 3NYJA 1FMWA 2LP4A 3RYLA 1MQVA 1Z5ZA 1Y6DA 1DOWA 2V26A 1NLXA 1YJGA 2YL3A 3DZAA 3U3BA 2HFIA 2I15A 4BJTA 5A6BD 3AG1C 2Q00A 1JAFA 1N1CA 4PK4A 3SXZA 1SYQA 4Z9HA 1ZHTA 1PV3A 2YQYA 3DJUB 2H7OA 1VMAA 1HY5A 1WATA 3DM9B 1W2WA 4ZLDA 1TQGA 3O10A 2HMQA 2AVKA 2KJGA 4KNVA 3LLKA 4N06A 4NC3A 4O6NA 3Q7LA 3JRTA 5F28E 1JMWA 4U5EE 4J7YA 5CIVA 1TFOB 1V4AA 3LLIA 1ZVZA 2A68F 4LACB 4MNDA 2CCYA 4BEJA 1LM3B 2J7PA 1C02A 4DOZA 4WGYA 1J8MF 3RQFA 3NDBB 256BA 1RKCA 2QE9A 3K1HA 4R32A 2B0JA 3EZIA 3DE8A 2YVKA 4MQ9F 4JJFA 2P61A 4AL0A 1LPEA 1JPJA 3EHNA 4CS9C 4O6YA 2UUIA 4DRHB 1SMYF 2FGYA 4XEKA 4JC7A 1CGNA 1MMDA 4DVZA 3PDMP 3A9CA 4CS9A 2EIKC 2FFHA 2G3VA 4FWVA 3S29A 3K7DA 1ZHWA 4PJNA 4K1OA 1WOLA 2BE5F 4E18A 1D0XA 3NKEA 5A6JA 1G4WR 1RXQA 4YJWA 1M2VA 1VTMP 3G4XA 3U8PA 2YLGA 1H9TA 1OW7A 3AG4C 3C8ZA 2HJMA 1T5OA 4L6RA 4CDVA 4IGGA 4G7OF 4CS8C 1ST6A 4AL1A 1UG7A 3RQEA 2KW3C 4YT5A 4MVZA 4W8KA 1AEPA 1U89A 2KC3A 3QMKA 1OCZC 4JEBA 3C8GD 4MVSA 3U8VA 4FAPB 2AU5A 5L0CA 4CS8A 1NFNA 4JTAB 3EFOB 4JURI 2Q9AA 1O87A 2XM4A 5FCLA 4ULVA 5KYYB 2GFHA 4JRZA 4ANJA 1LKXA 3I5QA 3H2VA 4JTCB 4LDRA 4ZLCA 2AWYA 1BBHA 4LLEA 5KYUB 2VCBA 3T6GB 2YL1A 5DS5A 3EG9B 4IB4A 3NYMA 3O6XA 2YZSA 2R7SA 2Q3TA 2R7OA 3WAQA 4AK9A 3V5XA 2DI3A 3U5SA 2IXMA 3T4RA 2XLOA 2EPKX 2R7TA 2Z15A 1L7CA 4KNWA 3DAFA 3L1MA 2WL8A 5A69A 5E33A 2NG1A 1VYKA 2LD6A 3C8GB 4JIOA 3MX3A 4MVRA 1OKKA 3DKAA 2PFDA 5IY5C 3ECSA 2L9JA 5GPGB 2LQGA 1C03A 4NTFA 1XWJA 3KYIA 1MMNA 2IOQA 3HKKA 1OCRC 2VCAA 3KMIA 1A41A 4H54A 2YL7A 4U9DA 3JCUQ 2J9BA 2VASA 2KYHA 4U5FE 2WVNA 4D4XA 3SXMA 3DAGA 3QW1A 3FMSA 4XWJA 1HMDA 3M15A 2XLVA 4PFPA 5B3IA 4C3DA 1YDIA 3OWTA 1YYJA 2VB6A 4NTAA 3CZ6A 5A6KA 4G0HA 4OIRF 5L3QA 3RVZA 1XZPA 3F47A 2GWWA 4G7HF 1OCOC 1G4US 3FOPA 4HFKB 3C7JA 1D1BA 4CIPA 2M4EA 4G7ZF 4AE4B 4MW8A 1FFHA 2YLIA 4GYTA 2XLMA 3JRMO 4DBRA 4EBBA 1ORYA 2I8BA 4OIQF 1GM5A 5COMA 1Q0GA 4M63A 2OKUA 1OXBA 2ETSA 3N2ZB 1HE1A 3MLGA 3SNHA 1OW8A 1LI7A 2RD9A 2P7VA 4C7OB 3S27A 3JYHA 2OQMA 3TK0A 2EIMC 5JVEA 3DWWA 5B3SC 2J45A 1CPRA 2IYLD 2IBFA 3X1OA 4DRJB 1EQ1A 1A7EA 1I5NA 3FHDA 5JT4A 3T6JA 1Y4CA 4Q4ZF 1BR1A 1JRAA 1TWCA 2A1DD 1TFKB 1QZXA 2HS5A 2J9VA 4J7TA 3AGTA 4O79A 4JCHA 4YWQA 1PCXA 4EWCA 3EGDB 1D1AA 3MYFA 1H9GA 2OU6A 4CIHA 3SYNA 1S05A 3X2QC 4HFFB 1M2OA 1VYIA 3TJ5A 2XS8A 2BC5A 2P1AA 1V55C 1KU2A 3LS0A 2YHSA 3VYWA 3EFOA 3ABMC 3ZSUA 3GWLA 2EINC 4JTDB 2L6FA 2L81A 2XLEA 4PJLA 3SP1A 1BDJB 3W2WA 3W8IA 5DS4A 3GM3A 2Y3HA 5AC5A 5JUAA 1EI7A 1VOMA 3U9MA 3V7OA 3T9OA 5KYUA 1WN0A 1U6HA 2MWQA 4CJGA 2CNWD 3TOLA 1WGWA 4IWBA 3EG9A 4YL1A 4UDVA 3MFNA 1E86A 4Z9IA 2JPUA 3M1CB 4IAOA 4CDYA 1ORSC 3GORA 3VRCA 3HNLA 3CAXA 4BPMA 1AUEA 1ZU5A 3JT1A 4MVMA 1IZMA 2YL0A 4YL3A 2E87A 3ZWIA 3H2UA 4C3EA 3NMIA 5A6AA 5BUOA 2WZLA 2R7UA 4XLNF 4DXWA 3FOOA 1Z7Qc 2HV6A 1MMAA 4PR9A 2HKVA 3AOUA 2AWCA 3DI5A 3UMKA 2A0UA 3JSZA 5T1DB 3C8GA 1I4YA 3M4BA 1KNYA 4WJ0A 4MVQA 2BL2A 4LLCA 1Q0DA 4PJJA 3VAYA 4BJ5C 5AGFA 1RMVA 3B0UX 3C62A 1H6GA 1R5ID 3IQ5A 4WABA 3QTHA 5EHHA 4BJ5A 1F1MA 1LIHA 2L7AA 3MYIA 3SEOA 5L0IA 4U5DE 2GA0A 2NUTB 4JZAA 4PACA 3UNGC 3AG2C 3CQZA 4I1MA 5KYXB 1WTYA 4P6IC 4O7GA 1E83A 1O3UA 1D0YA 3HNIA 3IQ6A 3HJCA 4NCQA 4P9TA 3ZTMA 3JYYA 2J46A 2KSFA 1Z23A 2ZXWC 3M4CA 4LDKA 5TJ5E 5B1BC 3G4ZA 3AGUA 3EGXA 1LVKA 2KGOA 2XLWA 2Q9CA 2IXOA 2P0NA 3B0PA 3VF0A 2R02A 3MBGA 1I4ZA 2PF4E 3FAJA 3JSEO 1BR2A 3GM2A 4JCZA 4ONSA 4AE4A 3ASOC 5HV9A 4GQHA 5L0DA 4XTKA 4QI2A 5DS6A 4XPXA 4E17A 3ZDLA 1APCA 2HUJA 4N6CA 3UGPA 1NZEA 1L3PA 4MTFA 3RKOF 3R7CA 3DXJF 4EBJA 3RF3A 2GDCA 5D92A 1Z63A 2YWAA 4U5HA 4LERA 4JJGA 1EA8A 2PX3A 1ZHXA 2ZXOA 3NMJA 2EPOA 3ABLC 3HTKC 3ZC4A 4AX2A 4DVYP 1LI5A 1QVXA 2WZGA 4C7OA 3AQBA 3DM5A 1NFOA 1CPQA 3QZCA 3JTLO 4YN0B 2JD3A 2EIJC 2LFDA 2WB7A 1V54C 3LNMB 5COGA 3F46A 1FR0A 2YEVA 4JKVA 1H7IA 4PJMA 3TULA 1M6TA 4CSAC 4HEAJ 5CI9A 3LS1A 1Z6AA 2QTVA 1KTMA 3DD7A 5E2QA 3BRJA 4H4KC 3WG7C 4CSAA 5L3VA 4EIYA 2X0CA 2A0BA 2Y3GA 2XS1A 2WZFA 1ZU4A 3WHNA 1YAUO 2RSEB 3I5PA 3LNRA 3EGDA 3L8IA 2KQ9A 3KL4A 4RDAA 4DRIB 1ZW2A 3NG1A 4Q7CA 1M2VB 4E0HA 2FAPB 1IW7F 4OD4A 3AQCA 1JOGA 4NQFA 5DVWA 1ORJA 3S28A 3TD7A 4X0RA 2Y69C 1K40A 3L34A 4O6MA 3W2VA 3IQTA 1TKNA 2EPLX 1PD0A 2LSEA 5AC4A 1E85A 1O5HA 2OG2A 2OJED 2W4BA 3HNJA 4DJ9A 2XLDA 1FFTC 1QSPA 2NUPB 3E9VA 4KBLA 3POVA 4YK5A 1OQCA 3K66A 1QLEC 1VK5A 3CEXA 3NRHA 2R7XA 3TOMA 5COFA 1JPNA 3HLZA 4Z9JA 3DE9A 4KC9A 2ZPAA 3R2PA 3I4UA 2EPNA 2PNOA 3K6BA 3ZVRA 1OCCC 4U9EA 4EKWA 4A4AA 4F4BA 5JS5A 1NSGB 1RKEB 2L6GA 3O55A 2Y3DA 4RBNA 3FAPB 5D91A 2WVOA 3SXKA 1OW6A 1PD1A 2A69F 4EHPA 4CX9A
chains in the Genus database with same CATH topology
1WTYA 3MFNA 3C8GD 2KK1A 1O3UA 2JPUA 3B71A 1QVXA 3L8JA 1JOGA 4NQFA 1K40A 3JYYA 4XEKA 2Q00A 4XEFA 2L6HA 1PV3A 3C18A 3K7DA 2JX0A 3TULA 3AJMA 1WOLA 2PBEA 1K05A 3O10A 1WWPA 3C8GA 1OW8A 3GM2A 1KTMA 5F28E 3U0CA 3BRJA 4XEVA 1KNYA 2LK4A 1ZZPA 2L6FA 3RQGA 3U3FA 1V4AA 2HSBA 1OW7A 1K04A 3GM1A 3GM3A 3JZ0A 3S9OA 3L8IA 3RQEA 2L6GA 3RQFA 4EBKA 4R32A 4EBJA 1OW6A 1UFBA 2YWAA 3C8GB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WTY A;  3MFN A;  3C8G D;  2KK1 A;  1O3U A;  2JPU A;  3B71 A;  1QVX A;  3L8J A;  1JOG A;  4NQF A;  1K40 A;  3JYY A;  4XEK A;  2Q00 A;  4XEF A;  2L6H A;  1PV3 A;  3C18 A;  3K7D A;  2JX0 A;  3TUL A;  3AJM A;  1WOL A;  2PBE A;  1K05 A;  3O10 A;  1WWP A;  3C8G A;  1OW8 A;  3GM2 A;  1KTM A;  5F28 E;  3U0C A;  3BRJ A;  4XEV A;  1KNY A;  2LK4 A;  1ZZP A;  2L6F A;  3RQG A;  3U3F A;  1V4A A;  2HSB A;  1OW7 A;  1K04 A;  3GM1 A;  3GM3 A;  3JZ0 A;  3S9O A;  3L8I A;  3RQE A;  2L6G A;  3RQF A;  4EBK A;  4R32 A;  4EBJ A;  1OW6 A;  1UFB A;  2YWA A;  3C8G B; 
#chains in the Genus database with same CATH topology
 3UR3 C;  1VLT A;  2WVQ A;  2KNH A;  3B9Q A;  3NMK A;  4ULW A;  2QNL A;  2X51 A;  3B71 A;  3KH2 A;  1J8Y F;  1NU9 C;  4D4N A;  4WGZ A;  3DMD A;  4MS2 A;  3IHU A;  4XQ1 A;  2NPU A;  3QVY A;  2O9X A;  2HV7 A;  2B0H A;  3G50 A;  3QW0 A;  3RFY A;  4P9F A;  1GQA A;  1BZ4 A;  2JX0 A;  3LEO A;  1U0B B;  1V74 B;  2PBE A;  3LUT B;  2A6E F;  2CNW A;  3N24 A;  3EH1 A;  3EHM A;  4I3M A;  2NUT A;  2MYS A;  4BEM J;  5KYX A;  2R7Q A;  4QI0 A;  4XEV A;  3UGO A;  1MND A;  1A0B A;  3EH2 A;  4XPY A;  1WAS A;  3ZG1 A;  4GEH A;  2A6H F;  2LCH A;  5L0G A;  4ER9 A;  3GM1 A;  4BJ6 C;  1CGM E;  2R7V A;  1TWH A;  2ZXP A;  2R05 A;  5KYW B;  5DQT A;  3OEO A;  1OR2 A;  4J30 B;  5E3C A;  3SZR A;  1ZYR F;  5T3T A;  1TWA A;  3U2M A;  1NBB A;  4BJ6 A;  2F22 A;  1R4T A;  2W4M A;  1E2X A;  1YYX A;  2OOC A;  5KYN A;  5BQH A;  3KYJ A;  3M79 A;  2LFF A;  2CW0 F;  4JVS A;  3IPM O;  4HE8 D;  4PFO A;  3ZTZ A;  2D5R B;  5F5F A;  1SR2 A;  2NSG A;  4QDL A;  3EQL F;  1YZC A;  2M64 A;  2XLH A;  4I1O B;  4G78 A;  3TQO A;  1A7V A;  2IM8 A;  3GEE A;  1K05 A;  2XL4 A;  3ASN C;  3NKD A;  1HMO A;  1C17 M;  4MVO A;  4MTG A;  2LK4 A;  3VM6 A;  1JR8 A;  4FES A;  2H7V C;  4RD9 A;  1ZZP A;  3GAN A;  3FVY A;  1D0Z A;  1LE4 A;  4OIO F;  4N6H A;  3Q6M A;  3LJB A;  5L0F A;  2XXA B;  4EBK A;  1Q0K A;  1VB5 A;  3EJN A;  3SXY A;  1ZHZ A;  1FAP B;  4C3B A;  5JRA A;  4Q5S F;  2J9W A;  4YL0 A;  4OIN F;  4J32 B;  1QKR A;  3W8H A;  3LAY A;  4IJJ A;  3RW0 A;  1RJ9 B;  2J7P D;  4KI2 A;  5T3W A;  3ZIB A;  3NYL A;  3RH3 A;  3B29 A;  1RCP A;  3FXH A;  4FX5 A;  1Q0F A;  2G62 A;  1MNE A;  2HJ3 A;  4NTB A;  5BQG A;  3T6B A;  1A7D A;  1T6U A;  1NG1 A;  1YZA A;  3CSK A;  2VCC A;  3KKB A;  2PP4 A;  2XM0 A;  3C63 A;  3RQG A;  3U3F A;  1K04 A;  2VC9 A;  3ITF A;  4XLP F;  3PMR A;  2YKZ A;  2ZXR A;  2QUP A;  2CDQ A;  2LIG A;  3HNK A;  4IAQ A;  2CYD A;  1B68 A;  1YAR O;  1UFB A;  1YA9 A;  3ABK C;  2GAQ A;  2NUP A;  2P6V A;  2PX0 A;  5JLI A;  2R7R A;  1YLM A;  2HZ8 A;  1G8X A;  2J9U A;  3LES A;  4JE9 A;  3WOD F;  3QVZ A;  2R03 A;  3EPV A;  2OEV A;  3ZQY A;  3S0X A;  1D1C A;  5BQI A;  2HMZ A;  2HSQ A;  2XRH A;  3S84 A;  4U5B E;  1M56 C;  4CDA A;  1RKE A;  1G5Z A;  1BR4 A;  3GEH A;  4YT4 A;  1OXK A;  4B6I A;  2DYR C;  2ASR A;  4MW3 A;  2H7B A;  2YLD A;  3V5Z A;  4E7Z A;  3U0C A;  4JW1 A;  3L0I A;  3A11 A;  3S90 A;  2D4U A;  2NSF A;  4BG0 A;  2IXP A;  2HSB A;  3GEI A;  2DB4 A;  2ZD9 A;  2XL8 A;  3JZ0 A;  4IRU A;  1YA7 O;  1NU7 D;  1SF8 A;  3TJ6 A;  2H8A A;  1TWG A;  1FTS A;  2R9R B;  3BEH A;  2R7W A;  2W45 A;  5K0I A;  3ZQV A;  4MVU A;  3US6 A;  1OR3 A;  4MTO A;  3IQC A;  3RIP A;  4A2N B;  2QY9 A;  3PCV A;  4N4W A;  5E3A A;  3UMH A;  2R25 A;  2J0X A;  5L0H A;  1CGO A;  3ATP A;  4U5G A;  1FNT c;  3GWN A;  4OIP F;  5F5H A;  2XL6 A;  2Q7R A;  2L6H A;  3E70 C;  2EPM X;  4LDQ A;  2OCC C;  3K1I C;  5KYW A;  1LS4 A;  1Q0M A;  3DJN B;  4OD5 A;  3W4Y A;  5DLJ A;  1OKK D;  2OEX A;  3AJM A;  5A6B A;  4BJ1 A;  1WWP A;  1ZHY A;  2J8W A;  4K7B A;  1M57 C;  3GOD A;  1ZW3 A;  3K1I A;  3OA1 A;  3N0T A;  3UMI A;  1MMG A;  4U5C E;  2W9Y A;  4E7S A;  2YRF A;  1S7Z A;  1QQ3 A;  3EGX B;  3PHF 2;  2XSE A;  3S9O A;  2Y39 A;  4W8P A;  1T6I A;  2EIL C;  2AP3 A;  5B1A C;  4EUK B;  2Q4F A;  1SZI A;  3LEV A;  1T6Q A;  2IXN A;  2V3C C;  2Q9B A;  3Q6N A;  2TMV P;  1GS9 A;  1VLS A;  1TR2 A;  1FMV A;  1HE9 A;  4I44 A;  4CJO A;  5HSW A;  3B0V C;  1EKY A;  3L8J A;  1LS1 A;  3U9J A;  3Q7G A;  2OJQ A;  2G3K A;  4IAR A;  5KYY A;  3RVY A;  1QPU A;  4XEF A;  1DOV A;  5JP7 A;  4CBE A;  1HW2 A;  3J06 A;  4YT2 A;  2C03 A;  4CS7 A;  1XZQ A;  3C18 A;  2XXA A;  4E0I A;  2UUH A;  4YT8 A;  1LE2 A;  1AVO B;  3O39 A;  5EK0 A;  1GGQ A;  3K33 A;  5CI8 A;  3AG3 C;  5JSL A;  2CGE A;  5EGY A;  3U2L A;  2C04 A;  1T9K A;  1Z3I X;  3IEE A;  2J0W A;  2Y3B A;  1RJ9 A;  3V5Y A;  1E84 A;  2DYS C;  4K0D A;  2MHR A;  2VH3 A;  3EZH A;  1YVI A;  3KPH A;  1T01 A;  1HW1 A;  3H65 A;  2QLA A;  4JEA A;  5DQZ A;  2ICW G;  2DGJ A;  4DBQ A;  5L0J A;  4XPW A;  4NY3 A;  3FDQ A;  5FZT A;  2KK1 A;  3NYJ A;  1FMW A;  2LP4 A;  3RYL A;  1MQV A;  1Z5Z A;  1Y6D A;  1DOW A;  2V26 A;  1NLX A;  1YJG A;  2YL3 A;  3DZA A;  3U3B A;  2HFI A;  2I15 A;  4BJT A;  5A6B D;  3AG1 C;  2Q00 A;  1JAF A;  1N1C A;  4PK4 A;  3SXZ A;  1SYQ A;  4Z9H A;  1ZHT A;  1PV3 A;  2YQY A;  3DJU B;  2H7O A;  1VMA A;  1HY5 A;  1WAT A;  3DM9 B;  1W2W A;  4ZLD A;  1TQG A;  3O10 A;  2HMQ A;  2AVK A;  2KJG A;  4KNV A;  3LLK A;  4N06 A;  4NC3 A;  4O6N A;  3Q7L A;  3JRT A;  5F28 E;  1JMW A;  4U5E E;  4J7Y A;  5CIV A;  1TFO B;  1V4A A;  3LLI A;  1ZVZ A;  2A68 F;  4LAC B;  4MND A;  2CCY A;  4BEJ A;  1LM3 B;  2J7P A;  1C02 A;  4DOZ A;  4WGY A;  1J8M F;  3RQF A;  3NDB B;  256B A;  1RKC A;  2QE9 A;  3K1H A;  4R32 A;  2B0J A;  3EZI A;  3DE8 A;  2YVK A;  4MQ9 F;  4JJF A;  2P61 A;  4AL0 A;  1LPE A;  1JPJ A;  3EHN A;  4CS9 C;  4O6Y A;  2UUI A;  4DRH B;  1SMY F;  2FGY A;  4XEK A;  4JC7 A;  1CGN A;  1MMD A;  4DVZ A;  3PDM P;  3A9C A;  4CS9 A;  2EIK C;  2FFH A;  2G3V A;  4FWV A;  3S29 A;  3K7D A;  1ZHW A;  4PJN A;  4K1O A;  1WOL A;  2BE5 F;  4E18 A;  1D0X A;  3NKE A;  5A6J A;  1G4W R;  1RXQ A;  4YJW A;  1M2V A;  1VTM P;  3G4X A;  3U8P A;  2YLG A;  1H9T A;  1OW7 A;  3AG4 C;  3C8Z A;  2HJM A;  1T5O A;  4L6R A;  4CDV A;  4IGG A;  4G7O F;  4CS8 C;  1ST6 A;  4AL1 A;  1UG7 A;  3RQE A;  2KW3 C;  4YT5 A;  4MVZ A;  4W8K A;  1AEP A;  1U89 A;  2KC3 A;  3QMK A;  1OCZ C;  4JEB A;  3C8G D;  4MVS A;  3U8V A;  4FAP B;  2AU5 A;  5L0C A;  4CS8 A;  1NFN A;  4JTA B;  3EFO B;  4JUR I;  2Q9A A;  1O87 A;  2XM4 A;  5FCL A;  4ULV A;  5KYY B;  2GFH A;  4JRZ A;  4ANJ A;  1LKX A;  3I5Q A;  3H2V A;  4JTC B;  4LDR A;  4ZLC A;  2AWY A;  1BBH A;  4LLE A;  5KYU B;  2VCB A;  3T6G B;  2YL1 A;  5DS5 A;  3EG9 B;  4IB4 A;  3NYM A;  3O6X A;  2YZS A;  2R7S A;  2Q3T A;  2R7O A;  3WAQ A;  4AK9 A;  3V5X A;  2DI3 A;  3U5S A;  2IXM A;  3T4R A;  2XLO A;  2EPK X;  2R7T A;  2Z15 A;  1L7C A;  4KNW A;  3DAF A;  3L1M A;  2WL8 A;  5A69 A;  5E33 A;  2NG1 A;  1VYK A;  2LD6 A;  3C8G B;  4JIO A;  3MX3 A;  4MVR A;  1OKK A;  3DKA A;  2PFD A;  5IY5 C;  3ECS A;  2L9J A;  5GPG B;  2LQG A;  1C03 A;  4NTF A;  1XWJ A;  3KYI A;  1MMN A;  2IOQ A;  3HKK A;  1OCR C;  2VCA A;  3KMI A;  1A41 A;  4H54 A;  2YL7 A;  4U9D A;  3JCU Q;  2J9B A;  2VAS A;  2KYH A;  4U5F E;  2WVN A;  4D4X A;  3SXM A;  3DAG A;  3QW1 A;  3FMS A;  4XWJ A;  1HMD A;  3M15 A;  2XLV A;  4PFP A;  5B3I A;  4C3D A;  1YDI A;  3OWT A;  1YYJ A;  2VB6 A;  4NTA A;  3CZ6 A;  5A6K A;  4G0H A;  4OIR F;  5L3Q A;  3RVZ A;  1XZP A;  3F47 A;  2GWW A;  4G7H F;  1OCO C;  1G4U S;  3FOP A;  4HFK B;  3C7J A;  1D1B A;  4CIP A;  2M4E A;  4G7Z F;  4AE4 B;  4MW8 A;  1FFH A;  2YLI A;  4GYT A;  2XLM A;  3JRM O;  4DBR A;  4EBB A;  1ORY A;  2I8B A;  4OIQ F;  1GM5 A;  5COM A;  1Q0G A;  4M63 A;  2OKU A;  1OXB A;  2ETS A;  3N2Z B;  1HE1 A;  3MLG A;  3SNH A;  1OW8 A;  1LI7 A;  2RD9 A;  2P7V A;  4C7O B;  3S27 A;  3JYH A;  2OQM A;  3TK0 A;  2EIM C;  5JVE A;  3DWW A;  5B3S C;  2J45 A;  1CPR A;  2IYL D;  2IBF A;  3X1O A;  4DRJ B;  1EQ1 A;  1A7E A;  1I5N A;  3FHD A;  5JT4 A;  3T6J A;  1Y4C A;  4Q4Z F;  1BR1 A;  1JRA A;  1TWC A;  2A1D D;  1TFK B;  1QZX A;  2HS5 A;  2J9V A;  4J7T A;  3AGT A;  4O79 A;  4JCH A;  4YWQ A;  1PCX A;  4EWC A;  3EGD B;  1D1A A;  3MYF A;  1H9G A;  2OU6 A;  4CIH A;  3SYN A;  1S05 A;  3X2Q C;  4HFF B;  1M2O A;  1VYI A;  3TJ5 A;  2XS8 A;  2BC5 A;  2P1A A;  1V55 C;  1KU2 A;  3LS0 A;  2YHS A;  3VYW A;  3EFO A;  3ABM C;  3ZSU A;  3GWL A;  2EIN C;  4JTD B;  2L6F A;  2L81 A;  2XLE A;  4PJL A;  3SP1 A;  1BDJ B;  3W2W A;  3W8I A;  5DS4 A;  3GM3 A;  2Y3H A;  5AC5 A;  5JUA A;  1EI7 A;  1VOM A;  3U9M A;  3V7O A;  3T9O A;  5KYU A;  1WN0 A;  1U6H A;  2MWQ A;  4CJG A;  2CNW D;  3TOL A;  1WGW A;  4IWB A;  3EG9 A;  4YL1 A;  4UDV A;  3MFN A;  1E86 A;  4Z9I A;  2JPU A;  3M1C B;  4IAO A;  4CDY A;  1ORS C;  3GOR A;  3VRC A;  3HNL A;  3CAX A;  4BPM A;  1AUE A;  1ZU5 A;  3JT1 A;  4MVM A;  1IZM A;  2YL0 A;  4YL3 A;  2E87 A;  3ZWI A;  3H2U A;  4C3E A;  3NMI A;  5A6A A;  5BUO A;  2WZL A;  2R7U A;  4XLN F;  4DXW A;  3FOO A;  1Z7Q c;  2HV6 A;  1MMA A;  4PR9 A;  2HKV A;  3AOU A;  2AWC A;  3DI5 A;  3UMK A;  2A0U A;  3JSZ A;  5T1D B;  3C8G A;  1I4Y A;  3M4B A;  1KNY A;  4WJ0 A;  4MVQ A;  2BL2 A;  4LLC A;  1Q0D A;  4PJJ A;  3VAY A;  4BJ5 C;  5AGF A;  1RMV A;  3B0U X;  3C62 A;  1H6G A;  1R5I D;  3IQ5 A;  4WAB A;  3QTH A;  5EHH A;  4BJ5 A;  1F1M A;  1LIH A;  2L7A A;  3MYI A;  3SEO A;  5L0I A;  4U5D E;  2GA0 A;  2NUT B;  4JZA A;  4PAC A;  3UNG C;  3AG2 C;  3CQZ A;  4I1M A;  5KYX B;  1WTY A;  4P6I C;  4O7G A;  1E83 A;  1O3U A;  1D0Y A;  3HNI A;  3IQ6 A;  3HJC A;  4NCQ A;  4P9T A;  3ZTM A;  3JYY A;  2J46 A;  2KSF A;  1Z23 A;  2ZXW C;  3M4C A;  4LDK A;  5TJ5 E;  5B1B C;  3G4Z A;  3AGU A;  3EGX A;  1LVK A;  2KGO A;  2XLW A;  2Q9C A;  2IXO A;  2P0N A;  3B0P A;  3VF0 A;  2R02 A;  3MBG A;  1I4Z A;  2PF4 E;  3FAJ A;  3JSE O;  1BR2 A;  3GM2 A;  4JCZ A;  4ONS A;  4AE4 A;  3ASO C;  5HV9 A;  4GQH A;  5L0D A;  4XTK A;  4QI2 A;  5DS6 A;  4XPX A;  4E17 A;  3ZDL A;  1APC A;  2HUJ A;  4N6C A;  3UGP A;  1NZE A;  1L3P A;  4MTF A;  3RKO F;  3R7C A;  3DXJ F;  4EBJ A;  3RF3 A;  2GDC A;  5D92 A;  1Z63 A;  2YWA A;  4U5H A;  4LER A;  4JJG A;  1EA8 A;  2PX3 A;  1ZHX A;  2ZXO A;  3NMJ A;  2EPO A;  3ABL C;  3HTK C;  3ZC4 A;  4AX2 A;  4DVY P;  1LI5 A;  1QVX A;  2WZG A;  4C7O A;  3AQB A;  3DM5 A;  1NFO A;  1CPQ A;  3QZC A;  3JTL O;  4YN0 B;  2JD3 A;  2EIJ C;  2LFD A;  2WB7 A;  1V54 C;  3LNM B;  5COG A;  3F46 A;  1FR0 A;  2YEV A;  4JKV A;  1H7I A;  4PJM A;  3TUL A;  1M6T A;  4CSA C;  4HEA J;  5CI9 A;  3LS1 A;  1Z6A A;  2QTV A;  1KTM A;  3DD7 A;  5E2Q A;  3BRJ A;  4H4K C;  3WG7 C;  4CSA A;  5L3V A;  4EIY A;  2X0C A;  2A0B A;  2Y3G A;  2XS1 A;  2WZF A;  1ZU4 A;  3WHN A;  1YAU O;  2RSE B;  3I5P A;  3LNR A;  3EGD A;  3L8I A;  2KQ9 A;  3KL4 A;  4RDA A;  4DRI B;  1ZW2 A;  3NG1 A;  4Q7C A;  1M2V B;  4E0H A;  2FAP B;  1IW7 F;  4OD4 A;  3AQC A;  1JOG A;  4NQF A;  5DVW A;  1ORJ A;  3S28 A;  3TD7 A;  4X0R A;  2Y69 C;  1K40 A;  3L34 A;  4O6M A;  3W2V A;  3IQT A;  1TKN A;  2EPL X;  1PD0 A;  2LSE A;  5AC4 A;  1E85 A;  1O5H A;  2OG2 A;  2OJE D;  2W4B A;  3HNJ A;  4DJ9 A;  2XLD A;  1FFT C;  1QSP A;  2NUP B;  3E9V A;  4KBL A;  3POV A;  4YK5 A;  1OQC A;  3K66 A;  1QLE C;  1VK5 A;  3CEX A;  3NRH A;  2R7X A;  3TOM A;  5COF A;  1JPN A;  3HLZ A;  4Z9J A;  3DE9 A;  4KC9 A;  2ZPA A;  3R2P A;  3I4U A;  2EPN A;  2PNO A;  3K6B A;  3ZVR A;  1OCC C;  4U9E A;  4EKW A;  4A4A A;  4F4B A;  5JS5 A;  1NSG B;  1RKE B;  2L6G A;  3O55 A;  2Y3D A;  4RBN A;  3FAP B;  5D91 A;  2WVO A;  3SXK A;  1OW6 A;  1PD1 A;  2A69 F;  4EHP A;  4CX9 A; 
#chains in the Genus database with same CATH homology
 1WTY A;  3MFN A;  3C8G D;  2KK1 A;  1O3U A;  2JPU A;  3B71 A;  1QVX A;  3L8J A;  1JOG A;  4NQF A;  1K40 A;  3JYY A;  4XEK A;  2Q00 A;  4XEF A;  2L6H A;  1PV3 A;  3C18 A;  3K7D A;  2JX0 A;  3TUL A;  3AJM A;  1WOL A;  2PBE A;  1K05 A;  3O10 A;  1WWP A;  3C8G A;  1OW8 A;  3GM2 A;  1KTM A;  5F28 E;  3U0C A;  3BRJ A;  4XEV A;  1KNY A;  2LK4 A;  1ZZP A;  2L6F A;  3RQG A;  3U3F A;  1V4A A;  2HSB A;  1OW7 A;  1K04 A;  3GM1 A;  3GM3 A;  3JZ0 A;  3S9O A;  3L8I A;  3RQE A;  2L6G A;  3RQF A;  4EBK A;  4R32 A;  4EBJ A;  1OW6 A;  1UFB A;  2YWA A;  3C8G B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...