3FAJA

Structure of the structural protein p131 of the archaeal virus acidianus two-tailed virus (atv)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
108
structure length
101
Chain Sequence
KKGDYAGGAVKILDMFENGQLGYPEVTLKLAGEEANARRAGDERTKEAIHAIVKMISDAMKPYRSQPIPGEVIAQVTSNPEYQQAKAFLASPATQVRNIER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Structure of the structural protein P131 of the archaeal virus Acidianus Two-tailed virus (ATV)
rcsb
source organism Acidianus two-tailed virus
molecule tags Structural protein
total genus 45
structure length 101
sequence length 108
ec nomenclature
pdb deposition date 2008-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.950 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3fajA00
3FAJA
chains in the Genus database with same CATH superfamily
3Q6MA 4J30B 4J7TA 4BJ6C 1EI7A 2YHSA 4LDRA 5COGA 3PDMP 1K40A 4RD9A 4NTFA 4EIYA 3NRHA 1TQGA 2HSQA 1OR2A 2R7QA 3LESA 3QMKA 3QVZA 3NKDA 3RQGA 2V26A 4XQ1A 4YN0B 5L0GA 1ZU4A 2L9JA 3RFYA 2A69F 3MYIA 1LI5A 5A6BD 5KYWA 2R7WA 5D91A 4XEFA 5KYWB 3M15A 2WZGA 1LKXA 2EIMC 2P61A 4ULVA 4NCQA 4C3EA 1I4ZA 1MNEA 1PV3A 2Q9BA 2YLGA 4FX5A 3LLKA 2A6EF 4OINF 2HJ3A 3AGUA 3DMDA 2J7PD 2A0UA 1D1AA 4QI0A 1Q0KA 2Q3TA 2QNLA 4AL1A 2CCYA 2VH3A 2KQ9A 2XL6A 4WABA 4JTCB 4JTDB 4D4NA 2NUPA 2NUPB 3ITFA 2CDQA 3JRTA 5FCLA 4PJMA 3K1HA 4JEBA 1YA7O 2H7VC 1V74B 2XXAB 5KYYA 5E2QA 3AGTA 256BA 3DJNB 1R5ID 1YYJA 4LERA 1G4WR 1ZHTA 3EFOA 4K1OA 1BBHA 4KNWA 4RDAA 5JVEA 1VTMP 3J06A 3GEEA 3PHF2 2KGOA 3HNIA 5AC5A 5JRAA 2VCCA 3C8GB 2QE9A 5DLJA 1T5OA 3U8PA 1H7IA 2NG1A 3ASNC 4KBLA 3LUTB 4EBBA 3GM1A 4MNDA 4WJ0A 2OG2A 3IEEA 4WGYA 4W8PA 3LEVA 4I3MA 2A0BA 5KYUB 1OXKA 1QPUA 3JTLO 3TJ6A 3JSZA 5FZTA 3W2VA 4LLCA 4DXWA 2J45A 3EG9A 4EWCA 4CIHA 5GPGB 1PD0A 2GDCA 3DE9A 3QZCA 5F5HA 4ANJA 2WB7A 4CS9A 2R03A 3EPVA 3O10A 1QSPA 2J9WA 2IXOA 3CQZA 2G3KA 2HV7A 1Z6AA 1Y4CA 4ER9A 4ULWA 2WZFA 2HUJA 2ZXPA 3L8JA 1KU2A 4XWJA 2HSBA 2D4UA 2IXNA 1NG1A 1IZMA 2IOQA 4IB4A 3EH1A 3EZIA 1I5NA 4JCHA 4B6IA 4O6NA 4XEVA 1ZHZA 4FAPB 2ETSA 2CNWA 2NSGA 1BZ4A 4UDVA 2Q4FA 3IQCA 1CPRA 2MWQA 2QLAA 1E2XA 4BG0A 3H2UA 2B0JA 1APCA 5HV9A 5HSWA 3NYLA 2YL7A 2FGYA 4A2NB 2YWAA 3QW0A 1EKYA 2PBEA 5EHHA 1CGME 2ZPAA 3KH2A 4XTKA 1SF8A 2EIKC 1WN0A 1GQAA 2QTVA 4YT5A 1NU9C 1G4US 2TMVP 2EIJC 1JPNA 5AC4A 3C8GD 3LS1A 4WGZA 2XM4A 3R7CA 5KYXA 4MW8A 2PX0A 4YJWA 1CGNA 1LE2A 2MYSA 2Z15A 3MX3A 4MTFA 5TJ5E 3Q7LA 3WAQA 3ZWIA 5A69A 1YA9A 2LFDA 2YL0A 2CGEA 4HFFB 2IXMA 1ORSC 4BJ1A 2W45A 4IARA 3RVZA 1E84A 1JAFA 1ZZPA 1AEPA 2YRFA 4OD4A 2BL2A 4E17A 4C3DA 4IAQA 4DVYP 3HLZA 2KK1A 3KL4A 5A6BA 3HJCA 1GS9A 3HTKC 1SZIA 3UMHA 5A6AA 1SMYF 3I5QA 3JZ0A 3L34A 3PCVA 1G8XA 4J7YA 4QI2A 4YT8A 2H7BA 4CX9A 1FFTC 1Q0GA 2LFFA 3C8ZA 3JT1A 3LAYA 4U9EA 1EQ1A 4EHPA 4MQ9F 2R7XA 4PACA 2CNWD 4IAOA 4CDAA 2JD3A 3PMRA 1JRAA 1ZYRF 1AUEA 4H54A 4MVSA 1Q0FA 3IQ5A 4R32A 5COFA 4DBRA 2NSFA 1HW2A 3RYLA 3K1IA 1NZEA 1A7EA 1S7ZA 2OJED 3AG4C 3IQ6A 1M6TA 2VASA 5CIVA 1GM5A 2M64A 3IQTA 1RMVA 1YDIA 3ZC4A 3T9OA 1K05A 1YZAA 4I1MA 4IWBA 1V54C 4IGGA 4CJOA 1U0BB 5JLIA 1OW7A 4CS9C 3DJUB 2OEXA 5JUAA 2YL1A 4BJTA 5T3TA 4JRZA 1YLMA 1VK5A 3KPHA 4GYTA 5DS6A 1YAUO 4GQHA 4PR9A 1H9GA 3FDQA 1JMWA 4G78A 4P9FA 5F5FA 3CSKA 3SXKA 2X51A 1D1BA 2J9VA 1YYXA 1W2WA 3M4CA 5D92A 1VYKA 3GWNA 3ZIBA 4CBEA 4G7HF 3DD7A 4KI2A 3C62A 3EGXA 1AVOB 4JURI 4CDYA 2VCAA 4E7ZA 4U5BE 3EGXB 1L3PA 1O5HA 2B0HA 2AP3A 3GEHA 4U5EE 4RBNA 4C3BA 3S84A 1RKCA 2F22A 1S05A 1QZXA 3Q6NA 3FAPB 3JYYA 1WATA 1ZHYA 2ZXOA 1MMNA 2PX3A 4EKWA 4U5HA 1XZPA 1O3UA 1PCXA 4IRUA 1U89A 1C03A 2VB6A 3ABKC 1A7VA 1Z3IX 4D4XA 2J0WA 5B3SC 1LVKA 2YEVA 5BUOA 1N1CA 2Q00A 2P0NA 3K6BA 4ONSA 3DZAA 2R7RA 3A11A 5B1BC 1NFNA 4AK9A 2XXAA 2IBFA 4NQFA 3SEOA 2KC3A 5L0HA 2Y3HA 3GWLA 3QTHA 4Q7CA 1VB5A 2H7OA 3IHUA 1Z63A 3FMSA 4HFKB 4DRIB 1Z23A 3VM6A 1GGQA 3FHDA 3C8GA 3S9OA 1ZHXA 5DQZA 2WVNA 3RQEA 5E3AA 3V5XA 2XLWA 4A4AA 2FFHA 1FMVA 4YT2A 3OWTA 4CS7A 1M2VB 1FTSA 3EH2A 1E83A 1UFBA 3AOUA 5KYUA 3QVYA 2OOCA 4NTAA 3FOOA 1VLTA 4JIOA 3K1IC 2IYLD 2WVQA 3DAGA 3S29A 5T1DB 1OCOC 2GFHA 3M79A 2R02A 2OU6A 2R9RB 3UGOA 3KYIA 1CPQA 2WL8A 1YZCA 3FOPA 3K66A 2HMZA 1VYIA 1TWHA 5EGYA 5L0IA 3U0CA 3B29A 4J32B 4YT4A 1ZW2A 2EPLX 3TQOA 4W8KA 1E85A 2KW3C 1JR8A 1NBBA 3ZSUA 3GANA 1F1MA 3ABLC 4DBQA 2W9YA 3DAFA 2DB4A 4XPWA 2LK4A 1D0XA 2HV6A 1RKEB 2XLMA 3AJMA 4G0HA 4Q4ZF 2J9BA 1H6GA 3JYHA 3LLIA 4P9TA 1M57C 2EILC 3LS0A 2BC5A 1D0YA 3NG1A 3JRMO 5KYNA 1T01A 3MFNA 2HMQA 5L0JA 2PF4E 4Z9JA 3U9MA 4XPYA 4MTOA 4DRHB 4EBJA 3POVA 2G3VA 3L8IA 2QY9A 4FESA 3GORA 3T6GB 2O9XA 1C17M 2C03A 1XWJA 4KC9A 4AE4A 3G4XA 3U8VA 2LQGA 2WVOA 1HE1A 2Y3GA 3EGDA 4EUKB 3R2PA 3AQCA 3EGDB 4JCZA 4PJNA 4OIOF 1NLXA 2L81A 1QQ3A 3RF3A 3G4ZA 2I15A 2DGJA 2W4MA 5F28E 3SZRA 2EINC 2P1AA 4XPXA 1LM3B 4DVZA 1HMOA 4L6RA 3U2MA 4CIPA 3NMKA 4DRJB 1CGOA 3SXZA 2HFIA 2R7UA 1MMAA 3F47A 4U5CE 4FWVA 4AE4B 2XSEA 1UG7A 1WOLA 2UUHA 3FVYA 4PJJA 1V55C 2P6VA 4MVQA 3EZHA 3L1MA 3EJNA 3RQFA 5L3QA 2L7AA 4OIPF 4MW3A 4LDQA 2YLIA 2R05A 5DVWA 2YZSA 4E7SA 3WG7C 2J46A 3B71A 2MHRA 2R7SA 2J9UA 2JPUA 1DOWA 3BRJA 2XRHA 1PD1A 1OW8A 1TFKB 4QDLA 1B68A 3BEHA 3DI5A 4N6HA 2W4BA 3ZDLA 3UGPA 1VOMA 3NMIA 1D1CA 1JOGA 2HKVA 2J0XA 1A7DA 3N0TA 5L0FA 1MMDA 3LNMB 1OCRC 1RJ9B 1V4AA 2R7OA 3TOLA 1H9TA 3TK0A 3HNLA 4YWQA 5L0DA 3U9JA 3S90A 4G7OF 5CI8A 2KJGA 2I8BA 1HY5A 4GEHA 1OQCA 3W4YA 3U5SA 4I1OB 2VC9A 4YL1A 2CW0F 3TD7A 3B0UX 2XLDA 1MQVA 5JP7A 2E87A 3S28A 4O6MA 2HJMA 5CI9A 3UMIA 3JSEO 5JT4A 2OEVA 1FFHA 1Z5ZA 2YVKA 1A41A 2A1DD 3T6BA 3T4RA 3UR3C 2VCBA 4CSAA 2OJQA 1Q0MA 3U2LA 3WODF 5DS4A 3MYFA 5BQHA 3ZTMA 1HW1A 3EHNA 1YVIA 1VMAA 1NU7D 1ZU5A 2IXPA 4CJGA 2L6HA 1BR2A 1HMDA 2R25A 2Y69C 2GWWA 2DYRC 3DKAA 3EHMA 1LI7A 2D5RB 3RKOF 2ICWG 2OCCC 3AG1C 5BQGA 1OR3A 4XEKA 1KNYA 2CYDA 4C7OB 5E3CA 1TKNA 2P7VA 2Y39A 3IPMO 3X2QC 2LCHA 1SYQA 2C04A 2YLDA 3KKBA 1OXBA 3LNRA 4O79A 4P6IC 4JW1A 1NSGB 2R7TA 2XLHA 2AWCA 2HZ8A 3I5PA 4U9DA 4BPMA 1OW6A 3B9QA 3UMKA 3GEIA 4NY3A 1OKKA 4MVMA 3I4UA 1BDJB 3WHNA 4EBKA 2JX0A 4CDVA 4MVUA 2PFDA 1WWPA 3OA1A 3V5ZA 2Q9CA 3CAXA 1QKRA 3DM9B 1RXQA 4PFOA 1M2VA 4LDKA 3O39A 4JC7A 3H65A 4MVOA 3NYJA 5L3VA 1QLEC 3B0PA 5BQIA 2LD6A 1WASA 3NKEA 2XL4A 3RVYA 3KMIA 3MBGA 2EPMX 2ZXWC 4Z9HA 5DQTA 3DWWA 2Q7RA 1T6QA 2G62A 3ZTZA 1TR2A 5KYYB 3G50A 3K7DA 3ASOC 3GODA 4NC3A 3QW1A 3AG2C 3KYJA 3EFOB 3ZQVA 3TULA 4Q5SF 3W8HA 1BR1A 2XLEA 2ZXRA 4DOZA 1DOVA 4JVSA 2RD9A 2KYHA 4ZLDA 4MVRA 2UUIA 2DYSC 1RKEA 2EPKX 1C02A 2LSEA 3CZ6A 2NUTA 1TWAA 2X0CA 1D0ZA 4BEMJ 4BEJA 1A0BA 1TWCA 2NUTB 2WZLA 2XLVA 4JKVA 1IW7F 1RCPA 4KNVA 1BR4A 1T6UA 4JZAA 4F4BA 1FNTc 1M2OA 2PP4A 4YK5A 2KSFA 5B1AC 4MS2A 3SXMA 3EG9B 3VAYA 1YARO 5B3IA 1OKKD 3N2ZB 1OCCC 4N6CA 1KTMA 3CEXA 4K7BA 2OKUA 4CSAC 5T3WA 4NTBA 1LS4A 3T6JA 5JS5A 1TFOB 2DI3A 2XM0A 4XLPF 1FMWA 2YQYA 4BJ5A 1T9KA 1MMGA 2XLOA 3RIPA 3UNGC 3B0VC 3W2WA 1ORYA 2YKZA 4CS8A 3S0XA 2ZD9A 3X1OA 3V5YA 4BJ6A 4E18A 1ORJA 2HS5A 3OEOA 3NDBB 3EQLF 4PJLA 4JTAB 3TOMA 4O7GA 3ATPA 3DXJF 4OIQF 4O6YA 2AU5A 2GA0A 3C18A 3FAJA 1JPJA 4N4WA 4U5GA 3O55A 4YL0A 1TWGA 1Z7Qc 3W8IA 3ZVRA 4E0IA 4OD5A 1ZW3A 2V3CC 3RW0A 4M63A 3DM5A 1FR0A 2XS8A 1WTYA 3SNHA 4AX2A 1ZVZA 1J8YF 3HKKA 3C63A 1ZHWA 1L7CA 3C7JA 2GAQA 3N24A 2XS1A 1HE9A 1G5ZA 3AQBA 3M1CB 1QVXA 2LIGA 2A68F 2Q9AA 1K04A 2QUPA 3NYMA 2YL3A 3ECSA 5KYXB 1ST6A 3F46A 3GM3A 2EPOA 4I44A 4U5FE 3GM2A 1R4TA 5A6KA 2EPNA 4ZLCA 4G7ZF 1OCZC 4JEAA 2Y3BA 1EA8A 2J8WA 3U3FA 3A9CA 4MTGA 4PK4A 2XL8A 3HNJA 2RSEB 5L0CA 1WGWA 4XLNF 2A6HF 3TJ5A 4H4KC 2LP4A 4LACB 1T6IA 1RJ9A 4JJFA 4E0HA 3O6XA 2ASRA 3H2VA 3RH3A 1J8MF 2OQMA 1SR2A 4DJ9A 3ABMC 3ZQYA 2KNHA 3US6A 5AGFA 3VRCA 2J7PA 4PFPA 4AL0A 3U3BA 4HE8D 4OIRF 1I4YA 3K33A 4JE9A 1M56C 4X0RA 5EK0A 5IY5C 3L0IA 1NFOA 3E9VA 3SXYA 4JJGA 4LLEA 5E33A 2AVKA 3SP1A 3HNKA 3VYWA 4HEAJ 3FXHA 5A6JA 4CS8C 3V7OA 2NPUA 4U5DE 1LPEA 2M4EA 3NMJA 1E86A 4YL3A 4N06A 3JCUQ 3LEOA 2L6FA 4IJJA 5COMA 5JSLA 3SYNA 1O87A 2PNOA 1LIHA 2IM8A 2L6GA 1VLSA 3AG3C 1Q0DA 3MLGA 3DE8A 4K0DA 2H8AA 3E70C 5K0IA 3VF0A 1LS1A 1Y6DA 1YJGA 2R7VA 1FAPB 2AWYA 1MNDA 2BE5F 1U6HA 2Y3DA 4MVZA 5DS5A 4BJ5C 1LE4A 1XZQA 3ZG1A 3Q7GA 3S27A 3M4BA 3LJBA 4Z9IA 4C7OA 2FAPB
chains in the Genus database with same CATH topology
3Q6MA 4J30B 4BJ6C 2YHSA 4RD9A 3NRHA 2R7QA 3LESA 3QMKA 3NKDA 2V26A 4YN0B 1ZU4A 2L9JA 3RFYA 2A69F 5KYWA 2R7WA 5D91A 5KYWB 2WZGA 1LKXA 2EIMC 2Q9BA 1MNEA 4FX5A 3LLKA 2A6EF 4OINF 3DMDA 4QI0A 2J7PD 1D1AA 2Q3TA 2VH3A 2KQ9A 2NUPA 2NUPB 3ITFA 2CDQA 3JRTA 5FCLA 4PJMA 3K1HA 2H7VC 2XXAB 5KYYA 5E2QA 3DJNB 4LERA 4KNWA 1ZHTA 3EFOA 4RDAA 3PHF2 2KGOA 5DLJA 2NG1A 3ASNC 4KBLA 4EBBA 4MNDA 4WJ0A 2OG2A 3IEEA 3LEVA 4I3MA 5KYUB 3JSZA 3W2VA 4LLCA 2J45A 3EG9A 4CIHA 1PD0A 3QZCA 5F5HA 4ANJA 2WB7A 4CS9A 3EPVA 2J9WA 2IXOA 3CQZA 2G3KA 2HV7A 1Z6AA 4ULWA 2WZFA 2ZXPA 4XWJA 1KU2A 2IXNA 1NG1A 1IZMA 2IOQA 3EH1A 3EZIA 4B6IA 4JCHA 4O6NA 1ZHZA 2CNWA 2MWQA 4BG0A 2B0JA 5HSWA 3NYLA 2FGYA 4A2NB 5EHHA 2ZPAA 3KH2A 4XTKA 1SF8A 2EIKC 2QTVA 4YT5A 1NU9C 2EIJC 1JPNA 3LS1A 5KYXA 2PX0A 4YJWA 4AE4B 3MX3A 2MYSA 2Z15A 4EWCA 3Q7LA 2CGEA 4HFFB 2IXMA 4BJ1A 2W45A 4OD4A 4C3DA 4DVYP 3HLZA 3KL4A 3HJCA 3HTKC 1SZIA 3UMHA 1SMYF 3I5QA 3L34A 1G8XA 4QI2A 4YT8A 2H7BA 1FFTC 3LAYA 3JT1A 4MQ9F 2R7XA 2CNWD 4IAOA 2JD3A 3PMRA 1ZYRF 4DBRA 3RYLA 4C3EA 1NZEA 1S7ZA 3AG4C 2VASA 3ZC4A 4IWBA 4I1MA 1V54C 4CS9C 3DJUB 4BJTA 5T3TA 1VK5A 4GYTA 5DS6A 3FDQA 5F5FA 3CSKA 2X51A 1D1BA 2J9VA 1W2WA 5D92A 1VYKA 4CBEA 3ZIBA 4G7HF 4KI2A 3DD7A 3EGXA 4E7ZA 4JURI 4U5BE 3EGXB 1O5HA 4U5EE 4RBNA 4C3BA 1QZXA 3Q6NA 1ZHYA 2ZXOA 1MMNA 2PX3A 4U5HA 1PCXA 4IRUA 2VB6A 3ABKC 1Z3IX 5B3SC 2J0WA 1LVKA 2YEVA 5BUOA 1N1CA 3K6BA 3DZAA 2R7RA 5B1BC 4AK9A 2XXAA 3SEOA 2Y3HA 4Q7CA 2H7OA 1Z63A 4HFKB 1Z23A 3FHDA 1ZHXA 5DQZA 2WVNA 5E3AA 2FFHA 1FMVA 4YT2A 3OWTA 4CS7A 1M2VB 1FTSA 3EH2A 5KYUA 3K1IC 2IYLD 2WVQA 3DAGA 3S29A 5T1DB 1OCOC 2GFHA 3UGOA 2WL8A 3K66A 1VYIA 1TWHA 5EGYA 4YT4A 4J32B 4W8KA 2KW3C 3ZSUA 3GANA 3ABLC 2W9YA 3DAFA 1D0XA 2HV6A 4G0HA 4Q4ZF 3JYHA 3LLIA 1M57C 2EILC 3LS0A 1D0YA 3NG1A 5KYNA 2PF4E 3POVA 2G3VA 2QY9A 4FESA 2O9XA 2C03A 4KC9A 4AE4A 2WVOA 3EGDA 2Y3GA 4OIOF 3AQCA 3EGDB 4PJNA 2L81A 2DGJA 2W4MA 3SZRA 2EINC 4DVZA 2R7UA 1MMAA 3F47A 4U5CE 4FWVA 2XSEA 4PJJA 3FVYA 1V55C 2P6VA 3EZHA 3EJNA 5L3QA 4OIPF 5DVWA 2YZSA 4E7SA 3WG7C 2J46A 2R7SA 2J9UA 2XRHA 1PD1A 4QDLA 2W4BA 3UGPA 1VOMA 1D1CA 3N0TA 2J0XA 1MMDA 1OCRC 1RJ9B 2R7OA 4YWQA 4G7OF 5CI8A 2KJGA 2I8BA 4GEHA 4I1OB 3TD7A 3B0UX 2CW0F 2E87A 3S28A 4O6MA 5CI9A 3UMIA 1FFHA 1Z5ZA 3T6BA 2A1DD 3T4RA 3UR3C 4CSAA 3WODF 5DS4A 3EHNA 1VMAA 1NU7D 1ZU5A 2IXPA 3JCUQ 1BR2A 4DBQA 2Y69C 3EHMA 2DYRC 2D5RB 3RKOF 2OCCC 3AG1C 4C7OB 5E3CA 1TKNA 2P7VA 2Y39A 3X2QC 2C04A 3KKBA 3LNRA 4O79A 4P6IC 4JW1A 2R7TA 3I5PA 3B9QA 3UMKA 4NY3A 1OKKA 3I4UA 2PFDA 3OA1A 2Q9CA 3DM9B 4PFOA 1M2VA 3O39A 3H65A 3NYJA 5L3VA 1QLEC 3B0PA 3NKEA 2XL4A 3KMIA 2ZXWC 5DQTA 2G62A 1TR2A 5KYYB 3K7DA 3ASOC 3GODA 3AG2C 3EFOB 4Q5SF 3W8HA 1BR1A 2ZXRA 4DOZA 4JVSA 4ZLDA 2DYSC 3CZ6A 2LSEA 2NUTA 1TWAA 4BEJA 1D0ZA 4CS8A 1TWCA 2NUTB 2WZLA 4KNVA 4JZAA 1IW7F 1BR4A 4F4BA 1M2OA 2PP4A 5B1AC 3EG9B 3VAYA 1OKKD 3N2ZB 1OCCC 4K7BA 4CSAC 5T3WA 3T6JA 4XLPF 1FMWA 4BJ5A 1MMGA 3RIPA 3UNGC 3B0VC 3W2WA 3S0XA 3X1OA 4BJ6A 3OEOA 3NDBB 3EQLF 4PJLA 4O7GA 3DXJF 4OIQF 4O6YA 3FAJA 4U5GA 1JPJA 3W8IA 1TWGA 3ZVRA 4OD5A 2V3CC 4M63A 3DM5A 3SNHA 4AX2A 1J8YF 1ZHWA 3N24A 3AQBA 3M1CB 2A68F 2Q9AA 3NYMA 3ECSA 5KYXB 1ST6A 3F46A 4U5FE 4I44A 4ZLCA 4G7ZF 1OCZC 2Y3BA 4PK4A 1WGWA 4XLNF 2A6HF 4H4KC 4LACB 1RJ9A 4JJFA 3O6XA 3RH3A 1J8MF 3ABMC 2KNHA 2J7PA 4PFPA 4HE8D 4OIRF 3K33A 1M56C 4X0RA 5IY5C 3L0IA 3E9VA 4JJGA 4LLEA 5E33A 3SP1A 3VYWA 4HEAJ 4CS8C 3V7OA 4U5DE 2M4EA 4N06A 4IJJA 3SYNA 1O87A 3AG3C 3MLGA 4K0DA 3E70C 1LS1A 2R7VA 2BE5F 1MNDA 2Y3DA 5DS5A 4BJ5C 3ZG1A 3Q7GA 3S27A 3LJBA 4C7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FAJ A; 
#chains in the Genus database with same CATH topology
 3Q6M A;  4J30 B;  4J7T A;  4BJ6 C;  1EI7 A;  2YHS A;  4LDR A;  5COG A;  3PDM P;  1K40 A;  4RD9 A;  4NTF A;  4EIY A;  3NRH A;  1TQG A;  2HSQ A;  1OR2 A;  2R7Q A;  3LES A;  3QMK A;  3QVZ A;  3NKD A;  3RQG A;  2V26 A;  4XQ1 A;  4YN0 B;  5L0G A;  1ZU4 A;  2L9J A;  3RFY A;  2A69 F;  3MYI A;  1LI5 A;  5A6B D;  5KYW A;  2R7W A;  5D91 A;  4XEF A;  5KYW B;  3M15 A;  2WZG A;  1LKX A;  2EIM C;  2P61 A;  4ULV A;  4NCQ A;  4C3E A;  1I4Z A;  1MNE A;  1PV3 A;  2Q9B A;  2YLG A;  4FX5 A;  3LLK A;  2A6E F;  4OIN F;  2HJ3 A;  3AGU A;  3DMD A;  2J7P D;  2A0U A;  1D1A A;  4QI0 A;  1Q0K A;  2Q3T A;  2QNL A;  4AL1 A;  2CCY A;  2VH3 A;  2KQ9 A;  2XL6 A;  4WAB A;  4JTC B;  4JTD B;  4D4N A;  2NUP A;  2NUP B;  3ITF A;  2CDQ A;  3JRT A;  5FCL A;  4PJM A;  3K1H A;  4JEB A;  1YA7 O;  2H7V C;  1V74 B;  2XXA B;  5KYY A;  5E2Q A;  3AGT A;  256B A;  3DJN B;  1R5I D;  1YYJ A;  4LER A;  1G4W R;  1ZHT A;  3EFO A;  4K1O A;  1BBH A;  4KNW A;  4RDA A;  5JVE A;  1VTM P;  3J06 A;  3GEE A;  3PHF 2;  2KGO A;  3HNI A;  5AC5 A;  5JRA A;  2VCC A;  3C8G B;  2QE9 A;  5DLJ A;  1T5O A;  3U8P A;  1H7I A;  2NG1 A;  3ASN C;  4KBL A;  3LUT B;  4EBB A;  3GM1 A;  4MND A;  4WJ0 A;  2OG2 A;  3IEE A;  4WGY A;  4W8P A;  3LEV A;  4I3M A;  2A0B A;  5KYU B;  1OXK A;  1QPU A;  3JTL O;  3TJ6 A;  3JSZ A;  5FZT A;  3W2V A;  4LLC A;  4DXW A;  2J45 A;  3EG9 A;  4EWC A;  4CIH A;  5GPG B;  1PD0 A;  2GDC A;  3DE9 A;  3QZC A;  5F5H A;  4ANJ A;  2WB7 A;  4CS9 A;  2R03 A;  3EPV A;  3O10 A;  1QSP A;  2J9W A;  2IXO A;  3CQZ A;  2G3K A;  2HV7 A;  1Z6A A;  1Y4C A;  4ER9 A;  4ULW A;  2WZF A;  2HUJ A;  2ZXP A;  3L8J A;  1KU2 A;  4XWJ A;  2HSB A;  2D4U A;  2IXN A;  1NG1 A;  1IZM A;  2IOQ A;  4IB4 A;  3EH1 A;  3EZI A;  1I5N A;  4JCH A;  4B6I A;  4O6N A;  4XEV A;  1ZHZ A;  4FAP B;  2ETS A;  2CNW A;  2NSG A;  1BZ4 A;  4UDV A;  2Q4F A;  3IQC A;  1CPR A;  2MWQ A;  2QLA A;  1E2X A;  4BG0 A;  3H2U A;  2B0J A;  1APC A;  5HV9 A;  5HSW A;  3NYL A;  2YL7 A;  2FGY A;  4A2N B;  2YWA A;  3QW0 A;  1EKY A;  2PBE A;  5EHH A;  1CGM E;  2ZPA A;  3KH2 A;  4XTK A;  1SF8 A;  2EIK C;  1WN0 A;  1GQA A;  2QTV A;  4YT5 A;  1NU9 C;  1G4U S;  2TMV P;  2EIJ C;  1JPN A;  5AC4 A;  3C8G D;  3LS1 A;  4WGZ A;  2XM4 A;  3R7C A;  5KYX A;  4MW8 A;  2PX0 A;  4YJW A;  1CGN A;  1LE2 A;  2MYS A;  2Z15 A;  3MX3 A;  4MTF A;  5TJ5 E;  3Q7L A;  3WAQ A;  3ZWI A;  5A69 A;  1YA9 A;  2LFD A;  2YL0 A;  2CGE A;  4HFF B;  2IXM A;  1ORS C;  4BJ1 A;  2W45 A;  4IAR A;  3RVZ A;  1E84 A;  1JAF A;  1ZZP A;  1AEP A;  2YRF A;  4OD4 A;  2BL2 A;  4E17 A;  4C3D A;  4IAQ A;  4DVY P;  3HLZ A;  2KK1 A;  3KL4 A;  5A6B A;  3HJC A;  1GS9 A;  3HTK C;  1SZI A;  3UMH A;  5A6A A;  1SMY F;  3I5Q A;  3JZ0 A;  3L34 A;  3PCV A;  1G8X A;  4J7Y A;  4QI2 A;  4YT8 A;  2H7B A;  4CX9 A;  1FFT C;  1Q0G A;  2LFF A;  3C8Z A;  3JT1 A;  3LAY A;  4U9E A;  1EQ1 A;  4EHP A;  4MQ9 F;  2R7X A;  4PAC A;  2CNW D;  4IAO A;  4CDA A;  2JD3 A;  3PMR A;  1JRA A;  1ZYR F;  1AUE A;  4H54 A;  4MVS A;  1Q0F A;  3IQ5 A;  4R32 A;  5COF A;  4DBR A;  2NSF A;  1HW2 A;  3RYL A;  3K1I A;  1NZE A;  1A7E A;  1S7Z A;  2OJE D;  3AG4 C;  3IQ6 A;  1M6T A;  2VAS A;  5CIV A;  1GM5 A;  2M64 A;  3IQT A;  1RMV A;  1YDI A;  3ZC4 A;  3T9O A;  1K05 A;  1YZA A;  4I1M A;  4IWB A;  1V54 C;  4IGG A;  4CJO A;  1U0B B;  5JLI A;  1OW7 A;  4CS9 C;  3DJU B;  2OEX A;  5JUA A;  2YL1 A;  4BJT A;  5T3T A;  4JRZ A;  1YLM A;  1VK5 A;  3KPH A;  4GYT A;  5DS6 A;  1YAU O;  4GQH A;  4PR9 A;  1H9G A;  3FDQ A;  1JMW A;  4G78 A;  4P9F A;  5F5F A;  3CSK A;  3SXK A;  2X51 A;  1D1B A;  2J9V A;  1YYX A;  1W2W A;  3M4C A;  5D92 A;  1VYK A;  3GWN A;  3ZIB A;  4CBE A;  4G7H F;  3DD7 A;  4KI2 A;  3C62 A;  3EGX A;  1AVO B;  4JUR I;  4CDY A;  2VCA A;  4E7Z A;  4U5B E;  3EGX B;  1L3P A;  1O5H A;  2B0H A;  2AP3 A;  3GEH A;  4U5E E;  4RBN A;  4C3B A;  3S84 A;  1RKC A;  2F22 A;  1S05 A;  1QZX A;  3Q6N A;  3FAP B;  3JYY A;  1WAT A;  1ZHY A;  2ZXO A;  1MMN A;  2PX3 A;  4EKW A;  4U5H A;  1XZP A;  1O3U A;  1PCX A;  4IRU A;  1U89 A;  1C03 A;  2VB6 A;  3ABK C;  1A7V A;  1Z3I X;  4D4X A;  2J0W A;  5B3S C;  1LVK A;  2YEV A;  5BUO A;  1N1C A;  2Q00 A;  2P0N A;  3K6B A;  4ONS A;  3DZA A;  2R7R A;  3A11 A;  5B1B C;  1NFN A;  4AK9 A;  2XXA A;  2IBF A;  4NQF A;  3SEO A;  2KC3 A;  5L0H A;  2Y3H A;  3GWL A;  3QTH A;  4Q7C A;  1VB5 A;  2H7O A;  3IHU A;  1Z63 A;  3FMS A;  4HFK B;  4DRI B;  1Z23 A;  3VM6 A;  1GGQ A;  3FHD A;  3C8G A;  3S9O A;  1ZHX A;  5DQZ A;  2WVN A;  3RQE A;  5E3A A;  3V5X A;  2XLW A;  4A4A A;  2FFH A;  1FMV A;  4YT2 A;  3OWT A;  4CS7 A;  1M2V B;  1FTS A;  3EH2 A;  1E83 A;  1UFB A;  3AOU A;  5KYU A;  3QVY A;  2OOC A;  4NTA A;  3FOO A;  1VLT A;  4JIO A;  3K1I C;  2IYL D;  2WVQ A;  3DAG A;  3S29 A;  5T1D B;  1OCO C;  2GFH A;  3M79 A;  2R02 A;  2OU6 A;  2R9R B;  3UGO A;  3KYI A;  1CPQ A;  2WL8 A;  1YZC A;  3FOP A;  3K66 A;  2HMZ A;  1VYI A;  1TWH A;  5EGY A;  5L0I A;  3U0C A;  3B29 A;  4J32 B;  4YT4 A;  1ZW2 A;  2EPL X;  3TQO A;  4W8K A;  1E85 A;  2KW3 C;  1JR8 A;  1NBB A;  3ZSU A;  3GAN A;  1F1M A;  3ABL C;  4DBQ A;  2W9Y A;  3DAF A;  2DB4 A;  4XPW A;  2LK4 A;  1D0X A;  2HV6 A;  1RKE B;  2XLM A;  3AJM A;  4G0H A;  4Q4Z F;  2J9B A;  1H6G A;  3JYH A;  3LLI A;  4P9T A;  1M57 C;  2EIL C;  3LS0 A;  2BC5 A;  1D0Y A;  3NG1 A;  3JRM O;  5KYN A;  1T01 A;  3MFN A;  2HMQ A;  5L0J A;  2PF4 E;  4Z9J A;  3U9M A;  4XPY A;  4MTO A;  4DRH B;  4EBJ A;  3POV A;  2G3V A;  3L8I A;  2QY9 A;  4FES A;  3GOR A;  3T6G B;  2O9X A;  1C17 M;  2C03 A;  1XWJ A;  4KC9 A;  4AE4 A;  3G4X A;  3U8V A;  2LQG A;  2WVO A;  1HE1 A;  2Y3G A;  3EGD A;  4EUK B;  3R2P A;  3AQC A;  3EGD B;  4JCZ A;  4PJN A;  4OIO F;  1NLX A;  2L81 A;  1QQ3 A;  3RF3 A;  3G4Z A;  2I15 A;  2DGJ A;  2W4M A;  5F28 E;  3SZR A;  2EIN C;  2P1A A;  4XPX A;  1LM3 B;  4DVZ A;  1HMO A;  4L6R A;  3U2M A;  4CIP A;  3NMK A;  4DRJ B;  1CGO A;  3SXZ A;  2HFI A;  2R7U A;  1MMA A;  3F47 A;  4U5C E;  4FWV A;  4AE4 B;  2XSE A;  1UG7 A;  1WOL A;  2UUH A;  3FVY A;  4PJJ A;  1V55 C;  2P6V A;  4MVQ A;  3EZH A;  3L1M A;  3EJN A;  3RQF A;  5L3Q A;  2L7A A;  4OIP F;  4MW3 A;  4LDQ A;  2YLI A;  2R05 A;  5DVW A;  2YZS A;  4E7S A;  3WG7 C;  2J46 A;  3B71 A;  2MHR A;  2R7S A;  2J9U A;  2JPU A;  1DOW A;  3BRJ A;  2XRH A;  1PD1 A;  1OW8 A;  1TFK B;  4QDL A;  1B68 A;  3BEH A;  3DI5 A;  4N6H A;  2W4B A;  3ZDL A;  3UGP A;  1VOM A;  3NMI A;  1D1C A;  1JOG A;  2HKV A;  2J0X A;  1A7D A;  3N0T A;  5L0F A;  1MMD A;  3LNM B;  1OCR C;  1RJ9 B;  1V4A A;  2R7O A;  3TOL A;  1H9T A;  3TK0 A;  3HNL A;  4YWQ A;  5L0D A;  3U9J A;  3S90 A;  4G7O F;  5CI8 A;  2KJG A;  2I8B A;  1HY5 A;  4GEH A;  1OQC A;  3W4Y A;  3U5S A;  4I1O B;  2VC9 A;  4YL1 A;  2CW0 F;  3TD7 A;  3B0U X;  2XLD A;  1MQV A;  5JP7 A;  2E87 A;  3S28 A;  4O6M A;  2HJM A;  5CI9 A;  3UMI A;  3JSE O;  5JT4 A;  2OEV A;  1FFH A;  1Z5Z A;  2YVK A;  1A41 A;  2A1D D;  3T6B A;  3T4R A;  3UR3 C;  2VCB A;  4CSA A;  2OJQ A;  1Q0M A;  3U2L A;  3WOD F;  5DS4 A;  3MYF A;  5BQH A;  3ZTM A;  1HW1 A;  3EHN A;  1YVI A;  1VMA A;  1NU7 D;  1ZU5 A;  2IXP A;  4CJG A;  2L6H A;  1BR2 A;  1HMD A;  2R25 A;  2Y69 C;  2GWW A;  2DYR C;  3DKA A;  3EHM A;  1LI7 A;  2D5R B;  3RKO F;  2ICW G;  2OCC C;  3AG1 C;  5BQG A;  1OR3 A;  4XEK A;  1KNY A;  2CYD A;  4C7O B;  5E3C A;  1TKN A;  2P7V A;  2Y39 A;  3IPM O;  3X2Q C;  2LCH A;  1SYQ A;  2C04 A;  2YLD A;  3KKB A;  1OXB A;  3LNR A;  4O79 A;  4P6I C;  4JW1 A;  1NSG B;  2R7T A;  2XLH A;  2AWC A;  2HZ8 A;  3I5P A;  4U9D A;  4BPM A;  1OW6 A;  3B9Q A;  3UMK A;  3GEI A;  4NY3 A;  1OKK A;  4MVM A;  3I4U A;  1BDJ B;  3WHN A;  4EBK A;  2JX0 A;  4CDV A;  4MVU A;  2PFD A;  1WWP A;  3OA1 A;  3V5Z A;  2Q9C A;  3CAX A;  1QKR A;  3DM9 B;  1RXQ A;  4PFO A;  1M2V A;  4LDK A;  3O39 A;  4JC7 A;  3H65 A;  4MVO A;  3NYJ A;  5L3V A;  1QLE C;  3B0P A;  5BQI A;  2LD6 A;  1WAS A;  3NKE A;  2XL4 A;  3RVY A;  3KMI A;  3MBG A;  2EPM X;  2ZXW C;  4Z9H A;  5DQT A;  3DWW A;  2Q7R A;  1T6Q A;  2G62 A;  3ZTZ A;  1TR2 A;  5KYY B;  3G50 A;  3K7D A;  3ASO C;  3GOD A;  4NC3 A;  3QW1 A;  3AG2 C;  3KYJ A;  3EFO B;  3ZQV A;  3TUL A;  4Q5S F;  3W8H A;  1BR1 A;  2XLE A;  2ZXR A;  4DOZ A;  1DOV A;  4JVS A;  2RD9 A;  2KYH A;  4ZLD A;  4MVR A;  2UUI A;  2DYS C;  1RKE A;  2EPK X;  1C02 A;  2LSE A;  3CZ6 A;  2NUT A;  1TWA A;  2X0C A;  1D0Z A;  4BEM J;  4BEJ A;  1A0B A;  1TWC A;  2NUT B;  2WZL A;  2XLV A;  4JKV A;  1IW7 F;  1RCP A;  4KNV A;  1BR4 A;  1T6U A;  4JZA A;  4F4B A;  1FNT c;  1M2O A;  2PP4 A;  4YK5 A;  2KSF A;  5B1A C;  4MS2 A;  3SXM A;  3EG9 B;  3VAY A;  1YAR O;  5B3I A;  1OKK D;  3N2Z B;  1OCC C;  4N6C A;  1KTM A;  3CEX A;  4K7B A;  2OKU A;  4CSA C;  5T3W A;  4NTB A;  1LS4 A;  3T6J A;  5JS5 A;  1TFO B;  2DI3 A;  2XM0 A;  4XLP F;  1FMW A;  2YQY A;  4BJ5 A;  1T9K A;  1MMG A;  2XLO A;  3RIP A;  3UNG C;  3B0V C;  3W2W A;  1ORY A;  2YKZ A;  4CS8 A;  3S0X A;  2ZD9 A;  3X1O A;  3V5Y A;  4BJ6 A;  4E18 A;  1ORJ A;  2HS5 A;  3OEO A;  3NDB B;  3EQL F;  4PJL A;  4JTA B;  3TOM A;  4O7G A;  3ATP A;  3DXJ F;  4OIQ F;  4O6Y A;  2AU5 A;  2GA0 A;  3C18 A;  3FAJ A;  1JPJ A;  4N4W A;  4U5G A;  3O55 A;  4YL0 A;  1TWG A;  1Z7Q c;  3W8I A;  3ZVR A;  4E0I A;  4OD5 A;  1ZW3 A;  2V3C C;  3RW0 A;  4M63 A;  3DM5 A;  1FR0 A;  2XS8 A;  1WTY A;  3SNH A;  4AX2 A;  1ZVZ A;  1J8Y F;  3HKK A;  3C63 A;  1ZHW A;  1L7C A;  3C7J A;  2GAQ A;  3N24 A;  2XS1 A;  1HE9 A;  1G5Z A;  3AQB A;  3M1C B;  1QVX A;  2LIG A;  2A68 F;  2Q9A A;  1K04 A;  2QUP A;  3NYM A;  2YL3 A;  3ECS A;  5KYX B;  1ST6 A;  3F46 A;  3GM3 A;  2EPO A;  4I44 A;  4U5F E;  3GM2 A;  1R4T A;  5A6K A;  2EPN A;  4ZLC A;  4G7Z F;  1OCZ C;  4JEA A;  2Y3B A;  1EA8 A;  2J8W A;  3U3F A;  3A9C A;  4MTG A;  4PK4 A;  2XL8 A;  3HNJ A;  2RSE B;  5L0C A;  1WGW A;  4XLN F;  2A6H F;  3TJ5 A;  4H4K C;  2LP4 A;  4LAC B;  1T6I A;  1RJ9 A;  4JJF A;  4E0H A;  3O6X A;  2ASR A;  3H2V A;  3RH3 A;  1J8M F;  2OQM A;  1SR2 A;  4DJ9 A;  3ABM C;  3ZQY A;  2KNH A;  3US6 A;  5AGF A;  3VRC A;  2J7P A;  4PFP A;  4AL0 A;  3U3B A;  4HE8 D;  4OIR F;  1I4Y A;  3K33 A;  4JE9 A;  1M56 C;  4X0R A;  5EK0 A;  5IY5 C;  3L0I A;  1NFO A;  3E9V A;  3SXY A;  4JJG A;  4LLE A;  5E33 A;  2AVK A;  3SP1 A;  3HNK A;  3VYW A;  4HEA J;  3FXH A;  5A6J A;  4CS8 C;  3V7O A;  2NPU A;  4U5D E;  1LPE A;  2M4E A;  3NMJ A;  1E86 A;  4YL3 A;  4N06 A;  3JCU Q;  3LEO A;  2L6F A;  4IJJ A;  5COM A;  5JSL A;  3SYN A;  1O87 A;  2PNO A;  1LIH A;  2IM8 A;  2L6G A;  1VLS A;  3AG3 C;  1Q0D A;  3MLG A;  3DE8 A;  4K0D A;  2H8A A;  3E70 C;  5K0I A;  3VF0 A;  1LS1 A;  1Y6D A;  1YJG A;  2R7V A;  1FAP B;  2AWY A;  1MND A;  2BE5 F;  1U6H A;  2Y3D A;  4MVZ A;  5DS5 A;  4BJ5 C;  1LE4 A;  1XZQ A;  3ZG1 A;  3Q7G A;  3S27 A;  3M4B A;  3LJB A;  4Z9I A;  4C7O A;  2FAP B; 
#chains in the Genus database with same CATH homology
 3Q6M A;  4J30 B;  4BJ6 C;  2YHS A;  4RD9 A;  3NRH A;  2R7Q A;  3LES A;  3QMK A;  3NKD A;  2V26 A;  4YN0 B;  1ZU4 A;  2L9J A;  3RFY A;  2A69 F;  5KYW A;  2R7W A;  5D91 A;  5KYW B;  2WZG A;  1LKX A;  2EIM C;  2Q9B A;  1MNE A;  4FX5 A;  3LLK A;  2A6E F;  4OIN F;  3DMD A;  4QI0 A;  2J7P D;  1D1A A;  2Q3T A;  2VH3 A;  2KQ9 A;  2NUP A;  2NUP B;  3ITF A;  2CDQ A;  3JRT A;  5FCL A;  4PJM A;  3K1H A;  2H7V C;  2XXA B;  5KYY A;  5E2Q A;  3DJN B;  4LER A;  4KNW A;  1ZHT A;  3EFO A;  4RDA A;  3PHF 2;  2KGO A;  5DLJ A;  2NG1 A;  3ASN C;  4KBL A;  4EBB A;  4MND A;  4WJ0 A;  2OG2 A;  3IEE A;  3LEV A;  4I3M A;  5KYU B;  3JSZ A;  3W2V A;  4LLC A;  2J45 A;  3EG9 A;  4CIH A;  1PD0 A;  3QZC A;  5F5H A;  4ANJ A;  2WB7 A;  4CS9 A;  3EPV A;  2J9W A;  2IXO A;  3CQZ A;  2G3K A;  2HV7 A;  1Z6A A;  4ULW A;  2WZF A;  2ZXP A;  4XWJ A;  1KU2 A;  2IXN A;  1NG1 A;  1IZM A;  2IOQ A;  3EH1 A;  3EZI A;  4B6I A;  4JCH A;  4O6N A;  1ZHZ A;  2CNW A;  2MWQ A;  4BG0 A;  2B0J A;  5HSW A;  3NYL A;  2FGY A;  4A2N B;  5EHH A;  2ZPA A;  3KH2 A;  4XTK A;  1SF8 A;  2EIK C;  2QTV A;  4YT5 A;  1NU9 C;  2EIJ C;  1JPN A;  3LS1 A;  5KYX A;  2PX0 A;  4YJW A;  4AE4 B;  3MX3 A;  2MYS A;  2Z15 A;  4EWC A;  3Q7L A;  2CGE A;  4HFF B;  2IXM A;  4BJ1 A;  2W45 A;  4OD4 A;  4C3D A;  4DVY P;  3HLZ A;  3KL4 A;  3HJC A;  3HTK C;  1SZI A;  3UMH A;  1SMY F;  3I5Q A;  3L34 A;  1G8X A;  4QI2 A;  4YT8 A;  2H7B A;  1FFT C;  3LAY A;  3JT1 A;  4MQ9 F;  2R7X A;  2CNW D;  4IAO A;  2JD3 A;  3PMR A;  1ZYR F;  4DBR A;  3RYL A;  4C3E A;  1NZE A;  1S7Z A;  3AG4 C;  2VAS A;  3ZC4 A;  4IWB A;  4I1M A;  1V54 C;  4CS9 C;  3DJU B;  4BJT A;  5T3T A;  1VK5 A;  4GYT A;  5DS6 A;  3FDQ A;  5F5F A;  3CSK A;  2X51 A;  1D1B A;  2J9V A;  1W2W A;  5D92 A;  1VYK A;  4CBE A;  3ZIB A;  4G7H F;  4KI2 A;  3DD7 A;  3EGX A;  4E7Z A;  4JUR I;  4U5B E;  3EGX B;  1O5H A;  4U5E E;  4RBN A;  4C3B A;  1QZX A;  3Q6N A;  1ZHY A;  2ZXO A;  1MMN A;  2PX3 A;  4U5H A;  1PCX A;  4IRU A;  2VB6 A;  3ABK C;  1Z3I X;  5B3S C;  2J0W A;  1LVK A;  2YEV A;  5BUO A;  1N1C A;  3K6B A;  3DZA A;  2R7R A;  5B1B C;  4AK9 A;  2XXA A;  3SEO A;  2Y3H A;  4Q7C A;  2H7O A;  1Z63 A;  4HFK B;  1Z23 A;  3FHD A;  1ZHX A;  5DQZ A;  2WVN A;  5E3A A;  2FFH A;  1FMV A;  4YT2 A;  3OWT A;  4CS7 A;  1M2V B;  1FTS A;  3EH2 A;  5KYU A;  3K1I C;  2IYL D;  2WVQ A;  3DAG A;  3S29 A;  5T1D B;  1OCO C;  2GFH A;  3UGO A;  2WL8 A;  3K66 A;  1VYI A;  1TWH A;  5EGY A;  4YT4 A;  4J32 B;  4W8K A;  2KW3 C;  3ZSU A;  3GAN A;  3ABL C;  2W9Y A;  3DAF A;  1D0X A;  2HV6 A;  4G0H A;  4Q4Z F;  3JYH A;  3LLI A;  1M57 C;  2EIL C;  3LS0 A;  1D0Y A;  3NG1 A;  5KYN A;  2PF4 E;  3POV A;  2G3V A;  2QY9 A;  4FES A;  2O9X A;  2C03 A;  4KC9 A;  4AE4 A;  2WVO A;  3EGD A;  2Y3G A;  4OIO F;  3AQC A;  3EGD B;  4PJN A;  2L81 A;  2DGJ A;  2W4M A;  3SZR A;  2EIN C;  4DVZ A;  2R7U A;  1MMA A;  3F47 A;  4U5C E;  4FWV A;  2XSE A;  4PJJ A;  3FVY A;  1V55 C;  2P6V A;  3EZH A;  3EJN A;  5L3Q A;  4OIP F;  5DVW A;  2YZS A;  4E7S A;  3WG7 C;  2J46 A;  2R7S A;  2J9U A;  2XRH A;  1PD1 A;  4QDL A;  2W4B A;  3UGP A;  1VOM A;  1D1C A;  3N0T A;  2J0X A;  1MMD A;  1OCR C;  1RJ9 B;  2R7O A;  4YWQ A;  4G7O F;  5CI8 A;  2KJG A;  2I8B A;  4GEH A;  4I1O B;  3TD7 A;  3B0U X;  2CW0 F;  2E87 A;  3S28 A;  4O6M A;  5CI9 A;  3UMI A;  1FFH A;  1Z5Z A;  3T6B A;  2A1D D;  3T4R A;  3UR3 C;  4CSA A;  3WOD F;  5DS4 A;  3EHN A;  1VMA A;  1NU7 D;  1ZU5 A;  2IXP A;  3JCU Q;  1BR2 A;  4DBQ A;  2Y69 C;  3EHM A;  2DYR C;  2D5R B;  3RKO F;  2OCC C;  3AG1 C;  4C7O B;  5E3C A;  1TKN A;  2P7V A;  2Y39 A;  3X2Q C;  2C04 A;  3KKB A;  3LNR A;  4O79 A;  4P6I C;  4JW1 A;  2R7T A;  3I5P A;  3B9Q A;  3UMK A;  4NY3 A;  1OKK A;  3I4U A;  2PFD A;  3OA1 A;  2Q9C A;  3DM9 B;  4PFO A;  1M2V A;  3O39 A;  3H65 A;  3NYJ A;  5L3V A;  1QLE C;  3B0P A;  3NKE A;  2XL4 A;  3KMI A;  2ZXW C;  5DQT A;  2G62 A;  1TR2 A;  5KYY B;  3K7D A;  3ASO C;  3GOD A;  3AG2 C;  3EFO B;  4Q5S F;  3W8H A;  1BR1 A;  2ZXR A;  4DOZ A;  4JVS A;  4ZLD A;  2DYS C;  3CZ6 A;  2LSE A;  2NUT A;  1TWA A;  4BEJ A;  1D0Z A;  4CS8 A;  1TWC A;  2NUT B;  2WZL A;  4KNV A;  4JZA A;  1IW7 F;  1BR4 A;  4F4B A;  1M2O A;  2PP4 A;  5B1A C;  3EG9 B;  3VAY A;  1OKK D;  3N2Z B;  1OCC C;  4K7B A;  4CSA C;  5T3W A;  3T6J A;  4XLP F;  1FMW A;  4BJ5 A;  1MMG A;  3RIP A;  3UNG C;  3B0V C;  3W2W A;  3S0X A;  3X1O A;  4BJ6 A;  3OEO A;  3NDB B;  3EQL F;  4PJL A;  4O7G A;  3DXJ F;  4OIQ F;  4O6Y A;  3FAJ A;  4U5G A;  1JPJ A;  3W8I A;  1TWG A;  3ZVR A;  4OD5 A;  2V3C C;  4M63 A;  3DM5 A;  3SNH A;  4AX2 A;  1J8Y F;  1ZHW A;  3N24 A;  3AQB A;  3M1C B;  2A68 F;  2Q9A A;  3NYM A;  3ECS A;  5KYX B;  1ST6 A;  3F46 A;  4U5F E;  4I44 A;  4ZLC A;  4G7Z F;  1OCZ C;  2Y3B A;  4PK4 A;  1WGW A;  4XLN F;  2A6H F;  4H4K C;  4LAC B;  1RJ9 A;  4JJF A;  3O6X A;  3RH3 A;  1J8M F;  3ABM C;  2KNH A;  2J7P A;  4PFP A;  4HE8 D;  4OIR F;  3K33 A;  1M56 C;  4X0R A;  5IY5 C;  3L0I A;  3E9V A;  4JJG A;  4LLE A;  5E33 A;  3SP1 A;  3VYW A;  4HEA J;  4CS8 C;  3V7O A;  4U5D E;  2M4E A;  4N06 A;  4IJJ A;  3SYN A;  1O87 A;  3AG3 C;  3MLG A;  4K0D A;  3E70 C;  1LS1 A;  2R7V A;  2BE5 F;  1MND A;  2Y3D A;  5DS5 A;  4BJ5 C;  3ZG1 A;  3Q7G A;  3S27 A;  3LJB A;  4C7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...