3FAJA

Structure of the structural protein p131 of the archaeal virus acidianus two-tailed virus (atv)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
108
structure length
101
Chain Sequence
KKGDYAGGAVKILDMFENGQLGYPEVTLKLAGEEANARRAGDERTKEAIHAIVKMISDAMKPYRSQPIPGEVIAQVTSNPEYQQAKAFLASPATQVRNIER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Structure of the structural protein P131 of the archaeal virus Acidianus Two-tailed virus (ATV)
rcsb
source organism Acidianus two-tailed virus
molecule tags Structural protein
total genus 45
structure length 101
sequence length 108
ec nomenclature
pdb deposition date 2008-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.950 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3fajA00
3FAJA
chains in the Genus database with same CATH superfamily
3JTLO 3CSKA 4EIYA 4ER9A 4C3BA 1IW7F 4KI2A 4IAOA 4BJ6A 2Y3HA 4GYTA 4XLPF 4I44A 5EK0A 3ZC4A 1WWPA 3IQTA 2O9XA 2QY9A 4NTBA 2OOCA 5L3QA 2G62A 2I15A 3SZRA 4JZAA 3EZIA 4XLNF 4PJMA 3ZQYA 1E83A 3IHUA 1HMDA 1CGNA 4K7BA 4N6CA 1RKCA 4J30B 4YL1A 4BJ5C 2R7UA 2G3VA 4KC9A 4D4XA 3UGPA 1JOGA 4JEAA 2KNHA 1RJ9A 2YL0A 1ORYA 3DWWA 5E33A 2JD3A 1Q0MA 2ZD9A 3L8JA 4UDVA 3UGOA 1H9GA 4DJ9A 3T9OA 2M64A 3KYIA 1JMWA 2PX0A 3AQCA 5TJ5E 1G8XA 1EA8A 4A2NB 1TWGA 2J45A 4DOZA 3C7JA 3GORA 3TD7A 2KGOA 3EHMA 1OXBA 3L1MA 5L0GA 1YYJA 2NUPA 2J7PA 5A69A 1H9TA 1V55C 2ZXOA 1JAFA 3MLGA 4MW3A 3RYLA 2HMQA 3QMKA 4U5EE 4ULVA 4CIHA 1E86A 4WABA 1A7VA 1G4US 4CJOA 3O39A 1QVXA 3OEOA 3RQEA 4E7SA 4JTAB 3MX3A 3S9OA 2PFDA 3TK0A 4I3MA 4BJTA 4CS8A 2HSQA 4EUKB 2XLEA 4CDVA 2R02A 2XLDA 2MWQA 4CS9A 1APCA 3EFOA 3JT1A 4O6NA 4G7HF 4MW8A 1LKXA 4P9TA 4YK5A 4Z9IA 4W8KA 1S7ZA 2KSFA 5BQIA 1EQ1A 1NZEA 3B9QA 1LI7A 4WGYA 4ZLCA 1M2VB 3H2UA 1LE4A 4E0IA 1E2XA 5HV9A 1BR4A 2LQGA 3E70C 1VLTA 3QW1A 3U2MA 5A6KA 5EGYA 2LK4A 1K40A 4MTGA 5JVEA 4JW1A 3K7DA 4JKVA 2L6FA 2MYSA 2ZXPA 3UMKA 3RVYA 3IEEA 4PFPA 2IOQA 2P6VA 1OR3A 4MVZA 3U8PA 2XLHA 1ZHWA 3U3BA 4IWBA 4JE9A 5EHHA 2YEVA 4EHPA 2HJMA 4E17A 4JJGA 4PJNA 4PFOA 3RVZA 1OCZC 1T01A 4XPXA 5COGA 3VYWA 1MMGA 4L6RA 4FAPB 4QI2A 5A6BD 3L0IA 1KU2A 3KYJA 3AG2C 2CNWD 2DGJA 1O87A 3G4XA 3IQ6A 5L0JA 4FESA 3GODA 3VRCA 1BR1A 3NDBB 2OJED 4U5CE 2FFHA 2KQ9A 5JS5A 5COFA 4FX5A 1Y4CA 1G4WR 2IXPA 4XEFA 3TQOA 3WAQA 4MNDA 2OU6A 3F47A 2EIMC 2OJQA 4XPWA 5JLIA 1E85A 3RIPA 1T6UA 3DZAA 1CPRA 3Q6MA 4BG0A 3B0PA 5KYWA 4JRZA 4CSAA 1RXQA 1YZAA 2Q9CA 3GWNA 3NRHA 1JR8A 1N1CA 1ZU5A 3SXKA 1M2VA 3X2QC 4DRIB 1QZXA 4JJFA 5B3SC 2GFHA 4YJWA 1KTMA 3K1HA 1I4ZA 1RJ9B 3H2VA 2NG1A 3FOOA 5AC5A 3I5PA 1YAUO 4CX9A 1SYQA 2I8BA 3KH2A 3M4CA 4IJJA 4U9DA 2Y3DA 4C3EA 1BBHA 4CJGA 2YL1A 1OW7A 1GS9A 1DOWA 1R5ID 1VLSA 2BE5F 1GM5A 3LLKA 1A41A 3EHNA 3JCUQ 4YT8A 2J9BA 1VMAA 2C03A 3UNGC 4MVUA 3MYIA 2EIJC 1WOLA 2R25A 3GEEA 3HNIA 5CIVA 1T6IA 2VB6A 3AGTA 2IBFA 1XZPA 3GM2A 4O6YA 4XPYA 3GEIA 2KK1A 3HTKC 5F5FA 1EI7A 1L3PA 2R7QA 2XLMA 2AWCA 2F22A 5T1DB 2R03A 3S29A 1VK5A 2CW0F 4MS2A 3X1OA 4EBKA 3DI5A 3JSZA 4J7TA 1D1AA 3ABMC 3CQZA 3JRMO 3ZDLA 1YDIA 4XEVA 3S28A 2RD9A 2EPNA 3EFOB 4N06A 4HFFB 1U89A 3IQCA 4U5BE 1MMAA 2J9UA 2NSGA 4MVQA 4YT4A 1E84A 1SR2A 4YT5A 3AOUA 1NU7D 2XSEA 3NKDA 2R9RB 3WHNA 4H54A 2XLOA 5L0FA 2VCAA 4PK4A 1I4YA 1FFTC 1ZZPA 5COMA 3W4YA 4Z9HA 5DS4A 5IY5C 2A68F 1FAPB 2FGYA 2XL4A 4J7YA 3C62A 3FHDA 3L34A 2D4UA 2LFFA 3GANA 1DOVA 1PD1A 2J0XA 2EPOA 4YL0A 3LAYA 2A6HF 5L3VA 1U0BB 2QLAA 3ZSUA 2ASRA 1O5HA 3OA1A 3CEXA 1LS1A 3NG1A 4QI0A 4EKWA 3E9VA 4KNVA 1AEPA 3NKEA 3QVZA 4P6IC 4JCZA 4LLCA 3W8HA 2ZPAA 1VTMP 1YLMA 2KYHA 1U6HA 1Q0DA 2CDQA 3AQBA 5KYNA 2CNWA 3ZIBA 4JTDB 2EIKC 4AL1A 1VB5A 1V74B 1MQVA 1CGME 1ZVZA 2YLIA 1L7CA 4O6MA 1KNYA 5KYUA 3F46A 5BQGA 1AUEA 2YHSA 2XM4A 2XS8A 3HNLA 4YL3A 3ZG1A 3ZWIA 3SXMA 3A9CA 1PD0A 3HKKA 1JPNA 4MVRA 4P9FA 3U3FA 2Q7RA 1HW2A 4XWJA 2IM8A 1SZIA 2LFDA 1QKRA 4JIOA 3SXZA 3W2VA 4C7OA 1WTYA 3UMIA 3T6BA 2RSEB 5KYWB 4Q4ZF 3PHF2 4E7ZA 4CSAC 1J8YF 5CI9A 2QNLA 1OCCC 1HY5A 3HNKA 3Q7LA 3KL4A 4IAQA 3G50A 4NCQA 1QLEC 3QW0A 5T3TA 3FVYA 3C8GD 3KMIA 1W2WA 3DAGA 3LEOA 1T6QA 3RH3A 1MNEA 256BA 3M15A 3NMKA 1Z6AA 3JRTA 4PJLA 2OCCC 4AK9A 5D92A 4B6IA 4AE4A 2CGEA 1ORSC 3NYLA 2EPMX 3ECSA 3FAJA 3N2ZB 5FZTA 1JRAA 1GGQA 4GEHA 3TJ5A 2R7WA 1A7EA 2FAPB 2Y3GA 2HS5A 2A6EF 2AU5A 2P0NA 4NTAA 2VCBA 2X51A 4GQHA 1ORJA 1M57C 4JEBA 4MTOA 3S0XA 4JVSA 3TULA 3FAPB 1CPQA 4K1OA 2YRFA 2XM0A 3G4ZA 5E3CA 3RF3A 5KYYA 3C18A 4LDRA 1JPJA 1ZW3A 2B0HA 3SYNA 2XRHA 4RDAA 5D91A 5JUAA 4Z9JA 2R05A 3WG7C 1YJGA 1V4AA 2E87A 2HUJA 1YZCA 4YN0B 4A4AA 4KBLA 5AC4A 3SP1A 2EPKX 3B0VC 4NTFA 4W8PA 1OR2A 4JURI 2CYDA 2YQYA 2HZ8A 3U0CA 5DVWA 3EGXA 2A0BA 2EPLX 5B1BC 1IZMA 3PDMP 4LACB 1FTSA 2AP3A 2KJGA 4Q7CA 3T6JA 4DXWA 3ITFA 4PR9A 3C8ZA 2H7VC 3US6A 4WGZA 2W4MA 3ABLC 1FNTc 2L81A 1OQCA 1AVOB 3DE8A 1NLXA 2LCHA 3N24A 4JTCB 3DKAA 5L0CA 4R32A 1OKKD 3SEOA 1PCXA 2MHRA 2WZLA 2YVKA 4O7GA 4X0RA 3EG9A 4BJ1A 3A11A 3LNMB 4YT2A 5A6AA 5CI8A 3EQLF 3LEVA 1OW8A 3BRJA 2W4BA 1HMOA 1NSGB 2NUTA 4E18A 2EILC 2DYRC 3JZ0A 3W8IA 5DLJA 3ATPA 4EBBA 2VH3A 3L8IA 3K6BA 5GPGB 1D1BA 4DBRA 5JRAA 1F1MA 1UG7A 2W9YA 3V5YA 3GWLA 5K0IA 2DB4A 2IXNA 2R7OA 3M79A 4LDQA 5L0IA 3ZQVA 2AVKA 3MBGA 2OKUA 5KYUB 2PF4E 3DM5A 1OCRC 1C17M 3ASNC 1Q0FA 4BEMJ 1RKEA 3EPVA 4OIPF 1FR0A 2L9JA 2QTVA 3C63A 2VCCA 1TFKB 3HLZA 2OG2A 5JSLA 2XS1A 2R7VA 2LSEA 3NYJA 1ZHTA 4PACA 3QVYA 4U9EA 1A7DA 2XXAA 3T4RA 4C7OB 2VC9A 4AX2A 3IPMO 1MNDA 1R4TA 2XLVA 4MVSA 1QQ3A 1YA7O 1CGOA 2WL8A 3LLIA 4MVOA 2QE9A 2PP4A 3C8GA 3CZ6A 1D0ZA 1T5OA 1HE9A 3ZVRA 1YVIA 2NPUA 2YLDA 1VOMA 4LDKA 1OCOC 3QTHA 1J8MF 4ONSA 1Z23A 2IXMA 2YKZA 3AG4C 4U5HA 5L0HA 2UUHA 2L6GA 3O10A 1UFBA 4JC7A 3TOLA 4AE4B 2GA0A 3AGUA 3LESA 3NYMA 3T6GB 4AL0A 1NG1A 2A1DD 1OW6A 2GAQA 2OEVA 3AG1C 4OIQF 3R7CA 3NMJA 1D0XA 1LIHA 3I4UA 3U9MA 3V5ZA 3LJBA 2Q4FA 1WASA 4C3DA 3DM9B 1K05A 1NFNA 5DS5A 2A0UA 2A69F 2JPUA 5KYYB 4LLEA 3Q7GA 5A6BA 2C04A 5F28E 1ZHXA 3IQ5A 4N6HA 4DRHB 3ASOC 2M4EA 3EGDB 3JSEO 3FDQA 2H7BA 3SXYA 5DQZA 2B0JA 2R7SA 1B68A 2Q3TA 4RD9A 2WVOA 3FXHA 2KC3A 1NU9C 4J32B 3SNHA 2H7OA 2J8WA 5DQTA 4ANJA 3DE9A 1QPUA 1VYIA 4MTFA 1RMVA 3EGXB 1T9KA 2L7AA 3NMIA 3DMDA 1XWJA 2DI3A 4G7ZF 2WZGA 4CDAA 3EJNA 4DRJB 1OKKA 3MFNA 1M6TA 2P61A 4PJJA 4CDYA 2HFIA 3M4BA 1FFHA 1FMWA 3HJCA 1M56C 1Z7Qc 1TKNA 1LI5A 2HJ3A 3U5SA 4BEJA 2HMZA 5F5HA 3EG9B 4KNWA 3J06A 1BDJB 3LUTB 4HEAJ 3ZTZA 1TQGA 4ULWA 1TWCA 2UUIA 5BUOA 2NUTB 1NBBA 3K1IA 4IRUA 1FMVA 2VASA 1MMDA 1C03A 2BL2A 2IYLD 1Q0GA 3LS0A 2ZXRA 4U5FE 2R7RA 3VM6A 4F4BA 3Q6NA 1LPEA 2AWYA 2Y39A 2Y3BA 2WZFA 1SF8A 4O79A 2XLWA 1BR2A 3GEHA 3K33A 4I1MA 4MVMA 3S90A 2GDCA 1TWAA 2J0WA 2YZSA 1RCPA 1D0YA 1ZHYA 1Z3IX 4I1OB 3LS1A 3B0UX 3EH1A 2R7XA 1NFOA 1M2OA 3ABKC 5BQHA 4H4KC 1PV3A 1WATA 3S84A 4XQ1A 2WB7A 4DVYP 1RKEB 3AJMA 3RW0A 2Z15A 1ZW2A 1TR2A 4NC3A 2ICWG 1OXKA 1HE1A 3OWTA 4XEKA 2X0CA 3EGDA 4CIPA 3U8VA 4ZLDA 4EBJA 2HV7A 3GM1A 4G78A 2TMVP 2XXAB 1A0BA 1O3UA 2OEXA 2PBEA 2PX3A 4NY3A 4BJ5A 3V7OA 1LM3B 4EWCA 3TOMA 1H6GA 4BPMA 5KYXB 3WODF 2R7TA 4K0DA 3C8GB 5E3AA 4D4NA 4LERA 2KW3C 2LIGA 2BC5A 1D1CA 4QDLA 2J9WA 3PMRA 2D5RB 3FMSA 4N4WA 4DVZA 3V5XA 1SMYF 3O6XA 4WJ0A 3TJ6A 5FCLA 1K04A 1VYKA 5DS6A 2PNOA 1MMNA 4NQFA 4U5DE 1YA9A 2HKVA 3O55A 3RKOF 3ZTMA 2J7PD 3U9JA 2WVNA 2P7VA 4RBNA 4XTKA 4IB4A 4FWVA 2H8AA 5E2QA 5B3IA 4BJ6C 5L0DA 3AG3C 3POVA 3KPHA 4HFKB 4JCHA 3RQGA 4G0HA 2CCYA 2ETSA 4DBQA 2YLGA 2HSBA 3DAFA 3VAYA 3U2LA 4E0HA 2YL3A 3RQFA 3BEHA 1QSPA 2Y69C 4Q5SF 2XL6A 1G5ZA 3K66A 1LS4A 3M1CB 3DJNB 3H65A 3KKBA 4HE8D 3UR3C 2JX0A 2Q00A 3B71A 1Y6DA 5JT4A 1ST6A 1GQAA 2G3KA 2V26A 1H7IA 4OD5A 1LE2A 3GM3A 2QUPA 5T3WA 1XZQA 3DXJF 4OINF 3RFYA 3HNJA 3B29A 4OIOF 2HV6A 2Q9BA 3JYHA 4OIRF 1EKYA 1Z63A 1ZYRF 2YWAA 3DD7A 1TWHA 2P1AA 3EH2A 3QZCA 3VF0A 4YWQA 3N0TA 1I5NA 2Q9AA 4CBEA 3W2WA 1Q0KA 1YYXA 2ZXWC 1WGWA 2EINC 1C02A 3DJUB 3R2PA 5A6JA 4MQ9F 5KYXA 1V54C 3FOPA 3S27A 2W45A 4CS7A 1ZU4A 5HSWA 4G7OF 3PCVA 2NUPB 1TFOB 2OQMA 2YL7A 1S05A 1BZ4A 1Z5ZA 2XL8A 1ZHZA 4OD4A 2V3CC 5JP7A 2LD6A 4IARA 3K1IC 1HW1A 2J46A 2J9VA 2L6HA 1LVKA 3MYFA 2DYSC 3EZHA 4U5GA 2NSFA 3UMHA 2LP4A 3JYYA 4M63A 4IGGA 3CAXA 5B1AC 2WVQA 1YARO 3LNRA 2IXOA 5AGFA 4CS8C 3I5QA 1WN0A 2GWWA 4CS9C
chains in the Genus database with same CATH topology
3CSKA 4C3BA 1IW7F 4KI2A 4IAOA 4BJ6A 2Y3HA 4GYTA 4XLPF 4I44A 3ZC4A 2O9XA 2QY9A 5L3QA 2G62A 3SZRA 4JZAA 3EZIA 4XLNF 4PJMA 4K7BA 4BJ5C 4J30B 2R7UA 2G3VA 4KC9A 3UGPA 2KNHA 1RJ9A 5E33A 2JD3A 3UGOA 2PX0A 3AQCA 1G8XA 4A2NB 1TWGA 2J45A 4DOZA 3TD7A 2KGOA 3EHMA 2NUPA 2J7PA 1V55C 2ZXOA 3MLGA 3RYLA 3QMKA 4U5EE 4CIHA 4E7SA 3O39A 3OEOA 3MX3A 4CS8A 2PFDA 4I3MA 4BJTA 4CS9A 2MWQA 3EFOA 3JT1A 4O6NA 1LKXA 4W8KA 1S7ZA 1NZEA 3B9QA 4ZLCA 1M2VB 1BR4A 3E70C 5EGYA 4JW1A 3K7DA 2MYSA 3UMKA 2ZXPA 3IEEA 4PFPA 2IOQA 2P6VA 1ZHWA 4IWBA 5EHHA 2YEVA 4JJGA 4PJNA 4PFOA 1OCZC 3VYWA 1MMGA 4QI2A 3L0IA 1KU2A 3AG2C 2CNWD 2DGJA 1O87A 4FESA 3GODA 3NDBB 4U5CE 2FFHA 2KQ9A 4FX5A 2IXPA 4MNDA 3F47A 2EIMC 3RIPA 3DZAA 5KYWA 3Q6MA 4BG0A 3B0PA 4CSAA 2Q9CA 3NRHA 1N1CA 1ZU5A 1M2VA 3X2QC 1QZXA 4JJFA 5B3SC 2GFHA 4YJWA 3K1HA 1RJ9B 2NG1A 3I5PA 2I8BA 3KH2A 4IJJA 2Y3DA 4C3EA 2BE5F 3LLKA 3EHNA 3JCUQ 4YT8A 1VMAA 2C03A 3UNGC 2EIJC 2VB6A 4O6YA 3HTKC 5F5FA 2R7QA 5T1DB 3S29A 1VK5A 2CW0F 3X1OA 3JSZA 1D1AA 3ABMC 3CQZA 3S28A 3EFOB 4N06A 4HFFB 4U5BE 1MMAA 2J9UA 4YT4A 4YT5A 1NU7D 2XSEA 3NKDA 4PK4A 1FFTC 5DS4A 5IY5C 2A68F 2FGYA 2XL4A 3L34A 3FHDA 3GANA 1PD1A 2J0XA 3LAYA 2A6HF 5L3VA 3ZSUA 1O5HA 3OA1A 4QI0A 1LS1A 3NG1A 3E9VA 4KNVA 4P6IC 3NKEA 4LLCA 3W8HA 2ZPAA 2CDQA 3AQBA 5KYNA 2CNWA 3ZIBA 2EIKC 4O6MA 5KYUA 3F46A 2YHSA 3ZG1A 1PD0A 1JPNA 4XWJA 1SZIA 4C7OA 3W2VA 3UMIA 3T6BA 5KYWB 4Q4ZF 3PHF2 4E7ZA 4CSAC 1J8YF 5CI9A 1OCCC 3Q7LA 3KL4A 1QLEC 5T3TA 3FVYA 3KMIA 3RH3A 1W2WA 3DAGA 1MNEA 1Z6AA 3JRTA 4PJLA 2OCCC 4AK9A 5D92A 4B6IA 4AE4A 2CGEA 3NYLA 3ECSA 3FAJA 3N2ZB 2R7WA 4GEHA 2Y3GA 2A6EF 2X51A 3S0XA 1M57C 4JVSA 5E3CA 5KYYA 1JPJA 3SYNA 2XRHA 4RDAA 5D91A 3WG7C 2E87A 4YN0B 3B0VC 4KBLA 3SP1A 4JURI 5DVWA 3EGXA 5B1BC 1IZMA 4LACB 1FTSA 4Q7CA 2KJGA 3T6JA 3ITFA 2H7VC 2W4MA 3ABLC 2L81A 3N24A 1OKKD 3SEOA 1PCXA 2WZLA 4X0RA 4O7GA 3EG9A 4BJ1A 4YT2A 5CI8A 3EQLF 3LEVA 2W4BA 2NUTA 2EILC 2DYRC 3W8IA 5DLJA 4EBBA 2VH3A 3K6BA 1D1BA 4DBRA 2W9YA 2IXNA 2R7OA 5KYUB 2PF4E 3DM5A 1OCRC 3ASNC 3EPVA 2L9JA 2QTVA 3HLZA 2OG2A 2R7VA 2LSEA 3NYJA 1ZHTA 2XXAA 3T4RA 4C7OB 4AX2A 1MNDA 2WL8A 3LLIA 2PP4A 3CZ6A 1D0ZA 3ZVRA 1VOMA 1OCOC 1J8MF 1Z23A 2IXMA 3AG4C 4U5HA 4AE4B 3LESA 3NYMA 4OIQF 1NG1A 2A1DD 3AG1C 1D0XA 3I4UA 3LJBA 4C3DA 3DM9B 5DS5A 2A69F 5KYYB 4LLEA 3Q7GA 2C04A 1ZHXA 3ASOC 2M4EA 3EGDB 3FDQA 2H7BA 5DQZA 2B0JA 2R7SA 2Q3TA 4RD9A 2WVOA 4J32B 5DQTA 1NU9C 3SNHA 4ANJA 2H7OA 4G7HF 1VYIA 3EGXB 3DMDA 4G7ZF 2WZGA 3EJNA 1OKKA 4PJJA 1FFHA 1FMWA 3HJCA 1M56C 1TKNA 4BEJA 5F5HA 3EG9B 4KNWA 4HEAJ 4ULWA 1TWCA 5BUOA 2NUTB 4IRUA 1FMVA 2VASA 1MMDA 2IYLD 3LS0A 2ZXRA 4U5FE 2R7RA 4F4BA 3Q6NA 2Y39A 2Y3BA 2WZFA 1SF8A 4O79A 3K33A 1BR2A 4I1MA 2YZSA 1TWAA 2J0WA 3B0UX 2R7XA 1D0YA 1ZHYA 1Z3IX 4I1OB 3LS1A 3EH1A 1M2OA 3ABKC 4H4KC 2WB7A 4DVYP 2Z15A 1TR2A 3OWTA 3EGDA 4ZLDA 2HV7A 2XXAB 4BJ5A 4NY3A 2PX3A 3V7OA 4EWCA 5KYXB 3WODF 2R7TA 4K0DA 5E3AA 4LERA 2KW3C 1D1CA 4QDLA 2J9WA 3PMRA 2D5RB 4DVZA 1SMYF 3O6XA 4WJ0A 5FCLA 1VYKA 5DS6A 1MMNA 4U5DE 3RKOF 2J7PD 2WVNA 2P7VA 4RBNA 4XTKA 5E2QA 4FWVA 4BJ6C 3AG3C 3POVA 4HFKB 4JCHA 4G0HA 4DBQA 3DAFA 3VAYA 4Q5SF 2Y69C 3K66A 3M1CB 3UR3C 3DJNB 3H65A 3KKBA 4HE8D 4OIPF 1ST6A 2G3KA 2V26A 4OD5A 5T3WA 3DXJF 4OINF 3RFYA 4OIOF 2HV6A 2Q9BA 3JYHA 4OIRF 1Z63A 1ZYRF 3DD7A 1TWHA 3EH2A 4YWQA 3QZCA 3N0TA 2Q9AA 4CBEA 3W2WA 2ZXWC 1WGWA 2EINC 3DJUB 5KYXA 4MQ9F 1V54C 4CS7A 3S27A 2W45A 4G7OF 1ZU4A 5HSWA 2NUPB 1Z5ZA 1ZHZA 4OD4A 2V3CC 3K1IC 4U5GA 2J46A 2J9VA 1LVKA 2DYSC 3EZHA 3UMHA 4M63A 5B1AC 2WVQA 4CS8C 3LNRA 2IXOA 3I5QA 1BR1A 4CS9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FAJ A; 
#chains in the Genus database with same CATH topology
 3JTL O;  3CSK A;  4EIY A;  4ER9 A;  4C3B A;  1IW7 F;  4KI2 A;  4IAO A;  4BJ6 A;  2Y3H A;  4GYT A;  4XLP F;  4I44 A;  5EK0 A;  3ZC4 A;  1WWP A;  3IQT A;  2O9X A;  2QY9 A;  4NTB A;  2OOC A;  5L3Q A;  2G62 A;  2I15 A;  3SZR A;  4JZA A;  3EZI A;  4XLN F;  4PJM A;  3ZQY A;  1E83 A;  3IHU A;  1HMD A;  1CGN A;  4K7B A;  4N6C A;  1RKC A;  4J30 B;  4YL1 A;  4BJ5 C;  2R7U A;  2G3V A;  4KC9 A;  4D4X A;  3UGP A;  1JOG A;  4JEA A;  2KNH A;  1RJ9 A;  2YL0 A;  1ORY A;  3DWW A;  5E33 A;  2JD3 A;  1Q0M A;  2ZD9 A;  3L8J A;  4UDV A;  3UGO A;  1H9G A;  4DJ9 A;  3T9O A;  2M64 A;  3KYI A;  1JMW A;  2PX0 A;  3AQC A;  5TJ5 E;  1G8X A;  1EA8 A;  4A2N B;  1TWG A;  2J45 A;  4DOZ A;  3C7J A;  3GOR A;  3TD7 A;  2KGO A;  3EHM A;  1OXB A;  3L1M A;  5L0G A;  1YYJ A;  2NUP A;  2J7P A;  5A69 A;  1H9T A;  1V55 C;  2ZXO A;  1JAF A;  3MLG A;  4MW3 A;  3RYL A;  2HMQ A;  3QMK A;  4U5E E;  4ULV A;  4CIH A;  1E86 A;  4WAB A;  1A7V A;  1G4U S;  4CJO A;  3O39 A;  1QVX A;  3OEO A;  3RQE A;  4E7S A;  4JTA B;  3MX3 A;  3S9O A;  2PFD A;  3TK0 A;  4I3M A;  4BJT A;  4CS8 A;  2HSQ A;  4EUK B;  2XLE A;  4CDV A;  2R02 A;  2XLD A;  2MWQ A;  4CS9 A;  1APC A;  3EFO A;  3JT1 A;  4O6N A;  4G7H F;  4MW8 A;  1LKX A;  4P9T A;  4YK5 A;  4Z9I A;  4W8K A;  1S7Z A;  2KSF A;  5BQI A;  1EQ1 A;  1NZE A;  3B9Q A;  1LI7 A;  4WGY A;  4ZLC A;  1M2V B;  3H2U A;  1LE4 A;  4E0I A;  1E2X A;  5HV9 A;  1BR4 A;  2LQG A;  3E70 C;  1VLT A;  3QW1 A;  3U2M A;  5A6K A;  5EGY A;  2LK4 A;  1K40 A;  4MTG A;  5JVE A;  4JW1 A;  3K7D A;  4JKV A;  2L6F A;  2MYS A;  2ZXP A;  3UMK A;  3RVY A;  3IEE A;  4PFP A;  2IOQ A;  2P6V A;  1OR3 A;  4MVZ A;  3U8P A;  2XLH A;  1ZHW A;  3U3B A;  4IWB A;  4JE9 A;  5EHH A;  2YEV A;  4EHP A;  2HJM A;  4E17 A;  4JJG A;  4PJN A;  4PFO A;  3RVZ A;  1OCZ C;  1T01 A;  4XPX A;  5COG A;  3VYW A;  1MMG A;  4L6R A;  4FAP B;  4QI2 A;  5A6B D;  3L0I A;  1KU2 A;  3KYJ A;  3AG2 C;  2CNW D;  2DGJ A;  1O87 A;  3G4X A;  3IQ6 A;  5L0J A;  4FES A;  3GOD A;  3VRC A;  1BR1 A;  3NDB B;  2OJE D;  4U5C E;  2FFH A;  2KQ9 A;  5JS5 A;  5COF A;  4FX5 A;  1Y4C A;  1G4W R;  2IXP A;  4XEF A;  3TQO A;  3WAQ A;  4MND A;  2OU6 A;  3F47 A;  2EIM C;  2OJQ A;  4XPW A;  5JLI A;  1E85 A;  3RIP A;  1T6U A;  3DZA A;  1CPR A;  3Q6M A;  4BG0 A;  3B0P A;  5KYW A;  4JRZ A;  4CSA A;  1RXQ A;  1YZA A;  2Q9C A;  3GWN A;  3NRH A;  1JR8 A;  1N1C A;  1ZU5 A;  3SXK A;  1M2V A;  3X2Q C;  4DRI B;  1QZX A;  4JJF A;  5B3S C;  2GFH A;  4YJW A;  1KTM A;  3K1H A;  1I4Z A;  1RJ9 B;  3H2V A;  2NG1 A;  3FOO A;  5AC5 A;  3I5P A;  1YAU O;  4CX9 A;  1SYQ A;  2I8B A;  3KH2 A;  3M4C A;  4IJJ A;  4U9D A;  2Y3D A;  4C3E A;  1BBH A;  4CJG A;  2YL1 A;  1OW7 A;  1GS9 A;  1DOW A;  1R5I D;  1VLS A;  2BE5 F;  1GM5 A;  3LLK A;  1A41 A;  3EHN A;  3JCU Q;  4YT8 A;  2J9B A;  1VMA A;  2C03 A;  3UNG C;  4MVU A;  3MYI A;  2EIJ C;  1WOL A;  2R25 A;  3GEE A;  3HNI A;  5CIV A;  1T6I A;  2VB6 A;  3AGT A;  2IBF A;  1XZP A;  3GM2 A;  4O6Y A;  4XPY A;  3GEI A;  2KK1 A;  3HTK C;  5F5F A;  1EI7 A;  1L3P A;  2R7Q A;  2XLM A;  2AWC A;  2F22 A;  5T1D B;  2R03 A;  3S29 A;  1VK5 A;  2CW0 F;  4MS2 A;  3X1O A;  4EBK A;  3DI5 A;  3JSZ A;  4J7T A;  1D1A A;  3ABM C;  3CQZ A;  3JRM O;  3ZDL A;  1YDI A;  4XEV A;  3S28 A;  2RD9 A;  2EPN A;  3EFO B;  4N06 A;  4HFF B;  1U89 A;  3IQC A;  4U5B E;  1MMA A;  2J9U A;  2NSG A;  4MVQ A;  4YT4 A;  1E84 A;  1SR2 A;  4YT5 A;  3AOU A;  1NU7 D;  2XSE A;  3NKD A;  2R9R B;  3WHN A;  4H54 A;  2XLO A;  5L0F A;  2VCA A;  4PK4 A;  1I4Y A;  1FFT C;  1ZZP A;  5COM A;  3W4Y A;  4Z9H A;  5DS4 A;  5IY5 C;  2A68 F;  1FAP B;  2FGY A;  2XL4 A;  4J7Y A;  3C62 A;  3FHD A;  3L34 A;  2D4U A;  2LFF A;  3GAN A;  1DOV A;  1PD1 A;  2J0X A;  2EPO A;  4YL0 A;  3LAY A;  2A6H F;  5L3V A;  1U0B B;  2QLA A;  3ZSU A;  2ASR A;  1O5H A;  3OA1 A;  3CEX A;  1LS1 A;  3NG1 A;  4QI0 A;  4EKW A;  3E9V A;  4KNV A;  1AEP A;  3NKE A;  3QVZ A;  4P6I C;  4JCZ A;  4LLC A;  3W8H A;  2ZPA A;  1VTM P;  1YLM A;  2KYH A;  1U6H A;  1Q0D A;  2CDQ A;  3AQB A;  5KYN A;  2CNW A;  3ZIB A;  4JTD B;  2EIK C;  4AL1 A;  1VB5 A;  1V74 B;  1MQV A;  1CGM E;  1ZVZ A;  2YLI A;  1L7C A;  4O6M A;  1KNY A;  5KYU A;  3F46 A;  5BQG A;  1AUE A;  2YHS A;  2XM4 A;  2XS8 A;  3HNL A;  4YL3 A;  3ZG1 A;  3ZWI A;  3SXM A;  3A9C A;  1PD0 A;  3HKK A;  1JPN A;  4MVR A;  4P9F A;  3U3F A;  2Q7R A;  1HW2 A;  4XWJ A;  2IM8 A;  1SZI A;  2LFD A;  1QKR A;  4JIO A;  3SXZ A;  3W2V A;  4C7O A;  1WTY A;  3UMI A;  3T6B A;  2RSE B;  5KYW B;  4Q4Z F;  3PHF 2;  4E7Z A;  4CSA C;  1J8Y F;  5CI9 A;  2QNL A;  1OCC C;  1HY5 A;  3HNK A;  3Q7L A;  3KL4 A;  4IAQ A;  3G50 A;  4NCQ A;  1QLE C;  3QW0 A;  5T3T A;  3FVY A;  3C8G D;  3KMI A;  1W2W A;  3DAG A;  3LEO A;  1T6Q A;  3RH3 A;  1MNE A;  256B A;  3M15 A;  3NMK A;  1Z6A A;  3JRT A;  4PJL A;  2OCC C;  4AK9 A;  5D92 A;  4B6I A;  4AE4 A;  2CGE A;  1ORS C;  3NYL A;  2EPM X;  3ECS A;  3FAJ A;  3N2Z B;  5FZT A;  1JRA A;  1GGQ A;  4GEH A;  3TJ5 A;  2R7W A;  1A7E A;  2FAP B;  2Y3G A;  2HS5 A;  2A6E F;  2AU5 A;  2P0N A;  4NTA A;  2VCB A;  2X51 A;  4GQH A;  1ORJ A;  1M57 C;  4JEB A;  4MTO A;  3S0X A;  4JVS A;  3TUL A;  3FAP B;  1CPQ A;  4K1O A;  2YRF A;  2XM0 A;  3G4Z A;  5E3C A;  3RF3 A;  5KYY A;  3C18 A;  4LDR A;  1JPJ A;  1ZW3 A;  2B0H A;  3SYN A;  2XRH A;  4RDA A;  5D91 A;  5JUA A;  4Z9J A;  2R05 A;  3WG7 C;  1YJG A;  1V4A A;  2E87 A;  2HUJ A;  1YZC A;  4YN0 B;  4A4A A;  4KBL A;  5AC4 A;  3SP1 A;  2EPK X;  3B0V C;  4NTF A;  4W8P A;  1OR2 A;  4JUR I;  2CYD A;  2YQY A;  2HZ8 A;  3U0C A;  5DVW A;  3EGX A;  2A0B A;  2EPL X;  5B1B C;  1IZM A;  3PDM P;  4LAC B;  1FTS A;  2AP3 A;  2KJG A;  4Q7C A;  3T6J A;  4DXW A;  3ITF A;  4PR9 A;  3C8Z A;  2H7V C;  3US6 A;  4WGZ A;  2W4M A;  3ABL C;  1FNT c;  2L81 A;  1OQC A;  1AVO B;  3DE8 A;  1NLX A;  2LCH A;  3N24 A;  4JTC B;  3DKA A;  5L0C A;  4R32 A;  1OKK D;  3SEO A;  1PCX A;  2MHR A;  2WZL A;  2YVK A;  4O7G A;  4X0R A;  3EG9 A;  4BJ1 A;  3A11 A;  3LNM B;  4YT2 A;  5A6A A;  5CI8 A;  3EQL F;  3LEV A;  1OW8 A;  3BRJ A;  2W4B A;  1HMO A;  1NSG B;  2NUT A;  4E18 A;  2EIL C;  2DYR C;  3JZ0 A;  3W8I A;  5DLJ A;  3ATP A;  4EBB A;  2VH3 A;  3L8I A;  3K6B A;  5GPG B;  1D1B A;  4DBR A;  5JRA A;  1F1M A;  1UG7 A;  2W9Y A;  3V5Y A;  3GWL A;  5K0I A;  2DB4 A;  2IXN A;  2R7O A;  3M79 A;  4LDQ A;  5L0I A;  3ZQV A;  2AVK A;  3MBG A;  2OKU A;  5KYU B;  2PF4 E;  3DM5 A;  1OCR C;  1C17 M;  3ASN C;  1Q0F A;  4BEM J;  1RKE A;  3EPV A;  4OIP F;  1FR0 A;  2L9J A;  2QTV A;  3C63 A;  2VCC A;  1TFK B;  3HLZ A;  2OG2 A;  5JSL A;  2XS1 A;  2R7V A;  2LSE A;  3NYJ A;  1ZHT A;  4PAC A;  3QVY A;  4U9E A;  1A7D A;  2XXA A;  3T4R A;  4C7O B;  2VC9 A;  4AX2 A;  3IPM O;  1MND A;  1R4T A;  2XLV A;  4MVS A;  1QQ3 A;  1YA7 O;  1CGO A;  2WL8 A;  3LLI A;  4MVO A;  2QE9 A;  2PP4 A;  3C8G A;  3CZ6 A;  1D0Z A;  1T5O A;  1HE9 A;  3ZVR A;  1YVI A;  2NPU A;  2YLD A;  1VOM A;  4LDK A;  1OCO C;  3QTH A;  1J8M F;  4ONS A;  1Z23 A;  2IXM A;  2YKZ A;  3AG4 C;  4U5H A;  5L0H A;  2UUH A;  2L6G A;  3O10 A;  1UFB A;  4JC7 A;  3TOL A;  4AE4 B;  2GA0 A;  3AGU A;  3LES A;  3NYM A;  3T6G B;  4AL0 A;  1NG1 A;  2A1D D;  1OW6 A;  2GAQ A;  2OEV A;  3AG1 C;  4OIQ F;  3R7C A;  3NMJ A;  1D0X A;  1LIH A;  3I4U A;  3U9M A;  3V5Z A;  3LJB A;  2Q4F A;  1WAS A;  4C3D A;  3DM9 B;  1K05 A;  1NFN A;  5DS5 A;  2A0U A;  2A69 F;  2JPU A;  5KYY B;  4LLE A;  3Q7G A;  5A6B A;  2C04 A;  5F28 E;  1ZHX A;  3IQ5 A;  4N6H A;  4DRH B;  3ASO C;  2M4E A;  3EGD B;  3JSE O;  3FDQ A;  2H7B A;  3SXY A;  5DQZ A;  2B0J A;  2R7S A;  1B68 A;  2Q3T A;  4RD9 A;  2WVO A;  3FXH A;  2KC3 A;  1NU9 C;  4J32 B;  3SNH A;  2H7O A;  2J8W A;  5DQT A;  4ANJ A;  3DE9 A;  1QPU A;  1VYI A;  4MTF A;  1RMV A;  3EGX B;  1T9K A;  2L7A A;  3NMI A;  3DMD A;  1XWJ A;  2DI3 A;  4G7Z F;  2WZG A;  4CDA A;  3EJN A;  4DRJ B;  1OKK A;  3MFN A;  1M6T A;  2P61 A;  4PJJ A;  4CDY A;  2HFI A;  3M4B A;  1FFH A;  1FMW A;  3HJC A;  1M56 C;  1Z7Q c;  1TKN A;  1LI5 A;  2HJ3 A;  3U5S A;  4BEJ A;  2HMZ A;  5F5H A;  3EG9 B;  4KNW A;  3J06 A;  1BDJ B;  3LUT B;  4HEA J;  3ZTZ A;  1TQG A;  4ULW A;  1TWC A;  2UUI A;  5BUO A;  2NUT B;  1NBB A;  3K1I A;  4IRU A;  1FMV A;  2VAS A;  1MMD A;  1C03 A;  2BL2 A;  2IYL D;  1Q0G A;  3LS0 A;  2ZXR A;  4U5F E;  2R7R A;  3VM6 A;  4F4B A;  3Q6N A;  1LPE A;  2AWY A;  2Y39 A;  2Y3B A;  2WZF A;  1SF8 A;  4O79 A;  2XLW A;  1BR2 A;  3GEH A;  3K33 A;  4I1M A;  4MVM A;  3S90 A;  2GDC A;  1TWA A;  2J0W A;  2YZS A;  1RCP A;  1D0Y A;  1ZHY A;  1Z3I X;  4I1O B;  3LS1 A;  3B0U X;  3EH1 A;  2R7X A;  1NFO A;  1M2O A;  3ABK C;  5BQH A;  4H4K C;  1PV3 A;  1WAT A;  3S84 A;  4XQ1 A;  2WB7 A;  4DVY P;  1RKE B;  3AJM A;  3RW0 A;  2Z15 A;  1ZW2 A;  1TR2 A;  4NC3 A;  2ICW G;  1OXK A;  1HE1 A;  3OWT A;  4XEK A;  2X0C A;  3EGD A;  4CIP A;  3U8V A;  4ZLD A;  4EBJ A;  2HV7 A;  3GM1 A;  4G78 A;  2TMV P;  2XXA B;  1A0B A;  1O3U A;  2OEX A;  2PBE A;  2PX3 A;  4NY3 A;  4BJ5 A;  3V7O A;  1LM3 B;  4EWC A;  3TOM A;  1H6G A;  4BPM A;  5KYX B;  3WOD F;  2R7T A;  4K0D A;  3C8G B;  5E3A A;  4D4N A;  4LER A;  2KW3 C;  2LIG A;  2BC5 A;  1D1C A;  4QDL A;  2J9W A;  3PMR A;  2D5R B;  3FMS A;  4N4W A;  4DVZ A;  3V5X A;  1SMY F;  3O6X A;  4WJ0 A;  3TJ6 A;  5FCL A;  1K04 A;  1VYK A;  5DS6 A;  2PNO A;  1MMN A;  4NQF A;  4U5D E;  1YA9 A;  2HKV A;  3O55 A;  3RKO F;  3ZTM A;  2J7P D;  3U9J A;  2WVN A;  2P7V A;  4RBN A;  4XTK A;  4IB4 A;  4FWV A;  2H8A A;  5E2Q A;  5B3I A;  4BJ6 C;  5L0D A;  3AG3 C;  3POV A;  3KPH A;  4HFK B;  4JCH A;  3RQG A;  4G0H A;  2CCY A;  2ETS A;  4DBQ A;  2YLG A;  2HSB A;  3DAF A;  3VAY A;  3U2L A;  4E0H A;  2YL3 A;  3RQF A;  3BEH A;  1QSP A;  2Y69 C;  4Q5S F;  2XL6 A;  1G5Z A;  3K66 A;  1LS4 A;  3M1C B;  3DJN B;  3H65 A;  3KKB A;  4HE8 D;  3UR3 C;  2JX0 A;  2Q00 A;  3B71 A;  1Y6D A;  5JT4 A;  1ST6 A;  1GQA A;  2G3K A;  2V26 A;  1H7I A;  4OD5 A;  1LE2 A;  3GM3 A;  2QUP A;  5T3W A;  1XZQ A;  3DXJ F;  4OIN F;  3RFY A;  3HNJ A;  3B29 A;  4OIO F;  2HV6 A;  2Q9B A;  3JYH A;  4OIR F;  1EKY A;  1Z63 A;  1ZYR F;  2YWA A;  3DD7 A;  1TWH A;  2P1A A;  3EH2 A;  3QZC A;  3VF0 A;  4YWQ A;  3N0T A;  1I5N A;  2Q9A A;  4CBE A;  3W2W A;  1Q0K A;  1YYX A;  2ZXW C;  1WGW A;  2EIN C;  1C02 A;  3DJU B;  3R2P A;  5A6J A;  4MQ9 F;  5KYX A;  1V54 C;  3FOP A;  3S27 A;  2W45 A;  4CS7 A;  1ZU4 A;  5HSW A;  4G7O F;  3PCV A;  2NUP B;  1TFO B;  2OQM A;  2YL7 A;  1S05 A;  1BZ4 A;  1Z5Z A;  2XL8 A;  1ZHZ A;  4OD4 A;  2V3C C;  5JP7 A;  2LD6 A;  4IAR A;  3K1I C;  1HW1 A;  2J46 A;  2J9V A;  2L6H A;  1LVK A;  3MYF A;  2DYS C;  3EZH A;  4U5G A;  2NSF A;  3UMH A;  2LP4 A;  3JYY A;  4M63 A;  4IGG A;  3CAX A;  5B1A C;  2WVQ A;  1YAR O;  3LNR A;  2IXO A;  5AGF A;  4CS8 C;  3I5Q A;  1WN0 A;  2GWW A;  4CS9 C; 
#chains in the Genus database with same CATH homology
 3CSK A;  4C3B A;  1IW7 F;  4KI2 A;  4IAO A;  4BJ6 A;  2Y3H A;  4GYT A;  4XLP F;  4I44 A;  3ZC4 A;  2O9X A;  2QY9 A;  5L3Q A;  2G62 A;  3SZR A;  4JZA A;  3EZI A;  4XLN F;  4PJM A;  4K7B A;  4BJ5 C;  4J30 B;  2R7U A;  2G3V A;  4KC9 A;  3UGP A;  2KNH A;  1RJ9 A;  5E33 A;  2JD3 A;  3UGO A;  2PX0 A;  3AQC A;  1G8X A;  4A2N B;  1TWG A;  2J45 A;  4DOZ A;  3TD7 A;  2KGO A;  3EHM A;  2NUP A;  2J7P A;  1V55 C;  2ZXO A;  3MLG A;  3RYL A;  3QMK A;  4U5E E;  4CIH A;  4E7S A;  3O39 A;  3OEO A;  3MX3 A;  4CS8 A;  2PFD A;  4I3M A;  4BJT A;  4CS9 A;  2MWQ A;  3EFO A;  3JT1 A;  4O6N A;  1LKX A;  4W8K A;  1S7Z A;  1NZE A;  3B9Q A;  4ZLC A;  1M2V B;  1BR4 A;  3E70 C;  5EGY A;  4JW1 A;  3K7D A;  2MYS A;  3UMK A;  2ZXP A;  3IEE A;  4PFP A;  2IOQ A;  2P6V A;  1ZHW A;  4IWB A;  5EHH A;  2YEV A;  4JJG A;  4PJN A;  4PFO A;  1OCZ C;  3VYW A;  1MMG A;  4QI2 A;  3L0I A;  1KU2 A;  3AG2 C;  2CNW D;  2DGJ A;  1O87 A;  4FES A;  3GOD A;  3NDB B;  4U5C E;  2FFH A;  2KQ9 A;  4FX5 A;  2IXP A;  4MND A;  3F47 A;  2EIM C;  3RIP A;  3DZA A;  5KYW A;  3Q6M A;  4BG0 A;  3B0P A;  4CSA A;  2Q9C A;  3NRH A;  1N1C A;  1ZU5 A;  1M2V A;  3X2Q C;  1QZX A;  4JJF A;  5B3S C;  2GFH A;  4YJW A;  3K1H A;  1RJ9 B;  2NG1 A;  3I5P A;  2I8B A;  3KH2 A;  4IJJ A;  2Y3D A;  4C3E A;  2BE5 F;  3LLK A;  3EHN A;  3JCU Q;  4YT8 A;  1VMA A;  2C03 A;  3UNG C;  2EIJ C;  2VB6 A;  4O6Y A;  3HTK C;  5F5F A;  2R7Q A;  5T1D B;  3S29 A;  1VK5 A;  2CW0 F;  3X1O A;  3JSZ A;  1D1A A;  3ABM C;  3CQZ A;  3S28 A;  3EFO B;  4N06 A;  4HFF B;  4U5B E;  1MMA A;  2J9U A;  4YT4 A;  4YT5 A;  1NU7 D;  2XSE A;  3NKD A;  4PK4 A;  1FFT C;  5DS4 A;  5IY5 C;  2A68 F;  2FGY A;  2XL4 A;  3L34 A;  3FHD A;  3GAN A;  1PD1 A;  2J0X A;  3LAY A;  2A6H F;  5L3V A;  3ZSU A;  1O5H A;  3OA1 A;  4QI0 A;  1LS1 A;  3NG1 A;  3E9V A;  4KNV A;  4P6I C;  3NKE A;  4LLC A;  3W8H A;  2ZPA A;  2CDQ A;  3AQB A;  5KYN A;  2CNW A;  3ZIB A;  2EIK C;  4O6M A;  5KYU A;  3F46 A;  2YHS A;  3ZG1 A;  1PD0 A;  1JPN A;  4XWJ A;  1SZI A;  4C7O A;  3W2V A;  3UMI A;  3T6B A;  5KYW B;  4Q4Z F;  3PHF 2;  4E7Z A;  4CSA C;  1J8Y F;  5CI9 A;  1OCC C;  3Q7L A;  3KL4 A;  1QLE C;  5T3T A;  3FVY A;  3KMI A;  3RH3 A;  1W2W A;  3DAG A;  1MNE A;  1Z6A A;  3JRT A;  4PJL A;  2OCC C;  4AK9 A;  5D92 A;  4B6I A;  4AE4 A;  2CGE A;  3NYL A;  3ECS A;  3FAJ A;  3N2Z B;  2R7W A;  4GEH A;  2Y3G A;  2A6E F;  2X51 A;  3S0X A;  1M57 C;  4JVS A;  5E3C A;  5KYY A;  1JPJ A;  3SYN A;  2XRH A;  4RDA A;  5D91 A;  3WG7 C;  2E87 A;  4YN0 B;  3B0V C;  4KBL A;  3SP1 A;  4JUR I;  5DVW A;  3EGX A;  5B1B C;  1IZM A;  4LAC B;  1FTS A;  4Q7C A;  2KJG A;  3T6J A;  3ITF A;  2H7V C;  2W4M A;  3ABL C;  2L81 A;  3N24 A;  1OKK D;  3SEO A;  1PCX A;  2WZL A;  4X0R A;  4O7G A;  3EG9 A;  4BJ1 A;  4YT2 A;  5CI8 A;  3EQL F;  3LEV A;  2W4B A;  2NUT A;  2EIL C;  2DYR C;  3W8I A;  5DLJ A;  4EBB A;  2VH3 A;  3K6B A;  1D1B A;  4DBR A;  2W9Y A;  2IXN A;  2R7O A;  5KYU B;  2PF4 E;  3DM5 A;  1OCR C;  3ASN C;  3EPV A;  2L9J A;  2QTV A;  3HLZ A;  2OG2 A;  2R7V A;  2LSE A;  3NYJ A;  1ZHT A;  2XXA A;  3T4R A;  4C7O B;  4AX2 A;  1MND A;  2WL8 A;  3LLI A;  2PP4 A;  3CZ6 A;  1D0Z A;  3ZVR A;  1VOM A;  1OCO C;  1J8M F;  1Z23 A;  2IXM A;  3AG4 C;  4U5H A;  4AE4 B;  3LES A;  3NYM A;  4OIQ F;  1NG1 A;  2A1D D;  3AG1 C;  1D0X A;  3I4U A;  3LJB A;  4C3D A;  3DM9 B;  5DS5 A;  2A69 F;  5KYY B;  4LLE A;  3Q7G A;  2C04 A;  1ZHX A;  3ASO C;  2M4E A;  3EGD B;  3FDQ A;  2H7B A;  5DQZ A;  2B0J A;  2R7S A;  2Q3T A;  4RD9 A;  2WVO A;  4J32 B;  5DQT A;  1NU9 C;  3SNH A;  4ANJ A;  2H7O A;  4G7H F;  1VYI A;  3EGX B;  3DMD A;  4G7Z F;  2WZG A;  3EJN A;  1OKK A;  4PJJ A;  1FFH A;  1FMW A;  3HJC A;  1M56 C;  1TKN A;  4BEJ A;  5F5H A;  3EG9 B;  4KNW A;  4HEA J;  4ULW A;  1TWC A;  5BUO A;  2NUT B;  4IRU A;  1FMV A;  2VAS A;  1MMD A;  2IYL D;  3LS0 A;  2ZXR A;  4U5F E;  2R7R A;  4F4B A;  3Q6N A;  2Y39 A;  2Y3B A;  2WZF A;  1SF8 A;  4O79 A;  3K33 A;  1BR2 A;  4I1M A;  2YZS A;  1TWA A;  2J0W A;  3B0U X;  2R7X A;  1D0Y A;  1ZHY A;  1Z3I X;  4I1O B;  3LS1 A;  3EH1 A;  1M2O A;  3ABK C;  4H4K C;  2WB7 A;  4DVY P;  2Z15 A;  1TR2 A;  3OWT A;  3EGD A;  4ZLD A;  2HV7 A;  2XXA B;  4BJ5 A;  4NY3 A;  2PX3 A;  3V7O A;  4EWC A;  5KYX B;  3WOD F;  2R7T A;  4K0D A;  5E3A A;  4LER A;  2KW3 C;  1D1C A;  4QDL A;  2J9W A;  3PMR A;  2D5R B;  4DVZ A;  1SMY F;  3O6X A;  4WJ0 A;  5FCL A;  1VYK A;  5DS6 A;  1MMN A;  4U5D E;  3RKO F;  2J7P D;  2WVN A;  2P7V A;  4RBN A;  4XTK A;  5E2Q A;  4FWV A;  4BJ6 C;  3AG3 C;  3POV A;  4HFK B;  4JCH A;  4G0H A;  4DBQ A;  3DAF A;  3VAY A;  4Q5S F;  2Y69 C;  3K66 A;  3M1C B;  3UR3 C;  3DJN B;  3H65 A;  3KKB A;  4HE8 D;  4OIP F;  1ST6 A;  2G3K A;  2V26 A;  4OD5 A;  5T3W A;  3DXJ F;  4OIN F;  3RFY A;  4OIO F;  2HV6 A;  2Q9B A;  3JYH A;  4OIR F;  1Z63 A;  1ZYR F;  3DD7 A;  1TWH A;  3EH2 A;  4YWQ A;  3QZC A;  3N0T A;  2Q9A A;  4CBE A;  3W2W A;  2ZXW C;  1WGW A;  2EIN C;  3DJU B;  5KYX A;  4MQ9 F;  1V54 C;  4CS7 A;  3S27 A;  2W45 A;  4G7O F;  1ZU4 A;  5HSW A;  2NUP B;  1Z5Z A;  1ZHZ A;  4OD4 A;  2V3C C;  3K1I C;  4U5G A;  2J46 A;  2J9V A;  1LVK A;  2DYS C;  3EZH A;  3UMH A;  4M63 A;  5B1A C;  2WVQ A;  4CS8 C;  3LNR A;  2IXO A;  3I5Q A;  1BR1 A;  4CS9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...