3FAJA

Structure of the structural protein p131 of the archaeal virus acidianus two-tailed virus (atv)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
108
structure length
101
Chain Sequence
KKGDYAGGAVKILDMFENGQLGYPEVTLKLAGEEANARRAGDERTKEAIHAIVKMISDAMKPYRSQPIPGEVIAQVTSNPEYQQAKAFLASPATQVRNIER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Putative uncharacterized protein
publication title Structure of the structural protein P131 of the archaeal virus Acidianus Two-tailed virus (ATV)
rcsb
source organism Acidianus two-tailed virus
total genus 45
structure length 101
sequence length 108
ec nomenclature
pdb deposition date 2008-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.950 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3fajA00
3FAJA
chains in the Genus database with same CATH superfamily
3B0PA 3ZC4A 4JZAA 4HFFB 1M2VA 1A41A 2Y39A 4IGGA 5B1AC 1LI5A 3FDQA 3JRMO 5JSLA 5T3TA 4BJ1A 4BJTA 3QTHA 5KYUB 2YKZA 4G7HF 3ZTZA 1Q0FA 4E0IA 3NG1A 2IBFA 2M64A 2NSGA 3W8IA 3OWTA 1D1CA 2Y3BA 2WZLA 1M56C 1M2OA 2J9BA 3LS0A 5L0JA 4PJMA 2A69F 2A6HF 3RQFA 2XLVA 3NKEA 2AVKA 2F22A 1WATA 4JIOA 3RYLA 2W9YA 1YA7O 4XEVA 3ZSUA 4UDVA 4G7ZF 1O87A 5T1DB 3A11A 2R7VA 2J7PD 2WB7A 1JPJA 1JPNA 1FFTC 1Q0KA 3S27A 2XM4A 4NC3A 1I4ZA 2DGJA 2QTVA 2VB6A 3H2VA 3V5XA 1MMGA 3JSEO 1G5ZA 2L81A 3EH2A 3LUTB 3S90A 3JRTA 5L0FA 3NMKA 1T6QA 3EHMA 1BBHA 3U8PA 5L0DA 3L8IA 3WG7C 1RXQA 3TJ5A 2YL7A 3TD7A 4PJNA 1ZU4A 1YVIA 3RW0A 4CDYA 2KQ9A 5F5FA 2XLEA 2OEXA 3WHNA 2BL2A 2KW3C 5F5HA 2R02A 1Z3IX 4BEJA 4YT4A 2WZFA 1UFBA 4U9DA 5CI8A 4XLNF 2NSFA 4O6NA 2O9XA 3DAGA 2OU6A 3RIPA 4PR9A 4D4XA 4I1MA 1T5OA 2NUTB 4JJFA 1VLTA 2OQMA 3ZDLA 4J32B 4ULWA 4CX9A 3O10A 2ZXOA 2G3KA 2IXNA 3E70C 4MVQA 1TQGA 2CGEA 2MHRA 1TWAA 2J9UA 3KL4A 4G78A 3UMHA 1HE9A 2Q3TA 4OIQF 1F1MA 1MMDA 5FZTA 2L6GA 4XPXA 3AJMA 3LNMB 1MMAA 2P7VA 3O39A 1PD0A 4E17A 2KSFA 5KYUA 2HZ8A 3JZ0A 2LCHA 3LEVA 3RQGA 3EFOB 2I15A 4ONSA 4MQ9F 1WTYA 2VCBA 4EIYA 3A9CA 3VRCA 5HV9A 2WVQA 1DOWA 4YN0B 3X2QC 3NDBB 2HKVA 3EZHA 3QMKA 2EIJC 3CAXA 3BEHA 4LLCA 2OKUA 1WASA 3LEOA 3SP1A 3DMDA 4MVRA 4NTBA 3LLKA 3UR3C 4DBQA 3LNRA 5KYYB 1QZXA 4WGZA 4XWJA 1Q0MA 3T4RA 1QPUA 2ASRA 4CDVA 2HFIA 4GEHA 1VYKA 1NU9C 4XPWA 2WVOA 4EBBA 5L3VA 1QKRA 5COGA 2XSEA 2VCCA 3ZQYA 5AC5A 3UGPA 3DXJF 4Z9HA 3LLIA 1VTMP 3L1MA 1G4US 1BR4A 2X0CA 2PF4E 3IEEA 2KNHA 3MFNA 1LS1A 2ZXWC 3Q7GA 3UGOA 1AUEA 1NSGB 2L9JA 3B71A 3IPMO 3KYJA 2IXPA 1MNEA 3T6GB 2EPKX 3RKOF 2CNWA 3AOUA 3EQLF 4C3BA 2R03A 1Z6AA 4LLEA 3US6A 5JUAA 1XZPA 4Z9JA 3GM2A 3KMIA 4MNDA 2CYDA 4M63A 3TULA 4K0DA 2TMVP 2V3CC 3AQBA 4JC7A 3VF0A 4KNVA 2V26A 2GAQA 2QNLA 4AX2A 2VC9A 5JP7A 2H7OA 2LQGA 3W8HA 1LIHA 2HS5A 5D91A 4BJ5A 5BQHA 4HFKB 3B0UX 2LP4A 2Q7RA 3ZIBA 3I5PA 3S0XA 3JCUQ 3SXKA 1K40A 3DE8A 3EG9B 3ZVRA 2JD3A 1QVXA 5L0CA 1LM3B 4XQ1A 4O7GA 2B0HA 2FAPB 1H7IA 1M6TA 2LD6A 4RBNA 2ETSA 3GORA 4DVYP 5BUOA 2VCAA 1JRAA 3K7DA 3N0TA 1E86A 2R7WA 2DB4A 5DS6A 5A69A 5A6AA 4OINF 1Z7Qc 1BZ4A 1OCCC 2DYRC 1YYXA 2XL8A 3EFOA 5DLJA 2L6FA 5COMA 2I8BA 5A6KA 1ZW3A 3W2VA 2W4BA 1H9GA 2OG2A 4P6IC 1C03A 1BR2A 4AE4B 1ZHWA 2Q9BA 1ST6A 4BJ6C 5KYYA 2XLOA 4N6CA 4N6HA 4O6MA 3G4XA 2C03A 1YARO 2CNWD 2LK4A 2YL1A 4DRHB 1L3PA 2B0JA 4RDAA 3JTLO 2XM0A 2EPOA 3GEEA 4YK5A 2YWAA 4IB4A 1C17M 2Y3DA 1VK5A 4EBJA 4EKWA 5JT4A 4KNWA 3MYFA 2LFDA 1K04A 3DM5A 1D1AA 1DOVA 4IWBA 2LIGA 2YEVA 2UUHA 2HV7A 2Q9CA 4JTAB 1LS4A 3ABKC 1FFHA 2AWYA 1U0BB 5AGFA 2C04A 4NY3A 3TQOA 5TJ5E 2CCYA 1QQ3A 2ICWG 4HE8D 1OXKA 3ASNC 2YLIA 2DYSC 4Z9IA 2MWQA 1GGQA 2RSEB 2XL4A 2R7TA 1YJGA 2HMZA 3R2PA 1ZU5A 4E0HA 2UUIA 3IQ6A 1YA9A 2FGYA 2XRHA 3FXHA 1UG7A 1ZHTA 1WOLA 2NPUA 3N24A 3EPVA 5KYNA 3GM3A 1OQCA 4ZLCA 3EH1A 3EGXB 3EG9A 1BDJB 2G3VA 3CEXA 4JVSA 4D4NA 4CIPA 4JCZA 4LACB 4XEKA 3VAYA 3KYIA 1ZZPA 1O3UA 4EWCA 2HV6A 2XLHA 3IQCA 1OCZC 5COFA 4KBLA 3WODF 5JLIA 5CI9A 2EILC 1WN0A 2WZGA 2G62A 1TFKB 1D0ZA 2OEVA 2XLMA 4MVMA 4DBRA 2NUPB 2IXMA 2WL8A 3HNIA 3LJBA 2X51A 3EHNA 3RQEA 2HMQA 2Y69C 1T9KA 4EHPA 2IYLD 4KI2A 1YYJA 1RKCA 3OEOA 3NMIA 2LSEA 4A2NB 3H2UA 1V74B 3V5ZA 4CSAC 5EGYA 4IJJA 3GM1A 4WGYA 4F4BA 2E87A 4QI0A 3LS1A 4K7BA 1CPQA 1LE4A 4GYTA 4IARA 2KC3A 1SR2A 1YDIA 3TK0A 5DS5A 3VM6A 1ZVZA 3R7CA 2XLDA 1KNYA 3PHF2 1XWJA 4JRZA 2L7AA 1U6HA 2OJQA 4FX5A 3L34A 1LI7A 4U9EA 2VH3A 4U5DE 3RFYA 2YLGA 2BC5A 4YL3A 3IQ5A 2QLAA 1APCA 3C63A 1JR8A 2A0UA 5B1BC 1A0BA 3TOLA 5F28E 1NZEA 4B6IA 3MLGA 2R9RB 4OD5A 3SEOA 2XXAB 2GWWA 1B68A 2J0XA 3G4ZA 3HNLA 4JKVA 2OJED 1NG1A 1A7VA 4BEMJ 2W4MA 4PJLA 3EGDB 3M4CA 4H54A 1S05A 3GANA 3S84A 2PBEA 5A6BA 2PP4A 2Y3GA 3EGXA 4FESA 4E18A 1MQVA 4ZLDA 4MW8A 3U8VA 4DRIB 4JEAA 2PX3A 4J7YA 1E83A 3L8JA 4KC9A 3I5QA 3SXZA 1PD1A 4C3DA 2P6VA 3U3BA 5CIVA 5KYWB 1LPEA 4PFPA 4YT5A 1T01A 1PCXA 1OKKA 1OXBA 2AU5A 2GFHA 3K33A 1JAFA 1CPRA 2EIKC 4EBKA 1ZHYA 2NUPA 4G7OF 4NTAA 2CDQA 2KK1A 5KYXB 3HNJA 4H4KC 4U5BE 2P0NA 2EIMC 4CJGA 1E85A 3CZ6A 5JVEA 3F46A 2OCCC 2HUJA 4AK9A 2EINC 2R7XA 5HSWA 2J46A 3I4UA 3FOOA 4CS7A 5L0IA 1E2XA 3ECSA 2XL6A 2AP3A 1WWPA 3TJ6A 3TOMA 4OIPF 3ZTMA 2NUTA 4JEBA 2KGOA 1M57C 1T6IA 4NTFA 4PACA 4A4AA 2QUPA 2GA0A 3NMJA 4W8KA 4PK4A 5L3QA 5L0HA 2GDCA 1TWCA 1ZW2A 3K1HA 3QW1A 1VB5A 1VLSA 4X0RA 3S28A 3QZCA 2HJ3A 2R05A 2R7RA 4YT8A 2IXOA 2JX0A 4BJ6A 2R7UA 1FNTc 1I4YA 1RJ9B 5A6BD 2D5RB 3ZG1A 4MTFA 4U5EE 1J8MF 4CBEA 3NYMA 1W2WA 1Z5ZA 2XXAA 1IW7F 3Q7LA 5E3CA 1S7ZA 2J9VA 3SXYA 1L7CA 1OKKD 2IOQA 3EGDA 4MVOA 4U5GA 5E2QA 4O79A 1HW2A 4U5CE 3HNKA 2Z15A 4CJOA 4WJ0A 2QY9A 1A7DA 1C02A 1YLMA 3QVYA 3GEHA 2ZPAA 4P9FA 2P61A 1H9TA 3E9VA 256BA 5T3WA 1HE1A 1TWGA 2P1AA 2J0WA 3AGUA 2OOCA 4CIHA 4LDKA 1FMWA 3KKBA 2J9WA 4W8PA 2Q4FA 3K1IA 3Q6NA 3DJNB 3SXMA 1Q0GA 2BE5F 2A0BA 2H7VC 3LESA 2M4EA 4CDAA 2YRFA 1IZMA 1D0YA 1HY5A 2XS8A 3C8GB 4JURI 5JS5A 1G8XA 4RD9A 4DRJB 4CS8C 3OA1A 2J8WA 1NFOA 3ABLC 3GEIA 3K1IC 1BR1A 4BG0A 2W45A 1OCRC 2IM8A 3POVA 2DI3A 3KH2A 1JOGA 2HSQA 1CGNA 4MVSA 3G50A 4XLPF 1TR2A 2PFDA 3O6XA 2XLWA 3FHDA 2PX0A 2Y3HA 4CS9C 1EA8A 5E33A 1OW8A 3DD7A 1PV3A 2WVNA 2D4UA 1V54C 5IY5C 5BQIA 4XPYA 4U5FE 1OR2A 4CSAA 5EK0A 4I1OB 4JJGA 3EZIA 1RJ9A 2R7OA 1NBBA 3SNHA 3CQZA 1O5HA 3K6BA 4E7SA 3AG4C 3FAPB 1Z23A 4MS2A 3KPHA 1SYQA 3EJNA 3U9MA 4DXWA 4JE9A 4MTGA 3RVZA 5K0IA 5AC4A 4N06A 2RD9A 4AE4A 3DE9A 3SYNA 1VOMA 1Y6DA 1OW6A 2YHSA 4I3MA 1GQAA 2EPLX 1EI7A 4JW1A 3J06A 3ABMC 3IQTA 1SZIA 1NU7D 5B3IA 1TKNA 2KJGA 3PMRA 1D0XA 4U5HA 4JCHA 5EHHA 3AG1C 3AGTA 3W2WA 3GWNA 1ORSC 4JTCB 2MYSA 1Y4CA 1RKEB 3U3FA 4OIOF 3RVYA 1OR3A 4IRUA 2FFHA 4PJJA 1SF8A 3L0IA 3U2MA 3M79A 3DAFA 1ZYRF 1Q0DA 2A6EF 3C8GA 3LAYA 3DM9B 5DQTA 1HW1A 5FCLA 1K05A 1ZHZA 2H8AA 3GODA 3DWWA 4I44A 3DKAA 3RF3A 4AL0A 1G4WR 4Q5SF 3N2ZB 1GM5A 2YZSA 3T6BA 3UMIA 4NQFA 1NLXA 1KTMA 3B9QA 4IAQA 1QLEC 4GQHA 5DVWA 1E84A 2L6HA 4Q7CA 4ULVA 1WGWA 4YJWA 5D92A 4P9TA 2R25A 2QE9A 4Q4ZF 3SZRA 2Q00A 3U5SA 2YQYA 3Q6MA 1T6UA 4C7OB 2YVKA 2HJMA 1J8YF 4JTDB 2Q9AA 3U0CA 3NRHA 1AVOB 3PDMP 3U2LA 4E7ZA 4YT2A 3V7OA 4ANJA 2A68F 5E3AA 3DJUB 3ATPA 1EQ1A 1OCOC 2ZD9A 3QVZA 1R5ID 3BRJA 2VASA 3B0VC 3C62A 3FAJA 2PNOA 4XEFA 2H7BA 1RMVA 2YL0A 1ORJA 1YAUO 4EUKB 1FR0A 1LKXA 3F47A 3PCVA 4R32A 3UNGC 4DJ9A 4OIRF 1V55C 1R4TA 3JSZA 3WAQA 3HJCA 5BQGA 3C8GD 3ZWIA 4J7TA 3JYYA 1M2VB 4O6YA 1KU2A 1U89A 1AEPA 3X1OA 3CSKA 2KYHA 1LE2A 3T9OA 2A1DD 1Z63A 1ORYA 3HTKC 3IHUA 1GS9A 3HLZA 1YZAA 1LVKA 1RKEA 4IAOA 4PFOA 1HMOA 2J45A 3NYLA 3FMSA 4N4WA 3AQCA 2XS1A 1D1BA 3ZQVA 3H65A 2YL3A 2AWCA 3C7JA 1N1CA 2ZXPA 1MNDA 1VMAA 3NKDA 3K66A 4J30B 4LDQA 1V4AA 1HMDA 4MW3A 3JT1A 1NFNA 3T6JA 5JRAA 3MX3A 5GPGB 3RH3A 4YL0A 5B3SC 1H6GA 1EKYA 3M1CB 2EPMX 4MVUA 4ER9A 3UMKA 3VYWA 1XZQA 2NG1A 3C8ZA 3NYJA 1QSPA 3MBGA 1FMVA 2HSBA 3C18A 2CW0F 4FWVA 4G0HA 4L6RA 4QDLA 4C3EA 3M15A 3V5YA 4BPMA 4DVZA 1FAPB 1OW7A 4BJ5C 5L0GA 3ASOC 3FVYA 2R7QA 1CGME 2ZXRA 3DI5A 3ITFA 4AL1A 4C7OA 1ZHXA 4LDRA 1VYIA 4MTOA 3MYIA 4CS8A 3S9OA 5KYWA 1RCPA 4MVZA 2J7PA 1FTSA 4YL1A 1TWHA 3JYHA 3S29A 3AG2C 4WABA 3GWLA 4HEAJ 5DS4A 1I5NA 1MMNA 5KYXA 2EPNA 3O55A 2JPUA 4DOZA 1A7EA 2YLDA 3QW0A 4CS9A 1CGOA 3HKKA 2R7SA 1YZCA 4XTKA 4YWQA 1JMWA 1TFOB 4QI2A 4K1OA 5A6JA 3W4YA 4NCQA 4LERA 3B29A 1SMYF 4OD4A 4FAPB 3FOPA 5DQZA 3DZAA 3M4BA 3U9JA 3AG3C 2LFFA
chains in the Genus database with same CATH topology
3B0PA 3ZC4A 4JZAA 4HFFB 1M2VA 2Y39A 5B1AC 3FDQA 5T3TA 4BJ1A 4BJTA 5KYUB 4G7HF 3NG1A 3W8IA 3OWTA 1D1CA 2Y3BA 2WZLA 1M56C 1M2OA 3LS0A 4PJMA 2A69F 2A6HF 3RYLA 4CS7A 3NKEA 3ZSUA 2W9YA 4G7ZF 1O87A 5T1DB 2R7VA 2J7PD 2WB7A 1JPJA 1JPNA 1FFTC 3S27A 2DGJA 2QTVA 2VB6A 1MMGA 2L81A 3EH2A 3JRTA 3EHMA 3WG7C 3TD7A 4PJNA 1ZU4A 5F5FA 2KQ9A 2KW3C 5F5HA 1Z3IX 4BEJA 4YT4A 2WZFA 5CI8A 4XLNF 4O6NA 2O9XA 3DAGA 3RIPA 4I1MA 2NUTB 4JJFA 4J32B 4ULWA 2ZXOA 2G3KA 2IXNA 3E70C 2CGEA 3KL4A 1TWAA 2J9UA 3UMHA 2Q3TA 4OIQF 1MMDA 1MMAA 2P7VA 3O39A 1PD0A 5KYUA 3LEVA 3EFOB 4MQ9F 2WVQA 3X2QC 4YN0B 3NDBB 3EZHA 3QMKA 2EIJC 4LLCA 5KYYB 3SP1A 3DMDA 3UR3C 3LLKA 4DBQA 3LNRA 1QZXA 4XWJA 3T4RA 4GEHA 1VYKA 1NU9C 4EBBA 2WVOA 5L3VA 2XSEA 3UGPA 3DXJF 3LLIA 1BR4A 2PF4E 3IEEA 2KNHA 1LS1A 2ZXWC 3Q7GA 3UGOA 2L9JA 2IXPA 1MNEA 3RKOF 2CNWA 3EQLF 4C3BA 1Z6AA 4LLEA 3KMIA 4MNDA 4M63A 2V3CC 4K0DA 3AQBA 4KNVA 2V26A 4AX2A 2H7OA 3W8HA 5D91A 4BJ5A 4HFKB 3B0UX 3ZIBA 3I5PA 3S0XA 3JCUQ 3EG9B 3ZVRA 2JD3A 4O7GA 4DVYP 4RBNA 5BUOA 3K7DA 3N0TA 2R7WA 5DS6A 4OINF 5DLJA 1Z63A 1OCCC 2DYRC 3EFOA 2I8BA 3W2VA 2W4BA 2OG2A 4P6IC 1BR2A 4AE4B 1ZHWA 2Q9BA 1ST6A 4BJ6C 5KYYA 4O6MA 2C03A 2CNWD 2B0JA 4RDAA 1VK5A 4KNWA 4IWBA 3DM5A 1D1AA 2YEVA 2HV7A 2Q9CA 3ABKC 1FFHA 2C04A 4NY3A 4HE8D 3ASNC 2DYSC 2MWQA 2XL4A 2R7TA 1ZU5A 3RFYA 2FGYA 2XRHA 3N24A 1ZHTA 3EPVA 5KYNA 4ZLCA 3EH1A 3EGXB 3EG9A 2G3VA 4JVSA 4LACB 3VAYA 4EWCA 2HV6A 1OCZC 4KBLA 3WODF 5CI9A 2EILC 2WZGA 2G62A 1D0ZA 4DBRA 2NUPB 2IXMA 2WL8A 3LJBA 2X51A 3EHNA 2Y69C 4KI2A 2IYLD 3OEOA 4A2NB 2LSEA 4CSAC 5EGYA 4IJJA 4F4BA 2E87A 4QI0A 3LS1A 4K7BA 4GYTA 5DS5A 3PHF2 4FX5A 3L34A 2VH3A 4U5DE 5B1BC 1NZEA 4B6IA 3MLGA 4OD5A 3SEOA 2XXAB 2J0XA 1NG1A 2W4MA 4PJLA 3EGDB 3GANA 2PP4A 2Y3GA 3EGXA 4FESA 4ZLDA 2PX3A 4KC9A 3I5QA 1PD1A 4C3DA 2P6VA 5KYWB 4PFPA 4YT5A 1PCXA 1OKKA 2GFHA 3K33A 2EIKC 1ZHYA 2NUPA 4G7OF 2CDQA 5KYXB 4H4KC 4U5BE 2EIMC 3CZ6A 3F46A 2OCCC 4AK9A 2EINC 2R7XA 5HSWA 2J46A 3I4UA 3ECSA 4OIPF 2NUTA 2KGOA 1M57C 4W8KA 4PK4A 5L3QA 4X0RA 1TWCA 3S28A 3K1HA 3QZCA 2R7RA 4YT8A 2IXOA 4BJ6A 2R7UA 1RJ9B 2D5RB 3ZG1A 4U5EE 1J8MF 4CBEA 3NYMA 1W2WA 1Z5ZA 2XXAA 1IW7F 3Q7LA 5E3CA 1S7ZA 2J9VA 1OKKD 2IOQA 3EGDA 4U5GA 5E2QA 4O79A 4U5CE 2Z15A 4WJ0A 2QY9A 2ZPAA 3E9VA 5T3WA 1TWGA 2J0WA 4CIHA 1FMWA 3KKBA 2J9WA 3Q6NA 3DJNB 2BE5F 2H7VC 3LESA 2M4EA 1IZMA 1D0YA 4JURI 1G8XA 4RD9A 4CS8C 3OA1A 3ABLC 3K1IC 1BR1A 4BG0A 2W45A 1OCRC 3POVA 3KH2A 4XLPF 1TR2A 2PFDA 3O6XA 3FHDA 2PX0A 2Y3HA 4CS9C 5E33A 3DD7A 2WVNA 1V54C 5IY5C 4U5FE 4CSAA 4I1OB 4JJGA 3EZIA 1RJ9A 2R7OA 3SNHA 3CQZA 1O5HA 3K6BA 4E7SA 3AG4C 1Z23A 3EJNA 4N06A 4AE4A 3SYNA 1VOMA 2YHSA 4I3MA 4JW1A 3ABMC 1SZIA 1NU7D 1TKNA 2KJGA 3PMRA 1D0XA 4U5HA 4JCHA 5EHHA 3AG1C 3W2WA 2MYSA 4OIOF 4IRUA 2FFHA 4PJJA 1SF8A 3L0IA 3DAFA 1ZYRF 2A6EF 3LAYA 3DM9B 5DQTA 5FCLA 3GODA 1ZHZA 4I44A 4Q5SF 3N2ZB 2YZSA 3T6BA 3UMIA 3B9QA 5DVWA 1QLEC 4Q7CA 5D92A 1WGWA 4YJWA 4Q4ZF 3SZRA 3Q6MA 4C7OB 1J8YF 2Q9AA 3NRHA 4E7ZA 4YT2A 3V7OA 4ANJA 2A68F 5E3AA 3DJUB 1OCOC 3B0VC 2VASA 3FAJA 2H7BA 1LKXA 3F47A 3UNGC 4OIRF 1V55C 3JSZA 3HJCA 1M2VB 4O6YA 1KU2A 3X1OA 3CSKA 2A1DD 3HTKC 4IAOA 4PFOA 3HLZA 1LVKA 3NYLA 2J45A 3AQCA 1D1BA 3H65A 1N1CA 2ZXPA 1MNDA 1VMAA 3NKDA 3K66A 4J30B 3T6JA 3JT1A 3MX3A 3RH3A 5B3SC 3M1CB 3UMKA 3VYWA 2NG1A 4G0HA 3NYJA 4QDLA 2R7SA 1FMVA 4FWVA 2CW0F 4C3EA 4DVZA 4BJ5C 3ASOC 3FVYA 2R7QA 2ZXRA 3ITFA 4C7OA 1ZHXA 1VYIA 4CS8A 5KYWA 2J7PA 1FTSA 1TWHA 3JYHA 3S29A 3AG2C 5DS4A 4HEAJ 1MMNA 5KYXA 4DOZA 4CS9A 4XTKA 4YWQA 4QI2A 4LERA 1SMYF 4OD4A 5DQZA 3DZAA 3AG3C 2Y3DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FAJ A; 
#chains in the Genus database with same CATH topology
 3B0P A;  3ZC4 A;  4JZA A;  4HFF B;  1M2V A;  1A41 A;  2Y39 A;  4IGG A;  5B1A C;  1LI5 A;  3FDQ A;  3JRM O;  5JSL A;  5T3T A;  4BJ1 A;  4BJT A;  3QTH A;  5KYU B;  2YKZ A;  4G7H F;  3ZTZ A;  1Q0F A;  4E0I A;  3NG1 A;  2IBF A;  2M64 A;  2NSG A;  3W8I A;  3OWT A;  1D1C A;  2Y3B A;  2WZL A;  1M56 C;  1M2O A;  2J9B A;  3LS0 A;  5L0J A;  4PJM A;  2A69 F;  2A6H F;  3RQF A;  2XLV A;  3NKE A;  2AVK A;  2F22 A;  1WAT A;  4JIO A;  3RYL A;  2W9Y A;  1YA7 O;  4XEV A;  3ZSU A;  4UDV A;  4G7Z F;  1O87 A;  5T1D B;  3A11 A;  2R7V A;  2J7P D;  2WB7 A;  1JPJ A;  1JPN A;  1FFT C;  1Q0K A;  3S27 A;  2XM4 A;  4NC3 A;  1I4Z A;  2DGJ A;  2QTV A;  2VB6 A;  3H2V A;  3V5X A;  1MMG A;  3JSE O;  1G5Z A;  2L81 A;  3EH2 A;  3LUT B;  3S90 A;  3JRT A;  5L0F A;  3NMK A;  1T6Q A;  3EHM A;  1BBH A;  3U8P A;  5L0D A;  3L8I A;  3WG7 C;  1RXQ A;  3TJ5 A;  2YL7 A;  3TD7 A;  4PJN A;  1ZU4 A;  1YVI A;  3RW0 A;  4CDY A;  2KQ9 A;  5F5F A;  2XLE A;  2OEX A;  3WHN A;  2BL2 A;  2KW3 C;  5F5H A;  2R02 A;  1Z3I X;  4BEJ A;  4YT4 A;  2WZF A;  1UFB A;  4U9D A;  5CI8 A;  4XLN F;  2NSF A;  4O6N A;  2O9X A;  3DAG A;  2OU6 A;  3RIP A;  4PR9 A;  4D4X A;  4I1M A;  1T5O A;  2NUT B;  4JJF A;  1VLT A;  2OQM A;  3ZDL A;  4J32 B;  4ULW A;  4CX9 A;  3O10 A;  2ZXO A;  2G3K A;  2IXN A;  3E70 C;  4MVQ A;  1TQG A;  2CGE A;  2MHR A;  1TWA A;  2J9U A;  3KL4 A;  4G78 A;  3UMH A;  1HE9 A;  2Q3T A;  4OIQ F;  1F1M A;  1MMD A;  5FZT A;  2L6G A;  4XPX A;  3AJM A;  3LNM B;  1MMA A;  2P7V A;  3O39 A;  1PD0 A;  4E17 A;  2KSF A;  5KYU A;  2HZ8 A;  3JZ0 A;  2LCH A;  3LEV A;  3RQG A;  3EFO B;  2I15 A;  4ONS A;  4MQ9 F;  1WTY A;  2VCB A;  4EIY A;  3A9C A;  3VRC A;  5HV9 A;  2WVQ A;  1DOW A;  4YN0 B;  3X2Q C;  3NDB B;  2HKV A;  3EZH A;  3QMK A;  2EIJ C;  3CAX A;  3BEH A;  4LLC A;  2OKU A;  1WAS A;  3LEO A;  3SP1 A;  3DMD A;  4MVR A;  4NTB A;  3LLK A;  3UR3 C;  4DBQ A;  3LNR A;  5KYY B;  1QZX A;  4WGZ A;  4XWJ A;  1Q0M A;  3T4R A;  1QPU A;  2ASR A;  4CDV A;  2HFI A;  4GEH A;  1VYK A;  1NU9 C;  4XPW A;  2WVO A;  4EBB A;  5L3V A;  1QKR A;  5COG A;  2XSE A;  2VCC A;  3ZQY A;  5AC5 A;  3UGP A;  3DXJ F;  4Z9H A;  3LLI A;  1VTM P;  3L1M A;  1G4U S;  1BR4 A;  2X0C A;  2PF4 E;  3IEE A;  2KNH A;  3MFN A;  1LS1 A;  2ZXW C;  3Q7G A;  3UGO A;  1AUE A;  1NSG B;  2L9J A;  3B71 A;  3IPM O;  3KYJ A;  2IXP A;  1MNE A;  3T6G B;  2EPK X;  3RKO F;  2CNW A;  3AOU A;  3EQL F;  4C3B A;  2R03 A;  1Z6A A;  4LLE A;  3US6 A;  5JUA A;  1XZP A;  4Z9J A;  3GM2 A;  3KMI A;  4MND A;  2CYD A;  4M63 A;  3TUL A;  4K0D A;  2TMV P;  2V3C C;  3AQB A;  4JC7 A;  3VF0 A;  4KNV A;  2V26 A;  2GAQ A;  2QNL A;  4AX2 A;  2VC9 A;  5JP7 A;  2H7O A;  2LQG A;  3W8H A;  1LIH A;  2HS5 A;  5D91 A;  4BJ5 A;  5BQH A;  4HFK B;  3B0U X;  2LP4 A;  2Q7R A;  3ZIB A;  3I5P A;  3S0X A;  3JCU Q;  3SXK A;  1K40 A;  3DE8 A;  3EG9 B;  3ZVR A;  2JD3 A;  1QVX A;  5L0C A;  1LM3 B;  4XQ1 A;  4O7G A;  2B0H A;  2FAP B;  1H7I A;  1M6T A;  2LD6 A;  4RBN A;  2ETS A;  3GOR A;  4DVY P;  5BUO A;  2VCA A;  1JRA A;  3K7D A;  3N0T A;  1E86 A;  2R7W A;  2DB4 A;  5DS6 A;  5A69 A;  5A6A A;  4OIN F;  1Z7Q c;  1BZ4 A;  1OCC C;  2DYR C;  1YYX A;  2XL8 A;  3EFO A;  5DLJ A;  2L6F A;  5COM A;  2I8B A;  5A6K A;  1ZW3 A;  3W2V A;  2W4B A;  1H9G A;  2OG2 A;  4P6I C;  1C03 A;  1BR2 A;  4AE4 B;  1ZHW A;  2Q9B A;  1ST6 A;  4BJ6 C;  5KYY A;  2XLO A;  4N6C A;  4N6H A;  4O6M A;  3G4X A;  2C03 A;  1YAR O;  2CNW D;  2LK4 A;  2YL1 A;  4DRH B;  1L3P A;  2B0J A;  4RDA A;  3JTL O;  2XM0 A;  2EPO A;  3GEE A;  4YK5 A;  2YWA A;  4IB4 A;  1C17 M;  2Y3D A;  1VK5 A;  4EBJ A;  4EKW A;  5JT4 A;  4KNW A;  3MYF A;  2LFD A;  1K04 A;  3DM5 A;  1D1A A;  1DOV A;  4IWB A;  2LIG A;  2YEV A;  2UUH A;  2HV7 A;  2Q9C A;  4JTA B;  1LS4 A;  3ABK C;  1FFH A;  2AWY A;  1U0B B;  5AGF A;  2C04 A;  4NY3 A;  3TQO A;  5TJ5 E;  2CCY A;  1QQ3 A;  2ICW G;  4HE8 D;  1OXK A;  3ASN C;  2YLI A;  2DYS C;  4Z9I A;  2MWQ A;  1GGQ A;  2RSE B;  2XL4 A;  2R7T A;  1YJG A;  2HMZ A;  3R2P A;  1ZU5 A;  4E0H A;  2UUI A;  3IQ6 A;  1YA9 A;  2FGY A;  2XRH A;  3FXH A;  1UG7 A;  1ZHT A;  1WOL A;  2NPU A;  3N24 A;  3EPV A;  5KYN A;  3GM3 A;  1OQC A;  4ZLC A;  3EH1 A;  3EGX B;  3EG9 A;  1BDJ B;  2G3V A;  3CEX A;  4JVS A;  4D4N A;  4CIP A;  4JCZ A;  4LAC B;  4XEK A;  3VAY A;  3KYI A;  1ZZP A;  1O3U A;  4EWC A;  2HV6 A;  2XLH A;  3IQC A;  1OCZ C;  5COF A;  4KBL A;  3WOD F;  5JLI A;  5CI9 A;  2EIL C;  1WN0 A;  2WZG A;  2G62 A;  1TFK B;  1D0Z A;  2OEV A;  2XLM A;  4MVM A;  4DBR A;  2NUP B;  2IXM A;  2WL8 A;  3HNI A;  3LJB A;  2X51 A;  3EHN A;  3RQE A;  2HMQ A;  2Y69 C;  1T9K A;  4EHP A;  2IYL D;  4KI2 A;  1YYJ A;  1RKC A;  3OEO A;  3NMI A;  2LSE A;  4A2N B;  3H2U A;  1V74 B;  3V5Z A;  4CSA C;  5EGY A;  4IJJ A;  3GM1 A;  4WGY A;  4F4B A;  2E87 A;  4QI0 A;  3LS1 A;  4K7B A;  1CPQ A;  1LE4 A;  4GYT A;  4IAR A;  2KC3 A;  1SR2 A;  1YDI A;  3TK0 A;  5DS5 A;  3VM6 A;  1ZVZ A;  3R7C A;  2XLD A;  1KNY A;  3PHF 2;  1XWJ A;  4JRZ A;  2L7A A;  1U6H A;  2OJQ A;  4FX5 A;  3L34 A;  1LI7 A;  4U9E A;  2VH3 A;  4U5D E;  3RFY A;  2YLG A;  2BC5 A;  4YL3 A;  3IQ5 A;  2QLA A;  1APC A;  3C63 A;  1JR8 A;  2A0U A;  5B1B C;  1A0B A;  3TOL A;  5F28 E;  1NZE A;  4B6I A;  3MLG A;  2R9R B;  4OD5 A;  3SEO A;  2XXA B;  2GWW A;  1B68 A;  2J0X A;  3G4Z A;  3HNL A;  4JKV A;  2OJE D;  1NG1 A;  1A7V A;  4BEM J;  2W4M A;  4PJL A;  3EGD B;  3M4C A;  4H54 A;  1S05 A;  3GAN A;  3S84 A;  2PBE A;  5A6B A;  2PP4 A;  2Y3G A;  3EGX A;  4FES A;  4E18 A;  1MQV A;  4ZLD A;  4MW8 A;  3U8V A;  4DRI B;  4JEA A;  2PX3 A;  4J7Y A;  1E83 A;  3L8J A;  4KC9 A;  3I5Q A;  3SXZ A;  1PD1 A;  4C3D A;  2P6V A;  3U3B A;  5CIV A;  5KYW B;  1LPE A;  4PFP A;  4YT5 A;  1T01 A;  1PCX A;  1OKK A;  1OXB A;  2AU5 A;  2GFH A;  3K33 A;  1JAF A;  1CPR A;  2EIK C;  4EBK A;  1ZHY A;  2NUP A;  4G7O F;  4NTA A;  2CDQ A;  2KK1 A;  5KYX B;  3HNJ A;  4H4K C;  4U5B E;  2P0N A;  2EIM C;  4CJG A;  1E85 A;  3CZ6 A;  5JVE A;  3F46 A;  2OCC C;  2HUJ A;  4AK9 A;  2EIN C;  2R7X A;  5HSW A;  2J46 A;  3I4U A;  3FOO A;  4CS7 A;  5L0I A;  1E2X A;  3ECS A;  2XL6 A;  2AP3 A;  1WWP A;  3TJ6 A;  3TOM A;  4OIP F;  3ZTM A;  2NUT A;  4JEB A;  2KGO A;  1M57 C;  1T6I A;  4NTF A;  4PAC A;  4A4A A;  2QUP A;  2GA0 A;  3NMJ A;  4W8K A;  4PK4 A;  5L3Q A;  5L0H A;  2GDC A;  1TWC A;  1ZW2 A;  3K1H A;  3QW1 A;  1VB5 A;  1VLS A;  4X0R A;  3S28 A;  3QZC A;  2HJ3 A;  2R05 A;  2R7R A;  4YT8 A;  2IXO A;  2JX0 A;  4BJ6 A;  2R7U A;  1FNT c;  1I4Y A;  1RJ9 B;  5A6B D;  2D5R B;  3ZG1 A;  4MTF A;  4U5E E;  1J8M F;  4CBE A;  3NYM A;  1W2W A;  1Z5Z A;  2XXA A;  1IW7 F;  3Q7L A;  5E3C A;  1S7Z A;  2J9V A;  3SXY A;  1L7C A;  1OKK D;  2IOQ A;  3EGD A;  4MVO A;  4U5G A;  5E2Q A;  4O79 A;  1HW2 A;  4U5C E;  3HNK A;  2Z15 A;  4CJO A;  4WJ0 A;  2QY9 A;  1A7D A;  1C02 A;  1YLM A;  3QVY A;  3GEH A;  2ZPA A;  4P9F A;  2P61 A;  1H9T A;  3E9V A;  256B A;  5T3W A;  1HE1 A;  1TWG A;  2P1A A;  2J0W A;  3AGU A;  2OOC A;  4CIH A;  4LDK A;  1FMW A;  3KKB A;  2J9W A;  4W8P A;  2Q4F A;  3K1I A;  3Q6N A;  3DJN B;  3SXM A;  1Q0G A;  2BE5 F;  2A0B A;  2H7V C;  3LES A;  2M4E A;  4CDA A;  2YRF A;  1IZM A;  1D0Y A;  1HY5 A;  2XS8 A;  3C8G B;  4JUR I;  5JS5 A;  1G8X A;  4RD9 A;  4DRJ B;  4CS8 C;  3OA1 A;  2J8W A;  1NFO A;  3ABL C;  3GEI A;  3K1I C;  1BR1 A;  4BG0 A;  2W45 A;  1OCR C;  2IM8 A;  3POV A;  2DI3 A;  3KH2 A;  1JOG A;  2HSQ A;  1CGN A;  4MVS A;  3G50 A;  4XLP F;  1TR2 A;  2PFD A;  3O6X A;  2XLW A;  3FHD A;  2PX0 A;  2Y3H A;  4CS9 C;  1EA8 A;  5E33 A;  1OW8 A;  3DD7 A;  1PV3 A;  2WVN A;  2D4U A;  1V54 C;  5IY5 C;  5BQI A;  4XPY A;  4U5F E;  1OR2 A;  4CSA A;  5EK0 A;  4I1O B;  4JJG A;  3EZI A;  1RJ9 A;  2R7O A;  1NBB A;  3SNH A;  3CQZ A;  1O5H A;  3K6B A;  4E7S A;  3AG4 C;  3FAP B;  1Z23 A;  4MS2 A;  3KPH A;  1SYQ A;  3EJN A;  3U9M A;  4DXW A;  4JE9 A;  4MTG A;  3RVZ A;  5K0I A;  5AC4 A;  4N06 A;  2RD9 A;  4AE4 A;  3DE9 A;  3SYN A;  1VOM A;  1Y6D A;  1OW6 A;  2YHS A;  4I3M A;  1GQA A;  2EPL X;  1EI7 A;  4JW1 A;  3J06 A;  3ABM C;  3IQT A;  1SZI A;  1NU7 D;  5B3I A;  1TKN A;  2KJG A;  3PMR A;  1D0X A;  4U5H A;  4JCH A;  5EHH A;  3AG1 C;  3AGT A;  3W2W A;  3GWN A;  1ORS C;  4JTC B;  2MYS A;  1Y4C A;  1RKE B;  3U3F A;  4OIO F;  3RVY A;  1OR3 A;  4IRU A;  2FFH A;  4PJJ A;  1SF8 A;  3L0I A;  3U2M A;  3M79 A;  3DAF A;  1ZYR F;  1Q0D A;  2A6E F;  3C8G A;  3LAY A;  3DM9 B;  5DQT A;  1HW1 A;  5FCL A;  1K05 A;  1ZHZ A;  2H8A A;  3GOD A;  3DWW A;  4I44 A;  3DKA A;  3RF3 A;  4AL0 A;  1G4W R;  4Q5S F;  3N2Z B;  1GM5 A;  2YZS A;  3T6B A;  3UMI A;  4NQF A;  1NLX A;  1KTM A;  3B9Q A;  4IAQ A;  1QLE C;  4GQH A;  5DVW A;  1E84 A;  2L6H A;  4Q7C A;  4ULV A;  1WGW A;  4YJW A;  5D92 A;  4P9T A;  2R25 A;  2QE9 A;  4Q4Z F;  3SZR A;  2Q00 A;  3U5S A;  2YQY A;  3Q6M A;  1T6U A;  4C7O B;  2YVK A;  2HJM A;  1J8Y F;  4JTD B;  2Q9A A;  3U0C A;  3NRH A;  1AVO B;  3PDM P;  3U2L A;  4E7Z A;  4YT2 A;  3V7O A;  4ANJ A;  2A68 F;  5E3A A;  3DJU B;  3ATP A;  1EQ1 A;  1OCO C;  2ZD9 A;  3QVZ A;  1R5I D;  3BRJ A;  2VAS A;  3B0V C;  3C62 A;  3FAJ A;  2PNO A;  4XEF A;  2H7B A;  1RMV A;  2YL0 A;  1ORJ A;  1YAU O;  4EUK B;  1FR0 A;  1LKX A;  3F47 A;  3PCV A;  4R32 A;  3UNG C;  4DJ9 A;  4OIR F;  1V55 C;  1R4T A;  3JSZ A;  3WAQ A;  3HJC A;  5BQG A;  3C8G D;  3ZWI A;  4J7T A;  3JYY A;  1M2V B;  4O6Y A;  1KU2 A;  1U89 A;  1AEP A;  3X1O A;  3CSK A;  2KYH A;  1LE2 A;  3T9O A;  2A1D D;  1Z63 A;  1ORY A;  3HTK C;  3IHU A;  1GS9 A;  3HLZ A;  1YZA A;  1LVK A;  1RKE A;  4IAO A;  4PFO A;  1HMO A;  2J45 A;  3NYL A;  3FMS A;  4N4W A;  3AQC A;  2XS1 A;  1D1B A;  3ZQV A;  3H65 A;  2YL3 A;  2AWC A;  3C7J A;  1N1C A;  2ZXP A;  1MND A;  1VMA A;  3NKD A;  3K66 A;  4J30 B;  4LDQ A;  1V4A A;  1HMD A;  4MW3 A;  3JT1 A;  1NFN A;  3T6J A;  5JRA A;  3MX3 A;  5GPG B;  3RH3 A;  4YL0 A;  5B3S C;  1H6G A;  1EKY A;  3M1C B;  2EPM X;  4MVU A;  4ER9 A;  3UMK A;  3VYW A;  1XZQ A;  2NG1 A;  3C8Z A;  3NYJ A;  1QSP A;  3MBG A;  1FMV A;  2HSB A;  3C18 A;  2CW0 F;  4FWV A;  4G0H A;  4L6R A;  4QDL A;  4C3E A;  3M15 A;  3V5Y A;  4BPM A;  4DVZ A;  1FAP B;  1OW7 A;  4BJ5 C;  5L0G A;  3ASO C;  3FVY A;  2R7Q A;  1CGM E;  2ZXR A;  3DI5 A;  3ITF A;  4AL1 A;  4C7O A;  1ZHX A;  4LDR A;  1VYI A;  4MTO A;  3MYI A;  4CS8 A;  3S9O A;  5KYW A;  1RCP A;  4MVZ A;  2J7P A;  1FTS A;  4YL1 A;  1TWH A;  3JYH A;  3S29 A;  3AG2 C;  4WAB A;  3GWL A;  4HEA J;  5DS4 A;  1I5N A;  1MMN A;  5KYX A;  2EPN A;  3O55 A;  2JPU A;  4DOZ A;  1A7E A;  2YLD A;  3QW0 A;  4CS9 A;  1CGO A;  3HKK A;  2R7S A;  1YZC A;  4XTK A;  4YWQ A;  1JMW A;  1TFO B;  4QI2 A;  4K1O A;  5A6J A;  3W4Y A;  4NCQ A;  4LER A;  3B29 A;  1SMY F;  4OD4 A;  4FAP B;  3FOP A;  5DQZ A;  3DZA A;  3M4B A;  3U9J A;  3AG3 C;  2LFF A; 
#chains in the Genus database with same CATH homology
 3B0P A;  3ZC4 A;  4JZA A;  4HFF B;  1M2V A;  2Y39 A;  5B1A C;  3FDQ A;  5T3T A;  4BJ1 A;  4BJT A;  5KYU B;  4G7H F;  3NG1 A;  3W8I A;  3OWT A;  1D1C A;  2Y3B A;  2WZL A;  1M56 C;  1M2O A;  3LS0 A;  4PJM A;  2A69 F;  2A6H F;  3RYL A;  4CS7 A;  3NKE A;  3ZSU A;  2W9Y A;  4G7Z F;  1O87 A;  5T1D B;  2R7V A;  2J7P D;  2WB7 A;  1JPJ A;  1JPN A;  1FFT C;  3S27 A;  2DGJ A;  2QTV A;  2VB6 A;  1MMG A;  2L81 A;  3EH2 A;  3JRT A;  3EHM A;  3WG7 C;  3TD7 A;  4PJN A;  1ZU4 A;  5F5F A;  2KQ9 A;  2KW3 C;  5F5H A;  1Z3I X;  4BEJ A;  4YT4 A;  2WZF A;  5CI8 A;  4XLN F;  4O6N A;  2O9X A;  3DAG A;  3RIP A;  4I1M A;  2NUT B;  4JJF A;  4J32 B;  4ULW A;  2ZXO A;  2G3K A;  2IXN A;  3E70 C;  2CGE A;  3KL4 A;  1TWA A;  2J9U A;  3UMH A;  2Q3T A;  4OIQ F;  1MMD A;  1MMA A;  2P7V A;  3O39 A;  1PD0 A;  5KYU A;  3LEV A;  3EFO B;  4MQ9 F;  2WVQ A;  3X2Q C;  4YN0 B;  3NDB B;  3EZH A;  3QMK A;  2EIJ C;  4LLC A;  5KYY B;  3SP1 A;  3DMD A;  3UR3 C;  3LLK A;  4DBQ A;  3LNR A;  1QZX A;  4XWJ A;  3T4R A;  4GEH A;  1VYK A;  1NU9 C;  4EBB A;  2WVO A;  5L3V A;  2XSE A;  3UGP A;  3DXJ F;  3LLI A;  1BR4 A;  2PF4 E;  3IEE A;  2KNH A;  1LS1 A;  2ZXW C;  3Q7G A;  3UGO A;  2L9J A;  2IXP A;  1MNE A;  3RKO F;  2CNW A;  3EQL F;  4C3B A;  1Z6A A;  4LLE A;  3KMI A;  4MND A;  4M63 A;  2V3C C;  4K0D A;  3AQB A;  4KNV A;  2V26 A;  4AX2 A;  2H7O A;  3W8H A;  5D91 A;  4BJ5 A;  4HFK B;  3B0U X;  3ZIB A;  3I5P A;  3S0X A;  3JCU Q;  3EG9 B;  3ZVR A;  2JD3 A;  4O7G A;  4DVY P;  4RBN A;  5BUO A;  3K7D A;  3N0T A;  2R7W A;  5DS6 A;  4OIN F;  5DLJ A;  1Z63 A;  1OCC C;  2DYR C;  3EFO A;  2I8B A;  3W2V A;  2W4B A;  2OG2 A;  4P6I C;  1BR2 A;  4AE4 B;  1ZHW A;  2Q9B A;  1ST6 A;  4BJ6 C;  5KYY A;  4O6M A;  2C03 A;  2CNW D;  2B0J A;  4RDA A;  1VK5 A;  4KNW A;  4IWB A;  3DM5 A;  1D1A A;  2YEV A;  2HV7 A;  2Q9C A;  3ABK C;  1FFH A;  2C04 A;  4NY3 A;  4HE8 D;  3ASN C;  2DYS C;  2MWQ A;  2XL4 A;  2R7T A;  1ZU5 A;  3RFY A;  2FGY A;  2XRH A;  3N24 A;  1ZHT A;  3EPV A;  5KYN A;  4ZLC A;  3EH1 A;  3EGX B;  3EG9 A;  2G3V A;  4JVS A;  4LAC B;  3VAY A;  4EWC A;  2HV6 A;  1OCZ C;  4KBL A;  3WOD F;  5CI9 A;  2EIL C;  2WZG A;  2G62 A;  1D0Z A;  4DBR A;  2NUP B;  2IXM A;  2WL8 A;  3LJB A;  2X51 A;  3EHN A;  2Y69 C;  4KI2 A;  2IYL D;  3OEO A;  4A2N B;  2LSE A;  4CSA C;  5EGY A;  4IJJ A;  4F4B A;  2E87 A;  4QI0 A;  3LS1 A;  4K7B A;  4GYT A;  5DS5 A;  3PHF 2;  4FX5 A;  3L34 A;  2VH3 A;  4U5D E;  5B1B C;  1NZE A;  4B6I A;  3MLG A;  4OD5 A;  3SEO A;  2XXA B;  2J0X A;  1NG1 A;  2W4M A;  4PJL A;  3EGD B;  3GAN A;  2PP4 A;  2Y3G A;  3EGX A;  4FES A;  4ZLD A;  2PX3 A;  4KC9 A;  3I5Q A;  1PD1 A;  4C3D A;  2P6V A;  5KYW B;  4PFP A;  4YT5 A;  1PCX A;  1OKK A;  2GFH A;  3K33 A;  2EIK C;  1ZHY A;  2NUP A;  4G7O F;  2CDQ A;  5KYX B;  4H4K C;  4U5B E;  2EIM C;  3CZ6 A;  3F46 A;  2OCC C;  4AK9 A;  2EIN C;  2R7X A;  5HSW A;  2J46 A;  3I4U A;  3ECS A;  4OIP F;  2NUT A;  2KGO A;  1M57 C;  4W8K A;  4PK4 A;  5L3Q A;  4X0R A;  1TWC A;  3S28 A;  3K1H A;  3QZC A;  2R7R A;  4YT8 A;  2IXO A;  4BJ6 A;  2R7U A;  1RJ9 B;  2D5R B;  3ZG1 A;  4U5E E;  1J8M F;  4CBE A;  3NYM A;  1W2W A;  1Z5Z A;  2XXA A;  1IW7 F;  3Q7L A;  5E3C A;  1S7Z A;  2J9V A;  1OKK D;  2IOQ A;  3EGD A;  4U5G A;  5E2Q A;  4O79 A;  4U5C E;  2Z15 A;  4WJ0 A;  2QY9 A;  2ZPA A;  3E9V A;  5T3W A;  1TWG A;  2J0W A;  4CIH A;  1FMW A;  3KKB A;  2J9W A;  3Q6N A;  3DJN B;  2BE5 F;  2H7V C;  3LES A;  2M4E A;  1IZM A;  1D0Y A;  4JUR I;  1G8X A;  4RD9 A;  4CS8 C;  3OA1 A;  3ABL C;  3K1I C;  1BR1 A;  4BG0 A;  2W45 A;  1OCR C;  3POV A;  3KH2 A;  4XLP F;  1TR2 A;  2PFD A;  3O6X A;  3FHD A;  2PX0 A;  2Y3H A;  4CS9 C;  5E33 A;  3DD7 A;  2WVN A;  1V54 C;  5IY5 C;  4U5F E;  4CSA A;  4I1O B;  4JJG A;  3EZI A;  1RJ9 A;  2R7O A;  3SNH A;  3CQZ A;  1O5H A;  3K6B A;  4E7S A;  3AG4 C;  1Z23 A;  3EJN A;  4N06 A;  4AE4 A;  3SYN A;  1VOM A;  2YHS A;  4I3M A;  4JW1 A;  3ABM C;  1SZI A;  1NU7 D;  1TKN A;  2KJG A;  3PMR A;  1D0X A;  4U5H A;  4JCH A;  5EHH A;  3AG1 C;  3W2W A;  2MYS A;  4OIO F;  4IRU A;  2FFH A;  4PJJ A;  1SF8 A;  3L0I A;  3DAF A;  1ZYR F;  2A6E F;  3LAY A;  3DM9 B;  5DQT A;  5FCL A;  3GOD A;  1ZHZ A;  4I44 A;  4Q5S F;  3N2Z B;  2YZS A;  3T6B A;  3UMI A;  3B9Q A;  5DVW A;  1QLE C;  4Q7C A;  5D92 A;  1WGW A;  4YJW A;  4Q4Z F;  3SZR A;  3Q6M A;  4C7O B;  1J8Y F;  2Q9A A;  3NRH A;  4E7Z A;  4YT2 A;  3V7O A;  4ANJ A;  2A68 F;  5E3A A;  3DJU B;  1OCO C;  3B0V C;  2VAS A;  3FAJ A;  2H7B A;  1LKX A;  3F47 A;  3UNG C;  4OIR F;  1V55 C;  3JSZ A;  3HJC A;  1M2V B;  4O6Y A;  1KU2 A;  3X1O A;  3CSK A;  2A1D D;  3HTK C;  4IAO A;  4PFO A;  3HLZ A;  1LVK A;  3NYL A;  2J45 A;  3AQC A;  1D1B A;  3H65 A;  1N1C A;  2ZXP A;  1MND A;  1VMA A;  3NKD A;  3K66 A;  4J30 B;  3T6J A;  3JT1 A;  3MX3 A;  3RH3 A;  5B3S C;  3M1C B;  3UMK A;  3VYW A;  2NG1 A;  4G0H A;  3NYJ A;  4QDL A;  2R7S A;  1FMV A;  4FWV A;  2CW0 F;  4C3E A;  4DVZ A;  4BJ5 C;  3ASO C;  3FVY A;  2R7Q A;  2ZXR A;  3ITF A;  4C7O A;  1ZHX A;  1VYI A;  4CS8 A;  5KYW A;  2J7P A;  1FTS A;  1TWH A;  3JYH A;  3S29 A;  3AG2 C;  5DS4 A;  4HEA J;  1MMN A;  5KYX A;  4DOZ A;  4CS9 A;  4XTK A;  4YWQ A;  4QI2 A;  4LER A;  1SMY F;  4OD4 A;  5DQZ A;  3DZA A;  3AG3 C;  2Y3D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...