4EHPA

Crystal structure of human vinculin head domain (residues 1-252) in complex with alpha-catenin (residues 277-382)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
251
structure length
248
Chain Sequence
PVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKIEEALKNRNFTVEKMSAEINEIIRVLQLTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Vinculin
publication title alpha-Catenin unfurls upon binding to vinculin
pubmed doi rcsb
source organism Homo sapiens
total genus 103
structure length 248
sequence length 251
ec nomenclature
pdb deposition date 2012-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 4ehpA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 4ehpA01
5L0CA 4K1OA 4ONSA 5L0DA 5L0IA 5L0FA 4E18A 2HSQA 1SYQA 1DOVA 1ZW3A 1RKEA 1U89A 3H2VA 3MYIA 5L0GA 4DJ9A 4IGGA 3S90A 3TJ6A 2B0HA 1H6GA 1L7CA 2L7AA 4P9TA 4PR9A 3ZDLA 2GWWA 4E17A 4EHPA 1U6HA 1RKEB 1ZVZA 3H2UA 1RKCA 2X0CA 3VF0A 1ZW2A 3T6GB 5L0HA 5L0JA 3TJ5A 1DOWA 4W8PA 1T01A 1XWJA 1QKRA 1TR2A 3RF3A 1YDIA 2LQGA 2IBFA 2GDCA 5FZTA 1ST6A
chains in the Genus database with same CATH superfamily
5L0CA 5E2QA 4LACB 4OD4A 2J9BA 2HUJA 3ASOC 1C03A 4RBNA 3A9CA 1QVXA 2Y3DA 3MBGA 3W8HA 1BDJB 3H2VA 4DBRA 4OIRF 2QE9A 1LKXA 4H54A 2ICWG 4PFPA 1H6GA 3LS1A 1XZQA 5JP7A 3POVA 1WN0A 5JVEA 4ULWA 2UUIA 1YYJA 2MHRA 3LAYA 1T6UA 1CGNA 2NPUA 1FMVA 4DXWA 2NSFA 3U9JA 3IQCA 3V5YA 1O3UA 4OIPF 2L81A 1TFKB 4W8PA 1GQAA 1Y6DA 4U5FE 3R7CA 4BJ1A 3LESA 3DAFA 1F1MA 4C3EA 3Q7LA 4WGZA 4MS2A 4CDAA 3KYJA 1HE9A 1VOMA 1YLMA 1Z23A 2J0WA 4LDRA 4O6NA 4ULVA 3ATPA 5HV9A 1LI5A 1NU9C 5JUAA 3K1IA 2FFHA 4ONSA 2Q7RA 3IEEA 5L0DA 2Y69C 1ZYRF 2VC9A 2YL7A 1E2XA 3O55A 2KJGA 2V26A 4PJMA 2YRFA 4JE9A 1DOVA 3AG4C 2YL3A 3EHMA 3RQGA 3T6JA 4BEMJ 1WWPA 1U0BB 2DYSC 2KYHA 4FWVA 1VYKA 4AE4B 5BQIA 5B1BC 1YA9A 4MVZA 4K7BA 4YL1A 4NTFA 4AL1A 3EG9A 3W8IA 4E17A 4EHPA 4YT8A 3U0CA 1GS9A 2B0JA 4N06A 4IJJA 3EJNA 4PK4A 3SXKA 3ZWIA 4YWQA 1OKKA 4AK9A 1T5OA 4CIHA 1T01A 3LLIA 3O6XA 2R7SA 2C03A 1T9KA 4Q5SF 3KH2A 2A0BA 3W4YA 1RCPA 5HSWA 1H9GA 4RD9A 1C17M 2XSEA 3UR3C 1JOGA 1D1AA 3MLGA 5K0IA 2PFDA 3TOMA 2A1DD 4CJGA 3QZCA 4JURI 5AGFA 3K7DA 1J8YF 4N4WA 5COMA 1YJGA 2YHSA 4WJ0A 2G62A 1LVKA 1TWAA 5EGYA 1NG1A 2W4BA 1WTYA 2CCYA 2R7QA 2HKVA 4CDVA 3H65A 2R7VA 1AVOB 5L0JA 4OIOF 3U2LA 1A41A 4E0IA 4PACA 3CQZA 3FVYA 1D0XA 2HFIA 4O79A 4PJLA 3EGXB 4XTKA 2D5RB 5D91A 3Q6NA 3ZTMA 5FZTA 4QDLA 2KSFA 2ZXPA 5JSLA 3KKBA 2R7TA 2IXOA 1LI7A 4B6IA 3DI5A 4U5CE 3ZC4A 5E3AA 2WZLA 3PMRA 1ZHTA 2OJED 3RH3A 3UMIA 5L0FA 4Q7CA 5JLIA 3F47A 3S0XA 1MQVA 3SYNA 2PBEA 4MVQA 2PF4E 1A7VA 1U89A 4E7SA 1BR2A 3Q6MA 4FESA 1TQGA 4O6YA 1G4WR 4G0HA 3W2WA 4G7OF 1OCRC 3SNHA 3T4RA 1NFOA 4WGYA 5B3SC 3X1OA 1OCCC 2FGYA 2P7VA 4JJGA 4C7OB 3ABKC 3RIPA 2HV6A 2XLMA 3MX3A 4MNDA 2V3CC 2NG1A 3DKAA 3S9OA 1D1CA 4BG0A 4BPMA 3DAGA 5DS4A 3FDQA 1O5HA 4W8KA 4CBEA 2DB4A 3EZHA 1ZU4A 4M63A 4F4BA 3C63A 4OINF 3JSZA 1CPQA 2XLHA 1AUEA 3ZG1A 1ZZPA 3FXHA 3S28A 3L8IA 1D1BA 3U3FA 2LFFA 3EQLF 3NKDA 4CS8C 2AU5A 3KMIA 1Y4CA 5AC5A 1FFTC 1BR1A 1SF8A 3RW0A 3HJCA 3CEXA 3I4UA 1GGQA 4XEKA 4J7YA 4JTAB 4CS9C 3WHNA 3U8PA 5KYUA 4L6RA 3HNLA 2JD3A 1FMWA 2KGOA 4PFOA 5BQGA 1ZVZA 2A68F 2PX3A 3GM2A 2X0CA 3RKOF 3ZQVA 5T1DB 3TJ5A 3R2PA 2QUPA 2KC3A 4HFFB 3PHF2 3G50A 2BE5F 1YVIA 2MWQA 5KYYB 1SR2A 1ZU5A 3A11A 2EILC 4E7ZA 4DRIB 1H7IA 1NU7D 2IBFA 3N0TA 4FX5A 4YL3A 1VMAA 3K33A 1Z6AA 2HMQA 2XXAA 4MW8A 3U2MA 3I5PA 4JVSA 3PCVA 4NY3A 4XPWA 4EIYA 1D0YA 1KTMA 3FAPB 1I4ZA 1MMDA 4XQ1A 5DS6A 3BEHA 2L9JA 2XLEA 3S90A 1E84A 2OCCC 4R32A 1M57C 2Y39A 5GPGB 2LSEA 2DGJA 1FR0A 2KW3C 4MVMA 3NYMA 1YARO 2NSGA 5L3QA 1V74B 3OWTA 3VYWA 3ZQYA 4JZAA 3FMSA 2RSEB 2YL0A 2YQYA 2YKZA 4LDKA 5A6BD 2EPLX 4NCQA 5B3IA 1NBBA 1R4TA 2IXPA 2H8AA 2OU6A 4I44A 3B0VC 1LS1A 3M15A 1BR4A 1D0ZA 4AL0A 3US6A 1FTSA 2Q9BA 2YL1A 1LE2A 2ZXOA 4E18A 3LS0A 2PX0A 2HSQA 4A2NB 1AEPA 1G4US 1RJ9A 2FAPB 3GWNA 1IW7F 3OA1A 3ZDLA 1OQCA 3ZIBA 4PJNA 4MTFA 3VM6A 1QLEC 3DE9A 2EPOA 1U6HA 3U5SA 4E0HA 3TQOA 1CGOA 1OXKA 2GFHA 2QTVA 2A6EF 1YZCA 1ZHZA 1OW6A 1OCOC 1Q0GA 3B9QA 1M2VB 2NUPB 1VLTA 4NQFA 4YJWA 3AG2C 5CI8A 3RF3A 2DYRC 1I5NA 3ABMC 2Y3BA 3ASNC 4XEVA 3SP1A 4D4NA 4JIOA 4EBKA 3C8GB 1WATA 3FOOA 3IPMO 1R5ID 4MQ9F 2J0XA 2CW0F 5L0IA 5CIVA 3EFOB 3EGDB 1E86A 2A69F 2CGEA 1JRAA 2XL4A 3FOPA 2LFDA 4HE8D 4MVSA 5T3WA 1H9TA 1JAFA 2XLDA 2XXAB 2OG2A 2HMZA 3C18A 3SXZA 1EKYA 1G8XA 2LCHA 1BZ4A 2ZD9A 3V5XA 1EA8A 2EPMX 1L7CA 4P9TA 5E3CA 4HFKB 3DWWA 3JT1A 2LK4A 1OR2A 2VCCA 2YWAA 1RMVA 1RKCA 5L0HA 2YLDA 2ZXWC 4CSAC 2C04A 1WGWA 2L6HA 4LLCA 3C8ZA 1DOWA 4KNVA 4U5BE 3GEHA 3M4BA 4IB4A 3S29A 4N6HA 3NKEA 3V5ZA 1JPNA 5E33A 2CYDA 2GAQA 1LPEA 3TOLA 2QLAA 2R7XA 3AQBA 1NSGB 4OD5A 3DJUB 3TD7A 2WL8A 1MNDA 2GA0A 3ABLC 1OR3A 4MTOA 5FCLA 1EQ1A 5F5HA 1S7ZA 1BBHA 2IXMA 2Y3GA 5A6BA 3RYLA 3WAQA 1RKEA 1MMGA 3K66A 4GEHA 4J30B 3WG7C 2AP3A 4BJ6C 1T6QA 2IM8A 1EI7A 3UGOA 4XWJA 3AJMA 2VCAA 3C62A 3JZ0A 4JRZA 3B0UX 5COFA 1KU2A 2JPUA 5TJ5E 2W9YA 4I1MA 3QVZA 1MNEA 3EG9B 3EH2A 3E9VA 1CPRA 3T9OA 4QI2A 4FAPB 4N6CA 3AG1C 2D4UA 1HY5A 1T6IA 2H7OA 2XRHA 2VH3A 3HKKA 5COGA 5KYWA 2EIMC 2YLIA 3L8JA 2OEXA 3NYLA 3ZTZA 1LIHA 2O9XA 1K40A 1JMWA 2XLWA 4KI2A 2Q9AA 5DLJA 3ZSUA 1PD1A 1M2OA 1OW7A 1HW1A 4EUKB 3V7OA 2F22A 4JC7A 5D92A 3U3BA 1Z63A 2JX0A 4PJJA 3TJ6A 1YAUO 1WASA 3RQFA 3DM5A 3W2VA 3HTKC 4MVRA 3UMKA 1VLSA 4DOZA 2WB7A 5DS5A 3QW0A 4LERA 4YT2A 2Q9CA 4OIQF 3QW1A 2R7UA 4C3DA 2J9UA 1M56C 4DRJB 2XS1A 2LIGA 3CSKA 1HMDA 3MFNA 4K0DA 3ECSA 1QKRA 1TWHA 2QNLA 3AGUA 5EK0A 3M79A 2BC5A 4G7HF 2LQGA 2HJMA 2H7BA 5DQZA 2HJ3A 4Z9HA 256BA 2Q00A 1K04A 4J32B 2P0NA 1NLXA 5B1AC 3RVYA 3IQ6A 4U9EA 1OW8A 4G78A 4AE4A 3O39A 1E83A 1LE4A 3SZRA 4GYTA 1TWCA 3CAXA 2L6GA 3DXJF 4IWBA 2Q4FA 2XM4A 1YYXA 4XPYA 3JTLO 4CS8A 4DJ9A 5JRAA 3KYIA 3TK0A 2LD6A 3HNIA 3VAYA 2GWWA 3EPVA 3VRCA 5KYNA 1M6TA 1ZHWA 2HS5A 2QY9A 3FHDA 1HMOA 4YN0B 1QSPA 3T6GB 3KPHA 1Z5ZA 3AGTA 4CS9A 5KYXA 1C02A 2YLGA 3GM1A 3ITFA 2XLOA 1TKNA 2Z15A 3GEIA 4DRHB 5JT4A 1QPUA 3NMKA 3LJBA 3NYJA 4I3MA 5A6JA 1ST6A 1L3PA 1NZEA 2AWCA 1A7DA 3JYYA 4ANJA 1ORJA 4IARA 3B0PA 4JTCB 1A7EA 3GODA 3FAJA 3F46A 3SXYA 3AOUA 4JEBA 4XEFA 4BJ5C 2KNHA 2ZXRA 5KYWB 2EINC 2PP4A 4Z9JA 4NTAA 3SEOA 1JPJA 2ASRA 2LP4A 2VASA 3EZIA 3TULA 3CZ6A 2H7VC 3NMJA 3N24A 1YA7O 3EGXA 3GEEA 4DVZA 1TWGA 3BRJA 2XS8A 3Q7GA 4U5HA 3VF0A 5A69A 2EPKX 2DI3A 1Z7Qc 2OQMA 3NMIA 4JEAA 4ZLCA 1LS4A 2BL2A 2J46A 5BUOA 5KYUB 3S84A 2CNWD 1NFNA 1PCXA 1QZXA 3C7JA 2WZFA 2HSBA 2YVKA 1MMAA 1RXQA 3RVZA 2R02A 1VTMP 2P6VA 4YK5A 2R9RB 2J7PD 4H4KC 5L3VA 2OKUA 2ZPAA 3E70C 2TMVP 4MVOA 3LEVA 1SYQA 5L0GA 3HNJA 3G4ZA 3MYIA 5IY5C 2E87A 3L0IA 5A6KA 4IGGA 4CDYA 4C7OA 3LLKA 2J9VA 2B0HA 4LDQA 2YZSA 4BEJA 1Q0KA 3G4XA 2NUTA 3JCUQ 1J8MF 2IYLD 4BJ5A 4Z9IA 3LNRA 3GORA 2W4MA 4P6IC 1PD0A 1XZPA 4DVYP 4Q4ZF 4ZLDA 1IZMA 3OEOA 3L34A 3AG3C 4RDAA 1W2WA 4MVUA 2L6FA 3SXMA 5DQTA 3EH1A 1Q0MA 4CIPA 2XL8A 1MMNA 3DJNB 5KYXB 4J7TA 3AQCA 2R25A 5T3TA 2P61A 2R7WA 2R7RA 3NRHA 3O10A 3GWLA 3JSEO 3LNMB 4QI0A 4XPXA 4YT5A 1HE1A 4AX2A 1K05A 4MTGA 1FFHA 3DM9B 1FAPB 2XL6A 3DE8A 4BJTA 5EHHA 1O87A 3C8GD 2CDQA 4JCHA 3RFYA 5BQHA 1ZW3A 1ZHYA 3RQEA 1OXBA 2G3KA 2KQ9A 3JRMO 1SMYF 2M4EA 3N2ZB 5AC4A 1A0BA 4P9FA 2J45A 2L7AA 4YL0A 1OCZC 5DVWA 1CGME 5KYYA 1FNTc 4U5GA 1PV3A 1RJ9B 4EBBA 4O7GA 3GANA 1N1CA 4CJOA 2IXNA 2A0UA 2W45A 3DZAA 3B29A 2R7OA 1TR2A 2J9WA 3DD7A 1S05A 3K1HA 4CX9A 2OJQA 4ER9A 2AWYA 4WABA 4CSAA 2WVQA 1GM5A 2Y3HA 2MYSA 5F28E 4XLPF 2I15A 2EIKC 4IAQA 2PNOA 4YT4A 3UGPA 2HV7A 1TFOB 2J8WA 2G3VA 3QMKA 3NDBB 3M4CA 1Q0FA 1V4AA 3B71A 3GM3A 4XLNF 4KC9A 1VB5A 2UUHA 3S27A 3PDMP 4LLEA 2CNWA 1SZIA 1UG7A 1V55C 5CI9A 3UMHA 4MW3A 1E85A 2P1AA 4HEAJ 2XM0A 4PR9A 3WODF 5A6AA 4IAOA 2AVKA 1LM3B 4I1OB 3IQ5A 2X51A 2Q3TA 2J7PA 3H2UA 2EPNA 2XLVA 2NUTB 4BJ6A 4U5DE 4EWCA 5JS5A 4NC3A 4JJFA 4GQHA 1YZAA 3JYHA 3LEOA 1APCA 3DMDA 2OOCA 1QQ3A 4O6MA 2IOQA 2GDCA 3U8VA 4A4AA 4JCZA 3K6BA 3QTHA 1G5ZA 3QVYA 4KBLA 2HZ8A 1Z3IX 2M64A 1VYIA 4K1OA 2RD9A 3M1CB 1I4YA 4NTBA 1ORYA 1Q0DA 3IHUA 3T6BA 4EBJA 4D4XA 1OKKD 2EIJC 3KL4A 4EKWA 4JTDB 4DBQA 3I5QA 4UDVA 2R03A 2VCBA 3MYFA 5F5FA 2I8BA 3LUTB 3U9MA 1WOLA 2YEVA 1M2VA 2NUPA 2OEVA 1ORSC 4U9DA 3UNGC 1HW2A 1RKEB 4IRUA 1UFBA 4U5EE 3L1MA 1ZW2A 3J06A 3JRTA 3EHNA 2WVNA 3IQTA 1V54C 2KK1A 3C8GA 3NG1A 2R05A 4G7ZF 4JKVA 4X0RA 1XWJA 2A6HF 2WZGA 4CS7A 2WVOA 3HLZA 3EFOA 1YDIA 3EGDA 3ZVRA 3K1IC 1B68A 1ZHXA 2ETSA 2VB6A 1VK5A 3HNKA 4JW1A 4KNWA 4C3BA 3X2QC 1KNYA 1JR8A
chains in the Genus database with same CATH topology
5L0CA 4K1OA 4ONSA 5L0DA 5L0IA 5L0FA 4E18A 2HSQA 1SYQA 1DOVA 1ZW3A 1RKEA 1U89A 3H2VA 3MYIA 5L0GA 4DJ9A 4IGGA 3S90A 3TJ6A 2B0HA 1H6GA 1L7CA 2L7AA 4P9TA 4PR9A 3ZDLA 2GWWA 4E17A 4EHPA 1U6HA 1RKEB 1ZVZA 3H2UA 1RKCA 2X0CA 3VF0A 1ZW2A 3T6GB 5L0HA 5L0JA 3TJ5A 1DOWA 4W8PA 1T01A 1XWJA 1QKRA 1TR2A 3RF3A 1YDIA 2LQGA 2IBFA 2GDCA 5FZTA 1ST6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L0C A;  4K1O A;  4ONS A;  5L0D A;  5L0I A;  5L0F A;  4E18 A;  2HSQ A;  1SYQ A;  1DOV A;  1ZW3 A;  1RKE A;  1U89 A;  3H2V A;  3MYI A;  5L0G A;  4DJ9 A;  4IGG A;  3S90 A;  3TJ6 A;  2B0H A;  1H6G A;  1L7C A;  2L7A A;  4P9T A;  4PR9 A;  3ZDL A;  2GWW A;  4E17 A;  4EHP A;  1U6H A;  1RKE B;  1ZVZ A;  3H2U A;  1RKC A;  2X0C A;  3VF0 A;  1ZW2 A;  3T6G B;  5L0H A;  5L0J A;  3TJ5 A;  1DOW A;  4W8P A;  1T01 A;  1XWJ A;  1QKR A;  1TR2 A;  3RF3 A;  1YDI A;  2LQG A;  2IBF A;  2GDC A;  5FZT A;  1ST6 A; 
#chains in the Genus database with same CATH topology
 5L0C A;  5E2Q A;  4LAC B;  4OD4 A;  2J9B A;  2HUJ A;  3ASO C;  1C03 A;  4RBN A;  3A9C A;  1QVX A;  2Y3D A;  3MBG A;  3W8H A;  1BDJ B;  3H2V A;  4DBR A;  4OIR F;  2QE9 A;  1LKX A;  4H54 A;  2ICW G;  4PFP A;  1H6G A;  3LS1 A;  1XZQ A;  5JP7 A;  3POV A;  1WN0 A;  5JVE A;  4ULW A;  2UUI A;  1YYJ A;  2MHR A;  3LAY A;  1T6U A;  1CGN A;  2NPU A;  1FMV A;  4DXW A;  2NSF A;  3U9J A;  3IQC A;  3V5Y A;  1O3U A;  4OIP F;  2L81 A;  1TFK B;  4W8P A;  1GQA A;  1Y6D A;  4U5F E;  3R7C A;  4BJ1 A;  3LES A;  3DAF A;  1F1M A;  4C3E A;  3Q7L A;  4WGZ A;  4MS2 A;  4CDA A;  3KYJ A;  1HE9 A;  1VOM A;  1YLM A;  1Z23 A;  2J0W A;  4LDR A;  4O6N A;  4ULV A;  3ATP A;  5HV9 A;  1LI5 A;  1NU9 C;  5JUA A;  3K1I A;  2FFH A;  4ONS A;  2Q7R A;  3IEE A;  5L0D A;  2Y69 C;  1ZYR F;  2VC9 A;  2YL7 A;  1E2X A;  3O55 A;  2KJG A;  2V26 A;  4PJM A;  2YRF A;  4JE9 A;  1DOV A;  3AG4 C;  2YL3 A;  3EHM A;  3RQG A;  3T6J A;  4BEM J;  1WWP A;  1U0B B;  2DYS C;  2KYH A;  4FWV A;  1VYK A;  4AE4 B;  5BQI A;  5B1B C;  1YA9 A;  4MVZ A;  4K7B A;  4YL1 A;  4NTF A;  4AL1 A;  3EG9 A;  3W8I A;  4E17 A;  4EHP A;  4YT8 A;  3U0C A;  1GS9 A;  2B0J A;  4N06 A;  4IJJ A;  3EJN A;  4PK4 A;  3SXK A;  3ZWI A;  4YWQ A;  1OKK A;  4AK9 A;  1T5O A;  4CIH A;  1T01 A;  3LLI A;  3O6X A;  2R7S A;  2C03 A;  1T9K A;  4Q5S F;  3KH2 A;  2A0B A;  3W4Y A;  1RCP A;  5HSW A;  1H9G A;  4RD9 A;  1C17 M;  2XSE A;  3UR3 C;  1JOG A;  1D1A A;  3MLG A;  5K0I A;  2PFD A;  3TOM A;  2A1D D;  4CJG A;  3QZC A;  4JUR I;  5AGF A;  3K7D A;  1J8Y F;  4N4W A;  5COM A;  1YJG A;  2YHS A;  4WJ0 A;  2G62 A;  1LVK A;  1TWA A;  5EGY A;  1NG1 A;  2W4B A;  1WTY A;  2CCY A;  2R7Q A;  2HKV A;  4CDV A;  3H65 A;  2R7V A;  1AVO B;  5L0J A;  4OIO F;  3U2L A;  1A41 A;  4E0I A;  4PAC A;  3CQZ A;  3FVY A;  1D0X A;  2HFI A;  4O79 A;  4PJL A;  3EGX B;  4XTK A;  2D5R B;  5D91 A;  3Q6N A;  3ZTM A;  5FZT A;  4QDL A;  2KSF A;  2ZXP A;  5JSL A;  3KKB A;  2R7T A;  2IXO A;  1LI7 A;  4B6I A;  3DI5 A;  4U5C E;  3ZC4 A;  5E3A A;  2WZL A;  3PMR A;  1ZHT A;  2OJE D;  3RH3 A;  3UMI A;  5L0F A;  4Q7C A;  5JLI A;  3F47 A;  3S0X A;  1MQV A;  3SYN A;  2PBE A;  4MVQ A;  2PF4 E;  1A7V A;  1U89 A;  4E7S A;  1BR2 A;  3Q6M A;  4FES A;  1TQG A;  4O6Y A;  1G4W R;  4G0H A;  3W2W A;  4G7O F;  1OCR C;  3SNH A;  3T4R A;  1NFO A;  4WGY A;  5B3S C;  3X1O A;  1OCC C;  2FGY A;  2P7V A;  4JJG A;  4C7O B;  3ABK C;  3RIP A;  2HV6 A;  2XLM A;  3MX3 A;  4MND A;  2V3C C;  2NG1 A;  3DKA A;  3S9O A;  1D1C A;  4BG0 A;  4BPM A;  3DAG A;  5DS4 A;  3FDQ A;  1O5H A;  4W8K A;  4CBE A;  2DB4 A;  3EZH A;  1ZU4 A;  4M63 A;  4F4B A;  3C63 A;  4OIN F;  3JSZ A;  1CPQ A;  2XLH A;  1AUE A;  3ZG1 A;  1ZZP A;  3FXH A;  3S28 A;  3L8I A;  1D1B A;  3U3F A;  2LFF A;  3EQL F;  3NKD A;  4CS8 C;  2AU5 A;  3KMI A;  1Y4C A;  5AC5 A;  1FFT C;  1BR1 A;  1SF8 A;  3RW0 A;  3HJC A;  3CEX A;  3I4U A;  1GGQ A;  4XEK A;  4J7Y A;  4JTA B;  4CS9 C;  3WHN A;  3U8P A;  5KYU A;  4L6R A;  3HNL A;  2JD3 A;  1FMW A;  2KGO A;  4PFO A;  5BQG A;  1ZVZ A;  2A68 F;  2PX3 A;  3GM2 A;  2X0C A;  3RKO F;  3ZQV A;  5T1D B;  3TJ5 A;  3R2P A;  2QUP A;  2KC3 A;  4HFF B;  3PHF 2;  3G50 A;  2BE5 F;  1YVI A;  2MWQ A;  5KYY B;  1SR2 A;  1ZU5 A;  3A11 A;  2EIL C;  4E7Z A;  4DRI B;  1H7I A;  1NU7 D;  2IBF A;  3N0T A;  4FX5 A;  4YL3 A;  1VMA A;  3K33 A;  1Z6A A;  2HMQ A;  2XXA A;  4MW8 A;  3U2M A;  3I5P A;  4JVS A;  3PCV A;  4NY3 A;  4XPW A;  4EIY A;  1D0Y A;  1KTM A;  3FAP B;  1I4Z A;  1MMD A;  4XQ1 A;  5DS6 A;  3BEH A;  2L9J A;  2XLE A;  3S90 A;  1E84 A;  2OCC C;  4R32 A;  1M57 C;  2Y39 A;  5GPG B;  2LSE A;  2DGJ A;  1FR0 A;  2KW3 C;  4MVM A;  3NYM A;  1YAR O;  2NSG A;  5L3Q A;  1V74 B;  3OWT A;  3VYW A;  3ZQY A;  4JZA A;  3FMS A;  2RSE B;  2YL0 A;  2YQY A;  2YKZ A;  4LDK A;  5A6B D;  2EPL X;  4NCQ A;  5B3I A;  1NBB A;  1R4T A;  2IXP A;  2H8A A;  2OU6 A;  4I44 A;  3B0V C;  1LS1 A;  3M15 A;  1BR4 A;  1D0Z A;  4AL0 A;  3US6 A;  1FTS A;  2Q9B A;  2YL1 A;  1LE2 A;  2ZXO A;  4E18 A;  3LS0 A;  2PX0 A;  2HSQ A;  4A2N B;  1AEP A;  1G4U S;  1RJ9 A;  2FAP B;  3GWN A;  1IW7 F;  3OA1 A;  3ZDL A;  1OQC A;  3ZIB A;  4PJN A;  4MTF A;  3VM6 A;  1QLE C;  3DE9 A;  2EPO A;  1U6H A;  3U5S A;  4E0H A;  3TQO A;  1CGO A;  1OXK A;  2GFH A;  2QTV A;  2A6E F;  1YZC A;  1ZHZ A;  1OW6 A;  1OCO C;  1Q0G A;  3B9Q A;  1M2V B;  2NUP B;  1VLT A;  4NQF A;  4YJW A;  3AG2 C;  5CI8 A;  3RF3 A;  2DYR C;  1I5N A;  3ABM C;  2Y3B A;  3ASN C;  4XEV A;  3SP1 A;  4D4N A;  4JIO A;  4EBK A;  3C8G B;  1WAT A;  3FOO A;  3IPM O;  1R5I D;  4MQ9 F;  2J0X A;  2CW0 F;  5L0I A;  5CIV A;  3EFO B;  3EGD B;  1E86 A;  2A69 F;  2CGE A;  1JRA A;  2XL4 A;  3FOP A;  2LFD A;  4HE8 D;  4MVS A;  5T3W A;  1H9T A;  1JAF A;  2XLD A;  2XXA B;  2OG2 A;  2HMZ A;  3C18 A;  3SXZ A;  1EKY A;  1G8X A;  2LCH A;  1BZ4 A;  2ZD9 A;  3V5X A;  1EA8 A;  2EPM X;  1L7C A;  4P9T A;  5E3C A;  4HFK B;  3DWW A;  3JT1 A;  2LK4 A;  1OR2 A;  2VCC A;  2YWA A;  1RMV A;  1RKC A;  5L0H A;  2YLD A;  2ZXW C;  4CSA C;  2C04 A;  1WGW A;  2L6H A;  4LLC A;  3C8Z A;  1DOW A;  4KNV A;  4U5B E;  3GEH A;  3M4B A;  4IB4 A;  3S29 A;  4N6H A;  3NKE A;  3V5Z A;  1JPN A;  5E33 A;  2CYD A;  2GAQ A;  1LPE A;  3TOL A;  2QLA A;  2R7X A;  3AQB A;  1NSG B;  4OD5 A;  3DJU B;  3TD7 A;  2WL8 A;  1MND A;  2GA0 A;  3ABL C;  1OR3 A;  4MTO A;  5FCL A;  1EQ1 A;  5F5H A;  1S7Z A;  1BBH A;  2IXM A;  2Y3G A;  5A6B A;  3RYL A;  3WAQ A;  1RKE A;  1MMG A;  3K66 A;  4GEH A;  4J30 B;  3WG7 C;  2AP3 A;  4BJ6 C;  1T6Q A;  2IM8 A;  1EI7 A;  3UGO A;  4XWJ A;  3AJM A;  2VCA A;  3C62 A;  3JZ0 A;  4JRZ A;  3B0U X;  5COF A;  1KU2 A;  2JPU A;  5TJ5 E;  2W9Y A;  4I1M A;  3QVZ A;  1MNE A;  3EG9 B;  3EH2 A;  3E9V A;  1CPR A;  3T9O A;  4QI2 A;  4FAP B;  4N6C A;  3AG1 C;  2D4U A;  1HY5 A;  1T6I A;  2H7O A;  2XRH A;  2VH3 A;  3HKK A;  5COG A;  5KYW A;  2EIM C;  2YLI A;  3L8J A;  2OEX A;  3NYL A;  3ZTZ A;  1LIH A;  2O9X A;  1K40 A;  1JMW A;  2XLW A;  4KI2 A;  2Q9A A;  5DLJ A;  3ZSU A;  1PD1 A;  1M2O A;  1OW7 A;  1HW1 A;  4EUK B;  3V7O A;  2F22 A;  4JC7 A;  5D92 A;  3U3B A;  1Z63 A;  2JX0 A;  4PJJ A;  3TJ6 A;  1YAU O;  1WAS A;  3RQF A;  3DM5 A;  3W2V A;  3HTK C;  4MVR A;  3UMK A;  1VLS A;  4DOZ A;  2WB7 A;  5DS5 A;  3QW0 A;  4LER A;  4YT2 A;  2Q9C A;  4OIQ F;  3QW1 A;  2R7U A;  4C3D A;  2J9U A;  1M56 C;  4DRJ B;  2XS1 A;  2LIG A;  3CSK A;  1HMD A;  3MFN A;  4K0D A;  3ECS A;  1QKR A;  1TWH A;  2QNL A;  3AGU A;  5EK0 A;  3M79 A;  2BC5 A;  4G7H F;  2LQG A;  2HJM A;  2H7B A;  5DQZ A;  2HJ3 A;  4Z9H A;  256B A;  2Q00 A;  1K04 A;  4J32 B;  2P0N A;  1NLX A;  5B1A C;  3RVY A;  3IQ6 A;  4U9E A;  1OW8 A;  4G78 A;  4AE4 A;  3O39 A;  1E83 A;  1LE4 A;  3SZR A;  4GYT A;  1TWC A;  3CAX A;  2L6G A;  3DXJ F;  4IWB A;  2Q4F A;  2XM4 A;  1YYX A;  4XPY A;  3JTL O;  4CS8 A;  4DJ9 A;  5JRA A;  3KYI A;  3TK0 A;  2LD6 A;  3HNI A;  3VAY A;  2GWW A;  3EPV A;  3VRC A;  5KYN A;  1M6T A;  1ZHW A;  2HS5 A;  2QY9 A;  3FHD A;  1HMO A;  4YN0 B;  1QSP A;  3T6G B;  3KPH A;  1Z5Z A;  3AGT A;  4CS9 A;  5KYX A;  1C02 A;  2YLG A;  3GM1 A;  3ITF A;  2XLO A;  1TKN A;  2Z15 A;  3GEI A;  4DRH B;  5JT4 A;  1QPU A;  3NMK A;  3LJB A;  3NYJ A;  4I3M A;  5A6J A;  1ST6 A;  1L3P A;  1NZE A;  2AWC A;  1A7D A;  3JYY A;  4ANJ A;  1ORJ A;  4IAR A;  3B0P A;  4JTC B;  1A7E A;  3GOD A;  3FAJ A;  3F46 A;  3SXY A;  3AOU A;  4JEB A;  4XEF A;  4BJ5 C;  2KNH A;  2ZXR A;  5KYW B;  2EIN C;  2PP4 A;  4Z9J A;  4NTA A;  3SEO A;  1JPJ A;  2ASR A;  2LP4 A;  2VAS A;  3EZI A;  3TUL A;  3CZ6 A;  2H7V C;  3NMJ A;  3N24 A;  1YA7 O;  3EGX A;  3GEE A;  4DVZ A;  1TWG A;  3BRJ A;  2XS8 A;  3Q7G A;  4U5H A;  3VF0 A;  5A69 A;  2EPK X;  2DI3 A;  1Z7Q c;  2OQM A;  3NMI A;  4JEA A;  4ZLC A;  1LS4 A;  2BL2 A;  2J46 A;  5BUO A;  5KYU B;  3S84 A;  2CNW D;  1NFN A;  1PCX A;  1QZX A;  3C7J A;  2WZF A;  2HSB A;  2YVK A;  1MMA A;  1RXQ A;  3RVZ A;  2R02 A;  1VTM P;  2P6V A;  4YK5 A;  2R9R B;  2J7P D;  4H4K C;  5L3V A;  2OKU A;  2ZPA A;  3E70 C;  2TMV P;  4MVO A;  3LEV A;  1SYQ A;  5L0G A;  3HNJ A;  3G4Z A;  3MYI A;  5IY5 C;  2E87 A;  3L0I A;  5A6K A;  4IGG A;  4CDY A;  4C7O A;  3LLK A;  2J9V A;  2B0H A;  4LDQ A;  2YZS A;  4BEJ A;  1Q0K A;  3G4X A;  2NUT A;  3JCU Q;  1J8M F;  2IYL D;  4BJ5 A;  4Z9I A;  3LNR A;  3GOR A;  2W4M A;  4P6I C;  1PD0 A;  1XZP A;  4DVY P;  4Q4Z F;  4ZLD A;  1IZM A;  3OEO A;  3L34 A;  3AG3 C;  4RDA A;  1W2W A;  4MVU A;  2L6F A;  3SXM A;  5DQT A;  3EH1 A;  1Q0M A;  4CIP A;  2XL8 A;  1MMN A;  3DJN B;  5KYX B;  4J7T A;  3AQC A;  2R25 A;  5T3T A;  2P61 A;  2R7W A;  2R7R A;  3NRH A;  3O10 A;  3GWL A;  3JSE O;  3LNM B;  4QI0 A;  4XPX A;  4YT5 A;  1HE1 A;  4AX2 A;  1K05 A;  4MTG A;  1FFH A;  3DM9 B;  1FAP B;  2XL6 A;  3DE8 A;  4BJT A;  5EHH A;  1O87 A;  3C8G D;  2CDQ A;  4JCH A;  3RFY A;  5BQH A;  1ZW3 A;  1ZHY A;  3RQE A;  1OXB A;  2G3K A;  2KQ9 A;  3JRM O;  1SMY F;  2M4E A;  3N2Z B;  5AC4 A;  1A0B A;  4P9F A;  2J45 A;  2L7A A;  4YL0 A;  1OCZ C;  5DVW A;  1CGM E;  5KYY A;  1FNT c;  4U5G A;  1PV3 A;  1RJ9 B;  4EBB A;  4O7G A;  3GAN A;  1N1C A;  4CJO A;  2IXN A;  2A0U A;  2W45 A;  3DZA A;  3B29 A;  2R7O A;  1TR2 A;  2J9W A;  3DD7 A;  1S05 A;  3K1H A;  4CX9 A;  2OJQ A;  4ER9 A;  2AWY A;  4WAB A;  4CSA A;  2WVQ A;  1GM5 A;  2Y3H A;  2MYS A;  5F28 E;  4XLP F;  2I15 A;  2EIK C;  4IAQ A;  2PNO A;  4YT4 A;  3UGP A;  2HV7 A;  1TFO B;  2J8W A;  2G3V A;  3QMK A;  3NDB B;  3M4C A;  1Q0F A;  1V4A A;  3B71 A;  3GM3 A;  4XLN F;  4KC9 A;  1VB5 A;  2UUH A;  3S27 A;  3PDM P;  4LLE A;  2CNW A;  1SZI A;  1UG7 A;  1V55 C;  5CI9 A;  3UMH A;  4MW3 A;  1E85 A;  2P1A A;  4HEA J;  2XM0 A;  4PR9 A;  3WOD F;  5A6A A;  4IAO A;  2AVK A;  1LM3 B;  4I1O B;  3IQ5 A;  2X51 A;  2Q3T A;  2J7P A;  3H2U A;  2EPN A;  2XLV A;  2NUT B;  4BJ6 A;  4U5D E;  4EWC A;  5JS5 A;  4NC3 A;  4JJF A;  4GQH A;  1YZA A;  3JYH A;  3LEO A;  1APC A;  3DMD A;  2OOC A;  1QQ3 A;  4O6M A;  2IOQ A;  2GDC A;  3U8V A;  4A4A A;  4JCZ A;  3K6B A;  3QTH A;  1G5Z A;  3QVY A;  4KBL A;  2HZ8 A;  1Z3I X;  2M64 A;  1VYI A;  4K1O A;  2RD9 A;  3M1C B;  1I4Y A;  4NTB A;  1ORY A;  1Q0D A;  3IHU A;  3T6B A;  4EBJ A;  4D4X A;  1OKK D;  2EIJ C;  3KL4 A;  4EKW A;  4JTD B;  4DBQ A;  3I5Q A;  4UDV A;  2R03 A;  2VCB A;  3MYF A;  5F5F A;  2I8B A;  3LUT B;  3U9M A;  1WOL A;  2YEV A;  1M2V A;  2NUP A;  2OEV A;  1ORS C;  4U9D A;  3UNG C;  1HW2 A;  1RKE B;  4IRU A;  1UFB A;  4U5E E;  3L1M A;  1ZW2 A;  3J06 A;  3JRT A;  3EHN A;  2WVN A;  3IQT A;  1V54 C;  2KK1 A;  3C8G A;  3NG1 A;  2R05 A;  4G7Z F;  4JKV A;  4X0R A;  1XWJ A;  2A6H F;  2WZG A;  4CS7 A;  2WVO A;  3HLZ A;  3EFO A;  1YDI A;  3EGD A;  3ZVR A;  3K1I C;  1B68 A;  1ZHX A;  2ETS A;  2VB6 A;  1VK5 A;  3HNK A;  4JW1 A;  4KNW A;  4C3B A;  3X2Q C;  1KNY A;  1JR8 A; 
#chains in the Genus database with same CATH homology
 5L0C A;  4K1O A;  4ONS A;  5L0D A;  5L0I A;  5L0F A;  4E18 A;  2HSQ A;  1SYQ A;  1DOV A;  1ZW3 A;  1RKE A;  1U89 A;  3H2V A;  3MYI A;  5L0G A;  4DJ9 A;  4IGG A;  3S90 A;  3TJ6 A;  2B0H A;  1H6G A;  1L7C A;  2L7A A;  4P9T A;  4PR9 A;  3ZDL A;  2GWW A;  4E17 A;  4EHP A;  1U6H A;  1RKE B;  1ZVZ A;  3H2U A;  1RKC A;  2X0C A;  3VF0 A;  1ZW2 A;  3T6G B;  5L0H A;  5L0J A;  3TJ5 A;  1DOW A;  4W8P A;  1T01 A;  1XWJ A;  1QKR A;  1TR2 A;  3RF3 A;  1YDI A;  2LQG A;  2IBF A;  2GDC A;  5FZT A;  1ST6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...