4EHPA

Crystal structure of human vinculin head domain (residues 1-252) in complex with alpha-catenin (residues 277-382)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
251
structure length
248
Chain Sequence
PVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKIEEALKNRNFTVEKMSAEINEIIRVLQLTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title alpha-Catenin unfurls upon binding to vinculin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Vinculin
total genus 103
structure length 248
sequence length 251
ec nomenclature
pdb deposition date 2012-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 4ehpA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 4ehpA01
2LQGA 4K1OA 4E17A 1ZW2A 1U6HA 1L7CA 3MYIA 3ZDLA 4E18A 1U89A 4EHPA 5L0GA 5L0IA 3H2VA 1QKRA 5L0JA 1XWJA 4PR9A 2B0HA 3T6GB 3H2UA 1DOVA 1RKEB 2HSQA 1T01A 2X0CA 4W8PA 1H6GA 2GWWA 1SYQA 1DOWA 2IBFA 3TJ5A 3RF3A 5L0CA 2GDCA 3VF0A 1ZVZA 3TJ6A 4DJ9A 1RKEA 5FZTA 2L7AA 1ZW3A 1ST6A 1RKCA 1YDIA 4IGGA 5L0DA 5L0FA 5L0HA 3S90A 1TR2A 4ONSA 4P9TA
chains in the Genus database with same CATH superfamily
2VASA 2CW0F 2YKZA 1M2OA 2HMZA 5E3AA 3M4CA 4LERA 4XEVA 1AUEA 1H7IA 4F4BA 1C03A 4LLEA 5A6JA 3K6BA 2G3KA 3JCUQ 5L0FA 3VYWA 4ZLCA 2R7OA 2H7OA 2R7XA 4BJTA 1V55C 2H8AA 3L8IA 3LS0A 4HFFB 1XWJA 5F5HA 4CS8C 4KNWA 2V3CC 1OXBA 1FFTC 2B0HA 4P9FA 2R7WA 4P6IC 3L1MA 1ZYRF 2EIJC 4DBRA 4ER9A 1HMDA 2VCBA 4Q4ZF 3QZCA 3W2WA 4WGZA 1Z6AA 1RXQA 2L6FA 2OEVA 2CYDA 3S84A 1IW7F 1FAPB 1NSGB 3T9OA 5HV9A 3RYLA 4G7OF 3C8GD 1DOWA 3BRJA 3ABKC 3VRCA 4EBJA 4N4WA 5JP7A 4N06A 3FMSA 1D0ZA 1RKCA 3ZTZA 1K04A 4OIQF 3LEOA 4U5HA 4CS8A 2GAQA 4IRUA 1MNEA 1D1AA 1Q0FA 2FGYA 3LLIA 3X1OA 2KC3A 1H9GA 2VC9A 2KJGA 3UMKA 3B71A 3Q7LA 1JMWA 5T1DB 4MVOA 1LS4A 1U89A 4R32A 2OKUA 4LACB 1JPJA 1UFBA 1LKXA 1MMNA 2A68F 3H2UA 4IB4A 2HFIA 5L3VA 4YL3A 3MFNA 2CNWD 4N6CA 5COMA 1WATA 3CEXA 3O10A 5BQIA 4BJ5A 4XQ1A 3V5XA 4CSAA 4YT8A 1HY5A 1O3UA 2Q9BA 3U9MA 3RF3A 1SF8A 2GDCA 1YZCA 2YVKA 3K1IC 3VF0A 1I4ZA 2M4EA 4JJGA 5K0IA 2J9UA 1T9KA 3F46A 4PJLA 2G62A 1NFOA 3JRTA 4YWQA 5B3SC 3DM9B 2Y3BA 1YDIA 1Y4CA 4ONSA 4XLPF 4LLCA 2WZGA 3N2ZB 2AP3A 3DJNB 2P61A 1OR2A 5COFA 3Q7GA 3GM1A 2KNHA 4IAOA 4BJ5C 3C7JA 1YVIA 2EPKX 1MQVA 2VCCA 2OEXA 3PCVA 3U8VA 1LE2A 3H65A 3LNRA 3W8IA 3EGDB 1A41A 1LVKA 3C63A 5EK0A 2NSGA 1OCRC 2CCYA 3K1IA 4G78A 2EPOA 2OOCA 4JCHA 1NBBA 1RJ9B 1T6QA 2EIMC 3ZWIA 2WZLA 1FNTc 3GWLA 4BEJA 1BZ4A 4RBNA 1OW8A 3GORA 3UNGC 3ZG1A 1QQ3A 2J0XA 3AGUA 4M63A 2BE5F 1V54C 3DXJF 2D4UA 3TQOA 4OIPF 5BUOA 2H7BA 5E2QA 2DYRC 3M4BA 4XLNF 3LJBA 2B0JA 3DD7A 3EHMA 1E86A 1R4TA 2UUIA 5E3CA 5AC4A 1TWGA 3NYJA 4JEAA 4MVSA 1V4AA 2R9RB 2R7QA 2HS5A 1IZMA 1VMAA 3JZ0A 4YK5A 2HKVA 2BL2A 2UUHA 4L6RA 3B0UX 1M2VA 4CDYA 3RQGA 3ZQYA 4ULWA 4AL1A 4GYTA 4GEHA 4LDRA 4CJOA 3J06A 1Q0DA 4H54A 3RKOF 2HSQA 2OJED 3NDBB 2HJMA 3M15A 2X0CA 2YL1A 3ABLC 4DXWA 4IARA 1WN0A 1MNDA 2VB6A 3OWTA 4JW1A 4ANJA 4BJ6A 2NG1A 3E70C 5A6BA 4MS2A 1ZU5A 1ZW3A 2EINC 3DE9A 2KGOA 1H9TA 3LS1A 4RDAA 4KNVA 4AL0A 1NU9C 2Q3TA 3NYLA 4OD4A 3SYNA 4U5EE 3RVZA 3U8PA 3HNJA 4JKVA 3UR3C 1UG7A 2JX0A 5KYWA 2C04A 5KYXB 1TWCA 3SXZA 3BEHA 1O87A 4CBEA 1QLEC 3FHDA 4YT5A 2QE9A 3M79A 2IOQA 4XPWA 2AVKA 5AGFA 2IXPA 3C18A 2IM8A 3DAFA 3HNKA 3K33A 4E7ZA 3GEEA 5DS6A 5DS5A 1AVOB 1HE9A 4JZAA 4AX2A 2R02A 3NMIA 1KNYA 3ABMC 4GQHA 4O6NA 1VB5A 4W8PA 5TJ5E 1YA9A 3SP1A 4Z9HA 3ZTMA 2R05A 4J7TA 3CSKA 4BG0A 2OJQA 5L0CA 1YARO 4PACA 1A7EA 5AC5A 3ZVRA 3GM2A 2HSBA 4IGGA 4MW3A 3US6A 2Z15A 1BBHA 1A7VA 2PP4A 1LPEA 1WTYA 4U5DE 1TR2A 4CDAA 2XL6A 4MW8A 4XPYA 3QVYA 4NCQA 1BR4A 1E2XA 1S05A 3A11A 2Q7RA 4X0RA 3WODF 1APCA 4IWBA 2YL0A 1VK5A 4E17A 5FCLA 2IXMA 3S27A 4O6YA 1PD1A 1Y6DA 4J32B 4NTAA 2Q00A 1VLTA 4HEAJ 3AQCA 4CS9A 1FTSA 1G5ZA 1Q0GA 1R5ID 3DAGA 3NMKA 3B0VC 3JT1A 2GWWA 3C62A 5JRAA 5DQZA 2KSFA 1S7ZA 2Y3HA 2EIKC 1T6UA 5A6BD 3W4YA 1NZEA 4WABA 4E0HA 2YL3A 2LFFA 3QVZA 1LI7A 2XS8A 3DMDA 1YLMA 4MTOA 4O6MA 2ZXPA 3MBGA 2WL8A 4Z9IA 2MYSA 3EHNA 2ZXWC 3RQFA 3SZRA 3V5ZA 3ZQVA 5JVEA 3HNLA 3ZC4A 4MVMA 4C3DA 2FFHA 1TFOB 2XLMA 4YT4A 1U6HA 1D0XA 2F22A 4EHPA 3EG9A 3QMKA 4MQ9F 2Y3GA 1EA8A 1GS9A 2ZPAA 1KU2A 1DOVA 2OG2A 2OQMA 2J46A 3Q6MA 2PBEA 3LLKA 3TD7A 1T01A 3B29A 4MVUA 4Q7CA 4N6HA 1G4US 4C3EA 2YZSA 3HTKC 4ULVA 3U2LA 2YLIA 2IBFA 4JTCB 2OU6A 1J8YF 2GA0A 2XM0A 2I8BA 1WGWA 1A0BA 2A1DD 3FAPB 3FAJA 4EWCA 3KL4A 1WWPA 4OIOF 4FESA 1I5NA 2LQGA 4OIRF 1VYIA 1XZPA 2NUPA 2M64A 3PMRA 4BEMJ 5EGYA 4JVSA 5A6KA 4E18A 5JUAA 1TWAA 1C17M 2QUPA 2AU5A 3K1HA 1QKRA 3SEOA 3SXMA 3KYJA 2DI3A 3G50A 3DI5A 2PNOA 3AQBA 4CS7A 3NKEA 3M1CB 1NG1A 5HSWA 3QW0A 3IHUA 2XSEA 2AWCA 4AE4A 2E87A 2NSFA 4UDVA 2PFDA 3DWWA 2XL4A 4DRIB 2LIGA 5BQGA 4XPXA 3L8JA 3S9OA 4U5BE 1OXKA 5L0DA 1M57C 1TKNA 3NRHA 3EJNA 2XM4A 1U0BB 4FAPB 2XXAB 2J7PD 4I1OB 4NQFA 1HW1A 1YYXA 2LFDA 5KYWB 2QLAA 4HFKB 3TULA 3RH3A 2KQ9A 2RD9A 2ZD9A 1TFKB 1JR8A 3ITFA 1BR2A 2FAPB 3U9JA 3W2VA 5B3IA 5L0IA 4G7ZF 3ECSA 4JE9A 4MTFA 5L0JA 1D0YA 1CPRA 4KBLA 2XLHA 3T6GB 1I4YA 3EQLF 4XWJA 2EPNA 2P0NA 3AG4C 5T3TA 5KYUB 2HMQA 3EG9B 1OW6A 4E7SA 3HKKA 4O79A 1HMOA 3IQTA 4C7OB 1QSPA 1LIHA 1Q0KA 2YHSA 3X2QC 4G0HA 1SZIA 2YLGA 3WG7C 2PX0A 1CPQA 2Q9CA 2W9YA 5KYUA 2WVOA 3T6BA 5KYYA 3NG1A 4DJ9A 1K40A 1ZHZA 2KK1A 3RW0A 3C8GA 2L7AA 5BQHA 3RVYA 3HNIA 5L0HA 4Z9JA 5A69A 1E83A 3OEOA 2P6VA 4JURI 2YQYA 5A6AA 5L3QA 1Z63A 3I5QA 4U9DA 3GM3A 3U2MA 2PX3A 3SNHA 2KYHA 3AG1C 4DRJB 4CIPA 3GEHA 1M6TA 4BJ6C 3C8GB 1MMDA 4QDLA 5JLIA 2R03A 3CAXA 1YA7O 2KW3C 3TK0A 3V7OA 2O9XA 4ZLDA 1CGOA 2WVQA 2L6GA 4YN0B 4DVYP 2L9JA 1HE1A 3HJCA 5E33A 1ZHTA 3FXHA 1EKYA 2Y69C 1GGQA 3IEEA 1JPNA 3NKDA 2G3VA 4BJ1A 3POVA 3G4ZA 4H4KC 1ZHWA 1CGNA 3RFYA 4CX9A 3EFOB 2ASRA 1JAFA 1OCCC 1W2WA 3IPMO 3FOPA 4U5FE 3I5PA 2NUTA 3S28A 1L3PA 1Q0MA 2P1AA 3CZ6A 4A4AA 4XEFA 3WAQA 4C7OA 1RMVA 1YZAA 3JSZA 3TOLA 3CQZA 4EBKA 1FR0A 1NFNA 3B9QA 4DVZA 1YJGA 2WVNA 3EGXA 3LNMB 2LSEA 4MTGA 4O7GA 5CI8A 3IQCA 3LESA 2XL8A 2AWYA 4JEBA 3W8HA 4DRHB 3AG2C 4YT2A 3Q6NA 1D1BA 4YL1A 3A9CA 1PD0A 1NU7D 3U3FA 4I3MA 4U5GA 1BR1A 4PFPA 3PDMP 4XTKA 1N1CA 2QNLA 3FVYA 5DVWA 4D4NA 1C02A 1QPUA 3EGXB 4EIYA 1E85A 3T4RA 3U0CA 2H7VC 4K7BA 1OQCA 1ORYA 1EI7A 2V26A 4J7YA 5B1BC 4CS9C 2ZXOA 2WZFA 1D1CA 4QI2A 2HUJA 2J9BA 4LDQA 4NY3A 3VM6A 3ZIBA 4DOZA 1Z3IX 3JSEO 4B6IA 3KPHA 3K7DA 3O6XA 3EFOA 1WASA 4EKWA 2D5RB 2CDQA 3WHNA 4PK4A 2CGEA 2QY9A 4WJ0A 2RSEB 2P7VA 3K66A 4FWVA 4LDKA 1VOMA 2DYSC 3U3BA 1ZU4A 2A6EF 1OKKD 2W4BA 4EBBA 5CIVA 1HW2A 2IXOA 4E0IA 5T3WA 1H6GA 3G4XA 1PV3A 3RIPA 1FMWA 2LP4A 4HE8D 3AJMA 5COGA 4I1MA 3U5SA 5FZTA 2A0BA 2XLOA 2J7PA 2L81A 2VH3A 3F47A 2Q9AA 2NPUA 2WB7A 3GANA 3L34A 1GQAA 1ORSC 2A0UA 3KKBA 3S90A 2ICWG 4C3BA 4PFOA 4MNDA 1OKKA 3R2PA 4BPMA 4DBQA 3MYFA 1LS1A 1F1MA 2I15A 2NUTB 1FFHA 2QTVA 1YAUO 4CSAC 2XXAA 3EPVA 1VLSA 1L7CA 1OR3A 2HV7A 2J9WA 1LI5A 1XZQA 4MVQA 3H2VA 2Q4FA 5F5FA 2J0WA 4YJWA 2XS1A 1Z7Qc 3R7CA 3EGDA 1RKEB 3GWNA 3JYHA 1MMGA 1O5HA 2IYLD 1J8MF 2LD6A 3IQ6A 2J45A 2MHRA 3DJUB 4YL0A 4AK9A 2X51A 3MX3A 4WGYA 3FOOA 3VAYA 3LUTB 1TQGA 1WOLA 4FX5A 3DKAA 4W8KA 3UGOA 3ASNC 2YWAA 2HZ8A 4JCZA 3LEVA 3AG3C 4K0DA 1K05A 3GEIA 4PJMA 1CGME 4Q5SF 3QW1A 4CIHA 3KH2A 1ORJA 4JTAB 4P9TA 3PHF2 5GPGB 2VCAA 2R7SA 2R7UA 3S0XA 3EZHA 4J30B 4OINF 2R7VA 3EZIA 3UGPA 1FMVA 1Z5ZA 1NLXA 2L6HA 3KMIA 4D4XA 2R7TA 3ZDLA 2J9VA 1V74B 1TWHA 4IJJA 2YRFA 3GODA 1OCZC 2HJ3A 4JRZA 3ASOC 3S29A 5JSLA 4KI2A 1SMYF 2Y39A 4A2NB 5KYYB 1GM5A 5B1AC 4U5CE 2ZXRA 3I4UA 3HLZA 1T6IA 1ZHXA 2BC5A 4I44A 4JTDB 4AE4B 3O39A 1VYKA 1YYJA 2JD3A 3OA1A 1ZVZA 1RJ9A 5IY5C 2XLEA 5JS5A 3DE8A 4PJJA 1B68A 1BDJB 3B0PA 2A6HF 1MMAA 2CNWA 4EUKB 4XEKA 3UMHA 1Z23A 3ZSUA 4K1OA 2LK4A 1ZHYA 4MVRA 2DGJA 1QVXA 3TOMA 3C8ZA 4NTFA 5L0GA 4CDVA 3ATPA 3LAYA 3EH1A 3N0TA 4IAQA 2C03A 3UMIA 4PR9A 5DLJA 2XRHA 1OW7A 1JOGA 5JT4A 3NYMA 1A7DA 2EPLX 5KYXA 1E84A 4NTBA 2YL7A 2YEVA 2ETSA 3KYIA 3O55A 4G7HF 3L0IA 1G8XA 2W45A 3JYYA 1SYQA 5D92A 3SXYA 2IXNA 2R7RA 256BA 1JRAA 3TJ6A 4OD5A 4CJGA 3T6JA 4JIOA 3SXKA 1EQ1A 5EHHA 2YLDA 2LCHA 4QI0A 2J8WA 1SR2A 3E9VA 4JJFA 5CI9A 3FDQA 4KC9A 1LM3B 3IQ5A 1M56C 2DB4A 2EILC 2MWQA 2XLDA 3DM5A 3DZAA 1ZW2A 3NMJA 3MYIA 5F28E 1G4WR 2XLVA 3QTHA 1RCPA 2JPUA 1KTMA 4U9EA 4RD9A 2TMVP 2W4MA 1M2VB 1QZXA 3AOUA 4PJNA 3V5YA 2OCCC 5DS4A 2GFHA 1PCXA 5D91A 2HV6A 2A69F 3EH2A 4MVZA 2NUPB 1ZZPA 1LE4A 1T5OA 2R25A 3N24A 2PF4E 3TJ5A 3RQEA 4NC3A 2Y3DA 3JTLO 4JC7A 1OCOC 1RKEA 3AGTA 5DQTA 5KYNA 2EPMX 1ST6A 2XLWA 3JRMO 1VTMP 3MLGA 1AEPA
chains in the Genus database with same CATH topology
2LQGA 4K1OA 4E17A 1ZW2A 1U6HA 1L7CA 3MYIA 3ZDLA 4E18A 1U89A 4EHPA 5L0GA 5L0IA 3H2VA 1QKRA 5L0JA 1XWJA 4PR9A 2B0HA 3T6GB 3H2UA 1DOVA 1RKEB 2HSQA 1T01A 2X0CA 4W8PA 1H6GA 2GWWA 1SYQA 1DOWA 2IBFA 3TJ5A 3RF3A 5L0CA 2GDCA 3VF0A 1ZVZA 3TJ6A 4DJ9A 1RKEA 5FZTA 2L7AA 1ZW3A 1ST6A 1RKCA 1YDIA 4IGGA 5L0DA 5L0FA 5L0HA 3S90A 1TR2A 4ONSA 4P9TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LQG A;  4K1O A;  4E17 A;  1ZW2 A;  1U6H A;  1L7C A;  3MYI A;  3ZDL A;  4E18 A;  1U89 A;  4EHP A;  5L0G A;  5L0I A;  3H2V A;  1QKR A;  5L0J A;  1XWJ A;  4PR9 A;  2B0H A;  3T6G B;  3H2U A;  1DOV A;  1RKE B;  2HSQ A;  1T01 A;  2X0C A;  4W8P A;  1H6G A;  2GWW A;  1SYQ A;  1DOW A;  2IBF A;  3TJ5 A;  3RF3 A;  5L0C A;  2GDC A;  3VF0 A;  1ZVZ A;  3TJ6 A;  4DJ9 A;  1RKE A;  5FZT A;  2L7A A;  1ZW3 A;  1ST6 A;  1RKC A;  1YDI A;  4IGG A;  5L0D A;  5L0F A;  5L0H A;  3S90 A;  1TR2 A;  4ONS A;  4P9T A; 
#chains in the Genus database with same CATH topology
 2VAS A;  2CW0 F;  2YKZ A;  1M2O A;  2HMZ A;  5E3A A;  3M4C A;  4LER A;  4XEV A;  1AUE A;  1H7I A;  4F4B A;  1C03 A;  4LLE A;  5A6J A;  3K6B A;  2G3K A;  3JCU Q;  5L0F A;  3VYW A;  4ZLC A;  2R7O A;  2H7O A;  2R7X A;  4BJT A;  1V55 C;  2H8A A;  3L8I A;  3LS0 A;  4HFF B;  1XWJ A;  5F5H A;  4CS8 C;  4KNW A;  2V3C C;  1OXB A;  1FFT C;  2B0H A;  4P9F A;  2R7W A;  4P6I C;  3L1M A;  1ZYR F;  2EIJ C;  4DBR A;  4ER9 A;  1HMD A;  2VCB A;  4Q4Z F;  3QZC A;  3W2W A;  4WGZ A;  1Z6A A;  1RXQ A;  2L6F A;  2OEV A;  2CYD A;  3S84 A;  1IW7 F;  1FAP B;  1NSG B;  3T9O A;  5HV9 A;  3RYL A;  4G7O F;  3C8G D;  1DOW A;  3BRJ A;  3ABK C;  3VRC A;  4EBJ A;  4N4W A;  5JP7 A;  4N06 A;  3FMS A;  1D0Z A;  1RKC A;  3ZTZ A;  1K04 A;  4OIQ F;  3LEO A;  4U5H A;  4CS8 A;  2GAQ A;  4IRU A;  1MNE A;  1D1A A;  1Q0F A;  2FGY A;  3LLI A;  3X1O A;  2KC3 A;  1H9G A;  2VC9 A;  2KJG A;  3UMK A;  3B71 A;  3Q7L A;  1JMW A;  5T1D B;  4MVO A;  1LS4 A;  1U89 A;  4R32 A;  2OKU A;  4LAC B;  1JPJ A;  1UFB A;  1LKX A;  1MMN A;  2A68 F;  3H2U A;  4IB4 A;  2HFI A;  5L3V A;  4YL3 A;  3MFN A;  2CNW D;  4N6C A;  5COM A;  1WAT A;  3CEX A;  3O10 A;  5BQI A;  4BJ5 A;  4XQ1 A;  3V5X A;  4CSA A;  4YT8 A;  1HY5 A;  1O3U A;  2Q9B A;  3U9M A;  3RF3 A;  1SF8 A;  2GDC A;  1YZC A;  2YVK A;  3K1I C;  3VF0 A;  1I4Z A;  2M4E A;  4JJG A;  5K0I A;  2J9U A;  1T9K A;  3F46 A;  4PJL A;  2G62 A;  1NFO A;  3JRT A;  4YWQ A;  5B3S C;  3DM9 B;  2Y3B A;  1YDI A;  1Y4C A;  4ONS A;  4XLP F;  4LLC A;  2WZG A;  3N2Z B;  2AP3 A;  3DJN B;  2P61 A;  1OR2 A;  5COF A;  3Q7G A;  3GM1 A;  2KNH A;  4IAO A;  4BJ5 C;  3C7J A;  1YVI A;  2EPK X;  1MQV A;  2VCC A;  2OEX A;  3PCV A;  3U8V A;  1LE2 A;  3H65 A;  3LNR A;  3W8I A;  3EGD B;  1A41 A;  1LVK A;  3C63 A;  5EK0 A;  2NSG A;  1OCR C;  2CCY A;  3K1I A;  4G78 A;  2EPO A;  2OOC A;  4JCH A;  1NBB A;  1RJ9 B;  1T6Q A;  2EIM C;  3ZWI A;  2WZL A;  1FNT c;  3GWL A;  4BEJ A;  1BZ4 A;  4RBN A;  1OW8 A;  3GOR A;  3UNG C;  3ZG1 A;  1QQ3 A;  2J0X A;  3AGU A;  4M63 A;  2BE5 F;  1V54 C;  3DXJ F;  2D4U A;  3TQO A;  4OIP F;  5BUO A;  2H7B A;  5E2Q A;  2DYR C;  3M4B A;  4XLN F;  3LJB A;  2B0J A;  3DD7 A;  3EHM A;  1E86 A;  1R4T A;  2UUI A;  5E3C A;  5AC4 A;  1TWG A;  3NYJ A;  4JEA A;  4MVS A;  1V4A A;  2R9R B;  2R7Q A;  2HS5 A;  1IZM A;  1VMA A;  3JZ0 A;  4YK5 A;  2HKV A;  2BL2 A;  2UUH A;  4L6R A;  3B0U X;  1M2V A;  4CDY A;  3RQG A;  3ZQY A;  4ULW A;  4AL1 A;  4GYT A;  4GEH A;  4LDR A;  4CJO A;  3J06 A;  1Q0D A;  4H54 A;  3RKO F;  2HSQ A;  2OJE D;  3NDB B;  2HJM A;  3M15 A;  2X0C A;  2YL1 A;  3ABL C;  4DXW A;  4IAR A;  1WN0 A;  1MND A;  2VB6 A;  3OWT A;  4JW1 A;  4ANJ A;  4BJ6 A;  2NG1 A;  3E70 C;  5A6B A;  4MS2 A;  1ZU5 A;  1ZW3 A;  2EIN C;  3DE9 A;  2KGO A;  1H9T A;  3LS1 A;  4RDA A;  4KNV A;  4AL0 A;  1NU9 C;  2Q3T A;  3NYL A;  4OD4 A;  3SYN A;  4U5E E;  3RVZ A;  3U8P A;  3HNJ A;  4JKV A;  3UR3 C;  1UG7 A;  2JX0 A;  5KYW A;  2C04 A;  5KYX B;  1TWC A;  3SXZ A;  3BEH A;  1O87 A;  4CBE A;  1QLE C;  3FHD A;  4YT5 A;  2QE9 A;  3M79 A;  2IOQ A;  4XPW A;  2AVK A;  5AGF A;  2IXP A;  3C18 A;  2IM8 A;  3DAF A;  3HNK A;  3K33 A;  4E7Z A;  3GEE A;  5DS6 A;  5DS5 A;  1AVO B;  1HE9 A;  4JZA A;  4AX2 A;  2R02 A;  3NMI A;  1KNY A;  3ABM C;  4GQH A;  4O6N A;  1VB5 A;  4W8P A;  5TJ5 E;  1YA9 A;  3SP1 A;  4Z9H A;  3ZTM A;  2R05 A;  4J7T A;  3CSK A;  4BG0 A;  2OJQ A;  5L0C A;  1YAR O;  4PAC A;  1A7E A;  5AC5 A;  3ZVR A;  3GM2 A;  2HSB A;  4IGG A;  4MW3 A;  3US6 A;  2Z15 A;  1BBH A;  1A7V A;  2PP4 A;  1LPE A;  1WTY A;  4U5D E;  1TR2 A;  4CDA A;  2XL6 A;  4MW8 A;  4XPY A;  3QVY A;  4NCQ A;  1BR4 A;  1E2X A;  1S05 A;  3A11 A;  2Q7R A;  4X0R A;  3WOD F;  1APC A;  4IWB A;  2YL0 A;  1VK5 A;  4E17 A;  5FCL A;  2IXM A;  3S27 A;  4O6Y A;  1PD1 A;  1Y6D A;  4J32 B;  4NTA A;  2Q00 A;  1VLT A;  4HEA J;  3AQC A;  4CS9 A;  1FTS A;  1G5Z A;  1Q0G A;  1R5I D;  3DAG A;  3NMK A;  3B0V C;  3JT1 A;  2GWW A;  3C62 A;  5JRA A;  5DQZ A;  2KSF A;  1S7Z A;  2Y3H A;  2EIK C;  1T6U A;  5A6B D;  3W4Y A;  1NZE A;  4WAB A;  4E0H A;  2YL3 A;  2LFF A;  3QVZ A;  1LI7 A;  2XS8 A;  3DMD A;  1YLM A;  4MTO A;  4O6M A;  2ZXP A;  3MBG A;  2WL8 A;  4Z9I A;  2MYS A;  3EHN A;  2ZXW C;  3RQF A;  3SZR A;  3V5Z A;  3ZQV A;  5JVE A;  3HNL A;  3ZC4 A;  4MVM A;  4C3D A;  2FFH A;  1TFO B;  2XLM A;  4YT4 A;  1U6H A;  1D0X A;  2F22 A;  4EHP A;  3EG9 A;  3QMK A;  4MQ9 F;  2Y3G A;  1EA8 A;  1GS9 A;  2ZPA A;  1KU2 A;  1DOV A;  2OG2 A;  2OQM A;  2J46 A;  3Q6M A;  2PBE A;  3LLK A;  3TD7 A;  1T01 A;  3B29 A;  4MVU A;  4Q7C A;  4N6H A;  1G4U S;  4C3E A;  2YZS A;  3HTK C;  4ULV A;  3U2L A;  2YLI A;  2IBF A;  4JTC B;  2OU6 A;  1J8Y F;  2GA0 A;  2XM0 A;  2I8B A;  1WGW A;  1A0B A;  2A1D D;  3FAP B;  3FAJ A;  4EWC A;  3KL4 A;  1WWP A;  4OIO F;  4FES A;  1I5N A;  2LQG A;  4OIR F;  1VYI A;  1XZP A;  2NUP A;  2M64 A;  3PMR A;  4BEM J;  5EGY A;  4JVS A;  5A6K A;  4E18 A;  5JUA A;  1TWA A;  1C17 M;  2QUP A;  2AU5 A;  3K1H A;  1QKR A;  3SEO A;  3SXM A;  3KYJ A;  2DI3 A;  3G50 A;  3DI5 A;  2PNO A;  3AQB A;  4CS7 A;  3NKE A;  3M1C B;  1NG1 A;  5HSW A;  3QW0 A;  3IHU A;  2XSE A;  2AWC A;  4AE4 A;  2E87 A;  2NSF A;  4UDV A;  2PFD A;  3DWW A;  2XL4 A;  4DRI B;  2LIG A;  5BQG A;  4XPX A;  3L8J A;  3S9O A;  4U5B E;  1OXK A;  5L0D A;  1M57 C;  1TKN A;  3NRH A;  3EJN A;  2XM4 A;  1U0B B;  4FAP B;  2XXA B;  2J7P D;  4I1O B;  4NQF A;  1HW1 A;  1YYX A;  2LFD A;  5KYW B;  2QLA A;  4HFK B;  3TUL A;  3RH3 A;  2KQ9 A;  2RD9 A;  2ZD9 A;  1TFK B;  1JR8 A;  3ITF A;  1BR2 A;  2FAP B;  3U9J A;  3W2V A;  5B3I A;  5L0I A;  4G7Z F;  3ECS A;  4JE9 A;  4MTF A;  5L0J A;  1D0Y A;  1CPR A;  4KBL A;  2XLH A;  3T6G B;  1I4Y A;  3EQL F;  4XWJ A;  2EPN A;  2P0N A;  3AG4 C;  5T3T A;  5KYU B;  2HMQ A;  3EG9 B;  1OW6 A;  4E7S A;  3HKK A;  4O79 A;  1HMO A;  3IQT A;  4C7O B;  1QSP A;  1LIH A;  1Q0K A;  2YHS A;  3X2Q C;  4G0H A;  1SZI A;  2YLG A;  3WG7 C;  2PX0 A;  1CPQ A;  2Q9C A;  2W9Y A;  5KYU A;  2WVO A;  3T6B A;  5KYY A;  3NG1 A;  4DJ9 A;  1K40 A;  1ZHZ A;  2KK1 A;  3RW0 A;  3C8G A;  2L7A A;  5BQH A;  3RVY A;  3HNI A;  5L0H A;  4Z9J A;  5A69 A;  1E83 A;  3OEO A;  2P6V A;  4JUR I;  2YQY A;  5A6A A;  5L3Q A;  1Z63 A;  3I5Q A;  4U9D A;  3GM3 A;  3U2M A;  2PX3 A;  3SNH A;  2KYH A;  3AG1 C;  4DRJ B;  4CIP A;  3GEH A;  1M6T A;  4BJ6 C;  3C8G B;  1MMD A;  4QDL A;  5JLI A;  2R03 A;  3CAX A;  1YA7 O;  2KW3 C;  3TK0 A;  3V7O A;  2O9X A;  4ZLD A;  1CGO A;  2WVQ A;  2L6G A;  4YN0 B;  4DVY P;  2L9J A;  1HE1 A;  3HJC A;  5E33 A;  1ZHT A;  3FXH A;  1EKY A;  2Y69 C;  1GGQ A;  3IEE A;  1JPN A;  3NKD A;  2G3V A;  4BJ1 A;  3POV A;  3G4Z A;  4H4K C;  1ZHW A;  1CGN A;  3RFY A;  4CX9 A;  3EFO B;  2ASR A;  1JAF A;  1OCC C;  1W2W A;  3IPM O;  3FOP A;  4U5F E;  3I5P A;  2NUT A;  3S28 A;  1L3P A;  1Q0M A;  2P1A A;  3CZ6 A;  4A4A A;  4XEF A;  3WAQ A;  4C7O A;  1RMV A;  1YZA A;  3JSZ A;  3TOL A;  3CQZ A;  4EBK A;  1FR0 A;  1NFN A;  3B9Q A;  4DVZ A;  1YJG A;  2WVN A;  3EGX A;  3LNM B;  2LSE A;  4MTG A;  4O7G A;  5CI8 A;  3IQC A;  3LES A;  2XL8 A;  2AWY A;  4JEB A;  3W8H A;  4DRH B;  3AG2 C;  4YT2 A;  3Q6N A;  1D1B A;  4YL1 A;  3A9C A;  1PD0 A;  1NU7 D;  3U3F A;  4I3M A;  4U5G A;  1BR1 A;  4PFP A;  3PDM P;  4XTK A;  1N1C A;  2QNL A;  3FVY A;  5DVW A;  4D4N A;  1C02 A;  1QPU A;  3EGX B;  4EIY A;  1E85 A;  3T4R A;  3U0C A;  2H7V C;  4K7B A;  1OQC A;  1ORY A;  1EI7 A;  2V26 A;  4J7Y A;  5B1B C;  4CS9 C;  2ZXO A;  2WZF A;  1D1C A;  4QI2 A;  2HUJ A;  2J9B A;  4LDQ A;  4NY3 A;  3VM6 A;  3ZIB A;  4DOZ A;  1Z3I X;  3JSE O;  4B6I A;  3KPH A;  3K7D A;  3O6X A;  3EFO A;  1WAS A;  4EKW A;  2D5R B;  2CDQ A;  3WHN A;  4PK4 A;  2CGE A;  2QY9 A;  4WJ0 A;  2RSE B;  2P7V A;  3K66 A;  4FWV A;  4LDK A;  1VOM A;  2DYS C;  3U3B A;  1ZU4 A;  2A6E F;  1OKK D;  2W4B A;  4EBB A;  5CIV A;  1HW2 A;  2IXO A;  4E0I A;  5T3W A;  1H6G A;  3G4X A;  1PV3 A;  3RIP A;  1FMW A;  2LP4 A;  4HE8 D;  3AJM A;  5COG A;  4I1M A;  3U5S A;  5FZT A;  2A0B A;  2XLO A;  2J7P A;  2L81 A;  2VH3 A;  3F47 A;  2Q9A A;  2NPU A;  2WB7 A;  3GAN A;  3L34 A;  1GQA A;  1ORS C;  2A0U A;  3KKB A;  3S90 A;  2ICW G;  4C3B A;  4PFO A;  4MND A;  1OKK A;  3R2P A;  4BPM A;  4DBQ A;  3MYF A;  1LS1 A;  1F1M A;  2I15 A;  2NUT B;  1FFH A;  2QTV A;  1YAU O;  4CSA C;  2XXA A;  3EPV A;  1VLS A;  1L7C A;  1OR3 A;  2HV7 A;  2J9W A;  1LI5 A;  1XZQ A;  4MVQ A;  3H2V A;  2Q4F A;  5F5F A;  2J0W A;  4YJW A;  2XS1 A;  1Z7Q c;  3R7C A;  3EGD A;  1RKE B;  3GWN A;  3JYH A;  1MMG A;  1O5H A;  2IYL D;  1J8M F;  2LD6 A;  3IQ6 A;  2J45 A;  2MHR A;  3DJU B;  4YL0 A;  4AK9 A;  2X51 A;  3MX3 A;  4WGY A;  3FOO A;  3VAY A;  3LUT B;  1TQG A;  1WOL A;  4FX5 A;  3DKA A;  4W8K A;  3UGO A;  3ASN C;  2YWA A;  2HZ8 A;  4JCZ A;  3LEV A;  3AG3 C;  4K0D A;  1K05 A;  3GEI A;  4PJM A;  1CGM E;  4Q5S F;  3QW1 A;  4CIH A;  3KH2 A;  1ORJ A;  4JTA B;  4P9T A;  3PHF 2;  5GPG B;  2VCA A;  2R7S A;  2R7U A;  3S0X A;  3EZH A;  4J30 B;  4OIN F;  2R7V A;  3EZI A;  3UGP A;  1FMV A;  1Z5Z A;  1NLX A;  2L6H A;  3KMI A;  4D4X A;  2R7T A;  3ZDL A;  2J9V A;  1V74 B;  1TWH A;  4IJJ A;  2YRF A;  3GOD A;  1OCZ C;  2HJ3 A;  4JRZ A;  3ASO C;  3S29 A;  5JSL A;  4KI2 A;  1SMY F;  2Y39 A;  4A2N B;  5KYY B;  1GM5 A;  5B1A C;  4U5C E;  2ZXR A;  3I4U A;  3HLZ A;  1T6I A;  1ZHX A;  2BC5 A;  4I44 A;  4JTD B;  4AE4 B;  3O39 A;  1VYK A;  1YYJ A;  2JD3 A;  3OA1 A;  1ZVZ A;  1RJ9 A;  5IY5 C;  2XLE A;  5JS5 A;  3DE8 A;  4PJJ A;  1B68 A;  1BDJ B;  3B0P A;  2A6H F;  1MMA A;  2CNW A;  4EUK B;  4XEK A;  3UMH A;  1Z23 A;  3ZSU A;  4K1O A;  2LK4 A;  1ZHY A;  4MVR A;  2DGJ A;  1QVX A;  3TOM A;  3C8Z A;  4NTF A;  5L0G A;  4CDV A;  3ATP A;  3LAY A;  3EH1 A;  3N0T A;  4IAQ A;  2C03 A;  3UMI A;  4PR9 A;  5DLJ A;  2XRH A;  1OW7 A;  1JOG A;  5JT4 A;  3NYM A;  1A7D A;  2EPL X;  5KYX A;  1E84 A;  4NTB A;  2YL7 A;  2YEV A;  2ETS A;  3KYI A;  3O55 A;  4G7H F;  3L0I A;  1G8X A;  2W45 A;  3JYY A;  1SYQ A;  5D92 A;  3SXY A;  2IXN A;  2R7R A;  256B A;  1JRA A;  3TJ6 A;  4OD5 A;  4CJG A;  3T6J A;  4JIO A;  3SXK A;  1EQ1 A;  5EHH A;  2YLD A;  2LCH A;  4QI0 A;  2J8W A;  1SR2 A;  3E9V A;  4JJF A;  5CI9 A;  3FDQ A;  4KC9 A;  1LM3 B;  3IQ5 A;  1M56 C;  2DB4 A;  2EIL C;  2MWQ A;  2XLD A;  3DM5 A;  3DZA A;  1ZW2 A;  3NMJ A;  3MYI A;  5F28 E;  1G4W R;  2XLV A;  3QTH A;  1RCP A;  2JPU A;  1KTM A;  4U9E A;  4RD9 A;  2TMV P;  2W4M A;  1M2V B;  1QZX A;  3AOU A;  4PJN A;  3V5Y A;  2OCC C;  5DS4 A;  2GFH A;  1PCX A;  5D91 A;  2HV6 A;  2A69 F;  3EH2 A;  4MVZ A;  2NUP B;  1ZZP A;  1LE4 A;  1T5O A;  2R25 A;  3N24 A;  2PF4 E;  3TJ5 A;  3RQE A;  4NC3 A;  2Y3D A;  3JTL O;  4JC7 A;  1OCO C;  1RKE A;  3AGT A;  5DQT A;  5KYN A;  2EPM X;  1ST6 A;  2XLW A;  3JRM O;  1VTM P;  3MLG A;  1AEP A; 
#chains in the Genus database with same CATH homology
 2LQG A;  4K1O A;  4E17 A;  1ZW2 A;  1U6H A;  1L7C A;  3MYI A;  3ZDL A;  4E18 A;  1U89 A;  4EHP A;  5L0G A;  5L0I A;  3H2V A;  1QKR A;  5L0J A;  1XWJ A;  4PR9 A;  2B0H A;  3T6G B;  3H2U A;  1DOV A;  1RKE B;  2HSQ A;  1T01 A;  2X0C A;  4W8P A;  1H6G A;  2GWW A;  1SYQ A;  1DOW A;  2IBF A;  3TJ5 A;  3RF3 A;  5L0C A;  2GDC A;  3VF0 A;  1ZVZ A;  3TJ6 A;  4DJ9 A;  1RKE A;  5FZT A;  2L7A A;  1ZW3 A;  1ST6 A;  1RKC A;  1YDI A;  4IGG A;  5L0D A;  5L0F A;  5L0H A;  3S90 A;  1TR2 A;  4ONS A;  4P9T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...