4EHPA

Crystal structure of human vinculin head domain (residues 1-252) in complex with alpha-catenin (residues 277-382)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
251
structure length
248
Chain Sequence
PVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKIEEALKNRNFTVEKMSAEINEIIRVLQLTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinculin
publication title alpha-Catenin unfurls upon binding to vinculin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 103
structure length 248
sequence length 251
ec nomenclature
pdb deposition date 2012-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 4ehpA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 4ehpA01
5L0CA 1ZVZA 2GWWA 1XWJA 4E18A 1DOVA 4K1OA 3H2VA 1QKRA 1ZW3A 1U89A 5L0FA 4IGGA 1YDIA 2GDCA 3T6GB 1T01A 3VF0A 2HSQA 1TR2A 2B0HA 3H2UA 1DOWA 1L7CA 4ONSA 1ZW2A 1U6HA 5FZTA 4E17A 1ST6A 1H6GA 3ZDLA 3S90A 4PR9A 2X0CA 1SYQA 2L7AA 3TJ5A 4EHPA 1RKEB 4W8PA 4DJ9A 2IBFA 3RF3A 3MYIA 3TJ6A 1RKEA 1RKCA 5L0IA 4P9TA 5L0DA 5L0HA 2LQGA 5L0JA 5L0GA
chains in the Genus database with same CATH superfamily
2XLEA 3EG9A 4E18A 4Q4ZF 3FOOA 3E70C 4YT8A 5T3TA 1T6UA 5L0FA 4CDYA 3M79A 2ZXWC 3U3BA 3B9QA 1G4US 3WG7C 1SMYF 3O39A 5L3QA 4D4XA 2OJED 5FZTA 5AC5A 1CGNA 2W4BA 1D1AA 4PR9A 1NG1A 1M6TA 2L6GA 4JEBA 5JSLA 4BEJA 1E2XA 3ABKC 3RVYA 4EUKB 2WZGA 1TFOB 1EKYA 4XPXA 1MNEA 2OOCA 3TOMA 2B0JA 4A4AA 4IB4A 4PJJA 2YKZA 1V74B 5L0HA 4XLPF 1GM5A 3VRCA 4QI0A 2YL3A 1ZYRF 2YLGA 5IY5C 5F5HA 4CJGA 1A7VA 2HZ8A 2YHSA 3NKDA 4XEVA 3VAYA 4YT2A 1FTSA 3POVA 4F4BA 3MX3A 4JJGA 1JMWA 1NBBA 3HNJA 4BJ6A 3SZRA 3R7CA 1WTYA 3HNIA 3US6A 3DKAA 5JRAA 1RJ9B 4WGZA 4EBKA 4MW3A 1LE2A 1ZHTA 4EWCA 1RJ9A 2Y3GA 3HTKC 4HFFB 2DGJA 4EHPA 1LVKA 4JCHA 1K04A 5TJ5E 3K66A 2HMZA 1OR2A 3ABMC 5A6BD 1MMNA 2J46A 3ZQVA 4DVZA 2XLOA 1BR4A 2Y69C 3B29A 3HLZA 4CS7A 3EGXB 1KTMA 2MWQA 2O9XA 3M15A 3Q7GA 2XS8A 2XM0A 1RXQA 2ZXPA 3EGXA 3LEOA 1M56C 3NG1A 2R05A 3DE8A 5EHHA 2G3VA 3DAFA 4IWBA 2XS1A 1YAUO 2AP3A 2Z15A 1G4WR 3CZ6A 3CQZA 3GWNA 5E2QA 4E7SA 4XTKA 2A6EF 3S9OA 4BJ1A 4LDKA 1E83A 2ETSA 2EPNA 3DE9A 4YN0B 4LDRA 3U3FA 3TQOA 1OKKA 2KYHA 3LLKA 2A6HF 3L8JA 2IBFA 3KPHA 1IZMA 1IW7F 4PJMA 4P6IC 5DS6A 3BRJA 1QLEC 4N4WA 4FX5A 1RKCA 1FMVA 1V55C 2J8WA 3FVYA 4PJLA 5L0IA 1ZU5A 3TULA 1ORYA 1ZVZA 2EIJC 3FHDA 1WATA 4MVQA 4RDAA 3ZTZA 4BG0A 1LE4A 2WB7A 1RMVA 1OW8A 4WJ0A 4CJOA 3U0CA 3DM9B 3EFOB 3RQGA 256BA 3AGTA 4JURI 1R4TA 2HSQA 2HSBA 3GWLA 1KU2A 3EFOA 1ZW2A 3GEEA 1NZEA 3PCVA 2KK1A 3GM3A 2M64A 2HS5A 3C62A 1Z6AA 3GODA 3WODF 3DZAA 3GEIA 1A41A 3ATPA 4DBRA 1H7IA 3UGOA 2J7PD 2YVKA 3AG3C 4G7OF 1HW2A 3ECSA 2CNWD 4YT4A 2JD3A 4Q5SF 4GYTA 1YZCA 2HFIA 5COMA 2L81A 3EJNA 4LLCA 1TWHA 1TKNA 2WVQA 2LQGA 4P9TA 5COGA 4DRIB 4OIQF 3ABLC 4U5DE 2EINC 3JTLO 3IQCA 1W2WA 4C7OB 3JYHA 1ZW3A 1U89A 3C7JA 2D5RB 3I5PA 3SNHA 1YARO 2ZXOA 2PF4E 4CS9A 4KI2A 4LDQA 3L8IA 5BQIA 3ZVRA 4AE4B 3C63A 3NMKA 4XLNF 3UMHA 5DLJA 4OIRF 2FFHA 2Y3BA 4YL1A 4AE4A 3R2PA 2QY9A 1MNDA 2KC3A 4XQ1A 1Y4CA 3LLIA 1LM3B 1RKEB 3V5YA 3JZ0A 2GFHA 5F28E 1YVIA 2L6FA 3JRMO 2R7RA 3RIPA 3LAYA 4CBEA 2CCYA 2XRHA 4BJTA 1T6QA 1ZHYA 4EBBA 3TD7A 3KH2A 5B3SC 2IYLD 2IOQA 5L0DA 2XLWA 4NTAA 1J8MF 4JJFA 2HV7A 4YL3A 1D1BA 4EIYA 2RD9A 3IPMO 3T6JA 3ZSUA 3JSEO 1CPRA 3TK0A 4C3BA 5L3VA 1A7EA 1I4YA 4YK5A 1WN0A 1Z23A 1AUEA 2M4EA 2VCAA 4I1OB 4JEAA 5T1DB 1YA7O 1C17M 2KW3C 1C03A 1K40A 3A9CA 4KC9A 4XEKA 5K0IA 1ZHXA 1VMAA 1DOWA 3VYWA 1H9TA 2LFFA 2J45A 4RD9A 1YA9A 2V26A 4IARA 4G7ZF 2KSFA 3RQFA 2G3KA 3EHNA 3ZDLA 2J9WA 2NUTB 1KNYA 2WVNA 5JS5A 5JUAA 4G0HA 4U5CE 1TWCA 3DJNB 4N6HA 4U9EA 3MYIA 4X0RA 1LPEA 1VB5A 2FGYA 2LCHA 1XZPA 2XLVA 4DOZA 1A7DA 2QE9A 3HKKA 3IQ5A 2R7OA 2PNOA 1HY5A 2ZD9A 2EPKX 4XPWA 1XWJA 4NTFA 1QPUA 4N6CA 3SEOA 2R7SA 2CDQA 3FDQA 3RQEA 2LK4A 1D1CA 3MLGA 2LIGA 1Q0FA 3VM6A 1B68A 3QVYA 2KGOA 1EA8A 4IJJA 5A6JA 4OIOF 1LI7A 3RKOF 3RYLA 2L9JA 2BC5A 1QZXA 3QVZA 4U5EE 1G8XA 1WWPA 5D91A 3JYYA 2R7VA 3S90A 3DJUB 2Q00A 4FAPB 1YLMA 4NQFA 3RFYA 2R7XA 1GQAA 2NUPB 2KJGA 1JOGA 1FMWA 1S7ZA 4JTCB 4MVUA 3O10A 4DJ9A 1PV3A 3G50A 3KMIA 2YQYA 2NUPA 4EBJA 4G78A 3TJ6A 1VTMP 1JPNA 4EKWA 1QVXA 2H7BA 4MTFA 3ZIBA 2DI3A 5E33A 4E7ZA 4H4KC 2IM8A 3C8ZA 3I4UA 2ZPAA 1TWAA 3GANA 4OINF 1J8YF 1D0XA 3NMJA 1DOVA 2IXMA 1GGQA 2OEXA 3O6XA 1ZZPA 4U5BE 2D4UA 4YWQA 1Z5ZA 3NDBB 5B3IA 1FNTc 4MQ9F 4JTAB 3DWWA 5DVWA 1D0YA 4CDVA 3W2VA 2Q9AA 5KYYB 2A0BA 2WZLA 4FESA 1ST6A 3LUTB 3V5ZA 3J06A 3K6BA 2R9RB 4JKVA 4PJNA 2P6VA 5KYYA 2A69F 1O5HA 4K7BA 4M63A 4W8PA 3S28A 1E85A 4IAOA 3SXKA 2EILC 3X1OA 1HMOA 1OXBA 1V54C 5BQGA 2TMVP 3IQTA 3NYJA 1VK5A 2OKUA 3H65A 4JW1A 1UFBA 3LS1A 3LNRA 5D92A 4BJ6C 2OCCC 4E0IA 3E9VA 3ZC4A 4R32A 1CGOA 3W4YA 3EZIA 3SYNA 4GQHA 3C8GD 3HNKA 5COFA 2YL0A 2HJ3A 3CEXA 3OWTA 3B0UX 1SF8A 4G7HF 4RBNA 1BZ4A 1WGWA 1JPJA 1K05A 5BQHA 2AU5A 3AG1C 1T01A 2WVOA 3A11A 3RH3A 1YZAA 5A6AA 5KYUB 3DM5A 3HNLA 4W8KA 1EI7A 2LFDA 2KQ9A 3AG4C 1H6GA 4Q7CA 3V7OA 4YJWA 3LS0A 4JZAA 2PP4A 4JC7A 2QNLA 4J32B 3TOLA 1MMGA 2HJMA 2R7TA 3AOUA 1JAFA 2J0XA 4CS8A 4ULVA 3N0TA 1Z3IX 3OEOA 4MW8A 5JVEA 5GPGB 3PHF2 4U9DA 3KYJA 2FAPB 3NKEA 4LACB 1NSGB 2J9UA 1ZHZA 2R02A 4XPYA 2OQMA 3W8IA 5HV9A 5L0JA 4JCZA 4QI2A 2EPOA 3IHUA 2GA0A 3S29A 3U2MA 2I15A 4U5HA 3PMRA 4AK9A 1QKRA 3GM2A 1AVOB 2IXNA 1GS9A 2Y39A 1HW1A 3F47A 2WZFA 1VLSA 1JRAA 4OD4A 4YT5A 4C7OA 4ONSA 4DVYP 2CW0F 1MQVA 2EPLX 3Q6NA 4JTDB 3JRTA 2YEVA 1Y6DA 2EPMX 3QTHA 2PX0A 3DXJF 3EH1A 3LEVA 3QMKA 4K0DA 3TJ5A 2ICWG 4UDVA 3S0XA 2MYSA 2V3CC 2AVKA 2RSEB 1RKEA 4I44A 4YL0A 2J7PA 2HUJA 3EZHA 1PD1A 2CNWA 2E87A 1C02A 2P1AA 5F5FA 1D0ZA 4NC3A 1NFOA 4MVRA 2PFDA 3MBGA 3B71A 3PDMP 2R25A 1R5ID 3DD7A 3QW1A 5KYWB 1YYXA 4NTBA 1BBHA 2BL2A 3ZQYA 2W9YA 1O87A 4DXWA 3IQ6A 2R03A 5DS4A 2ZXRA 2H8AA 1VYIA 1A0BA 3AGUA 1G5ZA 2CYDA 3UMKA 2NSGA 3U5SA 4WABA 1SR2A 4ZLCA 1T5OA 4OD5A 2H7VC 1OCOC 2BE5F 4U5GA 2L7AA 3DMDA 4CX9A 3OA1A 2YLIA 1ZU4A 4JVSA 3NYLA 2YZSA 2NPUA 4D4NA 4DBQA 3EGDB 1YYJA 2NG1A 2NUTA 2R7QA 4OIPF 4CSAA 2C03A 3B0VC 3KL4A 3K1HA 2OJQA 4HEAJ 5EGYA 1MMAA 4CS9C 2J0WA 2H7OA 1BR2A 5L0GA 4O79A 5KYNA 2OU6A 1TQGA 2I8BA 4KNWA 1Q0MA 3AG2C 1N1CA 2NSFA 2DB4A 2YWAA 3H2VA 4P9FA 2XLMA 2YRFA 4ER9A 4PFOA 1S05A 2J9VA 1VLTA 4U5FE 1AEPA 3M4BA 1YDIA 3SXYA 1Q0KA 1E84A 2XM4A 1FAPB 3H2UA 3JCUQ 3UGPA 4XWJA 3ZTMA 3B0PA 1L7CA 3S84A 3M1CB 1HMDA 4DRHB 2A0UA 2PBEA 3KYIA 1TFKB 1APCA 2X0CA 3GORA 5BUOA 1CGME 4IRUA 3U8VA 4CIPA 3EHMA 3K1IA 3UR3C 1BR1A 2Y3HA 3FAJA 3NMIA 4HFKB 3V5XA 3W8HA 2XXAB 1WASA 2J9BA 2L6HA 2XXAA 1NU9C 3F46A 4MVOA 4JE9A 1T9KA 1LKXA 4MTGA 1FFTC 4O7GA 5T3WA 4ZLDA 4LLEA 5L0CA 2VC9A 4J7YA 4Z9IA 1U0BB 2C04A 2VH3A 3K33A 4BJ5A 4MVMA 1T6IA 3SP1A 2W4MA 3L34A 3SXMA 1OCRC 1I4ZA 2A1DD 2P0NA 2CGEA 1VOMA 2B0HA 4AX2A 5A69A 2PX3A 2YL7A 4CSAC 2HV6A 1OKKD 3DI5A 3GEHA 2JPUA 4AL0A 3Q7LA 1FR0A 4ANJA 3Q6MA 1OW6A 1L3PA 1NLXA 3AQBA 4WGYA 2VCCA 2EIKC 1FFHA 4I1MA 4NCQA 2YL1A 2IXOA 2Y3DA 3RF3A 1LIHA 4AL1A 5CI8A 4BPMA 2LSEA 2VB6A 2OEVA 4QDLA 5FCLA 2QLAA 4MVZA 3O55A 2LD6A 4LERA 3JSZA 2GAQA 2UUIA 1OQCA 2OG2A 2YLDA 3FMSA 1BDJB 2IXPA 3T4RA 3QW0A 1OW7A 4IAQA 5CIVA 4A2NB 2Q9CA 3CAXA 2DYRC 3I5QA 5DQZA 1NFNA 4GEHA 1XZQA 3CSKA 3K1IC 1V4AA 4JIOA 3VF0A 1LS1A 1OXKA 3U9JA 3LJBA 1TWGA 2AWYA 5DQTA 2AWCA 3L1MA 4I3MA 2F22A 2EIMC 5B1BC 1O3UA 3NYMA 3W2WA 1UG7A 3LNMB 1SZIA 5KYUA 2DYSC 2XL6A 4XEFA 4CDAA 4MTOA 3UMIA 3KKBA 1ORJA 3N2ZB 3UNGC 1MMDA 2XL8A 5JT4A 4BJ5C 1YJGA 2X51A 3ITFA 3LESA 5DS5A 5A6KA 1HE9A 4DRJB 3EH2A 4JRZA 2VCBA 3T6BA 2XLHA 4J7TA 3RVZA 4PK4A 1H9GA 2Q7RA 1Z63A 2W45A 4MS2A 3C8GB 3QZCA 1OR3A 2GWWA 1VYKA 2QUPA 4MVSA 3NRHA 5HSWA 3U8PA 3C8GA 1LS4A 3X2QC 1RCPA 2MHRA 4KNVA 3U9MA 4O6NA 2GDCA 2JX0A 3T6GB 1ORSC 3N24A 4L6RA 1TR2A 2XL4A 5JP7A 2WL8A 3S27A 3ZWIA 1QQ3A 3BEHA 3AJMA 4Z9HA 4BEMJ 5JLIA 1Q0GA 1QSPA 3G4ZA 1EQ1A 1JR8A 1OCZC 4Z9JA 4E17A 4C3EA 3FAPB 4PACA 3WAQA 3FXHA 4NY3A 4B6IA 3M4CA 2HKVA 2VASA 4J30B 1M57C 3AQCA 3HJCA 4C3DA 2Q4FA 2R7UA 3C18A 4O6YA 3MYFA 1M2OA 3EQLF 1F1MA 2G62A 3FOPA 4ULWA 3EPVA 2R7WA 3SXZA 3ASOC 1PD0A 4O6MA 4E0HA 3ZG1A 4H54A 2ASRA 4K1OA 5AC4A 4MNDA 3T9OA 1E86A 1NU7D 3L0IA 3IEEA 2Q9BA 3ASNC 4IGGA 5EK0A 2P61A 3RW0A 2LP4A 1Q0DA 3WHNA 5AGFA 4CS8C 5KYWA 4KBLA 2UUHA 1Z7Qc 1U6HA 4N06A 5A6BA 5E3AA 2XLDA 4CIHA 3K7DA 5E3CA 5B1AC 2XSEA 1CPQA 1OCCC 1SYQA 2Q3TA 5KYXB 2HMQA 1HE1A 2P7VA 2QTVA 3MFNA 1M2VB 5KYXA 1I5NA 1WOLA 4FWVA 1ZHWA 2A68F 3DAGA 2KNHA 4HE8D 1M2VA 3GM1A 3U2LA 1LI5A 3EG9B 3EGDA 3G4XA 5CI9A 4PFPA 1PCXA 3JT1A
chains in the Genus database with same CATH topology
5L0CA 1ZVZA 2GWWA 1XWJA 4E18A 1DOVA 4K1OA 3H2VA 1QKRA 1ZW3A 1U89A 5L0FA 4IGGA 1YDIA 2GDCA 3T6GB 1T01A 3VF0A 2HSQA 1TR2A 2B0HA 3H2UA 1DOWA 1L7CA 4ONSA 1ZW2A 1U6HA 5FZTA 4E17A 1ST6A 1H6GA 3ZDLA 3S90A 4PR9A 2X0CA 1SYQA 2L7AA 3TJ5A 4EHPA 1RKEB 4W8PA 4DJ9A 2IBFA 3RF3A 3MYIA 3TJ6A 1RKEA 1RKCA 5L0IA 4P9TA 5L0DA 5L0HA 2LQGA 5L0JA 5L0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L0C A;  1ZVZ A;  2GWW A;  1XWJ A;  4E18 A;  1DOV A;  4K1O A;  3H2V A;  1QKR A;  1ZW3 A;  1U89 A;  5L0F A;  4IGG A;  1YDI A;  2GDC A;  3T6G B;  1T01 A;  3VF0 A;  2HSQ A;  1TR2 A;  2B0H A;  3H2U A;  1DOW A;  1L7C A;  4ONS A;  1ZW2 A;  1U6H A;  5FZT A;  4E17 A;  1ST6 A;  1H6G A;  3ZDL A;  3S90 A;  4PR9 A;  2X0C A;  1SYQ A;  2L7A A;  3TJ5 A;  4EHP A;  1RKE B;  4W8P A;  4DJ9 A;  2IBF A;  3RF3 A;  3MYI A;  3TJ6 A;  1RKE A;  1RKC A;  5L0I A;  4P9T A;  5L0D A;  5L0H A;  2LQG A;  5L0J A;  5L0G A; 
#chains in the Genus database with same CATH topology
 2XLE A;  3EG9 A;  4E18 A;  4Q4Z F;  3FOO A;  3E70 C;  4YT8 A;  5T3T A;  1T6U A;  5L0F A;  4CDY A;  3M79 A;  2ZXW C;  3U3B A;  3B9Q A;  1G4U S;  3WG7 C;  1SMY F;  3O39 A;  5L3Q A;  4D4X A;  2OJE D;  5FZT A;  5AC5 A;  1CGN A;  2W4B A;  1D1A A;  4PR9 A;  1NG1 A;  1M6T A;  2L6G A;  4JEB A;  5JSL A;  4BEJ A;  1E2X A;  3ABK C;  3RVY A;  4EUK B;  2WZG A;  1TFO B;  1EKY A;  4XPX A;  1MNE A;  2OOC A;  3TOM A;  2B0J A;  4A4A A;  4IB4 A;  4PJJ A;  2YKZ A;  1V74 B;  5L0H A;  4XLP F;  1GM5 A;  3VRC A;  4QI0 A;  2YL3 A;  1ZYR F;  2YLG A;  5IY5 C;  5F5H A;  4CJG A;  1A7V A;  2HZ8 A;  2YHS A;  3NKD A;  4XEV A;  3VAY A;  4YT2 A;  1FTS A;  3POV A;  4F4B A;  3MX3 A;  4JJG A;  1JMW A;  1NBB A;  3HNJ A;  4BJ6 A;  3SZR A;  3R7C A;  1WTY A;  3HNI A;  3US6 A;  3DKA A;  5JRA A;  1RJ9 B;  4WGZ A;  4EBK A;  4MW3 A;  1LE2 A;  1ZHT A;  4EWC A;  1RJ9 A;  2Y3G A;  3HTK C;  4HFF B;  2DGJ A;  4EHP A;  1LVK A;  4JCH A;  1K04 A;  5TJ5 E;  3K66 A;  2HMZ A;  1OR2 A;  3ABM C;  5A6B D;  1MMN A;  2J46 A;  3ZQV A;  4DVZ A;  2XLO A;  1BR4 A;  2Y69 C;  3B29 A;  3HLZ A;  4CS7 A;  3EGX B;  1KTM A;  2MWQ A;  2O9X A;  3M15 A;  3Q7G A;  2XS8 A;  2XM0 A;  1RXQ A;  2ZXP A;  3EGX A;  3LEO A;  1M56 C;  3NG1 A;  2R05 A;  3DE8 A;  5EHH A;  2G3V A;  3DAF A;  4IWB A;  2XS1 A;  1YAU O;  2AP3 A;  2Z15 A;  1G4W R;  3CZ6 A;  3CQZ A;  3GWN A;  5E2Q A;  4E7S A;  4XTK A;  2A6E F;  3S9O A;  4BJ1 A;  4LDK A;  1E83 A;  2ETS A;  2EPN A;  3DE9 A;  4YN0 B;  4LDR A;  3U3F A;  3TQO A;  1OKK A;  2KYH A;  3LLK A;  2A6H F;  3L8J A;  2IBF A;  3KPH A;  1IZM A;  1IW7 F;  4PJM A;  4P6I C;  5DS6 A;  3BRJ A;  1QLE C;  4N4W A;  4FX5 A;  1RKC A;  1FMV A;  1V55 C;  2J8W A;  3FVY A;  4PJL A;  5L0I A;  1ZU5 A;  3TUL A;  1ORY A;  1ZVZ A;  2EIJ C;  3FHD A;  1WAT A;  4MVQ A;  4RDA A;  3ZTZ A;  4BG0 A;  1LE4 A;  2WB7 A;  1RMV A;  1OW8 A;  4WJ0 A;  4CJO A;  3U0C A;  3DM9 B;  3EFO B;  3RQG A;  256B A;  3AGT A;  4JUR I;  1R4T A;  2HSQ A;  2HSB A;  3GWL A;  1KU2 A;  3EFO A;  1ZW2 A;  3GEE A;  1NZE A;  3PCV A;  2KK1 A;  3GM3 A;  2M64 A;  2HS5 A;  3C62 A;  1Z6A A;  3GOD A;  3WOD F;  3DZA A;  3GEI A;  1A41 A;  3ATP A;  4DBR A;  1H7I A;  3UGO A;  2J7P D;  2YVK A;  3AG3 C;  4G7O F;  1HW2 A;  3ECS A;  2CNW D;  4YT4 A;  2JD3 A;  4Q5S F;  4GYT A;  1YZC A;  2HFI A;  5COM A;  2L81 A;  3EJN A;  4LLC A;  1TWH A;  1TKN A;  2WVQ A;  2LQG A;  4P9T A;  5COG A;  4DRI B;  4OIQ F;  3ABL C;  4U5D E;  2EIN C;  3JTL O;  3IQC A;  1W2W A;  4C7O B;  3JYH A;  1ZW3 A;  1U89 A;  3C7J A;  2D5R B;  3I5P A;  3SNH A;  1YAR O;  2ZXO A;  2PF4 E;  4CS9 A;  4KI2 A;  4LDQ A;  3L8I A;  5BQI A;  3ZVR A;  4AE4 B;  3C63 A;  3NMK A;  4XLN F;  3UMH A;  5DLJ A;  4OIR F;  2FFH A;  2Y3B A;  4YL1 A;  4AE4 A;  3R2P A;  2QY9 A;  1MND A;  2KC3 A;  4XQ1 A;  1Y4C A;  3LLI A;  1LM3 B;  1RKE B;  3V5Y A;  3JZ0 A;  2GFH A;  5F28 E;  1YVI A;  2L6F A;  3JRM O;  2R7R A;  3RIP A;  3LAY A;  4CBE A;  2CCY A;  2XRH A;  4BJT A;  1T6Q A;  1ZHY A;  4EBB A;  3TD7 A;  3KH2 A;  5B3S C;  2IYL D;  2IOQ A;  5L0D A;  2XLW A;  4NTA A;  1J8M F;  4JJF A;  2HV7 A;  4YL3 A;  1D1B A;  4EIY A;  2RD9 A;  3IPM O;  3T6J A;  3ZSU A;  3JSE O;  1CPR A;  3TK0 A;  4C3B A;  5L3V A;  1A7E A;  1I4Y A;  4YK5 A;  1WN0 A;  1Z23 A;  1AUE A;  2M4E A;  2VCA A;  4I1O B;  4JEA A;  5T1D B;  1YA7 O;  1C17 M;  2KW3 C;  1C03 A;  1K40 A;  3A9C A;  4KC9 A;  4XEK A;  5K0I A;  1ZHX A;  1VMA A;  1DOW A;  3VYW A;  1H9T A;  2LFF A;  2J45 A;  4RD9 A;  1YA9 A;  2V26 A;  4IAR A;  4G7Z F;  2KSF A;  3RQF A;  2G3K A;  3EHN A;  3ZDL A;  2J9W A;  2NUT B;  1KNY A;  2WVN A;  5JS5 A;  5JUA A;  4G0H A;  4U5C E;  1TWC A;  3DJN B;  4N6H A;  4U9E A;  3MYI A;  4X0R A;  1LPE A;  1VB5 A;  2FGY A;  2LCH A;  1XZP A;  2XLV A;  4DOZ A;  1A7D A;  2QE9 A;  3HKK A;  3IQ5 A;  2R7O A;  2PNO A;  1HY5 A;  2ZD9 A;  2EPK X;  4XPW A;  1XWJ A;  4NTF A;  1QPU A;  4N6C A;  3SEO A;  2R7S A;  2CDQ A;  3FDQ A;  3RQE A;  2LK4 A;  1D1C A;  3MLG A;  2LIG A;  1Q0F A;  3VM6 A;  1B68 A;  3QVY A;  2KGO A;  1EA8 A;  4IJJ A;  5A6J A;  4OIO F;  1LI7 A;  3RKO F;  3RYL A;  2L9J A;  2BC5 A;  1QZX A;  3QVZ A;  4U5E E;  1G8X A;  1WWP A;  5D91 A;  3JYY A;  2R7V A;  3S90 A;  3DJU B;  2Q00 A;  4FAP B;  1YLM A;  4NQF A;  3RFY A;  2R7X A;  1GQA A;  2NUP B;  2KJG A;  1JOG A;  1FMW A;  1S7Z A;  4JTC B;  4MVU A;  3O10 A;  4DJ9 A;  1PV3 A;  3G50 A;  3KMI A;  2YQY A;  2NUP A;  4EBJ A;  4G78 A;  3TJ6 A;  1VTM P;  1JPN A;  4EKW A;  1QVX A;  2H7B A;  4MTF A;  3ZIB A;  2DI3 A;  5E33 A;  4E7Z A;  4H4K C;  2IM8 A;  3C8Z A;  3I4U A;  2ZPA A;  1TWA A;  3GAN A;  4OIN F;  1J8Y F;  1D0X A;  3NMJ A;  1DOV A;  2IXM A;  1GGQ A;  2OEX A;  3O6X A;  1ZZP A;  4U5B E;  2D4U A;  4YWQ A;  1Z5Z A;  3NDB B;  5B3I A;  1FNT c;  4MQ9 F;  4JTA B;  3DWW A;  5DVW A;  1D0Y A;  4CDV A;  3W2V A;  2Q9A A;  5KYY B;  2A0B A;  2WZL A;  4FES A;  1ST6 A;  3LUT B;  3V5Z A;  3J06 A;  3K6B A;  2R9R B;  4JKV A;  4PJN A;  2P6V A;  5KYY A;  2A69 F;  1O5H A;  4K7B A;  4M63 A;  4W8P A;  3S28 A;  1E85 A;  4IAO A;  3SXK A;  2EIL C;  3X1O A;  1HMO A;  1OXB A;  1V54 C;  5BQG A;  2TMV P;  3IQT A;  3NYJ A;  1VK5 A;  2OKU A;  3H65 A;  4JW1 A;  1UFB A;  3LS1 A;  3LNR A;  5D92 A;  4BJ6 C;  2OCC C;  4E0I A;  3E9V A;  3ZC4 A;  4R32 A;  1CGO A;  3W4Y A;  3EZI A;  3SYN A;  4GQH A;  3C8G D;  3HNK A;  5COF A;  2YL0 A;  2HJ3 A;  3CEX A;  3OWT A;  3B0U X;  1SF8 A;  4G7H F;  4RBN A;  1BZ4 A;  1WGW A;  1JPJ A;  1K05 A;  5BQH A;  2AU5 A;  3AG1 C;  1T01 A;  2WVO A;  3A11 A;  3RH3 A;  1YZA A;  5A6A A;  5KYU B;  3DM5 A;  3HNL A;  4W8K A;  1EI7 A;  2LFD A;  2KQ9 A;  3AG4 C;  1H6G A;  4Q7C A;  3V7O A;  4YJW A;  3LS0 A;  4JZA A;  2PP4 A;  4JC7 A;  2QNL A;  4J32 B;  3TOL A;  1MMG A;  2HJM A;  2R7T A;  3AOU A;  1JAF A;  2J0X A;  4CS8 A;  4ULV A;  3N0T A;  1Z3I X;  3OEO A;  4MW8 A;  5JVE A;  5GPG B;  3PHF 2;  4U9D A;  3KYJ A;  2FAP B;  3NKE A;  4LAC B;  1NSG B;  2J9U A;  1ZHZ A;  2R02 A;  4XPY A;  2OQM A;  3W8I A;  5HV9 A;  5L0J A;  4JCZ A;  4QI2 A;  2EPO A;  3IHU A;  2GA0 A;  3S29 A;  3U2M A;  2I15 A;  4U5H A;  3PMR A;  4AK9 A;  1QKR A;  3GM2 A;  1AVO B;  2IXN A;  1GS9 A;  2Y39 A;  1HW1 A;  3F47 A;  2WZF A;  1VLS A;  1JRA A;  4OD4 A;  4YT5 A;  4C7O A;  4ONS A;  4DVY P;  2CW0 F;  1MQV A;  2EPL X;  3Q6N A;  4JTD B;  3JRT A;  2YEV A;  1Y6D A;  2EPM X;  3QTH A;  2PX0 A;  3DXJ F;  3EH1 A;  3LEV A;  3QMK A;  4K0D A;  3TJ5 A;  2ICW G;  4UDV A;  3S0X A;  2MYS A;  2V3C C;  2AVK A;  2RSE B;  1RKE A;  4I44 A;  4YL0 A;  2J7P A;  2HUJ A;  3EZH A;  1PD1 A;  2CNW A;  2E87 A;  1C02 A;  2P1A A;  5F5F A;  1D0Z A;  4NC3 A;  1NFO A;  4MVR A;  2PFD A;  3MBG A;  3B71 A;  3PDM P;  2R25 A;  1R5I D;  3DD7 A;  3QW1 A;  5KYW B;  1YYX A;  4NTB A;  1BBH A;  2BL2 A;  3ZQY A;  2W9Y A;  1O87 A;  4DXW A;  3IQ6 A;  2R03 A;  5DS4 A;  2ZXR A;  2H8A A;  1VYI A;  1A0B A;  3AGU A;  1G5Z A;  2CYD A;  3UMK A;  2NSG A;  3U5S A;  4WAB A;  1SR2 A;  4ZLC A;  1T5O A;  4OD5 A;  2H7V C;  1OCO C;  2BE5 F;  4U5G A;  2L7A A;  3DMD A;  4CX9 A;  3OA1 A;  2YLI A;  1ZU4 A;  4JVS A;  3NYL A;  2YZS A;  2NPU A;  4D4N A;  4DBQ A;  3EGD B;  1YYJ A;  2NG1 A;  2NUT A;  2R7Q A;  4OIP F;  4CSA A;  2C03 A;  3B0V C;  3KL4 A;  3K1H A;  2OJQ A;  4HEA J;  5EGY A;  1MMA A;  4CS9 C;  2J0W A;  2H7O A;  1BR2 A;  5L0G A;  4O79 A;  5KYN A;  2OU6 A;  1TQG A;  2I8B A;  4KNW A;  1Q0M A;  3AG2 C;  1N1C A;  2NSF A;  2DB4 A;  2YWA A;  3H2V A;  4P9F A;  2XLM A;  2YRF A;  4ER9 A;  4PFO A;  1S05 A;  2J9V A;  1VLT A;  4U5F E;  1AEP A;  3M4B A;  1YDI A;  3SXY A;  1Q0K A;  1E84 A;  2XM4 A;  1FAP B;  3H2U A;  3JCU Q;  3UGP A;  4XWJ A;  3ZTM A;  3B0P A;  1L7C A;  3S84 A;  3M1C B;  1HMD A;  4DRH B;  2A0U A;  2PBE A;  3KYI A;  1TFK B;  1APC A;  2X0C A;  3GOR A;  5BUO A;  1CGM E;  4IRU A;  3U8V A;  4CIP A;  3EHM A;  3K1I A;  3UR3 C;  1BR1 A;  2Y3H A;  3FAJ A;  3NMI A;  4HFK B;  3V5X A;  3W8H A;  2XXA B;  1WAS A;  2J9B A;  2L6H A;  2XXA A;  1NU9 C;  3F46 A;  4MVO A;  4JE9 A;  1T9K A;  1LKX A;  4MTG A;  1FFT C;  4O7G A;  5T3W A;  4ZLD A;  4LLE A;  5L0C A;  2VC9 A;  4J7Y A;  4Z9I A;  1U0B B;  2C04 A;  2VH3 A;  3K33 A;  4BJ5 A;  4MVM A;  1T6I A;  3SP1 A;  2W4M A;  3L34 A;  3SXM A;  1OCR C;  1I4Z A;  2A1D D;  2P0N A;  2CGE A;  1VOM A;  2B0H A;  4AX2 A;  5A69 A;  2PX3 A;  2YL7 A;  4CSA C;  2HV6 A;  1OKK D;  3DI5 A;  3GEH A;  2JPU A;  4AL0 A;  3Q7L A;  1FR0 A;  4ANJ A;  3Q6M A;  1OW6 A;  1L3P A;  1NLX A;  3AQB A;  4WGY A;  2VCC A;  2EIK C;  1FFH A;  4I1M A;  4NCQ A;  2YL1 A;  2IXO A;  2Y3D A;  3RF3 A;  1LIH A;  4AL1 A;  5CI8 A;  4BPM A;  2LSE A;  2VB6 A;  2OEV A;  4QDL A;  5FCL A;  2QLA A;  4MVZ A;  3O55 A;  2LD6 A;  4LER A;  3JSZ A;  2GAQ A;  2UUI A;  1OQC A;  2OG2 A;  2YLD A;  3FMS A;  1BDJ B;  2IXP A;  3T4R A;  3QW0 A;  1OW7 A;  4IAQ A;  5CIV A;  4A2N B;  2Q9C A;  3CAX A;  2DYR C;  3I5Q A;  5DQZ A;  1NFN A;  4GEH A;  1XZQ A;  3CSK A;  3K1I C;  1V4A A;  4JIO A;  3VF0 A;  1LS1 A;  1OXK A;  3U9J A;  3LJB A;  1TWG A;  2AWY A;  5DQT A;  2AWC A;  3L1M A;  4I3M A;  2F22 A;  2EIM C;  5B1B C;  1O3U A;  3NYM A;  3W2W A;  1UG7 A;  3LNM B;  1SZI A;  5KYU A;  2DYS C;  2XL6 A;  4XEF A;  4CDA A;  4MTO A;  3UMI A;  3KKB A;  1ORJ A;  3N2Z B;  3UNG C;  1MMD A;  2XL8 A;  5JT4 A;  4BJ5 C;  1YJG A;  2X51 A;  3ITF A;  3LES A;  5DS5 A;  5A6K A;  1HE9 A;  4DRJ B;  3EH2 A;  4JRZ A;  2VCB A;  3T6B A;  2XLH A;  4J7T A;  3RVZ A;  4PK4 A;  1H9G A;  2Q7R A;  1Z63 A;  2W45 A;  4MS2 A;  3C8G B;  3QZC A;  1OR3 A;  2GWW A;  1VYK A;  2QUP A;  4MVS A;  3NRH A;  5HSW A;  3U8P A;  3C8G A;  1LS4 A;  3X2Q C;  1RCP A;  2MHR A;  4KNV A;  3U9M A;  4O6N A;  2GDC A;  2JX0 A;  3T6G B;  1ORS C;  3N24 A;  4L6R A;  1TR2 A;  2XL4 A;  5JP7 A;  2WL8 A;  3S27 A;  3ZWI A;  1QQ3 A;  3BEH A;  3AJM A;  4Z9H A;  4BEM J;  5JLI A;  1Q0G A;  1QSP A;  3G4Z A;  1EQ1 A;  1JR8 A;  1OCZ C;  4Z9J A;  4E17 A;  4C3E A;  3FAP B;  4PAC A;  3WAQ A;  3FXH A;  4NY3 A;  4B6I A;  3M4C A;  2HKV A;  2VAS A;  4J30 B;  1M57 C;  3AQC A;  3HJC A;  4C3D A;  2Q4F A;  2R7U A;  3C18 A;  4O6Y A;  3MYF A;  1M2O A;  3EQL F;  1F1M A;  2G62 A;  3FOP A;  4ULW A;  3EPV A;  2R7W A;  3SXZ A;  3ASO C;  1PD0 A;  4O6M A;  4E0H A;  3ZG1 A;  4H54 A;  2ASR A;  4K1O A;  5AC4 A;  4MND A;  3T9O A;  1E86 A;  1NU7 D;  3L0I A;  3IEE A;  2Q9B A;  3ASN C;  4IGG A;  5EK0 A;  2P61 A;  3RW0 A;  2LP4 A;  1Q0D A;  3WHN A;  5AGF A;  4CS8 C;  5KYW A;  4KBL A;  2UUH A;  1Z7Q c;  1U6H A;  4N06 A;  5A6B A;  5E3A A;  2XLD A;  4CIH A;  3K7D A;  5E3C A;  5B1A C;  2XSE A;  1CPQ A;  1OCC C;  1SYQ A;  2Q3T A;  5KYX B;  2HMQ A;  1HE1 A;  2P7V A;  2QTV A;  3MFN A;  1M2V B;  5KYX A;  1I5N A;  1WOL A;  4FWV A;  1ZHW A;  2A68 F;  3DAG A;  2KNH A;  4HE8 D;  1M2V A;  3GM1 A;  3U2L A;  1LI5 A;  3EG9 B;  3EGD A;  3G4X A;  5CI9 A;  4PFP A;  1PCX A;  3JT1 A; 
#chains in the Genus database with same CATH homology
 5L0C A;  1ZVZ A;  2GWW A;  1XWJ A;  4E18 A;  1DOV A;  4K1O A;  3H2V A;  1QKR A;  1ZW3 A;  1U89 A;  5L0F A;  4IGG A;  1YDI A;  2GDC A;  3T6G B;  1T01 A;  3VF0 A;  2HSQ A;  1TR2 A;  2B0H A;  3H2U A;  1DOW A;  1L7C A;  4ONS A;  1ZW2 A;  1U6H A;  5FZT A;  4E17 A;  1ST6 A;  1H6G A;  3ZDL A;  3S90 A;  4PR9 A;  2X0C A;  1SYQ A;  2L7A A;  3TJ5 A;  4EHP A;  1RKE B;  4W8P A;  4DJ9 A;  2IBF A;  3RF3 A;  3MYI A;  3TJ6 A;  1RKE A;  1RKC A;  5L0I A;  4P9T A;  5L0D A;  5L0H A;  2LQG A;  5L0J A;  5L0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...