1NSGB

The structure of the immunophilin-immunosuppressant fkbp12-rapamycin complex interacting with human frap
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
94
structure length
94
Chain Sequence
VAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Complex (isomerase/kinase)
molecule keywords FK506-BINDING PROTEIN
publication title Refined structure of the FKBP12-rapamycin-FRB ternary complex at 2.2 A resolution.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 94
sequence length 94
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 1997-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) FKBP12-rapamycin binding domain 1nsgB00
1AUEA 1FAPB 5GPGB 2RSEB 2GAQA 4DRJB 2NPUA 2FAPB 3FAPB 4DRHB 4DRIB 1NSGB 4FAPB
chains in the Genus database with same CATH superfamily
2G3KA 5L0CA 4ZLDA 5E3AA 1WATA 2P1AA 3L8JA 3GORA 1MNDA 4DRJB 4HE8D 3A9CA 1V74B 3CZ6A 3DJUB 2H8AA 3FMSA 3Q6NA 4XWJA 2X0CA 3SNHA 4E18A 1QPUA 1YYXA 1JRAA 3KMIA 2R9RB 3NYLA 4JTAB 2XLHA 3ZTMA 5DQZA 2XRHA 2NG1A 3HKKA 2XM4A 2R7OA 4G7HF 4CDAA 1H9GA 3ABKC 4JIOA 4MVMA 2YZSA 1Z3IX 2A68F 4MTFA 1TFKB 3C8ZA 3FOOA 3FXHA 3LJBA 2A0UA 2EPMX 2L6HA 1VYKA 4BG0A 2YLIA 1KU2A 2YWAA 3Q7LA 3LEVA 3EH1A 4C3BA 2HMZA 4N4WA 1E84A 3AJMA 1K05A 3G50A 1MMDA 1YYJA 1QKRA 1LS4A 2WZFA 2LK4A 4PFOA 3ZWIA 5KYYB 1ZVZA 1VYIA 3JT1A 2OJED 3PMRA 3K1HA 4YT8A 1ZHZA 1RXQA 3UNGC 3L1MA 4YK5A 1M2VB 1ZYRF 3ZQVA 3JRMO 1YLMA 3SZRA 1G4US 3NKDA 4U9EA 1YJGA 1JMWA 3PDMP 3C8GA 4XEKA 5D91A 2W45A 4Z9HA 3UR3C 3NDBB 3ZVRA 1Q0DA 3B9QA 5JT4A 3U9JA 1TWAA 2GDCA 1OR3A 2CNWA 4DRHB 4E17A 2X51A 4D4XA 2R7VA 3JTLO 1NFOA 4BJ6C 2Y3BA 2VC9A 5AC4A 3N24A 2WVNA 1Y4CA 4MTGA 2W4MA 1T6QA 4XPYA 3FDQA 2YLGA 4F4BA 2CCYA 3CSKA 3SEOA 3O6XA 4EWCA 2H7BA 4YT2A 3EJNA 1Z23A 3LNRA 4DRIB 5A6JA 4JE9A 1SR2A 3L34A 1C03A 2PBEA 1KTMA 1JPNA 3SXMA 3NMIA 4LACB 5KYWA 3HLZA 3NRHA 4OIQF 3QVYA 3EGXA 3GM2A 3MBGA 3LUTB 4HEAJ 3IQTA 1A7DA 4EBKA 4LDRA 1J8MF 1H7IA 3DM5A 1N1CA 2A6HF 1VLTA 1L3PA 4BJ1A 4CDVA 2R7UA 1EKYA 5BQIA 5DS5A 2XM0A 2ZXRA 2A69F 3JCUQ 4I1MA 2AWCA 3S90A 2OG2A 3V5ZA 3L0IA 3IPMO 1O5HA 5HSWA 2D5RB 2ASRA 2P0NA 4C7OB 5EHHA 2P61A 1LI7A 2VB6A 2PF4E 2J0WA 3C63A 3W8HA 4E0HA 4CSAC 4WJ0A 3IQCA 2YVKA 3UMIA 1EI7A 4EHPA 3VM6A 4AX2A 3H2UA 4JCZA 1KNYA 2TMVP 4KBLA 2GFHA 1APCA 1M57C 2NPUA 3N2ZB 2EPNA 2DI3A 3M4BA 3A11A 4QI0A 4YL0A 3ECSA 3EG9A 4XLNF 3UMKA 3ZG1A 2WL8A 4C3DA 3U9MA 2MWQA 1VB5A 2KW3C 1CGME 3QW1A 1D0XA 2R25A 2XLEA 1YZCA 1WWPA 5FZTA 1ZHYA 3NKEA 5BUOA 2AU5A 1AUEA 2AWYA 1HW2A 5COFA 1O3UA 1SMYF 3GEHA 3LS0A 4IARA 1ZU4A 4K1OA 4JZAA 5TJ5E 3LAYA 2ZXPA 2J7PA 4KNWA 4X0RA 4O6YA 4YN0B 3WG7C 4CS7A 3QVZA 5F28E 2D4UA 3IQ5A 5HV9A 2EIMC 2ZPAA 4OIRF 2NUPB 2PX3A 1D0YA 1WTYA 4H4KC 2ZXWC 1RKEA 4GYTA 3B0VC 5E3CA 1Q0KA 1FNTc 4MW8A 1NBBA 1E83A 3FHDA 1FTSA 3GM3A 1U89A 4U5EE 5DS4A 3FVYA 4WABA 4OD5A 1LE2A 4M63A 2EIJC 3TJ6A 1CGOA 3AQCA 3JSEO 2R7SA 2WZLA 2V26A 3DMDA 4G0HA 5JRAA 4YJWA 2O9XA 5KYNA 1HE1A 3B0UX 2DGJA 3M1CB 4DXWA 2DB4A 3RH3A 1DOVA 3QZCA 1OXBA 1E2XA 1WASA 2HJ3A 3SYNA 2R7XA 2BE5F 3JZ0A 5L0FA 3GWNA 3KYIA 2F22A 1M2OA 3AOUA 4R32A 4XEVA 4EBJA 2HUJA 2HZ8A 1K40A 2HSBA 3EH2A 4N6CA 3JYYA 5T3WA 3TQOA 1U6HA 4JEAA 4U5FE 1NLXA 2M4EA 2VASA 1JPJA 1ORJA 3LNMB 3O55A 4PJMA 5DLJA 1T6IA 2YL0A 3EZIA 3CAXA 4FESA 1MMAA 2HV6A 2Q9CA 3FAJA 4IB4A 5A6AA 1VK5A 2R7QA 3VYWA 4RD9A 3T4RA 3T6BA 3F46A 256BA 1LIHA 2L7AA 1TFOB 1VTMP 2YL1A 1WN0A 4U5HA 3MLGA 3EHMA 2KJGA 1RJ9A 3C18A 1QQ3A 3E70C 5CI9A 3V7OA 5B3IA 1HY5A 1LI5A 4B6IA 3UGPA 5JUAA 4G7OF 2CW0F 3Q6MA 3U8PA 1RCPA 3V5XA 4U5GA 4OIOF 2P6VA 1H6GA 1ST6A 3EHNA 3U0CA 3DD7A 5L0DA 4AL0A 3RW0A 3OWTA 2VCCA 4IAQA 1DOWA 3RKOF 4ANJA 3T6JA 5KYXA 3RQGA 5L0GA 1Q0GA 2C03A 3JSZA 2UUHA 3RVZA 1E86A 3M79A 2FAPB 3N0TA 4W8KA 3W2WA 4PACA 5B1AC 4J7YA 3IHUA 4CJGA 4QI2A 1M56C 2QY9A 4O79A 3EFOA 1TWCA 3W4YA 2WVQA 4LLCA 4YT5A 3KYJA 1GQAA 1MQVA 3AG4C 4J32B 2L6FA 1ZZPA 3HJCA 2KQ9A 4PJLA 3U3BA 1YA7O 3JYHA 4CJOA 2J7PD 3U2MA 1A41A 2JPUA 4ONSA 3HNIA 4HFFB 1GS9A 4CBEA 5EGYA 2XXAA 4AE4A 3TOLA 3C62A 1F1MA 2IBFA 2ETSA 2YQYA 2HV7A 1I4ZA 4YL1A 1GGQA 3DKAA 3RQFA 3QTHA 3CQZA 3SP1A 2HSQA 2R02A 1CPRA 4JJGA 1QLEC 4LDKA 2YL3A 1QZXA 2KNHA 4XQ1A 2IM8A 1LE4A 1W2WA 2XL4A 2EINC 2H7VC 1OW7A 1ORSC 3LEOA 1FR0A 3K33A 2QUPA 3GEIA 2C04A 2VH3A 2PNOA 3K1IA 3V5YA 4JEBA 1NSGB 2PP4A 1V54C 3DE8A 4DVZA 2ZXOA 2A1DD 1BDJB 4GEHA 4MNDA 4Q7CA 4FWVA 5DVWA 3AG1C 3KH2A 2IXOA 3K6BA 2IXNA 3K7DA 5BQHA 1LS1A 1NZEA 4OINF 5A6KA 4JTDB 4I1OB 5IY5C 3POVA 3ZDLA 1Z6AA 4ULVA 3PHF2 4Q4ZF 2KC3A 2XLWA 5KYUA 1V55C 1OKKA 1LKXA 3HNKA 4UDVA 3C8GB 5K0IA 3QMKA 5JS5A 1T5OA 5EK0A 3KPHA 3F47A 3OA1A 2Q00A 4OD4A 4WGZA 1HW1A 1YARO 4HFKB 3ATPA 2GAQA 2J45A 1TWGA 1I5NA 4KI2A 2LIGA 4KC9A 2GA0A 2NUTB 2G62A 3DE9A 3X2QC 1SYQA 4AK9A 2J9BA 3K66A 1MMNA 1ZHTA 2PFDA 4NQFA 4P9TA 5JSLA 3EGDA 2HFIA 3NYJA 4NCQA 4MVOA 3U5SA 3B0PA 3VRCA 4QDLA 2PX0A 4BJTA 4CX9A 3MFNA 1A7EA 1JR8A 4U5BE 3C8GD 3RF3A 1FAPB 1G4WR 2Y3DA 3KL4A 1OQCA 1OW6A 1PD0A 1V4AA 2RSEB 3SXZA 1K04A 3H65A 2CNWD 3EGXB 2EIKC 1HMDA 3H2VA 3AG3C 1BR2A 2LD6A 2R7TA 2OEXA 4DBQA 5D92A 3QW0A 3W8IA 4A4AA 4ER9A 4IRUA 1FMWA 3BRJA 1UG7A 4W8PA 1MNEA 3GEEA 3L8IA 3ZQYA 3ASOC 4BJ5A 2QE9A 1NG1A 3DI5A 2H7OA 2IOQA 2RD9A 4KNVA 4K0DA 4CS9A 5A6BA 3LLIA 3X1OA 5JLIA 4N06A 1ZU5A 2W4BA 4G7ZF 1AVOB 3DZAA 1AEPA 3WHNA 5L0IA 3W2VA 1S7ZA 4CIHA 2QTVA 4PR9A 4O6NA 2YRFA 2XL8A 4NTAA 3U2LA 3LESA 2JD3A 4IJJA 1CPQA 3RQEA 3WAQA 4BJ5C 1RMVA 5KYYA 4JVSA 4NY3A 2Y69C 3TULA 2CDQA 2Q9AA 1EQ1A 4CS9C 3O10A 2B0JA 1YDIA 4J7TA 1M2VA 5CIVA 3EG9B 3I5QA 2OQMA 4IAOA 4PJNA 1OCCC 2KYHA 4RBNA 2A6EF 3FOPA 4MS2A 5JP7A 4C3EA 3ABLC 2EILC 2J46A 3C7JA 2XLOA 2YKZA 2Z15A 4D4NA 2NSGA 1BBHA 3DXJF 1YAUO 1ZW2A 3G4XA 1A0BA 4JTCB 3DWWA 2Y3GA 1OKKD 3B29A 1ZHXA 5E33A 1XZPA 4LLEA 2LCHA 2YL7A 2XS1A 4NTBA 2HS5A 4CDYA 3KKBA 3R7CA 2OEVA 2P7VA 4XTKA 2OJQA 4FX5A 4XEFA 3I4UA 2WVOA 1RKEB 4MVRA 1IZMA 4BEMJ 5B3SC 3BEHA 1M6TA 5COMA 3J06A 2B0HA 4MVUA 2XS8A 3DAGA 3NYMA 2LP4A 4N6HA 3TJ5A 4CIPA 5CI8A 1LM3B 3RIPA 2I8BA 1T6UA 2J0XA 2VCAA 1YA9A 4BPMA 1L7CA 1CGNA 2OOCA 2R03A 3MYFA 5T1DB 3MX3A 2EPLX 2HJMA 5F5FA 1BZ4A 1RKCA 3CEXA 4JRZA 4XLPF 2A0BA 4NTFA 1TQGA 3PCVA 4DOZA 2HMQA 2XLMA 3O39A 4EKWA 2L9JA 1H9TA 4JJFA 3TD7A 4ULWA 1ORYA 2FFHA 4NC3A 1YZAA 1ZHWA 3EPVA 3IQ6A 5T3TA 4A2NB 4Q5SF 1TWHA 2NSFA 2JX0A 1GM5A 2J8WA 2OKUA 4DVYP 4IWBA 3MYIA 3T9OA 4BJ6A 4MVSA 2OCCC 1T01A 4C7OA 1JOGA 4MTOA 2ICWG 1D0ZA 1D1BA 2LFFA 1IW7F 3US6A 3G4ZA 1XWJA 2MHRA 5F5HA 1SF8A 3HTKC 1WGWA 4LDQA 3S28A 4DBRA 2KK1A 1PD1A 5A6BD 5FCLA 5BQGA 2M64A 2L6GA 1LPEA 1E85A 2EPOA 1RJ9B 2Q9BA 1BR1A 1HMOA 4P9FA 4K7BA 4AL1A 3I5PA 2Y39A 2Q7RA 3S84A 3S29A 1SZIA 1QVXA 2I15A 4WGYA 4Z9IA 2NUTA 4DJ9A 4PK4A 3ASNC 3OEOA 4MVQA 5KYXB 4ZLCA 3SXYA 1A7VA 3VAYA 4JURI 3GODA 3M15A 2ZD9A 2YHSA 3LLKA 3K1IC 1EA8A 3IEEA 3ZIBA 2IYLD 1FFHA 2Q3TA 2LQGA 1NU7D 2E87A 1D1CA 3EFOB 4Z9JA 3S9OA 1LVKA 1D1AA 2L81A 5AC5A 2IXMA 2LFDA 4JW1A 4BEJA 1FFTC 2NUPA 2XLDA 1OCRC 4EBBA 1Y6DA 2J9VA 3HNLA 2AVKA 2HKVA 3GM1A 4CSAA 1WOLA 4L6RA 4E7SA 3ZSUA 2YEVA 4I3MA 4JKVA 1U0BB 2J9WA 4MW3A 2G3VA 2VCBA 3TOMA 2XXAB 2EPKX 1FMVA 2FGYA 4AE4B 1PCXA 1R5ID 3UGOA 4PFPA 4J30B 5B1BC 4E0IA 1C17M 3ZC4A 1OCOC 4GQHA 3SXKA 1I4YA 1OW8A 1NFNA 2Y3HA 2YLDA 2QLAA 3S27A 1UFBA 3GANA 2CYDA 4RDAA 3AGUA 3LS1A 2AP3A 2DYRC 2R05A 3B71A 3WODF 5L3QA 2KGOA 1PV3A 4XPWA 2UUIA 4H54A 1B68A 1YVIA 2BL2A 3JRTA 3ITFA 5COGA 5GPGB 3UMHA 5DQTA 1Q0FA 1R4TA 3R2PA 3NMKA 1G5ZA 3DM9B 4XPXA 4YT4A 1S05A 1T9KA 2Q4FA 4CS8A 3S0XA 4P6IC 3E9VA 1XZQA 4YL3A 5L0JA 3EZHA 4I44A 3RYLA 3AQBA 2GWWA 1OR2A 1BR4A 3RFYA 1VLSA 4U5CE 3T6GB 4MVZA 2WZGA 2IXPA 5KYUB 4LERA 5DS6A 3Q7GA 5A69A 1TR2A 1JAFA 2R7WA 1Z63A 2W9YA 3HNJA 4CS8C 3ABMC 2BC5A 3AG2C 1TKNA 3GWLA 1O87A 1Z5ZA 2OU6A 1J8YF 3TK0A 1OCZC 3DAFA 5JVEA 4JC7A 4G78A 1OXKA 5E2QA 2V3CC 2WB7A 1Q0MA 3DJNB 2QNLA 3RVYA 1HE9A 2XL6A 4U9DA 2KSFA 4EIYA 4EUKB 5L0HA 3FAPB 4MQ9F 3NMJA 4IGGA 4PJJA 4E7ZA 4JCHA 5AGFA 1NU9C 2CGEA 2J9UA 2XSEA 2XLVA 3AGTA 3EQLF 4OIPF 2MYSA 5L3VA 5KYWB 3EGDB 2R7RA 3U8VA 4YWQA 1C02A 4O6MA 4FAPB 1G8XA 4U5DE 1MMGA 1ZW3A 2DYSC 1QSPA 1Z7Qc 2LSEA 3U3FA 3ZTZA 4O7GA 3M4CA 3NG1A 1VOMA 1VMAA 3VF0A
chains in the Genus database with same CATH topology
1AUEA 1FAPB 5GPGB 2RSEB 2GAQA 4DRJB 2NPUA 2FAPB 3FAPB 4DRHB 4DRIB 1NSGB 4FAPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AUE A;  1FAP B;  5GPG B;  2RSE B;  2GAQ A;  4DRJ B;  2NPU A;  2FAP B;  3FAP B;  4DRH B;  4DRI B;  1NSG B;  4FAP B; 
#chains in the Genus database with same CATH topology
 2G3K A;  5L0C A;  4ZLD A;  5E3A A;  1WAT A;  2P1A A;  3L8J A;  3GOR A;  1MND A;  4DRJ B;  4HE8 D;  3A9C A;  1V74 B;  3CZ6 A;  3DJU B;  2H8A A;  3FMS A;  3Q6N A;  4XWJ A;  2X0C A;  3SNH A;  4E18 A;  1QPU A;  1YYX A;  1JRA A;  3KMI A;  2R9R B;  3NYL A;  4JTA B;  2XLH A;  3ZTM A;  5DQZ A;  2XRH A;  2NG1 A;  3HKK A;  2XM4 A;  2R7O A;  4G7H F;  4CDA A;  1H9G A;  3ABK C;  4JIO A;  4MVM A;  2YZS A;  1Z3I X;  2A68 F;  4MTF A;  1TFK B;  3C8Z A;  3FOO A;  3FXH A;  3LJB A;  2A0U A;  2EPM X;  2L6H A;  1VYK A;  4BG0 A;  2YLI A;  1KU2 A;  2YWA A;  3Q7L A;  3LEV A;  3EH1 A;  4C3B A;  2HMZ A;  4N4W A;  1E84 A;  3AJM A;  1K05 A;  3G50 A;  1MMD A;  1YYJ A;  1QKR A;  1LS4 A;  2WZF A;  2LK4 A;  4PFO A;  3ZWI A;  5KYY B;  1ZVZ A;  1VYI A;  3JT1 A;  2OJE D;  3PMR A;  3K1H A;  4YT8 A;  1ZHZ A;  1RXQ A;  3UNG C;  3L1M A;  4YK5 A;  1M2V B;  1ZYR F;  3ZQV A;  3JRM O;  1YLM A;  3SZR A;  1G4U S;  3NKD A;  4U9E A;  1YJG A;  1JMW A;  3PDM P;  3C8G A;  4XEK A;  5D91 A;  2W45 A;  4Z9H A;  3UR3 C;  3NDB B;  3ZVR A;  1Q0D A;  3B9Q A;  5JT4 A;  3U9J A;  1TWA A;  2GDC A;  1OR3 A;  2CNW A;  4DRH B;  4E17 A;  2X51 A;  4D4X A;  2R7V A;  3JTL O;  1NFO A;  4BJ6 C;  2Y3B A;  2VC9 A;  5AC4 A;  3N24 A;  2WVN A;  1Y4C A;  4MTG A;  2W4M A;  1T6Q A;  4XPY A;  3FDQ A;  2YLG A;  4F4B A;  2CCY A;  3CSK A;  3SEO A;  3O6X A;  4EWC A;  2H7B A;  4YT2 A;  3EJN A;  1Z23 A;  3LNR A;  4DRI B;  5A6J A;  4JE9 A;  1SR2 A;  3L34 A;  1C03 A;  2PBE A;  1KTM A;  1JPN A;  3SXM A;  3NMI A;  4LAC B;  5KYW A;  3HLZ A;  3NRH A;  4OIQ F;  3QVY A;  3EGX A;  3GM2 A;  3MBG A;  3LUT B;  4HEA J;  3IQT A;  1A7D A;  4EBK A;  4LDR A;  1J8M F;  1H7I A;  3DM5 A;  1N1C A;  2A6H F;  1VLT A;  1L3P A;  4BJ1 A;  4CDV A;  2R7U A;  1EKY A;  5BQI A;  5DS5 A;  2XM0 A;  2ZXR A;  2A69 F;  3JCU Q;  4I1M A;  2AWC A;  3S90 A;  2OG2 A;  3V5Z A;  3L0I A;  3IPM O;  1O5H A;  5HSW A;  2D5R B;  2ASR A;  2P0N A;  4C7O B;  5EHH A;  2P61 A;  1LI7 A;  2VB6 A;  2PF4 E;  2J0W A;  3C63 A;  3W8H A;  4E0H A;  4CSA C;  4WJ0 A;  3IQC A;  2YVK A;  3UMI A;  1EI7 A;  4EHP A;  3VM6 A;  4AX2 A;  3H2U A;  4JCZ A;  1KNY A;  2TMV P;  4KBL A;  2GFH A;  1APC A;  1M57 C;  2NPU A;  3N2Z B;  2EPN A;  2DI3 A;  3M4B A;  3A11 A;  4QI0 A;  4YL0 A;  3ECS A;  3EG9 A;  4XLN F;  3UMK A;  3ZG1 A;  2WL8 A;  4C3D A;  3U9M A;  2MWQ A;  1VB5 A;  2KW3 C;  1CGM E;  3QW1 A;  1D0X A;  2R25 A;  2XLE A;  1YZC A;  1WWP A;  5FZT A;  1ZHY A;  3NKE A;  5BUO A;  2AU5 A;  1AUE A;  2AWY A;  1HW2 A;  5COF A;  1O3U A;  1SMY F;  3GEH A;  3LS0 A;  4IAR A;  1ZU4 A;  4K1O A;  4JZA A;  5TJ5 E;  3LAY A;  2ZXP A;  2J7P A;  4KNW A;  4X0R A;  4O6Y A;  4YN0 B;  3WG7 C;  4CS7 A;  3QVZ A;  5F28 E;  2D4U A;  3IQ5 A;  5HV9 A;  2EIM C;  2ZPA A;  4OIR F;  2NUP B;  2PX3 A;  1D0Y A;  1WTY A;  4H4K C;  2ZXW C;  1RKE A;  4GYT A;  3B0V C;  5E3C A;  1Q0K A;  1FNT c;  4MW8 A;  1NBB A;  1E83 A;  3FHD A;  1FTS A;  3GM3 A;  1U89 A;  4U5E E;  5DS4 A;  3FVY A;  4WAB A;  4OD5 A;  1LE2 A;  4M63 A;  2EIJ C;  3TJ6 A;  1CGO A;  3AQC A;  3JSE O;  2R7S A;  2WZL A;  2V26 A;  3DMD A;  4G0H A;  5JRA A;  4YJW A;  2O9X A;  5KYN A;  1HE1 A;  3B0U X;  2DGJ A;  3M1C B;  4DXW A;  2DB4 A;  3RH3 A;  1DOV A;  3QZC A;  1OXB A;  1E2X A;  1WAS A;  2HJ3 A;  3SYN A;  2R7X A;  2BE5 F;  3JZ0 A;  5L0F A;  3GWN A;  3KYI A;  2F22 A;  1M2O A;  3AOU A;  4R32 A;  4XEV A;  4EBJ A;  2HUJ A;  2HZ8 A;  1K40 A;  2HSB A;  3EH2 A;  4N6C A;  3JYY A;  5T3W A;  3TQO A;  1U6H A;  4JEA A;  4U5F E;  1NLX A;  2M4E A;  2VAS A;  1JPJ A;  1ORJ A;  3LNM B;  3O55 A;  4PJM A;  5DLJ A;  1T6I A;  2YL0 A;  3EZI A;  3CAX A;  4FES A;  1MMA A;  2HV6 A;  2Q9C A;  3FAJ A;  4IB4 A;  5A6A A;  1VK5 A;  2R7Q A;  3VYW A;  4RD9 A;  3T4R A;  3T6B A;  3F46 A;  256B A;  1LIH A;  2L7A A;  1TFO B;  1VTM P;  2YL1 A;  1WN0 A;  4U5H A;  3MLG A;  3EHM A;  2KJG A;  1RJ9 A;  3C18 A;  1QQ3 A;  3E70 C;  5CI9 A;  3V7O A;  5B3I A;  1HY5 A;  1LI5 A;  4B6I A;  3UGP A;  5JUA A;  4G7O F;  2CW0 F;  3Q6M A;  3U8P A;  1RCP A;  3V5X A;  4U5G A;  4OIO F;  2P6V A;  1H6G A;  1ST6 A;  3EHN A;  3U0C A;  3DD7 A;  5L0D A;  4AL0 A;  3RW0 A;  3OWT A;  2VCC A;  4IAQ A;  1DOW A;  3RKO F;  4ANJ A;  3T6J A;  5KYX A;  3RQG A;  5L0G A;  1Q0G A;  2C03 A;  3JSZ A;  2UUH A;  3RVZ A;  1E86 A;  3M79 A;  2FAP B;  3N0T A;  4W8K A;  3W2W A;  4PAC A;  5B1A C;  4J7Y A;  3IHU A;  4CJG A;  4QI2 A;  1M56 C;  2QY9 A;  4O79 A;  3EFO A;  1TWC A;  3W4Y A;  2WVQ A;  4LLC A;  4YT5 A;  3KYJ A;  1GQA A;  1MQV A;  3AG4 C;  4J32 B;  2L6F A;  1ZZP A;  3HJC A;  2KQ9 A;  4PJL A;  3U3B A;  1YA7 O;  3JYH A;  4CJO A;  2J7P D;  3U2M A;  1A41 A;  2JPU A;  4ONS A;  3HNI A;  4HFF B;  1GS9 A;  4CBE A;  5EGY A;  2XXA A;  4AE4 A;  3TOL A;  3C62 A;  1F1M A;  2IBF A;  2ETS A;  2YQY A;  2HV7 A;  1I4Z A;  4YL1 A;  1GGQ A;  3DKA A;  3RQF A;  3QTH A;  3CQZ A;  3SP1 A;  2HSQ A;  2R02 A;  1CPR A;  4JJG A;  1QLE C;  4LDK A;  2YL3 A;  1QZX A;  2KNH A;  4XQ1 A;  2IM8 A;  1LE4 A;  1W2W A;  2XL4 A;  2EIN C;  2H7V C;  1OW7 A;  1ORS C;  3LEO A;  1FR0 A;  3K33 A;  2QUP A;  3GEI A;  2C04 A;  2VH3 A;  2PNO A;  3K1I A;  3V5Y A;  4JEB A;  1NSG B;  2PP4 A;  1V54 C;  3DE8 A;  4DVZ A;  2ZXO A;  2A1D D;  1BDJ B;  4GEH A;  4MND A;  4Q7C A;  4FWV A;  5DVW A;  3AG1 C;  3KH2 A;  2IXO A;  3K6B A;  2IXN A;  3K7D A;  5BQH A;  1LS1 A;  1NZE A;  4OIN F;  5A6K A;  4JTD B;  4I1O B;  5IY5 C;  3POV A;  3ZDL A;  1Z6A A;  4ULV A;  3PHF 2;  4Q4Z F;  2KC3 A;  2XLW A;  5KYU A;  1V55 C;  1OKK A;  1LKX A;  3HNK A;  4UDV A;  3C8G B;  5K0I A;  3QMK A;  5JS5 A;  1T5O A;  5EK0 A;  3KPH A;  3F47 A;  3OA1 A;  2Q00 A;  4OD4 A;  4WGZ A;  1HW1 A;  1YAR O;  4HFK B;  3ATP A;  2GAQ A;  2J45 A;  1TWG A;  1I5N A;  4KI2 A;  2LIG A;  4KC9 A;  2GA0 A;  2NUT B;  2G62 A;  3DE9 A;  3X2Q C;  1SYQ A;  4AK9 A;  2J9B A;  3K66 A;  1MMN A;  1ZHT A;  2PFD A;  4NQF A;  4P9T A;  5JSL A;  3EGD A;  2HFI A;  3NYJ A;  4NCQ A;  4MVO A;  3U5S A;  3B0P A;  3VRC A;  4QDL A;  2PX0 A;  4BJT A;  4CX9 A;  3MFN A;  1A7E A;  1JR8 A;  4U5B E;  3C8G D;  3RF3 A;  1FAP B;  1G4W R;  2Y3D A;  3KL4 A;  1OQC A;  1OW6 A;  1PD0 A;  1V4A A;  2RSE B;  3SXZ A;  1K04 A;  3H65 A;  2CNW D;  3EGX B;  2EIK C;  1HMD A;  3H2V A;  3AG3 C;  1BR2 A;  2LD6 A;  2R7T A;  2OEX A;  4DBQ A;  5D92 A;  3QW0 A;  3W8I A;  4A4A A;  4ER9 A;  4IRU A;  1FMW A;  3BRJ A;  1UG7 A;  4W8P A;  1MNE A;  3GEE A;  3L8I A;  3ZQY A;  3ASO C;  4BJ5 A;  2QE9 A;  1NG1 A;  3DI5 A;  2H7O A;  2IOQ A;  2RD9 A;  4KNV A;  4K0D A;  4CS9 A;  5A6B A;  3LLI A;  3X1O A;  5JLI A;  4N06 A;  1ZU5 A;  2W4B A;  4G7Z F;  1AVO B;  3DZA A;  1AEP A;  3WHN A;  5L0I A;  3W2V A;  1S7Z A;  4CIH A;  2QTV A;  4PR9 A;  4O6N A;  2YRF A;  2XL8 A;  4NTA A;  3U2L A;  3LES A;  2JD3 A;  4IJJ A;  1CPQ A;  3RQE A;  3WAQ A;  4BJ5 C;  1RMV A;  5KYY A;  4JVS A;  4NY3 A;  2Y69 C;  3TUL A;  2CDQ A;  2Q9A A;  1EQ1 A;  4CS9 C;  3O10 A;  2B0J A;  1YDI A;  4J7T A;  1M2V A;  5CIV A;  3EG9 B;  3I5Q A;  2OQM A;  4IAO A;  4PJN A;  1OCC C;  2KYH A;  4RBN A;  2A6E F;  3FOP A;  4MS2 A;  5JP7 A;  4C3E A;  3ABL C;  2EIL C;  2J46 A;  3C7J A;  2XLO A;  2YKZ A;  2Z15 A;  4D4N A;  2NSG A;  1BBH A;  3DXJ F;  1YAU O;  1ZW2 A;  3G4X A;  1A0B A;  4JTC B;  3DWW A;  2Y3G A;  1OKK D;  3B29 A;  1ZHX A;  5E33 A;  1XZP A;  4LLE A;  2LCH A;  2YL7 A;  2XS1 A;  4NTB A;  2HS5 A;  4CDY A;  3KKB A;  3R7C A;  2OEV A;  2P7V A;  4XTK A;  2OJQ A;  4FX5 A;  4XEF A;  3I4U A;  2WVO A;  1RKE B;  4MVR A;  1IZM A;  4BEM J;  5B3S C;  3BEH A;  1M6T A;  5COM A;  3J06 A;  2B0H A;  4MVU A;  2XS8 A;  3DAG A;  3NYM A;  2LP4 A;  4N6H A;  3TJ5 A;  4CIP A;  5CI8 A;  1LM3 B;  3RIP A;  2I8B A;  1T6U A;  2J0X A;  2VCA A;  1YA9 A;  4BPM A;  1L7C A;  1CGN A;  2OOC A;  2R03 A;  3MYF A;  5T1D B;  3MX3 A;  2EPL X;  2HJM A;  5F5F A;  1BZ4 A;  1RKC A;  3CEX A;  4JRZ A;  4XLP F;  2A0B A;  4NTF A;  1TQG A;  3PCV A;  4DOZ A;  2HMQ A;  2XLM A;  3O39 A;  4EKW A;  2L9J A;  1H9T A;  4JJF A;  3TD7 A;  4ULW A;  1ORY A;  2FFH A;  4NC3 A;  1YZA A;  1ZHW A;  3EPV A;  3IQ6 A;  5T3T A;  4A2N B;  4Q5S F;  1TWH A;  2NSF A;  2JX0 A;  1GM5 A;  2J8W A;  2OKU A;  4DVY P;  4IWB A;  3MYI A;  3T9O A;  4BJ6 A;  4MVS A;  2OCC C;  1T01 A;  4C7O A;  1JOG A;  4MTO A;  2ICW G;  1D0Z A;  1D1B A;  2LFF A;  1IW7 F;  3US6 A;  3G4Z A;  1XWJ A;  2MHR A;  5F5H A;  1SF8 A;  3HTK C;  1WGW A;  4LDQ A;  3S28 A;  4DBR A;  2KK1 A;  1PD1 A;  5A6B D;  5FCL A;  5BQG A;  2M64 A;  2L6G A;  1LPE A;  1E85 A;  2EPO A;  1RJ9 B;  2Q9B A;  1BR1 A;  1HMO A;  4P9F A;  4K7B A;  4AL1 A;  3I5P A;  2Y39 A;  2Q7R A;  3S84 A;  3S29 A;  1SZI A;  1QVX A;  2I15 A;  4WGY A;  4Z9I A;  2NUT A;  4DJ9 A;  4PK4 A;  3ASN C;  3OEO A;  4MVQ A;  5KYX B;  4ZLC A;  3SXY A;  1A7V A;  3VAY A;  4JUR I;  3GOD A;  3M15 A;  2ZD9 A;  2YHS A;  3LLK A;  3K1I C;  1EA8 A;  3IEE A;  3ZIB A;  2IYL D;  1FFH A;  2Q3T A;  2LQG A;  1NU7 D;  2E87 A;  1D1C A;  3EFO B;  4Z9J A;  3S9O A;  1LVK A;  1D1A A;  2L81 A;  5AC5 A;  2IXM A;  2LFD A;  4JW1 A;  4BEJ A;  1FFT C;  2NUP A;  2XLD A;  1OCR C;  4EBB A;  1Y6D A;  2J9V A;  3HNL A;  2AVK A;  2HKV A;  3GM1 A;  4CSA A;  1WOL A;  4L6R A;  4E7S A;  3ZSU A;  2YEV A;  4I3M A;  4JKV A;  1U0B B;  2J9W A;  4MW3 A;  2G3V A;  2VCB A;  3TOM A;  2XXA B;  2EPK X;  1FMV A;  2FGY A;  4AE4 B;  1PCX A;  1R5I D;  3UGO A;  4PFP A;  4J30 B;  5B1B C;  4E0I A;  1C17 M;  3ZC4 A;  1OCO C;  4GQH A;  3SXK A;  1I4Y A;  1OW8 A;  1NFN A;  2Y3H A;  2YLD A;  2QLA A;  3S27 A;  1UFB A;  3GAN A;  2CYD A;  4RDA A;  3AGU A;  3LS1 A;  2AP3 A;  2DYR C;  2R05 A;  3B71 A;  3WOD F;  5L3Q A;  2KGO A;  1PV3 A;  4XPW A;  2UUI A;  4H54 A;  1B68 A;  1YVI A;  2BL2 A;  3JRT A;  3ITF A;  5COG A;  5GPG B;  3UMH A;  5DQT A;  1Q0F A;  1R4T A;  3R2P A;  3NMK A;  1G5Z A;  3DM9 B;  4XPX A;  4YT4 A;  1S05 A;  1T9K A;  2Q4F A;  4CS8 A;  3S0X A;  4P6I C;  3E9V A;  1XZQ A;  4YL3 A;  5L0J A;  3EZH A;  4I44 A;  3RYL A;  3AQB A;  2GWW A;  1OR2 A;  1BR4 A;  3RFY A;  1VLS A;  4U5C E;  3T6G B;  4MVZ A;  2WZG A;  2IXP A;  5KYU B;  4LER A;  5DS6 A;  3Q7G A;  5A69 A;  1TR2 A;  1JAF A;  2R7W A;  1Z63 A;  2W9Y A;  3HNJ A;  4CS8 C;  3ABM C;  2BC5 A;  3AG2 C;  1TKN A;  3GWL A;  1O87 A;  1Z5Z A;  2OU6 A;  1J8Y F;  3TK0 A;  1OCZ C;  3DAF A;  5JVE A;  4JC7 A;  4G78 A;  1OXK A;  5E2Q A;  2V3C C;  2WB7 A;  1Q0M A;  3DJN B;  2QNL A;  3RVY A;  1HE9 A;  2XL6 A;  4U9D A;  2KSF A;  4EIY A;  4EUK B;  5L0H A;  3FAP B;  4MQ9 F;  3NMJ A;  4IGG A;  4PJJ A;  4E7Z A;  4JCH A;  5AGF A;  1NU9 C;  2CGE A;  2J9U A;  2XSE A;  2XLV A;  3AGT A;  3EQL F;  4OIP F;  2MYS A;  5L3V A;  5KYW B;  3EGD B;  2R7R A;  3U8V A;  4YWQ A;  1C02 A;  4O6M A;  4FAP B;  1G8X A;  4U5D E;  1MMG A;  1ZW3 A;  2DYS C;  1QSP A;  1Z7Q c;  2LSE A;  3U3F A;  3ZTZ A;  4O7G A;  3M4C A;  3NG1 A;  1VOM A;  1VMA A;  3VF0 A; 
#chains in the Genus database with same CATH homology
 1AUE A;  1FAP B;  5GPG B;  2RSE B;  2GAQ A;  4DRJ B;  2NPU A;  2FAP B;  3FAP B;  4DRH B;  4DRI B;  1NSG B;  4FAP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...