1NSGB

The structure of the immunophilin-immunosuppressant fkbp12-rapamycin complex interacting with human frap
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
94
structure length
94
Chain Sequence
b'VAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FK506-BINDING PROTEIN
publication title Refined structure of the FKBP12-rapamycin-FRB ternary complex at 2.2 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (isomerase/kinase)
total genus 36
structure length 94
sequence length 94
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 1997-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) FKBP12-rapamycin binding domain 1nsgB00
2FAPB 4DRJB 2GAQA 4FAPB 5GPGB 1FAPB 1AUEA 1NSGB 4DRHB 2NPUA 4DRIB 2RSEB 3FAPB
chains in the Genus database with same CATH superfamily
5DVWA 4KNWA 4XTKA 3B0PA 5DS4A 1NFNA 3LJBA 3OA1A 2XXAB 2I15A 1NLXA 1ST6A 2LK4A 3RW0A 3WHNA 1TFKB 4I1MA 3MYIA 3QVZA 4A4AA 3LS1A 1YDIA 4C3BA 1BZ4A 5L0CA 1NG1A 3UGOA 1B68A 1AVOB 4K1OA 4GEHA 1FFHA 4CBEA 1ORYA 2MWQA 3N24A 2ASRA 1O3UA 1Z3IX 1D1CA 2AWYA 4W8KA 4PR9A 1YLMA 4D4NA 2R7SA 1T5OA 2HJMA 2EPKX 3NYJA 4GQHA 2DI3A 4G78A 5B3IA 3V5XA 1M56C 5CI9A 3HNIA 4MW3A 3POVA 4H4KC 3B29A 1NBBA 2XLOA 2XLHA 3NKDA 2BC5A 2NUPB 2X51A 4ONSA 1TWAA 2G62A 2NUTA 2QTVA 3EZIA 4MVUA 1MQVA 4JIOA 3SP1A 4YT8A 1E83A 3HJCA 2MHRA 1OXKA 1PD0A 1RKCA 3FOPA 1WOLA 1FAPB 2EPOA 3DM9B 1E86A 3ITFA 4BJ5A 3M4BA 5HV9A 1Q0FA 1ZW3A 2CNWD 2P0NA 2YHSA 3GORA 2VCCA 2HV7A 2LD6A 5JSLA 1ZVZA 3NKEA 3VF0A 3M4CA 1W2WA 2J0WA 4C3EA 2HMQA 2WZFA 1WATA 4PK4A 2P6VA 1Z6AA 2WL8A 5F5HA 3V5YA 2L6GA 3UNGC 2NSGA 5HSWA 1QKRA 1SZIA 1E2XA 2J45A 2JX0A 2Q9AA 2R7OA 2Y3GA 3EJNA 2E87A 1SF8A 2PX0A 2QLAA 1NFOA 4MTFA 2NUTB 1MNEA 2FAPB 1OCRC 1G4US 3O39A 3OWTA 4OD5A 4YT2A 5A69A 4JEBA 4CIPA 5L0HA 3JSEO 3K1IC 4EBBA 4EWCA 1YJGA 1T6UA 2NSFA 4ER9A 1CGME 2QE9A 4XPYA 4PJLA 3LESA 5FCLA 5GPGB 3CZ6A 1QLEC 1JR8A 3AGTA 2EIKC 3L8IA 4LDRA 2HZ8A 2YZSA 3JT1A 3MX3A 2X0CA 3VRCA 1R5ID 4L6RA 5F28E 1O5HA 2DB4A 5BQGA 4ZLDA 3L8JA 3S29A 5AC4A 3ZDLA 2XLDA 2KGOA 1A7DA 3AG2C 1JMWA 2OEVA 4IAOA 3GEIA 3RFYA 2LQGA 2DYSC 1J8MF 1NSGB 1FR0A 1H9GA 2CDQA 2R02A 3EGXA 3FXHA 2Q00A 3TD7A 3SXKA 2AVKA 4IJJA 1LE2A 2NG1A 4DBQA 3GEEA 1BR1A 4EUKB 4ULWA 5DQTA 2O9XA 2R7XA 3TQOA 3PHF2 4N6HA 3RF3A 2LCHA 4MVZA 5E2QA 4AE4A 4JC7A 2LFFA 2J7PA 2HJ3A 2J9WA 5EGYA 3JTLO 5KYUA 1YVIA 3T9OA 2A0UA 5L3VA 1RMVA 3FHDA 4HFKB 4ZLCA 5E3AA 1Q0GA 4P6IC 1G8XA 4BG0A 4E18A 4KI2A 3GM1A 2AU5A 1S05A 4IAQA 3ASNC 2QY9A 3LUTB 3ZSUA 4I44A 3EH2A 3K66A 4U5EE 1DOVA 3L0IA 1YYJA 2XSEA 2R7UA 5JT4A 3GWNA 2W45A 4MW8A 3EGXB 1BDJB 4JRZA 4JTCB 4W8PA 1OKKD 4EBKA 4U5GA 3LAYA 3S84A 4JCZA 2ZXPA 3PCVA 4MVSA 2R03A 3G4XA 2KW3C 3K1IA 3QMKA 5FZTA 2KSFA 1OR2A 4JTAB 3PMRA 4IGGA 1ZHZA 1D0ZA 3QZCA 4U5FE 4AL1A 2YQYA 2Q3TA 2WVOA 4NQFA 1C03A 2MYSA 4AE4B 2VCAA 3M1CB 4JURI 1YZAA 3O10A 3ABKC 1QZXA 1D0YA 4KC9A 4MQ9F 4Z9JA 5KYUB 4O7GA 1G5ZA 3ZG1A 4CJOA 3NMKA 3HTKC 4DJ9A 2J9UA 3I4UA 3FVYA 3FMSA 1CPRA 2OG2A 4R32A 2J9VA 3S9OA 2XL6A 4OIQF 2Q9CA 3QW0A 3DXJF 4CS7A 4PJMA 3UMKA 4DBRA 3ZVRA 2OJED 4LDKA 2A0BA 4G7ZF 3GODA 1L7CA 1YAUO 1EA8A 2A1DD 4N6CA 1ZHYA 2Z15A 1T6IA 1WWPA 1M2OA 3MLGA 2H7BA 4J32B 2WVNA 2OOCA 4B6IA 1DOWA 2BE5F 4AL0A 1FFTC 1M6TA 5IY5C 3A11A 5D92A 3DAGA 1OCCC 1EKYA 1J8YF 1CGNA 4XEKA 5DS5A 3JRMO 2OEXA 1YZCA 4K0DA 1ZU4A 2EINC 1YYXA 2HV6A 4JVSA 4XLPF 3NYMA 4NTAA 1YA7O 3CQZA 1KNYA 3W2VA 2F22A 2ZXWC 1XZQA 1MMDA 2B0HA 3C7JA 3K33A 3C8GD 3TJ6A 3B71A 1H6GA 1OW8A 4G7HF 2XS8A 3IQ6A 3W8HA 2AP3A 2Y3HA 5COMA 3EH1A 2V3CC 3NDBB 1ZHXA 4LDQA 4PJNA 5KYYA 3UR3C 3LS0A 2R7VA 4U9DA 4O79A 3NYLA 1RJ9A 4XPXA 2W4MA 3E9VA 3T6GB 5AC5A 5D91A 3ZTMA 4BJ6A 3SXYA 4DVZA 4DVYP 5A6KA 3KMIA 5BQIA 1LPEA 4JW1A 4MTOA 2Y3BA 3ZQVA 2WB7A 3Q7LA 2CCYA 2EIJC 1HMOA 2LIGA 3RQGA 4UDVA 5TJ5E 3QW1A 3DD7A 4U5HA 3IQ5A 4IARA 4BEJA 5A6BA 1Z63A 5DLJA 4CX9A 1TKNA 3EHMA 2VC9A 1M2VA 3DI5A 4J7YA 1JRAA 5L0GA 4E7SA 4U5DE 2IXPA 3DKAA 3NMJA 1AUEA 1ZYRF 1I5NA 1WTYA 3CSKA 1U89A 1QSPA 3C8ZA 3EZHA 5KYYB 4YK5A 4E0HA 2XL8A 1ZZPA 3DJNB 1LS4A 2IBFA 4FX5A 1RJ9B 3EHNA 3ZC4A 3MYFA 1V54C 1NZEA 5T3TA 4EKWA 2C04A 3C63A 3U3FA 3L34A 1QQ3A 1H9TA 4E17A 4J30B 1GM5A 1TQGA 2YL1A 2CGEA 3F46A 3JYYA 3AGUA 1XWJA 5B1AC 3JRTA 1D0XA 4E0IA 3FDQA 4RDAA 4NY3A 5JVEA 1LS1A 2GFHA 3EFOA 4YJWA 4YWQA 4HFFB 3FAPB 1M2VB 1I4ZA 1ORJA 3AJMA 4H54A 3X2QC 2PP4A 4DOZA 4C3DA 3HNLA 4NC3A 4N4WA 3HNKA 4YL3A 1K05A 5JP7A 2IXOA 2YVKA 4MTGA 3DM5A 1WN0A 3M79A 1WGWA 3KYJA 3I5PA 1FMVA 3T4RA 4XWJA 1C17M 1K04A 4WGZA 2A68F 4YT5A 2VB6A 3V7OA 2WZLA 3LNRA 3U5SA 5L0FA 2V26A 2L9JA 3K1HA 5CI8A 1OR3A 3GWLA 2XS1A 3KPHA 4OIRF 3QVYA 4MVOA 4CDAA 3U9MA 1TWHA 3SXZA 1Z23A 2LP4A 1VYIA 5E3CA 2YWAA 4NCQA 3SZRA 2C03A 4D4XA 3O55A 1KU2A 1L3PA 4X0RA 3AG1C 3S90A 2H7OA 4F4BA 1I4YA 1OCOC 3NG1A 3EFOB 4OINF 4XLNF 3T6BA 5CIVA 1PCXA 3GM2A 1UG7A 2HSQA 2ZD9A 4CJGA 1LI7A 3E70C 1OCZC 2EPMX 2YKZA 3AG4C 2HKVA 2Y3DA 2XM0A 1CPQA 1GS9A 2GAQA 3U2MA 5KYWA 1HW1A 1MMGA 1OQCA 1VYKA 4O6NA 3X1OA 2EIMC 3US6A 2XLEA 4A2NB 4KNVA 3BRJA 4BJ6C 2PBEA 3S27A 3AOUA 5KYXA 1HW2A 4PJJA 2Y69C 3JZ0A 2CNWA 3H65A 2RSEB 4BPMA 4G7OF 3RKOF 1IW7F 3U8VA 3ASOC 4CSAC 3TJ5A 3RVZA 3UMIA 2R7RA 1MMNA 3TOLA 1LM3B 2JD3A 3DZAA 1Y6DA 2HFIA 2L6FA 2XLMA 4O6YA 2R7WA 4RBNA 1G4WR 1T01A 2XL4A 3IEEA 1V55C 2P1AA 4C7OA 3B9QA 2OU6A 2XRHA 3EPVA 5COGA 1MMAA 3Q7GA 2OJQA 1GGQA 4WGYA 3U0CA 4U5BE 5B3SC 3AQCA 5KYWB 2FGYA 4ULVA 3LNMB 3IQTA 1VK5A 2KC3A 2OQMA 2KJGA 4MS2A 1V4AA 2ZXOA 1T9KA 4OD4A 1FNTc 4QI0A 1QVXA 2YL3A 5KYXB 3R2PA 2G3VA 2WZGA 1QPUA 4WJ0A 1NU7D 2J9BA 2YRFA 2J8WA 3KKBA 3I5QA 1HE9A 1HE1A 4GYTA 4IWBA 3FAJA 3TOMA 5JS5A 3SEOA 4EIYA 1PV3A 4I1OB 1N1CA 1OW6A 3HLZA 3ZIBA 3KH2A 1E84A 3IHUA 4MVRA 1A0BA 256BA 3DAFA 1ORSC 1LI5A 4XEFA 4C7OB 2YEVA 3LEOA 2VCBA 1S7ZA 4HE8D 4I3MA 4ANJA 1BR2A 4CS9A 1F1MA 2A6HF 2CYDA 3UGPA 3RIPA 1LKXA 1YARO 4MVMA 5AGFA 4Z9HA 2IM8A 2J7PD 1O87A 1JPNA 4BEMJ 3MFNA 3NRHA 3S0XA 3KYIA 1SR2A 2CW0F 3DE8A 2IXNA 1A7VA 3HNJA 2IOQA 3KL4A 2D5RB 2KYHA 1BR4A 4G0HA 2GWWA 5COFA 3WODF 2EPNA 1GQAA 4IRUA 3RQFA 5T1DB 4DRHB 4CS8C 4CSAA 3J06A 4E7ZA 2UUIA 2OKUA 1TFOB 4DRJB 1LE4A 2R25A 1NU9C 2DYRC 4IB4A 4NTBA 3FOOA 2Q9BA 2KNHA 4M63A 2VASA 1APCA 3C62A 3L1MA 1EQ1A 3ZWIA 1A7EA 4XEVA 4DXWA 2J0XA 1JPJA 1RKEA 3EG9A 3BEHA 3F47A 4HEAJ 1OKKA 5T3WA 4EBJA 4YT4A 2UUHA 3VYWA 1ZHWA 2TMVP 3SXMA 2H7VC 3LLKA 2RD9A 3K7DA 4JZAA 2QNLA 3HKKA 4MVQA 5BQHA 3SYNA 2ZPAA 1BBHA 4LACB 3R7CA 2YL7A 2WVQA 3JSZA 2Q7RA 4DRIB 1U6HA 1UFBA 3DMDA 3U9JA 1ZU5A 3ATPA 3DE9A 4JJGA 2GDCA 1FTSA 3UMHA 5BUOA 1D1AA 4BJ1A 1IZMA 4JTDB 3C18A 3G4ZA 1XZPA 3G50A 5B1BC 2A69F 1TR2A 1Y4CA 2D4UA 2PNOA 3H2UA 2HUJA 4JKVA 3T6JA 5DQZA 3IQCA 1VTMP 2ZXRA 4P9TA 2NPUA 2PF4E 3GANA 3WG7C 4Q5SF 3W2WA 2L7AA 3DWWA 3N2ZB 5EHHA 5A6AA 2QUPA 1VLTA 4AK9A 3EG9B 1RKEB 2W9YA 2FFHA 3V5ZA 3ZQYA 2HS5A 2M64A 2LSEA 3OEOA 1HMDA 2G3KA 4WABA 4JCHA 2P7VA 4PACA 5JRAA 3CEXA 5L0IA 1SMYF 4N06A 5EK0A 2IYLD 1ZW2A 2L81A 3VM6A 4Q4ZF 1YA9A 1Q0DA 2KK1A 4YL0A 3SNHA 1H7IA 2PFDA 4RD9A 3Q6MA 3RQEA 3IPMO 4CS8A 2XLWA 4OIOF 2R05A 3ECSA 2ETSA 4FAPB 1U0BB 3EGDA 1VB5A 3C8GA 1Z5ZA 1RCPA 3K6BA 4XQ1A 4JEAA 2ICWG 4Z9IA 5KYNA 1PD1A 1TWCA 1D1BA 2R7QA 2JPUA 4U5CE 5L3QA 1OW7A 3N0TA 4CS9C 5L0DA 3JYHA 4P9FA 1VLSA 2A6EF 3JCUQ 3MBGA 3A9CA 4YN0B 4QDLA 1M57C 3H2VA 3GM3A 3QTHA 3VAYA 4AX2A 5K0IA 3M15A 5A6BD 4J7TA 4CDVA 2R7TA 4K7BA 3Q6NA 1EI7A 1VOMA 2YLIA 2GA0A 1E85A 2M4EA 4U9EA 1CGOA 4QI2A 1LIHA 4JJFA 4OIPF 3S28A 3DJUB 1JOGA 2DGJA 2YLGA 1AEPA 2KQ9A 1T6QA 4XPWA 3B0UX 5DS6A 3EGDB 5F5FA 3RVYA 3W8IA 3EQLF 3C8GB 3W4YA 1HY5A 2EPLX 2HMZA 1SYQA 2Q4FA 2VH3A 2IXMA 2XM4A 1WASA 3ABLC 4LERA 3TULA 3B0VC 2P61A 2XXAA 4LLCA 1Q0KA 3WAQA 2OCCC 2B0JA 4JE9A 3LEVA 3CAXA 4LLEA 4Q7CA 4NTFA 3TK0A 3PDMP 4BJ5C 2YL0A 2R9RB 4CIHA 3GEHA 1C02A 3LLIA 5L0JA 3O6XA 4PFOA 3ZTZA 1TWGA 1JAFA 1OXBA 2LFDA 5A6JA 3ABMC 4FWVA 4YL1A 2EILC 1K40A 1Z7Qc 4PFPA 4EHPA 2I8BA 1A41A 2W4BA 3U3BA 1KTMA 5JLIA 3NMIA 4O6MA 3U8PA 3RH3A 1R4TA 2J46A 1RXQA 4FESA 5E33A 2XLVA 3AQBA 1V74B 1LVKA 2BL2A 3AG3C 1FMWA 2L6HA 2NUPA 2H8AA 3RYLA 2Y39A 1VMAA 1ZHTA 2YLDA 2HSBA 4KBLA 3U2LA 5JUAA 4BJTA 2PX3A 4CDYA 4MNDA 1MNDA 1Q0MA 2AWCA
chains in the Genus database with same CATH topology
2FAPB 4DRJB 2GAQA 4FAPB 5GPGB 1FAPB 1AUEA 1NSGB 4DRHB 2NPUA 4DRIB 2RSEB 3FAPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FAP B;  4DRJ B;  2GAQ A;  4FAP B;  5GPG B;  1FAP B;  1AUE A;  1NSG B;  4DRH B;  2NPU A;  4DRI B;  2RSE B;  3FAP B; 
#chains in the Genus database with same CATH topology
 5DVW A;  4KNW A;  4XTK A;  3B0P A;  5DS4 A;  1NFN A;  3LJB A;  3OA1 A;  2XXA B;  2I15 A;  1NLX A;  1ST6 A;  2LK4 A;  3RW0 A;  3WHN A;  1TFK B;  4I1M A;  3MYI A;  3QVZ A;  4A4A A;  3LS1 A;  1YDI A;  4C3B A;  1BZ4 A;  5L0C A;  1NG1 A;  3UGO A;  1B68 A;  1AVO B;  4K1O A;  4GEH A;  1FFH A;  4CBE A;  1ORY A;  2MWQ A;  3N24 A;  2ASR A;  1O3U A;  1Z3I X;  1D1C A;  2AWY A;  4W8K A;  4PR9 A;  1YLM A;  4D4N A;  2R7S A;  1T5O A;  2HJM A;  2EPK X;  3NYJ A;  4GQH A;  2DI3 A;  4G78 A;  5B3I A;  3V5X A;  1M56 C;  5CI9 A;  3HNI A;  4MW3 A;  3POV A;  4H4K C;  3B29 A;  1NBB A;  2XLO A;  2XLH A;  3NKD A;  2BC5 A;  2NUP B;  2X51 A;  4ONS A;  1TWA A;  2G62 A;  2NUT A;  2QTV A;  3EZI A;  4MVU A;  1MQV A;  4JIO A;  3SP1 A;  4YT8 A;  1E83 A;  3HJC A;  2MHR A;  1OXK A;  1PD0 A;  1RKC A;  3FOP A;  1WOL A;  1FAP B;  2EPO A;  3DM9 B;  1E86 A;  3ITF A;  4BJ5 A;  3M4B A;  5HV9 A;  1Q0F A;  1ZW3 A;  2CNW D;  2P0N A;  2YHS A;  3GOR A;  2VCC A;  2HV7 A;  2LD6 A;  5JSL A;  1ZVZ A;  3NKE A;  3VF0 A;  3M4C A;  1W2W A;  2J0W A;  4C3E A;  2HMQ A;  2WZF A;  1WAT A;  4PK4 A;  2P6V A;  1Z6A A;  2WL8 A;  5F5H A;  3V5Y A;  2L6G A;  3UNG C;  2NSG A;  5HSW A;  1QKR A;  1SZI A;  1E2X A;  2J45 A;  2JX0 A;  2Q9A A;  2R7O A;  2Y3G A;  3EJN A;  2E87 A;  1SF8 A;  2PX0 A;  2QLA A;  1NFO A;  4MTF A;  2NUT B;  1MNE A;  2FAP B;  1OCR C;  1G4U S;  3O39 A;  3OWT A;  4OD5 A;  4YT2 A;  5A69 A;  4JEB A;  4CIP A;  5L0H A;  3JSE O;  3K1I C;  4EBB A;  4EWC A;  1YJG A;  1T6U A;  2NSF A;  4ER9 A;  1CGM E;  2QE9 A;  4XPY A;  4PJL A;  3LES A;  5FCL A;  5GPG B;  3CZ6 A;  1QLE C;  1JR8 A;  3AGT A;  2EIK C;  3L8I A;  4LDR A;  2HZ8 A;  2YZS A;  3JT1 A;  3MX3 A;  2X0C A;  3VRC A;  1R5I D;  4L6R A;  5F28 E;  1O5H A;  2DB4 A;  5BQG A;  4ZLD A;  3L8J A;  3S29 A;  5AC4 A;  3ZDL A;  2XLD A;  2KGO A;  1A7D A;  3AG2 C;  1JMW A;  2OEV A;  4IAO A;  3GEI A;  3RFY A;  2LQG A;  2DYS C;  1J8M F;  1NSG B;  1FR0 A;  1H9G A;  2CDQ A;  2R02 A;  3EGX A;  3FXH A;  2Q00 A;  3TD7 A;  3SXK A;  2AVK A;  4IJJ A;  1LE2 A;  2NG1 A;  4DBQ A;  3GEE A;  1BR1 A;  4EUK B;  4ULW A;  5DQT A;  2O9X A;  2R7X A;  3TQO A;  3PHF 2;  4N6H A;  3RF3 A;  2LCH A;  4MVZ A;  5E2Q A;  4AE4 A;  4JC7 A;  2LFF A;  2J7P A;  2HJ3 A;  2J9W A;  5EGY A;  3JTL O;  5KYU A;  1YVI A;  3T9O A;  2A0U A;  5L3V A;  1RMV A;  3FHD A;  4HFK B;  4ZLC A;  5E3A A;  1Q0G A;  4P6I C;  1G8X A;  4BG0 A;  4E18 A;  4KI2 A;  3GM1 A;  2AU5 A;  1S05 A;  4IAQ A;  3ASN C;  2QY9 A;  3LUT B;  3ZSU A;  4I44 A;  3EH2 A;  3K66 A;  4U5E E;  1DOV A;  3L0I A;  1YYJ A;  2XSE A;  2R7U A;  5JT4 A;  3GWN A;  2W45 A;  4MW8 A;  3EGX B;  1BDJ B;  4JRZ A;  4JTC B;  4W8P A;  1OKK D;  4EBK A;  4U5G A;  3LAY A;  3S84 A;  4JCZ A;  2ZXP A;  3PCV A;  4MVS A;  2R03 A;  3G4X A;  2KW3 C;  3K1I A;  3QMK A;  5FZT A;  2KSF A;  1OR2 A;  4JTA B;  3PMR A;  4IGG A;  1ZHZ A;  1D0Z A;  3QZC A;  4U5F E;  4AL1 A;  2YQY A;  2Q3T A;  2WVO A;  4NQF A;  1C03 A;  2MYS A;  4AE4 B;  2VCA A;  3M1C B;  4JUR I;  1YZA A;  3O10 A;  3ABK C;  1QZX A;  1D0Y A;  4KC9 A;  4MQ9 F;  4Z9J A;  5KYU B;  4O7G A;  1G5Z A;  3ZG1 A;  4CJO A;  3NMK A;  3HTK C;  4DJ9 A;  2J9U A;  3I4U A;  3FVY A;  3FMS A;  1CPR A;  2OG2 A;  4R32 A;  2J9V A;  3S9O A;  2XL6 A;  4OIQ F;  2Q9C A;  3QW0 A;  3DXJ F;  4CS7 A;  4PJM A;  3UMK A;  4DBR A;  3ZVR A;  2OJE D;  4LDK A;  2A0B A;  4G7Z F;  3GOD A;  1L7C A;  1YAU O;  1EA8 A;  2A1D D;  4N6C A;  1ZHY A;  2Z15 A;  1T6I A;  1WWP A;  1M2O A;  3MLG A;  2H7B A;  4J32 B;  2WVN A;  2OOC A;  4B6I A;  1DOW A;  2BE5 F;  4AL0 A;  1FFT C;  1M6T A;  5IY5 C;  3A11 A;  5D92 A;  3DAG A;  1OCC C;  1EKY A;  1J8Y F;  1CGN A;  4XEK A;  5DS5 A;  3JRM O;  2OEX A;  1YZC A;  4K0D A;  1ZU4 A;  2EIN C;  1YYX A;  2HV6 A;  4JVS A;  4XLP F;  3NYM A;  4NTA A;  1YA7 O;  3CQZ A;  1KNY A;  3W2V A;  2F22 A;  2ZXW C;  1XZQ A;  1MMD A;  2B0H A;  3C7J A;  3K33 A;  3C8G D;  3TJ6 A;  3B71 A;  1H6G A;  1OW8 A;  4G7H F;  2XS8 A;  3IQ6 A;  3W8H A;  2AP3 A;  2Y3H A;  5COM A;  3EH1 A;  2V3C C;  3NDB B;  1ZHX A;  4LDQ A;  4PJN A;  5KYY A;  3UR3 C;  3LS0 A;  2R7V A;  4U9D A;  4O79 A;  3NYL A;  1RJ9 A;  4XPX A;  2W4M A;  3E9V A;  3T6G B;  5AC5 A;  5D91 A;  3ZTM A;  4BJ6 A;  3SXY A;  4DVZ A;  4DVY P;  5A6K A;  3KMI A;  5BQI A;  1LPE A;  4JW1 A;  4MTO A;  2Y3B A;  3ZQV A;  2WB7 A;  3Q7L A;  2CCY A;  2EIJ C;  1HMO A;  2LIG A;  3RQG A;  4UDV A;  5TJ5 E;  3QW1 A;  3DD7 A;  4U5H A;  3IQ5 A;  4IAR A;  4BEJ A;  5A6B A;  1Z63 A;  5DLJ A;  4CX9 A;  1TKN A;  3EHM A;  2VC9 A;  1M2V A;  3DI5 A;  4J7Y A;  1JRA A;  5L0G A;  4E7S A;  4U5D E;  2IXP A;  3DKA A;  3NMJ A;  1AUE A;  1ZYR F;  1I5N A;  1WTY A;  3CSK A;  1U89 A;  1QSP A;  3C8Z A;  3EZH A;  5KYY B;  4YK5 A;  4E0H A;  2XL8 A;  1ZZP A;  3DJN B;  1LS4 A;  2IBF A;  4FX5 A;  1RJ9 B;  3EHN A;  3ZC4 A;  3MYF A;  1V54 C;  1NZE A;  5T3T A;  4EKW A;  2C04 A;  3C63 A;  3U3F A;  3L34 A;  1QQ3 A;  1H9T A;  4E17 A;  4J30 B;  1GM5 A;  1TQG A;  2YL1 A;  2CGE A;  3F46 A;  3JYY A;  3AGU A;  1XWJ A;  5B1A C;  3JRT A;  1D0X A;  4E0I A;  3FDQ A;  4RDA A;  4NY3 A;  5JVE A;  1LS1 A;  2GFH A;  3EFO A;  4YJW A;  4YWQ A;  4HFF B;  3FAP B;  1M2V B;  1I4Z A;  1ORJ A;  3AJM A;  4H54 A;  3X2Q C;  2PP4 A;  4DOZ A;  4C3D A;  3HNL A;  4NC3 A;  4N4W A;  3HNK A;  4YL3 A;  1K05 A;  5JP7 A;  2IXO A;  2YVK A;  4MTG A;  3DM5 A;  1WN0 A;  3M79 A;  1WGW A;  3KYJ A;  3I5P A;  1FMV A;  3T4R A;  4XWJ A;  1C17 M;  1K04 A;  4WGZ A;  2A68 F;  4YT5 A;  2VB6 A;  3V7O A;  2WZL A;  3LNR A;  3U5S A;  5L0F A;  2V26 A;  2L9J A;  3K1H A;  5CI8 A;  1OR3 A;  3GWL A;  2XS1 A;  3KPH A;  4OIR F;  3QVY A;  4MVO A;  4CDA A;  3U9M A;  1TWH A;  3SXZ A;  1Z23 A;  2LP4 A;  1VYI A;  5E3C A;  2YWA A;  4NCQ A;  3SZR A;  2C03 A;  4D4X A;  3O55 A;  1KU2 A;  1L3P A;  4X0R A;  3AG1 C;  3S90 A;  2H7O A;  4F4B A;  1I4Y A;  1OCO C;  3NG1 A;  3EFO B;  4OIN F;  4XLN F;  3T6B A;  5CIV A;  1PCX A;  3GM2 A;  1UG7 A;  2HSQ A;  2ZD9 A;  4CJG A;  1LI7 A;  3E70 C;  1OCZ C;  2EPM X;  2YKZ A;  3AG4 C;  2HKV A;  2Y3D A;  2XM0 A;  1CPQ A;  1GS9 A;  2GAQ A;  3U2M A;  5KYW A;  1HW1 A;  1MMG A;  1OQC A;  1VYK A;  4O6N A;  3X1O A;  2EIM C;  3US6 A;  2XLE A;  4A2N B;  4KNV A;  3BRJ A;  4BJ6 C;  2PBE A;  3S27 A;  3AOU A;  5KYX A;  1HW2 A;  4PJJ A;  2Y69 C;  3JZ0 A;  2CNW A;  3H65 A;  2RSE B;  4BPM A;  4G7O F;  3RKO F;  1IW7 F;  3U8V A;  3ASO C;  4CSA C;  3TJ5 A;  3RVZ A;  3UMI A;  2R7R A;  1MMN A;  3TOL A;  1LM3 B;  2JD3 A;  3DZA A;  1Y6D A;  2HFI A;  2L6F A;  2XLM A;  4O6Y A;  2R7W A;  4RBN A;  1G4W R;  1T01 A;  2XL4 A;  3IEE A;  1V55 C;  2P1A A;  4C7O A;  3B9Q A;  2OU6 A;  2XRH A;  3EPV A;  5COG A;  1MMA A;  3Q7G A;  2OJQ A;  1GGQ A;  4WGY A;  3U0C A;  4U5B E;  5B3S C;  3AQC A;  5KYW B;  2FGY A;  4ULV A;  3LNM B;  3IQT A;  1VK5 A;  2KC3 A;  2OQM A;  2KJG A;  4MS2 A;  1V4A A;  2ZXO A;  1T9K A;  4OD4 A;  1FNT c;  4QI0 A;  1QVX A;  2YL3 A;  5KYX B;  3R2P A;  2G3V A;  2WZG A;  1QPU A;  4WJ0 A;  1NU7 D;  2J9B A;  2YRF A;  2J8W A;  3KKB A;  3I5Q A;  1HE9 A;  1HE1 A;  4GYT A;  4IWB A;  3FAJ A;  3TOM A;  5JS5 A;  3SEO A;  4EIY A;  1PV3 A;  4I1O B;  1N1C A;  1OW6 A;  3HLZ A;  3ZIB A;  3KH2 A;  1E84 A;  3IHU A;  4MVR A;  1A0B A;  256B A;  3DAF A;  1ORS C;  1LI5 A;  4XEF A;  4C7O B;  2YEV A;  3LEO A;  2VCB A;  1S7Z A;  4HE8 D;  4I3M A;  4ANJ A;  1BR2 A;  4CS9 A;  1F1M A;  2A6H F;  2CYD A;  3UGP A;  3RIP A;  1LKX A;  1YAR O;  4MVM A;  5AGF A;  4Z9H A;  2IM8 A;  2J7P D;  1O87 A;  1JPN A;  4BEM J;  3MFN A;  3NRH A;  3S0X A;  3KYI A;  1SR2 A;  2CW0 F;  3DE8 A;  2IXN A;  1A7V A;  3HNJ A;  2IOQ A;  3KL4 A;  2D5R B;  2KYH A;  1BR4 A;  4G0H A;  2GWW A;  5COF A;  3WOD F;  2EPN A;  1GQA A;  4IRU A;  3RQF A;  5T1D B;  4DRH B;  4CS8 C;  4CSA A;  3J06 A;  4E7Z A;  2UUI A;  2OKU A;  1TFO B;  4DRJ B;  1LE4 A;  2R25 A;  1NU9 C;  2DYR C;  4IB4 A;  4NTB A;  3FOO A;  2Q9B A;  2KNH A;  4M63 A;  2VAS A;  1APC A;  3C62 A;  3L1M A;  1EQ1 A;  3ZWI A;  1A7E A;  4XEV A;  4DXW A;  2J0X A;  1JPJ A;  1RKE A;  3EG9 A;  3BEH A;  3F47 A;  4HEA J;  1OKK A;  5T3W A;  4EBJ A;  4YT4 A;  2UUH A;  3VYW A;  1ZHW A;  2TMV P;  3SXM A;  2H7V C;  3LLK A;  2RD9 A;  3K7D A;  4JZA A;  2QNL A;  3HKK A;  4MVQ A;  5BQH A;  3SYN A;  2ZPA A;  1BBH A;  4LAC B;  3R7C A;  2YL7 A;  2WVQ A;  3JSZ A;  2Q7R A;  4DRI B;  1U6H A;  1UFB A;  3DMD A;  3U9J A;  1ZU5 A;  3ATP A;  3DE9 A;  4JJG A;  2GDC A;  1FTS A;  3UMH A;  5BUO A;  1D1A A;  4BJ1 A;  1IZM A;  4JTD B;  3C18 A;  3G4Z A;  1XZP A;  3G50 A;  5B1B C;  2A69 F;  1TR2 A;  1Y4C A;  2D4U A;  2PNO A;  3H2U A;  2HUJ A;  4JKV A;  3T6J A;  5DQZ A;  3IQC A;  1VTM P;  2ZXR A;  4P9T A;  2NPU A;  2PF4 E;  3GAN A;  3WG7 C;  4Q5S F;  3W2W A;  2L7A A;  3DWW A;  3N2Z B;  5EHH A;  5A6A A;  2QUP A;  1VLT A;  4AK9 A;  3EG9 B;  1RKE B;  2W9Y A;  2FFH A;  3V5Z A;  3ZQY A;  2HS5 A;  2M64 A;  2LSE A;  3OEO A;  1HMD A;  2G3K A;  4WAB A;  4JCH A;  2P7V A;  4PAC A;  5JRA A;  3CEX A;  5L0I A;  1SMY F;  4N06 A;  5EK0 A;  2IYL D;  1ZW2 A;  2L81 A;  3VM6 A;  4Q4Z F;  1YA9 A;  1Q0D A;  2KK1 A;  4YL0 A;  3SNH A;  1H7I A;  2PFD A;  4RD9 A;  3Q6M A;  3RQE A;  3IPM O;  4CS8 A;  2XLW A;  4OIO F;  2R05 A;  3ECS A;  2ETS A;  4FAP B;  1U0B B;  3EGD A;  1VB5 A;  3C8G A;  1Z5Z A;  1RCP A;  3K6B A;  4XQ1 A;  4JEA A;  2ICW G;  4Z9I A;  5KYN A;  1PD1 A;  1TWC A;  1D1B A;  2R7Q A;  2JPU A;  4U5C E;  5L3Q A;  1OW7 A;  3N0T A;  4CS9 C;  5L0D A;  3JYH A;  4P9F A;  1VLS A;  2A6E F;  3JCU Q;  3MBG A;  3A9C A;  4YN0 B;  4QDL A;  1M57 C;  3H2V A;  3GM3 A;  3QTH A;  3VAY A;  4AX2 A;  5K0I A;  3M15 A;  5A6B D;  4J7T A;  4CDV A;  2R7T A;  4K7B A;  3Q6N A;  1EI7 A;  1VOM A;  2YLI A;  2GA0 A;  1E85 A;  2M4E A;  4U9E A;  1CGO A;  4QI2 A;  1LIH A;  4JJF A;  4OIP F;  3S28 A;  3DJU B;  1JOG A;  2DGJ A;  2YLG A;  1AEP A;  2KQ9 A;  1T6Q A;  4XPW A;  3B0U X;  5DS6 A;  3EGD B;  5F5F A;  3RVY A;  3W8I A;  3EQL F;  3C8G B;  3W4Y A;  1HY5 A;  2EPL X;  2HMZ A;  1SYQ A;  2Q4F A;  2VH3 A;  2IXM A;  2XM4 A;  1WAS A;  3ABL C;  4LER A;  3TUL A;  3B0V C;  2P61 A;  2XXA A;  4LLC A;  1Q0K A;  3WAQ A;  2OCC C;  2B0J A;  4JE9 A;  3LEV A;  3CAX A;  4LLE A;  4Q7C A;  4NTF A;  3TK0 A;  3PDM P;  4BJ5 C;  2YL0 A;  2R9R B;  4CIH A;  3GEH A;  1C02 A;  3LLI A;  5L0J A;  3O6X A;  4PFO A;  3ZTZ A;  1TWG A;  1JAF A;  1OXB A;  2LFD A;  5A6J A;  3ABM C;  4FWV A;  4YL1 A;  2EIL C;  1K40 A;  1Z7Q c;  4PFP A;  4EHP A;  2I8B A;  1A41 A;  2W4B A;  3U3B A;  1KTM A;  5JLI A;  3NMI A;  4O6M A;  3U8P A;  3RH3 A;  1R4T A;  2J46 A;  1RXQ A;  4FES A;  5E33 A;  2XLV A;  3AQB A;  1V74 B;  1LVK A;  2BL2 A;  3AG3 C;  1FMW A;  2L6H A;  2NUP A;  2H8A A;  3RYL A;  2Y39 A;  1VMA A;  1ZHT A;  2YLD A;  2HSB A;  4KBL A;  3U2L A;  5JUA A;  4BJT A;  2PX3 A;  4CDY A;  4MND A;  1MND A;  1Q0M A;  2AWC A; 
#chains in the Genus database with same CATH homology
 2FAP B;  4DRJ B;  2GAQ A;  4FAP B;  5GPG B;  1FAP B;  1AUE A;  1NSG B;  4DRH B;  2NPU A;  4DRI B;  2RSE B;  3FAP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...