4IRUA

Crystal structure of lepb gap core in a transition state mimetic complex with rab1a and alf3
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
296
structure length
296
Chain Sequence
SLKPLTLLMTSSTSFSETINQWADILKTTDMEKFSFDSNPINLLELVKQFNLYVDELAITCEANNVWAKERIDSTPNLFALYDNSGGEAIHGHAFVPYYKESIVLRRLFTVDPNTFNLSRFAAFEGPCQLYCKEHKDSAWVKIQTLLTLGNGIINTLKIIKQAQAFGIDEAVTENLKALKEQFIAFQLAEADIKESLKAPSFAEPLPNKESEFFYPIDEKALAKMNGYQLATICLEELNSPKPSPLIERILSNKKFWKRINSAFESGVFKGRTDDPAGKIAKIREWHQLLQISGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Legionella pneumophila GTPase Activating Protein LepB Accelerates Rab1 Deactivation by a Non-canonical Hydrolytic Mechanism.
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase/hydrolase
molecule keywords LepB
total genus 109
structure length 296
sequence length 296
chains with identical sequence C, E
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2013-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18172 LepB_GAP_N LepB GAP domain N-terminal subdomain
A PF18227 LepB_GAP_C LepB GAP domain C-terminal subdomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1700 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4iruA01
1.25.40.830 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4iruA02
4JW1A 4I1OB 4JVSA 4I1MA 4IRUA
chains in the Genus database with same CATH superfamily
5EIBE 3VTYA 2RD9A 3PS6A 3QWPA 2KCVA 2YRFA 4U5GA 1RKEB 1FTSA 4ANJA 4E85A 4CDVA 1YVIA 4WNGA 4PACA 4B8CB 2VSYA 5AENA 1OCOC 4DRIB 3FULA 5B1AE 1Z5ZA 2CDQA 3TQOA 1U3DA 3DWWA 4U7EB 2J49A 2BL2A 2YL0A 3DI5A 4G26A 4OIQF 3Q9UC 4UI9K 4UUCA 2R7SA 3UUXA 2HJMA 2OCCE 3E30A 2XRZA 4TXRA 4HB5A 1E90A 5AN8A 3QWWA 4I43A 2J9BA 5D66A 1PAQA 3UT4A 4QI0A 4GPKA 4YWQA 2C04A 5BT1A 2WVNA 5L0IA 2KYHA 1VYKA 3ZGQA 4A2NB 2IOLA 3IV0A 2Y39A 5AGFA 3APFA 4N6CA 1TEZA 2KZTA 4Y6WA 2I6HA 4BX8A 4LDKA 3U5SA 1S70B 5FTPA 3I3NA 3NBNB 4MLPA 5GPGB 3EPVA 3KYIA 1HO8A 3RRUA 2R59A 3L17A 2ZXRA 4EZJA 1V55C 3UM1A 2NPUA 2PM6A 1FCHA 1H6GA 2EIKE 2FFHA 4UQYA 3GEEA 3SGHA 1E8YA 3HJCA 2P9PG 1BR2A 2HSQA 2XCCA 2W45A 4AL1A 4YL1A 2B6CA 3LVRE 3U9WA 4AX2A 1HU3A 2C2LA 4CX9A 3IHYA 3NZUA 4LCTA 2MYOA 2FO1E 2JLBA 2BTDA 3SD5A 4U8VD 3ZWIA 3AG3C 4NTFA 1JWFA 3PUJA 3ECSA 2JX0A 3RQEA 2I15A 3W2VA 4BTBA 3VF0A 5KWDA 2M63A 3FTSA 3T8KA 3TULA 3K1IA 4PDXA 3E37A 5KYYB 3D9HA 1S05A 3SO8A 2DYSC 3U64A 4LLCA 3SBSA 1FMWA 2M64A 2HFIA 2AWYA 3SI5A 4IGGA 2P9SG 4ATGA 4N2SA 3S0XA 1JMWA 4JZYA 5AARA 4F53A 1O3UA 4CBEA 3E34A 4UWHA 3C98A 4D10C 3Q49B 3AG4E 2XLEA 3AQCA 4M3OA 5C2YA 2ZD9A 1NZNA 3BEEA 4YVOA 1RZ4A 3NKEA 3DM9B 3MYIA 2LIGA 1TKNA 2IY0C 5G2NA 2J9QA 4KT6B 3TXNA 1H2TC 5EX0A 3JXJA 1OWPA 2EINC 3LJBA 3CK9A 3C18A 4U9EA 3NRHA 3S9OA 4U5DE 3UQ3A 3DAGA 3FAPB 3ZG1A 2XLHA 3L8JA 3RRMB 2IYLD 4C0MA 3J5QB 4PS8A 3ABLC 3HXFA 1YA7O 2XXAB 4J8YA 2P2CP 2V4LA 4P9FA 5BW8C 4OD4A 4J8SA 2XPZA 3ASOE 3BG0B 5LP0A 2R03A 3SBTB 4WNEA 5KYXB 3SYNA 3RAUA 2YLIA 1U3CA 3FHEA 3LKUA 4U8YD 4WWPA 3EFOB 4I6JA 2J4DA 3FHDA 3B0PA 4K1OA 4HI8A 5DS6A 3GW4A 3UR3C 3TK0A 2L6HA 4CDYA 3EDTB 1WN0A 3KPHA 1IW7F 1GGQA 2X6IA 3SQVA 4BJ5C 3FTZA 1YZAA 5LOZA 4RDAA 3UI2A 3NQPA 3TWQA 3CEQA 4CS9A 1L3PA 3O39A 2R7VA 2VGYA 3TWUA 2F8YA 3EHRA 4PS7A 2D5RB 3X2QE 4I44A 3QVZA 4PJLA 1NZEA 5AQBA 3VTXA 2JD3A 2FULA 2IONA 1O1SA 5AQAA 2WXPA 4CS8C 1M57C 4XLNF 2IOQA 1QQEA 2BKKB 4ACKA 3K9IA 4IULA 4EPZA 2KSFA 5KYXA 4XTKA 2QNLA 2VJ8A 2QLAA 3QMKA 2XM4A 1IKND 2IO3C 5T4YA 2AXUA 3VLEA 4B0ZA 2CFUA 1SVXA 3ASFA 2NUTB 5L0FA 4Y6CA 3HNKA 5CRUA 1N95A 2X6FA 2VC9A 2V26A 1PCXA 5HV9A 2XLDA 5KJLA 2P61A 4JA7A 3RU0A 4PFPA 2TMVP 1BR1A 2J08A 4L6RA 3GZ2A 5FZTA 1OCRC 2WVQA 3UTMA 2XEEA 5B1BC 3Q73A 1I5NA 3N71A 4BEMJ 5KYNA 1MMGA 3L34A 3SXMA 4TUUA 1JCRA 3BQOA 2LK4A 2R7RA 2OOEA 3TXMA 3JRTA 4JTAB 3GWLA 1PY1A 2A6EF 3LY7A 4P29A 2YL3A 3PZ1A 2LD6A 3QVYA 3V79K 2XXAA 4OIPF 3LCAA 5D0QD 4I6EA 3L16A 2A0UA 5ARFA 4GQHA 4YL0A 3O48A 4ANVA 3FUIA 3VYWA 3UM0A 2E87A 1E86A 1S0PA 2LFFA 3KSLA 2A5EA 2GRRB 2KATA 1F1MA 2A68F 4XEVA 3Q5MA 3NMKA 1FMVA 3CLJA 2W9YA 1ORJA 4LLEA 3QB2A 4HI9A 2KM4A 3ZXSA 3L8IA 3LNMB 1FR0A 5HRYA 2RFAA 3DSUA 1EA8A 5G05C 1GW6A 2VGEA 4HFGA 1O5MA 4YT4A 3ASNC 4W8KA 4HBDA 5JSLA 1LD7A 3PREA 4ILHB 4FADA 3C63A 1M6TA 4PR9A 3C8GD 3DXMG 4KZCA 5T3TA 3AG1C 1DNPA 1V54E 3AG3E 5FINA 4LNGA 2EPOA 3ML9A 3JQ1A 3Q6NA 3OWTA 1UOHA 4M63A 4TUMA 4AEZC 3EGXB 3B0UX 2AU5A 4EBKA 2GROB 4KC9A 4LACB 2H6FA 3DZAA 1B68A 3TAXA 1ORYA 1LS4A 3HNJA 4HFFB 5ITZF 1A7EA 2R7TA 2P9NG 5B3SC 3GODA 4HEAJ 3QAQA 4AJWA 2XS8A 4XI9A 5B3IA 5DS5A 4U63A 1HMOA 4PFOA 2EINE 2KBXA 4J32B 1OR3A 1OKKD 1K04A 3E9VA 1PD0A 1ZW3A 4F1PA 3IKOB 4PUCA 4YNDA 3ZYLA 2EPKX 3FY4A 1G5ZA 5L3QA 3RVYA 4EHPA 4U0ZA 2VTBA 1A17A 4M7CA 1N54A 2MHRA 4J8EA 1YARO 3KL4A 3B7RL 4EKWA 3FFLA 4NQFA 2DZNA 3G2VA 4I1AA 5KNHD 4JE9A 5KJKA 3NYMA 4BERA 4UWGA 2HV6A 4G2VA 2L9JA 4UQXA 3MCXA 4L23A 5CERB 3FTXA 2NUTA 3EHQA 3JYSA 1Q0GA 2WXQA 2WXKA 4JEUA 4NY3A 4YL3A 3EZHA 1N4PA 5M72A 5ENQD 2NSZA 4HVBA 1LVKA 2OU6A 5JS5A 2C0MA 3G4ZA 4ATZD 4B89A 2H6HA 4KI2A 4H54A 4WNDA 4WWNA 4N39A 4Z9HA 3B7TA 3OXGA 4GYWA 3ZUVB 4FULA 4U0SA 4DVZA 4G1TA 4BG0A 3S7FA 4E6HA 5CBNA 1ELKA 2BC5A 3KS2A 5EILA 3L9TA 4PJNA 2ETSA 3AQBA 4OD5A 3SEOA 3W2WA 3VM6A 3PUKA 2FGYA 3SFYA 3V5YA 3ZYMA 4ANWA 5CMWA 3ASOC 4FWVA 4ANXA 5HKPA 5JJ7A 1B89A 1FNTc 4KVOA 3FDQA 3DSSA 3TWWA 5FIOA 1ZVZA 1MJ0A 3AOUA 3W8HA 3FVYA 2GRNB 3AJMA 1NU9C 3FU0A 1N0RA 3KKBA 3B9QA 3S90A 4U8HA 3Q7GA 4MVUA 2DYSE 3NDBB 3CV0A 2ZXWC 5JMND 2J9UA 4CEMA 2VB6A 1E7VA 3ONKA 3LLIA 2EQXA 3NOCD 2DVWA 2A0BA 1SZIA 2BF0X 1UJJA 4CJGA 4EBBA 3JT1A 1CPQA 3UM2A 1KTMA 4EBJA 4GTQA 1LI7A 1HH8A 2R2LA 2XLWA 2FBNA 1J8MF 3D3MA 3AAAC 3JUIA 5BV1A 4UI9C 2A69F 4BX9A 1FPPA 1MYOA 1RJ9A 2R9RB 1LF8A 4G23A 2A1DD 2RFMA 3B7BA 3MEKA 2UY1A 1Q2ZA 4MQ9F 3CHMA 1OUVA 2I2OA 1YLMA 3L22A 4ANUA 1D9SA 3EU9A 1BU9A 1VB5A 3FP3A 1MMAA 2O9XA 3AG2C 3ABMC 3AU4A 3ZDLA 2VYIA 3SY2A 1YA0A 1Q0DA 3ASNE 3SFXA 1A0BA 3FU3A 2R17C 3CKBA 5ENTD 2P1AA 3PVLA 1TNUA 3C8ZA 2HE0A 2PP4A 4JW1A 2L6BA 3ZIMA 3MV3B 3RK6A 2ZISA 3AG1E 4GU5A 4MTOA 1BR4A 3ZC4A 3EQLF 1BPOA 2F37A 4AVXA 5CHEE 2OVFA 3K7DA 4XPWA 3T9KA 4AM9A 4EBAA 4P9TA 4CJOA 3RH3A 4GZ6A 1HE8A 5DQTA 2AXZA 2RKKA 1OWLA 1BDJB 1GS9A 1LE2A 1Z3XA 4DX5D 3C3OA 2GRMA 3PEUB 5JHAA 4GTOA 1M2OA 5ENRD 3C5RA 1JCQA 1SR2A 3GEIA 4DXWA 3RQGA 2AWIA 4GZ5A 2WZLA 1SW6A 2V5FA 5BUZA 1NLXA 2UWJG 5BXOA 3JCKC 4A63B 1T5OA 3M79A 2AW6A 1Y6IA 2XL8A 3AS5A 3S2AA 3GORA 5L0GA 3PDMP 2DZOA 1HF8A 3EHNA 1HZ4A 4LEUA 3LPZA 4MBGA 2MOWA 1GQAA 3T6BA 4MW8A 3ZW3A 4ER9A 5L0DA 3FOOA 1XWJA 4EBAG 5E2QA 2WQ7A 2VASA 2XRHA 2YVKA 1OCCE 4JB8P 2P58C 1L7CA 4OIOF 1G4US 1ZU2A 5BQHA 1N11A 2DBAA 1NFNA 2WMOA 1N9AA 1H2VC 1PC2A 1KT0A 1DCQA 2PQNA 3ZKJA 4LRZA 4XLPF 3ZYKA 2PQRA 2J9VA 2PNNA 2G62A 4K0RA 4WGZA 1H9TA 1TWGA 3M4BA 5A7DB 2LAHA 4UWFA 3FU6A 3HYMB 2KC3A 1TYQG 3LEWA 4IARA 4HLEA 3DSXA 1N52A 2IJGX 1HW1A 3FUKA 4TRQA 4RG9A 2XEVA 2ZXOA 4JVSA 3H2UA 2WQHA 3EHMA 3IEEA 1OXBA 2B0HA 2LQGA 4E7ZA 1Z6AA 5J08A 4D4NA 1WM5A 4JRZA 1EF1C 1AP7A 1C17M 4E17A 2XPYA 4AY6A 3ZRHA 1SQMA 4HS2A 3D9JA 3CVUA 3HNIA 5COGA 3EG9A 2WQ6A 2R7QA 3QZCA 4U5CE 1RXQA 3WXXA 2BEDA 2MWQA 5AYWD 2AVPA 5CI8A 4WGYA 2WZGA 1ZU4A 1QPUA 3B29A 3CQZA 1XZPA 4YT2A 2OJQA 1YYJA 2RG8A 4JKVA 4OYSA 1S7ZA 3QW0A 3NMIA 3APCA 2WVIA 1PV3A 4JCHA 2E2EA 3DEOA 1WTYA 2DB4A 3L82A 5H7PA 3CEXA 1Q0MA 2Q4FA 4FX5A 2Q7FA 4BSXA 2G3KA 3HG0D 4IN3B 1ZHWA 1K40A 3FUMA 3FDHA 5G05J 4U5HA 3UX4A 3ZQYA 4J7TA 5DBKA 3UXGA 2GRLA 4Q4ZF 5ANRA 2LXMA 3LNRA 3A9CA 3UMHA 1K8KG 2LO6A 3WG7C 4GMJA 3SHFA 2KXPC 3ZHEB 3L13A 4QDLA 3G2TA 1CGNA 3GZ1A 4JL0A 1HE1A 2DIWA 2Y69C 3SXYA 1TNOA 1YA9A 1EQ1A 2QY9A 4RBNA 4ABNA 4EECA 4YT8A 4JJGA 1JRAA 3L0IA 4IAOA 3JYHA 4O6NA 4JA9A 1YMPA 2XHEA 4DLOA 4GYTA 4CDNA 4E0IA 4G0HA 4U9DA 2P7VA 1IQUA 1TN7A 4ULVA 1TWCA 2XPIA 3EUVA 5HS0A 3MLGA 3UT7A 1LI5A 4Q7CA 3ZSUA 3ZXPA 3CVPA 1ZU5A 1ZZPA 1ZB1A 4RLYA 2GAQA 4LNBA 4RQIA 5HI7A 1AWCB 2ETAA 4XEIG 1V74B 4BEJA 4N3CA 4HOTA 2NUPB 1Y6DA 2YHCA 4Z68A 4FJZA 1DVPA 4K5CA 4BSZB 4NACA 5KYUA 3FTYA 4DRJB 3DSVA 3ZU7B 3JYYA 3U2LA 4CSAC 3RSEG 2VCAA 4MVSA 1XZQA 5A6CA 2OOCA 3LS0A 2BUGA 4ONSA 3ZIBA 5A6BD 1FT1A 2W4BA 1AVOB 1ZYRF 1OWNA 5E3AA 3U3WA 1A41A 5AJLA 2P9UG 1I4ZA 3EIQC 1OW6A 1LE4A 3M4CA 1N0QA 1C03A 2G3VA 4E0HA 3JUEA 5DIZA 3W9FA 3J06A 3RJVA 4YDOA 2ZIRA 4PJMA 2IOSA 3R9AB 3O6XA 1FVHA 3CHPA 3ISMC 4N5CA 5CMYA 3IPMO 2Q9CA 3T4RA 4CT0A 2WXOA 2H7OA 4X0RA 1T9KA 4F1SA 5JHBA 3LVQE 4JURI 3QKYA 4XIFA 4BPMA 2IU1A 2H6GA 2NYJA 3QW1A 4J7YA 2X6HA 1YJGA 3I4RB 2ZU6B 2ZGDA 4G25A 2HYZA 2C03A 1N4RA 4Q94A 1WOLA 3VLFA 5EKQD 1UG3A 3I4GA 2ILRA 3FOPA 4QFVA 4Q69A 2M4EA 2WZFA 2WMNA 1NP7A 3AG2E 2VGXB 1DOVA 1WATA 3GYZA 4KVMA 4XQ1A 4U0UA 1N94A 2C0LA 4JC8A 3RKOF 4FU3A 3FUDA 2IEJA 3MYVA 3U3BA 1VOMA 4G7OF 1T6UA 3W8IA 4AE4A 3ZQVA 1Q0FA 1AUEA 4GTMA 4UI9J 1TFKB 4U96D 3UT8A 3C3RA 3RO3A 2ONDA 5A6JA 4JHKA 5LFAA 3TWXA 1Y4CA 3EH2A 4U5EE 5JA4D 3HVEA 5JJTA 4CCAA 3MKQA 2LSEA 1BI8B 5FQ7A 1A7VA 1LPEA 2GRQB 4CIPA 3C72A 1RMVA 1H7IA 3ZHEA 2F22A 2I1KA 4HNAD 2Y0BG 1RKCA 3CHOA 3UKUG 2YNQA 3IBEA 4LUNU 1U89A 3CVLA 3D9NA 1BI7B 2CNWD 1M56C 3TG5A 1JCSA 4HFKB 3TWTA 1J8YF 3IQCA 5KJMA 4HRLA 1MZCA 2QYUA 4JHJA 4KMOA 4C9BB 2B0JA 3ENEA 2WM9A 4ACLA 4AK9A 3ITFA 3HKKA 4XX5A 3RW0A 2Q7RA 3AS8A 3JZ0A 3URZA 1UW4B 3N2ZB 4PH4B 3V5XA 3IHUA 4XPXA 4OVUA 1VLSA 3JCUQ 2NXPA 4EIYA 3CVXA 2CW0F 2RSEB 4GPMA 1OWMA 4DVYP 2YQYA 3K6BA 4NRHB 3PZDA 3IHVA 3HXCA 3UIOC 1TNBA 3N0TA 4GMRA 4MKTA 1QBQA 4O1OA 4B93B 4E18A 3KEAA 2IBFA 3TJ5A 1Z3IX 4OAUC 4N6HA 1O5HA 2I8BA 2Y3BA 1O1TA 1OY3D 1KT1A 3PNLB 3FU5A 3U8VA 4MNDA 3TOLA 4O6YA 5TJ5E 1SMYF 2ZPAA 2RD0A 1HMDA 2HKVA 4JD2G 4ZHBA 1MQSA 2WXRA 3NYLA 3HDXA 5CRVA 3UNGC 3ZTZA 3UPVA 2GW1A 3GANA 5KJNA 2X6KA 5BXUA 3CKCA 2XQ0A 5A6BA 3Q7FA 4FLHA 2KC7A 4A55A 2KCLA 2VSOE 3C62A 2H8AA 3R2PA 2Y69E 3QOUA 4O79A 3C7JA 1TJFA 1M2VA 3LJ3A 3SXKA 3PZ2A 2XZDG 3DEPA 3FEXA 4BJ1A 1MQVA 1VTMP 2QE9A 3NF1A 3Q7AA 4GYYA 4G7HF 2PX3A 4F6RD 1VYIA 1H0AA 3QNKA 1TR4A 4V3IA 4O1PA 3UGOA 4TXQA 1U2VG 1APCA 3PMRA 3CHQA 3S7DA 3OXLA 2OEXA 3T6GB 2H7BA 3LY9A 4DJAA 4GZDA 4MVZA 2ZXPA 1IXVA 3OXFA 1S63A 3U9JA 4CIHA 2L6FA 2IFUA 3FUFA 2OJED 3A11A 1YYXA 1OCZE 5EK0A 3BUAA 4DBQA 2VSNA 1JPNA 3TJPA 1EI7A 1JPLA 1MX6A 4GTTA 5B1BE 3MZLB 2MYSA 3RFYA 4JC7A 4JEBA 3T5XA 2IF4A 5B3SE 4FJYA 1HG5A 4OVVA 5D92A 4GTPA 1Q0KA 5F5FA 4AIFA 4BTAA 5D0OD 4IYPA 4G78A 1E85A 4J6IA 4A1GA 3ABKC 3OTNA 3U9MA 2P9LG 1E83A 1EDUA 2P9KG 2HO1A 4EWCA 2NSFA 4UWKA 4DX1A 4EZKA 2XGMA 4DLQA 5COMA 3UIPC 1N1CA 5CCMA 3ZEFA 1YAUO 3FWVA 4LNUD 1TFOB 4DBRA 1D0XA 3FTVA 2WXHA 3K1HA 2X38A 1JR8A 1LM3B 3OAWA 4BEPA 1G8XA 1E84A 2KJGA 3TL5A 1Z63A 3RIPA 3S28A 1L5JA 1ZHZA 3ZTMA 2V3CC 2WXMA 5ENPD 3V2XA 3DWLG 1V54C 4K03A 4CYMD 1TWHA 3D9MA 4BT9A 1YZCA 3SNHA 3D9OA 1WASA 4G8LA 4I1OB 1IZMA 1M2VB 5AC4A 3ZYQA 2A5UA 2KK1A 2OV8A 4L9PA 4MTFA 2XGSA 4XKCA 5EIDA 4BT8A 4DI4A 1UN9A 1SA5A 4K5BA 4PJJA 4CGWA 4RD9A 2QC9A 3KMIA 5ENNA 3S7BA 4AV7A 4RG6A 5FCLA 4KNWA 1SZ9A 3H2VA 5BQGA 3U3FA 3BG1B 2EPNA 1X5BA 4HOQA 4MVRA 2IXOA 1MHQA 1NSGB 1NA0A 4O6FA 5LCWC 4HQDA 3IQTA 4O6MA 2CYDA 3TWRA 3MV2B 1JWGA 4EZLA 3ULYA 1K3ZD 1LD8A 1UJKA 3RO2A 1KPSB 3AGUA 3ZN3A 1AEPA 5K0IA 2Y3DA 4PK4A 3UGPA 3LUTB 2L6JA 1CPRA 1OCOE 2HR2A 4YDWA 2R25A 1FVFA 1N4SA 2J8SD 2WXNA 4XE0A 5KYWA 3M15A 3WHNA 1JUQA 4JEHA 4IWBA 3RVZA 2X6JA 3DPDA 3CK8A 2YKZA 2DGJA 5EN5D 3JQ0A 4DI3A 4I1MA 4WJ0A 5BNWA 3G2UA 2IXPA 3L08A 3HIZA 2WVOA 1HX8A 5EHHA 3QWVA 3Q79A 3IXEA 3B7SA 4A4AA 5AC5A 2Y3AA 4J8DA 1QNFA 2NUPA 1D8DA 2CG2A 3G4XA 3BU8A 1OT8A 3MX3A 1HXIA 4I3MA 3PEVB 2B0OE 1DOWA 3LJNA 1Y8MA 2PFDA 5JVEA 1ZBPA 3R7QA 2L7AA 4GEHA 2P9IG 1I4YA 2R7UA 3MKRA 2L0IA 4G24A 4Q96A 4DJ9A 4BY6A 5T3RA 4XWJA 2EIJE 4FA6A 4I6GA 2OVBA 1TNZA 1MNEA 3H65A 1UG7A 4WWOA 1WGWA 1E96B 5JLIA 3IEGA 3V7OA 5FQ6A 5L0HA 5T3WA 4HRNA 4N3BA 2YHSA 2BKGA 3US6A 3FUNA 2H7VC 3V30A 1CGOA 1ELWA 1K1AA 5F5HA 3B7UX 2Z15A 4IRUA 3TJ6A 1KZPA 1O1RA 2HJ3A 4C48B 4XZ4A 2IXNA 3MKQB 5BV0A 3HXEA 2R5SA 3ZPJA 3DPYA 5JJ6A 2QTVA 1NL4A 4JIOA 3EZIA 2VQ2A 2A6HF 4ULWA 3ZVVA 4CRWA 4PS3A 2J7PD 1UFBA 4U5FE 4CS7A 3GM2A 2HMZA 4AL0A 2X3MA 4EQFA 3FMSA 4H7YA 3NYJA 4AXHA 4N3AA 3CK7A 4FP7A 3AG4C 5JRAA 4CGVA 1CGME 4BWRA 3IQ6A 4FLBA 4URKA 3I4UA 1YYHA 2A4ZA 5ENOD 5JP7A 2Y3GA 2EILE 2OKUA 5EYPF 2AP3A 4YVQC 3PNTB 3EG9B 2HMQA 4AP2A 4E7SA 1Z5SC 4GCOA 5HQ8A 4G8KA 2I9CA 1C02A 2Q9BA 3CQGB 4KYOB 2Q9AA 4K7BA 2E0IA 2I1JA 3EH1A 5FJYA 2X0CA 1X81A 1EYHA 1JPJA 2J4BA 3K66A 4B94A 1QKRA 3DSWA 4EUKB 1OCCC 1G3NB 3UMVA 1OCZC 3F47A 1D8EA 2AVKA 4I9CA 1BLXB 4TV3A 2LP4A 4KXKB 1SF8A 2EPMX 1H6OA 3QARA 3DBSA 4ME2A 3U4TA 1ZHXA 2EIMC 3PE3A 4K0DA 1QSPA 3VAYA 4C7OA 5L0CA 2DYRE 2GRPB 3QJZA 2UY1B 2AXVA 2GGFA 2XEHA 5A69A 1ORSC 3Q7LA 3C3QA 3J5PA 5FQ8A 3B0VC 4BJ6A 3CGHA 3T9OA 3MYFA 3PCVA 2VCCA 1OW8A 2P6VA 4WAFA 2ZGGA 3ABKE 3RQFA 4QI2A 5A6KA 4FAPB 4XPYA 4YJWA 2Q00A 1JAFA 3X2QC 3NAWA 5L0JA 1D0YA 4NC3A 5C1DA 4N5QA 5FZSA 3SF4A 3LEOA 3K1IC 4GAAA 4GCNA 2WXIA 3FXHA 3FH8A 4I9EA 3DJNB 3G2SA 3ATPA 1RKEA 2WB7A 3Q15A 2EPLX 1N4QA 2YHEA 4MVOA 2VSXE 2J0XA 3PH0C 4DK5A 3ABLE 3KSQA 1E8WA 4G7ZF 4CSAA 4D4XA 3PZ3A 2XS1A 4KBLA 3L6AA 1XNFA 3CR3A 2JPUA 2J46A 3GZSA 4A1SA 4AOFA 2R7OA 3RIBA 2YL7A 1QZXA 1VMAA 5KYUB 5IY5C 2WXLA 4HXIA 3E70C 3NKDA 3E32A 1P5QA 3NMJA 5AJDA 3RF3A 3HHMA 4MW3A 4R32A 2L6GA 3HXBA 3QC1A 4C7OB 2XM0A 4O60A 4GA0A 4GZCA 5AQ7A 4P6IC 3KAEA 3PRZA 3CIAA 2LUHA 1A7DA 3WG7E 2PF4E 4UQZA 1DC2A 2J7PA 1VLTA 2EIJC 4BJ6C 1BBHA 4C3DA 2R7WA 1DCEA 3SFZA 1IHBA 4N4WA 2QYJA 1MX2A 4WNFA 4JZAA 2Y1LE 3FH5A 2AJAA 3QDNA 3EGXA 2GWWA 4MRUA 1HFAA 1U0BB 4CZ2D 2YLGA 3W9GA 4N2QA 5DLJA 3JRMO 4JPSA 5KBAA 1MX4A 1QZ2A 5FZRA 4U07A 3TGOA 4KBQA 1MNDA 4EHMA 3LAYA 1WG0A 1U6HA 2HM8A 3HVEB 3ULQA 3GWNA 4LSZE 5T1DB 3PE4A 1QLEC 2PX0A 1RCPA 2OQMA 1LIHA 4A3VA 2KNHA 5EDSA 5CEDB 1TWAA 3ONLA 3ASDA 2DI3A 4L2YA 3DXJF 5DQZA 2XGOA 4ILGA 2OG2A 1PD1A 1T6IA 2Y3HA 3AGTA 4HE8D 3VRCA 1WDYA 2V5QC 4K5AB 1S64A 1Z6TA 3KYJA 1H6PA 3MA5A 3JSZA 4G11A 5CI9A 5LX8A 1INZA 2GFHA 4JEAA 2R02A 5E3CA 1LS1A 4CS8A 3JTLO 3AJIA 3L54A 4L1BA 3SZ7A 1D1BA 2QZAA 3UKRG 3OA1A 3GM3A 3W4YA 2LNIA 3ESLA 3KD7A 4L7TA 3DSTA 2R7XA 1NFIE 5ANLA 2J09A 2VGXA 4NIKA 2HSBA 1OCRE 1Z23A 1VDYA 2QY7A 2IM8A 4FESA 4UDVA 4IJJA 3O55A 5JUAA 4R7LA 5ARGA 4KNVA 1TQGA 3T8MA 5CCLA 2ETCA 3BRJA 5BUOA 3BEHA 2XL4A 3KH2A 2IO2C 4Z9IA 4W9RA 2HZ8A 1W2WA 3WAQA 4GYOA 3TWVA 2W4MA 1R5ID 3RKVA 1A5EA 1G4WR 5KCMA 3S7JA 3O4ZA 2MHKA 1FAPB 3F6QA 3C8GB 1BD8A 4JJFA 2DYRC 4Q5SF 2EILC 4U5BE 2XLMA 3LLKA 3DD7A 3OEOA 3LS1A 4I17A 4CDAA 5KYWB 1OQCA 3DKAA 4W8PA 1WY6A 2Y4TA 3MGBA 2PZIA 1NG1A 1T01A 3Q47B 2MRIA 4XI0A 1OXKA 3U66A 1ZHTA 4H7XA 3TWSA 1WAO1 4J7WA 5FWQA 4CT4A 4QQIA 3Q6MA 1W3BA 2LSVA 4NURA 3CSKA 1KLXA 1HY5A 3DJUB 4J8FA 2VCBA 2H6IA 4XKBA 3VLDA 1ELRA 3CVNA 3S29A 3CHSA 5A6AA 2KW3C 2FAPB 3SXZA 2J8WA 4C0EA 3WODF 1TNYA 4ILIA 5FQ4A 2IQCA 4JXTA 4GMLA 5E33A 5CIVA 3UMKA 5B1AC 1H6KA 2AWCA 4JHRA 3CQCB 3ESKA 3ABME 1SA4A 2LAIA 2FO7A 3ASHA 2Y4UA 1SYQA 3CSTA 4BJTA 1KNYA 2QFCA 2WXJA 4HRMB 2XL6A 4DUIA 3KEZA 2ASRA 3I5QA 1K1BA 5KNGA 3E33A 3R7RA 4HORA 4JTCB 1HE9A 2V4HC 2NC9A 2Q3TA 1IHGA 3PDNA 3FUHA 3FEYA 4A3TA 3SZRA 4CDMA 3E4BA 4H4KC 3CVQA 1H19A 3CVYA 2NSGA 4WABA 2NG1A 3AS4A 3PZ4A 3NZSA 1KU2A 4YDYA 2HV7A 5DVWA 3JXIA 4MS2A 4LDRA 4MS6A 4B8AA 3DE8A 1JOGA 3DM5A 2WPVA 3N24A 4NTAA 1KZOA 3SNXA 5IY5E 2EIKC 4L2LA 4MVMA 2PM7A 1Z3YA 4YT5A 1E2XA 2QUPA 3FTUA 2EIME 1FT2A 5E76A 3CVVA 4O7GA 2J9WA 3D9LA 1SZAA 2ZXWE 3Q4AB 1XGWA 5JT4A 2LCHA 3R9MA 4ZLCA 5KYYA 1H2UA 1K05A 2CHZA 4NQ0A 3POVA 3G50A 1VK5A 2GDCA 5BPPA 5G04C 1TJCA 3CSFA 4RVBA 2XLVA 3FUJA 2ICWG 1E8ZA 4BFRA 3LEVA 2DWZA 1IQRA 1E8XA 3MBGA 4LERA 3GEHA 1ZW2A 4OIRF 3Q78A 2XENA 4IAQA 5L3VA 3NOGD 2ETBA 4DPRA 5E75A 4HOSA 4ZFHA 4WUYA 4DOZA 2FI7A 4APOA 2L0TB 2YWAA 3K33A 4LG6A 3CHRA 1QVXA 2J0WA 3UM3A 4AE4B 4FC8A 3EFOA 3D9PA 1LTXA 4GB9A 3EGDB 1O87A 4NTBA 3LDZA 3TG4A 1HG2A 3V5ZA 3UINC 3D9IA 3HNLA 4BETA 3D9KA 4LDQA 4YDEA 3ZNGA 2XRYA 2V8SE 3B95A 5DS4A 2R05A 2LFDA 1OR2A 3P2BA 2CFZA 4GA2A 4XEFA 5HSWA 2KQ9A 1D1CA 1ZHYA 4NCQA 1NA3A 3NB2A 3M1CB 5BQIA 3DAFA 1YCSB 4I2ZA 3JSEO 4J0UA 3ULEG 3Q9NC 4DRXE 3MFNA 1D1AA 2OCCC 2P0NA 4F3VA 2CHWA 3GM1A 2UUIA 2JABA 3LXUX 2YL1A 5EGYA 5T8IA 3C8GA 4MTGA 1LKXA 3V31A 4DX7D 3APDA 4F7AA 1TN6A 1OXJA 3B71A 4C3EA 1TN8A 2V0PA 2BE5F 4GTVA 3HLZA 3F46A 2OEVA 2PNOA 3T5VA 3Q75A 1NU7D 2F8XK 1V55E 4F4BA 5CEAA 5D2MC 2VTBB 2YLDA 3HTKC 3RRNB 4U04A 2WXFA 2HUJA 3L1MA 4HOUA 3TD7A 4ZLDA 1TR2A 3DXKG 2X51A 4BESA 4XEKA 4HLLA 1ST6A 1WWPA 3UMIA 1RW2A 2HS5A 2VH3A 4IB4A 3EIJA 2YEVA 3SP1A 3HRAA 4Z9JA 4B6IA 3DRAA 3O10A 3ZFWA 2XLOA 4GTRA 2YQ8A 4OAVB 1D0ZA 3NG1A 4FHJA 3CAXA 3TOMA 2IXMA 4I2WA 4MVQA 3T6JA 2L81A 4N06A 1RJ9B 2GA0A 3ZVRA 5AIJA 5CBOA 1BZ4A 3S84A 3G2WA 3LS8A 2CNWA 4RSYA 4JTDB 2XSEA 3HXDA 1EKYA 3B13A 3FUEA 2KCKA 3LY8A 2LXLA 4FHKA 3RYLA 2WXGA 1YDIA 3MJWA 5FT9A 3DE9A 4U95D 1IYGA 5ENSD 2YINA 5COFA 2JEKA 3PHF2 2D4UA 1R4TA 3QK0A 1MMDA 2XCBA 2L9BA 1HW2A 4CS9C 4CDRA 3U0CA 5F28E 1E7UA 2F0YA 4C3BA 5FZQA 3EU5A 1QYMA 3U8PA 1Z7Qc 4BJ5A 4APFA 5AQ9A 2FF4A 1NBBA 4YN0B 4OINF 3FTWA 2YZSA 2CG3A 2KZTB 1HS6A 1NFOA 4KZ0A 1NI1A 1V4AA 2UUHA 1OWOA 2DCPA 2J07A 2WL8A 4X8QA 2CGEA 3EJNA 1FFTC 2XZTG 4DX2A 2CHXA 4YK5A 4J30B 1FFHA 2PL2A 1GM5A 5AAOA 1OW7A 4UWLA 1H9GA 3P1UA 2FEZA 2CCYA 1T6QA 3FAJA 5D91A 2WB2A 3V2OA 3ASGA 4AY5A 3CVWA 3I5PA 1OKKA 1MMNA 5CECB 5EX3A 4DX6D 3R7CA 5G55A 5G04J 256BA 5J90A 1QQ3A 4JCZA 2KGOA 2OEWA 2PBEA 4GA1A 2J45A 1EPUA 4GZ3A 3CZ6A 3X1OA 4DRHB 4GTSA 3QTHA 3IQ5A 2LSUA 3EGDA 5A23A 3ML8A 3LYAA 3FH7A 3S27A 3DMDA 3U2MA 5EYLA 5LCWJ 3LESA 1UN8A 4TXPA 3AU5A
chains in the Genus database with same CATH topology
3VTYA 3PS6A 3QWPA 2KCVA 4U5GA 1FTSA 4ANJA 4E85A 4WNGA 4B8CB 2VSYA 5AENA 1OCOC 3FULA 1Z5ZA 2CDQA 1U3DA 2J49A 4G26A 4OIQF 4UI9K 3UUXA 2R7SA 2XRZA 1E90A 3QWWA 4I43A 1PAQA 3UT4A 4QI0A 4GPKA 4YWQA 2C04A 5BT1A 2WVNA 1VYKA 3ZGQA 4A2NB 2IOLA 3IV0A 2Y39A 3APFA 1TEZA 2KZTA 4Y6WA 2I6HA 4BX8A 5FTPA 3I3NA 4MLPA 3EPVA 1HO8A 3RRUA 2R59A 3L17A 2ZXRA 4EZJA 1V55C 2PM6A 1FCHA 2FFHA 4UQYA 3SGHA 1E8YA 3HJCA 1BR2A 2XCCA 2W45A 3LVRE 3U9WA 4AX2A 1HU3A 2C2LA 3IHYA 3NZUA 4LCTA 2JLBA 2BTDA 3SD5A 3AG3C 1JWFA 3PUJA 3ECSA 3W2VA 4BTBA 2M63A 3FTSA 4PDXA 5KYYB 3U64A 2DYSC 4LLCA 3SBSA 1FMWA 3SI5A 4ATGA 4N2SA 3S0XA 4JZYA 4F53A 4CBEA 4UWHA 3C98A 4D10C 3Q49B 3AQCA 4M3OA 5C2YA 1NZNA 3BEEA 4YVOA 3NKEA 3DM9B 1TKNA 5G2NA 2J9QA 4KT6B 3TXNA 1H2TC 5EX0A 1OWPA 2EINC 3LJBA 3CK9A 3NRHA 4U5DE 3UQ3A 3DAGA 3ZG1A 3RRMB 2IYLD 4C0MA 4PS8A 3ABLC 2XXAB 2V4LA 5BW8C 4OD4A 4J8SA 2XPZA 3BG0B 5LP0A 3SBTB 4WNEA 5KYXB 3SYNA 1U3CA 3FHEA 3LKUA 4WWPA 3EFOB 4I6JA 2J4DA 3FHDA 3B0PA 5DS6A 3GW4A 3UR3C 3EDTB 1IW7F 2X6IA 4BJ5C 3FTZA 5LOZA 4RDAA 3NQPA 3CEQA 4CS9A 3O39A 2R7VA 2VGYA 4PS7A 2D5RB 4I44A 4PJLA 1NZEA 3VTXA 2JD3A 2FULA 2IONA 2WXPA 4CS8C 1M57C 4XLNF 2IOQA 1QQEA 4ACKA 3K9IA 4IULA 4EPZA 5KYXA 4XTKA 2VJ8A 3QMKA 5T4YA 2AXUA 3VLEA 4B0ZA 2CFUA 3ASFA 2NUTB 4Y6CA 2X6FA 2V26A 1PCXA 5KJLA 4JA7A 3RU0A 4PFPA 1BR1A 2J08A 3GZ2A 1OCRC 2WVQA 5B1BC 3N71A 5KYNA 1MMGA 3L34A 4TUUA 3TXMA 2R7RA 2OOEA 3JRTA 1PY1A 3LY7A 2A6EF 4P29A 2XXAA 4OIPF 3LCAA 5D0QD 4I6EA 3L16A 5ARFA 3O48A 4ANVA 3FUIA 3VYWA 2E87A 1S0PA 2KATA 2A68F 3Q5MA 1FMVA 3CLJA 2W9YA 4LLEA 3QB2A 3ZXSA 2KM4A 5G05C 1GW6A 4HFGA 4YT4A 3ASNC 4W8KA 3PREA 4ILHB 4FADA 4KZCA 5T3TA 3AG1C 1DNPA 3ML9A 3JQ1A 3Q6NA 3OWTA 4M63A 4AEZC 3EGXB 3B0UX 4KC9A 4LACB 3DZAA 3TAXA 4HFFB 2R7TA 5B3SC 3GODA 4HEAJ 3QAQA 4AJWA 4XI9A 5DS5A 4U63A 4PFOA 4J32B 1OKKD 3E9VA 1PD0A 3IKOB 4PUCA 4YNDA 3ZYLA 3FY4A 5L3QA 4U0ZA 2VTBA 1A17A 1N54A 4J8EA 3KL4A 3B7RL 3FFLA 3G2VA 4I1AA 5KJKA 3NYMA 4UWGA 2HV6A 4G2VA 2L9JA 4UQXA 3MCXA 4L23A 3FTXA 2NUTA 3JYSA 2WXQA 2WXKA 4JEUA 4NY3A 3EZHA 5M72A 2NSZA 4HVBA 1LVKA 2C0MA 4B89A 4KI2A 4WWNA 4WNDA 4N39A 3B7TA 3OXGA 4GYWA 4FULA 4U0SA 4DVZA 4G1TA 4BG0A 3S7FA 4E6HA 1ELKA 3KS2A 4PJNA 3AQBA 4OD5A 3SEOA 3PUKA 3W2WA 2FGYA 3ZYMA 4ANWA 5CMWA 3ASOC 4FWVA 4ANXA 5JJ7A 1B89A 4KVOA 3FDQA 3W8HA 3FVYA 1NU9C 3FU0A 3KKBA 3B9QA 4U8HA 3Q7GA 3NDBB 3CV0A 2ZXWC 2J9UA 4CEMA 2VB6A 1E7VA 3ONKA 3LLIA 2EQXA 1SZIA 2BF0X 1UJJA 4EBBA 3JT1A 1HH8A 2FBNA 3D3MA 1J8MF 3JUIA 5BV1A 4UI9C 2A69F 4BX9A 1RJ9A 1LF8A 4G23A 2A1DD 3MEKA 2UY1A 4MQ9F 3CHMA 1OUVA 2I2OA 3L22A 4ANUA 3FP3A 1MMAA 2O9XA 3AG2C 3ABMC 3AU4A 2VYIA 1YA0A 3FU3A 2R17C 3CKBA 3PVLA 2PP4A 4JW1A 3ZIMA 3MV3B 3RK6A 4GU5A 1BR4A 3ZC4A 3EQLF 1BPOA 4AVXA 5CHEE 2OVFA 3K7DA 4EBAA 4AM9A 3RH3A 4GZ6A 1HE8A 5DQTA 2AXZA 1OWLA 1Z3XA 5JHAA 2GRMA 3PEUB 1M2OA 2AWIA 4GZ5A 2WZLA 2V5FA 5BUZA 2UWJG 3JCKC 2AW6A 1Y6IA 3AS5A 3S2AA 1HF8A 3EHNA 1HZ4A 4LEUA 3LPZA 2MOWA 3T6BA 3ZW3A 4EBAG 5E2QA 2WQ7A 2VASA 2XRHA 2P58C 4OIOF 1ZU2A 2DBAA 2WMOA 1H2VC 1PC2A 1KT0A 2PQNA 4LRZA 4XLPF 3ZYKA 2PQRA 2J9VA 2G62A 4K0RA 1TWGA 5A7DB 2LAHA 4UWFA 3FU6A 3HYMB 3LEWA 4HLEA 1N52A 2IJGX 3FUKA 4TRQA 4RG9A 2XEVA 2ZXOA 4JVSA 2WQHA 3EHMA 3IEEA 4E7ZA 1Z6AA 5J08A 1WM5A 1EF1C 2XPYA 4AY6A 3ZRHA 1SQMA 4HS2A 3D9JA 3CVUA 2WQ6A 3EG9A 2R7QA 3QZCA 4U5CE 3WXXA 2MWQA 5AYWD 2AVPA 5CI8A 2WZGA 1ZU4A 3CQZA 4YT2A 2RG8A 4OYSA 1S7ZA 3APCA 2WVIA 4JCHA 2E2EA 4FX5A 2Q7FA 4BSXA 2G3KA 4IN3B 1ZHWA 3FUMA 3FDHA 5G05J 4U5HA 3UX4A 5DBKA 2GRLA 4Q4ZF 5ANRA 3LNRA 3UMHA 2LO6A 3WG7C 4GMJA 3SHFA 3ZHEB 3L13A 4QDLA 3G2TA 3GZ1A 4JL0A 2DIWA 2Y69C 4ABNA 2QY9A 4RBNA 4EECA 4YT8A 4JJGA 3L0IA 4IAOA 3JYHA 4O6NA 4JA9A 2XHEA 4DLOA 4GYTA 4CDNA 4G0HA 2P7VA 1IQUA 1TWCA 2XPIA 3MLGA 3UT7A 4Q7CA 3ZSUA 3CVPA 1ZU5A 5HI7A 4BEJA 4N3CA 4HOTA 2NUPB 2YHCA 4FJZA 1DVPA 4NACA 5KYUA 3FTYA 4CSAC 5A6CA 3LS0A 2BUGA 3ZIBA 2W4BA 1ZYRF 1OWNA 5E3AA 3U3WA 5AJLA 3EIQC 2G3VA 5DIZA 3RJVA 3R9AB 4PJMA 2IOSA 3O6XA 1FVHA 3CHPA 4N5CA 5CMYA 2Q9CA 3T4RA 4CT0A 2WXOA 2H7OA 4X0RA 5JHBA 4F1SA 3LVQE 4JURI 3QKYA 4XIFA 2IU1A 2X6HA 3I4RB 2ZU6B 4G25A 2HYZA 2C03A 4Q94A 3VLFA 5EKQD 1UG3A 3I4GA 2ILRA 4QFVA 4Q69A 2M4EA 2WZFA 2WMNA 1NP7A 2VGXB 3GYZA 4KVMA 4U0UA 2C0LA 4JC8A 3RKOF 4FU3A 3FUDA 3MYVA 1VOMA 4G7OF 3W8IA 4AE4A 4UI9J 3UT8A 3RO3A 2ONDA 4JHKA 5LFAA 3EH2A 4U5EE 5JJTA 3HVEA 4CCAA 3MKQA 2LSEA 5FQ7A 3ZHEA 2I1KA 3CHOA 2YNQA 3IBEA 4LUNU 3CVLA 3D9NA 2CNWD 1M56C 3TG5A 4HFKB 1J8YF 5KJMA 4JHJA 4KMOA 4C9BB 2B0JA 3ENEA 2WM9A 4ACLA 4AK9A 3ITFA 4XX5A 3AS8A 3URZA 1UW4B 3N2ZB 4PH4B 4OVUA 3JCUQ 2NXPA 3CVXA 2CW0F 1OWMA 4DVYP 3K6BA 4NRHB 3PZDA 3IHVA 3N0TA 4MKTA 1Z3IX 1O5HA 2I8BA 2Y3BA 3PNLB 1KT1A 3FU5A 4MNDA 4O6YA 1SMYF 2ZPAA 2RD0A 1MQSA 2WXRA 3NYLA 3HDXA 3UNGC 3UPVA 2GW1A 3GANA 5KJNA 2X6KA 3CKCA 2XQ0A 4FLHA 2KC7A 4A55A 2KCLA 2VSOE 3QOUA 4O79A 1TJFA 1M2VA 3LJ3A 3FEXA 4BJ1A 3NF1A 4GYYA 4G7HF 2PX3A 1VYIA 1H0AA 3QNKA 4V3IA 3UGOA 3PMRA 3CHQA 3S7DA 3OXLA 2H7BA 3LY9A 4DJAA 4GZDA 2ZXPA 3OXFA 4CIHA 2IFUA 3FUFA 4DBQA 2VSNA 1JPNA 3TJPA 1JPLA 3MZLB 2MYSA 3RFYA 3T5XA 2IF4A 4FJYA 1HG5A 4OVVA 5D92A 5F5FA 4AIFA 4BTAA 5D0OD 4IYPA 4J6IA 4A1GA 3ABKC 3OTNA 1EDUA 2HO1A 4EWCA 4UWKA 4EZKA 2XGMA 4DLQA 1N1CA 5CCMA 3ZEFA 3FWVA 4DBRA 1D0XA 3FTVA 2WXHA 3K1HA 2X38A 3OAWA 1G8XA 3TL5A 2KJGA 1Z63A 3RIPA 3S28A 1L5JA 1ZHZA 2WXMA 2V3CC 1V54C 4K03A 1TWHA 3D9MA 4BT9A 3SNHA 3D9OA 4I1OB 1IZMA 1M2VB 3ZYQA 2A5UA 2OV8A 4XKCA 2XGSA 4BT8A 4DI4A 1UN9A 4PJJA 4CGWA 4RD9A 3KMIA 5ENNA 3S7BA 4AV7A 4RG6A 5FCLA 4KNWA 1SZ9A 3BG1B 1X5BA 4HOQA 2IXOA 1MHQA 1NA0A 4O6FA 5LCWC 4O6MA 3MV2B 1JWGA 4EZLA 1UJKA 3RO2A 3ZN3A 2Y3DA 4PK4A 3UGPA 2L6JA 2HR2A 1FVFA 2WXNA 4XE0A 5KYWA 1JUQA 4JEHA 4IWBA 2X6JA 3DPDA 3CK8A 2DGJA 3JQ0A 4DI3A 4I1MA 4WJ0A 5BNWA 3G2UA 2IXPA 3L08A 3HIZA 2WVOA 1HX8A 5EHHA 3QWVA 3B7SA 2Y3AA 4J8DA 1QNFA 2NUPA 2CG2A 3MX3A 1HXIA 4I3MA 3PEVB 1Y8MA 2PFDA 1ZBPA 3R7QA 4GEHA 2R7UA 3MKRA 2L0IA 4G24A 4Q96A 4BY6A 5T3RA 4XWJA 4FA6A 4I6GA 2OVBA 1MNEA 3H65A 4WWOA 1WGWA 1E96B 3IEGA 3V7OA 5FQ6A 5T3WA 4N3BA 2YHSA 3FUNA 2H7VC 1ELWA 5F5HA 3B7UX 2Z15A 4IRUA 4XZ4A 2IXNA 3MKQB 5BV0A 2R5SA 3ZPJA 5JJ6A 2QTVA 3EZIA 2VQ2A 2A6HF 4ULWA 3ZVVA 4CRWA 4PS3A 2J7PD 4U5FE 4CS7A 2X3MA 4EQFA 4H7YA 3NYJA 4AXHA 4N3AA 3CK7A 4FP7A 3AG4C 4CGVA 4BWRA 4FLBA 4URKA 3I4UA 2A4ZA 2Y3GA 4YVQC 3PNTB 3EG9B 4AP2A 4E7SA 4GCOA 5HQ8A 2I9CA 2Q9BA 3CQGB 4KYOB 2Q9AA 4K7BA 2E0IA 2I1JA 3EH1A 5FJYA 1JPJA 1EYHA 2J4BA 3K66A 4B94A 1OCCC 3UMVA 1OCZC 3F47A 4I9CA 4TV3A 4KXKB 1SF8A 3QARA 3DBSA 4ME2A 3U4TA 1ZHXA 2EIMC 3PE3A 4K0DA 3VAYA 4C7OA 3QJZA 2UY1B 2AXVA 2GGFA 3Q7LA 5FQ8A 3B0VC 4BJ6A 3CGHA 2P6VA 4WAFA 4QI2A 4YJWA 3X2QC 1D0YA 5C1DA 5FZSA 3SF4A 4GAAA 3K1IC 4GCNA 2WXIA 3FH8A 4I9EA 3DJNB 3G2SA 2WB7A 3Q15A 2YHEA 2VSXE 2J0XA 3PH0C 4DK5A 1E8WA 4G7ZF 4CSAA 4KBLA 3L6AA 1XNFA 3CR3A 2J46A 3GZSA 4AOFA 2R7OA 3RIBA 1QZXA 1VMAA 5KYUB 5IY5C 2WXLA 4HXIA 3E70C 3NKDA 1P5QA 5AJDA 3HHMA 3QC1A 4C7OB 4GA0A 4GZCA 4P6IC 3KAEA 3PRZA 3CIAA 2PF4E 4UQZA 2J7PA 2EIJC 4BJ6C 4C3DA 2R7WA 3SFZA 4WNFA 4JZAA 3FH5A 3QDNA 3EGXA 4MRUA 1HFAA 4N2QA 5DLJA 4JPSA 1QZ2A 5FZRA 4U07A 3TGOA 4KBQA 1MNDA 3LAYA 2HM8A 3HVEB 3ULQA 5T1DB 3PE4A 1QLEC 2PX0A 4A3VA 2KNHA 5EDSA 1TWAA 3ONLA 3ASDA 4L2YA 3DXJF 5DQZA 2XGOA 4ILGA 2OG2A 1PD1A 2Y3HA 4HE8D 1Z6TA 3MA5A 3JSZA 4G11A 5CI9A 5LX8A 1INZA 2GFHA 5E3CA 1LS1A 4CS8A 3L54A 4L1BA 3SZ7A 1D1BA 3OA1A 2LNIA 3ESLA 3KD7A 4L7TA 2R7XA 5ANLA 2J09A 2VGXA 1Z23A 1VDYA 2QY7A 4FESA 4IJJA 4R7LA 5ARGA 4KNVA 3T8MA 5CCLA 5BUOA 2XL4A 3KH2A 4W9RA 1W2WA 4GYOA 2W4MA 3RKVA 5KCMA 3S7JA 3O4ZA 2MHKA 4JJFA 2DYRC 4Q5SF 2EILC 4U5BE 3LLKA 3DD7A 3OEOA 3LS1A 4I17A 5KYWB 1WY6A 2Y4TA 3MGBA 2PZIA 1NG1A 3Q47B 2MRIA 4XI0A 3U66A 1ZHTA 4H7XA 1WAO1 5FWQA 4CT4A 3Q6MA 1W3BA 2LSVA 4NURA 3CSKA 1KLXA 3DJUB 4J8FA 4XKBA 3VLDA 1ELRA 3CVNA 3S29A 3CHSA 2KW3C 4C0EA 3WODF 4ILIA 5FQ4A 2IQCA 4JXTA 4GMLA 5E33A 3UMKA 5B1AC 1H6KA 4JHRA 3CQCB 3ESKA 2LAIA 2FO7A 3ASHA 2Y4UA 3CSTA 4BJTA 2QFCA 2WXJA 3KEZA 3I5QA 3R7RA 4HORA 2NC9A 2Q3TA 1IHGA 3PDNA 3FUHA 3FEYA 4A3TA 3SZRA 4CDMA 3E4BA 4H4KC 3CVQA 1H19A 3CVYA 3AS4A 2NG1A 3NZSA 1KU2A 2HV7A 5DVWA 4MS6A 4B8AA 3DM5A 2WPVA 3N24A 3SNXA 2EIKC 4L2LA 2PM7A 1Z3YA 4YT5A 3FTUA 5E76A 3CVVA 4O7GA 2J9WA 3D9LA 1SZAA 3Q4AB 1XGWA 4ZLCA 5KYYA 1H2UA 2CHZA 4NQ0A 3POVA 1VK5A 5BPPA 5G04C 1TJCA 3CSFA 4RVBA 3FUJA 1E8ZA 4BFRA 3LEVA 1IQRA 1E8XA 4LERA 4OIRF 5L3VA 4DPRA 5E75A 4HOSA 4WUYA 4DOZA 2FI7A 4APOA 2L0TB 3K33A 3CHRA 2J0WA 4AE4B 4FC8A 3EFOA 3D9PA 4GB9A 3EGDB 1O87A 3LDZA 3TG4A 1HG2A 3D9IA 3D9KA 2XRYA 2V8SE 5DS4A 3P2BA 2CFZA 4GA2A 5HSWA 2KQ9A 1D1CA 1ZHYA 1NA3A 3M1CB 3DAFA 4I2ZA 4J0UA 1D1AA 2OCCC 4F3VA 2CHWA 3LXUX 5EGYA 5T8IA 1LKXA 3APDA 4F7AA 4C3EA 2V0PA 2BE5F 3HLZA 3F46A 3T5VA 1NU7D 4F4BA 2VTBB 3HTKC 3RRNB 4U04A 2WXFA 4HOUA 3TD7A 4ZLDA 1TR2A 2X51A 1ST6A 3UMIA 2VH3A 3EIJA 2YEVA 3SP1A 4B6IA 3ZFWA 2YQ8A 1D0ZA 3NG1A 4FHJA 2IXMA 4I2WA 3T6JA 2L81A 4N06A 1RJ9B 3ZVRA 5AIJA 3LS8A 3G2WA 2CNWA 4RSYA 2XSEA 3B13A 3FUEA 2KCKA 3LY8A 4FHKA 3RYLA 2WXGA 3MJWA 5FT9A 1IYGA 2YINA 2JEKA 3PHF2 3QK0A 1MMDA 2XCBA 2L9BA 4CS9C 4CDRA 5FZQA 1E7UA 4C3BA 4BJ5A 4APFA 2FF4A 4YN0B 4OINF 3FTWA 2YZSA 2CG3A 2KZTB 1HS6A 4KZ0A 1OWOA 2DCPA 2J07A 2WL8A 2CGEA 3EJNA 1FFTC 2CHXA 2PL2A 4J30B 1FFHA 4UWLA 3P1UA 2FEZA 3FAJA 5D91A 2WB2A 3ASGA 4AY5A 3CVWA 3I5PA 1OKKA 1MMNA 5EX3A 5G55A 5G04J 5J90A 2KGOA 4GA1A 2J45A 1EPUA 4GZ3A 3CZ6A 3X1OA 2LSUA 3EGDA 5A23A 3ML8A 3LYAA 3FH7A 3S27A 3DMDA 5LCWJ 3LESA 1UN8A 4A1SA 3AU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JW1 A;  4I1O B;  4JVS A;  4I1M A;  4IRU A; 
#chains in the Genus database with same CATH topology
 5EIB E;  3VTY A;  2RD9 A;  3PS6 A;  3QWP A;  2KCV A;  2YRF A;  4U5G A;  1RKE B;  1FTS A;  4ANJ A;  4E85 A;  4CDV A;  1YVI A;  4WNG A;  4PAC A;  4B8C B;  2VSY A;  5AEN A;  1OCO C;  4DRI B;  3FUL A;  5B1A E;  1Z5Z A;  2CDQ A;  3TQO A;  1U3D A;  3DWW A;  4U7E B;  2J49 A;  2BL2 A;  2YL0 A;  3DI5 A;  4G26 A;  4OIQ F;  3Q9U C;  4UI9 K;  4UUC A;  2R7S A;  3UUX A;  2HJM A;  2OCC E;  3E30 A;  2XRZ A;  4TXR A;  4HB5 A;  1E90 A;  5AN8 A;  3QWW A;  4I43 A;  2J9B A;  5D66 A;  1PAQ A;  3UT4 A;  4QI0 A;  4GPK A;  4YWQ A;  2C04 A;  5BT1 A;  2WVN A;  5L0I A;  2KYH A;  1VYK A;  3ZGQ A;  4A2N B;  2IOL A;  3IV0 A;  2Y39 A;  5AGF A;  3APF A;  4N6C A;  1TEZ A;  2KZT A;  4Y6W A;  2I6H A;  4BX8 A;  4LDK A;  3U5S A;  1S70 B;  5FTP A;  3I3N A;  3NBN B;  4MLP A;  5GPG B;  3EPV A;  3KYI A;  1HO8 A;  3RRU A;  2R59 A;  3L17 A;  2ZXR A;  4EZJ A;  1V55 C;  3UM1 A;  2NPU A;  2PM6 A;  1FCH A;  1H6G A;  2EIK E;  2FFH A;  4UQY A;  3GEE A;  3SGH A;  1E8Y A;  3HJC A;  2P9P G;  1BR2 A;  2HSQ A;  2XCC A;  2W45 A;  4AL1 A;  4YL1 A;  2B6C A;  3LVR E;  3U9W A;  4AX2 A;  1HU3 A;  2C2L A;  4CX9 A;  3IHY A;  3NZU A;  4LCT A;  2MYO A;  2FO1 E;  2JLB A;  2BTD A;  3SD5 A;  4U8V D;  3ZWI A;  3AG3 C;  4NTF A;  1JWF A;  3PUJ A;  3ECS A;  2JX0 A;  3RQE A;  2I15 A;  3W2V A;  4BTB A;  3VF0 A;  5KWD A;  2M63 A;  3FTS A;  3T8K A;  3TUL A;  3K1I A;  4PDX A;  3E37 A;  5KYY B;  3D9H A;  1S05 A;  3SO8 A;  2DYS C;  3U64 A;  4LLC A;  3SBS A;  1FMW A;  2M64 A;  2HFI A;  2AWY A;  3SI5 A;  4IGG A;  2P9S G;  4ATG A;  4N2S A;  3S0X A;  1JMW A;  4JZY A;  5AAR A;  4F53 A;  1O3U A;  4CBE A;  3E34 A;  4UWH A;  3C98 A;  4D10 C;  3Q49 B;  3AG4 E;  2XLE A;  3AQC A;  4M3O A;  5C2Y A;  2ZD9 A;  1NZN A;  3BEE A;  4YVO A;  1RZ4 A;  3NKE A;  3DM9 B;  3MYI A;  2LIG A;  1TKN A;  2IY0 C;  5G2N A;  2J9Q A;  4KT6 B;  3TXN A;  1H2T C;  5EX0 A;  3JXJ A;  1OWP A;  2EIN C;  3LJB A;  3CK9 A;  3C18 A;  4U9E A;  3NRH A;  3S9O A;  4U5D E;  3UQ3 A;  3DAG A;  3FAP B;  3ZG1 A;  2XLH A;  3L8J A;  3RRM B;  2IYL D;  4C0M A;  3J5Q B;  4PS8 A;  3ABL C;  3HXF A;  1YA7 O;  2XXA B;  4J8Y A;  2P2C P;  2V4L A;  4P9F A;  5BW8 C;  4OD4 A;  4J8S A;  2XPZ A;  3ASO E;  3BG0 B;  5LP0 A;  2R03 A;  3SBT B;  4WNE A;  5KYX B;  3SYN A;  3RAU A;  2YLI A;  1U3C A;  3FHE A;  3LKU A;  4U8Y D;  4WWP A;  3EFO B;  4I6J A;  2J4D A;  3FHD A;  3B0P A;  4K1O A;  4HI8 A;  5DS6 A;  3GW4 A;  3UR3 C;  3TK0 A;  2L6H A;  4CDY A;  3EDT B;  1WN0 A;  3KPH A;  1IW7 F;  1GGQ A;  2X6I A;  3SQV A;  4BJ5 C;  3FTZ A;  1YZA A;  5LOZ A;  4RDA A;  3UI2 A;  3NQP A;  3TWQ A;  3CEQ A;  4CS9 A;  1L3P A;  3O39 A;  2R7V A;  2VGY A;  3TWU A;  2F8Y A;  3EHR A;  4PS7 A;  2D5R B;  3X2Q E;  4I44 A;  3QVZ A;  4PJL A;  1NZE A;  5AQB A;  3VTX A;  2JD3 A;  2FUL A;  2ION A;  1O1S A;  5AQA A;  2WXP A;  4CS8 C;  1M57 C;  4XLN F;  2IOQ A;  1QQE A;  2BKK B;  4ACK A;  3K9I A;  4IUL A;  4EPZ A;  2KSF A;  5KYX A;  4XTK A;  2QNL A;  2VJ8 A;  2QLA A;  3QMK A;  2XM4 A;  1IKN D;  2IO3 C;  5T4Y A;  2AXU A;  3VLE A;  4B0Z A;  2CFU A;  1SVX A;  3ASF A;  2NUT B;  5L0F A;  4Y6C A;  3HNK A;  5CRU A;  1N95 A;  2X6F A;  2VC9 A;  2V26 A;  1PCX A;  5HV9 A;  2XLD A;  5KJL A;  2P61 A;  4JA7 A;  3RU0 A;  4PFP A;  2TMV P;  1BR1 A;  2J08 A;  4L6R A;  3GZ2 A;  5FZT A;  1OCR C;  2WVQ A;  3UTM A;  2XEE A;  5B1B C;  3Q73 A;  1I5N A;  3N71 A;  4BEM J;  5KYN A;  1MMG A;  3L34 A;  3SXM A;  4TUU A;  1JCR A;  3BQO A;  2LK4 A;  2R7R A;  2OOE A;  3TXM A;  3JRT A;  4JTA B;  3GWL A;  1PY1 A;  2A6E F;  3LY7 A;  4P29 A;  2YL3 A;  3PZ1 A;  2LD6 A;  3QVY A;  3V79 K;  2XXA A;  4OIP F;  3LCA A;  5D0Q D;  4I6E A;  3L16 A;  2A0U A;  5ARF A;  4GQH A;  4YL0 A;  3O48 A;  4ANV A;  3FUI A;  3VYW A;  3UM0 A;  2E87 A;  1E86 A;  1S0P A;  2LFF A;  3KSL A;  2A5E A;  2GRR B;  2KAT A;  1F1M A;  2A68 F;  4XEV A;  3Q5M A;  3NMK A;  1FMV A;  3CLJ A;  2W9Y A;  1ORJ A;  4LLE A;  3QB2 A;  4HI9 A;  2KM4 A;  3ZXS A;  3L8I A;  3LNM B;  1FR0 A;  5HRY A;  2RFA A;  3DSU A;  1EA8 A;  5G05 C;  1GW6 A;  2VGE A;  4HFG A;  1O5M A;  4YT4 A;  3ASN C;  4W8K A;  4HBD A;  5JSL A;  1LD7 A;  3PRE A;  4ILH B;  4FAD A;  3C63 A;  1M6T A;  4PR9 A;  3C8G D;  3DXM G;  4KZC A;  5T3T A;  3AG1 C;  1DNP A;  1V54 E;  3AG3 E;  5FIN A;  4LNG A;  2EPO A;  3ML9 A;  3JQ1 A;  3Q6N A;  3OWT A;  1UOH A;  4M63 A;  4TUM A;  4AEZ C;  3EGX B;  3B0U X;  2AU5 A;  4EBK A;  2GRO B;  4KC9 A;  4LAC B;  2H6F A;  3DZA A;  1B68 A;  3TAX A;  1ORY A;  1LS4 A;  3HNJ A;  4HFF B;  5ITZ F;  1A7E A;  2R7T A;  2P9N G;  5B3S C;  3GOD A;  4HEA J;  3QAQ A;  4AJW A;  2XS8 A;  4XI9 A;  5B3I A;  5DS5 A;  4U63 A;  1HMO A;  4PFO A;  2EIN E;  2KBX A;  4J32 B;  1OR3 A;  1OKK D;  1K04 A;  3E9V A;  1PD0 A;  1ZW3 A;  4F1P A;  3IKO B;  4PUC A;  4YND A;  3ZYL A;  2EPK X;  3FY4 A;  1G5Z A;  5L3Q A;  3RVY A;  4EHP A;  4U0Z A;  2VTB A;  1A17 A;  4M7C A;  1N54 A;  2MHR A;  4J8E A;  1YAR O;  3KL4 A;  3B7R L;  4EKW A;  3FFL A;  4NQF A;  2DZN A;  3G2V A;  4I1A A;  5KNH D;  4JE9 A;  5KJK A;  3NYM A;  4BER A;  4UWG A;  2HV6 A;  4G2V A;  2L9J A;  4UQX A;  3MCX A;  4L23 A;  5CER B;  3FTX A;  2NUT A;  3EHQ A;  3JYS A;  1Q0G A;  2WXQ A;  2WXK A;  4JEU A;  4NY3 A;  4YL3 A;  3EZH A;  1N4P A;  5M72 A;  5ENQ D;  2NSZ A;  4HVB A;  1LVK A;  2OU6 A;  5JS5 A;  2C0M A;  3G4Z A;  4ATZ D;  4B89 A;  2H6H A;  4KI2 A;  4H54 A;  4WND A;  4WWN A;  4N39 A;  4Z9H A;  3B7T A;  3OXG A;  4GYW A;  3ZUV B;  4FUL A;  4U0S A;  4DVZ A;  4G1T A;  4BG0 A;  3S7F A;  4E6H A;  5CBN A;  1ELK A;  2BC5 A;  3KS2 A;  5EIL A;  3L9T A;  4PJN A;  2ETS A;  3AQB A;  4OD5 A;  3SEO A;  3W2W A;  3VM6 A;  3PUK A;  2FGY A;  3SFY A;  3V5Y A;  3ZYM A;  4ANW A;  5CMW A;  3ASO C;  4FWV A;  4ANX A;  5HKP A;  5JJ7 A;  1B89 A;  1FNT c;  4KVO A;  3FDQ A;  3DSS A;  3TWW A;  5FIO A;  1ZVZ A;  1MJ0 A;  3AOU A;  3W8H A;  3FVY A;  2GRN B;  3AJM A;  1NU9 C;  3FU0 A;  1N0R A;  3KKB A;  3B9Q A;  3S90 A;  4U8H A;  3Q7G A;  4MVU A;  2DYS E;  3NDB B;  3CV0 A;  2ZXW C;  5JMN D;  2J9U A;  4CEM A;  2VB6 A;  1E7V A;  3ONK A;  3LLI A;  2EQX A;  3NOC D;  2DVW A;  2A0B A;  1SZI A;  2BF0 X;  1UJJ A;  4CJG A;  4EBB A;  3JT1 A;  1CPQ A;  3UM2 A;  1KTM A;  4EBJ A;  4GTQ A;  1LI7 A;  1HH8 A;  2R2L A;  2XLW A;  2FBN A;  1J8M F;  3D3M A;  3AAA C;  3JUI A;  5BV1 A;  4UI9 C;  2A69 F;  4BX9 A;  1FPP A;  1MYO A;  1RJ9 A;  2R9R B;  1LF8 A;  4G23 A;  2A1D D;  2RFM A;  3B7B A;  3MEK A;  2UY1 A;  1Q2Z A;  4MQ9 F;  3CHM A;  1OUV A;  2I2O A;  1YLM A;  3L22 A;  4ANU A;  1D9S A;  3EU9 A;  1BU9 A;  1VB5 A;  3FP3 A;  1MMA A;  2O9X A;  3AG2 C;  3ABM C;  3AU4 A;  3ZDL A;  2VYI A;  3SY2 A;  1YA0 A;  1Q0D A;  3ASN E;  3SFX A;  1A0B A;  3FU3 A;  2R17 C;  3CKB A;  5ENT D;  2P1A A;  3PVL A;  1TNU A;  3C8Z A;  2HE0 A;  2PP4 A;  4JW1 A;  2L6B A;  3ZIM A;  3MV3 B;  3RK6 A;  2ZIS A;  3AG1 E;  4GU5 A;  4MTO A;  1BR4 A;  3ZC4 A;  3EQL F;  1BPO A;  2F37 A;  4AVX A;  5CHE E;  2OVF A;  3K7D A;  4XPW A;  3T9K A;  4AM9 A;  4EBA A;  4P9T A;  4CJO A;  3RH3 A;  4GZ6 A;  1HE8 A;  5DQT A;  2AXZ A;  2RKK A;  1OWL A;  1BDJ B;  1GS9 A;  1LE2 A;  1Z3X A;  4DX5 D;  3C3O A;  2GRM A;  3PEU B;  5JHA A;  4GTO A;  1M2O A;  5ENR D;  3C5R A;  1JCQ A;  1SR2 A;  3GEI A;  4DXW A;  3RQG A;  2AWI A;  4GZ5 A;  2WZL A;  1SW6 A;  2V5F A;  5BUZ A;  1NLX A;  2UWJ G;  5BXO A;  3JCK C;  4A63 B;  1T5O A;  3M79 A;  2AW6 A;  1Y6I A;  2XL8 A;  3AS5 A;  3S2A A;  3GOR A;  5L0G A;  3PDM P;  2DZO A;  1HF8 A;  3EHN A;  1HZ4 A;  4LEU A;  3LPZ A;  4MBG A;  2MOW A;  1GQA A;  3T6B A;  4MW8 A;  3ZW3 A;  4ER9 A;  5L0D A;  3FOO A;  1XWJ A;  4EBA G;  5E2Q A;  2WQ7 A;  2VAS A;  2XRH A;  2YVK A;  1OCC E;  4JB8 P;  2P58 C;  1L7C A;  4OIO F;  1G4U S;  1ZU2 A;  5BQH A;  1N11 A;  2DBA A;  1NFN A;  2WMO A;  1N9A A;  1H2V C;  1PC2 A;  1KT0 A;  1DCQ A;  2PQN A;  3ZKJ A;  4LRZ A;  4XLP F;  3ZYK A;  2PQR A;  2J9V A;  2PNN A;  2G62 A;  4K0R A;  4WGZ A;  1H9T A;  1TWG A;  3M4B A;  5A7D B;  2LAH A;  4UWF A;  3FU6 A;  3HYM B;  2KC3 A;  1TYQ G;  3LEW A;  4IAR A;  4HLE A;  3DSX A;  1N52 A;  2IJG X;  1HW1 A;  3FUK A;  4TRQ A;  4RG9 A;  2XEV A;  2ZXO A;  4JVS A;  3H2U A;  2WQH A;  3EHM A;  3IEE A;  1OXB A;  2B0H A;  2LQG A;  4E7Z A;  1Z6A A;  5J08 A;  4D4N A;  1WM5 A;  4JRZ A;  1EF1 C;  1AP7 A;  1C17 M;  4E17 A;  2XPY A;  4AY6 A;  3ZRH A;  1SQM A;  4HS2 A;  3D9J A;  3CVU A;  3HNI A;  5COG A;  3EG9 A;  2WQ6 A;  2R7Q A;  3QZC A;  4U5C E;  1RXQ A;  3WXX A;  2BED A;  2MWQ A;  5AYW D;  2AVP A;  5CI8 A;  4WGY A;  2WZG A;  1ZU4 A;  1QPU A;  3B29 A;  3CQZ A;  1XZP A;  4YT2 A;  2OJQ A;  1YYJ A;  2RG8 A;  4JKV A;  4OYS A;  1S7Z A;  3QW0 A;  3NMI A;  3APC A;  2WVI A;  1PV3 A;  4JCH A;  2E2E A;  3DEO A;  1WTY A;  2DB4 A;  3L82 A;  5H7P A;  3CEX A;  1Q0M A;  2Q4F A;  4FX5 A;  2Q7F A;  4BSX A;  2G3K A;  3HG0 D;  4IN3 B;  1ZHW A;  1K40 A;  3FUM A;  3FDH A;  5G05 J;  4U5H A;  3UX4 A;  3ZQY A;  4J7T A;  5DBK A;  3UXG A;  2GRL A;  4Q4Z F;  5ANR A;  2LXM A;  3LNR A;  3A9C A;  3UMH A;  1K8K G;  2LO6 A;  3WG7 C;  4GMJ A;  3SHF A;  2KXP C;  3ZHE B;  3L13 A;  4QDL A;  3G2T A;  1CGN A;  3GZ1 A;  4JL0 A;  1HE1 A;  2DIW A;  2Y69 C;  3SXY A;  1TNO A;  1YA9 A;  1EQ1 A;  2QY9 A;  4RBN A;  4ABN A;  4EEC A;  4YT8 A;  4JJG A;  1JRA A;  3L0I A;  4IAO A;  3JYH A;  4O6N A;  4JA9 A;  1YMP A;  2XHE A;  4DLO A;  4GYT A;  4CDN A;  4E0I A;  4G0H A;  4U9D A;  2P7V A;  1IQU A;  1TN7 A;  4ULV A;  1TWC A;  2XPI A;  3EUV A;  5HS0 A;  3MLG A;  3UT7 A;  1LI5 A;  4Q7C A;  3ZSU A;  3ZXP A;  3CVP A;  1ZU5 A;  1ZZP A;  1ZB1 A;  4RLY A;  2GAQ A;  4LNB A;  4RQI A;  5HI7 A;  1AWC B;  2ETA A;  4XEI G;  1V74 B;  4BEJ A;  4N3C A;  4HOT A;  2NUP B;  1Y6D A;  2YHC A;  4Z68 A;  4FJZ A;  1DVP A;  4K5C A;  4BSZ B;  4NAC A;  5KYU A;  3FTY A;  4DRJ B;  3DSV A;  3ZU7 B;  3JYY A;  3U2L A;  4CSA C;  3RSE G;  2VCA A;  4MVS A;  1XZQ A;  5A6C A;  2OOC A;  3LS0 A;  2BUG A;  4ONS A;  3ZIB A;  5A6B D;  1FT1 A;  2W4B A;  1AVO B;  1ZYR F;  1OWN A;  5E3A A;  3U3W A;  1A41 A;  5AJL A;  2P9U G;  1I4Z A;  3EIQ C;  1OW6 A;  1LE4 A;  3M4C A;  1N0Q A;  1C03 A;  2G3V A;  4E0H A;  3JUE A;  5DIZ A;  3W9F A;  3J06 A;  3RJV A;  4YDO A;  2ZIR A;  4PJM A;  2IOS A;  3R9A B;  3O6X A;  1FVH A;  3CHP A;  3ISM C;  4N5C A;  5CMY A;  3IPM O;  2Q9C A;  3T4R A;  4CT0 A;  2WXO A;  2H7O A;  4X0R A;  1T9K A;  4F1S A;  5JHB A;  3LVQ E;  4JUR I;  3QKY A;  4XIF A;  4BPM A;  2IU1 A;  2H6G A;  2NYJ A;  3QW1 A;  4J7Y A;  2X6H A;  1YJG A;  3I4R B;  2ZU6 B;  2ZGD A;  4G25 A;  2HYZ A;  2C03 A;  1N4R A;  4Q94 A;  1WOL A;  3VLF A;  5EKQ D;  1UG3 A;  3I4G A;  2ILR A;  3FOP A;  4QFV A;  4Q69 A;  2M4E A;  2WZF A;  2WMN A;  1NP7 A;  3AG2 E;  2VGX B;  1DOV A;  1WAT A;  3GYZ A;  4KVM A;  4XQ1 A;  4U0U A;  1N94 A;  2C0L A;  4JC8 A;  3RKO F;  4FU3 A;  3FUD A;  2IEJ A;  3MYV A;  3U3B A;  1VOM A;  4G7O F;  1T6U A;  3W8I A;  4AE4 A;  3ZQV A;  1Q0F A;  1AUE A;  4GTM A;  4UI9 J;  1TFK B;  4U96 D;  3UT8 A;  3C3R A;  3RO3 A;  2OND A;  5A6J A;  4JHK A;  5LFA A;  3TWX A;  1Y4C A;  3EH2 A;  4U5E E;  5JA4 D;  3HVE A;  5JJT A;  4CCA A;  3MKQ A;  2LSE A;  1BI8 B;  5FQ7 A;  1A7V A;  1LPE A;  2GRQ B;  4CIP A;  3C72 A;  1RMV A;  1H7I A;  3ZHE A;  2F22 A;  2I1K A;  4HNA D;  2Y0B G;  1RKC A;  3CHO A;  3UKU G;  2YNQ A;  3IBE A;  4LUN U;  1U89 A;  3CVL A;  3D9N A;  1BI7 B;  2CNW D;  1M56 C;  3TG5 A;  1JCS A;  4HFK B;  3TWT A;  1J8Y F;  3IQC A;  5KJM A;  4HRL A;  1MZC A;  2QYU A;  4JHJ A;  4KMO A;  4C9B B;  2B0J A;  3ENE A;  2WM9 A;  4ACL A;  4AK9 A;  3ITF A;  3HKK A;  4XX5 A;  3RW0 A;  2Q7R A;  3AS8 A;  3JZ0 A;  3URZ A;  1UW4 B;  3N2Z B;  4PH4 B;  3V5X A;  3IHU A;  4XPX A;  4OVU A;  1VLS A;  3JCU Q;  2NXP A;  4EIY A;  3CVX A;  2CW0 F;  2RSE B;  4GPM A;  1OWM A;  4DVY P;  2YQY A;  3K6B A;  4NRH B;  3PZD A;  3IHV A;  3HXC A;  3UIO C;  1TNB A;  3N0T A;  4GMR A;  4MKT A;  1QBQ A;  4O1O A;  4B93 B;  4E18 A;  3KEA A;  2IBF A;  3TJ5 A;  1Z3I X;  4OAU C;  4N6H A;  1O5H A;  2I8B A;  2Y3B A;  1O1T A;  1OY3 D;  1KT1 A;  3PNL B;  3FU5 A;  3U8V A;  4MND A;  3TOL A;  4O6Y A;  5TJ5 E;  1SMY F;  2ZPA A;  2RD0 A;  1HMD A;  2HKV A;  4JD2 G;  4ZHB A;  1MQS A;  2WXR A;  3NYL A;  3HDX A;  5CRV A;  3UNG C;  3ZTZ A;  3UPV A;  2GW1 A;  3GAN A;  5KJN A;  2X6K A;  5BXU A;  3CKC A;  2XQ0 A;  5A6B A;  3Q7F A;  4FLH A;  2KC7 A;  4A55 A;  2KCL A;  2VSO E;  3C62 A;  2H8A A;  3R2P A;  2Y69 E;  3QOU A;  4O79 A;  3C7J A;  1TJF A;  1M2V A;  3LJ3 A;  3SXK A;  3PZ2 A;  2XZD G;  3DEP A;  3FEX A;  4BJ1 A;  1MQV A;  1VTM P;  2QE9 A;  3NF1 A;  3Q7A A;  4GYY A;  4G7H F;  2PX3 A;  4F6R D;  1VYI A;  1H0A A;  3QNK A;  1TR4 A;  4V3I A;  4O1P A;  3UGO A;  4TXQ A;  1U2V G;  1APC A;  3PMR A;  3CHQ A;  3S7D A;  3OXL A;  2OEX A;  3T6G B;  2H7B A;  3LY9 A;  4DJA A;  4GZD A;  4MVZ A;  2ZXP A;  1IXV A;  3OXF A;  1S63 A;  3U9J A;  4CIH A;  2L6F A;  2IFU A;  3FUF A;  2OJE D;  3A11 A;  1YYX A;  1OCZ E;  5EK0 A;  3BUA A;  4DBQ A;  2VSN A;  1JPN A;  3TJP A;  1EI7 A;  1JPL A;  1MX6 A;  4GTT A;  5B1B E;  3MZL B;  2MYS A;  3RFY A;  4JC7 A;  4JEB A;  3T5X A;  2IF4 A;  5B3S E;  4FJY A;  1HG5 A;  4OVV A;  5D92 A;  4GTP A;  1Q0K A;  5F5F A;  4AIF A;  4BTA A;  5D0O D;  4IYP A;  4G78 A;  1E85 A;  4J6I A;  4A1G A;  3ABK C;  3OTN A;  3U9M A;  2P9L G;  1E83 A;  1EDU A;  2P9K G;  2HO1 A;  4EWC A;  2NSF A;  4UWK A;  4DX1 A;  4EZK A;  2XGM A;  4DLQ A;  5COM A;  3UIP C;  1N1C A;  5CCM A;  3ZEF A;  1YAU O;  3FWV A;  4LNU D;  1TFO B;  4DBR A;  1D0X A;  3FTV A;  2WXH A;  3K1H A;  2X38 A;  1JR8 A;  1LM3 B;  3OAW A;  4BEP A;  1G8X A;  1E84 A;  2KJG A;  3TL5 A;  1Z63 A;  3RIP A;  3S28 A;  1L5J A;  1ZHZ A;  3ZTM A;  2V3C C;  2WXM A;  5ENP D;  3V2X A;  3DWL G;  1V54 C;  4K03 A;  4CYM D;  1TWH A;  3D9M A;  4BT9 A;  1YZC A;  3SNH A;  3D9O A;  1WAS A;  4G8L A;  4I1O B;  1IZM A;  1M2V B;  5AC4 A;  3ZYQ A;  2A5U A;  2KK1 A;  2OV8 A;  4L9P A;  4MTF A;  2XGS A;  4XKC A;  5EID A;  4BT8 A;  4DI4 A;  1UN9 A;  1SA5 A;  4K5B A;  4PJJ A;  4CGW A;  4RD9 A;  2QC9 A;  3KMI A;  5ENN A;  3S7B A;  4AV7 A;  4RG6 A;  5FCL A;  4KNW A;  1SZ9 A;  3H2V A;  5BQG A;  3U3F A;  3BG1 B;  2EPN A;  1X5B A;  4HOQ A;  4MVR A;  2IXO A;  1MHQ A;  1NSG B;  1NA0 A;  4O6F A;  5LCW C;  4HQD A;  3IQT A;  4O6M A;  2CYD A;  3TWR A;  3MV2 B;  1JWG A;  4EZL A;  3ULY A;  1K3Z D;  1LD8 A;  1UJK A;  3RO2 A;  1KPS B;  3AGU A;  3ZN3 A;  1AEP A;  5K0I A;  2Y3D A;  4PK4 A;  3UGP A;  3LUT B;  2L6J A;  1CPR A;  1OCO E;  2HR2 A;  4YDW A;  2R25 A;  1FVF A;  1N4S A;  2J8S D;  2WXN A;  4XE0 A;  5KYW A;  3M15 A;  3WHN A;  1JUQ A;  4JEH A;  4IWB A;  3RVZ A;  2X6J A;  3DPD A;  3CK8 A;  2YKZ A;  2DGJ A;  5EN5 D;  3JQ0 A;  4DI3 A;  4I1M A;  4WJ0 A;  5BNW A;  3G2U A;  2IXP A;  3L08 A;  3HIZ A;  2WVO A;  1HX8 A;  5EHH A;  3QWV A;  3Q79 A;  3IXE A;  3B7S A;  4A4A A;  5AC5 A;  2Y3A A;  4J8D A;  1QNF A;  2NUP A;  1D8D A;  2CG2 A;  3G4X A;  3BU8 A;  1OT8 A;  3MX3 A;  1HXI A;  4I3M A;  3PEV B;  2B0O E;  1DOW A;  3LJN A;  1Y8M A;  2PFD A;  5JVE A;  1ZBP A;  3R7Q A;  2L7A A;  4GEH A;  2P9I G;  1I4Y A;  2R7U A;  3MKR A;  2L0I A;  4G24 A;  4Q96 A;  4DJ9 A;  4BY6 A;  5T3R A;  4XWJ A;  2EIJ E;  4FA6 A;  4I6G A;  2OVB A;  1TNZ A;  1MNE A;  3H65 A;  1UG7 A;  4WWO A;  1WGW A;  1E96 B;  5JLI A;  3IEG A;  3V7O A;  5FQ6 A;  5L0H A;  5T3W A;  4HRN A;  4N3B A;  2YHS A;  2BKG A;  3US6 A;  3FUN A;  2H7V C;  3V30 A;  1CGO A;  1ELW A;  1K1A A;  5F5H A;  3B7U X;  2Z15 A;  4IRU A;  3TJ6 A;  1KZP A;  1O1R A;  2HJ3 A;  4C48 B;  4XZ4 A;  2IXN A;  3MKQ B;  5BV0 A;  3HXE A;  2R5S A;  3ZPJ A;  3DPY A;  5JJ6 A;  2QTV A;  1NL4 A;  4JIO A;  3EZI A;  2VQ2 A;  2A6H F;  4ULW A;  3ZVV A;  4CRW A;  4PS3 A;  2J7P D;  1UFB A;  4U5F E;  4CS7 A;  3GM2 A;  2HMZ A;  4AL0 A;  2X3M A;  4EQF A;  3FMS A;  4H7Y A;  3NYJ A;  4AXH A;  4N3A A;  3CK7 A;  4FP7 A;  3AG4 C;  5JRA A;  4CGV A;  1CGM E;  4BWR A;  3IQ6 A;  4FLB A;  4URK A;  3I4U A;  1YYH A;  2A4Z A;  5ENO D;  5JP7 A;  2Y3G A;  2EIL E;  2OKU A;  5EYP F;  2AP3 A;  4YVQ C;  3PNT B;  3EG9 B;  2HMQ A;  4AP2 A;  4E7S A;  1Z5S C;  4GCO A;  5HQ8 A;  4G8K A;  2I9C A;  1C02 A;  2Q9B A;  3CQG B;  4KYO B;  2Q9A A;  4K7B A;  2E0I A;  2I1J A;  3EH1 A;  5FJY A;  2X0C A;  1X81 A;  1EYH A;  1JPJ A;  2J4B A;  3K66 A;  4B94 A;  1QKR A;  3DSW A;  4EUK B;  1OCC C;  1G3N B;  3UMV A;  1OCZ C;  3F47 A;  1D8E A;  2AVK A;  4I9C A;  1BLX B;  4TV3 A;  2LP4 A;  4KXK B;  1SF8 A;  2EPM X;  1H6O A;  3QAR A;  3DBS A;  4ME2 A;  3U4T A;  1ZHX A;  2EIM C;  3PE3 A;  4K0D A;  1QSP A;  3VAY A;  4C7O A;  5L0C A;  2DYR E;  2GRP B;  3QJZ A;  2UY1 B;  2AXV A;  2GGF A;  2XEH A;  5A69 A;  1ORS C;  3Q7L A;  3C3Q A;  3J5P A;  5FQ8 A;  3B0V C;  4BJ6 A;  3CGH A;  3T9O A;  3MYF A;  3PCV A;  2VCC A;  1OW8 A;  2P6V A;  4WAF A;  2ZGG A;  3ABK E;  3RQF A;  4QI2 A;  5A6K A;  4FAP B;  4XPY A;  4YJW A;  2Q00 A;  1JAF A;  3X2Q C;  3NAW A;  5L0J A;  1D0Y A;  4NC3 A;  5C1D A;  4N5Q A;  5FZS A;  3SF4 A;  3LEO A;  3K1I C;  4GAA A;  4GCN A;  2WXI A;  3FXH A;  3FH8 A;  4I9E A;  3DJN B;  3G2S A;  3ATP A;  1RKE A;  2WB7 A;  3Q15 A;  2EPL X;  1N4Q A;  2YHE A;  4MVO A;  2VSX E;  2J0X A;  3PH0 C;  4DK5 A;  3ABL E;  3KSQ A;  1E8W A;  4G7Z F;  4CSA A;  4D4X A;  3PZ3 A;  2XS1 A;  4KBL A;  3L6A A;  1XNF A;  3CR3 A;  2JPU A;  2J46 A;  3GZS A;  4A1S A;  4AOF A;  2R7O A;  3RIB A;  2YL7 A;  1QZX A;  1VMA A;  5KYU B;  5IY5 C;  2WXL A;  4HXI A;  3E70 C;  3NKD A;  3E32 A;  1P5Q A;  3NMJ A;  5AJD A;  3RF3 A;  3HHM A;  4MW3 A;  4R32 A;  2L6G A;  3HXB A;  3QC1 A;  4C7O B;  2XM0 A;  4O60 A;  4GA0 A;  4GZC A;  5AQ7 A;  4P6I C;  3KAE A;  3PRZ A;  3CIA A;  2LUH A;  1A7D A;  3WG7 E;  2PF4 E;  4UQZ A;  1DC2 A;  2J7P A;  1VLT A;  2EIJ C;  4BJ6 C;  1BBH A;  4C3D A;  2R7W A;  1DCE A;  3SFZ A;  1IHB A;  4N4W A;  2QYJ A;  1MX2 A;  4WNF A;  4JZA A;  2Y1L E;  3FH5 A;  2AJA A;  3QDN A;  3EGX A;  2GWW A;  4MRU A;  1HFA A;  1U0B B;  4CZ2 D;  2YLG A;  3W9G A;  4N2Q A;  5DLJ A;  3JRM O;  4JPS A;  5KBA A;  1MX4 A;  1QZ2 A;  5FZR A;  4U07 A;  3TGO A;  4KBQ A;  1MND A;  4EHM A;  3LAY A;  1WG0 A;  1U6H A;  2HM8 A;  3HVE B;  3ULQ A;  3GWN A;  4LSZ E;  5T1D B;  3PE4 A;  1QLE C;  2PX0 A;  1RCP A;  2OQM A;  1LIH A;  4A3V A;  2KNH A;  5EDS A;  5CED B;  1TWA A;  3ONL A;  3ASD A;  2DI3 A;  4L2Y A;  3DXJ F;  5DQZ A;  2XGO A;  4ILG A;  2OG2 A;  1PD1 A;  1T6I A;  2Y3H A;  3AGT A;  4HE8 D;  3VRC A;  1WDY A;  2V5Q C;  4K5A B;  1S64 A;  1Z6T A;  3KYJ A;  1H6P A;  3MA5 A;  3JSZ A;  4G11 A;  5CI9 A;  5LX8 A;  1INZ A;  2GFH A;  4JEA A;  2R02 A;  5E3C A;  1LS1 A;  4CS8 A;  3JTL O;  3AJI A;  3L54 A;  4L1B A;  3SZ7 A;  1D1B A;  2QZA A;  3UKR G;  3OA1 A;  3GM3 A;  3W4Y A;  2LNI A;  3ESL A;  3KD7 A;  4L7T A;  3DST A;  2R7X A;  1NFI E;  5ANL A;  2J09 A;  2VGX A;  4NIK A;  2HSB A;  1OCR E;  1Z23 A;  1VDY A;  2QY7 A;  2IM8 A;  4FES A;  4UDV A;  4IJJ A;  3O55 A;  5JUA A;  4R7L A;  5ARG A;  4KNV A;  1TQG A;  3T8M A;  5CCL A;  2ETC A;  3BRJ A;  5BUO A;  3BEH A;  2XL4 A;  3KH2 A;  2IO2 C;  4Z9I A;  4W9R A;  2HZ8 A;  1W2W A;  3WAQ A;  4GYO A;  3TWV A;  2W4M A;  1R5I D;  3RKV A;  1A5E A;  1G4W R;  5KCM A;  3S7J A;  3O4Z A;  2MHK A;  1FAP B;  3F6Q A;  3C8G B;  1BD8 A;  4JJF A;  2DYR C;  4Q5S F;  2EIL C;  4U5B E;  2XLM A;  3LLK A;  3DD7 A;  3OEO A;  3LS1 A;  4I17 A;  4CDA A;  5KYW B;  1OQC A;  3DKA A;  4W8P A;  1WY6 A;  2Y4T A;  3MGB A;  2PZI A;  1NG1 A;  1T01 A;  3Q47 B;  2MRI A;  4XI0 A;  1OXK A;  3U66 A;  1ZHT A;  4H7X A;  3TWS A;  1WAO 1;  4J7W A;  5FWQ A;  4CT4 A;  4QQI A;  3Q6M A;  1W3B A;  2LSV A;  4NUR A;  3CSK A;  1KLX A;  1HY5 A;  3DJU B;  4J8F A;  2VCB A;  2H6I A;  4XKB A;  3VLD A;  1ELR A;  3CVN A;  3S29 A;  3CHS A;  5A6A A;  2KW3 C;  2FAP B;  3SXZ A;  2J8W A;  4C0E A;  3WOD F;  1TNY A;  4ILI A;  5FQ4 A;  2IQC A;  4JXT A;  4GML A;  5E33 A;  5CIV A;  3UMK A;  5B1A C;  1H6K A;  2AWC A;  4JHR A;  3CQC B;  3ESK A;  3ABM E;  1SA4 A;  2LAI A;  2FO7 A;  3ASH A;  2Y4U A;  1SYQ A;  3CST A;  4BJT A;  1KNY A;  2QFC A;  2WXJ A;  4HRM B;  2XL6 A;  4DUI A;  3KEZ A;  2ASR A;  3I5Q A;  1K1B A;  5KNG A;  3E33 A;  3R7R A;  4HOR A;  4JTC B;  1HE9 A;  2V4H C;  2NC9 A;  2Q3T A;  1IHG A;  3PDN A;  3FUH A;  3FEY A;  4A3T A;  3SZR A;  4CDM A;  3E4B A;  4H4K C;  3CVQ A;  1H19 A;  3CVY A;  2NSG A;  4WAB A;  2NG1 A;  3AS4 A;  3PZ4 A;  3NZS A;  1KU2 A;  4YDY A;  2HV7 A;  5DVW A;  3JXI A;  4MS2 A;  4LDR A;  4MS6 A;  4B8A A;  3DE8 A;  1JOG A;  3DM5 A;  2WPV A;  3N24 A;  4NTA A;  1KZO A;  3SNX A;  5IY5 E;  2EIK C;  4L2L A;  4MVM A;  2PM7 A;  1Z3Y A;  4YT5 A;  1E2X A;  2QUP A;  3FTU A;  2EIM E;  1FT2 A;  5E76 A;  3CVV A;  4O7G A;  2J9W A;  3D9L A;  1SZA A;  2ZXW E;  3Q4A B;  1XGW A;  5JT4 A;  2LCH A;  3R9M A;  4ZLC A;  5KYY A;  1H2U A;  1K05 A;  2CHZ A;  4NQ0 A;  3POV A;  3G50 A;  1VK5 A;  2GDC A;  5BPP A;  5G04 C;  1TJC A;  3CSF A;  4RVB A;  2XLV A;  3FUJ A;  2ICW G;  1E8Z A;  4BFR A;  3LEV A;  2DWZ A;  1IQR A;  1E8X A;  3MBG A;  4LER A;  3GEH A;  1ZW2 A;  4OIR F;  3Q78 A;  2XEN A;  4IAQ A;  5L3V A;  3NOG D;  2ETB A;  4DPR A;  5E75 A;  4HOS A;  4ZFH A;  4WUY A;  4DOZ A;  2FI7 A;  4APO A;  2L0T B;  2YWA A;  3K33 A;  4LG6 A;  3CHR A;  1QVX A;  2J0W A;  3UM3 A;  4AE4 B;  4FC8 A;  3EFO A;  3D9P A;  1LTX A;  4GB9 A;  3EGD B;  1O87 A;  4NTB A;  3LDZ A;  3TG4 A;  1HG2 A;  3V5Z A;  3UIN C;  3D9I A;  3HNL A;  4BET A;  3D9K A;  4LDQ A;  4YDE A;  3ZNG A;  2XRY A;  2V8S E;  3B95 A;  5DS4 A;  2R05 A;  2LFD A;  1OR2 A;  3P2B A;  2CFZ A;  4GA2 A;  4XEF A;  5HSW A;  2KQ9 A;  1D1C A;  1ZHY A;  4NCQ A;  1NA3 A;  3NB2 A;  3M1C B;  5BQI A;  3DAF A;  1YCS B;  4I2Z A;  3JSE O;  4J0U A;  3ULE G;  3Q9N C;  4DRX E;  3MFN A;  1D1A A;  2OCC C;  2P0N A;  4F3V A;  2CHW A;  3GM1 A;  2UUI A;  2JAB A;  3LXU X;  2YL1 A;  5EGY A;  5T8I A;  3C8G A;  4MTG A;  1LKX A;  3V31 A;  4DX7 D;  3APD A;  4F7A A;  1TN6 A;  1OXJ A;  3B71 A;  4C3E A;  1TN8 A;  2V0P A;  2BE5 F;  4GTV A;  3HLZ A;  3F46 A;  2OEV A;  2PNO A;  3T5V A;  3Q75 A;  1NU7 D;  2F8X K;  1V55 E;  4F4B A;  5CEA A;  5D2M C;  2VTB B;  2YLD A;  3HTK C;  3RRN B;  4U04 A;  2WXF A;  2HUJ A;  3L1M A;  4HOU A;  3TD7 A;  4ZLD A;  1TR2 A;  3DXK G;  2X51 A;  4BES A;  4XEK A;  4HLL A;  1ST6 A;  1WWP A;  3UMI A;  1RW2 A;  2HS5 A;  2VH3 A;  4IB4 A;  3EIJ A;  2YEV A;  3SP1 A;  3HRA A;  4Z9J A;  4B6I A;  3DRA A;  3O10 A;  3ZFW A;  2XLO A;  4GTR A;  2YQ8 A;  4OAV B;  1D0Z A;  3NG1 A;  4FHJ A;  3CAX A;  3TOM A;  2IXM A;  4I2W A;  4MVQ A;  3T6J A;  2L81 A;  4N06 A;  1RJ9 B;  2GA0 A;  3ZVR A;  5AIJ A;  5CBO A;  1BZ4 A;  3S84 A;  3G2W A;  3LS8 A;  2CNW A;  4RSY A;  4JTD B;  2XSE A;  3HXD A;  1EKY A;  3B13 A;  3FUE A;  2KCK A;  3LY8 A;  2LXL A;  4FHK A;  3RYL A;  2WXG A;  1YDI A;  3MJW A;  5FT9 A;  3DE9 A;  4U95 D;  1IYG A;  5ENS D;  2YIN A;  5COF A;  2JEK A;  3PHF 2;  2D4U A;  1R4T A;  3QK0 A;  1MMD A;  2XCB A;  2L9B A;  1HW2 A;  4CS9 C;  4CDR A;  3U0C A;  5F28 E;  1E7U A;  2F0Y A;  4C3B A;  5FZQ A;  3EU5 A;  1QYM A;  3U8P A;  1Z7Q c;  4BJ5 A;  4APF A;  5AQ9 A;  2FF4 A;  1NBB A;  4YN0 B;  4OIN F;  3FTW A;  2YZS A;  2CG3 A;  2KZT B;  1HS6 A;  1NFO A;  4KZ0 A;  1NI1 A;  1V4A A;  2UUH A;  1OWO A;  2DCP A;  2J07 A;  2WL8 A;  4X8Q A;  2CGE A;  3EJN A;  1FFT C;  2XZT G;  4DX2 A;  2CHX A;  4YK5 A;  4J30 B;  1FFH A;  2PL2 A;  1GM5 A;  5AAO A;  1OW7 A;  4UWL A;  1H9G A;  3P1U A;  2FEZ A;  2CCY A;  1T6Q A;  3FAJ A;  5D91 A;  2WB2 A;  3V2O A;  3ASG A;  4AY5 A;  3CVW A;  3I5P A;  1OKK A;  1MMN A;  5CEC B;  5EX3 A;  4DX6 D;  3R7C A;  5G55 A;  5G04 J;  256B A;  5J90 A;  1QQ3 A;  4JCZ A;  2KGO A;  2OEW A;  2PBE A;  4GA1 A;  2J45 A;  1EPU A;  4GZ3 A;  3CZ6 A;  3X1O A;  4DRH B;  4GTS A;  3QTH A;  3IQ5 A;  2LSU A;  3EGD A;  5A23 A;  3ML8 A;  3LYA A;  3FH7 A;  3S27 A;  3DMD A;  3U2M A;  5EYL A;  5LCW J;  3LES A;  1UN8 A;  4TXP A;  3AU5 A; 
#chains in the Genus database with same CATH homology
 3VTY A;  3PS6 A;  3QWP A;  2KCV A;  4U5G A;  1FTS A;  4ANJ A;  4E85 A;  4WNG A;  4B8C B;  2VSY A;  5AEN A;  1OCO C;  3FUL A;  1Z5Z A;  2CDQ A;  1U3D A;  2J49 A;  4G26 A;  4OIQ F;  4UI9 K;  3UUX A;  2R7S A;  2XRZ A;  1E90 A;  3QWW A;  4I43 A;  1PAQ A;  3UT4 A;  4QI0 A;  4GPK A;  4YWQ A;  2C04 A;  5BT1 A;  2WVN A;  1VYK A;  3ZGQ A;  4A2N B;  2IOL A;  3IV0 A;  2Y39 A;  3APF A;  1TEZ A;  2KZT A;  4Y6W A;  2I6H A;  4BX8 A;  5FTP A;  3I3N A;  4MLP A;  3EPV A;  1HO8 A;  3RRU A;  2R59 A;  3L17 A;  2ZXR A;  4EZJ A;  1V55 C;  2PM6 A;  1FCH A;  2FFH A;  4UQY A;  3SGH A;  1E8Y A;  3HJC A;  1BR2 A;  2XCC A;  2W45 A;  3LVR E;  3U9W A;  4AX2 A;  1HU3 A;  2C2L A;  3IHY A;  3NZU A;  4LCT A;  2JLB A;  2BTD A;  3SD5 A;  3AG3 C;  1JWF A;  3PUJ A;  3ECS A;  3W2V A;  4BTB A;  2M63 A;  3FTS A;  4PDX A;  5KYY B;  3U64 A;  2DYS C;  4LLC A;  3SBS A;  1FMW A;  3SI5 A;  4ATG A;  4N2S A;  3S0X A;  4JZY A;  4F53 A;  4CBE A;  4UWH A;  3C98 A;  4D10 C;  3Q49 B;  3AQC A;  4M3O A;  5C2Y A;  1NZN A;  3BEE A;  4YVO A;  3NKE A;  3DM9 B;  1TKN A;  5G2N A;  2J9Q A;  4KT6 B;  3TXN A;  1H2T C;  5EX0 A;  1OWP A;  2EIN C;  3LJB A;  3CK9 A;  3NRH A;  4U5D E;  3UQ3 A;  3DAG A;  3ZG1 A;  3RRM B;  2IYL D;  4C0M A;  4PS8 A;  3ABL C;  2XXA B;  2V4L A;  5BW8 C;  4OD4 A;  4J8S A;  2XPZ A;  3BG0 B;  5LP0 A;  3SBT B;  4WNE A;  5KYX B;  3SYN A;  1U3C A;  3FHE A;  3LKU A;  4WWP A;  3EFO B;  4I6J A;  2J4D A;  3FHD A;  3B0P A;  5DS6 A;  3GW4 A;  3UR3 C;  3EDT B;  1IW7 F;  2X6I A;  4BJ5 C;  3FTZ A;  5LOZ A;  4RDA A;  3NQP A;  3CEQ A;  4CS9 A;  3O39 A;  2R7V A;  2VGY A;  4PS7 A;  2D5R B;  4I44 A;  4PJL A;  1NZE A;  3VTX A;  2JD3 A;  2FUL A;  2ION A;  2WXP A;  4CS8 C;  1M57 C;  4XLN F;  2IOQ A;  1QQE A;  4ACK A;  3K9I A;  4IUL A;  4EPZ A;  5KYX A;  4XTK A;  2VJ8 A;  3QMK A;  5T4Y A;  2AXU A;  3VLE A;  4B0Z A;  2CFU A;  3ASF A;  2NUT B;  4Y6C A;  2X6F A;  2V26 A;  1PCX A;  5KJL A;  4JA7 A;  3RU0 A;  4PFP A;  1BR1 A;  2J08 A;  3GZ2 A;  1OCR C;  2WVQ A;  5B1B C;  3N71 A;  5KYN A;  1MMG A;  3L34 A;  4TUU A;  3TXM A;  2R7R A;  2OOE A;  3JRT A;  1PY1 A;  3LY7 A;  2A6E F;  4P29 A;  2XXA A;  4OIP F;  3LCA A;  5D0Q D;  4I6E A;  3L16 A;  5ARF A;  3O48 A;  4ANV A;  3FUI A;  3VYW A;  2E87 A;  1S0P A;  2KAT A;  2A68 F;  3Q5M A;  1FMV A;  3CLJ A;  2W9Y A;  4LLE A;  3QB2 A;  3ZXS A;  2KM4 A;  5G05 C;  1GW6 A;  4HFG A;  4YT4 A;  3ASN C;  4W8K A;  3PRE A;  4ILH B;  4FAD A;  4KZC A;  5T3T A;  3AG1 C;  1DNP A;  3ML9 A;  3JQ1 A;  3Q6N A;  3OWT A;  4M63 A;  4AEZ C;  3EGX B;  3B0U X;  4KC9 A;  4LAC B;  3DZA A;  3TAX A;  4HFF B;  2R7T A;  5B3S C;  3GOD A;  4HEA J;  3QAQ A;  4AJW A;  4XI9 A;  5DS5 A;  4U63 A;  4PFO A;  4J32 B;  1OKK D;  3E9V A;  1PD0 A;  3IKO B;  4PUC A;  4YND A;  3ZYL A;  3FY4 A;  5L3Q A;  4U0Z A;  2VTB A;  1A17 A;  1N54 A;  4J8E A;  3KL4 A;  3B7R L;  3FFL A;  3G2V A;  4I1A A;  5KJK A;  3NYM A;  4UWG A;  2HV6 A;  4G2V A;  2L9J A;  4UQX A;  3MCX A;  4L23 A;  3FTX A;  2NUT A;  3JYS A;  2WXQ A;  2WXK A;  4JEU A;  4NY3 A;  3EZH A;  5M72 A;  2NSZ A;  4HVB A;  1LVK A;  2C0M A;  4B89 A;  4KI2 A;  4WWN A;  4WND A;  4N39 A;  3B7T A;  3OXG A;  4GYW A;  4FUL A;  4U0S A;  4DVZ A;  4G1T A;  4BG0 A;  3S7F A;  4E6H A;  1ELK A;  3KS2 A;  4PJN A;  3AQB A;  4OD5 A;  3SEO A;  3PUK A;  3W2W A;  2FGY A;  3ZYM A;  4ANW A;  5CMW A;  3ASO C;  4FWV A;  4ANX A;  5JJ7 A;  1B89 A;  4KVO A;  3FDQ A;  3W8H A;  3FVY A;  1NU9 C;  3FU0 A;  3KKB A;  3B9Q A;  4U8H A;  3Q7G A;  3NDB B;  3CV0 A;  2ZXW C;  2J9U A;  4CEM A;  2VB6 A;  1E7V A;  3ONK A;  3LLI A;  2EQX A;  1SZI A;  2BF0 X;  1UJJ A;  4EBB A;  3JT1 A;  1HH8 A;  2FBN A;  3D3M A;  1J8M F;  3JUI A;  5BV1 A;  4UI9 C;  2A69 F;  4BX9 A;  1RJ9 A;  1LF8 A;  4G23 A;  2A1D D;  3MEK A;  2UY1 A;  4MQ9 F;  3CHM A;  1OUV A;  2I2O A;  3L22 A;  4ANU A;  3FP3 A;  1MMA A;  2O9X A;  3AG2 C;  3ABM C;  3AU4 A;  2VYI A;  1YA0 A;  3FU3 A;  2R17 C;  3CKB A;  3PVL A;  2PP4 A;  4JW1 A;  3ZIM A;  3MV3 B;  3RK6 A;  4GU5 A;  1BR4 A;  3ZC4 A;  3EQL F;  1BPO A;  4AVX A;  5CHE E;  2OVF A;  3K7D A;  4EBA A;  4AM9 A;  3RH3 A;  4GZ6 A;  1HE8 A;  5DQT A;  2AXZ A;  1OWL A;  1Z3X A;  5JHA A;  2GRM A;  3PEU B;  1M2O A;  2AWI A;  4GZ5 A;  2WZL A;  2V5F A;  5BUZ A;  2UWJ G;  3JCK C;  2AW6 A;  1Y6I A;  3AS5 A;  3S2A A;  1HF8 A;  3EHN A;  1HZ4 A;  4LEU A;  3LPZ A;  2MOW A;  3T6B A;  3ZW3 A;  4EBA G;  5E2Q A;  2WQ7 A;  2VAS A;  2XRH A;  2P58 C;  4OIO F;  1ZU2 A;  2DBA A;  2WMO A;  1H2V C;  1PC2 A;  1KT0 A;  2PQN A;  4LRZ A;  4XLP F;  3ZYK A;  2PQR A;  2J9V A;  2G62 A;  4K0R A;  1TWG A;  5A7D B;  2LAH A;  4UWF A;  3FU6 A;  3HYM B;  3LEW A;  4HLE A;  1N52 A;  2IJG X;  3FUK A;  4TRQ A;  4RG9 A;  2XEV A;  2ZXO A;  4JVS A;  2WQH A;  3EHM A;  3IEE A;  4E7Z A;  1Z6A A;  5J08 A;  1WM5 A;  1EF1 C;  2XPY A;  4AY6 A;  3ZRH A;  1SQM A;  4HS2 A;  3D9J A;  3CVU A;  2WQ6 A;  3EG9 A;  2R7Q A;  3QZC A;  4U5C E;  3WXX A;  2MWQ A;  5AYW D;  2AVP A;  5CI8 A;  2WZG A;  1ZU4 A;  3CQZ A;  4YT2 A;  2RG8 A;  4OYS A;  1S7Z A;  3APC A;  2WVI A;  4JCH A;  2E2E A;  4FX5 A;  2Q7F A;  4BSX A;  2G3K A;  4IN3 B;  1ZHW A;  3FUM A;  3FDH A;  5G05 J;  4U5H A;  3UX4 A;  5DBK A;  2GRL A;  4Q4Z F;  5ANR A;  3LNR A;  3UMH A;  2LO6 A;  3WG7 C;  4GMJ A;  3SHF A;  3ZHE B;  3L13 A;  4QDL A;  3G2T A;  3GZ1 A;  4JL0 A;  2DIW A;  2Y69 C;  4ABN A;  2QY9 A;  4RBN A;  4EEC A;  4YT8 A;  4JJG A;  3L0I A;  4IAO A;  3JYH A;  4O6N A;  4JA9 A;  2XHE A;  4DLO A;  4GYT A;  4CDN A;  4G0H A;  2P7V A;  1IQU A;  1TWC A;  2XPI A;  3MLG A;  3UT7 A;  4Q7C A;  3ZSU A;  3CVP A;  1ZU5 A;  5HI7 A;  4BEJ A;  4N3C A;  4HOT A;  2NUP B;  2YHC A;  4FJZ A;  1DVP A;  4NAC A;  5KYU A;  3FTY A;  4CSA C;  5A6C A;  3LS0 A;  2BUG A;  3ZIB A;  2W4B A;  1ZYR F;  1OWN A;  5E3A A;  3U3W A;  5AJL A;  3EIQ C;  2G3V A;  5DIZ A;  3RJV A;  3R9A B;  4PJM A;  2IOS A;  3O6X A;  1FVH A;  3CHP A;  4N5C A;  5CMY A;  2Q9C A;  3T4R A;  4CT0 A;  2WXO A;  2H7O A;  4X0R A;  5JHB A;  4F1S A;  3LVQ E;  4JUR I;  3QKY A;  4XIF A;  2IU1 A;  2X6H A;  3I4R B;  2ZU6 B;  4G25 A;  2HYZ A;  2C03 A;  4Q94 A;  3VLF A;  5EKQ D;  1UG3 A;  3I4G A;  2ILR A;  4QFV A;  4Q69 A;  2M4E A;  2WZF A;  2WMN A;  1NP7 A;  2VGX B;  3GYZ A;  4KVM A;  4U0U A;  2C0L A;  4JC8 A;  3RKO F;  4FU3 A;  3FUD A;  3MYV A;  1VOM A;  4G7O F;  3W8I A;  4AE4 A;  4UI9 J;  3UT8 A;  3RO3 A;  2OND A;  4JHK A;  5LFA A;  3EH2 A;  4U5E E;  5JJT A;  3HVE A;  4CCA A;  3MKQ A;  2LSE A;  5FQ7 A;  3ZHE A;  2I1K A;  3CHO A;  2YNQ A;  3IBE A;  4LUN U;  3CVL A;  3D9N A;  2CNW D;  1M56 C;  3TG5 A;  4HFK B;  1J8Y F;  5KJM A;  4JHJ A;  4KMO A;  4C9B B;  2B0J A;  3ENE A;  2WM9 A;  4ACL A;  4AK9 A;  3ITF A;  4XX5 A;  3AS8 A;  3URZ A;  1UW4 B;  3N2Z B;  4PH4 B;  4OVU A;  3JCU Q;  2NXP A;  3CVX A;  2CW0 F;  1OWM A;  4DVY P;  3K6B A;  4NRH B;  3PZD A;  3IHV A;  3N0T A;  4MKT A;  1Z3I X;  1O5H A;  2I8B A;  2Y3B A;  3PNL B;  1KT1 A;  3FU5 A;  4MND A;  4O6Y A;  1SMY F;  2ZPA A;  2RD0 A;  1MQS A;  2WXR A;  3NYL A;  3HDX A;  3UNG C;  3UPV A;  2GW1 A;  3GAN A;  5KJN A;  2X6K A;  3CKC A;  2XQ0 A;  4FLH A;  2KC7 A;  4A55 A;  2KCL A;  2VSO E;  3QOU A;  4O79 A;  1TJF A;  1M2V A;  3LJ3 A;  3FEX A;  4BJ1 A;  3NF1 A;  4GYY A;  4G7H F;  2PX3 A;  1VYI A;  1H0A A;  3QNK A;  4V3I A;  3UGO A;  3PMR A;  3CHQ A;  3S7D A;  3OXL A;  2H7B A;  3LY9 A;  4DJA A;  4GZD A;  2ZXP A;  3OXF A;  4CIH A;  2IFU A;  3FUF A;  4DBQ A;  2VSN A;  1JPN A;  3TJP A;  1JPL A;  3MZL B;  2MYS A;  3RFY A;  3T5X A;  2IF4 A;  4FJY A;  1HG5 A;  4OVV A;  5D92 A;  5F5F A;  4AIF A;  4BTA A;  5D0O D;  4IYP A;  4J6I A;  4A1G A;  3ABK C;  3OTN A;  1EDU A;  2HO1 A;  4EWC A;  4UWK A;  4EZK A;  2XGM A;  4DLQ A;  1N1C A;  5CCM A;  3ZEF A;  3FWV A;  4DBR A;  1D0X A;  3FTV A;  2WXH A;  3K1H A;  2X38 A;  3OAW A;  1G8X A;  3TL5 A;  2KJG A;  1Z63 A;  3RIP A;  3S28 A;  1L5J A;  1ZHZ A;  2WXM A;  2V3C C;  1V54 C;  4K03 A;  1TWH A;  3D9M A;  4BT9 A;  3SNH A;  3D9O A;  4I1O B;  1IZM A;  1M2V B;  3ZYQ A;  2A5U A;  2OV8 A;  4XKC A;  2XGS A;  4BT8 A;  4DI4 A;  1UN9 A;  4PJJ A;  4CGW A;  4RD9 A;  3KMI A;  5ENN A;  3S7B A;  4AV7 A;  4RG6 A;  5FCL A;  4KNW A;  1SZ9 A;  3BG1 B;  1X5B A;  4HOQ A;  2IXO A;  1MHQ A;  1NA0 A;  4O6F A;  5LCW C;  4O6M A;  3MV2 B;  1JWG A;  4EZL A;  1UJK A;  3RO2 A;  3ZN3 A;  2Y3D A;  4PK4 A;  3UGP A;  2L6J A;  2HR2 A;  1FVF A;  2WXN A;  4XE0 A;  5KYW A;  1JUQ A;  4JEH A;  4IWB A;  2X6J A;  3DPD A;  3CK8 A;  2DGJ A;  3JQ0 A;  4DI3 A;  4I1M A;  4WJ0 A;  5BNW A;  3G2U A;  2IXP A;  3L08 A;  3HIZ A;  2WVO A;  1HX8 A;  5EHH A;  3QWV A;  3B7S A;  2Y3A A;  4J8D A;  1QNF A;  2NUP A;  2CG2 A;  3MX3 A;  1HXI A;  4I3M A;  3PEV B;  1Y8M A;  2PFD A;  1ZBP A;  3R7Q A;  4GEH A;  2R7U A;  3MKR A;  2L0I A;  4G24 A;  4Q96 A;  4BY6 A;  5T3R A;  4XWJ A;  4FA6 A;  4I6G A;  2OVB A;  1MNE A;  3H65 A;  4WWO A;  1WGW A;  1E96 B;  3IEG A;  3V7O A;  5FQ6 A;  5T3W A;  4N3B A;  2YHS A;  3FUN A;  2H7V C;  1ELW A;  5F5H A;  3B7U X;  2Z15 A;  4IRU A;  4XZ4 A;  2IXN A;  3MKQ B;  5BV0 A;  2R5S A;  3ZPJ A;  5JJ6 A;  2QTV A;  3EZI A;  2VQ2 A;  2A6H F;  4ULW A;  3ZVV A;  4CRW A;  4PS3 A;  2J7P D;  4U5F E;  4CS7 A;  2X3M A;  4EQF A;  4H7Y A;  3NYJ A;  4AXH A;  4N3A A;  3CK7 A;  4FP7 A;  3AG4 C;  4CGV A;  4BWR A;  4FLB A;  4URK A;  3I4U A;  2A4Z A;  2Y3G A;  4YVQ C;  3PNT B;  3EG9 B;  4AP2 A;  4E7S A;  4GCO A;  5HQ8 A;  2I9C A;  2Q9B A;  3CQG B;  4KYO B;  2Q9A A;  4K7B A;  2E0I A;  2I1J A;  3EH1 A;  5FJY A;  1JPJ A;  1EYH A;  2J4B A;  3K66 A;  4B94 A;  1OCC C;  3UMV A;  1OCZ C;  3F47 A;  4I9C A;  4TV3 A;  4KXK B;  1SF8 A;  3QAR A;  3DBS A;  4ME2 A;  3U4T A;  1ZHX A;  2EIM C;  3PE3 A;  4K0D A;  3VAY A;  4C7O A;  3QJZ A;  2UY1 B;  2AXV A;  2GGF A;  3Q7L A;  5FQ8 A;  3B0V C;  4BJ6 A;  3CGH A;  2P6V A;  4WAF A;  4QI2 A;  4YJW A;  3X2Q C;  1D0Y A;  5C1D A;  5FZS A;  3SF4 A;  4GAA A;  3K1I C;  4GCN A;  2WXI A;  3FH8 A;  4I9E A;  3DJN B;  3G2S A;  2WB7 A;  3Q15 A;  2YHE A;  2VSX E;  2J0X A;  3PH0 C;  4DK5 A;  1E8W A;  4G7Z F;  4CSA A;  4KBL A;  3L6A A;  1XNF A;  3CR3 A;  2J46 A;  3GZS A;  4AOF A;  2R7O A;  3RIB A;  1QZX A;  1VMA A;  5KYU B;  5IY5 C;  2WXL A;  4HXI A;  3E70 C;  3NKD A;  1P5Q A;  5AJD A;  3HHM A;  3QC1 A;  4C7O B;  4GA0 A;  4GZC A;  4P6I C;  3KAE A;  3PRZ A;  3CIA A;  2PF4 E;  4UQZ A;  2J7P A;  2EIJ C;  4BJ6 C;  4C3D A;  2R7W A;  3SFZ A;  4WNF A;  4JZA A;  3FH5 A;  3QDN A;  3EGX A;  4MRU A;  1HFA A;  4N2Q A;  5DLJ A;  4JPS A;  1QZ2 A;  5FZR A;  4U07 A;  3TGO A;  4KBQ A;  1MND A;  3LAY A;  2HM8 A;  3HVE B;  3ULQ A;  5T1D B;  3PE4 A;  1QLE C;  2PX0 A;  4A3V A;  2KNH A;  5EDS A;  1TWA A;  3ONL A;  3ASD A;  4L2Y A;  3DXJ F;  5DQZ A;  2XGO A;  4ILG A;  2OG2 A;  1PD1 A;  2Y3H A;  4HE8 D;  1Z6T A;  3MA5 A;  3JSZ A;  4G11 A;  5CI9 A;  5LX8 A;  1INZ A;  2GFH A;  5E3C A;  1LS1 A;  4CS8 A;  3L54 A;  4L1B A;  3SZ7 A;  1D1B A;  3OA1 A;  2LNI A;  3ESL A;  3KD7 A;  4L7T A;  2R7X A;  5ANL A;  2J09 A;  2VGX A;  1Z23 A;  1VDY A;  2QY7 A;  4FES A;  4IJJ A;  4R7L A;  5ARG A;  4KNV A;  3T8M A;  5CCL A;  5BUO A;  2XL4 A;  3KH2 A;  4W9R A;  1W2W A;  4GYO A;  2W4M A;  3RKV A;  5KCM A;  3S7J A;  3O4Z A;  2MHK A;  4JJF A;  2DYR C;  4Q5S F;  2EIL C;  4U5B E;  3LLK A;  3DD7 A;  3OEO A;  3LS1 A;  4I17 A;  5KYW B;  1WY6 A;  2Y4T A;  3MGB A;  2PZI A;  1NG1 A;  3Q47 B;  2MRI A;  4XI0 A;  3U66 A;  1ZHT A;  4H7X A;  1WAO 1;  5FWQ A;  4CT4 A;  3Q6M A;  1W3B A;  2LSV A;  4NUR A;  3CSK A;  1KLX A;  3DJU B;  4J8F A;  4XKB A;  3VLD A;  1ELR A;  3CVN A;  3S29 A;  3CHS A;  2KW3 C;  4C0E A;  3WOD F;  4ILI A;  5FQ4 A;  2IQC A;  4JXT A;  4GML A;  5E33 A;  3UMK A;  5B1A C;  1H6K A;  4JHR A;  3CQC B;  3ESK A;  2LAI A;  2FO7 A;  3ASH A;  2Y4U A;  3CST A;  4BJT A;  2QFC A;  2WXJ A;  3KEZ A;  3I5Q A;  3R7R A;  4HOR A;  2NC9 A;  2Q3T A;  1IHG A;  3PDN A;  3FUH A;  3FEY A;  4A3T A;  3SZR A;  4CDM A;  3E4B A;  4H4K C;  3CVQ A;  1H19 A;  3CVY A;  3AS4 A;  2NG1 A;  3NZS A;  1KU2 A;  2HV7 A;  5DVW A;  4MS6 A;  4B8A A;  3DM5 A;  2WPV A;  3N24 A;  3SNX A;  2EIK C;  4L2L A;  2PM7 A;  1Z3Y A;  4YT5 A;  3FTU A;  5E76 A;  3CVV A;  4O7G A;  2J9W A;  3D9L A;  1SZA A;  3Q4A B;  1XGW A;  4ZLC A;  5KYY A;  1H2U A;  2CHZ A;  4NQ0 A;  3POV A;  1VK5 A;  5BPP A;  5G04 C;  1TJC A;  3CSF A;  4RVB A;  3FUJ A;  1E8Z A;  4BFR A;  3LEV A;  1IQR A;  1E8X A;  4LER A;  4OIR F;  5L3V A;  4DPR A;  5E75 A;  4HOS A;  4WUY A;  4DOZ A;  2FI7 A;  4APO A;  2L0T B;  3K33 A;  3CHR A;  2J0W A;  4AE4 B;  4FC8 A;  3EFO A;  3D9P A;  4GB9 A;  3EGD B;  1O87 A;  3LDZ A;  3TG4 A;  1HG2 A;  3D9I A;  3D9K A;  2XRY A;  2V8S E;  5DS4 A;  3P2B A;  2CFZ A;  4GA2 A;  5HSW A;  2KQ9 A;  1D1C A;  1ZHY A;  1NA3 A;  3M1C B;  3DAF A;  4I2Z A;  4J0U A;  1D1A A;  2OCC C;  4F3V A;  2CHW A;  3LXU X;  5EGY A;  5T8I A;  1LKX A;  3APD A;  4F7A A;  4C3E A;  2V0P A;  2BE5 F;  3HLZ A;  3F46 A;  3T5V A;  1NU7 D;  4F4B A;  2VTB B;  3HTK C;  3RRN B;  4U04 A;  2WXF A;  4HOU A;  3TD7 A;  4ZLD A;  1TR2 A;  2X51 A;  1ST6 A;  3UMI A;  2VH3 A;  3EIJ A;  2YEV A;  3SP1 A;  4B6I A;  3ZFW A;  2YQ8 A;  1D0Z A;  3NG1 A;  4FHJ A;  2IXM A;  4I2W A;  3T6J A;  2L81 A;  4N06 A;  1RJ9 B;  3ZVR A;  5AIJ A;  3LS8 A;  3G2W A;  2CNW A;  4RSY A;  2XSE A;  3B13 A;  3FUE A;  2KCK A;  3LY8 A;  4FHK A;  3RYL A;  2WXG A;  3MJW A;  5FT9 A;  1IYG A;  2YIN A;  2JEK A;  3PHF 2;  3QK0 A;  1MMD A;  2XCB A;  2L9B A;  4CS9 C;  4CDR A;  5FZQ A;  1E7U A;  4C3B A;  4BJ5 A;  4APF A;  2FF4 A;  4YN0 B;  4OIN F;  3FTW A;  2YZS A;  2CG3 A;  2KZT B;  1HS6 A;  4KZ0 A;  1OWO A;  2DCP A;  2J07 A;  2WL8 A;  2CGE A;  3EJN A;  1FFT C;  2CHX A;  2PL2 A;  4J30 B;  1FFH A;  4UWL A;  3P1U A;  2FEZ A;  3FAJ A;  5D91 A;  2WB2 A;  3ASG A;  4AY5 A;  3CVW A;  3I5P A;  1OKK A;  1MMN A;  5EX3 A;  5G55 A;  5G04 J;  5J90 A;  2KGO A;  4GA1 A;  2J45 A;  1EPU A;  4GZ3 A;  3CZ6 A;  3X1O A;  2LSU A;  3EGD A;  5A23 A;  3ML8 A;  3LYA A;  3FH7 A;  3S27 A;  3DMD A;  5LCW J;  3LES A;  1UN8 A;  4A1S A;  3AU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...