4IRUA

Crystal structure of lepb gap core in a transition state mimetic complex with rab1a and alf3
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
296
structure length
296
Chain Sequence
SLKPLTLLMTSSTSFSETINQWADILKTTDMEKFSFDSNPINLLELVKQFNLYVDELAITCEANNVWAKERIDSTPNLFALYDNSGGEAIHGHAFVPYYKESIVLRRLFTVDPNTFNLSRFAAFEGPCQLYCKEHKDSAWVKIQTLLTLGNGIINTLKIIKQAQAFGIDEAVTENLKALKEQFIAFQLAEADIKESLKAPSFAEPLPNKESEFFYPIDEKALAKMNGYQLATICLEELNSPKPSPLIERILSNKKFWKRINSAFESGVFKGRTDDPAGKIAKIREWHQLLQISGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LepB
publication title The Legionella pneumophila GTPase Activating Protein LepB Accelerates Rab1 Deactivation by a Non-canonical Hydrolytic Mechanism.
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase/hydrolase
total genus 109
structure length 296
sequence length 296
chains with identical sequence C, E
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2013-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18172 LepB_GAP_N LepB GAP domain N-terminal subdomain
A PF18227 LepB_GAP_C LepB GAP domain C-terminal subdomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1700 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4iruA01
1.25.40.830 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4iruA02
4JVSA 4JW1A 4I1OB 4IRUA 4I1MA
chains in the Genus database with same CATH superfamily
2DZNA 1Z3IX 5EKQD 3FU0A 3J5PA 5BT1A 1HX8A 4DBQA 2YL1A 1KT1A 1L7CA 4F53A 4EBAG 3AS8A 3ABMC 5L0FA 3ZKJA 4GAAA 3ZYLA 4JEAA 1M57C 2XPZA 4U63A 3LVQE 3ZFWA 3T5VA 5KYYB 2QNLA 1JAFA 4TUMA 3FAPB 3DKAA 3ZYKA 2OOCA 4GA1A 4BESA 1XNFA 5IY5C 4J0UA 3DXKG 3ABKE 3PE4A 3I5QA 3EHMA 5T4YA 2DB4A 4JKVA 3ESLA 4CT4A 3S7FA 1WAO1 3S27A 2OQMA 3JYYA 1U3CA 2RFAA 4KYOB 1WATA 3EGDB 4Z68A 5JUAA 4XLPF 5G05J 2DYSC 3IEEA 2EPOA 4O7GA 2J49A 3L82A 4F1PA 4CDMA 4JVSA 3FH5A 2KCVA 5FIOA 1IQUA 1D1AA 1NSGB 4NCQA 1ZYRF 2NUPA 1QQEA 2XEHA 4KT6B 4MLPA 1VYIA 5ENTD 1YA0A 2GRLA 3DAFA 3M4CA 1UN9A 3QWVA 4XKCA 2VSOE 1LPEA 3ML8A 2YRFA 3S7BA 5B1AC 2FF4A 3T8KA 2A6HF 3NZSA 4Q96A 2C2LA 3LEWA 5D66A 3Q15A 1YLMA 3D9OA 3VLFA 1UJJA 4J6IA 3EIQC 3CQCB 1MNEA 1FR0A 4G0HA 4H4KC 5LOZA 2QZAA 1T6UA 1JR8A 4U5GA 3AU4A 3I4GA 2BKKB 4MQ9F 1RMVA 2EILE 4P9TA 3Q7LA 3PDMP 2A4ZA 3TWVA 1Z3YA 5DS5A 3L13A 5AYWD 3IPMO 4E6HA 2XLOA 5DVWA 5A69A 4GYOA 1E84A 4CCAA 2BEDA 2PX3A 2B0JA 1Q2ZA 4EIYA 3O39A 3UI2A 1NA0A 1OW6A 2J46A 5JRAA 4G24A 2GWWA 1NZNA 4GMLA 2L6FA 3HVEB 2ZD9A 4Z9IA 3RVYA 3EJNA 2I2OA 3B95A 2UWJG 4W9RA 3N24A 2GRQB 3FY4A 2AXVA 2WQHA 1J8YF 1WG0A 3UMVA 2WM9A 2R7QA 4PJNA 1SW6A 5AQBA 3QVZA 2O9XA 3OWTA 1OCCC 3APDA 1LE4A 3DMDA 5EGYA 4MW3A 2WXGA 1Q0FA 5CRVA 4ONSA 4K03A 2H7OA 1EPUA 2CG2A 3F47A 4WWPA 3TJ6A 1VMAA 4I6GA 2WQ6A 2Y4TA 1MNDA 4Z9JA 3RIBA 2B0HA 3L1MA 1TJCA 3ULQA 4XTKA 3SQVA 3SXKA 3ZU7B 1BU9A 4L1BA 4LACB 1QKRA 3QZCA 4E0IA 4BX8A 2R7SA 5A23A 3U3WA 3KS2A 3WG7C 3B0VC 1BI7B 4UI9C 2OVFA 1SMYF 3LEOA 3ASOC 2XHEA 1Y4CA 3CVPA 4DJ9A 1V54E 3V5YA 4O6YA 3FWVA 1S64A 3B29A 1OWLA 4OIQF 4KNVA 3DWLG 1R4TA 4EHMA 4A3VA 2IEJA 1Z5SC 2CW0F 3QWPA 3RSEG 1I4YA 3DSVA 3LNMB 4F6RD 4DI4A 2XLEA 4XEFA 2LQGA 2ASRA 4Q4ZF 3M15A 3EFOA 2IOSA 2IBFA 2LO6A 3B0UX 3IBEA 4WUYA 3AG3E 4HQDA 4MVMA 4KI2A 1DNPA 1LE2A 1V74B 3QK0A 5CEAA 1KTMA 3UUXA 1GM5A 4RD9A 5JHAA 4HLLA 5LX8A 4JJFA 5ENQD 2BF0X 4UQZA 3VLDA 1JWGA 2ZPAA 3L6AA 1OCRE 3VAYA 3NZUA 5ANRA 3CVUA 3Q4AB 5D2MC 1BR1A 1OXBA 4LNUD 2LCHA 1IW7F 1VTMP 1MMNA 4I2WA 2ETSA 1O1TA 3K1IC 5T3WA 3ASHA 3SFYA 3B0PA 5CIVA 4XPYA 3KYIA 5LCWJ 5KYWB 3CKCA 3U66A 4GZCA 1TNOA 3DAGA 4BTAA 4I43A 3KSQA 2DVWA 4QFVA 2LD6A 4JTCB 1W2WA 2J9QA 3KPHA 3S28A 2IXOA 5AQ9A 3ML9A 3RQGA 1FCHA 4I3MA 3CSTA 5COMA 3EUVA 5CMWA 5FQ6A 3DEPA 1MZCA 3LJ3A 4I1OB 3FU6A 4OD4A 4WAFA 4J8FA 1EI7A 2EIME 5D0QD 3RK6A 3NBNB 3CHPA 3JXJA 3ZG1A 1ELWA 3G2TA 1OCOC 2Q9BA 5A6JA 2A5EA 3AG2C 4ANWA 4LLEA 4C7OB 3KAEA 3HLZA 2E87A 4F7AA 2JLBA 3VTXA 2DYRE 3KYJA 1N1CA 2J7PA 3ESKA 3Q73A 1N95A 4K7BA 2HR2A 2QFCA 3FTXA 3PMRA 2VGXA 3UIOC 3U2MA 2OG2A 3G2UA 2OEVA 2YHEA 3FH7A 4C3EA 1OR2A 2R59A 2AXUA 3U8PA 2FO7A 4J7WA 1MHQA 1OWOA 3WXXA 1Q0DA 2CGEA 2P9KG 3M79A 1XZQA 5FJYA 1YDIA 2ZIRA 3TWRA 2HO1A 5T3RA 3Q47B 4N3BA 4CS8C 2EIJC 4Q94A 1TFKB 4RLYA 3EU5A 4F3VA 2Y3BA 2UUHA 2ZXWC 2NYJA 5KJMA 1M2VA 1ORYA 3U4TA 2WQ7A 2TMVP 3TULA 3T4RA 5ITZF 3D9PA 2AU5A 2HE0A 4NY3A 3Q6NA 5B3SE 5L3QA 4GZDA 3UPVA 4O60A 3S84A 2MWQA 4XEKA 5G2NA 4HB5A 4D4NA 3CKBA 4A1SA 4GTSA 3SZRA 3AQCA 1WN0A 1E86A 3PH0C 1OCZE 3SP1A 4JA9A 3DRAA 2F22A 5AC5A 3PZ4A 1K05A 4EBJA 4U95D 3C5RA 3RRMB 1ZU4A 4DRIB 4ANXA 3MV3B 3CGHA 4GYWA 3R9MA 4H54A 3Q9UC 4Y6CA 3FFLA 4LNGA 2XLVA 3KMIA 1N4PA 3NKDA 4DRHB 3B7UX 1QNFA 3AG4C 4BETA 1D1CA 5J08A 3EZHA 2L9BA 3R9AB 3SD5A 4I9CA 5FQ4A 2J9BA 4J8YA 1WTYA 5FQ8A 5L0IA 5BW8C 2W45A 3EH1A 3K66A 2NSGA 2Q00A 4GTTA 3H65A 1U0BB 1FT1A 2XGMA 2PL2A 3V30A 1HS6A 3AS5A 4GMJA 3FULA 5HQ8A 3QKYA 3DM5A 4O1OA 3ASNC 4DLQA 4RSYA 2YHSA 1NL4A 1O3UA 3QJZA 2Y69C 1H6KA 2G62A 1RW2A 2VQ2A 5KJKA 3UKUG 1FPPA 2QTVA 4ANUA 1BDJB 4WGYA 5JA4D 1E96B 2J4DA 3ITFA 3SF4A 4WNEA 4XX5A 1MMGA 2HV7A 3VLEA 4RQIA 1INZA 1OQCA 3C18A 3EH2A 3CHOA 3O10A 3CVVA 1KNYA 1PAQA 2RKKA 4U8VD 2P9SG 3CR3A 3LJNA 2R2LA 3TWWA 2YWAA 1C17M 2LFFA 4H7XA 1CPQA 3DXMG 5JVEA 3LYAA 2XLHA 4GTVA 3CVQA 4XPWA 2WXKA 3RW0A 3GWLA 2CCYA 1P5QA 5AIJA 3M4BA 3KH2A 3MYFA 2WXRA 4GMRA 3RRUA 3VTYA 1OWNA 4G7ZF 4B8AA 2P6VA 5DLJA 1A7DA 2Q9AA 3EGXB 4AIFA 4I1MA 3EIJA 1O5HA 3LS1A 2P9IG 3L9TA 3CV0A 2ZU6B 2V4HC 1D8DA 4MTFA 3N0TA 3HRAA 3TQOA 2QYJA 4O6NA 3Q9NC 4FHKA 2IQCA 3HKKA 4JEBA 2XXAB 1TNYA 2LAIA 4K5CA 4YNDA 1XGWA 2R7RA 3O48A 2GRMA 4WGZA 2F0YA 2L0TB 3ZSUA 3K33A 5AJDA 4JIOA 3JZ0A 4GPKA 1H6OA 5CBNA 4HRNA 1M6TA 4YWQA 2I9CA 4QI2A 4A2NB 3EU9A 4ATZD 1OXKA 1O1SA 1QSPA 4CDRA 3JTLO 2Q7FA 1VOMA 5L0GA 3SXZA 3AG1E 2EPKX 4XZ4A 5AAOA 4BTBA 3NKEA 3JT1A 2PF4E 2YL0A 1IHGA 5HRYA 1K04A 4JC8A 3SNHA 3FH8A 1G3NB 4CGWA 2R7XA 3C3RA 2X6JA 2ZGGA 4FC8A 4WNFA 5FZQA 3NG1A 3MGBA 3GZSA 2KC7A 1HY5A 4U9EA 2HYZA 4N2QA 2OU6A 4DX6D 4AL1A 1HH8A 3JSEO 1F1MA 2X51A 3G2WA 2L6GA 1E8YA 3AS4A 3TD7A 2J09A 2KXPC 2HJMA 2LIGA 5EYLA 2GRNB 4ANVA 3PZ3A 3UIPC 2P61A 4H7YA 4BJ5C 3HNIA 2LUHA 3RO2A 2XPYA 4G8LA 4IYPA 5KYNA 1RKEA 4WWNA 2VYIA 2H6HA 3ZNGA 3VM6A 2NXPA 3BUAA 2G3VA 3OTNA 3CHSA 1FT2A 2I15A 2R7WA 3R2PA 3TJ5A 2FULA 2X6FA 4AP2A 3ISMC 3RH3A 3C98A 2F37A 4U7EB 1OKKA 4G23A 3UGPA 3V5ZA 5E33A 4OAUC 1D8EA 2R03A 2UUIA 1K3ZD 1OXJA 4AY5A 3B7SA 1FTSA 2AWCA 2W9YA 4Q69A 4YJWA 3OXGA 2EPMX 1T5OA 2V5QC 1LD8A 5FWQA 2YKZA 2WB7A 3LESA 3LXUX 1SVXA 5DS6A 1AP7A 3IQCA 3A11A 2J07A 3C63A 5CI8A 2VCBA 2FI7A 3QC1A 4GA2A 2XPIA 4PS7A 3Q78A 1E90A 2R02A 5M72A 3PZDA 2KGOA 2WZLA 5LFAA 2WVOA 4UWKA 4DRJB 1WASA 3FUFA 4J7TA 2WL8A 4BT9A 3GM2A 3FTUA 1YJGA 3TK0A 3JUIA 3PNLB 1VLTA 2FEZA 3HXEA 4GCNA 4GU5A 4M63A 2ETCA 4D10C 2Y3HA 1RXQA 4CSAC 4OVUA 1H19A 3NRHA 3OA1A 3W9FA 4GCOA 4U5BE 4J8EA 3ONKA 3GWNA 4GTRA 3AJIA 3CQGB 1IKND 3GEEA 2EIKC 3IXEA 2XRYA 3V2OA 2XRZA 2OCCE 4GYYA 1TN7A 2L81A 4O6FA 4EHPA 5EIDA 3NOCD 2VTBA 2WVNA 2IM8A 3X2QC 4CT0A 4BWRA 3CVYA 3RQFA 1YYXA 2HSQA 1E8XA 3IHUA 4HE8D 3PUKA 1G4US 5G04C 2OJED 5EYPF 4B6IA 3TGOA 1QVXA 1S70B 4GPMA 2J45A 1JPJA 2R9RB 2VCCA 2BE5F 3U9JA 3ABLC 1HG5A 5KBAA 4G26A 4E17A 5CI9A 1NLXA 3FUIA 2IXPA 1NA3A 3PEUB 3MX3A 2EINE 5J90A 3KEAA 2WB2A 3E33A 1Z5ZA 3ZGQA 4PDXA 4BSZB 1FNTc 3EHRA 2IXNA 4Q5SF 4L6RA 1MMDA 3BEHA 3U64A 4ZLDA 2A0BA 4IRUA 3CSKA 1Y8MA 1NZEA 1TNZA 3LS0A 3EDTB 3HG0D 3TXMA 1CGNA 4KNWA 1EKYA 1LKXA 256BA 3G2SA 2W4BA 2CNWA 1N0QA 2BC5A 5BXOA 3Q5MA 1T6IA 3AU5A 3KEZA 5KWDA 5BXUA 3FUKA 4DPRA 2X6IA 2XCBA 3MA5A 2J7PD 4MTOA 4BJ1A 2YNQA 4ULWA 3AAAC 4XKBA 1DCEA 1NI1A 4G25A 4W8PA 3RKOF 4YT8A 1ORJA 3GM3A 4JURI 2CHZA 2DI3A 3MCXA 1OR3A 3ZUVB 2KW3C 1BPOA 2HMQA 3US6A 2NUTB 3ZN3A 2GRRB 3HXFA 5FZTA 1YVIA 3E70C 4JE9A 3S90A 1AEPA 1SF8A 5F5HA 1CGOA 2XLDA 3W8HA 5B1BC 2HKVA 2P2CP 1APCA 3AGTA 2AVPA 4KBQA 5KYUA 2H6IA 3B9QA 4AE4A 3SY2A 3BG1B 1JPNA 2KCKA 2XGSA 1T9KA 4UDVA 5AJLA 1G5ZA 4MS2A 4OAVB 1TNUA 1H2TC 2ZXRA 3K1HA 5D92A 3APCA 5FINA 4N6CA 2JABA 2PBEA 2AXZA 3MLGA 4DI3A 2R7VA 3HXCA 2C0MA 5L3VA 1BR4A 3FDQA 3FTWA 3FAJA 2R7TA 2FO1E 3PHF2 3VRCA 3K1IA 3OEOA 4HORA 3FUNA 1ELKA 1JOGA 1Z6TA 1LI5A 4C3BA 2PX0A 2HZ8A 4B94A 3ABKC 4MRUA 3UTMA 1HG2A 1PC2A 1S05A 3C7JA 4IWBA 4HBDA 3GM1A 1QLEC 2Y3AA 3C3OA 2L0IA 4OVVA 2X3MA 4YT2A 4YVQC 3R7QA 4ZFHA 4G8KA 4PS8A 3AQBA 3U9WA 2NUPB 1PD1A 2EIJE 2IJGX 2YINA 5CCLA 1TEZA 4YDYA 3JYSA 2ZXWE 4RG6A 3VF0A 1WM5A 2Y1LE 1XZPA 5JP7A 4GYTA 2GA0A 4PUCA 4EKWA 2WXQA 3CQZA 4JA7A 2HS5A 4NRHB 1JPLA 1MJ0A 1YMPA 3FTYA 3OXLA 4I1AA 1EQ1A 4N06A 3DBSA 3ATPA 1NFIE 4UUCA 3UM0A 5AARA 3O55A 1MX2A 2ICWG 2NPUA 5KYXA 3R7CA 3GYZA 4L2YA 4JHKA 1J8MF 1A7VA 4CIHA 3UNGC 5GPGB 5E3AA 3IEGA 2VSYA 2EILC 3F46A 2J4BA 4I17A 2QY7A 4U0SA 1B68A 3NOGD 3ZXSA 1H9TA 3RO3A 1NG1A 3E37A 1BR2A 2LFDA 1OWPA 5G05C 3S7JA 4UQXA 3FHDA 3T9KA 2WXOA 3MEKA 2EPNA 4A55A 3SBSA 1SZAA 3TWQA 1V55E 1MQSA 4CS8A 4CYMD 1UN8A 4L2LA 3GEIA 4MVZA 3ZTZA 1TN6A 3D9JA 3Q75A 1WOLA 4BY6A 4JJGA 3SYNA 3B7TA 4Z9HA 2LXLA 4DX1A 3RVZA 3LAYA 2DZOA 3D9NA 5CERB 2XEVA 3APFA 1JCQA 1K8KG 3CEXA 2WXFA 3ZWIA 4DX2A 2VGYA 4XI0A 1AWCB 3U8VA 5A6BA 4J8DA 5JJ6A 3ZIMA 2J0XA 1QBQA 2VGEA 3E32A 5ARFA 3EG9A 3EHNA 4M3OA 3W4YA 1N4QA 3FUEA 3J5QB 4JZYA 2AP3A 2LAHA 4YVOA 5EN5D 4K5AB 2WVQA 4KVMA 4ATGA 2CDQA 3F6QA 4RVBA 4B89A 1MMAA 2J9UA 3JQ1A 4N5QA 4RG9A 4PJJA 4W8KA 3JXIA 1A41A 3MKRA 2R7OA 1ZZPA 4CX9A 4KMOA 1QZ2A 3EFOB 4J7YA 4AL0A 2L9JA 4E18A 4GA0A 3GODA 4ZHBA 2ONDA 4TUUA 4CDAA 1MYOA 1YARO 5HKPA 1AUEA 2VCAA 4YK5A 4A3TA 3O6XA 3PREA 3CEQA 2P9LG 3AG3C 3CK7A 3MV2B 1H2UA 4AXHA 3G4ZA 2OEXA 4PH4B 4WABA 4DLOA 5COFA 5EDSA 4APOA 3T6GB 3CHMA 3ZXPA 1Z3XA 5BV0A 3TWTA 4J30B 2AWYA 3TXNA 3UKRG 1Z6AA 2KCLA 3KKBA 2A0UA 3GZ1A 2ETBA 2FGYA 4U9DA 2X38A 4UWFA 3AJMA 5HI7A 3MYVA 4BG0A 1LD7A 2NC9A 1FFTC 1ORSC 3RYLA 3JYHA 3SNXA 2MYSA 3FUDA 2KZTA 2XQ0A 4TXPA 4TRQA 3T6JA 1SA5A 1OKKD 3FTVA 2GGFA 2KC3A 3Q7AA 4J8SA 4HVBA 1S63A 2M64A 4QDLA 2OVBA 3UMKA 1C02A 1RJ9A 4PFPA 2PNOA 3D9IA 4JD2G 5C1DA 3LY8A 4JCZA 1E8WA 1U89A 5ENRD 4P6IC 3NF1A 4WWOA 4RDAA 2OV8A 3CVNA 1N9AA 3Q6MA 4BJ6C 5E75A 2EIMC 2OOEA 3Q79A 2OKUA 4N4WA 4OIOF 5DS4A 4PACA 4UWGA 2Y3DA 1N11A 2M4EA 4IAQA 3W2WA 2VGXB 4KZ0A 1TNBA 3RRNB 1FMVA 1TWAA 1H9GA 2DYRC 4I2ZA 5LCWC 2P1AA 4DRXE 3TOMA 1WY6A 2HSBA 1OWMA 3C8GA 1IXVA 4XEIG 3BG0B 3TWXA 1NP7A 3QARA 1CGME 3LLKA 3DZAA 3DSWA 4K0DA 2J0WA 2R5SA 2L6JA 3GANA 3V5XA 4TXRA 2CYDA 5FZRA 3C3QA 3JCUQ 3ZDLA 5CCMA 1KLXA 3IQTA 2CFZA 3P2BA 2HFIA 1M2OA 1M2VB 3SHFA 2VASA 1Z23A 3J06A 4CS9A 2C04A 2XL4A 3DEOA 2XRHA 4DBRA 2LNIA 1U2VG 4FWVA 1FFHA 4JZAA 3MKQA 4F4BA 4U5HA 3DD7A 5T3TA 3RFYA 3U3BA 1TR2A 4ANJA 4DVZA 3HJCA 4KBLA 2Y3GA 2UY1A 5G04J 3NQPA 1SZ9A 4UWHA 1B89A 5B3SC 1E2XA 4BJ5A 2Q3TA 4NQ0A 5COGA 4AJWA 1O5MA 3ABME 4GTOA 4EECA 2LP4A 3X1OA 4XE0A 3I4RB 4HFFB 2Y4UA 2HV6A 4IARA 1OCZC 3JRMO 1PV3A 3DXJF 1FVHA 2KQ9A 1H7IA 4CZ2D 2HMZA 4WNGA 1YYJA 3FEXA 3LDZA 4EBAA 2WXNA 2WZFA 4AVXA 1H2VC 5A6AA 3BQOA 3ZHEA 2NSFA 1QYMA 5IY5E 2PM7A 4UWLA 1GS9A 2Q7RA 2NSZA 5KYYA 3K6BA 2Q4FA 3L17A 1V4AA 4XLNF 3QNKA 1R5ID 3ZQYA 3ZTMA 5FCLA 2DIWA 2V0PA 3FU5A 2DWZA 1TWHA 3Q7GA 4U8HA 3URZA 3TG5A 4AX2A 3JCKC 2CNWD 2DYSE 2QUPA 3SXMA 4ACLA 4NC3A 2RD9A 3EGDA 3CSFA 3DI5A 2LSEA 2QE9A 2R05A 2WXLA 3CVWA 3E34A 1A5EA 5A6CA 4JL0A 2YVKA 4GZ5A 5E76A 4AV7A 1FAPB 3OAWA 1K1AA 4GQHA 3FUMA 3JSZA 5B1AE 1OW7A 3OXFA 3HNLA 4HLEA 5EK0A 3L34A 4HOTA 4G1TA 5G55A 2YL7A 2XLMA 3FUJA 2EPLX 4C48B 4I44A 2J8SD 1E8ZA 1DVPA 3ZPJA 1E85A 2IONA 4E0HA 1QQ3A 5BQHA 2LSUA 5BV1A 3RF3A 5C2YA 5ENNA 4ER9A 5ENPD 2Z15A 4JC7A 2AW6A 2A5UA 1TJFA 4N39A 1JRAA 4APFA 3NDBB 3ASDA 1L5JA 4IAOA 2VSNA 3UX4A 1HW2A 2R17C 3WODF 1KZOA 1OY3D 2ZISA 1LI7A 2MHKA 2I1KA 4JB8P 4BT8A 4G7OF 4UI9J 3SGHA 2GROB 3PZ2A 1I4ZA 4HOQA 1VB5A 2R25A 5E3CA 3WAQA 3FUHA 4G2VA 4K1OA 4U04A 4XIFA 4B0ZA 4AY6A 1LVKA 1DC2A 2YEVA 3PS6A 1W3BA 4C0EA 3UINC 2ZXOA 4U0UA 5DBKA 4Q7CA 3S2AA 5JT4A 3PNTB 1H6PA 4CS7A 1X81A 4U96D 3PCVA 4PJMA 2V3CC 4ILGA 1SYQA 4C0MA 3HVEA 1DOVA 4HXIA 3C62A 5KCMA 2JEKA 3NMIA 4YN0B 2I1JA 2X6HA 2XCCA 3FTSA 3MJWA 3D9LA 1HZ4A 4CDNA 4JHRA 1ZHYA 1U6HA 1OCCE 4FLHA 4FA6A 3NAWA 2YLDA 3M1CB 4KXKB 2PZIA 3RAUA 5EIBE 4GZ3A 4E7SA 3JRTA 5AN8A 4JW1A 3D9HA 3NMJA 2IYLD 1VLSA 2XS8A 4YL0A 5ANLA 2RSEB 2PM6A 2J9WA 4J32B 1IYGA 3E9VA 3UM2A 5KJLA 1BLXB 3FOOA 5FZSA 5DIZA 3ZHEB 2AWIA 2IOQA 3LLIA 3WG7E 1GGQA 4MVRA 2L7AA 3EPVA 3DSSA 3UM3A 4ILHB 4B93B 4X8QA 2OEWA 1N52A 4JEHA 3ASOE 5FT9A 1XWJA 2XL8A 3AG1C 2DCPA 1TN8A 4D4XA 1ZHWA 4YL3A 3UGOA 3SZ7A 3UM1A 1YZAA 4C3DA 4UI9K 5EX3A 1A17A 2BTDA 3QWWA 1YCSB 4EZJA 3KSLA 4BEMJ 2JPUA 4LSZE 4XEVA 2IO3C 2YL3A 4ACKA 1Q0KA 2D4UA 1Q0MA 2D5RB 3DSXA 4GTPA 3V31A 1SQMA 1RKEB 2FBNA 5JHBA 4LERA 2WXHA 2NG1A 1BI8B 3QDNA 1C03A 3CHQA 2JX0A 1HFAA 2C03A 3W9GA 4OIPF 2XS1A 3ZVRA 1D0ZA 3POVA 5AQ7A 5FTPA 3NYMA 3PEVB 2P0NA 1Y6DA 1UG3A 2VB6A 2WZGA 2V5FA 3T6BA 4BJTA 4PS3A 3CLJA 4ZLCA 2Q9CA 1L3PA 2PQNA 1KZPA 3P1UA 4EQFA 4IJJA 3LVRE 4N5CA 3CK9A 4YDWA 3ZYQA 3DM9B 4MVQA 3W8IA 4FJYA 1EDUA 4CEMA 3Q7FA 4A1GA 3JUEA 4X0RA 3V79K 5A6KA 4AK9A 3TG4A 3TL5A 2H7VC 4PJLA 4JXTA 3HNJA 3PDNA 3N71A 4IULA 4U5FE 5ARGA 2F8XK 1YYHA 1HW1A 2WXJA 3HYMB 1PY1A 5A6BD 4MS6A 3B71A 3TWSA 3B13A 5KYWA 1HO8A 2H8AA 3S29A 2IU1A 5HS0A 4FHJA 4DUIA 3EZIA 3NB2A 5BQGA 3QB2A 5ENSD 2CHWA 3ZW3A 1T01A 4HOUA 2RFMA 1U3DA 3GZ2A 1BBHA 1MX4A 2BUGA 2ZGDA 3SBTB 3T5XA 2HM8A 1TWCA 5A7DB 4CJGA 2YQ8A 3DJUB 1OCOE 4EPZA 3HXBA 1E7VA 1KPSB 3AG2E 2VJ8A 1SR2A 2DGJA 3G2VA 3K7DA 1ELRA 3E4BA 1ZBPA 1K40A 2WMOA 1CPRA 4IB4A 4C7OA 5DQZA 1IHBA 2IFUA 2KNHA 3LEVA 2PNNA 1S0PA 4IN3B 2VTBB 4OYSA 3DE8A 5EX0A 3L08A 2OCCC 3L8JA 2XL6A 4U5EE 1UOHA 3MYIA 3EHQA 4R32A 3ASGA 2PFDA 1N4RA 2H6FA 1SZIA 5DQTA 5T8IA 2WMNA 3L0IA 1RKCA 3DJNB 1FVFA 1GW6A 2MYOA 1JCSA 1ZU2A 2WXIA 3FOPA 2XGOA 3SFXA 4KVOA 4XWJA 5CHEE 1LTXA 1UFBA 3B7RL 2YQYA 2AVKA 3MZLB 3SFZA 4YDOA 4MBGA 2EINC 3QAQA 2XM4A 2G3KA 3RJVA 2MRIA 5L0DA 5HV9A 2GRPB 4CBEA 2PQRA 4PFOA 2KK1A 3HHMA 3CK8A 4NACA 2KJGA 3UT4A 5JJTA 1LF8A 1DCQA 4LG6A 4PK4A 3TAXA 2IF4A 2YHCA 1BD8A 3IHVA 5L0CA 4HRLA 5H7PA 4BSXA 2J9VA 2YZSA 4DX5D 1UG7A 2XLWA 4EUKB 5D91A 3AG4E 3HXDA 3QVYA 3T9OA 4HS2A 4O6MA 1RZ4A 1LS4A 1YA9A 3IV0A 4EWCA 3QW1A 1VDYA 3S7DA 1HE8A 4Y6WA 1ZU5A 4LDQA 3L16A 5TJ5E 1HU3A 2X6KA 3C8GD 3U9MA 4DJAA 1HXIA 4CIPA 1Q0GA 1RCPA 4MVOA 3BU8A 3FHEA 5AGFA 3E30A 3K9IA 4LEUA 3ASNE 3S0XA 4FULA 4TV3A 5KYUB 1H6GA 4AE4B 4A4AA 2VH3A 4OD5A 2Y69E 1YA7O 4IGGA 3TWUA 1O87A 3FDHA 2PP4A 4WJ0A 2BKGA 3LS8A 2L6BA 3A9CA 3T8MA 4GTQA 3B7BA 3V2XA 5JLIA 3G4XA 3QMKA 1HE9A 1A0BA 5F5FA 4MVUA 1NU9C 3TOLA 4AOFA 4BFRA 4LNBA 4LRZA 3LY7A 2KM4A 5EHHA 2A69F 2KATA 5ENOD 1LS1A 4AEZC 1H0AA 1EA8A 3IHYA 4URKA 2CHXA 4FX5A 2AJAA 3PZ1A 1Z7Qc 4CRWA 4L7TA 1OT8A 3PVLA 3UR3C 4ULVA 3UXGA 1D0YA 3HTKC 1V54C 4HOSA 4U0ZA 2WVIA 1D0XA 1N54A 3SI5A 4XQ1A 1OW8A 4CGVA 4NURA 1D9SA 4JTDB 1QPUA 2C0LA 4MW8A 2L6HA 3ZYMA 4PR9A 1OUVA 3NYJA 2VSXE 2J08A 3DSUA 2XENA 3MFNA 4KZCA 3ULEG 5JS5A 4I9EA 3IQ6A 2LK4A 4OINF 3PRZA 3I4UA 4JHJA 3EGXA 2XZDG 4NTAA 2MOWA 3RIPA 4OIRF 2GFHA 3DWWA 2XEEA 2XZTG 4FAPB 3U2LA 3I3NA 4XI9A 1BZ4A 5F28E 4E7ZA 1TWGA 1ZVZA 2B6CA 2GW1A 5AQAA 4L23A 2B0OE 4NQFA 3FMSA 3RKVA 2XXAA 2GAQA 2QLAA 1OCRC 4BJ6A 1N4SA 4EZLA 5D0OD 3U0CA 4HNAD 3CVLA 3LPZA 3C8ZA 5KYXB 5L0JA 1I5NA 4I6EA 3SEOA 3H2UA 4CDVA 2FFHA 1IQRA 5CMYA 3EQLF 1HMOA 4GZ6A 4NIKA 3AGUA 4KC9A 3ZC4A 1O1RA 3LCAA 4HEAJ 2EQXA 2X0CA 3JQ0A 4B8CB 4HFKB 5B3IA 3ZVVA 3S9OA 4MKTA 1EF1C 3RU0A 2ETAA 2GDCA 4G78A 4C9BB 1T6QA 3NYLA 4V3IA 5CEDB 3NMKA 3ZRHA 1NFNA 2FAPB 4EBBA 4FADA 5BPPA 3BEEA 4A63B 4DOZA 2P9UG 5JMND 3SO8A 4DK5A 2H7BA 5LP0A 4EBKA 3UMHA 2HJ3A 4P29A 1HE1A 2Y39A 1V55C 3DSTA 1K1BA 2F8YA 4N2SA 3RQEA 1ZW2A 4GB9A 2BL2A 3GEHA 3UT7A 4QI0A 2MHRA 2IOLA 1YZCA 3KL4A 3L54A 2W4MA 4K5BA 4O1PA 3IQ5A 4ME2A 4N3AA 1GQAA 3VYWA 4FP7A 1HMDA 3CZ6A 1A7EA 1UW4B 3EG9B 3D9MA 1ZHXA 3FU3A 3ZQVA 2E0IA 4G11A 3CIAA 5BUOA 2ILRA 3ASFA 4I6JA 3UQ3A 4MTGA 4UQYA 2DBAA 2WXPA 4BPMA 1ZHZA 5CBOA 5KJNA 2J8WA 4G7HF 1JCRA 1UJKA 3TJPA 3L8IA 4QQIA 4FESA 1JWFA 1NU7D 3D9KA 1JMWA 3ZIBA 1VYKA 1NFOA 5KNHD 3IKOB 3LY9A 5JJ7A 3V7OA 4BX9A 2XM0A 1G8XA 2KBXA 2YLGA 3FTZA 4N3CA 3ULYA 1ST6A 4WNDA 1YAUO 2H6GA 3KD7A 1TQGA 5E2QA 2IY0C 3AOUA 4YT5A 4P9FA 4LDRA 3FEYA 5JSLA 2A6EF 4U5DE 3FXHA 5BNWA 4M7CA 2P9NG 3G50A 4CDYA 5T1DB 1AVOB 1G4WR 4DVYP 2YLIA 2IO2C 1Z63A 2P7VA 4LUNU 4ILIA 1WDYA 3GORA 2I8BA 5AENA 4BERA 4LDKA 5K0IA 4GEHA 1PCXA 4YDEA 4F1SA 1NBBA 2EIKE 3ZEFA 1VK5A 4U07A 5FQ7A 4FJZA 3LUTB 4AM9A 4HI8A 2KZTB 1JUQA 1QZXA 2XSEA 2VC9A 3ECSA 1IZMA 3X2QE 1LM3B 3CHRA 5KNGA 2P58C 4HI9A 2KYHA 3QOUA 4FU3A 4JEUA 4EZKA 4N6HA 4R7LA 4YL1A 2P9PG 2LXMA 1RJ9B 5BQIA 3ONLA 2RG8A 3O4ZA 3QW0A 4K0RA 3ABLE 1TR4A 3PE3A 3DE9A 1X5BA 2Y0BG 3R7RA 4CS9C 1FMWA 4DX7D 1N94A 4JCHA 1Y6IA 5CECB 4U5CE 1KT0A 4JPSA 1E7UA 2RD0A 2R7UA 2WXMA 1WGWA 4RBNA 2LSVA 3LNRA 2QC9A 2CFUA 3C72A 3SXYA 2QYUA 3HDXA 4XPXA 3U5SA 4CSAA 4FLBA 4BEJA 1ZB1A 3UMIA 3Q49B 2HUJA 4HFGA 1TFOB 2KSFA 3U3FA 3C8GB 3GW4A 1TYQG 3L22A 1D1BA 2IXMA 2QY9A 5BUZA 2A1DD 2I6HA 2E2EA 2V8SE 3D3MA 3DPYA 3FP3A 4MNDA 3I5PA 4LLCA 4NTBA 4TXQA 1WWPA 1N0RA 4BEPA 3W2VA 5EILA 2CG3A 3BRJA 1MX6A 5AC4A 3QTHA 5CRUA 1ZW3A 3CAXA 4ABNA 2V4LA 4YT4A 1EYHA 3WHNA 4GTMA 2WPVA 1SA4A 4DXWA 5HSWA 3ENEA 3HNKA 4NTFA 1S7ZA 3MKQB 2OJQA 1ZHTA 3LKUA 1MQVA 1KU2A 4O79A 2ZXPA 3N2ZB 1DOWA 4HRMB 3LJBA 1M56C 1TKNA 3CVXA 3PUJA 4U8YD 2UY1B 5B1BE 3H2VA 4LCTA 4E85A 3UT8A 5L0HA 2NUTA 1E83A 1LIHA 3FVYA 4JRZA 4CJOA 4JTAB 3DPDA 4L9PA 1PD0A 2JD3A 3MBGA 2M63A 3HIZA 1HF8A 2V26A 2A68F 4MVSA
chains in the Genus database with same CATH topology
1Z3IX 5EKQD 3FU0A 5BT1A 1HX8A 4DBQA 1KT1A 4F53A 4EBAG 3AS8A 3ABMC 4GAAA 3ZYLA 1M57C 2XPZA 4U63A 3LVQE 3ZFWA 3T5VA 5KYYB 3ZYKA 4GA1A 1XNFA 5IY5C 4J0UA 3PE4A 3I5QA 3EHMA 5T4YA 3ESLA 4CT4A 3S7FA 1WAO1 3S27A 1U3CA 4KYOB 3EGDB 4XLPF 5G05J 2DYSC 3IEEA 4O7GA 2J49A 4CDMA 4JVSA 3FH5A 2KCVA 1IQUA 1D1AA 1ZYRF 2NUPA 1QQEA 4MLPA 4KT6B 1VYIA 1YA0A 2GRLA 3DAFA 1UN9A 3QWVA 4XKCA 2VSOE 3ML8A 3S7BA 5B1AC 2FF4A 2A6HF 3NZSA 4Q96A 2C2LA 3LEWA 3Q15A 3D9OA 3VLFA 1UJJA 4J6IA 3EIQC 3CQCB 1MNEA 4G0HA 4H4KC 5LOZA 4U5GA 3AU4A 3I4GA 4MQ9F 3Q7LA 2A4ZA 1Z3YA 5DS5A 3L13A 5AYWD 4E6HA 5DVWA 4GYOA 4CCAA 2PX3A 2B0JA 3O39A 1NA0A 2J46A 4G24A 1NZNA 4GMLA 3HVEB 3EJNA 2I2OA 2UWJG 4W9RA 3N24A 3FY4A 2AXVA 2WQHA 1J8YF 3UMVA 2WM9A 2R7QA 4PJNA 2O9XA 3OWTA 1OCCC 3APDA 3DMDA 5EGYA 2WXGA 4K03A 2H7OA 1EPUA 2CG2A 3F47A 4WWPA 1VMAA 4I6GA 2WQ6A 2Y4TA 1MNDA 3RIBA 1TJCA 3ULQA 4XTKA 4L1BA 4LACB 3QZCA 4BX8A 2R7SA 5A23A 3U3WA 3KS2A 3WG7C 3B0VC 4UI9C 2OVFA 1SMYF 3ASOC 2XHEA 3CVPA 4O6YA 3FWVA 1OWLA 4OIQF 4KNVA 4A3VA 2CW0F 3QWPA 4DI4A 4Q4ZF 3EFOA 2IOSA 2LO6A 3B0UX 3IBEA 4WUYA 4KI2A 1DNPA 3QK0A 3UUXA 4RD9A 5JHAA 5LX8A 4JJFA 2BF0X 4UQZA 3VLDA 1JWGA 2ZPAA 3L6AA 3VAYA 3NZUA 5ANRA 3CVUA 3Q4AB 1BR1A 1IW7F 1MMNA 4I2WA 3K1IC 5T3WA 3ASHA 3B0PA 5LCWJ 5KYWB 3CKCA 3U66A 4GZCA 3DAGA 4BTAA 4I43A 4QFVA 1W2WA 2J9QA 3S28A 2IXOA 3ML9A 1FCHA 4I3MA 3CSTA 5CMWA 5FQ6A 3LJ3A 4I1OB 3FU6A 4OD4A 4WAFA 4J8FA 3RK6A 5D0QD 3CHPA 3ZG1A 1ELWA 3G2TA 1OCOC 2Q9BA 3AG2C 4ANWA 4LLEA 4C7OB 3KAEA 3HLZA 2E87A 4F7AA 2JLBA 3VTXA 1N1CA 2J7PA 3ESKA 4K7BA 2HR2A 2QFCA 3FTXA 3PMRA 2VGXA 2OG2A 3G2UA 2YHEA 3FH7A 4C3EA 2R59A 2AXUA 2FO7A 1MHQA 1OWOA 3WXXA 2CGEA 5FJYA 2HO1A 5T3RA 3Q47B 4N3BA 4CS8C 2EIJC 4Q94A 4F3VA 2Y3BA 2ZXWC 5KJMA 1M2VA 3U4TA 2WQ7A 3T4RA 3D9PA 4NY3A 3Q6NA 5L3QA 4GZDA 3UPVA 2MWQA 5G2NA 3CKBA 4A1SA 3SZRA 3AQCA 3PH0C 3SP1A 4JA9A 3RRMB 1ZU4A 4ANXA 3MV3B 3CGHA 4GYWA 4Y6CA 3FFLA 3KMIA 3NKDA 3B7UX 1QNFA 3AG4C 1D1CA 5J08A 3EZHA 2L9BA 3R9AB 3SD5A 4I9CA 5FQ4A 5FQ8A 5BW8C 2W45A 3EH1A 3K66A 3H65A 2XGMA 2PL2A 1HS6A 3AS5A 4GMJA 3FULA 5HQ8A 3QKYA 3DM5A 3ASNC 4DLQA 4RSYA 2YHSA 3QJZA 2Y69C 1H6KA 2G62A 2VQ2A 5KJKA 4ANUA 2QTVA 1E96B 2J4DA 3ITFA 3SF4A 4WNEA 4XX5A 1MMGA 2HV7A 3VLEA 1INZA 3EH2A 3CHOA 3CVVA 1PAQA 3CR3A 4H7XA 3LYAA 3CVQA 2WXKA 1P5QA 5AIJA 3KH2A 2WXRA 3RRUA 3VTYA 1OWNA 4G7ZF 4B8AA 2P6VA 5DLJA 2Q9AA 3EGXB 4AIFA 4I1MA 3EIJA 1O5HA 3LS1A 3CV0A 2ZU6B 3N0TA 4O6NA 4FHKA 2IQCA 2XXAB 2LAIA 4YNDA 1XGWA 2R7RA 3O48A 2GRMA 2L0TB 3ZSUA 3K33A 5AJDA 4GPKA 4YWQA 2I9CA 4QI2A 4A2NB 4CDRA 2Q7FA 1VOMA 4XZ4A 4BTBA 3NKEA 3JT1A 2PF4E 1IHGA 4JC8A 3SNHA 3FH8A 4CGWA 2R7XA 2X6JA 4FC8A 4WNFA 5FZQA 3NG1A 3MGBA 3GZSA 2KC7A 2HYZA 4N2QA 1HH8A 2X51A 3G2WA 1E8YA 3AS4A 3TD7A 2J09A 4ANVA 4H7YA 4BJ5C 3RO2A 2XPYA 4IYPA 5KYNA 4WWNA 2VYIA 2NXPA 2G3VA 3OTNA 3CHSA 2R7WA 2FULA 2X6FA 4AP2A 3RH3A 3C98A 1OKKA 4G23A 3UGPA 5E33A 4AY5A 3B7SA 1FTSA 2W9YA 4Q69A 4YJWA 3OXGA 5FWQA 2WB7A 3LESA 3LXUX 5DS6A 2J07A 5CI8A 2FI7A 3QC1A 4GA2A 2XPIA 4PS7A 1E90A 5M72A 3PZDA 2KGOA 2WZLA 5LFAA 2WVOA 4UWKA 3FUFA 2WL8A 4BT9A 3FTUA 3PNLB 3JUIA 2FEZA 4GCNA 4GU5A 4M63A 4D10C 2Y3HA 4CSAC 4OVUA 1H19A 3NRHA 3OA1A 4GCOA 4U5BE 4J8EA 3ONKA 3CQGB 2EIKC 2XRYA 2XRZA 4GYYA 2L81A 4O6FA 2VTBA 2WVNA 3X2QC 4CT0A 4BWRA 3CVYA 1E8XA 4HE8D 3PUKA 5G04C 4B6IA 3TGOA 2J45A 1JPJA 2BE5F 3ABLC 1HG5A 4G26A 5CI9A 3FUIA 2IXPA 1NA3A 3PEUB 3MX3A 5J90A 2WB2A 1Z5ZA 3ZGQA 4PDXA 2IXNA 4Q5SF 1MMDA 3U64A 4ZLDA 4IRUA 3CSKA 1Y8MA 1NZEA 3TXMA 3LS0A 3EDTB 4KNWA 1LKXA 3G2SA 2W4BA 2CNWA 3Q5MA 3AU5A 3KEZA 3FUKA 4DPRA 2X6IA 2XCBA 3MA5A 2J7PD 4BJ1A 2YNQA 4XKBA 4ULWA 4G25A 3RKOF 4YT8A 4JURI 2CHZA 3MCXA 2KW3C 1BPOA 2NUTB 3ZN3A 3E70C 1SF8A 5F5HA 3W8HA 5B1BC 2AVPA 4KBQA 5KYUA 3B9QA 4AE4A 3BG1B 1JPNA 2KCKA 2XGSA 5AJLA 1H2TC 2ZXRA 3K1HA 5D92A 3APCA 2AXZA 3MLGA 4DI3A 2R7VA 2C0MA 5L3VA 1BR4A 3FDQA 3FTWA 3FAJA 2R7TA 3PHF2 3OEOA 4HORA 3FUNA 1ELKA 1Z6TA 4C3BA 2PX0A 4B94A 3ABKC 4MRUA 1HG2A 1PC2A 4IWBA 1QLEC 2Y3AA 2L0IA 4OVVA 2X3MA 4YT2A 4YVQC 3R7QA 4PS8A 3AQBA 3U9WA 2NUPB 1PD1A 2YINA 2IJGX 5CCLA 1TEZA 3JYSA 4RG6A 1WM5A 4GYTA 4PUCA 2WXQA 3CQZA 4JA7A 4NRHB 1JPLA 3FTYA 4I1AA 3OXLA 4N06A 3DBSA 5KYXA 4L2YA 3GYZA 4JHKA 1J8MF 4CIHA 3UNGC 5E3AA 3IEGA 2VSYA 2EILC 3F46A 4I17A 2J4BA 4U0SA 2QY7A 3ZXSA 3RO3A 1NG1A 1BR2A 1OWPA 5G05C 3S7JA 4UQXA 3FHDA 2WXOA 3MEKA 4A55A 3SBSA 1SZAA 1MQSA 4CS8A 1UN8A 4L2LA 3D9JA 4BY6A 4JJGA 3SYNA 3B7TA 3LAYA 3D9NA 2XEVA 3APFA 2WXFA 2VGYA 4XI0A 4J8DA 5JJ6A 3ZIMA 2J0XA 5ARFA 3EG9A 3EHNA 4M3OA 3FUEA 4JZYA 2LAHA 4YVOA 2WVQA 4KVMA 4ATGA 2CDQA 4RVBA 4B89A 1MMAA 2J9UA 3JQ1A 4RG9A 4PJJA 4W8KA 3MKRA 2R7OA 4KMOA 1QZ2A 3EFOB 2L9JA 4GA0A 3GODA 2ONDA 4TUUA 4A3TA 3O6XA 3PREA 3CEQA 3AG3C 3CK7A 3MV2B 1H2UA 4AXHA 4PH4B 4DLOA 5EDSA 4APOA 3CHMA 1Z3XA 5BV0A 4J30B 3TXNA 1Z6AA 2KCLA 3KKBA 3GZ1A 4UWFA 2FGYA 2X38A 5HI7A 3MYVA 4BG0A 2NC9A 1FFTC 3RYLA 3JYHA 3SNXA 2MYSA 3FUDA 2KZTA 2XQ0A 4TRQA 3T6JA 1OKKD 3FTVA 2GGFA 4HVBA 4J8SA 4QDLA 2OVBA 3UMKA 1RJ9A 4PFPA 3D9IA 5C1DA 3LY8A 1E8WA 4P6IC 3NF1A 4WWOA 4RDAA 2OV8A 3CVNA 3Q6MA 4BJ6C 5E75A 2EIMC 2OOEA 4OIOF 5DS4A 4UWGA 2Y3DA 2M4EA 3W2WA 2VGXB 4KZ0A 3RRNB 1FMVA 1TWAA 2DYRC 4I2ZA 5LCWC 1WY6A 1OWMA 3BG0B 1NP7A 3QARA 3LLKA 3DZAA 4K0DA 2J0WA 2R5SA 2L6JA 3GANA 5FZRA 3JCUQ 5CCMA 1KLXA 2CFZA 3P2BA 1M2OA 1M2VB 3SHFA 2VASA 1Z23A 4CS9A 2C04A 2XL4A 2XRHA 4DBRA 2LNIA 4FWVA 1FFHA 4JZAA 3MKQA 4F4BA 4U5HA 3DD7A 5T3TA 3RFYA 1TR2A 4ANJA 4DVZA 3HJCA 4KBLA 2Y3GA 2UY1A 5G04J 3NQPA 1SZ9A 4UWHA 1B89A 5B3SC 4BJ5A 2Q3TA 4NQ0A 4AJWA 4EECA 3X1OA 4XE0A 3I4RB 4HFFB 2Y4UA 2HV6A 1OCZC 3DXJF 1FVHA 2KQ9A 4WNGA 3FEXA 3LDZA 4EBAA 2WXNA 2WZFA 4AVXA 1H2VC 3ZHEA 2PM7A 4UWLA 2NSZA 5KYYA 3K6BA 3L17A 4XLNF 3QNKA 5FCLA 2DIWA 2V0PA 3FU5A 1TWHA 3Q7GA 4U8HA 3URZA 3TG5A 4AX2A 3JCKC 2CNWD 4ACLA 3EGDA 3CSFA 2LSEA 2WXLA 3CVWA 5A6CA 4JL0A 4GZ5A 5E76A 4AV7A 3OAWA 3FUMA 3JSZA 3OXFA 4HLEA 3L34A 4HOTA 4G1TA 5G55A 3FUJA 4I44A 1E8ZA 1DVPA 3ZPJA 2IONA 2LSUA 5BV1A 5C2YA 5ENNA 2Z15A 2AW6A 2A5UA 1TJFA 4N39A 4APFA 3NDBB 3ASDA 1L5JA 4IAOA 2VSNA 3UX4A 2R17C 3WODF 2MHKA 2I1KA 4BT8A 4G7OF 4UI9J 3SGHA 4HOQA 5E3CA 3FUHA 4G2VA 4U04A 4XIFA 4B0ZA 4AY6A 1LVKA 2YEVA 3PS6A 1W3BA 4C0EA 2ZXOA 4U0UA 5DBKA 4Q7CA 3S2AA 3PNTB 4CS7A 4PJMA 2V3CC 4ILGA 4C0MA 3HVEA 4HXIA 5KCMA 2JEKA 4YN0B 2I1JA 2X6HA 2XCCA 3MJWA 3FTSA 4CDNA 3D9LA 1HZ4A 4JHRA 1ZHYA 4FLHA 4FA6A 3M1CB 4KXKB 2PZIA 4GZ3A 4E7SA 3JRTA 4JW1A 2IYLD 5ANLA 2PM6A 2J9WA 4J32B 1IYGA 3E9VA 5KJLA 5FZSA 5DIZA 3ZHEB 2AWIA 2IOQA 3LLIA 3EPVA 4ILHB 1N52A 4JEHA 5FT9A 3AG1C 2DCPA 1ZHWA 3UGOA 3SZ7A 4C3DA 4UI9K 5EX3A 1A17A 2BTDA 3QWWA 4EZJA 4ACKA 2D5RB 1SQMA 2FBNA 5JHBA 4LERA 2WXHA 2NG1A 3QDNA 3CHQA 1HFAA 2C03A 4OIPF 3ZVRA 5FTPA 1D0ZA 3POVA 3NYMA 3PEVB 1UG3A 2V5FA 2VB6A 2WZGA 3T6BA 4BJTA 4PS3A 3CLJA 4ZLCA 2Q9CA 2PQNA 3P1UA 4EQFA 4N5CA 3LVRE 4IJJA 3CK9A 3ZYQA 3DM9B 3W8IA 4FJYA 1EDUA 4CEMA 4A1GA 4X0RA 4AK9A 3TG4A 3TL5A 2H7VC 4PJLA 4JXTA 3PDNA 3N71A 4IULA 4U5FE 5ARGA 2WXJA 3HYMB 1PY1A 4MS6A 3B13A 5KYWA 1HO8A 3S29A 2IU1A 4FHJA 3EZIA 3QB2A 2CHWA 3ZW3A 4HOUA 1U3DA 3GZ2A 2BUGA 3SBTB 3T5XA 2HM8A 1TWCA 5A7DB 2YQ8A 3DJUB 4EPZA 1E7VA 2VJ8A 2DGJA 3G2VA 3K7DA 1ELRA 3E4BA 1ZBPA 2WMOA 4C7OA 5DQZA 2IFUA 2KNHA 3LEVA 1S0PA 4IN3B 2VTBB 4OYSA 5EX0A 3L08A 2OCCC 4U5EE 3ASGA 2PFDA 1SZIA 5DQTA 5T8IA 2WMNA 3L0IA 3DJNB 1FVFA 1GW6A 1ZU2A 2WXIA 2XGOA 4KVOA 4XWJA 5CHEE 3B7RL 3MZLB 3SFZA 2EINC 3QAQA 2G3KA 3RJVA 2MRIA 4CBEA 2PQRA 4PFOA 3HHMA 3CK8A 4NACA 2KJGA 3UT4A 5JJTA 1LF8A 4PK4A 3TAXA 2IF4A 2YHCA 3IHVA 4BSXA 2J9VA 2YZSA 5D91A 4HS2A 4O6MA 3IV0A 4EWCA 1VDYA 3S7DA 1HE8A 4Y6WA 1ZU5A 3L16A 1HU3A 2X6KA 4DJAA 1HXIA 3FHEA 3K9IA 4LEUA 3S0XA 4FULA 4TV3A 5KYUB 4AE4B 2VH3A 4OD5A 1O87A 3FDHA 2PP4A 4WJ0A 3LS8A 3T8MA 3QMKA 5F5FA 1NU9C 4AOFA 4BFRA 4LRZA 3LY7A 2KM4A 5EHHA 2A69F 2KATA 1LS1A 4AEZC 1H0AA 3IHYA 4URKA 2CHXA 4FX5A 4CRWA 4L7TA 3PVLA 3UR3C 1D0YA 3HTKC 1V54C 4HOSA 4U0ZA 2WVIA 1D0XA 1N54A 3SI5A 4CGVA 4NURA 2C0LA 3ZYMA 2VSXE 1OUVA 3NYJA 2J08A 4KZCA 4I9EA 4OINF 3PRZA 3I4UA 4JHJA 3EGXA 2MOWA 3RIPA 4OIRF 2GFHA 3I3NA 4XI9A 4E7ZA 1TWGA 2GW1A 4L23A 3RKVA 2XXAA 1OCRC 4BJ6A 4EZLA 5D0OD 3CVLA 3LPZA 5KYXB 4I6EA 3SEOA 2FFHA 1IQRA 5CMYA 3EQLF 4GZ6A 4KC9A 3ZC4A 3LCAA 4HEAJ 2EQXA 3JQ0A 4B8CB 4HFKB 3ZVVA 4MKTA 1EF1C 3RU0A 4C9BB 3NYLA 4V3IA 3ZRHA 4EBBA 4FADA 5BPPA 3BEEA 4DOZA 4DK5A 2H7BA 5LP0A 3UMHA 4P29A 2Y39A 1V55C 4N2SA 4GB9A 3UT7A 4QI0A 2IOLA 3KL4A 3L54A 2W4MA 4ME2A 4N3AA 3VYWA 4FP7A 3CZ6A 1UW4B 3EG9B 3D9MA 1ZHXA 3FU3A 2E0IA 4G11A 3CIAA 5BUOA 2ILRA 3ASFA 4I6JA 3UQ3A 4UQYA 2DBAA 2WXPA 1ZHZA 5KJNA 4G7HF 1UJKA 3TJPA 4FESA 1JWFA 3D9KA 1NU7D 3ZIBA 1VYKA 3IKOB 3LY9A 5JJ7A 3V7OA 4BX9A 1G8XA 3FTZA 4N3CA 1ST6A 4WNDA 3KD7A 5E2QA 4YT5A 3FEYA 2A6EF 4U5DE 5BNWA 5T1DB 4DVYP 1Z63A 2P7VA 4LUNU 4ILIA 2I8BA 5AENA 4GEHA 1PCXA 4F1SA 3ZEFA 1VK5A 4U07A 5FQ7A 4FJZA 4AM9A 2KZTB 1JUQA 1QZXA 2XSEA 3ECSA 1IZMA 3CHRA 2P58C 3QOUA 4FU3A 4JEUA 4EZKA 4R7LA 1RJ9B 3ONLA 2RG8A 3O4ZA 4K0RA 3PE3A 1X5BA 3R7RA 4CS9C 1FMWA 4JCHA 1Y6IA 4U5CE 1KT0A 4JPSA 1E7UA 2RD0A 2R7UA 2WXMA 1WGWA 4RBNA 2LSVA 3LNRA 2CFUA 3HDXA 4CSAA 4FLBA 4BEJA 3UMIA 3Q49B 4HFGA 3GW4A 3L22A 1D1BA 2IXMA 2QY9A 5BUZA 2A1DD 2I6HA 2E2EA 2V8SE 3D3MA 3FP3A 4MNDA 3I5PA 4LLCA 3W2VA 2CG3A 4ABNA 2V4LA 4YT4A 1EYHA 2WPVA 5HSWA 3ENEA 3MKQB 1S7ZA 3LKUA 1ZHTA 1KU2A 4O79A 2ZXPA 3N2ZB 3LJBA 1M56C 1TKNA 3CVXA 3PUJA 2UY1B 4LCTA 4E85A 3UT8A 2NUTA 3FVYA 3DPDA 1PD0A 2JD3A 2M63A 3HIZA 1HF8A 2V26A 2A68F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JVS A;  4JW1 A;  4I1O B;  4IRU A;  4I1M A; 
#chains in the Genus database with same CATH topology
 2DZN A;  1Z3I X;  5EKQ D;  3FU0 A;  3J5P A;  5BT1 A;  1HX8 A;  4DBQ A;  2YL1 A;  1KT1 A;  1L7C A;  4F53 A;  4EBA G;  3AS8 A;  3ABM C;  5L0F A;  3ZKJ A;  4GAA A;  3ZYL A;  4JEA A;  1M57 C;  2XPZ A;  4U63 A;  3LVQ E;  3ZFW A;  3T5V A;  5KYY B;  2QNL A;  1JAF A;  4TUM A;  3FAP B;  3DKA A;  3ZYK A;  2OOC A;  4GA1 A;  4BES A;  1XNF A;  5IY5 C;  4J0U A;  3DXK G;  3ABK E;  3PE4 A;  3I5Q A;  3EHM A;  5T4Y A;  2DB4 A;  4JKV A;  3ESL A;  4CT4 A;  3S7F A;  1WAO 1;  3S27 A;  2OQM A;  3JYY A;  1U3C A;  2RFA A;  4KYO B;  1WAT A;  3EGD B;  4Z68 A;  5JUA A;  4XLP F;  5G05 J;  2DYS C;  3IEE A;  2EPO A;  4O7G A;  2J49 A;  3L82 A;  4F1P A;  4CDM A;  4JVS A;  3FH5 A;  2KCV A;  5FIO A;  1IQU A;  1D1A A;  1NSG B;  4NCQ A;  1ZYR F;  2NUP A;  1QQE A;  2XEH A;  4KT6 B;  4MLP A;  1VYI A;  5ENT D;  1YA0 A;  2GRL A;  3DAF A;  3M4C A;  1UN9 A;  3QWV A;  4XKC A;  2VSO E;  1LPE A;  3ML8 A;  2YRF A;  3S7B A;  5B1A C;  2FF4 A;  3T8K A;  2A6H F;  3NZS A;  4Q96 A;  2C2L A;  3LEW A;  5D66 A;  3Q15 A;  1YLM A;  3D9O A;  3VLF A;  1UJJ A;  4J6I A;  3EIQ C;  3CQC B;  1MNE A;  1FR0 A;  4G0H A;  4H4K C;  5LOZ A;  2QZA A;  1T6U A;  1JR8 A;  4U5G A;  3AU4 A;  3I4G A;  2BKK B;  4MQ9 F;  1RMV A;  2EIL E;  4P9T A;  3Q7L A;  3PDM P;  2A4Z A;  3TWV A;  1Z3Y A;  5DS5 A;  3L13 A;  5AYW D;  3IPM O;  4E6H A;  2XLO A;  5DVW A;  5A69 A;  4GYO A;  1E84 A;  4CCA A;  2BED A;  2PX3 A;  2B0J A;  1Q2Z A;  4EIY A;  3O39 A;  3UI2 A;  1NA0 A;  1OW6 A;  2J46 A;  5JRA A;  4G24 A;  2GWW A;  1NZN A;  4GML A;  2L6F A;  3HVE B;  2ZD9 A;  4Z9I A;  3RVY A;  3EJN A;  2I2O A;  3B95 A;  2UWJ G;  4W9R A;  3N24 A;  2GRQ B;  3FY4 A;  2AXV A;  2WQH A;  1J8Y F;  1WG0 A;  3UMV A;  2WM9 A;  2R7Q A;  4PJN A;  1SW6 A;  5AQB A;  3QVZ A;  2O9X A;  3OWT A;  1OCC C;  3APD A;  1LE4 A;  3DMD A;  5EGY A;  4MW3 A;  2WXG A;  1Q0F A;  5CRV A;  4ONS A;  4K03 A;  2H7O A;  1EPU A;  2CG2 A;  3F47 A;  4WWP A;  3TJ6 A;  1VMA A;  4I6G A;  2WQ6 A;  2Y4T A;  1MND A;  4Z9J A;  3RIB A;  2B0H A;  3L1M A;  1TJC A;  3ULQ A;  4XTK A;  3SQV A;  3SXK A;  3ZU7 B;  1BU9 A;  4L1B A;  4LAC B;  1QKR A;  3QZC A;  4E0I A;  4BX8 A;  2R7S A;  5A23 A;  3U3W A;  3KS2 A;  3WG7 C;  3B0V C;  1BI7 B;  4UI9 C;  2OVF A;  1SMY F;  3LEO A;  3ASO C;  2XHE A;  1Y4C A;  3CVP A;  4DJ9 A;  1V54 E;  3V5Y A;  4O6Y A;  3FWV A;  1S64 A;  3B29 A;  1OWL A;  4OIQ F;  4KNV A;  3DWL G;  1R4T A;  4EHM A;  4A3V A;  2IEJ A;  1Z5S C;  2CW0 F;  3QWP A;  3RSE G;  1I4Y A;  3DSV A;  3LNM B;  4F6R D;  4DI4 A;  2XLE A;  4XEF A;  2LQG A;  2ASR A;  4Q4Z F;  3M15 A;  3EFO A;  2IOS A;  2IBF A;  2LO6 A;  3B0U X;  3IBE A;  4WUY A;  3AG3 E;  4HQD A;  4MVM A;  4KI2 A;  1DNP A;  1LE2 A;  1V74 B;  3QK0 A;  5CEA A;  1KTM A;  3UUX A;  1GM5 A;  4RD9 A;  5JHA A;  4HLL A;  5LX8 A;  4JJF A;  5ENQ D;  2BF0 X;  4UQZ A;  3VLD A;  1JWG A;  2ZPA A;  3L6A A;  1OCR E;  3VAY A;  3NZU A;  5ANR A;  3CVU A;  3Q4A B;  5D2M C;  1BR1 A;  1OXB A;  4LNU D;  2LCH A;  1IW7 F;  1VTM P;  1MMN A;  4I2W A;  2ETS A;  1O1T A;  3K1I C;  5T3W A;  3ASH A;  3SFY A;  3B0P A;  5CIV A;  4XPY A;  3KYI A;  5LCW J;  5KYW B;  3CKC A;  3U66 A;  4GZC A;  1TNO A;  3DAG A;  4BTA A;  4I43 A;  3KSQ A;  2DVW A;  4QFV A;  2LD6 A;  4JTC B;  1W2W A;  2J9Q A;  3KPH A;  3S28 A;  2IXO A;  5AQ9 A;  3ML9 A;  3RQG A;  1FCH A;  4I3M A;  3CST A;  5COM A;  3EUV A;  5CMW A;  5FQ6 A;  3DEP A;  1MZC A;  3LJ3 A;  4I1O B;  3FU6 A;  4OD4 A;  4WAF A;  4J8F A;  1EI7 A;  2EIM E;  5D0Q D;  3RK6 A;  3NBN B;  3CHP A;  3JXJ A;  3ZG1 A;  1ELW A;  3G2T A;  1OCO C;  2Q9B A;  5A6J A;  2A5E A;  3AG2 C;  4ANW A;  4LLE A;  4C7O B;  3KAE A;  3HLZ A;  2E87 A;  4F7A A;  2JLB A;  3VTX A;  2DYR E;  3KYJ A;  1N1C A;  2J7P A;  3ESK A;  3Q73 A;  1N95 A;  4K7B A;  2HR2 A;  2QFC A;  3FTX A;  3PMR A;  2VGX A;  3UIO C;  3U2M A;  2OG2 A;  3G2U A;  2OEV A;  2YHE A;  3FH7 A;  4C3E A;  1OR2 A;  2R59 A;  2AXU A;  3U8P A;  2FO7 A;  4J7W A;  1MHQ A;  1OWO A;  3WXX A;  1Q0D A;  2CGE A;  2P9K G;  3M79 A;  1XZQ A;  5FJY A;  1YDI A;  2ZIR A;  3TWR A;  2HO1 A;  5T3R A;  3Q47 B;  4N3B A;  4CS8 C;  2EIJ C;  4Q94 A;  1TFK B;  4RLY A;  3EU5 A;  4F3V A;  2Y3B A;  2UUH A;  2ZXW C;  2NYJ A;  5KJM A;  1M2V A;  1ORY A;  3U4T A;  2WQ7 A;  2TMV P;  3TUL A;  3T4R A;  5ITZ F;  3D9P A;  2AU5 A;  2HE0 A;  4NY3 A;  3Q6N A;  5B3S E;  5L3Q A;  4GZD A;  3UPV A;  4O60 A;  3S84 A;  2MWQ A;  4XEK A;  5G2N A;  4HB5 A;  4D4N A;  3CKB A;  4A1S A;  4GTS A;  3SZR A;  3AQC A;  1WN0 A;  1E86 A;  3PH0 C;  1OCZ E;  3SP1 A;  4JA9 A;  3DRA A;  2F22 A;  5AC5 A;  3PZ4 A;  1K05 A;  4EBJ A;  4U95 D;  3C5R A;  3RRM B;  1ZU4 A;  4DRI B;  4ANX A;  3MV3 B;  3CGH A;  4GYW A;  3R9M A;  4H54 A;  3Q9U C;  4Y6C A;  3FFL A;  4LNG A;  2XLV A;  3KMI A;  1N4P A;  3NKD A;  4DRH B;  3B7U X;  1QNF A;  3AG4 C;  4BET A;  1D1C A;  5J08 A;  3EZH A;  2L9B A;  3R9A B;  3SD5 A;  4I9C A;  5FQ4 A;  2J9B A;  4J8Y A;  1WTY A;  5FQ8 A;  5L0I A;  5BW8 C;  2W45 A;  3EH1 A;  3K66 A;  2NSG A;  2Q00 A;  4GTT A;  3H65 A;  1U0B B;  1FT1 A;  2XGM A;  2PL2 A;  3V30 A;  1HS6 A;  3AS5 A;  4GMJ A;  3FUL A;  5HQ8 A;  3QKY A;  3DM5 A;  4O1O A;  3ASN C;  4DLQ A;  4RSY A;  2YHS A;  1NL4 A;  1O3U A;  3QJZ A;  2Y69 C;  1H6K A;  2G62 A;  1RW2 A;  2VQ2 A;  5KJK A;  3UKU G;  1FPP A;  2QTV A;  4ANU A;  1BDJ B;  4WGY A;  5JA4 D;  1E96 B;  2J4D A;  3ITF A;  3SF4 A;  4WNE A;  4XX5 A;  1MMG A;  2HV7 A;  3VLE A;  4RQI A;  1INZ A;  1OQC A;  3C18 A;  3EH2 A;  3CHO A;  3O10 A;  3CVV A;  1KNY A;  1PAQ A;  2RKK A;  4U8V D;  2P9S G;  3CR3 A;  3LJN A;  2R2L A;  3TWW A;  2YWA A;  1C17 M;  2LFF A;  4H7X A;  1CPQ A;  3DXM G;  5JVE A;  3LYA A;  2XLH A;  4GTV A;  3CVQ A;  4XPW A;  2WXK A;  3RW0 A;  3GWL A;  2CCY A;  1P5Q A;  5AIJ A;  3M4B A;  3KH2 A;  3MYF A;  2WXR A;  4GMR A;  3RRU A;  3VTY A;  1OWN A;  4G7Z F;  4B8A A;  2P6V A;  5DLJ A;  1A7D A;  2Q9A A;  3EGX B;  4AIF A;  4I1M A;  3EIJ A;  1O5H A;  3LS1 A;  2P9I G;  3L9T A;  3CV0 A;  2ZU6 B;  2V4H C;  1D8D A;  4MTF A;  3N0T A;  3HRA A;  3TQO A;  2QYJ A;  4O6N A;  3Q9N C;  4FHK A;  2IQC A;  3HKK A;  4JEB A;  2XXA B;  1TNY A;  2LAI A;  4K5C A;  4YND A;  1XGW A;  2R7R A;  3O48 A;  2GRM A;  4WGZ A;  2F0Y A;  2L0T B;  3ZSU A;  3K33 A;  5AJD A;  4JIO A;  3JZ0 A;  4GPK A;  1H6O A;  5CBN A;  4HRN A;  1M6T A;  4YWQ A;  2I9C A;  4QI2 A;  4A2N B;  3EU9 A;  4ATZ D;  1OXK A;  1O1S A;  1QSP A;  4CDR A;  3JTL O;  2Q7F A;  1VOM A;  5L0G A;  3SXZ A;  3AG1 E;  2EPK X;  4XZ4 A;  5AAO A;  4BTB A;  3NKE A;  3JT1 A;  2PF4 E;  2YL0 A;  1IHG A;  5HRY A;  1K04 A;  4JC8 A;  3SNH A;  3FH8 A;  1G3N B;  4CGW A;  2R7X A;  3C3R A;  2X6J A;  2ZGG A;  4FC8 A;  4WNF A;  5FZQ A;  3NG1 A;  3MGB A;  3GZS A;  2KC7 A;  1HY5 A;  4U9E A;  2HYZ A;  4N2Q A;  2OU6 A;  4DX6 D;  4AL1 A;  1HH8 A;  3JSE O;  1F1M A;  2X51 A;  3G2W A;  2L6G A;  1E8Y A;  3AS4 A;  3TD7 A;  2J09 A;  2KXP C;  2HJM A;  2LIG A;  5EYL A;  2GRN B;  4ANV A;  3PZ3 A;  3UIP C;  2P61 A;  4H7Y A;  4BJ5 C;  3HNI A;  2LUH A;  3RO2 A;  2XPY A;  4G8L A;  4IYP A;  5KYN A;  1RKE A;  4WWN A;  2VYI A;  2H6H A;  3ZNG A;  3VM6 A;  2NXP A;  3BUA A;  2G3V A;  3OTN A;  3CHS A;  1FT2 A;  2I15 A;  2R7W A;  3R2P A;  3TJ5 A;  2FUL A;  2X6F A;  4AP2 A;  3ISM C;  3RH3 A;  3C98 A;  2F37 A;  4U7E B;  1OKK A;  4G23 A;  3UGP A;  3V5Z A;  5E33 A;  4OAU C;  1D8E A;  2R03 A;  2UUI A;  1K3Z D;  1OXJ A;  4AY5 A;  3B7S A;  1FTS A;  2AWC A;  2W9Y A;  4Q69 A;  4YJW A;  3OXG A;  2EPM X;  1T5O A;  2V5Q C;  1LD8 A;  5FWQ A;  2YKZ A;  2WB7 A;  3LES A;  3LXU X;  1SVX A;  5DS6 A;  1AP7 A;  3IQC A;  3A11 A;  2J07 A;  3C63 A;  5CI8 A;  2VCB A;  2FI7 A;  3QC1 A;  4GA2 A;  2XPI A;  4PS7 A;  3Q78 A;  1E90 A;  2R02 A;  5M72 A;  3PZD A;  2KGO A;  2WZL A;  5LFA A;  2WVO A;  4UWK A;  4DRJ B;  1WAS A;  3FUF A;  4J7T A;  2WL8 A;  4BT9 A;  3GM2 A;  3FTU A;  1YJG A;  3TK0 A;  3JUI A;  3PNL B;  1VLT A;  2FEZ A;  3HXE A;  4GCN A;  4GU5 A;  4M63 A;  2ETC A;  4D10 C;  2Y3H A;  1RXQ A;  4CSA C;  4OVU A;  1H19 A;  3NRH A;  3OA1 A;  3W9F A;  4GCO A;  4U5B E;  4J8E A;  3ONK A;  3GWN A;  4GTR A;  3AJI A;  3CQG B;  1IKN D;  3GEE A;  2EIK C;  3IXE A;  2XRY A;  3V2O A;  2XRZ A;  2OCC E;  4GYY A;  1TN7 A;  2L81 A;  4O6F A;  4EHP A;  5EID A;  3NOC D;  2VTB A;  2WVN A;  2IM8 A;  3X2Q C;  4CT0 A;  4BWR A;  3CVY A;  3RQF A;  1YYX A;  2HSQ A;  1E8X A;  3IHU A;  4HE8 D;  3PUK A;  1G4U S;  5G04 C;  2OJE D;  5EYP F;  4B6I A;  3TGO A;  1QVX A;  1S70 B;  4GPM A;  2J45 A;  1JPJ A;  2R9R B;  2VCC A;  2BE5 F;  3U9J A;  3ABL C;  1HG5 A;  5KBA A;  4G26 A;  4E17 A;  5CI9 A;  1NLX A;  3FUI A;  2IXP A;  1NA3 A;  3PEU B;  3MX3 A;  2EIN E;  5J90 A;  3KEA A;  2WB2 A;  3E33 A;  1Z5Z A;  3ZGQ A;  4PDX A;  4BSZ B;  1FNT c;  3EHR A;  2IXN A;  4Q5S F;  4L6R A;  1MMD A;  3BEH A;  3U64 A;  4ZLD A;  2A0B A;  4IRU A;  3CSK A;  1Y8M A;  1NZE A;  1TNZ A;  3LS0 A;  3EDT B;  3HG0 D;  3TXM A;  1CGN A;  4KNW A;  1EKY A;  1LKX A;  256B A;  3G2S A;  2W4B A;  2CNW A;  1N0Q A;  2BC5 A;  5BXO A;  3Q5M A;  1T6I A;  3AU5 A;  3KEZ A;  5KWD A;  5BXU A;  3FUK A;  4DPR A;  2X6I A;  2XCB A;  3MA5 A;  2J7P D;  4MTO A;  4BJ1 A;  2YNQ A;  4ULW A;  3AAA C;  4XKB A;  1DCE A;  1NI1 A;  4G25 A;  4W8P A;  3RKO F;  4YT8 A;  1ORJ A;  3GM3 A;  4JUR I;  2CHZ A;  2DI3 A;  3MCX A;  1OR3 A;  3ZUV B;  2KW3 C;  1BPO A;  2HMQ A;  3US6 A;  2NUT B;  3ZN3 A;  2GRR B;  3HXF A;  5FZT A;  1YVI A;  3E70 C;  4JE9 A;  3S90 A;  1AEP A;  1SF8 A;  5F5H A;  1CGO A;  2XLD A;  3W8H A;  5B1B C;  2HKV A;  2P2C P;  1APC A;  3AGT A;  2AVP A;  4KBQ A;  5KYU A;  2H6I A;  3B9Q A;  4AE4 A;  3SY2 A;  3BG1 B;  1JPN A;  2KCK A;  2XGS A;  1T9K A;  4UDV A;  5AJL A;  1G5Z A;  4MS2 A;  4OAV B;  1TNU A;  1H2T C;  2ZXR A;  3K1H A;  5D92 A;  3APC A;  5FIN A;  4N6C A;  2JAB A;  2PBE A;  2AXZ A;  3MLG A;  4DI3 A;  2R7V A;  3HXC A;  2C0M A;  5L3V A;  1BR4 A;  3FDQ A;  3FTW A;  3FAJ A;  2R7T A;  2FO1 E;  3PHF 2;  3VRC A;  3K1I A;  3OEO A;  4HOR A;  3FUN A;  1ELK A;  1JOG A;  1Z6T A;  1LI5 A;  4C3B A;  2PX0 A;  2HZ8 A;  4B94 A;  3ABK C;  4MRU A;  3UTM A;  1HG2 A;  1PC2 A;  1S05 A;  3C7J A;  4IWB A;  4HBD A;  3GM1 A;  1QLE C;  2Y3A A;  3C3O A;  2L0I A;  4OVV A;  2X3M A;  4YT2 A;  4YVQ C;  3R7Q A;  4ZFH A;  4G8K A;  4PS8 A;  3AQB A;  3U9W A;  2NUP B;  1PD1 A;  2EIJ E;  2IJG X;  2YIN A;  5CCL A;  1TEZ A;  4YDY A;  3JYS A;  2ZXW E;  4RG6 A;  3VF0 A;  1WM5 A;  2Y1L E;  1XZP A;  5JP7 A;  4GYT A;  2GA0 A;  4PUC A;  4EKW A;  2WXQ A;  3CQZ A;  4JA7 A;  2HS5 A;  4NRH B;  1JPL A;  1MJ0 A;  1YMP A;  3FTY A;  3OXL A;  4I1A A;  1EQ1 A;  4N06 A;  3DBS A;  3ATP A;  1NFI E;  4UUC A;  3UM0 A;  5AAR A;  3O55 A;  1MX2 A;  2ICW G;  2NPU A;  5KYX A;  3R7C A;  3GYZ A;  4L2Y A;  4JHK A;  1J8M F;  1A7V A;  4CIH A;  3UNG C;  5GPG B;  5E3A A;  3IEG A;  2VSY A;  2EIL C;  3F46 A;  2J4B A;  4I17 A;  2QY7 A;  4U0S A;  1B68 A;  3NOG D;  3ZXS A;  1H9T A;  3RO3 A;  1NG1 A;  3E37 A;  1BR2 A;  2LFD A;  1OWP A;  5G05 C;  3S7J A;  4UQX A;  3FHD A;  3T9K A;  2WXO A;  3MEK A;  2EPN A;  4A55 A;  3SBS A;  1SZA A;  3TWQ A;  1V55 E;  1MQS A;  4CS8 A;  4CYM D;  1UN8 A;  4L2L A;  3GEI A;  4MVZ A;  3ZTZ A;  1TN6 A;  3D9J A;  3Q75 A;  1WOL A;  4BY6 A;  4JJG A;  3SYN A;  3B7T A;  4Z9H A;  2LXL A;  4DX1 A;  3RVZ A;  3LAY A;  2DZO A;  3D9N A;  5CER B;  2XEV A;  3APF A;  1JCQ A;  1K8K G;  3CEX A;  2WXF A;  3ZWI A;  4DX2 A;  2VGY A;  4XI0 A;  1AWC B;  3U8V A;  5A6B A;  4J8D A;  5JJ6 A;  3ZIM A;  2J0X A;  1QBQ A;  2VGE A;  3E32 A;  5ARF A;  3EG9 A;  3EHN A;  4M3O A;  3W4Y A;  1N4Q A;  3FUE A;  3J5Q B;  4JZY A;  2AP3 A;  2LAH A;  4YVO A;  5EN5 D;  4K5A B;  2WVQ A;  4KVM A;  4ATG A;  2CDQ A;  3F6Q A;  4RVB A;  4B89 A;  1MMA A;  2J9U A;  3JQ1 A;  4N5Q A;  4RG9 A;  4PJJ A;  4W8K A;  3JXI A;  1A41 A;  3MKR A;  2R7O A;  1ZZP A;  4CX9 A;  4KMO A;  1QZ2 A;  3EFO B;  4J7Y A;  4AL0 A;  2L9J A;  4E18 A;  4GA0 A;  3GOD A;  4ZHB A;  2OND A;  4TUU A;  4CDA A;  1MYO A;  1YAR O;  5HKP A;  1AUE A;  2VCA A;  4YK5 A;  4A3T A;  3O6X A;  3PRE A;  3CEQ A;  2P9L G;  3AG3 C;  3CK7 A;  3MV2 B;  1H2U A;  4AXH A;  3G4Z A;  2OEX A;  4PH4 B;  4WAB A;  4DLO A;  5COF A;  5EDS A;  4APO A;  3T6G B;  3CHM A;  3ZXP A;  1Z3X A;  5BV0 A;  3TWT A;  4J30 B;  2AWY A;  3TXN A;  3UKR G;  1Z6A A;  2KCL A;  3KKB A;  2A0U A;  3GZ1 A;  2ETB A;  2FGY A;  4U9D A;  2X38 A;  4UWF A;  3AJM A;  5HI7 A;  3MYV A;  4BG0 A;  1LD7 A;  2NC9 A;  1FFT C;  1ORS C;  3RYL A;  3JYH A;  3SNX A;  2MYS A;  3FUD A;  2KZT A;  2XQ0 A;  4TXP A;  4TRQ A;  3T6J A;  1SA5 A;  1OKK D;  3FTV A;  2GGF A;  2KC3 A;  3Q7A A;  4J8S A;  4HVB A;  1S63 A;  2M64 A;  4QDL A;  2OVB A;  3UMK A;  1C02 A;  1RJ9 A;  4PFP A;  2PNO A;  3D9I A;  4JD2 G;  5C1D A;  3LY8 A;  4JCZ A;  1E8W A;  1U89 A;  5ENR D;  4P6I C;  3NF1 A;  4WWO A;  4RDA A;  2OV8 A;  3CVN A;  1N9A A;  3Q6M A;  4BJ6 C;  5E75 A;  2EIM C;  2OOE A;  3Q79 A;  2OKU A;  4N4W A;  4OIO F;  5DS4 A;  4PAC A;  4UWG A;  2Y3D A;  1N11 A;  2M4E A;  4IAQ A;  3W2W A;  2VGX B;  4KZ0 A;  1TNB A;  3RRN B;  1FMV A;  1TWA A;  1H9G A;  2DYR C;  4I2Z A;  5LCW C;  2P1A A;  4DRX E;  3TOM A;  1WY6 A;  2HSB A;  1OWM A;  3C8G A;  1IXV A;  4XEI G;  3BG0 B;  3TWX A;  1NP7 A;  3QAR A;  1CGM E;  3LLK A;  3DZA A;  3DSW A;  4K0D A;  2J0W A;  2R5S A;  2L6J A;  3GAN A;  3V5X A;  4TXR A;  2CYD A;  5FZR A;  3C3Q A;  3JCU Q;  3ZDL A;  5CCM A;  1KLX A;  3IQT A;  2CFZ A;  3P2B A;  2HFI A;  1M2O A;  1M2V B;  3SHF A;  2VAS A;  1Z23 A;  3J06 A;  4CS9 A;  2C04 A;  2XL4 A;  3DEO A;  2XRH A;  4DBR A;  2LNI A;  1U2V G;  4FWV A;  1FFH A;  4JZA A;  3MKQ A;  4F4B A;  4U5H A;  3DD7 A;  5T3T A;  3RFY A;  3U3B A;  1TR2 A;  4ANJ A;  4DVZ A;  3HJC A;  4KBL A;  2Y3G A;  2UY1 A;  5G04 J;  3NQP A;  1SZ9 A;  4UWH A;  1B89 A;  5B3S C;  1E2X A;  4BJ5 A;  2Q3T A;  4NQ0 A;  5COG A;  4AJW A;  1O5M A;  3ABM E;  4GTO A;  4EEC A;  2LP4 A;  3X1O A;  4XE0 A;  3I4R B;  4HFF B;  2Y4U A;  2HV6 A;  4IAR A;  1OCZ C;  3JRM O;  1PV3 A;  3DXJ F;  1FVH A;  2KQ9 A;  1H7I A;  4CZ2 D;  2HMZ A;  4WNG A;  1YYJ A;  3FEX A;  3LDZ A;  4EBA A;  2WXN A;  2WZF A;  4AVX A;  1H2V C;  5A6A A;  3BQO A;  3ZHE A;  2NSF A;  1QYM A;  5IY5 E;  2PM7 A;  4UWL A;  1GS9 A;  2Q7R A;  2NSZ A;  5KYY A;  3K6B A;  2Q4F A;  3L17 A;  1V4A A;  4XLN F;  3QNK A;  1R5I D;  3ZQY A;  3ZTM A;  5FCL A;  2DIW A;  2V0P A;  3FU5 A;  2DWZ A;  1TWH A;  3Q7G A;  4U8H A;  3URZ A;  3TG5 A;  4AX2 A;  3JCK C;  2CNW D;  2DYS E;  2QUP A;  3SXM A;  4ACL A;  4NC3 A;  2RD9 A;  3EGD A;  3CSF A;  3DI5 A;  2LSE A;  2QE9 A;  2R05 A;  2WXL A;  3CVW A;  3E34 A;  1A5E A;  5A6C A;  4JL0 A;  2YVK A;  4GZ5 A;  5E76 A;  4AV7 A;  1FAP B;  3OAW A;  1K1A A;  4GQH A;  3FUM A;  3JSZ A;  5B1A E;  1OW7 A;  3OXF A;  3HNL A;  4HLE A;  5EK0 A;  3L34 A;  4HOT A;  4G1T A;  5G55 A;  2YL7 A;  2XLM A;  3FUJ A;  2EPL X;  4C48 B;  4I44 A;  2J8S D;  1E8Z A;  1DVP A;  3ZPJ A;  1E85 A;  2ION A;  4E0H A;  1QQ3 A;  5BQH A;  2LSU A;  5BV1 A;  3RF3 A;  5C2Y A;  5ENN A;  4ER9 A;  5ENP D;  2Z15 A;  4JC7 A;  2AW6 A;  2A5U A;  1TJF A;  4N39 A;  1JRA A;  4APF A;  3NDB B;  3ASD A;  1L5J A;  4IAO A;  2VSN A;  3UX4 A;  1HW2 A;  2R17 C;  3WOD F;  1KZO A;  1OY3 D;  2ZIS A;  1LI7 A;  2MHK A;  2I1K A;  4JB8 P;  4BT8 A;  4G7O F;  4UI9 J;  3SGH A;  2GRO B;  3PZ2 A;  1I4Z A;  4HOQ A;  1VB5 A;  2R25 A;  5E3C A;  3WAQ A;  3FUH A;  4G2V A;  4K1O A;  4U04 A;  4XIF A;  4B0Z A;  4AY6 A;  1LVK A;  1DC2 A;  2YEV A;  3PS6 A;  1W3B A;  4C0E A;  3UIN C;  2ZXO A;  4U0U A;  5DBK A;  4Q7C A;  3S2A A;  5JT4 A;  3PNT B;  1H6P A;  4CS7 A;  1X81 A;  4U96 D;  3PCV A;  4PJM A;  2V3C C;  4ILG A;  1SYQ A;  4C0M A;  3HVE A;  1DOV A;  4HXI A;  3C62 A;  5KCM A;  2JEK A;  3NMI A;  4YN0 B;  2I1J A;  2X6H A;  2XCC A;  3FTS A;  3MJW A;  3D9L A;  1HZ4 A;  4CDN A;  4JHR A;  1ZHY A;  1U6H A;  1OCC E;  4FLH A;  4FA6 A;  3NAW A;  2YLD A;  3M1C B;  4KXK B;  2PZI A;  3RAU A;  5EIB E;  4GZ3 A;  4E7S A;  3JRT A;  5AN8 A;  4JW1 A;  3D9H A;  3NMJ A;  2IYL D;  1VLS A;  2XS8 A;  4YL0 A;  5ANL A;  2RSE B;  2PM6 A;  2J9W A;  4J32 B;  1IYG A;  3E9V A;  3UM2 A;  5KJL A;  1BLX B;  3FOO A;  5FZS A;  5DIZ A;  3ZHE B;  2AWI A;  2IOQ A;  3LLI A;  3WG7 E;  1GGQ A;  4MVR A;  2L7A A;  3EPV A;  3DSS A;  3UM3 A;  4ILH B;  4B93 B;  4X8Q A;  2OEW A;  1N52 A;  4JEH A;  3ASO E;  5FT9 A;  1XWJ A;  2XL8 A;  3AG1 C;  2DCP A;  1TN8 A;  4D4X A;  1ZHW A;  4YL3 A;  3UGO A;  3SZ7 A;  3UM1 A;  1YZA A;  4C3D A;  4UI9 K;  5EX3 A;  1A17 A;  2BTD A;  3QWW A;  1YCS B;  4EZJ A;  3KSL A;  4BEM J;  2JPU A;  4LSZ E;  4XEV A;  2IO3 C;  2YL3 A;  4ACK A;  1Q0K A;  2D4U A;  1Q0M A;  2D5R B;  3DSX A;  4GTP A;  3V31 A;  1SQM A;  1RKE B;  2FBN A;  5JHB A;  4LER A;  2WXH A;  2NG1 A;  1BI8 B;  3QDN A;  1C03 A;  3CHQ A;  2JX0 A;  1HFA A;  2C03 A;  3W9G A;  4OIP F;  2XS1 A;  3ZVR A;  1D0Z A;  3POV A;  5AQ7 A;  5FTP A;  3NYM A;  3PEV B;  2P0N A;  1Y6D A;  1UG3 A;  2VB6 A;  2WZG A;  2V5F A;  3T6B A;  4BJT A;  4PS3 A;  3CLJ A;  4ZLC A;  2Q9C A;  1L3P A;  2PQN A;  1KZP A;  3P1U A;  4EQF A;  4IJJ A;  3LVR E;  4N5C A;  3CK9 A;  4YDW A;  3ZYQ A;  3DM9 B;  4MVQ A;  3W8I A;  4FJY A;  1EDU A;  4CEM A;  3Q7F A;  4A1G A;  3JUE A;  4X0R A;  3V79 K;  5A6K A;  4AK9 A;  3TG4 A;  3TL5 A;  2H7V C;  4PJL A;  4JXT A;  3HNJ A;  3PDN A;  3N71 A;  4IUL A;  4U5F E;  5ARG A;  2F8X K;  1YYH A;  1HW1 A;  2WXJ A;  3HYM B;  1PY1 A;  5A6B D;  4MS6 A;  3B71 A;  3TWS A;  3B13 A;  5KYW A;  1HO8 A;  2H8A A;  3S29 A;  2IU1 A;  5HS0 A;  4FHJ A;  4DUI A;  3EZI A;  3NB2 A;  5BQG A;  3QB2 A;  5ENS D;  2CHW A;  3ZW3 A;  1T01 A;  4HOU A;  2RFM A;  1U3D A;  3GZ2 A;  1BBH A;  1MX4 A;  2BUG A;  2ZGD A;  3SBT B;  3T5X A;  2HM8 A;  1TWC A;  5A7D B;  4CJG A;  2YQ8 A;  3DJU B;  1OCO E;  4EPZ A;  3HXB A;  1E7V A;  1KPS B;  3AG2 E;  2VJ8 A;  1SR2 A;  2DGJ A;  3G2V A;  3K7D A;  1ELR A;  3E4B A;  1ZBP A;  1K40 A;  2WMO A;  1CPR A;  4IB4 A;  4C7O A;  5DQZ A;  1IHB A;  2IFU A;  2KNH A;  3LEV A;  2PNN A;  1S0P A;  4IN3 B;  2VTB B;  4OYS A;  3DE8 A;  5EX0 A;  3L08 A;  2OCC C;  3L8J A;  2XL6 A;  4U5E E;  1UOH A;  3MYI A;  3EHQ A;  4R32 A;  3ASG A;  2PFD A;  1N4R A;  2H6F A;  1SZI A;  5DQT A;  5T8I A;  2WMN A;  3L0I A;  1RKC A;  3DJN B;  1FVF A;  1GW6 A;  2MYO A;  1JCS A;  1ZU2 A;  2WXI A;  3FOP A;  2XGO A;  3SFX A;  4KVO A;  4XWJ A;  5CHE E;  1LTX A;  1UFB A;  3B7R L;  2YQY A;  2AVK A;  3MZL B;  3SFZ A;  4YDO A;  4MBG A;  2EIN C;  3QAQ A;  2XM4 A;  2G3K A;  3RJV A;  2MRI A;  5L0D A;  5HV9 A;  2GRP B;  4CBE A;  2PQR A;  4PFO A;  2KK1 A;  3HHM A;  3CK8 A;  4NAC A;  2KJG A;  3UT4 A;  5JJT A;  1LF8 A;  1DCQ A;  4LG6 A;  4PK4 A;  3TAX A;  2IF4 A;  2YHC A;  1BD8 A;  3IHV A;  5L0C A;  4HRL A;  5H7P A;  4BSX A;  2J9V A;  2YZS A;  4DX5 D;  1UG7 A;  2XLW A;  4EUK B;  5D91 A;  3AG4 E;  3HXD A;  3QVY A;  3T9O A;  4HS2 A;  4O6M A;  1RZ4 A;  1LS4 A;  1YA9 A;  3IV0 A;  4EWC A;  3QW1 A;  1VDY A;  3S7D A;  1HE8 A;  4Y6W A;  1ZU5 A;  4LDQ A;  3L16 A;  5TJ5 E;  1HU3 A;  2X6K A;  3C8G D;  3U9M A;  4DJA A;  1HXI A;  4CIP A;  1Q0G A;  1RCP A;  4MVO A;  3BU8 A;  3FHE A;  5AGF A;  3E30 A;  3K9I A;  4LEU A;  3ASN E;  3S0X A;  4FUL A;  4TV3 A;  5KYU B;  1H6G A;  4AE4 B;  4A4A A;  2VH3 A;  4OD5 A;  2Y69 E;  1YA7 O;  4IGG A;  3TWU A;  1O87 A;  3FDH A;  2PP4 A;  4WJ0 A;  2BKG A;  3LS8 A;  2L6B A;  3A9C A;  3T8M A;  4GTQ A;  3B7B A;  3V2X A;  5JLI A;  3G4X A;  3QMK A;  1HE9 A;  1A0B A;  5F5F A;  4MVU A;  1NU9 C;  3TOL A;  4AOF A;  4BFR A;  4LNB A;  4LRZ A;  3LY7 A;  2KM4 A;  5EHH A;  2A69 F;  2KAT A;  5ENO D;  1LS1 A;  4AEZ C;  1H0A A;  1EA8 A;  3IHY A;  4URK A;  2CHX A;  4FX5 A;  2AJA A;  3PZ1 A;  1Z7Q c;  4CRW A;  4L7T A;  1OT8 A;  3PVL A;  3UR3 C;  4ULV A;  3UXG A;  1D0Y A;  3HTK C;  1V54 C;  4HOS A;  4U0Z A;  2WVI A;  1D0X A;  1N54 A;  3SI5 A;  4XQ1 A;  1OW8 A;  4CGV A;  4NUR A;  1D9S A;  4JTD B;  1QPU A;  2C0L A;  4MW8 A;  2L6H A;  3ZYM A;  4PR9 A;  1OUV A;  3NYJ A;  2VSX E;  2J08 A;  3DSU A;  2XEN A;  3MFN A;  4KZC A;  3ULE G;  5JS5 A;  4I9E A;  3IQ6 A;  2LK4 A;  4OIN F;  3PRZ A;  3I4U A;  4JHJ A;  3EGX A;  2XZD G;  4NTA A;  2MOW A;  3RIP A;  4OIR F;  2GFH A;  3DWW A;  2XEE A;  2XZT G;  4FAP B;  3U2L A;  3I3N A;  4XI9 A;  1BZ4 A;  5F28 E;  4E7Z A;  1TWG A;  1ZVZ A;  2B6C A;  2GW1 A;  5AQA A;  4L23 A;  2B0O E;  4NQF A;  3FMS A;  3RKV A;  2XXA A;  2GAQ A;  2QLA A;  1OCR C;  4BJ6 A;  1N4S A;  4EZL A;  5D0O D;  3U0C A;  4HNA D;  3CVL A;  3LPZ A;  3C8Z A;  5KYX B;  5L0J A;  1I5N A;  4I6E A;  3SEO A;  3H2U A;  4CDV A;  2FFH A;  1IQR A;  5CMY A;  3EQL F;  1HMO A;  4GZ6 A;  4NIK A;  3AGU A;  4KC9 A;  3ZC4 A;  1O1R A;  3LCA A;  4HEA J;  2EQX A;  2X0C A;  3JQ0 A;  4B8C B;  4HFK B;  5B3I A;  3ZVV A;  3S9O A;  4MKT A;  1EF1 C;  3RU0 A;  2ETA A;  2GDC A;  4G78 A;  4C9B B;  1T6Q A;  3NYL A;  4V3I A;  5CED B;  3NMK A;  3ZRH A;  1NFN A;  2FAP B;  4EBB A;  4FAD A;  5BPP A;  3BEE A;  4A63 B;  4DOZ A;  2P9U G;  5JMN D;  3SO8 A;  4DK5 A;  2H7B A;  5LP0 A;  4EBK A;  3UMH A;  2HJ3 A;  4P29 A;  1HE1 A;  2Y39 A;  1V55 C;  3DST A;  1K1B A;  2F8Y A;  4N2S A;  3RQE A;  1ZW2 A;  4GB9 A;  2BL2 A;  3GEH A;  3UT7 A;  4QI0 A;  2MHR A;  2IOL A;  1YZC A;  3KL4 A;  3L54 A;  2W4M A;  4K5B A;  4O1P A;  3IQ5 A;  4ME2 A;  4N3A A;  1GQA A;  3VYW A;  4FP7 A;  1HMD A;  3CZ6 A;  1A7E A;  1UW4 B;  3EG9 B;  3D9M A;  1ZHX A;  3FU3 A;  3ZQV A;  2E0I A;  4G11 A;  3CIA A;  5BUO A;  2ILR A;  3ASF A;  4I6J A;  3UQ3 A;  4MTG A;  4UQY A;  2DBA A;  2WXP A;  4BPM A;  1ZHZ A;  5CBO A;  5KJN A;  2J8W A;  4G7H F;  1JCR A;  1UJK A;  3TJP A;  3L8I A;  4QQI A;  4FES A;  1JWF A;  1NU7 D;  3D9K A;  1JMW A;  3ZIB A;  1VYK A;  1NFO A;  5KNH D;  3IKO B;  3LY9 A;  5JJ7 A;  3V7O A;  4BX9 A;  2XM0 A;  1G8X A;  2KBX A;  2YLG A;  3FTZ A;  4N3C A;  3ULY A;  1ST6 A;  4WND A;  1YAU O;  2H6G A;  3KD7 A;  1TQG A;  5E2Q A;  2IY0 C;  3AOU A;  4YT5 A;  4P9F A;  4LDR A;  3FEY A;  5JSL A;  2A6E F;  4U5D E;  3FXH A;  5BNW A;  4M7C A;  2P9N G;  3G50 A;  4CDY A;  5T1D B;  1AVO B;  1G4W R;  4DVY P;  2YLI A;  2IO2 C;  1Z63 A;  2P7V A;  4LUN U;  4ILI A;  1WDY A;  3GOR A;  2I8B A;  5AEN A;  4BER A;  4LDK A;  5K0I A;  4GEH A;  1PCX A;  4YDE A;  4F1S A;  1NBB A;  2EIK E;  3ZEF A;  1VK5 A;  4U07 A;  5FQ7 A;  4FJZ A;  3LUT B;  4AM9 A;  4HI8 A;  2KZT B;  1JUQ A;  1QZX A;  2XSE A;  2VC9 A;  3ECS A;  1IZM A;  3X2Q E;  1LM3 B;  3CHR A;  5KNG A;  2P58 C;  4HI9 A;  2KYH A;  3QOU A;  4FU3 A;  4JEU A;  4EZK A;  4N6H A;  4R7L A;  4YL1 A;  2P9P G;  2LXM A;  1RJ9 B;  5BQI A;  3ONL A;  2RG8 A;  3O4Z A;  3QW0 A;  4K0R A;  3ABL E;  1TR4 A;  3PE3 A;  3DE9 A;  1X5B A;  2Y0B G;  3R7R A;  4CS9 C;  1FMW A;  4DX7 D;  1N94 A;  4JCH A;  1Y6I A;  5CEC B;  4U5C E;  1KT0 A;  4JPS A;  1E7U A;  2RD0 A;  2R7U A;  2WXM A;  1WGW A;  4RBN A;  2LSV A;  3LNR A;  2QC9 A;  2CFU A;  3C72 A;  3SXY A;  2QYU A;  3HDX A;  4XPX A;  3U5S A;  4CSA A;  4FLB A;  4BEJ A;  1ZB1 A;  3UMI A;  3Q49 B;  2HUJ A;  4HFG A;  1TFO B;  2KSF A;  3U3F A;  3C8G B;  3GW4 A;  1TYQ G;  3L22 A;  1D1B A;  2IXM A;  2QY9 A;  5BUZ A;  2A1D D;  2I6H A;  2E2E A;  2V8S E;  3D3M A;  3DPY A;  3FP3 A;  4MND A;  3I5P A;  4LLC A;  4NTB A;  4TXQ A;  1WWP A;  1N0R A;  4BEP A;  3W2V A;  5EIL A;  2CG3 A;  3BRJ A;  1MX6 A;  5AC4 A;  3QTH A;  5CRU A;  1ZW3 A;  3CAX A;  4ABN A;  2V4L A;  4YT4 A;  1EYH A;  3WHN A;  4GTM A;  2WPV A;  1SA4 A;  4DXW A;  5HSW A;  3ENE A;  3HNK A;  4NTF A;  1S7Z A;  3MKQ B;  2OJQ A;  1ZHT A;  3LKU A;  1MQV A;  1KU2 A;  4O79 A;  2ZXP A;  3N2Z B;  1DOW A;  4HRM B;  3LJB A;  1M56 C;  1TKN A;  3CVX A;  3PUJ A;  4U8Y D;  2UY1 B;  5B1B E;  3H2V A;  4LCT A;  4E85 A;  3UT8 A;  5L0H A;  2NUT A;  1E83 A;  1LIH A;  3FVY A;  4JRZ A;  4CJO A;  4JTA B;  3DPD A;  4L9P A;  1PD0 A;  2JD3 A;  3MBG A;  2M63 A;  3HIZ A;  1HF8 A;  2V26 A;  2A68 F;  4MVS A; 
#chains in the Genus database with same CATH homology
 1Z3I X;  5EKQ D;  3FU0 A;  5BT1 A;  1HX8 A;  4DBQ A;  1KT1 A;  4F53 A;  4EBA G;  3AS8 A;  3ABM C;  4GAA A;  3ZYL A;  1M57 C;  2XPZ A;  4U63 A;  3LVQ E;  3ZFW A;  3T5V A;  5KYY B;  3ZYK A;  4GA1 A;  1XNF A;  5IY5 C;  4J0U A;  3PE4 A;  3I5Q A;  3EHM A;  5T4Y A;  3ESL A;  4CT4 A;  3S7F A;  1WAO 1;  3S27 A;  1U3C A;  4KYO B;  3EGD B;  4XLP F;  5G05 J;  2DYS C;  3IEE A;  4O7G A;  2J49 A;  4CDM A;  4JVS A;  3FH5 A;  2KCV A;  1IQU A;  1D1A A;  1ZYR F;  2NUP A;  1QQE A;  4MLP A;  4KT6 B;  1VYI A;  1YA0 A;  2GRL A;  3DAF A;  1UN9 A;  3QWV A;  4XKC A;  2VSO E;  3ML8 A;  3S7B A;  5B1A C;  2FF4 A;  2A6H F;  3NZS A;  4Q96 A;  2C2L A;  3LEW A;  3Q15 A;  3D9O A;  3VLF A;  1UJJ A;  4J6I A;  3EIQ C;  3CQC B;  1MNE A;  4G0H A;  4H4K C;  5LOZ A;  4U5G A;  3AU4 A;  3I4G A;  4MQ9 F;  3Q7L A;  2A4Z A;  1Z3Y A;  5DS5 A;  3L13 A;  5AYW D;  4E6H A;  5DVW A;  4GYO A;  4CCA A;  2PX3 A;  2B0J A;  3O39 A;  1NA0 A;  2J46 A;  4G24 A;  1NZN A;  4GML A;  3HVE B;  3EJN A;  2I2O A;  2UWJ G;  4W9R A;  3N24 A;  3FY4 A;  2AXV A;  2WQH A;  1J8Y F;  3UMV A;  2WM9 A;  2R7Q A;  4PJN A;  2O9X A;  3OWT A;  1OCC C;  3APD A;  3DMD A;  5EGY A;  2WXG A;  4K03 A;  2H7O A;  1EPU A;  2CG2 A;  3F47 A;  4WWP A;  1VMA A;  4I6G A;  2WQ6 A;  2Y4T A;  1MND A;  3RIB A;  1TJC A;  3ULQ A;  4XTK A;  4L1B A;  4LAC B;  3QZC A;  4BX8 A;  2R7S A;  5A23 A;  3U3W A;  3KS2 A;  3WG7 C;  3B0V C;  4UI9 C;  2OVF A;  1SMY F;  3ASO C;  2XHE A;  3CVP A;  4O6Y A;  3FWV A;  1OWL A;  4OIQ F;  4KNV A;  4A3V A;  2CW0 F;  3QWP A;  4DI4 A;  4Q4Z F;  3EFO A;  2IOS A;  2LO6 A;  3B0U X;  3IBE A;  4WUY A;  4KI2 A;  1DNP A;  3QK0 A;  3UUX A;  4RD9 A;  5JHA A;  5LX8 A;  4JJF A;  2BF0 X;  4UQZ A;  3VLD A;  1JWG A;  2ZPA A;  3L6A A;  3VAY A;  3NZU A;  5ANR A;  3CVU A;  3Q4A B;  1BR1 A;  1IW7 F;  1MMN A;  4I2W A;  3K1I C;  5T3W A;  3ASH A;  3B0P A;  5LCW J;  5KYW B;  3CKC A;  3U66 A;  4GZC A;  3DAG A;  4BTA A;  4I43 A;  4QFV A;  1W2W A;  2J9Q A;  3S28 A;  2IXO A;  3ML9 A;  1FCH A;  4I3M A;  3CST A;  5CMW A;  5FQ6 A;  3LJ3 A;  4I1O B;  3FU6 A;  4OD4 A;  4WAF A;  4J8F A;  3RK6 A;  5D0Q D;  3CHP A;  3ZG1 A;  1ELW A;  3G2T A;  1OCO C;  2Q9B A;  3AG2 C;  4ANW A;  4LLE A;  4C7O B;  3KAE A;  3HLZ A;  2E87 A;  4F7A A;  2JLB A;  3VTX A;  1N1C A;  2J7P A;  3ESK A;  4K7B A;  2HR2 A;  2QFC A;  3FTX A;  3PMR A;  2VGX A;  2OG2 A;  3G2U A;  2YHE A;  3FH7 A;  4C3E A;  2R59 A;  2AXU A;  2FO7 A;  1MHQ A;  1OWO A;  3WXX A;  2CGE A;  5FJY A;  2HO1 A;  5T3R A;  3Q47 B;  4N3B A;  4CS8 C;  2EIJ C;  4Q94 A;  4F3V A;  2Y3B A;  2ZXW C;  5KJM A;  1M2V A;  3U4T A;  2WQ7 A;  3T4R A;  3D9P A;  4NY3 A;  3Q6N A;  5L3Q A;  4GZD A;  3UPV A;  2MWQ A;  5G2N A;  3CKB A;  4A1S A;  3SZR A;  3AQC A;  3PH0 C;  3SP1 A;  4JA9 A;  3RRM B;  1ZU4 A;  4ANX A;  3MV3 B;  3CGH A;  4GYW A;  4Y6C A;  3FFL A;  3KMI A;  3NKD A;  3B7U X;  1QNF A;  3AG4 C;  1D1C A;  5J08 A;  3EZH A;  2L9B A;  3R9A B;  3SD5 A;  4I9C A;  5FQ4 A;  5FQ8 A;  5BW8 C;  2W45 A;  3EH1 A;  3K66 A;  3H65 A;  2XGM A;  2PL2 A;  1HS6 A;  3AS5 A;  4GMJ A;  3FUL A;  5HQ8 A;  3QKY A;  3DM5 A;  3ASN C;  4DLQ A;  4RSY A;  2YHS A;  3QJZ A;  2Y69 C;  1H6K A;  2G62 A;  2VQ2 A;  5KJK A;  4ANU A;  2QTV A;  1E96 B;  2J4D A;  3ITF A;  3SF4 A;  4WNE A;  4XX5 A;  1MMG A;  2HV7 A;  3VLE A;  1INZ A;  3EH2 A;  3CHO A;  3CVV A;  1PAQ A;  3CR3 A;  4H7X A;  3LYA A;  3CVQ A;  2WXK A;  1P5Q A;  5AIJ A;  3KH2 A;  2WXR A;  3RRU A;  3VTY A;  1OWN A;  4G7Z F;  4B8A A;  2P6V A;  5DLJ A;  2Q9A A;  3EGX B;  4AIF A;  4I1M A;  3EIJ A;  1O5H A;  3LS1 A;  3CV0 A;  2ZU6 B;  3N0T A;  4O6N A;  4FHK A;  2IQC A;  2XXA B;  2LAI A;  4YND A;  1XGW A;  2R7R A;  3O48 A;  2GRM A;  2L0T B;  3ZSU A;  3K33 A;  5AJD A;  4GPK A;  4YWQ A;  2I9C A;  4QI2 A;  4A2N B;  4CDR A;  2Q7F A;  1VOM A;  4XZ4 A;  4BTB A;  3NKE A;  3JT1 A;  2PF4 E;  1IHG A;  4JC8 A;  3SNH A;  3FH8 A;  4CGW A;  2R7X A;  2X6J A;  4FC8 A;  4WNF A;  5FZQ A;  3NG1 A;  3MGB A;  3GZS A;  2KC7 A;  2HYZ A;  4N2Q A;  1HH8 A;  2X51 A;  3G2W A;  1E8Y A;  3AS4 A;  3TD7 A;  2J09 A;  4ANV A;  4H7Y A;  4BJ5 C;  3RO2 A;  2XPY A;  4IYP A;  5KYN A;  4WWN A;  2VYI A;  2NXP A;  2G3V A;  3OTN A;  3CHS A;  2R7W A;  2FUL A;  2X6F A;  4AP2 A;  3RH3 A;  3C98 A;  1OKK A;  4G23 A;  3UGP A;  5E33 A;  4AY5 A;  3B7S A;  1FTS A;  2W9Y A;  4Q69 A;  4YJW A;  3OXG A;  5FWQ A;  2WB7 A;  3LES A;  3LXU X;  5DS6 A;  2J07 A;  5CI8 A;  2FI7 A;  3QC1 A;  4GA2 A;  2XPI A;  4PS7 A;  1E90 A;  5M72 A;  3PZD A;  2KGO A;  2WZL A;  5LFA A;  2WVO A;  4UWK A;  3FUF A;  2WL8 A;  4BT9 A;  3FTU A;  3PNL B;  3JUI A;  2FEZ A;  4GCN A;  4GU5 A;  4M63 A;  4D10 C;  2Y3H A;  4CSA C;  4OVU A;  1H19 A;  3NRH A;  3OA1 A;  4GCO A;  4U5B E;  4J8E A;  3ONK A;  3CQG B;  2EIK C;  2XRY A;  2XRZ A;  4GYY A;  2L81 A;  4O6F A;  2VTB A;  2WVN A;  3X2Q C;  4CT0 A;  4BWR A;  3CVY A;  1E8X A;  4HE8 D;  3PUK A;  5G04 C;  4B6I A;  3TGO A;  2J45 A;  1JPJ A;  2BE5 F;  3ABL C;  1HG5 A;  4G26 A;  5CI9 A;  3FUI A;  2IXP A;  1NA3 A;  3PEU B;  3MX3 A;  5J90 A;  2WB2 A;  1Z5Z A;  3ZGQ A;  4PDX A;  2IXN A;  4Q5S F;  1MMD A;  3U64 A;  4ZLD A;  4IRU A;  3CSK A;  1Y8M A;  1NZE A;  3TXM A;  3LS0 A;  3EDT B;  4KNW A;  1LKX A;  3G2S A;  2W4B A;  2CNW A;  3Q5M A;  3AU5 A;  3KEZ A;  3FUK A;  4DPR A;  2X6I A;  2XCB A;  3MA5 A;  2J7P D;  4BJ1 A;  2YNQ A;  4XKB A;  4ULW A;  4G25 A;  3RKO F;  4YT8 A;  4JUR I;  2CHZ A;  3MCX A;  2KW3 C;  1BPO A;  2NUT B;  3ZN3 A;  3E70 C;  1SF8 A;  5F5H A;  3W8H A;  5B1B C;  2AVP A;  4KBQ A;  5KYU A;  3B9Q A;  4AE4 A;  3BG1 B;  1JPN A;  2KCK A;  2XGS A;  5AJL A;  1H2T C;  2ZXR A;  3K1H A;  5D92 A;  3APC A;  2AXZ A;  3MLG A;  4DI3 A;  2R7V A;  2C0M A;  5L3V A;  1BR4 A;  3FDQ A;  3FTW A;  3FAJ A;  2R7T A;  3PHF 2;  3OEO A;  4HOR A;  3FUN A;  1ELK A;  1Z6T A;  4C3B A;  2PX0 A;  4B94 A;  3ABK C;  4MRU A;  1HG2 A;  1PC2 A;  4IWB A;  1QLE C;  2Y3A A;  2L0I A;  4OVV A;  2X3M A;  4YT2 A;  4YVQ C;  3R7Q A;  4PS8 A;  3AQB A;  3U9W A;  2NUP B;  1PD1 A;  2YIN A;  2IJG X;  5CCL A;  1TEZ A;  3JYS A;  4RG6 A;  1WM5 A;  4GYT A;  4PUC A;  2WXQ A;  3CQZ A;  4JA7 A;  4NRH B;  1JPL A;  3FTY A;  4I1A A;  3OXL A;  4N06 A;  3DBS A;  5KYX A;  4L2Y A;  3GYZ A;  4JHK A;  1J8M F;  4CIH A;  3UNG C;  5E3A A;  3IEG A;  2VSY A;  2EIL C;  3F46 A;  4I17 A;  2J4B A;  4U0S A;  2QY7 A;  3ZXS A;  3RO3 A;  1NG1 A;  1BR2 A;  1OWP A;  5G05 C;  3S7J A;  4UQX A;  3FHD A;  2WXO A;  3MEK A;  4A55 A;  3SBS A;  1SZA A;  1MQS A;  4CS8 A;  1UN8 A;  4L2L A;  3D9J A;  4BY6 A;  4JJG A;  3SYN A;  3B7T A;  3LAY A;  3D9N A;  2XEV A;  3APF A;  2WXF A;  2VGY A;  4XI0 A;  4J8D A;  5JJ6 A;  3ZIM A;  2J0X A;  5ARF A;  3EG9 A;  3EHN A;  4M3O A;  3FUE A;  4JZY A;  2LAH A;  4YVO A;  2WVQ A;  4KVM A;  4ATG A;  2CDQ A;  4RVB A;  4B89 A;  1MMA A;  2J9U A;  3JQ1 A;  4RG9 A;  4PJJ A;  4W8K A;  3MKR A;  2R7O A;  4KMO A;  1QZ2 A;  3EFO B;  2L9J A;  4GA0 A;  3GOD A;  2OND A;  4TUU A;  4A3T A;  3O6X A;  3PRE A;  3CEQ A;  3AG3 C;  3CK7 A;  3MV2 B;  1H2U A;  4AXH A;  4PH4 B;  4DLO A;  5EDS A;  4APO A;  3CHM A;  1Z3X A;  5BV0 A;  4J30 B;  3TXN A;  1Z6A A;  2KCL A;  3KKB A;  3GZ1 A;  4UWF A;  2FGY A;  2X38 A;  5HI7 A;  3MYV A;  4BG0 A;  2NC9 A;  1FFT C;  3RYL A;  3JYH A;  3SNX A;  2MYS A;  3FUD A;  2KZT A;  2XQ0 A;  4TRQ A;  3T6J A;  1OKK D;  3FTV A;  2GGF A;  4HVB A;  4J8S A;  4QDL A;  2OVB A;  3UMK A;  1RJ9 A;  4PFP A;  3D9I A;  5C1D A;  3LY8 A;  1E8W A;  4P6I C;  3NF1 A;  4WWO A;  4RDA A;  2OV8 A;  3CVN A;  3Q6M A;  4BJ6 C;  5E75 A;  2EIM C;  2OOE A;  4OIO F;  5DS4 A;  4UWG A;  2Y3D A;  2M4E A;  3W2W A;  2VGX B;  4KZ0 A;  3RRN B;  1FMV A;  1TWA A;  2DYR C;  4I2Z A;  5LCW C;  1WY6 A;  1OWM A;  3BG0 B;  1NP7 A;  3QAR A;  3LLK A;  3DZA A;  4K0D A;  2J0W A;  2R5S A;  2L6J A;  3GAN A;  5FZR A;  3JCU Q;  5CCM A;  1KLX A;  2CFZ A;  3P2B A;  1M2O A;  1M2V B;  3SHF A;  2VAS A;  1Z23 A;  4CS9 A;  2C04 A;  2XL4 A;  2XRH A;  4DBR A;  2LNI A;  4FWV A;  1FFH A;  4JZA A;  3MKQ A;  4F4B A;  4U5H A;  3DD7 A;  5T3T A;  3RFY A;  1TR2 A;  4ANJ A;  4DVZ A;  3HJC A;  4KBL A;  2Y3G A;  2UY1 A;  5G04 J;  3NQP A;  1SZ9 A;  4UWH A;  1B89 A;  5B3S C;  4BJ5 A;  2Q3T A;  4NQ0 A;  4AJW A;  4EEC A;  3X1O A;  4XE0 A;  3I4R B;  4HFF B;  2Y4U A;  2HV6 A;  1OCZ C;  3DXJ F;  1FVH A;  2KQ9 A;  4WNG A;  3FEX A;  3LDZ A;  4EBA A;  2WXN A;  2WZF A;  4AVX A;  1H2V C;  3ZHE A;  2PM7 A;  4UWL A;  2NSZ A;  5KYY A;  3K6B A;  3L17 A;  4XLN F;  3QNK A;  5FCL A;  2DIW A;  2V0P A;  3FU5 A;  1TWH A;  3Q7G A;  4U8H A;  3URZ A;  3TG5 A;  4AX2 A;  3JCK C;  2CNW D;  4ACL A;  3EGD A;  3CSF A;  2LSE A;  2WXL A;  3CVW A;  5A6C A;  4JL0 A;  4GZ5 A;  5E76 A;  4AV7 A;  3OAW A;  3FUM A;  3JSZ A;  3OXF A;  4HLE A;  3L34 A;  4HOT A;  4G1T A;  5G55 A;  3FUJ A;  4I44 A;  1E8Z A;  1DVP A;  3ZPJ A;  2ION A;  2LSU A;  5BV1 A;  5C2Y A;  5ENN A;  2Z15 A;  2AW6 A;  2A5U A;  1TJF A;  4N39 A;  4APF A;  3NDB B;  3ASD A;  1L5J A;  4IAO A;  2VSN A;  3UX4 A;  2R17 C;  3WOD F;  2MHK A;  2I1K A;  4BT8 A;  4G7O F;  4UI9 J;  3SGH A;  4HOQ A;  5E3C A;  3FUH A;  4G2V A;  4U04 A;  4XIF A;  4B0Z A;  4AY6 A;  1LVK A;  2YEV A;  3PS6 A;  1W3B A;  4C0E A;  2ZXO A;  4U0U A;  5DBK A;  4Q7C A;  3S2A A;  3PNT B;  4CS7 A;  4PJM A;  2V3C C;  4ILG A;  4C0M A;  3HVE A;  4HXI A;  5KCM A;  2JEK A;  4YN0 B;  2I1J A;  2X6H A;  2XCC A;  3MJW A;  3FTS A;  4CDN A;  3D9L A;  1HZ4 A;  4JHR A;  1ZHY A;  4FLH A;  4FA6 A;  3M1C B;  4KXK B;  2PZI A;  4GZ3 A;  4E7S A;  3JRT A;  4JW1 A;  2IYL D;  5ANL A;  2PM6 A;  2J9W A;  4J32 B;  1IYG A;  3E9V A;  5KJL A;  5FZS A;  5DIZ A;  3ZHE B;  2AWI A;  2IOQ A;  3LLI A;  3EPV A;  4ILH B;  1N52 A;  4JEH A;  5FT9 A;  3AG1 C;  2DCP A;  1ZHW A;  3UGO A;  3SZ7 A;  4C3D A;  4UI9 K;  5EX3 A;  1A17 A;  2BTD A;  3QWW A;  4EZJ A;  4ACK A;  2D5R B;  1SQM A;  2FBN A;  5JHB A;  4LER A;  2WXH A;  2NG1 A;  3QDN A;  3CHQ A;  1HFA A;  2C03 A;  4OIP F;  3ZVR A;  5FTP A;  1D0Z A;  3POV A;  3NYM A;  3PEV B;  1UG3 A;  2V5F A;  2VB6 A;  2WZG A;  3T6B A;  4BJT A;  4PS3 A;  3CLJ A;  4ZLC A;  2Q9C A;  2PQN A;  3P1U A;  4EQF A;  4N5C A;  3LVR E;  4IJJ A;  3CK9 A;  3ZYQ A;  3DM9 B;  3W8I A;  4FJY A;  1EDU A;  4CEM A;  4A1G A;  4X0R A;  4AK9 A;  3TG4 A;  3TL5 A;  2H7V C;  4PJL A;  4JXT A;  3PDN A;  3N71 A;  4IUL A;  4U5F E;  5ARG A;  2WXJ A;  3HYM B;  1PY1 A;  4MS6 A;  3B13 A;  5KYW A;  1HO8 A;  3S29 A;  2IU1 A;  4FHJ A;  3EZI A;  3QB2 A;  2CHW A;  3ZW3 A;  4HOU A;  1U3D A;  3GZ2 A;  2BUG A;  3SBT B;  3T5X A;  2HM8 A;  1TWC A;  5A7D B;  2YQ8 A;  3DJU B;  4EPZ A;  1E7V A;  2VJ8 A;  2DGJ A;  3G2V A;  3K7D A;  1ELR A;  3E4B A;  1ZBP A;  2WMO A;  4C7O A;  5DQZ A;  2IFU A;  2KNH A;  3LEV A;  1S0P A;  4IN3 B;  2VTB B;  4OYS A;  5EX0 A;  3L08 A;  2OCC C;  4U5E E;  3ASG A;  2PFD A;  1SZI A;  5DQT A;  5T8I A;  2WMN A;  3L0I A;  3DJN B;  1FVF A;  1GW6 A;  1ZU2 A;  2WXI A;  2XGO A;  4KVO A;  4XWJ A;  5CHE E;  3B7R L;  3MZL B;  3SFZ A;  2EIN C;  3QAQ A;  2G3K A;  3RJV A;  2MRI A;  4CBE A;  2PQR A;  4PFO A;  3HHM A;  3CK8 A;  4NAC A;  2KJG A;  3UT4 A;  5JJT A;  1LF8 A;  4PK4 A;  3TAX A;  2IF4 A;  2YHC A;  3IHV A;  4BSX A;  2J9V A;  2YZS A;  5D91 A;  4HS2 A;  4O6M A;  3IV0 A;  4EWC A;  1VDY A;  3S7D A;  1HE8 A;  4Y6W A;  1ZU5 A;  3L16 A;  1HU3 A;  2X6K A;  4DJA A;  1HXI A;  3FHE A;  3K9I A;  4LEU A;  3S0X A;  4FUL A;  4TV3 A;  5KYU B;  4AE4 B;  2VH3 A;  4OD5 A;  1O87 A;  3FDH A;  2PP4 A;  4WJ0 A;  3LS8 A;  3T8M A;  3QMK A;  5F5F A;  1NU9 C;  4AOF A;  4BFR A;  4LRZ A;  3LY7 A;  2KM4 A;  5EHH A;  2A69 F;  2KAT A;  1LS1 A;  4AEZ C;  1H0A A;  3IHY A;  4URK A;  2CHX A;  4FX5 A;  4CRW A;  4L7T A;  3PVL A;  3UR3 C;  1D0Y A;  3HTK C;  1V54 C;  4HOS A;  4U0Z A;  2WVI A;  1D0X A;  1N54 A;  3SI5 A;  4CGV A;  4NUR A;  2C0L A;  3ZYM A;  2VSX E;  1OUV A;  3NYJ A;  2J08 A;  4KZC A;  4I9E A;  4OIN F;  3PRZ A;  3I4U A;  4JHJ A;  3EGX A;  2MOW A;  3RIP A;  4OIR F;  2GFH A;  3I3N A;  4XI9 A;  4E7Z A;  1TWG A;  2GW1 A;  4L23 A;  3RKV A;  2XXA A;  1OCR C;  4BJ6 A;  4EZL A;  5D0O D;  3CVL A;  3LPZ A;  5KYX B;  4I6E A;  3SEO A;  2FFH A;  1IQR A;  5CMY A;  3EQL F;  4GZ6 A;  4KC9 A;  3ZC4 A;  3LCA A;  4HEA J;  2EQX A;  3JQ0 A;  4B8C B;  4HFK B;  3ZVV A;  4MKT A;  1EF1 C;  3RU0 A;  4C9B B;  3NYL A;  4V3I A;  3ZRH A;  4EBB A;  4FAD A;  5BPP A;  3BEE A;  4DOZ A;  4DK5 A;  2H7B A;  5LP0 A;  3UMH A;  4P29 A;  2Y39 A;  1V55 C;  4N2S A;  4GB9 A;  3UT7 A;  4QI0 A;  2IOL A;  3KL4 A;  3L54 A;  2W4M A;  4ME2 A;  4N3A A;  3VYW A;  4FP7 A;  3CZ6 A;  1UW4 B;  3EG9 B;  3D9M A;  1ZHX A;  3FU3 A;  2E0I A;  4G11 A;  3CIA A;  5BUO A;  2ILR A;  3ASF A;  4I6J A;  3UQ3 A;  4UQY A;  2DBA A;  2WXP A;  1ZHZ A;  5KJN A;  4G7H F;  1UJK A;  3TJP A;  4FES A;  1JWF A;  3D9K A;  1NU7 D;  3ZIB A;  1VYK A;  3IKO B;  3LY9 A;  5JJ7 A;  3V7O A;  4BX9 A;  1G8X A;  3FTZ A;  4N3C A;  1ST6 A;  4WND A;  3KD7 A;  5E2Q A;  4YT5 A;  3FEY A;  2A6E F;  4U5D E;  5BNW A;  5T1D B;  4DVY P;  1Z63 A;  2P7V A;  4LUN U;  4ILI A;  2I8B A;  5AEN A;  4GEH A;  1PCX A;  4F1S A;  3ZEF A;  1VK5 A;  4U07 A;  5FQ7 A;  4FJZ A;  4AM9 A;  2KZT B;  1JUQ A;  1QZX A;  2XSE A;  3ECS A;  1IZM A;  3CHR A;  2P58 C;  3QOU A;  4FU3 A;  4JEU A;  4EZK A;  4R7L A;  1RJ9 B;  3ONL A;  2RG8 A;  3O4Z A;  4K0R A;  3PE3 A;  1X5B A;  3R7R A;  4CS9 C;  1FMW A;  4JCH A;  1Y6I A;  4U5C E;  1KT0 A;  4JPS A;  1E7U A;  2RD0 A;  2R7U A;  2WXM A;  1WGW A;  4RBN A;  2LSV A;  3LNR A;  2CFU A;  3HDX A;  4CSA A;  4FLB A;  4BEJ A;  3UMI A;  3Q49 B;  4HFG A;  3GW4 A;  3L22 A;  1D1B A;  2IXM A;  2QY9 A;  5BUZ A;  2A1D D;  2I6H A;  2E2E A;  2V8S E;  3D3M A;  3FP3 A;  4MND A;  3I5P A;  4LLC A;  3W2V A;  2CG3 A;  4ABN A;  2V4L A;  4YT4 A;  1EYH A;  2WPV A;  5HSW A;  3ENE A;  3MKQ B;  1S7Z A;  3LKU A;  1ZHT A;  1KU2 A;  4O79 A;  2ZXP A;  3N2Z B;  3LJB A;  1M56 C;  1TKN A;  3CVX A;  3PUJ A;  2UY1 B;  4LCT A;  4E85 A;  3UT8 A;  2NUT A;  3FVY A;  3DPD A;  1PD0 A;  2JD3 A;  2M63 A;  3HIZ A;  1HF8 A;  2V26 A;  2A68 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...