4IRUA

Crystal structure of lepb gap core in a transition state mimetic complex with rab1a and alf3
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
296
structure length
296
Chain Sequence
b'SLKPLTLLMTSSTSFSETINQWADILKTTDMEKFSFDSNPINLLELVKQFNLYVDELAITCEANNVWAKERIDSTPNLFALYDNSGGEAIHGHAFVPYYKESIVLRRLFTVDPNTFNLSRFAAFEGPCQLYCKEHKDSAWVKIQTLLTLGNGIINTLKIIKQAQAFGIDEAVTENLKALKEQFIAFQLAEADIKESLKAPSFAEPLPNKESEFFYPIDEKALAKMNGYQLATICLEELNSPKPSPLIERILSNKKFWKRINSAFESGVFKGRTDDPAGKIAKIREWHQLLQISGKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LepB
publication title The Legionella pneumophila GTPase Activating Protein LepB Accelerates Rab1 Deactivation by a Non-canonical Hydrolytic Mechanism.
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase/hydrolase
total genus 109
structure length 296
sequence length 296
chains with identical sequence C, E
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2013-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18172 LepB_GAP_N LepB GAP domain N-terminal subdomain
A PF18227 LepB_GAP_C LepB GAP domain C-terminal subdomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1700 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4iruA01
1.25.40.830 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4iruA02
4JW1A 4I1OB 4JVSA 4I1MA 4IRUA
chains in the Genus database with same CATH superfamily
3E33A 3ZTZA 1HX8A 1KNYA 2AVKA 2VB6A 3LJNA 1SZAA 1FMVA 4UWGA 3M15A 3TWQA 3PZ4A 4EBAG 3K66A 2WXJA 2XLDA 2V5FA 1AUEA 1ELKA 4EECA 1TYQG 1LM3B 3APDA 4GAAA 4PFOA 3DE9A 3BRJA 5E33A 1BPOA 5D0QD 3V30A 1IXVA 1B68A 3R7QA 2YLGA 2ZIRA 5KYYB 4GTTA 3ECSA 4NACA 2WQ6A 2XEVA 3LLIA 4L2LA 1IZMA 3GORA 1T6IA 4MVSA 4ULVA 5KJMA 1L5JA 5CIVA 3FDHA 2GRQB 3N0TA 4Z9HA 2A4ZA 4WUYA 3ONLA 5CRUA 5DS4A 3DPDA 5T4YA 4JJFA 4CIHA 4U04A 4DRXE 4XIFA 2PX3A 3MKQB 2E0IA 2XZTG 2DZOA 2A69F 5BV1A 3EJNA 2PM7A 2XL4A 1HG5A 3IEEA 4W9RA 4O1OA 2YLIA 2XL8A 3P2BA 4F3VA 3HRAA 1BBHA 2YVKA 3HDXA 4YT5A 5CHEE 1QQ3A 1AVOB 3IQ6A 4NIKA 2ZPAA 3QVZA 3SXZA 2RKKA 3HXDA 3KYIA 3UQ3A 3JQ0A 4DVZA 2PNNA 2V0PA 5G05J 4HLEA 1H2VC 3RVYA 5COMA 4DX6D 4GA0A 2P6VA 5ITZF 4E18A 3FUKA 4ZLDA 3EU9A 3J5QB 4JE9A 3LEVA 4DXWA 1HH8A 2GRPB 4C0MA 1ZBPA 1E7VA 5JLIA 4XPXA 3C8ZA 4O6YA 4CDVA 3PE4A 1LE2A 1E85A 1PCXA 3UM2A 1JCRA 1D0ZA 3SFZA 3U9WA 4WNFA 4G25A 5A6KA 4C7OB 5ENRD 2I15A 3G2TA 4XPWA 5KYWA 2ETAA 1HY5A 1U0BB 5HQ8A 4G78A 3FOPA 1LIHA 5L3QA 1TN7A 1VK5A 2BKKB 2BL2A 3M1CB 4CDAA 3L6AA 4FX5A 4HFFB 5FZQA 2VYIA 5A6JA 3L8IA 2KYHA 3QZCA 3TJ6A 3B7RL 4HORA 3NKDA 3QAQA 2L6HA 1H6KA 4A63B 2QY9A 4K0DA 2IY0C 5E2QA 3V5YA 1SA5A 5BXOA 1G8XA 5CI8A 3K9IA 3PE3A 3IQ5A 2NXPA 4J7TA 5JT4A 2H7VC 3JYHA 4AL1A 3UM1A 4BX9A 3IHUA 4AX2A 5AJLA 1IQRA 1HZ4A 1TWAA 2GAQA 3GZ1A 3V2OA 2XS1A 3E32A 5ENPD 2ZXPA 2WXRA 3D9KA 5D92A 1OR2A 2GDCA 256BA 2X51A 3AGUA 3DAGA 1D0YA 3JYYA 3MYFA 2KC3A 3CK9A 3PUKA 2VC9A 3O48A 4OIOF 3M4BA 4DK5A 1JR8A 3JTLO 3KD7A 2WXMA 4AV7A 3DI5A 1IKND 3TWXA 2H7BA 2V4LA 3DJNB 1E83A 3FTUA 4NRHB 4U5DE 4OD5A 3DE8A 2WXGA 3GANA 2KATA 4GPMA 2XLEA 2WXNA 3S84A 3D9JA 3B7SA 2DGJA 2HUJA 1N0RA 5LP0A 2R7RA 2YL7A 1D1AA 2BE5F 4A3VA 2E2EA 4WGZA 4JPSA 3K33A 3KKBA 1MQVA 4MS2A 2H6FA 2NC9A 3NOGD 3DSWA 4B8CB 1XGWA 3JSZA 3AGTA 3PEVB 3S2AA 3T8KA 5DQZA 4KVOA 2XPYA 5FZRA 1UJJA 1PD0A 4ILGA 2F22A 1E2XA 5EYLA 4XI9A 3TD7A 1ZHZA 4DRJB 2DYSE 4DX7D 2VCAA 1FAPB 3NZSA 3DEOA 4GZDA 2IXPA 1Q0FA 2OJED 3P1UA 1ZHYA 1LD7A 2FGYA 1HMOA 3UMKA 3G4ZA 2R25A 4O6NA 5KYWB 2Q9AA 3LESA 4U5HA 2XLVA 3DD7A 2LSVA 4PJMA 3TQOA 5EILA 4C3DA 1N94A 4M3OA 1BZ4A 3BEEA 3HXEA 3NAWA 1RCPA 1T5OA 1CGME 2XLWA 2A5EA 4DPRA 3MYVA 3TWTA 3G50A 4LLCA 1TQGA 2FI7A 4IRUA 2OOEA 1VYIA 5T1DB 3ASFA 4G23A 5AAOA 4O60A 3CLJA 2Q00A 3FTZA 1MX2A 2MRIA 3UKRG 3RAUA 2WB2A 1YA0A 4BJ6C 2ZXOA 4MQ9F 3C18A 3V7OA 1BI8B 1RJ9A 3SNXA 4HFGA 4N3AA 3NMJA 1OCOE 5JP7A 1WASA 1QZXA 4J7YA 2XZDG 4MKTA 3SFXA 4PFPA 2XRYA 5JVEA 3FP3A 3TXMA 5AIJA 4PS8A 4CBEA 1L7CA 4U9DA 4E17A 3UUXA 1FFTC 1WGWA 4L1BA 1Q0GA 3FUJA 1HW1A 4JHJA 1CPQA 1TEZA 3D9PA 4I3MA 1OWMA 3KSLA 2YQYA 3BU8A 3Q6NA 2V5QC 1Y6DA 1E90A 1K3ZD 2YL0A 3ESKA 3EH1A 3TULA 4EZLA 2CNWD 5A23A 3GEIA 1YA7O 3RH3A 2Q7FA 3SQVA 3ZDLA 3UXGA 4LNUD 5BQHA 3EHQA 4BTBA 2I6HA 1M6TA 2ASRA 5AQBA 1L3PA 4KNVA 2VJ8A 4KT6B 3FU3A 3MZLB 1MHQA 2J9QA 2PBEA 2FEZA 3ASDA 4AP2A 4LSZE 2LUHA 4XEIG 2VASA 3LLKA 2R17C 4GQHA 2NUPA 2J09A 2HO1A 4FLHA 5BXUA 1NU9C 3EH2A 2PZIA 2GW1A 3MBGA 2BTDA 5G55A 3EG9A 3D9MA 3C3RA 3FTVA 2C03A 2X6IA 4ABNA 1WDYA 2WQ7A 2ZISA 3Q9UC 4XLPF 5DS6A 3DSXA 4HNAD 4MW8A 3ZTMA 3WXXA 5JMND 3RYLA 2HJ3A 2L6BA 4HS2A 3ZQVA 1A41A 3SF4A 5M72A 2GRRB 2VSXE 5KYNA 3AQCA 3K1IC 3VAYA 2Y4UA 4BJ5C 4ILIA 3B0PA 2JX0A 1OY3D 4JVSA 3TWWA 4WABA 2EIME 2J4DA 3HIZA 3U3WA 2AXZA 2ONDA 4C3BA 5KYXA 5JRAA 3FDQA 3IEGA 2CGEA 1UW4B 3HXCA 2J9WA 1AWCB 2AXVA 4CT4A 4GPKA 3SXKA 2UY1B 1ZHWA 4BY6A 3HVEB 3TWSA 1RJ9B 3JQ1A 4ANWA 4ANUA 3U8PA 4ATGA 2FO7A 2W4BA 3TWRA 3TWUA 4OIPF 4IWBA 3ZN3A 1YLMA 5J08A 5A6AA 4BPMA 3QWPA 4TUUA 5AJDA 5ANLA 4N3BA 4U8YD 1UG7A 3L8JA 1SZ9A 4YVOA 2EILC 2CFUA 3FMSA 3AS5A 2DYSC 3B0UX 1JCSA 3L0IA 3HKKA 5FZTA 1RZ4A 2VSNA 3CV0A 4MVUA 1OWLA 2R9RB 3Q78A 4IGGA 4RBNA 5A69A 4OVVA 2WXLA 2CNWA 3SXYA 4DLOA 4ZLCA 2KW3C 5DQTA 3SBSA 5EHHA 5G04C 2PX0A 2GGFA 5AQAA 3WHNA 2YINA 2NPUA 2UUHA 4YT4A 2I2OA 3U2LA 3IV0A 3ABLE 3UTMA 4XQ1A 1SA4A 4AXHA 4AVXA 4L7TA 3B7BA 2IQCA 3CSTA 1I5NA 2Y3AA 3HTKC 3RF3A 2Q9BA 5B3SC 2OJQA 1NBBA 3HLZA 4I1AA 2RG8A 3UPVA 4XPYA 3LEOA 1FNTc 4NCQA 2LNIA 1OCOC 2NUPB 2DIWA 4AOFA 2XL6A 4NTBA 2WMNA 1KT0A 3CEQA 3HYMB 2HKVA 3EG9B 3C3QA 4G7HF 5LCWC 4BESA 3TWVA 3UNGC 3CQZA 2V8SE 4DX1A 2FAPB 1H0AA 1DC2A 4U9EA 3OXGA 5FZSA 3QW1A 1HE9A 1N0QA 4NURA 1DOWA 1R4TA 2LSUA 3TK0A 2Y0BG 2MWQA 3O39A 1SQMA 4H54A 1MMGA 1N4RA 3BEHA 3RQFA 3RRNB 3FUNA 5KYXB 5FQ4A 1FCHA 3SNHA 1D8EA 3UT8A 4EWCA 1GQAA 3JUIA 4Q69A 2ETBA 1ZVZA 1SF8A 2DBAA 3ULYA 2DVWA 3RIPA 3SGHA 3CQCB 3B71A 1NSGB 3RSEG 4JCHA 3UM3A 5ENNA 4GYWA 5D2MC 4NQ0A 2IXOA 4D4XA 3F6QA 2G3KA 4TRQA 2HZ8A 4U5GA 3KYJA 3H2UA 2ICWG 1YZAA 4I1OB 4F1SA 2RFAA 2YZSA 1ZHXA 4XX5A 4GA2A 4UDVA 4U8VD 2VH3A 3EDTB 4NY3A 3KMIA 2XCBA 2MHKA 1ZYRF 2Y3DA 3A11A 5D66A 4AIFA 2HV6A 4ME2A 2O9XA 3U4TA 1JPLA 3ZUVB 2LSEA 1I4ZA 5F5FA 3I4GA 2DI3A 1Q0KA 5HI7A 2EIMC 1HXIA 3L17A 2D5RB 5K0IA 4KI2A 2F0YA 1C02A 4I2ZA 2B0HA 2L9JA 3JXJA 3VLEA 5AENA 5FIOA 1LS1A 4K03A 4KMOA 4HRNA 5D0OD 3Q4AB 1CPRA 4FC8A 3VYWA 5FQ7A 3UX4A 1YA9A 4ZFHA 2KC7A 4UWKA 3CHSA 1JRAA 4ACLA 4GZCA 2I8BA 4JEHA 3CKCA 3OXFA 1H6GA 4E0HA 2YHEA 1ORJA 2J0XA 2LCHA 3BG1B 1N1CA 4UWLA 1H9GA 3MX3A 1NFIE 4APOA 1M56C 3PS6A 2HFIA 1K8KG 3SYNA 2GROB 2HJMA 3JRMO 2WXKA 4AL0A 2NSZA 3GM2A 5FQ6A 1YVIA 2CHXA 4W8KA 1IHBA 4HI9A 4U5FE 4Y6WA 2OOCA 3QJZA 2J9UA 4J8FA 2VCBA 4Z9IA 1MYOA 1QYMA 5DIZA 4AK9A 4YL1A 1WWPA 1S64A 4BJ1A 4FHJA 1UN8A 3ABLC 3TG5A 1NL4A 3OA1A 3UKUG 1EA8A 3FTXA 2DWZA 4NC3A 5C2YA 3AG4E 2RSEB 3FHDA 3UIOC 3D9OA 5JA4D 3FU5A 1X81A 3ZFWA 3LJ3A 2QUPA 5FJYA 4CSAC 1NFOA 3I5QA 3JZ0A 2XPIA 1J8YF 1KT1A 3CVWA 1W3BA 4GZ5A 3KL4A 4JRZA 1VYKA 4GU5A 4XKBA 2EIKE 2HR2A 3W2WA 2OKUA 2X3MA 3HXBA 3RFYA 2Y39A 1H6OA 3ASNC 3LDZA 1EPUA 1MMDA 3NG1A 3RRUA 4K5BA 3AU4A 4MW3A 4ANXA 3ZW3A 3CHPA 2XXAA 4A2NB 3R9MA 2AWYA 1TNBA 2OV8A 3E34A 3EHNA 3ZGQA 1OCRC 5AC5A 5H7PA 1U89A 5B1AE 4FJZA 4U95D 5CECB 3GEEA 2PNOA 2LFFA 4MNDA 1BU9A 4QI2A 1B89A 2P9LG 4WWOA 3S90A 5JHAA 2R7UA 4HFKB 1INZA 5BT1A 4CRWA 2XM4A 3DM5A 3QTHA 3CSFA 3FHEA 4UUCA 3TOMA 3SY2A 2OQMA 2XCCA 2QE9A 3JRTA 2R7SA 3U9JA 4DI4A 1C03A 3CVQA 1TWHA 4ULWA 3UGOA 3G2VA 2WVQA 3AG2E 3ULEG 4CDYA 1E7UA 1APCA 4G0HA 3C98A 2IXNA 3MEKA 2J08A 3FTWA 5JHBA 3ZXPA 4BETA 2EIJE 4RD9A 2GRNB 3AAAC 1XWJA 4U5CE 2WVOA 4LCTA 4N06A 2R7QA 4CIPA 2PQRA 1KPSB 2YHSA 2KBXA 2WPVA 1FT2A 3CK8A 4AY5A 3W9GA 2R7TA 4TXPA 4K5AB 4B89A 1DCEA 2ETSA 3ZIBA 4G2VA 3L34A 2PF4E 4JTAB 1T6UA 4O7GA 2ETCA 3EU5A 4W8PA 4DI3A 3SHFA 5LX8A 2IO3C 2KSFA 1ZU2A 2JABA 2PM6A 3L08A 2XLMA 3ONKA 3T6GB 3W2VA 2X6KA 1FTSA 3ASOE 3ENEA 4RQIA 4R32A 4B94A 1N95A 3PNLB 4ANVA 2GWWA 2NYJA 1TN6A 2R7OA 4F1PA 2YLDA 5AQ9A 3G2UA 1D0XA 4J0UA 3T5VA 3DSUA 3ABKE 4YL3A 3UM0A 1N52A 3O55A 4AM9A 2VSYA 4CYMD 2IOQA 2P9SG 4KBQA 2R05A 4G26A 3IQCA 5CBOA 3FUFA 2CYDA 3ZU7B 3UR3C 2OEVA 3L82A 4XTKA 3QARA 2KCVA 4LRZA 2NSFA 1TJCA 3PUJA 1WATA 2XXAB 2L6FA 4DOZA 1S63A 4JZYA 2XEEA 3TJPA 2HYZA 3FU0A 3CVUA 3OAWA 1MJ0A 5ENQD 1O87A 4FWVA 3DKAA 4I17A 2UWJG 3S0XA 1AEPA 2IOLA 3JXIA 3MLGA 1N4SA 4OIRF 3F47A 4PH4B 2YHCA 2P58C 3T9OA 2AW6A 2J0WA 4MTGA 5EKQD 2H6GA 3HHMA 3AG4C 1G3NB 1V54E 2CW0F 2AP3A 2QZAA 2XRHA 4U0SA 1QKRA 2OCCE 1E86A 4KBLA 3B7UX 4AE4A 1NP7A 1QBQA 4Q4ZF 5DVWA 2LP4A 4HRMB 3V5ZA 1RXQA 4FP7A 2OU6A 5HRYA 4DLQA 2EIKC 1TNOA 3U3FA 4I6EA 3KSQA 1T6QA 3E30A 4Z68A 2J7PD 5L0GA 5EN5D 1XZPA 3DXKG 2EPOA 3N24A 4PS3A 3UMVA 3CEXA 3R7CA 3HXFA 3EZHA 4MLPA 1R5ID 3UT7A 3QDNA 3G4XA 5KBAA 3QB2A 1NG1A 2VGEA 3FH8A 1G4US 2LO6A 2XRZA 2XLHA 4M63A 5CERB 1PC2A 4GMRA 4D4NA 4JC8A 3ABME 4ER9A 2MOWA 3BQOA 4NTFA 4URKA 2UY1A 3PVLA 1K05A 4A1SA 1SMYF 3HVEA 4E6HA 5AGFA 3PDMP 4Q7CA 3LUTB 4I43A 2HSQA 2RD0A 3LS8A 4QFVA 3DSTA 1J8MF 1V4AA 2Y1LE 3AG2C 3ZIMA 4JD2G 4KVMA 1E8WA 1HO8A 4YWQA 4GTMA 1TN8A 4GTRA 1NZEA 4ATZD 4JXTA 2V26A 2EIJC 1JOGA 2M63A 1EDUA 3ZEFA 4C0EA 5FQ8A 3C8GD 2Q9CA 3CAXA 1MZCA 2PL2A 3MCXA 4GYYA 2JD3A 1H6PA 1QSPA 4JTDB 3BUAA 4GCOA 2GFHA 2QNLA 2FBNA 2XPZA 4L23A 4DBRA 2XSEA 4I6JA 3EGXA 2DYRE 4HQDA 5A6CA 1JMWA 1YDIA 1MQSA 4EBAA 2OVFA 4BT9A 1VLSA 1IHGA 1KZOA 1LVKA 1IQUA 1BR2A 3UGPA 1HG2A 2WZGA 2NG1A 3NYMA 5EIDA 2WZLA 3M4CA 3VTXA 3L13A 3FAPB 1Q2ZA 4TXQA 4LNBA 1U6HA 3LJBA 4UQYA 3ASOC 4PR9A 3PH0C 3DSVA 1FR0A 1U3CA 3LKUA 3EQLF 4UQZA 2G3VA 2V4HC 2ZGDA 3ZNGA 1OXBA 2I1KA 1GGQA 1TNUA 2NSGA 1TFKB 5L0IA 4EZKA 1TWCA 1M57C 4AE4B 2J8SD 4I1MA 1NU7D 4HOTA 3ABKC 3U9MA 2AWIA 5AARA 5EGYA 4U8HA 4F4BA 1TKNA 4A3TA 2AU5A 4DRIB 2C0MA 2J7PA 3GM3A 4JW1A 4JZAA 2XGSA 4GA1A 2HMQA 4HEAJ 1FVHA 4EHPA 3JSEO 3B13A 4CS8A 3ATPA 3T6BA 3RQEA 1UFBA 3PZDA 4Q94A 3GODA 4HXIA 3AG1E 1YJGA 3SO8A 3S7FA 1ZHTA 1VMAA 3ZKJA 4A4AA 2G62A 3LAYA 2XM0A 3KPHA 1E84A 1HFAA 3NQPA 2AXUA 4G7OF 1WOLA 2LAHA 4PK4A 4HOUA 1MX4A 1W2WA 4CCAA 5L0HA 4LEUA 4FESA 2QYJA 1V54C 1PAQA 1HS6A 1LTXA 3FH5A 4FJYA 3MV2B 2OCCC 1H9TA 3EHRA 3JUEA 5ANRA 2IJGX 2VTBA 1NI1A 4GTVA 3UIPC 1JAFA 3GW4A 1S70B 4HVBA 3C62A 4JIOA 2B6CA 3ZQYA 5T8IA 2B0JA 1ZU5A 4OIQF 1OW6A 3I4RB 3C8GA 3EIJA 1U3DA 1Z6AA 4P9TA 1TFOB 3CVLA 3DSSA 1YAUO 2OEWA 3T8MA 1IYGA 4CT0A 2KCLA 3O4ZA 2Q7RA 5ENOD 5BNWA 3EGXB 1OCZE 3TJ5A 3ZYLA 3Q7LA 4NTAA 2B0OE 3QOUA 3B0VC 1S0PA 1HMDA 3J5PA 2ILRA 1GW6A 3FXHA 3RIBA 1T9KA 2LXLA 4ACKA 2LK4A 3MFNA 5AC4A 3R2PA 4PJLA 4CJGA 2R03A 2DB4A 3LS1A 3CHMA 5T3WA 3CHRA 1NA0A 1QLEC 1ZW2A 3PMRA 5EX3A 4I9EA 1SR2A 1GM5A 1PD1A 1ZU4A 5FWQA 2P61A 2KXPC 1H7IA 1S05A 3T6JA 1N11A 3O10A 1OWOA 2R2LA 3W9FA 3AG3E 2YEVA 2ZGGA 2Y3GA 4BEJA 3RW0A 4O1PA 3CSKA 3FWVA 3CVXA 3C63A 4OD4A 3GWNA 4EQFA 5EIBE 1O5HA 3C7JA 1ELWA 2DZNA 4G1TA 3B29A 2OVBA 3UMIA 2F8YA 4BTAA 1Z3IX 2LQGA 5CRVA 3NMIA 1YYJA 5F28E 4RVBA 4MVRA 4G8KA 3RKOF 1XNFA 5EYPF 4MVQA 5JS5A 4AEZC 3US6A 5AYWD 3I5PA 3K7DA 4H4KC 1Y6IA 2IYLD 2XGOA 5CBNA 1Y4CA 2YQ8A 4DJAA 4G8LA 4OYSA 2GRLA 4U5BE 1E96B 4B8AA 1OQCA 3ZVRA 3X2QE 2J45A 2BEDA 2H8AA 5A6BD 1OXJA 3URZA 1ZB1A 3ZWIA 1A7EA 4F7AA 1ST6A 3CVVA 3VF0A 1HF8A 2WVIA 1SYQA 2VTBB 4PUCA 3U64A 4QDLA 3L9TA 4A1GA 3APFA 1JPJA 1TWGA 3MGBA 3ASGA 4YT2A 3U0CA 4YDEA 3RU0A 2IONA 4K7BA 3C8GB 1M2VA 3GYZA 4KZ0A 4EPZA 5GPGB 3EFOA 1PY1A 2EPMX 3PDNA 3R7RA 2FULA 1CGNA 3KH2A 3VLDA 4G24A 4PJJA 4C48B 3SZ7A 1UN9A 2P9UG 3IQTA 3I4UA 3L1MA 4KZCA 2W9YA 3KS2A 4RLYA 3AG1C 3NDBB 2RFMA 1WN0A 2H7OA 3W4YA 1TJFA 4UI9J 1ZW3A 4J8DA 1HW2A 2J9BA 3SEOA 1YCSB 1O1TA 3E70C 2E87A 2EQXA 1Z5ZA 4WGYA 2KNHA 3AU5A 3IHYA 4GCNA 2X6JA 1LI5A 5BUZA 1V55E 1H2UA 4JL0A 3ZYKA 1NFNA 2P9IG 3JCUQ 3PCVA 3U3BA 4RSYA 3ISMC 4BJ5A 4J8YA 3FAJA 4I9CA 3N71A 4X8QA 3MV3B 4YDWA 4HBDA 3E37A 4AJWA 1Q0MA 3QK0A 3AJMA 2ZU6B 3PHF2 4FLBA 1YYXA 2LIGA 4KXKB 3ZC4A 1PV3A 4J30B 4CGVA 3DZAA 1FT1A 3FUMA 4P9FA 2X6FA 2W45A 2VGXA 3DJUB 3CHOA 4OAVB 2A6EF 1MMAA 2XHEA 1VLTA 1OCZC 4C3EA 1A5EA 2HS5A 1OUVA 3JT1A 4YJWA 2HMZA 2BKGA 2IF4A 3N2ZB 4EHMA 3DWWA 2PP4A 3NBNB 4ONSA 1QVXA 1JWGA 1P5QA 1Z5SC 2XLOA 1VDYA 3TL5A 3U8VA 5L3VA 2I1JA 3OWTA 1BDJB 3MYIA 4MVOA 2WQHA 2Y69E 1H19A 3LVRE 2LAIA 3Q79A 4YVQC 4DJ9A 5CMYA 3S29A 3Q7GA 2IOSA 3I3NA 1EQ1A 5FTPA 1A7VA 4FULA 5G05C 3SD5A 4K5CA 1EYHA 2A1DD 1TR2A 4JC7A 4FADA 4JURI 1M2VB 2PQNA 2IBFA 3EFOB 4IULA 3AG3C 2R5SA 3WG7E 1VTMP 4UWFA 2NUTA 1ZZPA 1Q0DA 3SI5A 4CX9A 3QWVA 3TOLA 5BPPA 4P29A 1OKKD 3RK6A 3L54A 5LFAA 4I44A 4IAQA 3DWLG 3T4RA 3J06A 4U96D 4XWJA 3ULQA 1G4WR 1NZNA 4EZJA 4GZ3A 3U66A 3SP1A 3IHVA 2C0LA 2L0IA 4DX5D 4YT8A 4N2QA 2MYSA 4GTPA 3T5XA 1D8DA 4J7WA 4JEAA 2M64A 1BI7B 1EI7A 1KLXA 3TAXA 4RDAA 1GS9A 3PEUB 2LXMA 3C5RA 2R7VA 1HE8A 3O6XA 2IFUA 3KEZA 5DLJA 3X2QC 1FFHA 3NRHA 3CVNA 2C2LA 1JWFA 1JUQA 2QYUA 1K1BA 4ANJA 1XZQA 3V5XA 4HE8D 1QZ2A 3FU6A 2A5UA 4O6FA 2RD9A 5B3IA 3LVQE 3DAFA 3EZIA 4JCZA 4OINF 4BEPA 4TUMA 3AS4A 4JHRA 2H6IA 4N5QA 4CS9A 3RO3A 3GWLA 3ASHA 2ZXRA 2WXOA 3ZG1A 2VGXB 3FUHA 3B95A 3FUIA 4XEFA 4G7ZF 4U07A 2A68F 4CDNA 4OVUA 4B0ZA 4KNWA 2P1AA 1D9SA 1Z63A 2HE0A 5EK0A 2J9VA 4JKVA 1M2OA 4K1OA 3CR3A 3L22A 4JTCB 4GMJA 4E7ZA 1WG0A 3CKBA 4RG6A 3QNKA 2OG2A 3G2SA 4PS7A 3HNLA 2WMOA 5CEDB 3QWWA 1ORYA 4LNGA 3Q6MA 2KGOA 3GZ2A 2XQ0A 4IN3B 1UOHA 5F5HA 2WVNA 1YMPA 2EINE 1V55C 4B93B 4MVZA 4R7LA 4PDXA 5FINA 3ZHEA 3LY7A 3PZ3A 3LNRA 2R7XA 4LDKA 1WY6A 3QKYA 2TMVP 5ENSD 2GA0A 2YKZA 5L0FA 5BQIA 1OWPA 2L6JA 4CZ2D 3ML8A 4UQXA 4D10C 1DOVA 2NUTB 4H7XA 4CJOA 1YYHA 2W4MA 4DUIA 1OKKA 3DXJF 4CS8C 2EPKX 3D3MA 3QW0A 2WXIA 5ENTD 4IYPA 2MHRA 3RQGA 2L9BA 3Q49B 1NA3A 2AJAA 2QC9A 4V3IA 4UWHA 4WAFA 3H2VA 3LEWA 4BG0A 2VCCA 3D9LA 1O5MA 1T01A 4FA6A 4XE0A 4HI8A 4MBGA 4EUKB 3QC1A 4DBQA 2L6GA 1OCCE 1EF1C 1LI7A 2X6HA 1LS4A 1TNYA 1SVXA 3DRAA 5KJKA 1KTMA 2Y69C 1MNEA 5LOZA 1NLXA 2CFZA 4FAPB 1LKXA 1VOMA 4ZHBA 1LF8A 2DCPA 2P9KG 1A17A 1F1MA 4BX8A 2YL1A 5B1BE 3FUEA 1DVPA 3IKOB 2FFHA 2VGYA 3NB2A 3EGDA 2YNQA 2VSOE 3FTSA 5KNHD 2A0BA 1S7ZA 1TNZA 1V74B 2JEKA 2XGMA 3WG7C 3T9KA 3FUDA 1I4YA 3ZPJA 4O79A 4G11A 1OWNA 4XEKA 3K6BA 3KEAA 2EILE 1N9AA 1E8YA 4GTOA 4CS7A 3CQGB 4APFA 2L7AA 4CSAA 3WAQA 3SBTB 4GYOA 4GTSA 5JJ6A 1OT8A 1JPNA 3JYSA 5B1AC 4XI0A 4MRUA 3AQBA 3MJWA 4YDOA 3Q15A 4LDRA 1A0BA 2IU1A 5ARGA 1SZIA 4KYOB 3IBEA 3LCAA 1YZCA 4BERA 4GYTA 4E85A 5KWDA 3M79A 4Q96A 2H6HA 2P9PG 4FHKA 1QPUA 4U0UA 1UJKA 3V31A 3ZHEB 4MTOA 1HU3A 2EPLX 2J8WA 4WNGA 3AJIA 2XS8A 3D9HA 5CMWA 1K04A 3VM6A 4MVMA 4BSZB 4L2YA 1JCQA 3TGOA 3X1OA 3Q73A 5BV0A 3NKEA 3SFYA 1LE4A 3BG0B 3SZRA 4XZ4A 5B3SE 4JJGA 5HV9A 1QNFA 3RO2A 1RW2A 3IXEA 2CG2A 2UUIA 2EPNA 2Y3BA 3IPMO 2CCYA 3FH7A 1D1CA 4N3CA 1ELRA 2VQ2A 4O6MA 1DCQA 5C1DA 1U2VG 3EPVA 3EIQC 4E7SA 4M7CA 2WXFA 3C3OA 3NOCD 3HNKA 3FULA 4A55A 2WB7A 4L9PA 4I2WA 3PREA 2XEHA 4YK5A 3CGHA 1A7DA 2ZD9A 1OXKA 2EINC 1N54A 4JEUA 4J32B 4E0IA 2LD6A 2GRMA 3Q75A 4LUNU 3NYLA 1EKYA 1KZPA 3CK7A 3DM9B 3LPZA 3DEPA 3PZ2A 3LY8A 3EGDB 3W8IA 1G5ZA 5KJLA 2HSBA 2AWCA 5HKPA 2IEJA 2P9NG 5COFA 2KM4A 5E76A 1RMVA 4EKWA 4F6RD 3Q7AA 5T3TA 5IY5E 4UI9K 3HNJA 3LYAA 2Q4FA 2J46A 3FFLA 3R9AB 3OTNA 2PFDA 4FU3A 3ZYQA 4Q5SF 3S7BA 3ZXSA 2AVPA 1TR4A 4GZ6A 2QLAA 4J8EA 1O1RA 5EX0A 3UMHA 3V79K 4RG9A 1BR4A 3H65A 4J6IA 1OCCC 2Y3HA 3LY9A 1RKEA 3VLFA 3CVYA 1WM5A 1RKCA 3GM1A 4CEMA 3W8HA 2KJGA 2R02A 3LXUX 4U7EB 3PZ1A 1VB5A 1CGOA 4DVYP 5KJNA 1Z7Qc 2MYOA 3AOUA 5HS0A 1FMWA 5DS5A 3HJCA 1MX6A 3G2WA 5B1BC 4IAOA 5T3RA 3DXMG 3A9CA 2J4BA 2P2CP 3S7DA 3CZ6A 3SXMA 2A0UA 2CDQA 3ITFA 2ZXWE 3RJVA 2HV7A 4P6IC 2X0CA 3LNMB 4N39A 3B9QA 5FT9A 3Q5MA 5CCMA 5KYUA 2WXPA 2L0TB 3PNTB 1O3UA 3Q47B 5JUAA 4DRHB 1BR1A 4JEBA 2C04A 4WNEA 2WL8A 4KC9A 3RVZA 4L6RA 2R7WA 4MS6A 1IW7F 2OEXA 5D91A 5E3CA 2LFDA 4WWNA 1Z3XA 2JPUA 5JSLA 4GB9A 3ABMC 3NF1A 4PACA 4XLNF 5DBKA 1Y8MA 2L81A 3CHQA 4F53A 5CCLA 5CI9A 3U5SA 5AN8A 4EBKA 1N4PA 4J8SA 3FEXA 3RKVA 4IJJA 5A7DB 4WWPA 2CHWA 4YNDA 1LD8A 4DX2A 3WODF 5BW8C 2I9CA 3Q7FA 4HOSA 4BJ6A 1ORSC 2HM8A 5BUOA 5L0CA 1SW6A 4HOQA 3EHMA 3DPYA 3APCA 3MKRA 3UINC 3ZRHA 4YDYA 4JHKA 1K1AA 2DYRC 2P7VA 4YN0B 2Z15A 4ILHB 1YARO 2D4UA 4CDMA 4BJTA 4N2SA 4GTQA 2Q3TA 3ASNE 1Z23A 4LG6A 4EIYA 3OXLA 4U0ZA 1MMNA 3LS0A 2QTVA 5G04J 3GEHA 1RKEB 2BUGA 4QQIA 3TXNA 4UI9C 3GZSA 4HLLA 3CIAA 1LPEA 5E3AA 3KAEA 4U63A 2BC5A 4JB8P 1OCRE 3FEYA 3OEOA 1E8ZA 2A6HF 3S7JA 2WZFA 2KZTA 3RRMB 4BT8A 2YWAA 5L0DA 1D1BA 2F37A 4WNDA 3S28A 5KCMA 3S9OA 2FF4A 2WXHA 4IARA 3DMDA 3PRZA 1Z6TA 1K40A 5J90A 2J49A 3K1HA 3VRCA 2FO1E 4BFRA 4CS9C 4BSXA 4EBJA 3NMKA 3Q9NC 5IY5C 1AP7A 5LCWJ 2KCKA 3AS8A 5COGA 4LACB 2V3CC 5KYUB 4I6GA 1OW7A 2KQ9A 4HB5A 2IM8A 5KYYA 1O1SA 5EDSA 3QVYA 4EBBA 2QFCA 2JLBA 4HRLA 3JCKC 4IB4A 2XENA 3VTYA 5ARFA 3QMKA 4WJ0A 1BLXB 5JJ7A 4AY6A 1H2TC 4TXRA 4CGWA 3ZVVA 3UI2A 3FOOA 1Z3YA 3POVA 1E8XA 1WAO1 3NYJA 3B7TA 3MA5A 3L16A 4B6IA 2P0NA 3UT4A 3ZSUA 1X5BA 2M4EA 3C72A 3ESLA 3ML9A 4XKCA 1BD8A 3MKQA 3E9VA 3K1IA 4LDQA 4K0RA 3HNIA 4OAUC 3FY4A 4JA7A 4Y6CA 1OR3A 3TG4A 4YL0A 3S27A 4N4WA 2YRFA 3CVPA 4BWRA 5L0JA 3NZUA 2KK1A 1OW8A 3ZYMA 4NQFA 2YL3A 2CHZA 3HG0D 3FVYA 3EUVA 4GEHA 3FTYA 4CDRA 2J07A 5G2NA 5TJ5E 3F46A 5KNGA 2ZXWC 5E75A 1MNDA 1UG3A 4C9BB 2IXMA 1WTYA 3E4BA 3D9IA 2CG3A 1FPPA 3U2MA 4LLEA 2X38A 2R59A 2WM9A 4GMLA 4PJNA 5FCLA 1HE1A 1N4QA 3DBSA 2Y4TA 4N5CA 5BQGA 2WXQA 4MTFA 5AQ7A 4XEVA 4Z9JA 1DNPA 4C7OA 2BF0X 4JA9A 1QQEA 1C17M 5CEAA 2QY7A 4U5EE 2IO2C 5A6BA 5JJTA 4BEMJ 1FVFA 4LERA 4N6CA 4X0RA 2F8XK 1KU2A 3D9NA 2KZTB 5HSWA 4QI0A 4TV3A 4N6HA 3V2XA 4H7YA
chains in the Genus database with same CATH topology
1HX8A 2VB6A 1SZAA 1FMVA 4UWGA 4EBAG 3K66A 2WXJA 2V5FA 1ELKA 4EECA 3APDA 4GAAA 4PFOA 5E33A 1BPOA 5D0QD 3R7QA 5KYYB 3ECSA 4NACA 2WQ6A 2XEVA 3LLIA 4L2LA 1IZMA 5KJMA 1L5JA 3FDHA 3N0TA 2A4ZA 4WUYA 3ONLA 5DS4A 3DPDA 5T4YA 4JJFA 4CIHA 4U04A 4XIFA 2PX3A 3MKQB 2E0IA 2A69F 5BV1A 3EJNA 2PM7A 2XL4A 1HG5A 3IEEA 4W9RA 3P2BA 4F3VA 3HDXA 4YT5A 5CHEE 2ZPAA 3UQ3A 3JQ0A 4DVZA 2V0PA 5G05J 4HLEA 1H2VC 4GA0A 2P6VA 3FUKA 4ZLDA 3LEVA 1HH8A 4C0MA 1ZBPA 1E7VA 4O6YA 3PE4A 1PCXA 3SFZA 1D0ZA 3U9WA 4WNFA 4G25A 4C7OB 3G2TA 5KYWA 5HQ8A 5L3QA 1VK5A 3M1CB 3L6AA 4FX5A 4HFFB 5FZQA 2VYIA 3QZCA 3B7RL 4HORA 3NKDA 3QAQA 1H6KA 2QY9A 4K0DA 5E2QA 1G8XA 5CI8A 3K9IA 3PE3A 2NXPA 2H7VC 3JYHA 4BX9A 4AX2A 5AJLA 1IQRA 1TWAA 1HZ4A 3GZ1A 2ZXPA 2WXRA 3D9KA 5D92A 2X51A 3DAGA 1D0YA 3CK9A 3PUKA 3O48A 4OIOF 4DK5A 3KD7A 2WXMA 4AV7A 2H7BA 2V4LA 3DJNB 3FTUA 4NRHB 4U5DE 4OD5A 2WXGA 3GANA 2KATA 2WXNA 3D9JA 3B7SA 2DGJA 5LP0A 2R7RA 1D1AA 2BE5F 4A3VA 2E2EA 4JPSA 3K33A 3KKBA 2NC9A 4B8CB 1XGWA 3JSZA 3PEVB 3S2AA 5DQZA 4KVOA 2XPYA 5FZRA 1UJJA 1PD0A 4ILGA 4XI9A 3TD7A 1ZHZA 3NZSA 4GZDA 2IXPA 3P1UA 1ZHYA 2FGYA 3UMKA 4O6NA 5KYWB 2Q9AA 3LESA 4U5HA 3DD7A 2LSVA 4PJMA 4C3DA 4M3OA 3BEEA 4DPRA 3MYVA 4LLCA 2FI7A 4IRUA 2OOEA 1VYIA 5T1DB 3ASFA 4G23A 3CLJA 3FTZA 2MRIA 2WB2A 1YA0A 4BJ6C 2ZXOA 4MQ9F 3V7OA 1RJ9A 3SNXA 4HFGA 4N3AA 1QZXA 4MKTA 4PFPA 2XRYA 3FP3A 3TXMA 5AIJA 4PS8A 4CBEA 3UUXA 1FFTC 1WGWA 4L1BA 3FUJA 4JHJA 1TEZA 3D9PA 4I3MA 1OWMA 3Q6NA 1E90A 3ESKA 3EH1A 4EZLA 2CNWD 5A23A 2Q7FA 3RH3A 4BTBA 2I6HA 2VJ8A 4KNVA 4KT6B 3FU3A 3MZLB 1MHQA 2J9QA 2FEZA 3ASDA 4AP2A 2VASA 3LLKA 2R17C 2NUPA 2J09A 2HO1A 4FLHA 1NU9C 3EH2A 2PZIA 2GW1A 2BTDA 5G55A 3EG9A 3D9MA 3FTVA 2C03A 2X6IA 4ABNA 2WQ7A 4XLPF 5DS6A 3WXXA 3RYLA 4HS2A 3SF4A 5M72A 2VSXE 5KYNA 3AQCA 3K1IC 3VAYA 2Y4UA 4BJ5C 4ILIA 3B0PA 4JVSA 2J4DA 3HIZA 3U3WA 2AXZA 2ONDA 4C3BA 5KYXA 3FDQA 3IEGA 2CGEA 1UW4B 2J9WA 2AXVA 4CT4A 4GPKA 2UY1B 1ZHWA 4BY6A 3HVEB 1RJ9B 3JQ1A 4ANWA 4ANUA 4ATGA 2FO7A 2W4BA 3ZN3A 4OIPF 4IWBA 5J08A 4TUUA 3QWPA 5AJDA 5ANLA 4N3BA 1SZ9A 4YVOA 2EILC 2CFUA 3AS5A 2DYSC 3B0UX 3L0IA 2VSNA 3CV0A 1OWLA 4RBNA 4OVVA 2WXLA 2CNWA 4DLOA 4ZLCA 2KW3C 5DQTA 3SBSA 5EHHA 5G04C 2PX0A 2GGFA 2YINA 4YT4A 2I2OA 3IV0A 4AXHA 4AVXA 4L7TA 2IQCA 3CSTA 2Y3AA 3HTKC 2Q9BA 5B3SC 3HLZA 4I1AA 2RG8A 3UPVA 2LNIA 1OCOC 2NUPB 2DIWA 4AOFA 2WMNA 1KT0A 3CEQA 3HYMB 3EG9B 5LCWC 4G7HF 3UNGC 3CQZA 2V8SE 1H0AA 3OXGA 5FZSA 4NURA 2LSUA 2MWQA 3O39A 1SQMA 1MMGA 3RRNB 3FUNA 5KYXB 5FQ4A 1FCHA 3SNHA 3UT8A 4EWCA 3JUIA 4Q69A 1SF8A 2DBAA 3RIPA 3SGHA 3CQCB 4JCHA 5ENNA 4GYWA 4NQ0A 2IXOA 2G3KA 4TRQA 4U5GA 4F1SA 4I1OB 2YZSA 1ZHXA 4XX5A 4GA2A 2VH3A 3EDTB 4NY3A 3KMIA 2XCBA 2MHKA 1ZYRF 2Y3DA 4AIFA 2HV6A 4ME2A 2O9XA 3U4TA 1JPLA 2LSEA 5F5FA 3I4GA 5HI7A 2EIMC 1HXIA 3L17A 2D5RB 4KI2A 4I2ZA 2L9JA 3VLEA 5AENA 1LS1A 4K03A 4KMOA 5D0OD 3Q4AB 4FC8A 3VYWA 5FQ7A 3UX4A 2KC7A 4UWKA 3CHSA 4ACLA 4GZCA 2I8BA 4JEHA 3CKCA 3OXFA 2YHEA 2J0XA 3BG1B 1N1CA 4UWLA 3MX3A 4APOA 1M56C 3PS6A 3SYNA 2WXKA 2NSZA 5FQ6A 2CHXA 4W8KA 4U5FE 4Y6WA 3QJZA 2J9UA 4J8FA 5DIZA 4AK9A 4BJ1A 4FHJA 1UN8A 3ABLC 3TG5A 3OA1A 3FTXA 5C2YA 3FHDA 3D9OA 3FU5A 3ZFWA 3LJ3A 5FJYA 4CSAC 3I5QA 2XPIA 1J8YF 1KT1A 3CVWA 1W3BA 4GZ5A 3KL4A 1VYKA 4GU5A 4XKBA 2HR2A 3W2WA 2X3MA 3RFYA 2Y39A 3ASNC 3LDZA 1EPUA 1MMDA 3NG1A 3RRUA 3AU4A 4ANXA 3ZW3A 3CHPA 2XXAA 4A2NB 2OV8A 3EHNA 3ZGQA 1OCRC 4FJZA 4MNDA 4QI2A 1B89A 4WWOA 5JHAA 2R7UA 4HFKB 1INZA 5BT1A 4CRWA 3DM5A 3CSFA 3FHEA 2XCCA 2R7SA 3JRTA 4DI4A 3CVQA 1TWHA 4ULWA 3UGOA 3G2VA 2WVQA 1E7UA 4G0HA 3C98A 2IXNA 3MEKA 2J08A 3FTWA 5JHBA 4RD9A 4U5CE 2WVOA 4LCTA 4N06A 2R7QA 2PQRA 2YHSA 2WPVA 3CK8A 4AY5A 2R7TA 4B89A 3ZIBA 4G2VA 3L34A 2PF4E 4O7GA 4DI3A 3SHFA 5LX8A 1ZU2A 2PM6A 3L08A 3ONKA 3W2VA 2X6KA 1FTSA 3ENEA 4B94A 3PNLB 4ANVA 2R7OA 3G2UA 1D0XA 4J0UA 3T5VA 1N52A 4AM9A 2VSYA 2IOQA 4KBQA 4G26A 3FUFA 3UR3C 4XTKA 3QARA 2KCVA 4LRZA 1TJCA 3PUJA 2XXAB 4DOZA 4JZYA 3TJPA 2HYZA 3FU0A 3CVUA 3OAWA 1O87A 4FWVA 4I17A 2UWJG 3S0XA 2IOLA 3MLGA 4OIRF 4PH4B 3F47A 2YHCA 2P58C 2AW6A 2J0WA 5EKQD 3HHMA 3AG4C 2CW0F 2XRHA 4U0SA 4KBLA 3B7UX 4AE4A 1NP7A 4Q4ZF 5DVWA 4FP7A 4DLQA 2EIKC 4I6EA 2J7PD 3N24A 4PS3A 3UMVA 3EZHA 4MLPA 3UT7A 3QDNA 3QB2A 1NG1A 3FH8A 2LO6A 2XRZA 4M63A 1PC2A 4JC8A 2MOWA 4URKA 2UY1A 3PVLA 4A1SA 1SMYF 3HVEA 4E6HA 4Q7CA 4I43A 2RD0A 3LS8A 4QFVA 1J8MF 3AG2C 3ZIMA 4KVMA 1E8WA 1HO8A 4YWQA 1NZEA 4JXTA 2V26A 2EIJC 2M63A 1EDUA 3ZEFA 4C0EA 5FQ8A 2Q9CA 2PL2A 3MCXA 4GYYA 2JD3A 4GCOA 2GFHA 2FBNA 2XPZA 4L23A 4DBRA 2XSEA 4I6JA 3EGXA 5A6CA 1MQSA 4EBAA 2OVFA 4BT9A 1IHGA 1LVKA 1IQUA 1BR2A 3UGPA 1HG2A 2WZGA 2NG1A 3NYMA 2WZLA 3VTXA 3L13A 3LJBA 4UQYA 3ASOC 3PH0C 3LKUA 1U3CA 3EQLF 4UQZA 2G3VA 2I1KA 4EZKA 1TWCA 1M57C 4AE4B 4I1MA 1NU7D 4HOTA 3ABKC 2AWIA 5EGYA 4U8HA 4F4BA 1TKNA 4A3TA 2C0MA 2J7PA 4JW1A 4JZAA 2XGSA 4GA1A 4HEAJ 1FVHA 3B13A 4CS8A 3T6BA 3PZDA 4Q94A 3GODA 4HXIA 3S7FA 1ZHTA 1VMAA 2G62A 3LAYA 1HFAA 3NQPA 2AXUA 4G7OF 2LAHA 4PK4A 4HOUA 1W2WA 4CCAA 4LEUA 4FESA 1V54C 1PAQA 1HS6A 3FH5A 4FJYA 3MV2B 2OCCC 5ANRA 2VTBA 2IJGX 3GW4A 4HVBA 5T8IA 2B0JA 1ZU5A 4OIQF 3I4RB 3EIJA 1U3DA 1Z6AA 3CVLA 3T8MA 1IYGA 4CT0A 2KCLA 3O4ZA 5BNWA 3EGXB 3ZYLA 3Q7LA 3QOUA 3B0VC 1S0PA 2ILRA 1GW6A 3RIBA 4ACKA 4PJLA 3LS1A 3CHMA 5T3WA 3CHRA 1NA0A 1QLEC 3PMRA 5EX3A 4I9EA 1PD1A 1ZU4A 5FWQA 3T6JA 1OWOA 2YEVA 2Y3GA 4BEJA 3CSKA 3FWVA 3CVXA 4OD4A 4EQFA 1O5HA 1ELWA 4G1TA 2OVBA 3UMIA 4BTAA 1Z3IX 4RVBA 3RKOF 1XNFA 4AEZC 5AYWD 3I5PA 3K7DA 4H4KC 1Y6IA 2IYLD 2XGOA 2YQ8A 4DJAA 4OYSA 2GRLA 4U5BE 1E96B 4B8AA 3ZVRA 2J45A 3URZA 4F7AA 1ST6A 3CVVA 1HF8A 2WVIA 2VTBB 4PUCA 3U64A 4QDLA 4A1GA 3APFA 1JPJA 1TWGA 3MGBA 3ASGA 4YT2A 3RU0A 2IONA 4K7BA 1M2VA 3GYZA 4KZ0A 4EPZA 3EFOA 1PY1A 3PDNA 3R7RA 2FULA 3KH2A 3VLDA 4G24A 4PJJA 3SZ7A 1UN9A 3I4UA 4KZCA 2W9YA 3KS2A 3AG1C 3NDBB 2H7OA 1TJFA 4UI9J 4J8DA 3SEOA 3E70C 2E87A 2EQXA 1Z5ZA 2KNHA 3AU5A 3IHYA 4GCNA 2X6JA 5BUZA 1H2UA 4JL0A 3ZYKA 3JCUQ 4RSYA 4BJ5A 3FAJA 4I9CA 3N71A 3MV3B 4AJWA 3QK0A 2ZU6B 3PHF2 4FLBA 4KXKB 3ZC4A 4J30B 4CGVA 3DZAA 3FUMA 2X6FA 2W45A 2VGXA 3DJUB 3CHOA 2A6EF 1MMAA 2XHEA 1OCZC 4C3EA 1OUVA 3JT1A 4YJWA 2IF4A 3N2ZB 2PP4A 1JWGA 1P5QA 1VDYA 3TL5A 5L3VA 2I1JA 3OWTA 2WQHA 1H19A 3LVRE 2LAIA 4YVQC 5CMYA 3S29A 3Q7GA 2IOSA 3I3NA 5FTPA 4FULA 5G05C 3SD5A 1EYHA 2A1DD 1TR2A 4FADA 4JURI 1M2VB 2PQNA 3EFOB 4IULA 3AG3C 2R5SA 4UWFA 2NUTA 3SI5A 3QWVA 5BPPA 4P29A 1OKKD 3RK6A 3L54A 5LFAA 4I44A 3T4RA 4XWJA 3ULQA 1NZNA 4EZJA 4GZ3A 3U66A 3SP1A 3IHVA 2C0LA 2L0IA 4YT8A 4N2QA 2MYSA 3T5XA 1KLXA 3TAXA 4RDAA 3PEUB 2R7VA 1HE8A 3O6XA 2IFUA 3KEZA 5DLJA 3X2QC 1FFHA 3NRHA 3CVNA 2C2LA 1JWFA 1JUQA 4ANJA 4HE8D 1QZ2A 3FU6A 2A5UA 4O6FA 3LVQE 3DAFA 3EZIA 4OINF 3AS4A 4JHRA 4CS9A 3RO3A 3ASHA 2ZXRA 2WXOA 3ZG1A 2VGXB 3FUHA 3FUIA 4G7ZF 4U07A 2A68F 4CDNA 4OVUA 4B0ZA 4KNWA 1Z63A 2J9VA 1M2OA 3CR3A 3L22A 4GMJA 4E7ZA 3CKBA 4RG6A 3QNKA 4PS7A 2OG2A 3G2SA 2WMOA 3QWWA 3Q6MA 2KGOA 3GZ2A 2XQ0A 4IN3B 5F5HA 2WVNA 1V55C 4R7LA 4PDXA 3ZHEA 3LY7A 3LNRA 2R7XA 1WY6A 3QKYA 1OWPA 2L6JA 3ML8A 4UQXA 4D10C 2NUTB 4H7XA 2W4MA 1OKKA 3DXJF 4CS8C 3D3MA 2WXIA 4IYPA 2L9BA 3Q49B 1NA3A 4V3IA 4UWHA 4WAFA 3LEWA 4BG0A 3D9LA 4FA6A 4XE0A 3QC1A 4DBQA 1EF1C 2X6HA 5KJKA 2Y69C 1MNEA 5LOZA 2CFZA 1LKXA 1VOMA 1LF8A 2DCPA 1A17A 4BX8A 3FUEA 1DVPA 3IKOB 2FFHA 2VGYA 3EGDA 2YNQA 2VSOE 3FTSA 1S7ZA 2JEKA 2XGMA 3WG7C 3FUDA 3ZPJA 4O79A 4G11A 1OWNA 3K6BA 1E8YA 4CS7A 3CQGB 4APFA 4CSAA 3SBTB 4GYOA 5JJ6A 1JPNA 3JYSA 5B1AC 4XI0A 4MRUA 3AQBA 3MJWA 3Q15A 5ARGA 2IU1A 1SZIA 4KYOB 3IBEA 3LCAA 4GYTA 4E85A 4Q96A 4FHKA 4U0UA 1UJKA 3ZHEB 1HU3A 4WNGA 5CMWA 4L2YA 3TGOA 3X1OA 5BV0A 3NKEA 3BG0B 3SZRA 4XZ4A 4JJGA 1QNFA 3RO2A 2CG2A 2Y3BA 3FH7A 1D1CA 4N3CA 1ELRA 2VQ2A 4O6MA 5C1DA 3EPVA 3EIQC 4E7SA 2WXFA 3FULA 4A55A 2WB7A 4I2WA 3PREA 3CGHA 1N54A 2EINC 4JEUA 4J32B 2GRMA 4LUNU 3NYLA 3CK7A 3DM9B 3LPZA 3LY8A 3EGDB 3W8IA 5KJLA 2KM4A 5E76A 5T3TA 4UI9K 3LYAA 2J46A 3FFLA 3R9AB 3OTNA 2PFDA 4FU3A 3ZYQA 4Q5SF 3S7BA 3ZXSA 2AVPA 4GZ6A 4J8EA 5EX0A 3UMHA 4RG9A 1BR4A 3H65A 4J6IA 1OCCC 2Y3HA 3LY9A 3VLFA 3CVYA 1WM5A 4CEMA 3W8HA 2KJGA 3LXUX 4DVYP 5KJNA 1FMWA 5DS5A 3HJCA 3G2WA 5B1BC 4IAOA 5T3RA 2J4BA 3S7DA 3CZ6A 2CDQA 3ITFA 3RJVA 2HV7A 4P6IC 4N39A 3B9QA 5FT9A 3Q5MA 5CCMA 5KYUA 2WXPA 2L0TB 3PNTB 3Q47B 1BR1A 2C04A 4WNEA 2WL8A 4KC9A 2R7WA 4MS6A 1IW7F 5D91A 5E3CA 4WWNA 1Z3XA 4GB9A 3ABMC 3NF1A 4XLNF 5DBKA 1Y8MA 2L81A 3CHQA 4F53A 5CCLA 5CI9A 4J8SA 3RKVA 3FEXA 4IJJA 5A7DB 4WWPA 2CHWA 4YNDA 3WODF 5BW8C 2I9CA 4HOSA 4BJ6A 2HM8A 5BUOA 4HOQA 3EHMA 3APCA 3MKRA 3ZRHA 4JHKA 2DYRC 2P7VA 4YN0B 2Z15A 4ILHB 4CDMA 4BJTA 4N2SA 2Q3TA 1Z23A 3OXLA 4U0ZA 1MMNA 3LS0A 2QTVA 5G04J 2BUGA 3TXNA 4UI9C 3GZSA 3CIAA 5E3AA 3KAEA 4U63A 3FEYA 3OEOA 1E8ZA 2A6HF 3S7JA 2WZFA 2KZTA 3RRMB 4BT8A 1D1BA 4WNDA 3S28A 5KCMA 2FF4A 2WXHA 3DMDA 3PRZA 1Z6TA 5J90A 2J49A 3K1HA 4BFRA 4CS9C 4BSXA 5IY5C 5LCWJ 2KCKA 3AS8A 4LACB 2V3CC 5KYUB 4I6GA 2KQ9A 5KYYA 5EDSA 4EBBA 2QFCA 2JLBA 3JCKC 3VTYA 5ARFA 3QMKA 4WJ0A 5JJ7A 4AY6A 1H2TC 4CGWA 3ZVVA 1Z3YA 3POVA 1E8XA 1WAO1 3NYJA 3B7TA 3MA5A 3L16A 4B6IA 3UT4A 3ZSUA 1X5BA 2M4EA 3ESLA 3ML9A 4XKCA 3MKQA 3E9VA 4K0RA 3FY4A 4JA7A 4Y6CA 3TG4A 3S27A 3CVPA 4BWRA 3NZUA 3ZYMA 2CHZA 3FVYA 4GEHA 3FTYA 4CDRA 2J07A 5G2NA 3F46A 2ZXWC 5E75A 1MNDA 1UG3A 4C9BB 2IXMA 3E4BA 3D9IA 2CG3A 4LLEA 2X38A 2R59A 2WM9A 4GMLA 4PJNA 5FCLA 3DBSA 2Y4TA 4N5CA 2WXQA 1DNPA 4C7OA 2BF0X 4JA9A 1QQEA 2QY7A 4U5EE 5JJTA 1FVFA 4LERA 4X0RA 1KU2A 3D9NA 2KZTB 5HSWA 4QI0A 4TV3A 4H7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JW1 A;  4I1O B;  4JVS A;  4I1M A;  4IRU A; 
#chains in the Genus database with same CATH topology
 3E33 A;  3ZTZ A;  1HX8 A;  1KNY A;  2AVK A;  2VB6 A;  3LJN A;  1SZA A;  1FMV A;  4UWG A;  3M15 A;  3TWQ A;  3PZ4 A;  4EBA G;  3K66 A;  2WXJ A;  2XLD A;  2V5F A;  1AUE A;  1ELK A;  4EEC A;  1TYQ G;  1LM3 B;  3APD A;  4GAA A;  4PFO A;  3DE9 A;  3BRJ A;  5E33 A;  1BPO A;  5D0Q D;  3V30 A;  1IXV A;  1B68 A;  3R7Q A;  2YLG A;  2ZIR A;  5KYY B;  4GTT A;  3ECS A;  4NAC A;  2WQ6 A;  2XEV A;  3LLI A;  4L2L A;  1IZM A;  3GOR A;  1T6I A;  4MVS A;  4ULV A;  5KJM A;  1L5J A;  5CIV A;  3FDH A;  2GRQ B;  3N0T A;  4Z9H A;  2A4Z A;  4WUY A;  3ONL A;  5CRU A;  5DS4 A;  3DPD A;  5T4Y A;  4JJF A;  4CIH A;  4U04 A;  4DRX E;  4XIF A;  2PX3 A;  3MKQ B;  2E0I A;  2XZT G;  2DZO A;  2A69 F;  5BV1 A;  3EJN A;  2PM7 A;  2XL4 A;  1HG5 A;  3IEE A;  4W9R A;  4O1O A;  2YLI A;  2XL8 A;  3P2B A;  4F3V A;  3HRA A;  1BBH A;  2YVK A;  3HDX A;  4YT5 A;  5CHE E;  1QQ3 A;  1AVO B;  3IQ6 A;  4NIK A;  2ZPA A;  3QVZ A;  3SXZ A;  2RKK A;  3HXD A;  3KYI A;  3UQ3 A;  3JQ0 A;  4DVZ A;  2PNN A;  2V0P A;  5G05 J;  4HLE A;  1H2V C;  3RVY A;  5COM A;  4DX6 D;  4GA0 A;  2P6V A;  5ITZ F;  4E18 A;  3FUK A;  4ZLD A;  3EU9 A;  3J5Q B;  4JE9 A;  3LEV A;  4DXW A;  1HH8 A;  2GRP B;  4C0M A;  1ZBP A;  1E7V A;  5JLI A;  4XPX A;  3C8Z A;  4O6Y A;  4CDV A;  3PE4 A;  1LE2 A;  1E85 A;  1PCX A;  3UM2 A;  1JCR A;  1D0Z A;  3SFZ A;  3U9W A;  4WNF A;  4G25 A;  5A6K A;  4C7O B;  5ENR D;  2I15 A;  3G2T A;  4XPW A;  5KYW A;  2ETA A;  1HY5 A;  1U0B B;  5HQ8 A;  4G78 A;  3FOP A;  1LIH A;  5L3Q A;  1TN7 A;  1VK5 A;  2BKK B;  2BL2 A;  3M1C B;  4CDA A;  3L6A A;  4FX5 A;  4HFF B;  5FZQ A;  2VYI A;  5A6J A;  3L8I A;  2KYH A;  3QZC A;  3TJ6 A;  3B7R L;  4HOR A;  3NKD A;  3QAQ A;  2L6H A;  1H6K A;  4A63 B;  2QY9 A;  4K0D A;  2IY0 C;  5E2Q A;  3V5Y A;  1SA5 A;  5BXO A;  1G8X A;  5CI8 A;  3K9I A;  3PE3 A;  3IQ5 A;  2NXP A;  4J7T A;  5JT4 A;  2H7V C;  3JYH A;  4AL1 A;  3UM1 A;  4BX9 A;  3IHU A;  4AX2 A;  5AJL A;  1IQR A;  1HZ4 A;  1TWA A;  2GAQ A;  3GZ1 A;  3V2O A;  2XS1 A;  3E32 A;  5ENP D;  2ZXP A;  2WXR A;  3D9K A;  5D92 A;  1OR2 A;  2GDC A;  256B A;  2X51 A;  3AGU A;  3DAG A;  1D0Y A;  3JYY A;  3MYF A;  2KC3 A;  3CK9 A;  3PUK A;  2VC9 A;  3O48 A;  4OIO F;  3M4B A;  4DK5 A;  1JR8 A;  3JTL O;  3KD7 A;  2WXM A;  4AV7 A;  3DI5 A;  1IKN D;  3TWX A;  2H7B A;  2V4L A;  3DJN B;  1E83 A;  3FTU A;  4NRH B;  4U5D E;  4OD5 A;  3DE8 A;  2WXG A;  3GAN A;  2KAT A;  4GPM A;  2XLE A;  2WXN A;  3S84 A;  3D9J A;  3B7S A;  2DGJ A;  2HUJ A;  1N0R A;  5LP0 A;  2R7R A;  2YL7 A;  1D1A A;  2BE5 F;  4A3V A;  2E2E A;  4WGZ A;  4JPS A;  3K33 A;  3KKB A;  1MQV A;  4MS2 A;  2H6F A;  2NC9 A;  3NOG D;  3DSW A;  4B8C B;  1XGW A;  3JSZ A;  3AGT A;  3PEV B;  3S2A A;  3T8K A;  5DQZ A;  4KVO A;  2XPY A;  5FZR A;  1UJJ A;  1PD0 A;  4ILG A;  2F22 A;  1E2X A;  5EYL A;  4XI9 A;  3TD7 A;  1ZHZ A;  4DRJ B;  2DYS E;  4DX7 D;  2VCA A;  1FAP B;  3NZS A;  3DEO A;  4GZD A;  2IXP A;  1Q0F A;  2OJE D;  3P1U A;  1ZHY A;  1LD7 A;  2FGY A;  1HMO A;  3UMK A;  3G4Z A;  2R25 A;  4O6N A;  5KYW B;  2Q9A A;  3LES A;  4U5H A;  2XLV A;  3DD7 A;  2LSV A;  4PJM A;  3TQO A;  5EIL A;  4C3D A;  1N94 A;  4M3O A;  1BZ4 A;  3BEE A;  3HXE A;  3NAW A;  1RCP A;  1T5O A;  1CGM E;  2XLW A;  2A5E A;  4DPR A;  3MYV A;  3TWT A;  3G50 A;  4LLC A;  1TQG A;  2FI7 A;  4IRU A;  2OOE A;  1VYI A;  5T1D B;  3ASF A;  4G23 A;  5AAO A;  4O60 A;  3CLJ A;  2Q00 A;  3FTZ A;  1MX2 A;  2MRI A;  3UKR G;  3RAU A;  2WB2 A;  1YA0 A;  4BJ6 C;  2ZXO A;  4MQ9 F;  3C18 A;  3V7O A;  1BI8 B;  1RJ9 A;  3SNX A;  4HFG A;  4N3A A;  3NMJ A;  1OCO E;  5JP7 A;  1WAS A;  1QZX A;  4J7Y A;  2XZD G;  4MKT A;  3SFX A;  4PFP A;  2XRY A;  5JVE A;  3FP3 A;  3TXM A;  5AIJ A;  4PS8 A;  4CBE A;  1L7C A;  4U9D A;  4E17 A;  3UUX A;  1FFT C;  1WGW A;  4L1B A;  1Q0G A;  3FUJ A;  1HW1 A;  4JHJ A;  1CPQ A;  1TEZ A;  3D9P A;  4I3M A;  1OWM A;  3KSL A;  2YQY A;  3BU8 A;  3Q6N A;  2V5Q C;  1Y6D A;  1E90 A;  1K3Z D;  2YL0 A;  3ESK A;  3EH1 A;  3TUL A;  4EZL A;  2CNW D;  5A23 A;  3GEI A;  1YA7 O;  3RH3 A;  2Q7F A;  3SQV A;  3ZDL A;  3UXG A;  4LNU D;  5BQH A;  3EHQ A;  4BTB A;  2I6H A;  1M6T A;  2ASR A;  5AQB A;  1L3P A;  4KNV A;  2VJ8 A;  4KT6 B;  3FU3 A;  3MZL B;  1MHQ A;  2J9Q A;  2PBE A;  2FEZ A;  3ASD A;  4AP2 A;  4LSZ E;  2LUH A;  4XEI G;  2VAS A;  3LLK A;  2R17 C;  4GQH A;  2NUP A;  2J09 A;  2HO1 A;  4FLH A;  5BXU A;  1NU9 C;  3EH2 A;  2PZI A;  2GW1 A;  3MBG A;  2BTD A;  5G55 A;  3EG9 A;  3D9M A;  3C3R A;  3FTV A;  2C03 A;  2X6I A;  4ABN A;  1WDY A;  2WQ7 A;  2ZIS A;  3Q9U C;  4XLP F;  5DS6 A;  3DSX A;  4HNA D;  4MW8 A;  3ZTM A;  3WXX A;  5JMN D;  3RYL A;  2HJ3 A;  2L6B A;  4HS2 A;  3ZQV A;  1A41 A;  3SF4 A;  5M72 A;  2GRR B;  2VSX E;  5KYN A;  3AQC A;  3K1I C;  3VAY A;  2Y4U A;  4BJ5 C;  4ILI A;  3B0P A;  2JX0 A;  1OY3 D;  4JVS A;  3TWW A;  4WAB A;  2EIM E;  2J4D A;  3HIZ A;  3U3W A;  2AXZ A;  2OND A;  4C3B A;  5KYX A;  5JRA A;  3FDQ A;  3IEG A;  2CGE A;  1UW4 B;  3HXC A;  2J9W A;  1AWC B;  2AXV A;  4CT4 A;  4GPK A;  3SXK A;  2UY1 B;  1ZHW A;  4BY6 A;  3HVE B;  3TWS A;  1RJ9 B;  3JQ1 A;  4ANW A;  4ANU A;  3U8P A;  4ATG A;  2FO7 A;  2W4B A;  3TWR A;  3TWU A;  4OIP F;  4IWB A;  3ZN3 A;  1YLM A;  5J08 A;  5A6A A;  4BPM A;  3QWP A;  4TUU A;  5AJD A;  5ANL A;  4N3B A;  4U8Y D;  1UG7 A;  3L8J A;  1SZ9 A;  4YVO A;  2EIL C;  2CFU A;  3FMS A;  3AS5 A;  2DYS C;  3B0U X;  1JCS A;  3L0I A;  3HKK A;  5FZT A;  1RZ4 A;  2VSN A;  3CV0 A;  4MVU A;  1OWL A;  2R9R B;  3Q78 A;  4IGG A;  4RBN A;  5A69 A;  4OVV A;  2WXL A;  2CNW A;  3SXY A;  4DLO A;  4ZLC A;  2KW3 C;  5DQT A;  3SBS A;  5EHH A;  5G04 C;  2PX0 A;  2GGF A;  5AQA A;  3WHN A;  2YIN A;  2NPU A;  2UUH A;  4YT4 A;  2I2O A;  3U2L A;  3IV0 A;  3ABL E;  3UTM A;  4XQ1 A;  1SA4 A;  4AXH A;  4AVX A;  4L7T A;  3B7B A;  2IQC A;  3CST A;  1I5N A;  2Y3A A;  3HTK C;  3RF3 A;  2Q9B A;  5B3S C;  2OJQ A;  1NBB A;  3HLZ A;  4I1A A;  2RG8 A;  3UPV A;  4XPY A;  3LEO A;  1FNT c;  4NCQ A;  2LNI A;  1OCO C;  2NUP B;  2DIW A;  4AOF A;  2XL6 A;  4NTB A;  2WMN A;  1KT0 A;  3CEQ A;  3HYM B;  2HKV A;  3EG9 B;  3C3Q A;  4G7H F;  5LCW C;  4BES A;  3TWV A;  3UNG C;  3CQZ A;  2V8S E;  4DX1 A;  2FAP B;  1H0A A;  1DC2 A;  4U9E A;  3OXG A;  5FZS A;  3QW1 A;  1HE9 A;  1N0Q A;  4NUR A;  1DOW A;  1R4T A;  2LSU A;  3TK0 A;  2Y0B G;  2MWQ A;  3O39 A;  1SQM A;  4H54 A;  1MMG A;  1N4R A;  3BEH A;  3RQF A;  3RRN B;  3FUN A;  5KYX B;  5FQ4 A;  1FCH A;  3SNH A;  1D8E A;  3UT8 A;  4EWC A;  1GQA A;  3JUI A;  4Q69 A;  2ETB A;  1ZVZ A;  1SF8 A;  2DBA A;  3ULY A;  2DVW A;  3RIP A;  3SGH A;  3CQC B;  3B71 A;  1NSG B;  3RSE G;  4JCH A;  3UM3 A;  5ENN A;  4GYW A;  5D2M C;  4NQ0 A;  2IXO A;  4D4X A;  3F6Q A;  2G3K A;  4TRQ A;  2HZ8 A;  4U5G A;  3KYJ A;  3H2U A;  2ICW G;  1YZA A;  4I1O B;  4F1S A;  2RFA A;  2YZS A;  1ZHX A;  4XX5 A;  4GA2 A;  4UDV A;  4U8V D;  2VH3 A;  3EDT B;  4NY3 A;  3KMI A;  2XCB A;  2MHK A;  1ZYR F;  2Y3D A;  3A11 A;  5D66 A;  4AIF A;  2HV6 A;  4ME2 A;  2O9X A;  3U4T A;  1JPL A;  3ZUV B;  2LSE A;  1I4Z A;  5F5F A;  3I4G A;  2DI3 A;  1Q0K A;  5HI7 A;  2EIM C;  1HXI A;  3L17 A;  2D5R B;  5K0I A;  4KI2 A;  2F0Y A;  1C02 A;  4I2Z A;  2B0H A;  2L9J A;  3JXJ A;  3VLE A;  5AEN A;  5FIO A;  1LS1 A;  4K03 A;  4KMO A;  4HRN A;  5D0O D;  3Q4A B;  1CPR A;  4FC8 A;  3VYW A;  5FQ7 A;  3UX4 A;  1YA9 A;  4ZFH A;  2KC7 A;  4UWK A;  3CHS A;  1JRA A;  4ACL A;  4GZC A;  2I8B A;  4JEH A;  3CKC A;  3OXF A;  1H6G A;  4E0H A;  2YHE A;  1ORJ A;  2J0X A;  2LCH A;  3BG1 B;  1N1C A;  4UWL A;  1H9G A;  3MX3 A;  1NFI E;  4APO A;  1M56 C;  3PS6 A;  2HFI A;  1K8K G;  3SYN A;  2GRO B;  2HJM A;  3JRM O;  2WXK A;  4AL0 A;  2NSZ A;  3GM2 A;  5FQ6 A;  1YVI A;  2CHX A;  4W8K A;  1IHB A;  4HI9 A;  4U5F E;  4Y6W A;  2OOC A;  3QJZ A;  2J9U A;  4J8F A;  2VCB A;  4Z9I A;  1MYO A;  1QYM A;  5DIZ A;  4AK9 A;  4YL1 A;  1WWP A;  1S64 A;  4BJ1 A;  4FHJ A;  1UN8 A;  3ABL C;  3TG5 A;  1NL4 A;  3OA1 A;  3UKU G;  1EA8 A;  3FTX A;  2DWZ A;  4NC3 A;  5C2Y A;  3AG4 E;  2RSE B;  3FHD A;  3UIO C;  3D9O A;  5JA4 D;  3FU5 A;  1X81 A;  3ZFW A;  3LJ3 A;  2QUP A;  5FJY A;  4CSA C;  1NFO A;  3I5Q A;  3JZ0 A;  2XPI A;  1J8Y F;  1KT1 A;  3CVW A;  1W3B A;  4GZ5 A;  3KL4 A;  4JRZ A;  1VYK A;  4GU5 A;  4XKB A;  2EIK E;  2HR2 A;  3W2W A;  2OKU A;  2X3M A;  3HXB A;  3RFY A;  2Y39 A;  1H6O A;  3ASN C;  3LDZ A;  1EPU A;  1MMD A;  3NG1 A;  3RRU A;  4K5B A;  3AU4 A;  4MW3 A;  4ANX A;  3ZW3 A;  3CHP A;  2XXA A;  4A2N B;  3R9M A;  2AWY A;  1TNB A;  2OV8 A;  3E34 A;  3EHN A;  3ZGQ A;  1OCR C;  5AC5 A;  5H7P A;  1U89 A;  5B1A E;  4FJZ A;  4U95 D;  5CEC B;  3GEE A;  2PNO A;  2LFF A;  4MND A;  1BU9 A;  4QI2 A;  1B89 A;  2P9L G;  4WWO A;  3S90 A;  5JHA A;  2R7U A;  4HFK B;  1INZ A;  5BT1 A;  4CRW A;  2XM4 A;  3DM5 A;  3QTH A;  3CSF A;  3FHE A;  4UUC A;  3TOM A;  3SY2 A;  2OQM A;  2XCC A;  2QE9 A;  3JRT A;  2R7S A;  3U9J A;  4DI4 A;  1C03 A;  3CVQ A;  1TWH A;  4ULW A;  3UGO A;  3G2V A;  2WVQ A;  3AG2 E;  3ULE G;  4CDY A;  1E7U A;  1APC A;  4G0H A;  3C98 A;  2IXN A;  3MEK A;  2J08 A;  3FTW A;  5JHB A;  3ZXP A;  4BET A;  2EIJ E;  4RD9 A;  2GRN B;  3AAA C;  1XWJ A;  4U5C E;  2WVO A;  4LCT A;  4N06 A;  2R7Q A;  4CIP A;  2PQR A;  1KPS B;  2YHS A;  2KBX A;  2WPV A;  1FT2 A;  3CK8 A;  4AY5 A;  3W9G A;  2R7T A;  4TXP A;  4K5A B;  4B89 A;  1DCE A;  2ETS A;  3ZIB A;  4G2V A;  3L34 A;  2PF4 E;  4JTA B;  1T6U A;  4O7G A;  2ETC A;  3EU5 A;  4W8P A;  4DI3 A;  3SHF A;  5LX8 A;  2IO3 C;  2KSF A;  1ZU2 A;  2JAB A;  2PM6 A;  3L08 A;  2XLM A;  3ONK A;  3T6G B;  3W2V A;  2X6K A;  1FTS A;  3ASO E;  3ENE A;  4RQI A;  4R32 A;  4B94 A;  1N95 A;  3PNL B;  4ANV A;  2GWW A;  2NYJ A;  1TN6 A;  2R7O A;  4F1P A;  2YLD A;  5AQ9 A;  3G2U A;  1D0X A;  4J0U A;  3T5V A;  3DSU A;  3ABK E;  4YL3 A;  3UM0 A;  1N52 A;  3O55 A;  4AM9 A;  2VSY A;  4CYM D;  2IOQ A;  2P9S G;  4KBQ A;  2R05 A;  4G26 A;  3IQC A;  5CBO A;  3FUF A;  2CYD A;  3ZU7 B;  3UR3 C;  2OEV A;  3L82 A;  4XTK A;  3QAR A;  2KCV A;  4LRZ A;  2NSF A;  1TJC A;  3PUJ A;  1WAT A;  2XXA B;  2L6F A;  4DOZ A;  1S63 A;  4JZY A;  2XEE A;  3TJP A;  2HYZ A;  3FU0 A;  3CVU A;  3OAW A;  1MJ0 A;  5ENQ D;  1O87 A;  4FWV A;  3DKA A;  4I17 A;  2UWJ G;  3S0X A;  1AEP A;  2IOL A;  3JXI A;  3MLG A;  1N4S A;  4OIR F;  3F47 A;  4PH4 B;  2YHC A;  2P58 C;  3T9O A;  2AW6 A;  2J0W A;  4MTG A;  5EKQ D;  2H6G A;  3HHM A;  3AG4 C;  1G3N B;  1V54 E;  2CW0 F;  2AP3 A;  2QZA A;  2XRH A;  4U0S A;  1QKR A;  2OCC E;  1E86 A;  4KBL A;  3B7U X;  4AE4 A;  1NP7 A;  1QBQ A;  4Q4Z F;  5DVW A;  2LP4 A;  4HRM B;  3V5Z A;  1RXQ A;  4FP7 A;  2OU6 A;  5HRY A;  4DLQ A;  2EIK C;  1TNO A;  3U3F A;  4I6E A;  3KSQ A;  1T6Q A;  3E30 A;  4Z68 A;  2J7P D;  5L0G A;  5EN5 D;  1XZP A;  3DXK G;  2EPO A;  3N24 A;  4PS3 A;  3UMV A;  3CEX A;  3R7C A;  3HXF A;  3EZH A;  4MLP A;  1R5I D;  3UT7 A;  3QDN A;  3G4X A;  5KBA A;  3QB2 A;  1NG1 A;  2VGE A;  3FH8 A;  1G4U S;  2LO6 A;  2XRZ A;  2XLH A;  4M63 A;  5CER B;  1PC2 A;  4GMR A;  4D4N A;  4JC8 A;  3ABM E;  4ER9 A;  2MOW A;  3BQO A;  4NTF A;  4URK A;  2UY1 A;  3PVL A;  1K05 A;  4A1S A;  1SMY F;  3HVE A;  4E6H A;  5AGF A;  3PDM P;  4Q7C A;  3LUT B;  4I43 A;  2HSQ A;  2RD0 A;  3LS8 A;  4QFV A;  3DST A;  1J8M F;  1V4A A;  2Y1L E;  3AG2 C;  3ZIM A;  4JD2 G;  4KVM A;  1E8W A;  1HO8 A;  4YWQ A;  4GTM A;  1TN8 A;  4GTR A;  1NZE A;  4ATZ D;  4JXT A;  2V26 A;  2EIJ C;  1JOG A;  2M63 A;  1EDU A;  3ZEF A;  4C0E A;  5FQ8 A;  3C8G D;  2Q9C A;  3CAX A;  1MZC A;  2PL2 A;  3MCX A;  4GYY A;  2JD3 A;  1H6P A;  1QSP A;  4JTD B;  3BUA A;  4GCO A;  2GFH A;  2QNL A;  2FBN A;  2XPZ A;  4L23 A;  4DBR A;  2XSE A;  4I6J A;  3EGX A;  2DYR E;  4HQD A;  5A6C A;  1JMW A;  1YDI A;  1MQS A;  4EBA A;  2OVF A;  4BT9 A;  1VLS A;  1IHG A;  1KZO A;  1LVK A;  1IQU A;  1BR2 A;  3UGP A;  1HG2 A;  2WZG A;  2NG1 A;  3NYM A;  5EID A;  2WZL A;  3M4C A;  3VTX A;  3L13 A;  3FAP B;  1Q2Z A;  4TXQ A;  4LNB A;  1U6H A;  3LJB A;  4UQY A;  3ASO C;  4PR9 A;  3PH0 C;  3DSV A;  1FR0 A;  1U3C A;  3LKU A;  3EQL F;  4UQZ A;  2G3V A;  2V4H C;  2ZGD A;  3ZNG A;  1OXB A;  2I1K A;  1GGQ A;  1TNU A;  2NSG A;  1TFK B;  5L0I A;  4EZK A;  1TWC A;  1M57 C;  4AE4 B;  2J8S D;  4I1M A;  1NU7 D;  4HOT A;  3ABK C;  3U9M A;  2AWI A;  5AAR A;  5EGY A;  4U8H A;  4F4B A;  1TKN A;  4A3T A;  2AU5 A;  4DRI B;  2C0M A;  2J7P A;  3GM3 A;  4JW1 A;  4JZA A;  2XGS A;  4GA1 A;  2HMQ A;  4HEA J;  1FVH A;  4EHP A;  3JSE O;  3B13 A;  4CS8 A;  3ATP A;  3T6B A;  3RQE A;  1UFB A;  3PZD A;  4Q94 A;  3GOD A;  4HXI A;  3AG1 E;  1YJG A;  3SO8 A;  3S7F A;  1ZHT A;  1VMA A;  3ZKJ A;  4A4A A;  2G62 A;  3LAY A;  2XM0 A;  3KPH A;  1E84 A;  1HFA A;  3NQP A;  2AXU A;  4G7O F;  1WOL A;  2LAH A;  4PK4 A;  4HOU A;  1MX4 A;  1W2W A;  4CCA A;  5L0H A;  4LEU A;  4FES A;  2QYJ A;  1V54 C;  1PAQ A;  1HS6 A;  1LTX A;  3FH5 A;  4FJY A;  3MV2 B;  2OCC C;  1H9T A;  3EHR A;  3JUE A;  5ANR A;  2IJG X;  2VTB A;  1NI1 A;  4GTV A;  3UIP C;  1JAF A;  3GW4 A;  1S70 B;  4HVB A;  3C62 A;  4JIO A;  2B6C A;  3ZQY A;  5T8I A;  2B0J A;  1ZU5 A;  4OIQ F;  1OW6 A;  3I4R B;  3C8G A;  3EIJ A;  1U3D A;  1Z6A A;  4P9T A;  1TFO B;  3CVL A;  3DSS A;  1YAU O;  2OEW A;  3T8M A;  1IYG A;  4CT0 A;  2KCL A;  3O4Z A;  2Q7R A;  5ENO D;  5BNW A;  3EGX B;  1OCZ E;  3TJ5 A;  3ZYL A;  3Q7L A;  4NTA A;  2B0O E;  3QOU A;  3B0V C;  1S0P A;  1HMD A;  3J5P A;  2ILR A;  1GW6 A;  3FXH A;  3RIB A;  1T9K A;  2LXL A;  4ACK A;  2LK4 A;  3MFN A;  5AC4 A;  3R2P A;  4PJL A;  4CJG A;  2R03 A;  2DB4 A;  3LS1 A;  3CHM A;  5T3W A;  3CHR A;  1NA0 A;  1QLE C;  1ZW2 A;  3PMR A;  5EX3 A;  4I9E A;  1SR2 A;  1GM5 A;  1PD1 A;  1ZU4 A;  5FWQ A;  2P61 A;  2KXP C;  1H7I A;  1S05 A;  3T6J A;  1N11 A;  3O10 A;  1OWO A;  2R2L A;  3W9F A;  3AG3 E;  2YEV A;  2ZGG A;  2Y3G A;  4BEJ A;  3RW0 A;  4O1P A;  3CSK A;  3FWV A;  3CVX A;  3C63 A;  4OD4 A;  3GWN A;  4EQF A;  5EIB E;  1O5H A;  3C7J A;  1ELW A;  2DZN A;  4G1T A;  3B29 A;  2OVB A;  3UMI A;  2F8Y A;  4BTA A;  1Z3I X;  2LQG A;  5CRV A;  3NMI A;  1YYJ A;  5F28 E;  4RVB A;  4MVR A;  4G8K A;  3RKO F;  1XNF A;  5EYP F;  4MVQ A;  5JS5 A;  4AEZ C;  3US6 A;  5AYW D;  3I5P A;  3K7D A;  4H4K C;  1Y6I A;  2IYL D;  2XGO A;  5CBN A;  1Y4C A;  2YQ8 A;  4DJA A;  4G8L A;  4OYS A;  2GRL A;  4U5B E;  1E96 B;  4B8A A;  1OQC A;  3ZVR A;  3X2Q E;  2J45 A;  2BED A;  2H8A A;  5A6B D;  1OXJ A;  3URZ A;  1ZB1 A;  3ZWI A;  1A7E A;  4F7A A;  1ST6 A;  3CVV A;  3VF0 A;  1HF8 A;  2WVI A;  1SYQ A;  2VTB B;  4PUC A;  3U64 A;  4QDL A;  3L9T A;  4A1G A;  3APF A;  1JPJ A;  1TWG A;  3MGB A;  3ASG A;  4YT2 A;  3U0C A;  4YDE A;  3RU0 A;  2ION A;  4K7B A;  3C8G B;  1M2V A;  3GYZ A;  4KZ0 A;  4EPZ A;  5GPG B;  3EFO A;  1PY1 A;  2EPM X;  3PDN A;  3R7R A;  2FUL A;  1CGN A;  3KH2 A;  3VLD A;  4G24 A;  4PJJ A;  4C48 B;  3SZ7 A;  1UN9 A;  2P9U G;  3IQT A;  3I4U A;  3L1M A;  4KZC A;  2W9Y A;  3KS2 A;  4RLY A;  3AG1 C;  3NDB B;  2RFM A;  1WN0 A;  2H7O A;  3W4Y A;  1TJF A;  4UI9 J;  1ZW3 A;  4J8D A;  1HW2 A;  2J9B A;  3SEO A;  1YCS B;  1O1T A;  3E70 C;  2E87 A;  2EQX A;  1Z5Z A;  4WGY A;  2KNH A;  3AU5 A;  3IHY A;  4GCN A;  2X6J A;  1LI5 A;  5BUZ A;  1V55 E;  1H2U A;  4JL0 A;  3ZYK A;  1NFN A;  2P9I G;  3JCU Q;  3PCV A;  3U3B A;  4RSY A;  3ISM C;  4BJ5 A;  4J8Y A;  3FAJ A;  4I9C A;  3N71 A;  4X8Q A;  3MV3 B;  4YDW A;  4HBD A;  3E37 A;  4AJW A;  1Q0M A;  3QK0 A;  3AJM A;  2ZU6 B;  3PHF 2;  4FLB A;  1YYX A;  2LIG A;  4KXK B;  3ZC4 A;  1PV3 A;  4J30 B;  4CGV A;  3DZA A;  1FT1 A;  3FUM A;  4P9F A;  2X6F A;  2W45 A;  2VGX A;  3DJU B;  3CHO A;  4OAV B;  2A6E F;  1MMA A;  2XHE A;  1VLT A;  1OCZ C;  4C3E A;  1A5E A;  2HS5 A;  1OUV A;  3JT1 A;  4YJW A;  2HMZ A;  2BKG A;  2IF4 A;  3N2Z B;  4EHM A;  3DWW A;  2PP4 A;  3NBN B;  4ONS A;  1QVX A;  1JWG A;  1P5Q A;  1Z5S C;  2XLO A;  1VDY A;  3TL5 A;  3U8V A;  5L3V A;  2I1J A;  3OWT A;  1BDJ B;  3MYI A;  4MVO A;  2WQH A;  2Y69 E;  1H19 A;  3LVR E;  2LAI A;  3Q79 A;  4YVQ C;  4DJ9 A;  5CMY A;  3S29 A;  3Q7G A;  2IOS A;  3I3N A;  1EQ1 A;  5FTP A;  1A7V A;  4FUL A;  5G05 C;  3SD5 A;  4K5C A;  1EYH A;  2A1D D;  1TR2 A;  4JC7 A;  4FAD A;  4JUR I;  1M2V B;  2PQN A;  2IBF A;  3EFO B;  4IUL A;  3AG3 C;  2R5S A;  3WG7 E;  1VTM P;  4UWF A;  2NUT A;  1ZZP A;  1Q0D A;  3SI5 A;  4CX9 A;  3QWV A;  3TOL A;  5BPP A;  4P29 A;  1OKK D;  3RK6 A;  3L54 A;  5LFA A;  4I44 A;  4IAQ A;  3DWL G;  3T4R A;  3J06 A;  4U96 D;  4XWJ A;  3ULQ A;  1G4W R;  1NZN A;  4EZJ A;  4GZ3 A;  3U66 A;  3SP1 A;  3IHV A;  2C0L A;  2L0I A;  4DX5 D;  4YT8 A;  4N2Q A;  2MYS A;  4GTP A;  3T5X A;  1D8D A;  4J7W A;  4JEA A;  2M64 A;  1BI7 B;  1EI7 A;  1KLX A;  3TAX A;  4RDA A;  1GS9 A;  3PEU B;  2LXM A;  3C5R A;  2R7V A;  1HE8 A;  3O6X A;  2IFU A;  3KEZ A;  5DLJ A;  3X2Q C;  1FFH A;  3NRH A;  3CVN A;  2C2L A;  1JWF A;  1JUQ A;  2QYU A;  1K1B A;  4ANJ A;  1XZQ A;  3V5X A;  4HE8 D;  1QZ2 A;  3FU6 A;  2A5U A;  4O6F A;  2RD9 A;  5B3I A;  3LVQ E;  3DAF A;  3EZI A;  4JCZ A;  4OIN F;  4BEP A;  4TUM A;  3AS4 A;  4JHR A;  2H6I A;  4N5Q A;  4CS9 A;  3RO3 A;  3GWL A;  3ASH A;  2ZXR A;  2WXO A;  3ZG1 A;  2VGX B;  3FUH A;  3B95 A;  3FUI A;  4XEF A;  4G7Z F;  4U07 A;  2A68 F;  4CDN A;  4OVU A;  4B0Z A;  4KNW A;  2P1A A;  1D9S A;  1Z63 A;  2HE0 A;  5EK0 A;  2J9V A;  4JKV A;  1M2O A;  4K1O A;  3CR3 A;  3L22 A;  4JTC B;  4GMJ A;  4E7Z A;  1WG0 A;  3CKB A;  4RG6 A;  3QNK A;  2OG2 A;  3G2S A;  4PS7 A;  3HNL A;  2WMO A;  5CED B;  3QWW A;  1ORY A;  4LNG A;  3Q6M A;  2KGO A;  3GZ2 A;  2XQ0 A;  4IN3 B;  1UOH A;  5F5H A;  2WVN A;  1YMP A;  2EIN E;  1V55 C;  4B93 B;  4MVZ A;  4R7L A;  4PDX A;  5FIN A;  3ZHE A;  3LY7 A;  3PZ3 A;  3LNR A;  2R7X A;  4LDK A;  1WY6 A;  3QKY A;  2TMV P;  5ENS D;  2GA0 A;  2YKZ A;  5L0F A;  5BQI A;  1OWP A;  2L6J A;  4CZ2 D;  3ML8 A;  4UQX A;  4D10 C;  1DOV A;  2NUT B;  4H7X A;  4CJO A;  1YYH A;  2W4M A;  4DUI A;  1OKK A;  3DXJ F;  4CS8 C;  2EPK X;  3D3M A;  3QW0 A;  2WXI A;  5ENT D;  4IYP A;  2MHR A;  3RQG A;  2L9B A;  3Q49 B;  1NA3 A;  2AJA A;  2QC9 A;  4V3I A;  4UWH A;  4WAF A;  3H2V A;  3LEW A;  4BG0 A;  2VCC A;  3D9L A;  1O5M A;  1T01 A;  4FA6 A;  4XE0 A;  4HI8 A;  4MBG A;  4EUK B;  3QC1 A;  4DBQ A;  2L6G A;  1OCC E;  1EF1 C;  1LI7 A;  2X6H A;  1LS4 A;  1TNY A;  1SVX A;  3DRA A;  5KJK A;  1KTM A;  2Y69 C;  1MNE A;  5LOZ A;  1NLX A;  2CFZ A;  4FAP B;  1LKX A;  1VOM A;  4ZHB A;  1LF8 A;  2DCP A;  2P9K G;  1A17 A;  1F1M A;  4BX8 A;  2YL1 A;  5B1B E;  3FUE A;  1DVP A;  3IKO B;  2FFH A;  2VGY A;  3NB2 A;  3EGD A;  2YNQ A;  2VSO E;  3FTS A;  5KNH D;  2A0B A;  1S7Z A;  1TNZ A;  1V74 B;  2JEK A;  2XGM A;  3WG7 C;  3T9K A;  3FUD A;  1I4Y A;  3ZPJ A;  4O79 A;  4G11 A;  1OWN A;  4XEK A;  3K6B A;  3KEA A;  2EIL E;  1N9A A;  1E8Y A;  4GTO A;  4CS7 A;  3CQG B;  4APF A;  2L7A A;  4CSA A;  3WAQ A;  3SBT B;  4GYO A;  4GTS A;  5JJ6 A;  1OT8 A;  1JPN A;  3JYS A;  5B1A C;  4XI0 A;  4MRU A;  3AQB A;  3MJW A;  4YDO A;  3Q15 A;  4LDR A;  1A0B A;  2IU1 A;  5ARG A;  1SZI A;  4KYO B;  3IBE A;  3LCA A;  1YZC A;  4BER A;  4GYT A;  4E85 A;  5KWD A;  3M79 A;  4Q96 A;  2H6H A;  2P9P G;  4FHK A;  1QPU A;  4U0U A;  1UJK A;  3V31 A;  3ZHE B;  4MTO A;  1HU3 A;  2EPL X;  2J8W A;  4WNG A;  3AJI A;  2XS8 A;  3D9H A;  5CMW A;  1K04 A;  3VM6 A;  4MVM A;  4BSZ B;  4L2Y A;  1JCQ A;  3TGO A;  3X1O A;  3Q73 A;  5BV0 A;  3NKE A;  3SFY A;  1LE4 A;  3BG0 B;  3SZR A;  4XZ4 A;  5B3S E;  4JJG A;  5HV9 A;  1QNF A;  3RO2 A;  1RW2 A;  3IXE A;  2CG2 A;  2UUI A;  2EPN A;  2Y3B A;  3IPM O;  2CCY A;  3FH7 A;  1D1C A;  4N3C A;  1ELR A;  2VQ2 A;  4O6M A;  1DCQ A;  5C1D A;  1U2V G;  3EPV A;  3EIQ C;  4E7S A;  4M7C A;  2WXF A;  3C3O A;  3NOC D;  3HNK A;  3FUL A;  4A55 A;  2WB7 A;  4L9P A;  4I2W A;  3PRE A;  2XEH A;  4YK5 A;  3CGH A;  1A7D A;  2ZD9 A;  1OXK A;  2EIN C;  1N54 A;  4JEU A;  4J32 B;  4E0I A;  2LD6 A;  2GRM A;  3Q75 A;  4LUN U;  3NYL A;  1EKY A;  1KZP A;  3CK7 A;  3DM9 B;  3LPZ A;  3DEP A;  3PZ2 A;  3LY8 A;  3EGD B;  3W8I A;  1G5Z A;  5KJL A;  2HSB A;  2AWC A;  5HKP A;  2IEJ A;  2P9N G;  5COF A;  2KM4 A;  5E76 A;  1RMV A;  4EKW A;  4F6R D;  3Q7A A;  5T3T A;  5IY5 E;  4UI9 K;  3HNJ A;  3LYA A;  2Q4F A;  2J46 A;  3FFL A;  3R9A B;  3OTN A;  2PFD A;  4FU3 A;  3ZYQ A;  4Q5S F;  3S7B A;  3ZXS A;  2AVP A;  1TR4 A;  4GZ6 A;  2QLA A;  4J8E A;  1O1R A;  5EX0 A;  3UMH A;  3V79 K;  4RG9 A;  1BR4 A;  3H65 A;  4J6I A;  1OCC C;  2Y3H A;  3LY9 A;  1RKE A;  3VLF A;  3CVY A;  1WM5 A;  1RKC A;  3GM1 A;  4CEM A;  3W8H A;  2KJG A;  2R02 A;  3LXU X;  4U7E B;  3PZ1 A;  1VB5 A;  1CGO A;  4DVY P;  5KJN A;  1Z7Q c;  2MYO A;  3AOU A;  5HS0 A;  1FMW A;  5DS5 A;  3HJC A;  1MX6 A;  3G2W A;  5B1B C;  4IAO A;  5T3R A;  3DXM G;  3A9C A;  2J4B A;  2P2C P;  3S7D A;  3CZ6 A;  3SXM A;  2A0U A;  2CDQ A;  3ITF A;  2ZXW E;  3RJV A;  2HV7 A;  4P6I C;  2X0C A;  3LNM B;  4N39 A;  3B9Q A;  5FT9 A;  3Q5M A;  5CCM A;  5KYU A;  2WXP A;  2L0T B;  3PNT B;  1O3U A;  3Q47 B;  5JUA A;  4DRH B;  1BR1 A;  4JEB A;  2C04 A;  4WNE A;  2WL8 A;  4KC9 A;  3RVZ A;  4L6R A;  2R7W A;  4MS6 A;  1IW7 F;  2OEX A;  5D91 A;  5E3C A;  2LFD A;  4WWN A;  1Z3X A;  2JPU A;  5JSL A;  4GB9 A;  3ABM C;  3NF1 A;  4PAC A;  4XLN F;  5DBK A;  1Y8M A;  2L81 A;  3CHQ A;  4F53 A;  5CCL A;  5CI9 A;  3U5S A;  5AN8 A;  4EBK A;  1N4P A;  4J8S A;  3FEX A;  3RKV A;  4IJJ A;  5A7D B;  4WWP A;  2CHW A;  4YND A;  1LD8 A;  4DX2 A;  3WOD F;  5BW8 C;  2I9C A;  3Q7F A;  4HOS A;  4BJ6 A;  1ORS C;  2HM8 A;  5BUO A;  5L0C A;  1SW6 A;  4HOQ A;  3EHM A;  3DPY A;  3APC A;  3MKR A;  3UIN C;  3ZRH A;  4YDY A;  4JHK A;  1K1A A;  2DYR C;  2P7V A;  4YN0 B;  2Z15 A;  4ILH B;  1YAR O;  2D4U A;  4CDM A;  4BJT A;  4N2S A;  4GTQ A;  2Q3T A;  3ASN E;  1Z23 A;  4LG6 A;  4EIY A;  3OXL A;  4U0Z A;  1MMN A;  3LS0 A;  2QTV A;  5G04 J;  3GEH A;  1RKE B;  2BUG A;  4QQI A;  3TXN A;  4UI9 C;  3GZS A;  4HLL A;  3CIA A;  1LPE A;  5E3A A;  3KAE A;  4U63 A;  2BC5 A;  4JB8 P;  1OCR E;  3FEY A;  3OEO A;  1E8Z A;  2A6H F;  3S7J A;  2WZF A;  2KZT A;  3RRM B;  4BT8 A;  2YWA A;  5L0D A;  1D1B A;  2F37 A;  4WND A;  3S28 A;  5KCM A;  3S9O A;  2FF4 A;  2WXH A;  4IAR A;  3DMD A;  3PRZ A;  1Z6T A;  1K40 A;  5J90 A;  2J49 A;  3K1H A;  3VRC A;  2FO1 E;  4BFR A;  4CS9 C;  4BSX A;  4EBJ A;  3NMK A;  3Q9N C;  5IY5 C;  1AP7 A;  5LCW J;  2KCK A;  3AS8 A;  5COG A;  4LAC B;  2V3C C;  5KYU B;  4I6G A;  1OW7 A;  2KQ9 A;  4HB5 A;  2IM8 A;  5KYY A;  1O1S A;  5EDS A;  3QVY A;  4EBB A;  2QFC A;  2JLB A;  4HRL A;  3JCK C;  4IB4 A;  2XEN A;  3VTY A;  5ARF A;  3QMK A;  4WJ0 A;  1BLX B;  5JJ7 A;  4AY6 A;  1H2T C;  4TXR A;  4CGW A;  3ZVV A;  3UI2 A;  3FOO A;  1Z3Y A;  3POV A;  1E8X A;  1WAO 1;  3NYJ A;  3B7T A;  3MA5 A;  3L16 A;  4B6I A;  2P0N A;  3UT4 A;  3ZSU A;  1X5B A;  2M4E A;  3C72 A;  3ESL A;  3ML9 A;  4XKC A;  1BD8 A;  3MKQ A;  3E9V A;  3K1I A;  4LDQ A;  4K0R A;  3HNI A;  4OAU C;  3FY4 A;  4JA7 A;  4Y6C A;  1OR3 A;  3TG4 A;  4YL0 A;  3S27 A;  4N4W A;  2YRF A;  3CVP A;  4BWR A;  5L0J A;  3NZU A;  2KK1 A;  1OW8 A;  3ZYM A;  4NQF A;  2YL3 A;  2CHZ A;  3HG0 D;  3FVY A;  3EUV A;  4GEH A;  3FTY A;  4CDR A;  2J07 A;  5G2N A;  5TJ5 E;  3F46 A;  5KNG A;  2ZXW C;  5E75 A;  1MND A;  1UG3 A;  4C9B B;  2IXM A;  1WTY A;  3E4B A;  3D9I A;  2CG3 A;  1FPP A;  3U2M A;  4LLE A;  2X38 A;  2R59 A;  2WM9 A;  4GML A;  4PJN A;  5FCL A;  1HE1 A;  1N4Q A;  3DBS A;  2Y4T A;  4N5C A;  5BQG A;  2WXQ A;  4MTF A;  5AQ7 A;  4XEV A;  4Z9J A;  1DNP A;  4C7O A;  2BF0 X;  4JA9 A;  1QQE A;  1C17 M;  5CEA A;  2QY7 A;  4U5E E;  2IO2 C;  5A6B A;  5JJT A;  4BEM J;  1FVF A;  4LER A;  4N6C A;  4X0R A;  2F8X K;  1KU2 A;  3D9N A;  2KZT B;  5HSW A;  4QI0 A;  4TV3 A;  4N6H A;  3V2X A;  4H7Y A; 
#chains in the Genus database with same CATH homology
 1HX8 A;  2VB6 A;  1SZA A;  1FMV A;  4UWG A;  4EBA G;  3K66 A;  2WXJ A;  2V5F A;  1ELK A;  4EEC A;  3APD A;  4GAA A;  4PFO A;  5E33 A;  1BPO A;  5D0Q D;  3R7Q A;  5KYY B;  3ECS A;  4NAC A;  2WQ6 A;  2XEV A;  3LLI A;  4L2L A;  1IZM A;  5KJM A;  1L5J A;  3FDH A;  3N0T A;  2A4Z A;  4WUY A;  3ONL A;  5DS4 A;  3DPD A;  5T4Y A;  4JJF A;  4CIH A;  4U04 A;  4XIF A;  2PX3 A;  3MKQ B;  2E0I A;  2A69 F;  5BV1 A;  3EJN A;  2PM7 A;  2XL4 A;  1HG5 A;  3IEE A;  4W9R A;  3P2B A;  4F3V A;  3HDX A;  4YT5 A;  5CHE E;  2ZPA A;  3UQ3 A;  3JQ0 A;  4DVZ A;  2V0P A;  5G05 J;  4HLE A;  1H2V C;  4GA0 A;  2P6V A;  3FUK A;  4ZLD A;  3LEV A;  1HH8 A;  4C0M A;  1ZBP A;  1E7V A;  4O6Y A;  3PE4 A;  1PCX A;  3SFZ A;  1D0Z A;  3U9W A;  4WNF A;  4G25 A;  4C7O B;  3G2T A;  5KYW A;  5HQ8 A;  5L3Q A;  1VK5 A;  3M1C B;  3L6A A;  4FX5 A;  4HFF B;  5FZQ A;  2VYI A;  3QZC A;  3B7R L;  4HOR A;  3NKD A;  3QAQ A;  1H6K A;  2QY9 A;  4K0D A;  5E2Q A;  1G8X A;  5CI8 A;  3K9I A;  3PE3 A;  2NXP A;  2H7V C;  3JYH A;  4BX9 A;  4AX2 A;  5AJL A;  1IQR A;  1TWA A;  1HZ4 A;  3GZ1 A;  2ZXP A;  2WXR A;  3D9K A;  5D92 A;  2X51 A;  3DAG A;  1D0Y A;  3CK9 A;  3PUK A;  3O48 A;  4OIO F;  4DK5 A;  3KD7 A;  2WXM A;  4AV7 A;  2H7B A;  2V4L A;  3DJN B;  3FTU A;  4NRH B;  4U5D E;  4OD5 A;  2WXG A;  3GAN A;  2KAT A;  2WXN A;  3D9J A;  3B7S A;  2DGJ A;  5LP0 A;  2R7R A;  1D1A A;  2BE5 F;  4A3V A;  2E2E A;  4JPS A;  3K33 A;  3KKB A;  2NC9 A;  4B8C B;  1XGW A;  3JSZ A;  3PEV B;  3S2A A;  5DQZ A;  4KVO A;  2XPY A;  5FZR A;  1UJJ A;  1PD0 A;  4ILG A;  4XI9 A;  3TD7 A;  1ZHZ A;  3NZS A;  4GZD A;  2IXP A;  3P1U A;  1ZHY A;  2FGY A;  3UMK A;  4O6N A;  5KYW B;  2Q9A A;  3LES A;  4U5H A;  3DD7 A;  2LSV A;  4PJM A;  4C3D A;  4M3O A;  3BEE A;  4DPR A;  3MYV A;  4LLC A;  2FI7 A;  4IRU A;  2OOE A;  1VYI A;  5T1D B;  3ASF A;  4G23 A;  3CLJ A;  3FTZ A;  2MRI A;  2WB2 A;  1YA0 A;  4BJ6 C;  2ZXO A;  4MQ9 F;  3V7O A;  1RJ9 A;  3SNX A;  4HFG A;  4N3A A;  1QZX A;  4MKT A;  4PFP A;  2XRY A;  3FP3 A;  3TXM A;  5AIJ A;  4PS8 A;  4CBE A;  3UUX A;  1FFT C;  1WGW A;  4L1B A;  3FUJ A;  4JHJ A;  1TEZ A;  3D9P A;  4I3M A;  1OWM A;  3Q6N A;  1E90 A;  3ESK A;  3EH1 A;  4EZL A;  2CNW D;  5A23 A;  2Q7F A;  3RH3 A;  4BTB A;  2I6H A;  2VJ8 A;  4KNV A;  4KT6 B;  3FU3 A;  3MZL B;  1MHQ A;  2J9Q A;  2FEZ A;  3ASD A;  4AP2 A;  2VAS A;  3LLK A;  2R17 C;  2NUP A;  2J09 A;  2HO1 A;  4FLH A;  1NU9 C;  3EH2 A;  2PZI A;  2GW1 A;  2BTD A;  5G55 A;  3EG9 A;  3D9M A;  3FTV A;  2C03 A;  2X6I A;  4ABN A;  2WQ7 A;  4XLP F;  5DS6 A;  3WXX A;  3RYL A;  4HS2 A;  3SF4 A;  5M72 A;  2VSX E;  5KYN A;  3AQC A;  3K1I C;  3VAY A;  2Y4U A;  4BJ5 C;  4ILI A;  3B0P A;  4JVS A;  2J4D A;  3HIZ A;  3U3W A;  2AXZ A;  2OND A;  4C3B A;  5KYX A;  3FDQ A;  3IEG A;  2CGE A;  1UW4 B;  2J9W A;  2AXV A;  4CT4 A;  4GPK A;  2UY1 B;  1ZHW A;  4BY6 A;  3HVE B;  1RJ9 B;  3JQ1 A;  4ANW A;  4ANU A;  4ATG A;  2FO7 A;  2W4B A;  3ZN3 A;  4OIP F;  4IWB A;  5J08 A;  4TUU A;  3QWP A;  5AJD A;  5ANL A;  4N3B A;  1SZ9 A;  4YVO A;  2EIL C;  2CFU A;  3AS5 A;  2DYS C;  3B0U X;  3L0I A;  2VSN A;  3CV0 A;  1OWL A;  4RBN A;  4OVV A;  2WXL A;  2CNW A;  4DLO A;  4ZLC A;  2KW3 C;  5DQT A;  3SBS A;  5EHH A;  5G04 C;  2PX0 A;  2GGF A;  2YIN A;  4YT4 A;  2I2O A;  3IV0 A;  4AXH A;  4AVX A;  4L7T A;  2IQC A;  3CST A;  2Y3A A;  3HTK C;  2Q9B A;  5B3S C;  3HLZ A;  4I1A A;  2RG8 A;  3UPV A;  2LNI A;  1OCO C;  2NUP B;  2DIW A;  4AOF A;  2WMN A;  1KT0 A;  3CEQ A;  3HYM B;  3EG9 B;  5LCW C;  4G7H F;  3UNG C;  3CQZ A;  2V8S E;  1H0A A;  3OXG A;  5FZS A;  4NUR A;  2LSU A;  2MWQ A;  3O39 A;  1SQM A;  1MMG A;  3RRN B;  3FUN A;  5KYX B;  5FQ4 A;  1FCH A;  3SNH A;  3UT8 A;  4EWC A;  3JUI A;  4Q69 A;  1SF8 A;  2DBA A;  3RIP A;  3SGH A;  3CQC B;  4JCH A;  5ENN A;  4GYW A;  4NQ0 A;  2IXO A;  2G3K A;  4TRQ A;  4U5G A;  4F1S A;  4I1O B;  2YZS A;  1ZHX A;  4XX5 A;  4GA2 A;  2VH3 A;  3EDT B;  4NY3 A;  3KMI A;  2XCB A;  2MHK A;  1ZYR F;  2Y3D A;  4AIF A;  2HV6 A;  4ME2 A;  2O9X A;  3U4T A;  1JPL A;  2LSE A;  5F5F A;  3I4G A;  5HI7 A;  2EIM C;  1HXI A;  3L17 A;  2D5R B;  4KI2 A;  4I2Z A;  2L9J A;  3VLE A;  5AEN A;  1LS1 A;  4K03 A;  4KMO A;  5D0O D;  3Q4A B;  4FC8 A;  3VYW A;  5FQ7 A;  3UX4 A;  2KC7 A;  4UWK A;  3CHS A;  4ACL A;  4GZC A;  2I8B A;  4JEH A;  3CKC A;  3OXF A;  2YHE A;  2J0X A;  3BG1 B;  1N1C A;  4UWL A;  3MX3 A;  4APO A;  1M56 C;  3PS6 A;  3SYN A;  2WXK A;  2NSZ A;  5FQ6 A;  2CHX A;  4W8K A;  4U5F E;  4Y6W A;  3QJZ A;  2J9U A;  4J8F A;  5DIZ A;  4AK9 A;  4BJ1 A;  4FHJ A;  1UN8 A;  3ABL C;  3TG5 A;  3OA1 A;  3FTX A;  5C2Y A;  3FHD A;  3D9O A;  3FU5 A;  3ZFW A;  3LJ3 A;  5FJY A;  4CSA C;  3I5Q A;  2XPI A;  1J8Y F;  1KT1 A;  3CVW A;  1W3B A;  4GZ5 A;  3KL4 A;  1VYK A;  4GU5 A;  4XKB A;  2HR2 A;  3W2W A;  2X3M A;  3RFY A;  2Y39 A;  3ASN C;  3LDZ A;  1EPU A;  1MMD A;  3NG1 A;  3RRU A;  3AU4 A;  4ANX A;  3ZW3 A;  3CHP A;  2XXA A;  4A2N B;  2OV8 A;  3EHN A;  3ZGQ A;  1OCR C;  4FJZ A;  4MND A;  4QI2 A;  1B89 A;  4WWO A;  5JHA A;  2R7U A;  4HFK B;  1INZ A;  5BT1 A;  4CRW A;  3DM5 A;  3CSF A;  3FHE A;  2XCC A;  2R7S A;  3JRT A;  4DI4 A;  3CVQ A;  1TWH A;  4ULW A;  3UGO A;  3G2V A;  2WVQ A;  1E7U A;  4G0H A;  3C98 A;  2IXN A;  3MEK A;  2J08 A;  3FTW A;  5JHB A;  4RD9 A;  4U5C E;  2WVO A;  4LCT A;  4N06 A;  2R7Q A;  2PQR A;  2YHS A;  2WPV A;  3CK8 A;  4AY5 A;  2R7T A;  4B89 A;  3ZIB A;  4G2V A;  3L34 A;  2PF4 E;  4O7G A;  4DI3 A;  3SHF A;  5LX8 A;  1ZU2 A;  2PM6 A;  3L08 A;  3ONK A;  3W2V A;  2X6K A;  1FTS A;  3ENE A;  4B94 A;  3PNL B;  4ANV A;  2R7O A;  3G2U A;  1D0X A;  4J0U A;  3T5V A;  1N52 A;  4AM9 A;  2VSY A;  2IOQ A;  4KBQ A;  4G26 A;  3FUF A;  3UR3 C;  4XTK A;  3QAR A;  2KCV A;  4LRZ A;  1TJC A;  3PUJ A;  2XXA B;  4DOZ A;  4JZY A;  3TJP A;  2HYZ A;  3FU0 A;  3CVU A;  3OAW A;  1O87 A;  4FWV A;  4I17 A;  2UWJ G;  3S0X A;  2IOL A;  3MLG A;  4OIR F;  4PH4 B;  3F47 A;  2YHC A;  2P58 C;  2AW6 A;  2J0W A;  5EKQ D;  3HHM A;  3AG4 C;  2CW0 F;  2XRH A;  4U0S A;  4KBL A;  3B7U X;  4AE4 A;  1NP7 A;  4Q4Z F;  5DVW A;  4FP7 A;  4DLQ A;  2EIK C;  4I6E A;  2J7P D;  3N24 A;  4PS3 A;  3UMV A;  3EZH A;  4MLP A;  3UT7 A;  3QDN A;  3QB2 A;  1NG1 A;  3FH8 A;  2LO6 A;  2XRZ A;  4M63 A;  1PC2 A;  4JC8 A;  2MOW A;  4URK A;  2UY1 A;  3PVL A;  4A1S A;  1SMY F;  3HVE A;  4E6H A;  4Q7C A;  4I43 A;  2RD0 A;  3LS8 A;  4QFV A;  1J8M F;  3AG2 C;  3ZIM A;  4KVM A;  1E8W A;  1HO8 A;  4YWQ A;  1NZE A;  4JXT A;  2V26 A;  2EIJ C;  2M63 A;  1EDU A;  3ZEF A;  4C0E A;  5FQ8 A;  2Q9C A;  2PL2 A;  3MCX A;  4GYY A;  2JD3 A;  4GCO A;  2GFH A;  2FBN A;  2XPZ A;  4L23 A;  4DBR A;  2XSE A;  4I6J A;  3EGX A;  5A6C A;  1MQS A;  4EBA A;  2OVF A;  4BT9 A;  1IHG A;  1LVK A;  1IQU A;  1BR2 A;  3UGP A;  1HG2 A;  2WZG A;  2NG1 A;  3NYM A;  2WZL A;  3VTX A;  3L13 A;  3LJB A;  4UQY A;  3ASO C;  3PH0 C;  3LKU A;  1U3C A;  3EQL F;  4UQZ A;  2G3V A;  2I1K A;  4EZK A;  1TWC A;  1M57 C;  4AE4 B;  4I1M A;  1NU7 D;  4HOT A;  3ABK C;  2AWI A;  5EGY A;  4U8H A;  4F4B A;  1TKN A;  4A3T A;  2C0M A;  2J7P A;  4JW1 A;  4JZA A;  2XGS A;  4GA1 A;  4HEA J;  1FVH A;  3B13 A;  4CS8 A;  3T6B A;  3PZD A;  4Q94 A;  3GOD A;  4HXI A;  3S7F A;  1ZHT A;  1VMA A;  2G62 A;  3LAY A;  1HFA A;  3NQP A;  2AXU A;  4G7O F;  2LAH A;  4PK4 A;  4HOU A;  1W2W A;  4CCA A;  4LEU A;  4FES A;  1V54 C;  1PAQ A;  1HS6 A;  3FH5 A;  4FJY A;  3MV2 B;  2OCC C;  5ANR A;  2VTB A;  2IJG X;  3GW4 A;  4HVB A;  5T8I A;  2B0J A;  1ZU5 A;  4OIQ F;  3I4R B;  3EIJ A;  1U3D A;  1Z6A A;  3CVL A;  3T8M A;  1IYG A;  4CT0 A;  2KCL A;  3O4Z A;  5BNW A;  3EGX B;  3ZYL A;  3Q7L A;  3QOU A;  3B0V C;  1S0P A;  2ILR A;  1GW6 A;  3RIB A;  4ACK A;  4PJL A;  3LS1 A;  3CHM A;  5T3W A;  3CHR A;  1NA0 A;  1QLE C;  3PMR A;  5EX3 A;  4I9E A;  1PD1 A;  1ZU4 A;  5FWQ A;  3T6J A;  1OWO A;  2YEV A;  2Y3G A;  4BEJ A;  3CSK A;  3FWV A;  3CVX A;  4OD4 A;  4EQF A;  1O5H A;  1ELW A;  4G1T A;  2OVB A;  3UMI A;  4BTA A;  1Z3I X;  4RVB A;  3RKO F;  1XNF A;  4AEZ C;  5AYW D;  3I5P A;  3K7D A;  4H4K C;  1Y6I A;  2IYL D;  2XGO A;  2YQ8 A;  4DJA A;  4OYS A;  2GRL A;  4U5B E;  1E96 B;  4B8A A;  3ZVR A;  2J45 A;  3URZ A;  4F7A A;  1ST6 A;  3CVV A;  1HF8 A;  2WVI A;  2VTB B;  4PUC A;  3U64 A;  4QDL A;  4A1G A;  3APF A;  1JPJ A;  1TWG A;  3MGB A;  3ASG A;  4YT2 A;  3RU0 A;  2ION A;  4K7B A;  1M2V A;  3GYZ A;  4KZ0 A;  4EPZ A;  3EFO A;  1PY1 A;  3PDN A;  3R7R A;  2FUL A;  3KH2 A;  3VLD A;  4G24 A;  4PJJ A;  3SZ7 A;  1UN9 A;  3I4U A;  4KZC A;  2W9Y A;  3KS2 A;  3AG1 C;  3NDB B;  2H7O A;  1TJF A;  4UI9 J;  4J8D A;  3SEO A;  3E70 C;  2E87 A;  2EQX A;  1Z5Z A;  2KNH A;  3AU5 A;  3IHY A;  4GCN A;  2X6J A;  5BUZ A;  1H2U A;  4JL0 A;  3ZYK A;  3JCU Q;  4RSY A;  4BJ5 A;  3FAJ A;  4I9C A;  3N71 A;  3MV3 B;  4AJW A;  3QK0 A;  2ZU6 B;  3PHF 2;  4FLB A;  4KXK B;  3ZC4 A;  4J30 B;  4CGV A;  3DZA A;  3FUM A;  2X6F A;  2W45 A;  2VGX A;  3DJU B;  3CHO A;  2A6E F;  1MMA A;  2XHE A;  1OCZ C;  4C3E A;  1OUV A;  3JT1 A;  4YJW A;  2IF4 A;  3N2Z B;  2PP4 A;  1JWG A;  1P5Q A;  1VDY A;  3TL5 A;  5L3V A;  2I1J A;  3OWT A;  2WQH A;  1H19 A;  3LVR E;  2LAI A;  4YVQ C;  5CMY A;  3S29 A;  3Q7G A;  2IOS A;  3I3N A;  5FTP A;  4FUL A;  5G05 C;  3SD5 A;  1EYH A;  2A1D D;  1TR2 A;  4FAD A;  4JUR I;  1M2V B;  2PQN A;  3EFO B;  4IUL A;  3AG3 C;  2R5S A;  4UWF A;  2NUT A;  3SI5 A;  3QWV A;  5BPP A;  4P29 A;  1OKK D;  3RK6 A;  3L54 A;  5LFA A;  4I44 A;  3T4R A;  4XWJ A;  3ULQ A;  1NZN A;  4EZJ A;  4GZ3 A;  3U66 A;  3SP1 A;  3IHV A;  2C0L A;  2L0I A;  4YT8 A;  4N2Q A;  2MYS A;  3T5X A;  1KLX A;  3TAX A;  4RDA A;  3PEU B;  2R7V A;  1HE8 A;  3O6X A;  2IFU A;  3KEZ A;  5DLJ A;  3X2Q C;  1FFH A;  3NRH A;  3CVN A;  2C2L A;  1JWF A;  1JUQ A;  4ANJ A;  4HE8 D;  1QZ2 A;  3FU6 A;  2A5U A;  4O6F A;  3LVQ E;  3DAF A;  3EZI A;  4OIN F;  3AS4 A;  4JHR A;  4CS9 A;  3RO3 A;  3ASH A;  2ZXR A;  2WXO A;  3ZG1 A;  2VGX B;  3FUH A;  3FUI A;  4G7Z F;  4U07 A;  2A68 F;  4CDN A;  4OVU A;  4B0Z A;  4KNW A;  1Z63 A;  2J9V A;  1M2O A;  3CR3 A;  3L22 A;  4GMJ A;  4E7Z A;  3CKB A;  4RG6 A;  3QNK A;  4PS7 A;  2OG2 A;  3G2S A;  2WMO A;  3QWW A;  3Q6M A;  2KGO A;  3GZ2 A;  2XQ0 A;  4IN3 B;  5F5H A;  2WVN A;  1V55 C;  4R7L A;  4PDX A;  3ZHE A;  3LY7 A;  3LNR A;  2R7X A;  1WY6 A;  3QKY A;  1OWP A;  2L6J A;  3ML8 A;  4UQX A;  4D10 C;  2NUT B;  4H7X A;  2W4M A;  1OKK A;  3DXJ F;  4CS8 C;  3D3M A;  2WXI A;  4IYP A;  2L9B A;  3Q49 B;  1NA3 A;  4V3I A;  4UWH A;  4WAF A;  3LEW A;  4BG0 A;  3D9L A;  4FA6 A;  4XE0 A;  3QC1 A;  4DBQ A;  1EF1 C;  2X6H A;  5KJK A;  2Y69 C;  1MNE A;  5LOZ A;  2CFZ A;  1LKX A;  1VOM A;  1LF8 A;  2DCP A;  1A17 A;  4BX8 A;  3FUE A;  1DVP A;  3IKO B;  2FFH A;  2VGY A;  3EGD A;  2YNQ A;  2VSO E;  3FTS A;  1S7Z A;  2JEK A;  2XGM A;  3WG7 C;  3FUD A;  3ZPJ A;  4O79 A;  4G11 A;  1OWN A;  3K6B A;  1E8Y A;  4CS7 A;  3CQG B;  4APF A;  4CSA A;  3SBT B;  4GYO A;  5JJ6 A;  1JPN A;  3JYS A;  5B1A C;  4XI0 A;  4MRU A;  3AQB A;  3MJW A;  3Q15 A;  5ARG A;  2IU1 A;  1SZI A;  4KYO B;  3IBE A;  3LCA A;  4GYT A;  4E85 A;  4Q96 A;  4FHK A;  4U0U A;  1UJK A;  3ZHE B;  1HU3 A;  4WNG A;  5CMW A;  4L2Y A;  3TGO A;  3X1O A;  5BV0 A;  3NKE A;  3BG0 B;  3SZR A;  4XZ4 A;  4JJG A;  1QNF A;  3RO2 A;  2CG2 A;  2Y3B A;  3FH7 A;  1D1C A;  4N3C A;  1ELR A;  2VQ2 A;  4O6M A;  5C1D A;  3EPV A;  3EIQ C;  4E7S A;  2WXF A;  3FUL A;  4A55 A;  2WB7 A;  4I2W A;  3PRE A;  3CGH A;  1N54 A;  2EIN C;  4JEU A;  4J32 B;  2GRM A;  4LUN U;  3NYL A;  3CK7 A;  3DM9 B;  3LPZ A;  3LY8 A;  3EGD B;  3W8I A;  5KJL A;  2KM4 A;  5E76 A;  5T3T A;  4UI9 K;  3LYA A;  2J46 A;  3FFL A;  3R9A B;  3OTN A;  2PFD A;  4FU3 A;  3ZYQ A;  4Q5S F;  3S7B A;  3ZXS A;  2AVP A;  4GZ6 A;  4J8E A;  5EX0 A;  3UMH A;  4RG9 A;  1BR4 A;  3H65 A;  4J6I A;  1OCC C;  2Y3H A;  3LY9 A;  3VLF A;  3CVY A;  1WM5 A;  4CEM A;  3W8H A;  2KJG A;  3LXU X;  4DVY P;  5KJN A;  1FMW A;  5DS5 A;  3HJC A;  3G2W A;  5B1B C;  4IAO A;  5T3R A;  2J4B A;  3S7D A;  3CZ6 A;  2CDQ A;  3ITF A;  3RJV A;  2HV7 A;  4P6I C;  4N39 A;  3B9Q A;  5FT9 A;  3Q5M A;  5CCM A;  5KYU A;  2WXP A;  2L0T B;  3PNT B;  3Q47 B;  1BR1 A;  2C04 A;  4WNE A;  2WL8 A;  4KC9 A;  2R7W A;  4MS6 A;  1IW7 F;  5D91 A;  5E3C A;  4WWN A;  1Z3X A;  4GB9 A;  3ABM C;  3NF1 A;  4XLN F;  5DBK A;  1Y8M A;  2L81 A;  3CHQ A;  4F53 A;  5CCL A;  5CI9 A;  4J8S A;  3RKV A;  3FEX A;  4IJJ A;  5A7D B;  4WWP A;  2CHW A;  4YND A;  3WOD F;  5BW8 C;  2I9C A;  4HOS A;  4BJ6 A;  2HM8 A;  5BUO A;  4HOQ A;  3EHM A;  3APC A;  3MKR A;  3ZRH A;  4JHK A;  2DYR C;  2P7V A;  4YN0 B;  2Z15 A;  4ILH B;  4CDM A;  4BJT A;  4N2S A;  2Q3T A;  1Z23 A;  3OXL A;  4U0Z A;  1MMN A;  3LS0 A;  2QTV A;  5G04 J;  2BUG A;  3TXN A;  4UI9 C;  3GZS A;  3CIA A;  5E3A A;  3KAE A;  4U63 A;  3FEY A;  3OEO A;  1E8Z A;  2A6H F;  3S7J A;  2WZF A;  2KZT A;  3RRM B;  4BT8 A;  1D1B A;  4WND A;  3S28 A;  5KCM A;  2FF4 A;  2WXH A;  3DMD A;  3PRZ A;  1Z6T A;  5J90 A;  2J49 A;  3K1H A;  4BFR A;  4CS9 C;  4BSX A;  5IY5 C;  5LCW J;  2KCK A;  3AS8 A;  4LAC B;  2V3C C;  5KYU B;  4I6G A;  2KQ9 A;  5KYY A;  5EDS A;  4EBB A;  2QFC A;  2JLB A;  3JCK C;  3VTY A;  5ARF A;  3QMK A;  4WJ0 A;  5JJ7 A;  4AY6 A;  1H2T C;  4CGW A;  3ZVV A;  1Z3Y A;  3POV A;  1E8X A;  1WAO 1;  3NYJ A;  3B7T A;  3MA5 A;  3L16 A;  4B6I A;  3UT4 A;  3ZSU A;  1X5B A;  2M4E A;  3ESL A;  3ML9 A;  4XKC A;  3MKQ A;  3E9V A;  4K0R A;  3FY4 A;  4JA7 A;  4Y6C A;  3TG4 A;  3S27 A;  3CVP A;  4BWR A;  3NZU A;  3ZYM A;  2CHZ A;  3FVY A;  4GEH A;  3FTY A;  4CDR A;  2J07 A;  5G2N A;  3F46 A;  2ZXW C;  5E75 A;  1MND A;  1UG3 A;  4C9B B;  2IXM A;  3E4B A;  3D9I A;  2CG3 A;  4LLE A;  2X38 A;  2R59 A;  2WM9 A;  4GML A;  4PJN A;  5FCL A;  3DBS A;  2Y4T A;  4N5C A;  2WXQ A;  1DNP A;  4C7O A;  2BF0 X;  4JA9 A;  1QQE A;  2QY7 A;  4U5E E;  5JJT A;  1FVF A;  4LER A;  4X0R A;  1KU2 A;  3D9N A;  2KZT B;  5HSW A;  4QI0 A;  4TV3 A;  4H7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...