4IRUA

Crystal structure of lepb gap core in a transition state mimetic complex with rab1a and alf3
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
296
structure length
296
Chain Sequence
SLKPLTLLMTSSTSFSETINQWADILKTTDMEKFSFDSNPINLLELVKQFNLYVDELAITCEANNVWAKERIDSTPNLFALYDNSGGEAIHGHAFVPYYKESIVLRRLFTVDPNTFNLSRFAAFEGPCQLYCKEHKDSAWVKIQTLLTLGNGIINTLKIIKQAQAFGIDEAVTENLKALKEQFIAFQLAEADIKESLKAPSFAEPLPNKESEFFYPIDEKALAKMNGYQLATICLEELNSPKPSPLIERILSNKKFWKRINSAFESGVFKGRTDDPAGKIAKIREWHQLLQISGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Legionella pneumophila GTPase Activating Protein LepB Accelerates Rab1 Deactivation by a Non-canonical Hydrolytic Mechanism.
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase/hydrolase
molecule keywords LepB
total genus 109
structure length 296
sequence length 296
chains with identical sequence C, E
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2013-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18172 LepB_GAP_N LepB GAP domain N-terminal subdomain
A PF18227 LepB_GAP_C LepB GAP domain C-terminal subdomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1700 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4iruA01
1.25.40.830 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4iruA02
4I1OB 4JW1A 4JVSA 4IRUA 4I1MA
chains in the Genus database with same CATH superfamily
1O1RA 1UFBA 3I3NA 3UINC 5L0JA 4LLEA 4PACA 1H7IA 2HE0A 3MKRA 3ZDLA 4OVUA 1BD8A 2P0NA 3S27A 4FP7A 4XEKA 3TQOA 3LY9A 3PRZA 3CQGB 4AE4B 3UMKA 2V3CC 3M4CA 4HLLA 1BZ4A 3S7FA 1CPRA 5ENQD 1D1AA 1QPUA 3NBNB 3NF1A 4Z9JA 1FFHA 4Q5SF 5KYWA 3T8MA 1KLXA 3GM3A 1YZAA 1IKND 1GQAA 1QLEC 2OJQA 3K1IA 1VDYA 4TV3A 2VSNA 3LKUA 1K04A 1ELWA 4BG0A 2VGXA 2HJ3A 2WXLA 4J8FA 3JYSA 3MGBA 4U96D 4GA1A 1V74B 2H6FA 2IXNA 4BJ6A 4AK9A 2X6JA 5LCWC 3NAWA 2WXKA 4E18A 4U0ZA 5E33A 5KJLA 1HW2A 4R7LA 3HXEA 5AQBA 4HOTA 4MW8A 4FX5A 1Q0GA 4JEBA 4XI0A 1Z5ZA 2IBFA 1JRAA 2WQHA 3CEQA 4KBQA 4JL0A 4CEMA 1HW1A 2PF4E 4DRIB 4K5BA 3D3MA 2G62A 2Q00A 4HQDA 3UNGC 3UPVA 1TJCA 2C03A 3DPDA 3KMIA 4DX1A 1Z5SC 3PEUB 2WXRA 4N2QA 2HR2A 5CCMA 2PFDA 3Q7AA 4KYOB 2HFIA 4LCTA 4DUIA 4WNGA 2AWCA 2KK1A 2KCLA 4BT8A 3PZ2A 4G78A 3CVLA 4A1GA 2XGMA 1O5HA 4OIQF 4RVBA 3MKQB 1I4ZA 4XLPF 2RFMA 5FZQA 3UT7A 4W8KA 4F1PA 2EIJC 2O9XA 4F4BA 2NSGA 3VLFA 4ZFHA 3JRMO 2J9VA 4BT9A 1WDYA 2QUPA 3G4ZA 4I9CA 2OEVA 4WJ0A 1KNYA 3PS6A 4OD4A 3QWWA 3D9IA 1PCXA 2X38A 4P9TA 5L3QA 3D9NA 1H2UA 3EGDA 4PK4A 2AXVA 3KD7A 2YINA 1Z3IX 4FULA 4ULVA 3KSQA 3SXYA 3G2TA 1JUQA 4K5CA 3IEEA 4Y6CA 2R7WA 3E32A 2FAPB 4Q4ZF 3RAUA 1IHBA 1Q0KA 5T3TA 3L0IA 3W9FA 4HORA 1WTYA 2GWWA 5GPGB 1K8KG 1E7VA 2GRNB 5CMYA 3FOOA 2XGSA 3ZIBA 5HRYA 4K0RA 1N11A 2Q9AA 3SBSA 3S9OA 1K3ZD 3CHOA 4UDVA 4HXIA 2VTBA 4GTMA 2Y0BG 4R32A 3JXJA 4OD5A 3L22A 1NZEA 3GODA 2VQ2A 2WXHA 4KBLA 5FCLA 1S64A 3G2SA 3AG4E 3PZ4A 1G5ZA 4LDKA 1NP7A 3ZKJA 2IYLD 3RVYA 1OQCA 1O1SA 5CRVA 3AG2C 3RVZA 1U3DA 2L9BA 5AC5A 5ANRA 4C0MA 2J7PA 1X5BA 3CSFA 3FHDA 1DNPA 1E8ZA 1WASA 2YKZA 3MZLB 3Q75A 4I6EA 1CGNA 3ENEA 3VAYA 3D9JA 2QZAA 3CKBA 3VRCA 3HJCA 1BPOA 1S70B 3SXMA 4JEAA 2X6KA 3DWWA 3RQGA 3Q9NC 4CDMA 2EQXA 4LNGA 4DVYP 1KT1A 2MWQA 2HUJA 3OA1A 4CRWA 3FU6A 1CGME 1TNZA 3MFNA 1QZ2A 4Q96A 3ZGQA 1JPLA 1BI7B 4IGGA 2IM8A 1HMDA 4WABA 3GM2A 3ZHEB 4ULWA 3T5XA 3W9GA 4GMJA 1A5EA 1MMNA 1AEPA 2R59A 2LSEA 3B7TA 1EYHA 3W8IA 3HXDA 1V54C 3U2LA 3S7JA 3RW0A 2WXMA 1BR4A 4PJJA 3E33A 3DAFA 3ZVRA 4FU3A 4J6IA 4P9FA 1SZ9A 3V2XA 3ONLA 4Y6WA 4YK5A 3CIAA 4G1TA 5AAOA 3UX4A 3DSTA 4I43A 4FWVA 3DSUA 3WG7C 5KYYB 4WNEA 2P1AA 5C2YA 1FAPB 2XCBA 5JP7A 1AVOB 4K7BA 1M57C 3EHRA 3MKQA 4DRXE 2VCCA 1JPNA 2GROB 3CVVA 3SYNA 3DEPA 4GYTA 5BXOA 3UGPA 1Z6TA 4GYYA 3NMIA 1G3NB 2EIMC 4IWBA 2XLVA 3ZWIA 3VM6A 2QY7A 4FC8A 4G2VA 3M15A 4CSAA 2NG1A 2ZGDA 2UUHA 3UUXA 4AOFA 3SEOA 1XGWA 1A41A 3RJVA 4FESA 4O6NA 2DGJA 5AARA 3PVLA 2M63A 3NYMA 5JSLA 3P2BA 2X51A 2H7BA 3L13A 3R9AB 2VH3A 3ULYA 3NOCD 2DCPA 2WQ7A 3DEOA 1O5MA 2XCCA 4AL1A 1A7EA 3ZYLA 4K5AB 2IOQA 5L0DA 2YVKA 4OAVB 4WWPA 1OXJA 2RKKA 4GTOA 2XPZA 1HXIA 5BW8C 1EA8A 1PC2A 1Y6DA 1JCSA 2CFZA 2Q9CA 2M64A 2Q9BA 1RJ9A 5H7PA 3DXKG 5JJTA 4P6IC 2QNLA 3CR3A 2NSFA 4DX6D 2A0BA 1OR3A 4GEHA 3RK6A 4KNWA 4JHJA 2H6GA 4CDRA 3FY4A 2QYUA 4UQZA 2WXOA 5CECB 3LVQE 3ASNC 4MQ9F 2LFFA 4OIPF 1JR8A 1EF1C 2VSXE 5FJYA 5HKPA 4KZ0A 3TL5A 3QW0A 3LLIA 4OVVA 5EYPF 3CAXA 2XEVA 2JD3A 4D4XA 3Q79A 4ACLA 2W4BA 3K6BA 4GAAA 4O79A 1HU3A 1PAQA 4DBRA 3RO2A 3HYMB 5JHBA 2DYSC 3B0PA 2DYRC 1HO8A 4U9EA 2YLGA 3PUKA 4B6IA 1SZAA 1IQUA 2QLAA 3RRNB 5A6KA 3LDZA 4MVUA 3VLDA 1V55C 2BE5F 4YJWA 3J5PA 3LJ3A 2FBNA 3L16A 1HX8A 3PE4A 1SW6A 3C3RA 4GYWA 3SBTB 5BPPA 5A23A 3LNMB 3G2UA 3Q4AB 1WN0A 1H2TC 2A1DD 2I9CA 4AY6A 3HNIA 3FTUA 1YVIA 3KEZA 2MYOA 2EIME 5BT1A 1N52A 2X3MA 1A7DA 4JCZA 1N54A 3FWVA 4JKVA 1TR4A 3K9IA 4G8KA 4V3IA 1MNEA 1NFIE 4CS9A 2YHSA 3L9TA 5L0IA 2OV8A 3ASOE 2R7RA 3R7CA 4E0IA 2VSYA 4YDWA 2GRPB 1VLTA 3CZ6A 4U8YD 4ONSA 5E76A 5B3SC 4J7TA 2AP3A 2AJAA 2ZPAA 3ZTZA 4UQXA 4L6RA 3S29A 5BQIA 3TOMA 1LKXA 3RFYA 2GA0A 4FAPB 4WWNA 5L0GA 3Q7GA 4K1OA 2OCCE 4J8YA 5T8IA 1MQVA 1V54E 5D92A 4XQ1A 3S0XA 2XRZA 3KYIA 3R9MA 3BG1B 3UM2A 3V7OA 3C7JA 3MX3A 2PNOA 3B7SA 4QFVA 2P9SG 2DWZA 1JPJA 1OT8A 2A5EA 3GEHA 1N1CA 2J07A 2LNIA 4NIKA 3AS5A 2PQNA 4N6HA 3ASFA 3FUDA 4H4KC 4XWJA 1LI7A 4XEVA 2WVIA 4KVMA 4AE4A 4MTOA 5ENSD 2KC3A 1JOGA 2AVKA 4LSZE 3FU5A 4F3VA 1PV3A 1ZHXA 3EHMA 1LD7A 5G04J 4XKBA 4I2ZA 1ORSC 1TWGA 4IRUA 4YDYA 3WAQA 3U9MA 2H7OA 4CIPA 3HRAA 3FU3A 3PREA 3C8ZA 5CI8A 2ETCA 1KZOA 5DQZA 5D2MC 1UN8A 4I2WA 2YL1A 1J8YF 1MMAA 3E70C 1KU2A 3MYVA 4UWHA 1H0AA 5COMA 3ITFA 2XL6A 3NRHA 3W8HA 2D5RB 3JSZA 4JC8A 3UI2A 2Q4FA 3IQCA 3UM3A 3S7DA 4YL1A 4MLPA 4TXPA 4DRJB 3RU0A 4TRQA 3TWXA 4CDAA 4YL0A 4QQIA 3ZIMA 5M72A 4EUKB 4GMLA 3ABLE 1OKKD 1RKEA 2CHXA 3EIQC 1CGOA 4Z9HA 2VCAA 2XLDA 4C7OA 3V31A 3QK0A 3O48A 5DIZA 5ENOD 1TEZA 2B0OE 4UI9K 4I9EA 2JPUA 1BBHA 1LPEA 4EBAA 1K1BA 3UKRG 4LNBA 2Y3DA 4XPYA 3ECSA 5JT4A 5CI9A 2UY1B 1D8EA 5BUOA 2F0YA 2DB4A 4CJOA 2ETBA 4E85A 3O10A 3VTXA 5EX3A 2FO7A 2GFHA 4KI2A 2ZGGA 3CVQA 3D9MA 2NSZA 2GGFA 2AWYA 1KPSB 4Q94A 2ILRA 2Y39A 1ELKA 3C18A 1ZVZA 3NDBB 3DM9B 2OOCA 3TG4A 3QB2A 3Q47B 1P5QA 4BJTA 4BJ5C 3LUTB 3V79K 3U9JA 3O6XA 1PD0A 3FH8A 2XXAA 2XGOA 3Q7FA 4DX2A 5BQGA 2YWAA 1H9GA 3UIPC 4AP2A 3C3OA 2GDCA 3BG0B 1H6GA 4A3VA 2KJGA 3AU5A 3FTXA 1V4AA 3UR3C 3HVEB 4BSXA 3UMIA 4ANVA 2LP4A 2LIGA 3HLZA 3B0VC 2BKKB 4PJLA 1ORJA 3Q9UC 3B95A 2ONDA 3KPHA 3DWLG 4I3MA 3K1IC 3HIZA 1KZPA 4GYOA 4DJAA 5AENA 5HSWA 1LD8A 5AN8A 2RD0A 1JWFA 3HVEA 2RD9A 4U9DA 2VGEA 3T8KA 3X2QC 2AXZA 2XENA 2IXOA 3H2UA 2OG2A 3EJNA 3N24A 4CGVA 1YYXA 2IQCA 2HMZA 2VJ8A 4G11A 2XS1A 5A6BA 3JYYA 1YARO 3LLKA 3KSLA 3LAYA 4GZ3A 2IJGX 3ZC4A 2L6FA 3QTHA 4RDAA 4K0DA 2EIKE 1RJ9B 2PZIA 4MS6A 3D9KA 2C04A 3ULQA 2OKUA 1YA7O 2RG8A 4GU5A 3QARA 1ZW2A 4JE9A 2R02A 3MYIA 3T6BA 1LS4A 1MQSA 1ZU2A 1L3PA 5DS6A 2L6JA 3OEOA 5AJDA 3Q73A 1H2VC 1G8XA 2EPNA 2GRQB 3NG1A 4N3BA 3BU8A 4B8AA 4U5GA 2W45A 3UMHA 1N0RA 4WUYA 2OCCC 4E7ZA 3C8GD 5EIDA 4ZLDA 2V4LA 3K66A 4ER9A 4QI0A 5A69A 4PS3A 3SF4A 3ABKE 3JYHA 4YT4A 1DOWA 4PJNA 4J8SA 3WXXA 3AAAC 2XEHA 4MW3A 1MX6A 2HKVA 4EHPA 2WXGA 4ILHB 1A7VA 4OINF 3CLJA 4GCNA 1XZPA 4FHJA 3UM0A 4P29A 2I8BA 2Y4TA 5FZTA 3CSTA 5DBKA 4XIFA 1SA4A 3SNHA 2Y4UA 4CT0A 1LF8A 3BRJA 1HE1A 1S7ZA 2OEWA 3ZN3A 2P9NG 2ZXPA 1BDJB 3V5XA 2DZOA 3RIBA 4YT5A 5KYNA 4E0HA 5DVWA 1NA3A 2Q7FA 4F7AA 3ZG1A 3R2PA 2IXPA 1NA0A 5B1BE 2BKGA 4M3OA 1NU7D 1GW6A 4XE0A 2IOLA 4IYPA 1RZ4A 2I2OA 1CPQA 2KATA 2XSEA 3PDNA 256BA 1Z6AA 3GM1A 1OWLA 3EU9A 1MMDA 1OCOE 5AGFA 2A6EF 4YDOA 1IHGA 5KYYA 3QC1A 4NRHB 4PH4B 2XQ0A 2DBAA 3S2AA 2JEKA 2XM4A 1QNFA 2IO2C 2EPKX 3EH2A 3RRMB 4U07A 4LDQA 2LQGA 4XEFA 2R7TA 4MTFA 5A6BD 1I4YA 4BEMJ 1OCZC 1ZW3A 2EPOA 2CG3A 2A4ZA 2FULA 3Q7LA 4MS2A 3L17A 5E75A 3NMJA 5CBOA 3DJUB 3UXGA 3B29A 4APOA 5BV1A 4KT6B 3I5PA 2XRHA 1IZMA 4TXQA 2HS5A 4N6CA 4BETA 3OWTA 2WXJA 1Q0DA 2Y3GA 4NACA 4HRMB 1PD1A 2V0PA 1FTSA 3DBSA 1QSPA 2J4BA 1B68A 5LX8A 4XLNF 2YEVA 4HI9A 4WAFA 4JVSA 1YCSB 1FT1A 2XPYA 2YQ8A 4ZLCA 4KVOA 3DPYA 4QI2A 2W9YA 1Y4CA 2IXMA 3AQCA 3Q6MA 3C5RA 4ABNA 3ZFWA 3CVPA 4EZJA 2H6HA 4G8LA 3KAEA 2L6HA 1T6UA 2I1KA 2WMOA 5G2NA 1HZ4A 3LEOA 4NQFA 2CW0F 3KH2A 3Q49B 5EK0A 3SXZA 4DVZA 1ZYRF 2VC9A 1K40A 2QC9A 3CHRA 1HMOA 2X0CA 2Q7RA 3PEVB 2J4DA 2A0UA 5ANLA 3GYZA 2R5SA 4RSYA 3TWRA 4NTFA 4LDRA 3LEWA 4XEIG 2R7SA 3ZU7B 1IXVA 4KNVA 3LS8A 4YT8A 3TJ5A 4U5HA 5AQ7A 1ZHWA 3VTYA 1LIHA 3V5ZA 3AG3E 3JQ0A 5A6AA 4QDLA 3FAPB 4CS8A 2IFUA 3AG3C 3NB2A 1Z63A 3C8GA 3LVRE 4WWOA 4AY5A 2R7XA 2NUPB 3K7DA 2IOSA 4NY3A 1GS9A 2J09A 3AGTA 3OTNA 4ILIA 3ZRHA 3GZSA 3MCXA 4CYMD 1WOLA 3M1CB 2JABA 1E8XA 3HXFA 4U5BE 3EU5A 4E7SA 4E6HA 5D91A 1DCQA 2L6BA 4L2YA 2NYJA 3L8IA 4DJ9A 4YWQA 1TJFA 1OCOC 3TOLA 1D0XA 2CDQA 5ENTD 4J32B 3KS2A 2L81A 3MBGA 2JX0A 3IBEA 1ZB1A 3O4ZA 4TUMA 1XZQA 5AJLA 4WNDA 1D8DA 2I15A 5FIOA 5COGA 4WNFA 3QWPA 1HFAA 1SVXA 1FPPA 1ELRA 2FEZA 3FUEA 2KM4A 2UWJG 5KYXB 4DX7D 2WXFA 1E85A 2ETAA 3TD7A 4TUUA 3LY7A 1SMYF 4GZDA 3GWNA 3SY2A 3FDQA 5JS5A 3UM1A 4GZ6A 1NU9C 4N2SA 3G4XA 4X0RA 2AWIA 3DRAA 2OEXA 1FMWA 4O60A 2OQMA 3FUHA 3U0CA 3PDMP 3X2QE 2FF4A 2B6CA 2V4HC 5ARFA 2CG2A 4N3AA 2GAQA 2XLMA 3DSVA 3ABKC 4N5QA 2WL8A 2YNQA 3L54A 3FEYA 3C63A 1YMPA 3FULA 3O55A 4L23A 2F8XK 2R2LA 1D0ZA 3U9WA 4MNDA 3LJBA 4I1OB 1AP7A 2PNNA 3M4BA 4G24A 3IHYA 4BWRA 5BXUA 1ZU5A 3RRUA 3HG0D 5CEDB 5LCWJ 3EZHA 1SZIA 2JLBA 2ZIRA 3AGUA 4URKA 3CVUA 4A4AA 2FGYA 2Y69C 4J8DA 2A5UA 3ASDA 1DC2A 3Q15A 4CDVA 1TNYA 2QE9A 4K03A 4JEUA 3FH5A 4J7YA 4WGYA 1AWCB 2GW1A 5D0OD 4CZ2D 2LFDA 2EPLX 5JMND 3KYJA 1RKEB 4XKCA 4G25A 2J9QA 4G26A 4GA0A 2ZXOA 2PM7A 3RQFA 4H7XA 3E9VA 5D66A 4C7OB 4DI4A 2LXMA 3CVWA 4TXRA 2A68F 2XS8A 3CK7A 4MVMA 4OIOF 4ME2A 1PY1A 1OCCC 1ZHTA 2DZNA 3D9PA 2UY1A 2VGXB 3ESLA 3LS0A 4CT4A 4HRNA 4AL0A 2X6FA 5CEAA 2WM9A 3AS8A 3ZYKA 2BL2A 4BEPA 5FZRA 1ZU4A 2EINC 5E2QA 3NZSA 2QYJA 4L2LA 1FVFA 1YZCA 1NSGB 5L3VA 2HO1A 4JHRA 3OAWA 1UJKA 2IEJA 3GZ2A 4RQIA 2I6HA 5KWDA 3RIPA 2AXUA 5L0FA 4EBKA 3MYFA 2F22A 3B13A 1VK5A 3QMKA 4JCHA 2WPVA 4GCOA 1J8MF 4I17A 2FO1E 2OU6A 1YA9A 3K33A 2C0MA 1N0QA 1Q0MA 5BUZA 3AJMA 3WODF 1TNBA 4O1PA 5DQTA 3L1MA 3ML9A 1TNOA 3ESKA 3PH0C 4X8QA 3V2OA 1OWOA 5ITZF 1EDUA 3FVYA 3HXBA 4MVQA 3V30A 3LY8A 5LP0A 2AW6A 4O6YA 5JJ6A 3ZXSA 1TFOB 4MRUA 1E86A 3HTKC 3LJNA 5CERB 1OXBA 2XHEA 1S0PA 2HYZA 2XL4A 4L9PA 4N3CA 5G05C 4LERA 4LRZA 1IQRA 2HSBA 2XLWA 4BJ5A 1LE2A 1S05A 5DS4A 3TJ6A 1LE4A 4AM9A 1FCHA 3G2VA 3S84A 3HXCA 5KCMA 2ZXWE 1NI1A 3LEVA 2Y3AA 4U63A 1MHQA 4I6JA 4DXWA 2OVFA 2P9IG 1R4TA 2YZSA 3ABME 3VF0A 2L7AA 2G3VA 3RO3A 2J9WA 5IY5E 2B0JA 3O39A 2X6IA 5FQ6A 1XNFA 3ATPA 2R7UA 1E96B 1EPUA 4JZAA 1YAUO 4JXTA 2CFUA 3RSEG 1QYMA 1O87A 1Y8MA 1YYHA 1ZZPA 4JRZA 3AG1E 2KGOA 5G04C 4BX9A 3FTYA 5FQ4A 3HNKA 3QWVA 4J8EA 2FFHA 2HV6A 4Z9IA 4IAQA 3JXIA 4OYSA 1T6IA 4WGZA 2CHZA 3JUIA 3E30A 3EGXB 2WVNA 2EIKC 3JCUQ 2BC5A 1BR2A 2E2EA 3A11A 3APCA 4EWCA 5B1AE 1EKYA 2J7PD 1BI8B 3IPMO 5KBAA 4O6MA 3ZW3A 5J08A 2WXPA 3PCVA 1MJ0A 3CV0A 3QOUA 2DVWA 4GPMA 5A7DB 4DRHB 2Z15A 4BPMA 4UWFA 4F53A 3DE8A 4XI9A 1FFTC 4ANXA 1BR1A 5T3WA 4BX8A 3APDA 3B7RL 3HNLA 3APFA 1WGWA 3CQZA 1JCRA 3EHQA 4U95D 1L5JA 2LO6A 1TN6A 3DAGA 5LOZA 3UT8A 1MYOA 4DI3A 1C17M 1YYJA 5JHAA 2OVBA 4HB5A 1V55E 3ZTMA 2V26A 4CX9A 2TMVP 2H6IA 2PX0A 4YN0B 4YVQC 5T1DB 3B71A 3S28A 4GZ5A 1SA5A 2GRMA 1RMVA 4BJ1A 1HE8A 1H6OA 1OWPA 2QTVA 3ZSUA 2X6HA 4U8VD 3FUJA 1O1TA 1VMAA 1JAFA 3IQTA 3CK8A 2YL0A 2XPIA 3L8JA 4NC3A 5L0CA 3UT4A 2P2CP 1U2VG 2J8WA 3D9HA 3E37A 2KW3C 2CNWA 2QFCA 3DD7A 4JPSA 3CVXA 2HMQA 3U8PA 4HFGA 5J90A 3U5SA 3ASNE 1UG7A 4GPKA 2WZLA 2XL8A 3TWQA 2RSEB 3SZRA 5KYXA 3I4GA 2ZD9A 3SI5A 2VYIA 3ZPJA 4HEAJ 3ASGA 2YRFA 2CCYA 3UQ3A 2DI3A 5AQAA 1HG2A 5T4YA 2PP4A 4CCAA 1R5ID 4CSAC 3TWTA 2Y3HA 1YA0A 5K0IA 4Z68A 1NFNA 1OWNA 4JA7A 3P1UA 1HG5A 3EFOA 4CBEA 2BTDA 1N94A 2MOWA 2R05A 4BERA 4I1AA 1MNDA 1M2VA 2P7VA 1I5NA 3F47A 4EPZA 3D9OA 1M56C 1S63A 4BTAA 2J9BA 5JLIA 1RW2A 2KCVA 3BEHA 2PQRA 4C48B 4EHMA 2BEDA 2VSOE 1ORYA 3ULEG 2R25A 4O1OA 3C8GB 5IY5C 5ENNA 3F46A 1UJJA 1UOHA 4KZCA 3ISMC 3TGOA 4OAUC 5ENPD 4U0UA 2MRIA 5EYLA 2BF0X 1U89A 4MBGA 2HZ8A 2MYSA 3CHQA 3SHFA 2LK4A 1O3UA 3JUEA 3FUKA 4CIHA 3DJNB 3GEEA 4EBAG 3CEXA 2EILE 1H6PA 3CSKA 2XEEA 1QZXA 2NC9A 2WXIA 5AYWD 1Z7Qc 2NUTA 4U5DE 3JQ1A 3S7BA 5JVEA 3RH3A 1HS6A 2R17C 1FT2A 2XLEA 5FQ7A 3ONKA 3B7UX 3SXKA 5KYUB 1OR2A 3FUNA 3LNRA 2XM0A 4HNAD 2VASA 1EI7A 5ARGA 4A2NB 3FOPA 4C9BB 4JJGA 4YT2A 3ABLC 4U5FE 4AXHA 1K05A 2VTBB 3RF3A 3RKOF 1JCQA 1OY3D 3IQ6A 2P9PG 3IHVA 4U04A 4OIRF 4KMOA 3ZEFA 2P9UG 3BUAA 2D4UA 2R7QA 4E17A 4EBJA 3GZ1A 4RG9A 2CNWD 2DYSE 1QQEA 5KJNA 4U7EB 2EPMX 4FLHA 3LXUX 4HVBA 2WXNA 1MX2A 3MLGA 4UUCA 2XRYA 5BV0A 4UWGA 4W9RA 1W2WA 1E90A 3CHMA 3SZ7A 5A6JA 2LSVA 3VLEA 1WWPA 4ANUA 1LTXA 2IO3C 4PR9A 3G50A 3QAQA 3FUIA 2H8AA 3TWWA 5AC4A 2KBXA 3WG7E 3T5VA 2QY9A 4PFPA 3NQPA 3DSSA 3AG2E 1YLMA 4J30B 4GTPA 1IYGA 2J0WA 1OCRE 2ZU6B 5F5FA 3I5QA 4MTGA 3OXFA 2RFAA 1NFOA 3E4BA 3UGOA 1N4SA 4JHKA 3LCAA 1YJGA 4EBBA 3U4TA 4ANWA 4XZ4A 3GEIA 3AG1C 3ZQYA 2KZTA 4DX5D 2WQ6A 4G0HA 5BNWA 3QZCA 4HLEA 1DVPA 1IW7F 4CDNA 3L82A 4GTRA 2L9JA 3DE9A 3FHEA 3FDHA 1U3CA 3NZUA 4RG6A 1M2VB 1WM5A 3NYLA 4NURA 2XLHA 3DKAA 5HQ8A 3HNJA 2KSFA 3W4YA 4LLCA 1N4PA 1Y6IA 3FTSA 2R7OA 4AEZC 1OW8A 5FQ8A 1Z3XA 4N39A 2YLDA 3MEKA 4ATZD 3DSWA 5B3SE 4C3EA 4H7YA 3TK0A 4FA6A 5CMWA 1SF8A 4GA2A 1SQMA 3LS1A 1DCEA 4HI8A 3C98A 1G4WR 4C3BA 4ILGA 1TN7A 4GB9A 3J5QB 4CS7A 3CK9A 2WMNA 3NYJA 1TFKB 3UKUG 3T4RA 2PM6A 3ZUVB 4DBQA 3PZ1A 3EFOB 3N2ZB 3NKDA 3QJZA 4F6RD 1H19A 1L7CA 2ASRA 3L08A 1HE9A 3AG4C 1RXQA 5EN5D 2LAHA 1N4QA 3T6JA 3K1HA 3QVZA 5KNHD 4PS7A 5HS0A 1GGQA 1TQGA 3OXLA 1E84A 3W2WA 4I1MA 3FFLA 4LACB 3FUMA 1X81A 3ABMC 3QVYA 4JZYA 2E0IA 5CBNA 3TXMA 2PBEA 2P9LG 3GWLA 3SO8A 2DYRE 3B0UX 2ZXWC 2G3KA 5B3IA 3FEXA 5JUAA 1OCRC 3L34A 4IULA 2AU5A 1TNUA 1E2XA 2HJMA 4IB4A 2L6GA 1D0YA 1QBQA 4FADA 1LS1A 2ZISA 1HY5A 2KNHA 1UW4B 5FZSA 1OW6A 4MVRA 3WHNA 3TXNA 3DXMG 1Z23A 3ASOC 3ZQVA 3KL4A 1C02A 3IQ5A 4IARA 4EECA 1AUEA 1KTMA 2HM8A 3F6QA 1VYIA 3PE3A 4NTBA 2WVOA 3LPZA 3N71A 4GTTA 5E3AA 4ATGA 3HDXA 3FXHA 3FU0A 3R7QA 1YDIA 4B94A 3E34A 1BU9A 3ZNGA 3N0TA 4C0EA 3A9CA 4XPWA 2YHCA 5KYUA 3M79A 4BESA 2F8YA 4UI9C 1OKKA 4BY6A 2WZFA 4NCQA 4HS2A 4HOSA 4I6GA 3JZ0A 1MMGA 5F5HA 3FH7A 3UIOC 4LEUA 3MJWA 3J06A 1HF8A 3EH1A 3NMKA 3GW4A 3JSEO 2L0IA 3V5YA 3W2VA 2J45A 2OJED 4BSZB 4CS9C 3KEAA 3ZYQA 4PDXA 2CYDA 4MKTA 3C72A 2PX3A 1OWMA 2VB6A 3PZDA 1LM3B 2P58C 2IONA 1H9TA 3FTZA 4KXKB 2IY0C 4DLQA 1NBBA 3R7RA 1RKCA 4G7ZF 3Q6NA 1OCCE 2KC7A 3C62A 5T3RA 1T9KA 2EILC 5G55A 4U0SA 3GORA 4GMRA 2ETSA 5HV9A 2E87A 4PFOA 2DIWA 5CRUA 4DPRA 1HH8A 1VYKA 4G7OF 5JJ7A 4LG6A 4ACKA 4KC9A 1INZA 4JTAB 1TKNA 2Y3BA 2V5QC 3UMVA 4UI9J 3JCKC 4HOUA 2ZXRA 1JWGA 4LUNU 5FWQA 5HI7A 1QVXA 3FMSA 4ANJA 2C2LA 5E3CA 5D0QD 3FTVA 2LAIA 3DXJF 3DMDA 4HFFB 4RD9A 2NUTB 3CHSA 3QDNA 3LYAA 3US6A 3U3FA 3SQVA 4CS8C 2IU1A 3CVNA 4JTCB 4IN3B 1E8YA 3SFZA 2VGYA 4HRLA 4HOQA 3VYWA 2YHEA 4O7GA 2KXPC 3I4RB 3Q5MA 4MVZA 2J8SD 5COFA 1VLSA 3ASHA 4GTVA 3AU4A 2A6HF 4J7WA 4FJYA 1C03A 1A0BA 1VOMA 3PMRA 1APCA 5EX0A 4JTDB 5B1BC 1E7UA 4B0ZA 4N5CA 4JURI 3CGHA 4C3DA 5BQHA 3FUFA 4DK5A 1WATA 1Q2ZA 2F37A 3GANA 1ZHYA 4UWLA 1OXKA 1ZBPA 5L0HA 1NLXA 4G23A 3FP3A 1OUVA 1D1CA 4RBNA 5EHHA 1B89A 4UWKA 3OXGA 4L7TA 4IAOA 4O6FA 2A69F 1NZNA 2PL2A 2XZTG 3C3QA 4AV7A 4EQFA 3ZXPA 5KJKA 1M2OA 1WY6A 5C1DA 4HE8D 3IXEA 2YLIA 1H6KA 2W4MA 1D1BA 3POVA 2H7VC 1F1MA 4F1SA 2B0HA 1LI5A 1T6QA 1GM5A 3MA5A 3EPVA 3PNLB 3CVYA 3DI5A 2KCKA 1QQ3A 2R9RB 5FTPA 2EIJE 4LNUD 3EUVA 2OOEA 4U5CE 5F28E 4L1BA 5FT9A 3DZAA 1JMWA 5A6CA 2J9UA 3FTWA 3PUJA 3EHNA 4GQHA 4N4WA 2NXPA 5JRAA 3IHUA 4Q69A 4GZCA 5EDSA 2J46A 2CHWA 4FJZA 2XLOA 4GTQA 3TAXA 2BUGA 4PUCA 1RCPA 3H65A 1TWHA 1KT0A 1ZHZA 2WXQA 3B9QA 2KZTB 3DSXA 5EKQD 2KYHA 1D9SA 3Q78A 2C0LA 3RQEA 2XXAB 3CHPA 1OW7A 3MV3B 4AIFA 5KYWB 4NTAA 3T6GB 4IJJA 3ZHEA 3EG9A 4JA9A 3TWSA 2IF4A 5TJ5E 5AQ9A 3MV2B 5KJMA 3SP1A 1K1AA 1DOVA 1NL4A 5B1AC 4AJWA 3FAJA 4N06A 4U5EE 1MX4A 4ZHBA 5DLJA 3LESA 3UTMA 3URZA 3SNXA 2Q3TA 1BLXB 3EG9B 2J49A 3SD5A 1WG0A 2MHKA 1N9AA 5LFAA 1FR0A 2LUHA 4MVSA 4RLYA 3TWVA 3QKYA 4CDYA 5CHEE 1ST6A 3IEGA 1A17A 1TR2A 3U66A 4BTBA 2HV7A 2Y69E 3IV0A 4H54A 3DM5A 2LCHA 5EGYA 5FINA 3AOUA 4BJ6C 3TWUA 4CGWA 2MHRA 1FVHA 4AX2A 5AIJA 1SR2A 4AVXA 1W3BA 4HFKB 3BEEA 2ICWG 2P61A 3EGXA 3B7BA 4A1SA 1UN9A 3AS4A 3HHMA 5EIBE 3ML8A 2YQYA 3EZIA 2LSUA 2YL3A 1M6TA 3PNTB 3EIJA 1Z3YA 4XPXA 4CJGA 3RYLA 3U8VA 4DOZA 4BFRA 1U0BB 1N95A 4W8PA 2GRRB 4I44A 2P9KG 1XWJA 2CGEA 4BEJA 1T01A 3I4UA 3JTLO 3ZYMA 5KNGA 3EGDB 4JIOA 4YDEA 4G7HF 1FNTc 3TULA 3U64A 3U3BA 4XX5A 4B89A 3L6AA 4MVOA 3JRTA 1U6HA 3TG5A 4D10C 3SFXA 3CQCB 4DLOA 4EKWA 3SGHA 3AJIA 5EILA 3S90A 3ZVVA 2HSQA 4Q7CA 3IKOB 3AQBA 1N4RA 2YL7A 4JC7A 3PZ3A 2LD6A 4J0UA 2NUPA 3EQLF 2V8SE 3SFYA 3U3WA 2R03A 2J0XA 3QNKA 2UUIA 2NPUA 4JW1A 3D9LA 1G4US 1TWAA 1E8WA 2L0TB 5ENRD 4JJFA 4GTSA 1WAO1 5DS5A 4M63A 4YNDA 4JB8P 2M4EA 2EINE 2GRLA 2J08A 4FLBA 3QW1A 1EQ1A 1VTMP 4HBDA 4U8HA 2I1JA 1T5OA 1TN8A 4M7CA 3NKEA 4B93B 4EZLA 4JD2G 2P6VA 1Q0FA 3JT1A 4PJMA 4A55A 3HKKA 3G2WA 5CCLA 1TWCA 2AVPA 3BQOA 4EIYA 3RKVA 4B8CB 1VB5A 2WZGA 2WB2A 4JEHA 1UG3A 3EDTB 5JA4D 3H2VA 3X1OA 3T9KA 2Y1LE 3CKCA 5CIVA 1QKRA 4XTKA 3KKBA 2LXLA 1MZCA 3U2MA 4D4NA 4YVOA 2KQ9A 3T9OA 2FI7A 4FHKA 5G05J 3NOGD 4APFA 4UQYA 2VCBA 2XZDG 3TJPA 4NQ0A 2WB7A 2WVQA 2V5FA 4A63B 1OCZE 1LVKA 4YL3A 4EZKA 1E83A 4PS8A 1FMVA 1TYQG 1NG1A 1SYQA 2R7VA 3PHF2 4A3TA
chains in the Genus database with same CATH topology
3I3NA 4LLEA 3MKRA 4OVUA 3S27A 4FP7A 3LY9A 3PRZA 3CQGB 4AE4B 3UMKA 2V3CC 3S7FA 1D1AA 3NF1A 1FFHA 4Q5SF 5KYWA 3T8MA 1KLXA 1QLEC 1VDYA 4TV3A 2VSNA 3LKUA 1ELWA 4BG0A 2VGXA 2WXLA 4J8FA 3JYSA 3MGBA 4GA1A 2IXNA 4BJ6A 4AK9A 2X6JA 5LCWC 2WXKA 4U0ZA 5E33A 5KJLA 4R7LA 4HOTA 4FX5A 4XI0A 1Z5ZA 2WQHA 3CEQA 4KBQA 4JL0A 4CEMA 2PF4E 3D3MA 2G62A 3UNGC 3UPVA 1TJCA 2C03A 3DPDA 3KMIA 3PEUB 2WXRA 4N2QA 2HR2A 5CCMA 2PFDA 4KYOB 4LCTA 4WNGA 2KCLA 4BT8A 3CVLA 4A1GA 2XGMA 1O5HA 4OIQF 4RVBA 3MKQB 4XLPF 5FZQA 3UT7A 4W8KA 2EIJC 2O9XA 4F4BA 3VLFA 2J9VA 4BT9A 4I9CA 4WJ0A 3PS6A 4OD4A 3QWWA 3D9IA 1PCXA 2X38A 5L3QA 3D9NA 1H2UA 3EGDA 4PK4A 2AXVA 3KD7A 2YINA 1Z3IX 4FULA 3G2TA 1JUQA 3IEEA 4Y6CA 2R7WA 4Q4ZF 5T3TA 4HORA 3L0IA 1E7VA 5CMYA 2XGSA 3ZIBA 4K0RA 2Q9AA 3SBSA 3CHOA 2VTBA 4HXIA 4OD5A 3L22A 1NZEA 3GODA 2VQ2A 2WXHA 4KBLA 5FCLA 3G2SA 1NP7A 2IYLD 3AG2C 1U3DA 2L9BA 5ANRA 4C0MA 2J7PA 1X5BA 3CSFA 3FHDA 1DNPA 1E8ZA 3MZLB 4I6EA 3ENEA 3VAYA 3D9JA 3CKBA 3HJCA 1BPOA 2X6KA 4CDMA 2EQXA 4DVYP 1KT1A 2MWQA 3OA1A 4CRWA 3FU6A 1QZ2A 4Q96A 3ZGQA 1JPLA 3ZHEB 4ULWA 3T5XA 4GMJA 1MMNA 2R59A 2LSEA 3B7TA 1EYHA 3W8IA 1V54C 3S7JA 2WXMA 1BR4A 4PJJA 3DAFA 3ZVRA 4FU3A 4J6IA 1SZ9A 3ONLA 4Y6WA 3CIAA 4G1TA 3UX4A 4I43A 4FWVA 3WG7C 5KYYB 4WNEA 5C2YA 2XCBA 4K7BA 1M57C 3MKQA 1JPNA 3CVVA 3SYNA 4GYTA 3UGPA 1Z6TA 4GYYA 2EIMC 4IWBA 2QY7A 4FC8A 4G2VA 4CSAA 2NG1A 4AOFA 3UUXA 3SEOA 1XGWA 3RJVA 4FESA 4O6NA 2DGJA 3PVLA 2M63A 3NYMA 3P2BA 2X51A 2H7BA 3L13A 3R9AB 2VH3A 2DCPA 2WQ7A 2XCCA 3ZYLA 2IOQA 4WWPA 2XPZA 1HXIA 5BW8C 1PC2A 2CFZA 2Q9CA 2Q9BA 1RJ9A 5JJTA 4P6IC 3CR3A 4GEHA 3RK6A 4KNWA 4JHJA 4CDRA 3FY4A 4UQZA 2WXOA 3LVQE 3ASNC 4MQ9F 5FJYA 4OIPF 1EF1C 2VSXE 3TL5A 4KZ0A 3LLIA 4OVVA 2XEVA 2JD3A 4ACLA 2W4BA 3K6BA 4GAAA 4O79A 1HU3A 1PAQA 4DBRA 3RO2A 3HYMB 5JHBA 2DYSC 3B0PA 2DYRC 1HO8A 3PUKA 4B6IA 1SZAA 1IQUA 3RRNB 3LDZA 3VLDA 1V55C 2BE5F 4YJWA 3LJ3A 2FBNA 3L16A 1HX8A 3PE4A 4GYWA 3SBTB 5BPPA 5A23A 3G2UA 3Q4AB 1H2TC 2A1DD 2I9CA 4AY6A 3FTUA 3KEZA 5BT1A 1N52A 2X3MA 1N54A 3FWVA 3K9IA 4V3IA 1MNEA 4CS9A 2YHSA 2OV8A 2R7RA 2VSYA 3CZ6A 5E76A 5B3SC 2ZPAA 4UQXA 3S29A 1LKXA 3RFYA 4WWNA 3Q7GA 5T8IA 5D92A 3S0XA 2XRZA 3BG1B 3V7OA 3MX3A 3B7SA 4QFVA 1JPJA 1N1CA 2J07A 2LNIA 3AS5A 2PQNA 3ASFA 3FUDA 4H4KC 4XWJA 2WVIA 4KVMA 4AE4A 3FU5A 4F3VA 1ZHXA 3EHMA 5G04J 4XKBA 4I2ZA 1TWGA 4IRUA 2H7OA 3FU3A 3PREA 5CI8A 5DQZA 1UN8A 4I2WA 1J8YF 1MMAA 3E70C 1KU2A 3MYVA 4UWHA 1H0AA 3ITFA 3NRHA 3W8HA 2D5RB 3JSZA 4JC8A 3S7DA 4MLPA 3RU0A 4TRQA 3ZIMA 5M72A 4GMLA 1OKKD 2CHXA 3EIQC 4C7OA 3QK0A 3O48A 5DIZA 1TEZA 4UI9K 4I9EA 4EBAA 2Y3DA 3ECSA 5CI9A 2UY1B 5BUOA 4E85A 3VTXA 5EX3A 2FO7A 2GFHA 4KI2A 3CVQA 3D9MA 2NSZA 2GGFA 4Q94A 2ILRA 2Y39A 1ELKA 3NDBB 3DM9B 3TG4A 3QB2A 3Q47B 1P5QA 4BJTA 4BJ5C 3O6XA 1PD0A 3FH8A 2XXAA 2XGOA 4AP2A 3BG0B 4A3VA 2KJGA 3AU5A 3FTXA 3HVEB 3UR3C 4BSXA 3UMIA 4ANVA 3HLZA 3B0VC 4PJLA 2ONDA 4I3MA 3K1IC 3HIZA 4GYOA 4DJAA 5AENA 5HSWA 2RD0A 1JWFA 3HVEA 3X2QC 2AXZA 2IXOA 2OG2A 3EJNA 3N24A 4CGVA 2IQCA 2VJ8A 4G11A 3LLKA 3LAYA 4GZ3A 2IJGX 3ZC4A 4RDAA 4K0DA 1RJ9B 2PZIA 4MS6A 3D9KA 2C04A 3ULQA 2RG8A 4GU5A 3QARA 3T6BA 1MQSA 1ZU2A 5DS6A 2L6JA 3OEOA 5AJDA 1H2VC 1G8XA 3NG1A 4N3BA 4B8AA 4U5GA 2W45A 3UMHA 4WUYA 2OCCC 4E7ZA 4ZLDA 2V4LA 3K66A 4QI0A 4PS3A 3SF4A 3JYHA 4YT4A 4PJNA 4J8SA 3WXXA 2WXGA 4ILHB 4OINF 3CLJA 4GCNA 4FHJA 4P29A 2I8BA 2Y4TA 5DBKA 4XIFA 3SNHA 2Y4UA 4CT0A 1LF8A 1S7ZA 3ZN3A 2ZXPA 3RIBA 4YT5A 5KYNA 1NA3A 5DVWA 2Q7FA 4F7AA 3ZG1A 2IXPA 1NA0A 4M3OA 1NU7D 1GW6A 4XE0A 2IOLA 4IYPA 2I2OA 2KATA 2XSEA 3PDNA 1Z6AA 1OWLA 1MMDA 2A6EF 1IHGA 5KYYA 3QC1A 4NRHB 4PH4B 2XQ0A 2DBAA 3S2AA 2JEKA 1QNFA 3EH2A 3RRMB 4U07A 2R7TA 1OCZC 2CG3A 2A4ZA 2FULA 3Q7LA 3L17A 5E75A 3DJUB 4APOA 5BV1A 4KT6B 3I5PA 2XRHA 1IZMA 3OWTA 2WXJA 2Y3GA 4NACA 1PD1A 2V0PA 1FTSA 3DBSA 2J4BA 5LX8A 4XLNF 2YEVA 4WAFA 4JVSA 2XPYA 2YQ8A 4ZLCA 4KVOA 4QI2A 2W9YA 2IXMA 3AQCA 3Q6MA 4ABNA 3ZFWA 3CVPA 4EZJA 3KAEA 2I1KA 2WMOA 5G2NA 1HZ4A 3Q49B 2CW0F 3KH2A 4DVZA 1ZYRF 3CHRA 3PEVB 2J4DA 5ANLA 3GYZA 2R5SA 4RSYA 3LEWA 2R7SA 4KNVA 3LS8A 4YT8A 4U5HA 1ZHWA 3VTYA 3JQ0A 4QDLA 2IFUA 4CS8A 4WWOA 3AG3C 3U66A 1Z63A 3LVRE 4AY5A 2R7XA 2NUPB 3K7DA 2IOSA 4NY3A 2J09A 3OTNA 4ILIA 3ZRHA 3GZSA 3MCXA 3M1CB 1E8XA 4U5BE 4E7SA 4E6HA 5D91A 4L2YA 4YWQA 1TJFA 1OCOC 1D0XA 2CDQA 4J32B 3KS2A 2L81A 3IBEA 3O4ZA 5AJLA 4WNDA 4WNFA 3QWPA 1HFAA 1ELRA 2FEZA 3FUEA 2KM4A 2UWJG 5KYXB 2WXFA 3TD7A 4TUUA 3LY7A 1SMYF 4GZDA 3FDQA 4GZ6A 1NU9C 4N2SA 4X0RA 2AWIA 1FMWA 3FUHA 2FF4A 5ARFA 2CG2A 4N3AA 3ABKC 2WL8A 2YNQA 3L54A 3FEYA 3FULA 4L23A 1D0ZA 3U9WA 4MNDA 3LJBA 4I1OB 4G24A 3IHYA 4BWRA 1ZU5A 3RRUA 5LCWJ 3EZHA 1SZIA 2JLBA 4URKA 3CVUA 2FGYA 2Y69C 4J8DA 2A5UA 3ASDA 3Q15A 4K03A 4JEUA 3FH5A 2GW1A 5D0OD 4XKCA 4G25A 2J9QA 4G26A 4GA0A 2ZXOA 2PM7A 4H7XA 3E9VA 4C7OB 4DI4A 3CVWA 2A68F 3CK7A 4OIOF 4ME2A 1PY1A 1OCCC 1ZHTA 3D9PA 2UY1A 2VGXB 3ESLA 3LS0A 4CT4A 2X6FA 2WM9A 3AS8A 3ZYKA 5FZRA 1ZU4A 2EINC 5E2QA 3NZSA 4L2LA 1FVFA 2HO1A 5L3VA 4JHRA 3OAWA 1UJKA 3GZ2A 2I6HA 3RIPA 2AXUA 3B13A 1VK5A 3QMKA 4JCHA 2WPVA 4GCOA 1J8MF 4I17A 3K33A 2C0MA 5BUZA 3WODF 5DQTA 3ML9A 3ESKA 3PH0C 1OWOA 1EDUA 3FVYA 3LY8A 5LP0A 2AW6A 4O6YA 5JJ6A 3ZXSA 4MRUA 3HTKC 2XHEA 1S0PA 5G05C 2HYZA 2XL4A 4N3CA 4LERA 4LRZA 1IQRA 4BJ5A 5DS4A 4AM9A 1FCHA 3G2VA 5KCMA 3LEVA 2Y3AA 4U63A 1MHQA 4I6JA 2OVFA 2YZSA 3RO3A 2G3VA 2J9WA 2B0JA 3O39A 2X6IA 5FQ6A 1XNFA 2R7UA 1E96B 1EPUA 4JZAA 4JXTA 2CFUA 1O87A 1Y8MA 2KGOA 5G04C 4BX9A 3FTYA 5FQ4A 3QWVA 4J8EA 2FFHA 2HV6A 4OYSA 2CHZA 3JUIA 3EGXB 2WVNA 2EIKC 3JCUQ 1BR2A 2E2EA 3APCA 4EWCA 2J7PD 4O6MA 3ZW3A 5J08A 2WXPA 3CV0A 3QOUA 5A7DB 2Z15A 4UWFA 4F53A 4XI9A 1FFTC 4ANXA 1BR1A 5T3WA 4BX8A 3APDA 3B7RL 3APFA 1WGWA 3CQZA 1L5JA 2LO6A 5LOZA 3DAGA 3UT8A 4DI3A 5JHAA 2OVBA 2V26A 2PX0A 4YN0B 4YVQC 5T1DB 3S28A 4GZ5A 2GRMA 4BJ1A 1HE8A 1OWPA 2QTVA 3ZSUA 2X6HA 3FUJA 1VMAA 3CK8A 2XPIA 3UT4A 2KW3C 2CNWA 2QFCA 3DD7A 4JPSA 3CVXA 4HFGA 5J90A 4GPKA 2WZLA 3SZRA 5KYXA 3I4GA 3SI5A 2VYIA 3ZPJA 4HEAJ 3ASGA 3UQ3A 5T4YA 1HG2A 4CCAA 2PP4A 4CSAC 2Y3HA 1YA0A 1OWNA 4JA7A 1HG5A 3EFOA 4CBEA 2BTDA 2MOWA 4I1AA 1MNDA 1M2VA 2P7VA 3F47A 4EPZA 3D9OA 1M56C 4BTAA 2KCVA 2PQRA 2VSOE 5IY5C 5ENNA 3F46A 1UJJA 4KZCA 3TGOA 4U0UA 2MRIA 2BF0X 2MYSA 3CHQA 3SHFA 3FUKA 4CIHA 3DJNB 4EBAG 3CSKA 1QZXA 2NC9A 5AYWD 2WXIA 2NUTA 4U5DE 3JQ1A 3S7BA 3RH3A 1HS6A 2R17C 5FQ7A 3ONKA 3B7UX 5KYUB 3FUNA 3LNRA 2VASA 5ARGA 4A2NB 4C9BB 4JJGA 4U5FE 3ABLC 4YT2A 4AXHA 2VTBB 3RKOF 3IHVA 4U04A 4OIRF 4KMOA 3ZEFA 2R7QA 3GZ1A 4RG9A 2CNWD 1QQEA 5KJNA 4FLHA 3LXUX 4HVBA 2WXNA 3MLGA 2XRYA 5BV0A 4UWGA 4W9RA 1W2WA 1E90A 3CHMA 3SZ7A 2LSVA 3VLEA 4ANUA 3QAQA 3FUIA 3T5VA 2QY9A 4PFPA 3NQPA 4J30B 1IYGA 2J0WA 2ZU6B 5F5FA 3I5QA 3OXFA 3E4BA 3UGOA 4JHKA 3LCAA 3U4TA 4EBBA 4ANWA 4XZ4A 3AG1C 2KZTA 2WQ6A 4G0HA 5BNWA 3QZCA 4HLEA 1DVPA 1IW7F 4CDNA 2L9JA 3FHEA 3FDHA 1U3CA 3NZUA 4RG6A 1M2VB 1WM5A 3NYLA 4NURA 5HQ8A 4LLCA 1Y6IA 3FTSA 2R7OA 4AEZC 5FQ8A 1Z3XA 4N39A 3MEKA 4C3EA 4H7YA 4FA6A 5CMWA 1SF8A 4GA2A 1SQMA 3LS1A 3C98A 4C3BA 4ILGA 4GB9A 4CS7A 3CK9A 2WMNA 3NYJA 3T4RA 2PM6A 4DBQA 3EFOB 3N2ZB 3NKDA 3QJZA 1H19A 3L08A 3AG4C 2LAHA 3T6JA 3K1HA 4PS7A 3OXLA 3W2WA 4I1MA 3FFLA 4LACB 3FUMA 3ABMC 4JZYA 2E0IA 3TXMA 3B0UX 2ZXWC 2G3KA 3FEXA 4IULA 1OCRC 3L34A 1D0YA 4FADA 1LS1A 2KNHA 1UW4B 5FZSA 3TXNA 1Z23A 3ASOC 3KL4A 4EECA 2HM8A 1VYIA 3PE3A 2WVOA 3LPZA 3N71A 5E3AA 4ATGA 3HDXA 3FU0A 3R7QA 4B94A 3N0TA 4C0EA 2YHCA 5KYUA 4UI9C 1OKKA 4BY6A 2WZFA 4HOSA 4HS2A 4I6GA 1MMGA 5F5HA 3FH7A 4LEUA 3MJWA 1HF8A 3EH1A 3GW4A 2L0IA 3W2VA 2J45A 4CS9C 3ZYQA 4PDXA 4MKTA 2PX3A 1OWMA 2VB6A 3PZDA 2P58C 2IONA 3FTZA 4KXKB 4DLQA 3R7RA 3Q6NA 4G7ZF 2KC7A 5T3RA 2EILC 5G55A 4U0SA 2E87A 4PFOA 2DIWA 4DPRA 1HH8A 1VYKA 4G7OF 5JJ7A 4ACKA 4KC9A 1INZA 1TKNA 2Y3BA 3UMVA 3PHF2 4UI9J 3JCKC 4HOUA 2ZXRA 1JWGA 4LUNU 5FWQA 5HI7A 4ANJA 2C2LA 5E3CA 5D0QD 3FTVA 2LAIA 3DXJF 3DMDA 4HFFB 4RD9A 2NUTB 3CHSA 3QDNA 3LYAA 4CS8C 2IU1A 3CVNA 4IN3B 1E8YA 3SFZA 2VGYA 4HOQA 3VYWA 2YHEA 4O7GA 3I4RB 3Q5MA 3ASHA 3AU4A 2A6HF 4FJYA 1VOMA 3PMRA 5EX0A 5B1BC 1E7UA 4B0ZA 4N5CA 4JURI 3CGHA 4C3DA 3FUFA 4DK5A 3GANA 1ZHYA 4UWLA 1ZBPA 4G23A 3FP3A 1OUVA 1D1CA 4RBNA 5EHHA 1B89A 4UWKA 3OXGA 4L7TA 4IAOA 4O6FA 2A69F 1NZNA 2PL2A 4AV7A 4EQFA 5KJKA 1M2OA 1WY6A 5C1DA 4HE8D 1H6KA 2W4MA 1D1BA 3POVA 2H7VC 4F1SA 3MA5A 3EPVA 3PNLB 3CVYA 2KCKA 5FTPA 2OOEA 4U5CE 4L1BA 5FT9A 3DZAA 5A6CA 2J9UA 3FTWA 3PUJA 3EHNA 2NXPA 4Q69A 4GZCA 5EDSA 2J46A 2CHWA 4FJZA 3TAXA 2BUGA 4PUCA 3H65A 1TWHA 1KT0A 1ZHZA 2WXQA 3B9QA 2KZTB 5EKQD 2XXAB 2C0LA 3CHPA 3MV3B 4AIFA 5KYWB 4IJJA 3ZHEA 3EG9A 4JA9A 2IF4A 3MV2B 5KJMA 3SP1A 5B1AC 4AJWA 3FAJA 4N06A 4U5EE 5DLJA 3LESA 3URZA 3SNXA 2Q3TA 2J49A 3EG9B 3SD5A 2MHKA 5LFAA 3QKYA 5CHEE 1ST6A 3IEGA 1A17A 1TR2A 4BTBA 2HV7A 3IV0A 3DM5A 5EGYA 4BJ6C 4CGWA 1FVHA 4AX2A 5AIJA 4AVXA 1W3BA 4HFKB 3BEEA 3EGXA 4A1SA 1UN9A 3AS4A 3HHMA 3ML8A 3EZIA 2LSUA 3PNTB 3EIJA 1Z3YA 3RYLA 4DOZA 4BFRA 4I44A 2CGEA 4BEJA 3I4UA 3ZYMA 3EGDB 4G7HF 3U64A 4B89A 4XX5A 3L6AA 4D10C 3JRTA 3TG5A 3CQCB 4DLOA 3SGHA 3ZVVA 4Q7CA 3IKOB 3AQBA 4J0UA 2NUPA 3EQLF 2V8SE 3U3WA 2J0XA 3QNKA 4JW1A 3D9LA 1TWAA 1E8WA 2L0TB 4JJFA 1WAO1 5DS5A 4M63A 4YNDA 2M4EA 2GRLA 2J08A 4FLBA 4U8HA 2I1JA 3NKEA 4EZLA 2P6VA 3JT1A 4PJMA 4A55A 3G2WA 5CCLA 1TWCA 2AVPA 3RKVA 4B8CB 2WB2A 2WZGA 4JEHA 1UG3A 3EDTB 3X1OA 3CKCA 4XTKA 3KKBA 4YVOA 2KQ9A 2FI7A 4FHKA 5G05J 4APFA 4UQYA 3TJPA 4NQ0A 2WB7A 2WVQA 2V5FA 1LVKA 4EZKA 4PS8A 1FMVA 1NG1A 3P1UA 2R7VA 3CSTA 4A3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I1O B;  4JW1 A;  4JVS A;  4IRU A;  4I1M A; 
#chains in the Genus database with same CATH topology
 1O1R A;  1UFB A;  3I3N A;  3UIN C;  5L0J A;  4LLE A;  4PAC A;  1H7I A;  2HE0 A;  3MKR A;  3ZDL A;  4OVU A;  1BD8 A;  2P0N A;  3S27 A;  4FP7 A;  4XEK A;  3TQO A;  3LY9 A;  3PRZ A;  3CQG B;  4AE4 B;  3UMK A;  2V3C C;  3M4C A;  4HLL A;  1BZ4 A;  3S7F A;  1CPR A;  5ENQ D;  1D1A A;  1QPU A;  3NBN B;  3NF1 A;  4Z9J A;  1FFH A;  4Q5S F;  5KYW A;  3T8M A;  1KLX A;  3GM3 A;  1YZA A;  1IKN D;  1GQA A;  1QLE C;  2OJQ A;  3K1I A;  1VDY A;  4TV3 A;  2VSN A;  3LKU A;  1K04 A;  1ELW A;  4BG0 A;  2VGX A;  2HJ3 A;  2WXL A;  4J8F A;  3JYS A;  3MGB A;  4U96 D;  4GA1 A;  1V74 B;  2H6F A;  2IXN A;  4BJ6 A;  4AK9 A;  2X6J A;  5LCW C;  3NAW A;  2WXK A;  4E18 A;  4U0Z A;  5E33 A;  5KJL A;  1HW2 A;  4R7L A;  3HXE A;  5AQB A;  4HOT A;  4MW8 A;  4FX5 A;  1Q0G A;  4JEB A;  4XI0 A;  1Z5Z A;  2IBF A;  1JRA A;  2WQH A;  3CEQ A;  4KBQ A;  4JL0 A;  4CEM A;  1HW1 A;  2PF4 E;  4DRI B;  4K5B A;  3D3M A;  2G62 A;  2Q00 A;  4HQD A;  3UNG C;  3UPV A;  1TJC A;  2C03 A;  3DPD A;  3KMI A;  4DX1 A;  1Z5S C;  3PEU B;  2WXR A;  4N2Q A;  2HR2 A;  5CCM A;  2PFD A;  3Q7A A;  4KYO B;  2HFI A;  4LCT A;  4DUI A;  4WNG A;  2AWC A;  2KK1 A;  2KCL A;  4BT8 A;  3PZ2 A;  4G78 A;  3CVL A;  4A1G A;  2XGM A;  1O5H A;  4OIQ F;  4RVB A;  3MKQ B;  1I4Z A;  4XLP F;  2RFM A;  5FZQ A;  3UT7 A;  4W8K A;  4F1P A;  2EIJ C;  2O9X A;  4F4B A;  2NSG A;  3VLF A;  4ZFH A;  3JRM O;  2J9V A;  4BT9 A;  1WDY A;  2QUP A;  3G4Z A;  4I9C A;  2OEV A;  4WJ0 A;  1KNY A;  3PS6 A;  4OD4 A;  3QWW A;  3D9I A;  1PCX A;  2X38 A;  4P9T A;  5L3Q A;  3D9N A;  1H2U A;  3EGD A;  4PK4 A;  2AXV A;  3KD7 A;  2YIN A;  1Z3I X;  4FUL A;  4ULV A;  3KSQ A;  3SXY A;  3G2T A;  1JUQ A;  4K5C A;  3IEE A;  4Y6C A;  2R7W A;  3E32 A;  2FAP B;  4Q4Z F;  3RAU A;  1IHB A;  1Q0K A;  5T3T A;  3L0I A;  3W9F A;  4HOR A;  1WTY A;  2GWW A;  5GPG B;  1K8K G;  1E7V A;  2GRN B;  5CMY A;  3FOO A;  2XGS A;  3ZIB A;  5HRY A;  4K0R A;  1N11 A;  2Q9A A;  3SBS A;  3S9O A;  1K3Z D;  3CHO A;  4UDV A;  4HXI A;  2VTB A;  4GTM A;  2Y0B G;  4R32 A;  3JXJ A;  4OD5 A;  3L22 A;  1NZE A;  3GOD A;  2VQ2 A;  2WXH A;  4KBL A;  5FCL A;  1S64 A;  3G2S A;  3AG4 E;  3PZ4 A;  1G5Z A;  4LDK A;  1NP7 A;  3ZKJ A;  2IYL D;  3RVY A;  1OQC A;  1O1S A;  5CRV A;  3AG2 C;  3RVZ A;  1U3D A;  2L9B A;  5AC5 A;  5ANR A;  4C0M A;  2J7P A;  1X5B A;  3CSF A;  3FHD A;  1DNP A;  1E8Z A;  1WAS A;  2YKZ A;  3MZL B;  3Q75 A;  4I6E A;  1CGN A;  3ENE A;  3VAY A;  3D9J A;  2QZA A;  3CKB A;  3VRC A;  3HJC A;  1BPO A;  1S70 B;  3SXM A;  4JEA A;  2X6K A;  3DWW A;  3RQG A;  3Q9N C;  4CDM A;  2EQX A;  4LNG A;  4DVY P;  1KT1 A;  2MWQ A;  2HUJ A;  3OA1 A;  4CRW A;  3FU6 A;  1CGM E;  1TNZ A;  3MFN A;  1QZ2 A;  4Q96 A;  3ZGQ A;  1JPL A;  1BI7 B;  4IGG A;  2IM8 A;  1HMD A;  4WAB A;  3GM2 A;  3ZHE B;  4ULW A;  3T5X A;  3W9G A;  4GMJ A;  1A5E A;  1MMN A;  1AEP A;  2R59 A;  2LSE A;  3B7T A;  1EYH A;  3W8I A;  3HXD A;  1V54 C;  3U2L A;  3S7J A;  3RW0 A;  2WXM A;  1BR4 A;  4PJJ A;  3E33 A;  3DAF A;  3ZVR A;  4FU3 A;  4J6I A;  4P9F A;  1SZ9 A;  3V2X A;  3ONL A;  4Y6W A;  4YK5 A;  3CIA A;  4G1T A;  5AAO A;  3UX4 A;  3DST A;  4I43 A;  4FWV A;  3DSU A;  3WG7 C;  5KYY B;  4WNE A;  2P1A A;  5C2Y A;  1FAP B;  2XCB A;  5JP7 A;  1AVO B;  4K7B A;  1M57 C;  3EHR A;  3MKQ A;  4DRX E;  2VCC A;  1JPN A;  2GRO B;  3CVV A;  3SYN A;  3DEP A;  4GYT A;  5BXO A;  3UGP A;  1Z6T A;  4GYY A;  3NMI A;  1G3N B;  2EIM C;  4IWB A;  2XLV A;  3ZWI A;  3VM6 A;  2QY7 A;  4FC8 A;  4G2V A;  3M15 A;  4CSA A;  2NG1 A;  2ZGD A;  2UUH A;  3UUX A;  4AOF A;  3SEO A;  1XGW A;  1A41 A;  3RJV A;  4FES A;  4O6N A;  2DGJ A;  5AAR A;  3PVL A;  2M63 A;  3NYM A;  5JSL A;  3P2B A;  2X51 A;  2H7B A;  3L13 A;  3R9A B;  2VH3 A;  3ULY A;  3NOC D;  2DCP A;  2WQ7 A;  3DEO A;  1O5M A;  2XCC A;  4AL1 A;  1A7E A;  3ZYL A;  4K5A B;  2IOQ A;  5L0D A;  2YVK A;  4OAV B;  4WWP A;  1OXJ A;  2RKK A;  4GTO A;  2XPZ A;  1HXI A;  5BW8 C;  1EA8 A;  1PC2 A;  1Y6D A;  1JCS A;  2CFZ A;  2Q9C A;  2M64 A;  2Q9B A;  1RJ9 A;  5H7P A;  3DXK G;  5JJT A;  4P6I C;  2QNL A;  3CR3 A;  2NSF A;  4DX6 D;  2A0B A;  1OR3 A;  4GEH A;  3RK6 A;  4KNW A;  4JHJ A;  2H6G A;  4CDR A;  3FY4 A;  2QYU A;  4UQZ A;  2WXO A;  5CEC B;  3LVQ E;  3ASN C;  4MQ9 F;  2LFF A;  4OIP F;  1JR8 A;  1EF1 C;  2VSX E;  5FJY A;  5HKP A;  4KZ0 A;  3TL5 A;  3QW0 A;  3LLI A;  4OVV A;  5EYP F;  3CAX A;  2XEV A;  2JD3 A;  4D4X A;  3Q79 A;  4ACL A;  2W4B A;  3K6B A;  4GAA A;  4O79 A;  1HU3 A;  1PAQ A;  4DBR A;  3RO2 A;  3HYM B;  5JHB A;  2DYS C;  3B0P A;  2DYR C;  1HO8 A;  4U9E A;  2YLG A;  3PUK A;  4B6I A;  1SZA A;  1IQU A;  2QLA A;  3RRN B;  5A6K A;  3LDZ A;  4MVU A;  3VLD A;  1V55 C;  2BE5 F;  4YJW A;  3J5P A;  3LJ3 A;  2FBN A;  3L16 A;  1HX8 A;  3PE4 A;  1SW6 A;  3C3R A;  4GYW A;  3SBT B;  5BPP A;  5A23 A;  3LNM B;  3G2U A;  3Q4A B;  1WN0 A;  1H2T C;  2A1D D;  2I9C A;  4AY6 A;  3HNI A;  3FTU A;  1YVI A;  3KEZ A;  2MYO A;  2EIM E;  5BT1 A;  1N52 A;  2X3M A;  1A7D A;  4JCZ A;  1N54 A;  3FWV A;  4JKV A;  1TR4 A;  3K9I A;  4G8K A;  4V3I A;  1MNE A;  1NFI E;  4CS9 A;  2YHS A;  3L9T A;  5L0I A;  2OV8 A;  3ASO E;  2R7R A;  3R7C A;  4E0I A;  2VSY A;  4YDW A;  2GRP B;  1VLT A;  3CZ6 A;  4U8Y D;  4ONS A;  5E76 A;  5B3S C;  4J7T A;  2AP3 A;  2AJA A;  2ZPA A;  3ZTZ A;  4UQX A;  4L6R A;  3S29 A;  5BQI A;  3TOM A;  1LKX A;  3RFY A;  2GA0 A;  4FAP B;  4WWN A;  5L0G A;  3Q7G A;  4K1O A;  2OCC E;  4J8Y A;  5T8I A;  1MQV A;  1V54 E;  5D92 A;  4XQ1 A;  3S0X A;  2XRZ A;  3KYI A;  3R9M A;  3BG1 B;  3UM2 A;  3V7O A;  3C7J A;  3MX3 A;  2PNO A;  3B7S A;  4QFV A;  2P9S G;  2DWZ A;  1JPJ A;  1OT8 A;  2A5E A;  3GEH A;  1N1C A;  2J07 A;  2LNI A;  4NIK A;  3AS5 A;  2PQN A;  4N6H A;  3ASF A;  3FUD A;  4H4K C;  4XWJ A;  1LI7 A;  4XEV A;  2WVI A;  4KVM A;  4AE4 A;  4MTO A;  5ENS D;  2KC3 A;  1JOG A;  2AVK A;  4LSZ E;  3FU5 A;  4F3V A;  1PV3 A;  1ZHX A;  3EHM A;  1LD7 A;  5G04 J;  4XKB A;  4I2Z A;  1ORS C;  1TWG A;  4IRU A;  4YDY A;  3WAQ A;  3U9M A;  2H7O A;  4CIP A;  3HRA A;  3FU3 A;  3PRE A;  3C8Z A;  5CI8 A;  2ETC A;  1KZO A;  5DQZ A;  5D2M C;  1UN8 A;  4I2W A;  2YL1 A;  1J8Y F;  1MMA A;  3E70 C;  1KU2 A;  3MYV A;  4UWH A;  1H0A A;  5COM A;  3ITF A;  2XL6 A;  3NRH A;  3W8H A;  2D5R B;  3JSZ A;  4JC8 A;  3UI2 A;  2Q4F A;  3IQC A;  3UM3 A;  3S7D A;  4YL1 A;  4MLP A;  4TXP A;  4DRJ B;  3RU0 A;  4TRQ A;  3TWX A;  4CDA A;  4YL0 A;  4QQI A;  3ZIM A;  5M72 A;  4EUK B;  4GML A;  3ABL E;  1OKK D;  1RKE A;  2CHX A;  3EIQ C;  1CGO A;  4Z9H A;  2VCA A;  2XLD A;  4C7O A;  3V31 A;  3QK0 A;  3O48 A;  5DIZ A;  5ENO D;  1TEZ A;  2B0O E;  4UI9 K;  4I9E A;  2JPU A;  1BBH A;  1LPE A;  4EBA A;  1K1B A;  3UKR G;  4LNB A;  2Y3D A;  4XPY A;  3ECS A;  5JT4 A;  5CI9 A;  2UY1 B;  1D8E A;  5BUO A;  2F0Y A;  2DB4 A;  4CJO A;  2ETB A;  4E85 A;  3O10 A;  3VTX A;  5EX3 A;  2FO7 A;  2GFH A;  4KI2 A;  2ZGG A;  3CVQ A;  3D9M A;  2NSZ A;  2GGF A;  2AWY A;  1KPS B;  4Q94 A;  2ILR A;  2Y39 A;  1ELK A;  3C18 A;  1ZVZ A;  3NDB B;  3DM9 B;  2OOC A;  3TG4 A;  3QB2 A;  3Q47 B;  1P5Q A;  4BJT A;  4BJ5 C;  3LUT B;  3V79 K;  3U9J A;  3O6X A;  1PD0 A;  3FH8 A;  2XXA A;  2XGO A;  3Q7F A;  4DX2 A;  5BQG A;  2YWA A;  1H9G A;  3UIP C;  4AP2 A;  3C3O A;  2GDC A;  3BG0 B;  1H6G A;  4A3V A;  2KJG A;  3AU5 A;  3FTX A;  1V4A A;  3UR3 C;  3HVE B;  4BSX A;  3UMI A;  4ANV A;  2LP4 A;  2LIG A;  3HLZ A;  3B0V C;  2BKK B;  4PJL A;  1ORJ A;  3Q9U C;  3B95 A;  2OND A;  3KPH A;  3DWL G;  4I3M A;  3K1I C;  3HIZ A;  1KZP A;  4GYO A;  4DJA A;  5AEN A;  5HSW A;  1LD8 A;  5AN8 A;  2RD0 A;  1JWF A;  3HVE A;  2RD9 A;  4U9D A;  2VGE A;  3T8K A;  3X2Q C;  2AXZ A;  2XEN A;  2IXO A;  3H2U A;  2OG2 A;  3EJN A;  3N24 A;  4CGV A;  1YYX A;  2IQC A;  2HMZ A;  2VJ8 A;  4G11 A;  2XS1 A;  5A6B A;  3JYY A;  1YAR O;  3LLK A;  3KSL A;  3LAY A;  4GZ3 A;  2IJG X;  3ZC4 A;  2L6F A;  3QTH A;  4RDA A;  4K0D A;  2EIK E;  1RJ9 B;  2PZI A;  4MS6 A;  3D9K A;  2C04 A;  3ULQ A;  2OKU A;  1YA7 O;  2RG8 A;  4GU5 A;  3QAR A;  1ZW2 A;  4JE9 A;  2R02 A;  3MYI A;  3T6B A;  1LS4 A;  1MQS A;  1ZU2 A;  1L3P A;  5DS6 A;  2L6J A;  3OEO A;  5AJD A;  3Q73 A;  1H2V C;  1G8X A;  2EPN A;  2GRQ B;  3NG1 A;  4N3B A;  3BU8 A;  4B8A A;  4U5G A;  2W45 A;  3UMH A;  1N0R A;  4WUY A;  2OCC C;  4E7Z A;  3C8G D;  5EID A;  4ZLD A;  2V4L A;  3K66 A;  4ER9 A;  4QI0 A;  5A69 A;  4PS3 A;  3SF4 A;  3ABK E;  3JYH A;  4YT4 A;  1DOW A;  4PJN A;  4J8S A;  3WXX A;  3AAA C;  2XEH A;  4MW3 A;  1MX6 A;  2HKV A;  4EHP A;  2WXG A;  4ILH B;  1A7V A;  4OIN F;  3CLJ A;  4GCN A;  1XZP A;  4FHJ A;  3UM0 A;  4P29 A;  2I8B A;  2Y4T A;  5FZT A;  3CST A;  5DBK A;  4XIF A;  1SA4 A;  3SNH A;  2Y4U A;  4CT0 A;  1LF8 A;  3BRJ A;  1HE1 A;  1S7Z A;  2OEW A;  3ZN3 A;  2P9N G;  2ZXP A;  1BDJ B;  3V5X A;  2DZO A;  3RIB A;  4YT5 A;  5KYN A;  4E0H A;  5DVW A;  1NA3 A;  2Q7F A;  4F7A A;  3ZG1 A;  3R2P A;  2IXP A;  1NA0 A;  5B1B E;  2BKG A;  4M3O A;  1NU7 D;  1GW6 A;  4XE0 A;  2IOL A;  4IYP A;  1RZ4 A;  2I2O A;  1CPQ A;  2KAT A;  2XSE A;  3PDN A;  256B A;  1Z6A A;  3GM1 A;  1OWL A;  3EU9 A;  1MMD A;  1OCO E;  5AGF A;  2A6E F;  4YDO A;  1IHG A;  5KYY A;  3QC1 A;  4NRH B;  4PH4 B;  2XQ0 A;  2DBA A;  3S2A A;  2JEK A;  2XM4 A;  1QNF A;  2IO2 C;  2EPK X;  3EH2 A;  3RRM B;  4U07 A;  4LDQ A;  2LQG A;  4XEF A;  2R7T A;  4MTF A;  5A6B D;  1I4Y A;  4BEM J;  1OCZ C;  1ZW3 A;  2EPO A;  2CG3 A;  2A4Z A;  2FUL A;  3Q7L A;  4MS2 A;  3L17 A;  5E75 A;  3NMJ A;  5CBO A;  3DJU B;  3UXG A;  3B29 A;  4APO A;  5BV1 A;  4KT6 B;  3I5P A;  2XRH A;  1IZM A;  4TXQ A;  2HS5 A;  4N6C A;  4BET A;  3OWT A;  2WXJ A;  1Q0D A;  2Y3G A;  4NAC A;  4HRM B;  1PD1 A;  2V0P A;  1FTS A;  3DBS A;  1QSP A;  2J4B A;  1B68 A;  5LX8 A;  4XLN F;  2YEV A;  4HI9 A;  4WAF A;  4JVS A;  1YCS B;  1FT1 A;  2XPY A;  2YQ8 A;  4ZLC A;  4KVO A;  3DPY A;  4QI2 A;  2W9Y A;  1Y4C A;  2IXM A;  3AQC A;  3Q6M A;  3C5R A;  4ABN A;  3ZFW A;  3CVP A;  4EZJ A;  2H6H A;  4G8L A;  3KAE A;  2L6H A;  1T6U A;  2I1K A;  2WMO A;  5G2N A;  1HZ4 A;  3LEO A;  4NQF A;  2CW0 F;  3KH2 A;  3Q49 B;  5EK0 A;  3SXZ A;  4DVZ A;  1ZYR F;  2VC9 A;  1K40 A;  2QC9 A;  3CHR A;  1HMO A;  2X0C A;  2Q7R A;  3PEV B;  2J4D A;  2A0U A;  5ANL A;  3GYZ A;  2R5S A;  4RSY A;  3TWR A;  4NTF A;  4LDR A;  3LEW A;  4XEI G;  2R7S A;  3ZU7 B;  1IXV A;  4KNV A;  3LS8 A;  4YT8 A;  3TJ5 A;  4U5H A;  5AQ7 A;  1ZHW A;  3VTY A;  1LIH A;  3V5Z A;  3AG3 E;  3JQ0 A;  5A6A A;  4QDL A;  3FAP B;  4CS8 A;  2IFU A;  3AG3 C;  3NB2 A;  1Z63 A;  3C8G A;  3LVR E;  4WWO A;  4AY5 A;  2R7X A;  2NUP B;  3K7D A;  2IOS A;  4NY3 A;  1GS9 A;  2J09 A;  3AGT A;  3OTN A;  4ILI A;  3ZRH A;  3GZS A;  3MCX A;  4CYM D;  1WOL A;  3M1C B;  2JAB A;  1E8X A;  3HXF A;  4U5B E;  3EU5 A;  4E7S A;  4E6H A;  5D91 A;  1DCQ A;  2L6B A;  4L2Y A;  2NYJ A;  3L8I A;  4DJ9 A;  4YWQ A;  1TJF A;  1OCO C;  3TOL A;  1D0X A;  2CDQ A;  5ENT D;  4J32 B;  3KS2 A;  2L81 A;  3MBG A;  2JX0 A;  3IBE A;  1ZB1 A;  3O4Z A;  4TUM A;  1XZQ A;  5AJL A;  4WND A;  1D8D A;  2I15 A;  5FIO A;  5COG A;  4WNF A;  3QWP A;  1HFA A;  1SVX A;  1FPP A;  1ELR A;  2FEZ A;  3FUE A;  2KM4 A;  2UWJ G;  5KYX B;  4DX7 D;  2WXF A;  1E85 A;  2ETA A;  3TD7 A;  4TUU A;  3LY7 A;  1SMY F;  4GZD A;  3GWN A;  3SY2 A;  3FDQ A;  5JS5 A;  3UM1 A;  4GZ6 A;  1NU9 C;  4N2S A;  3G4X A;  4X0R A;  2AWI A;  3DRA A;  2OEX A;  1FMW A;  4O60 A;  2OQM A;  3FUH A;  3U0C A;  3PDM P;  3X2Q E;  2FF4 A;  2B6C A;  2V4H C;  5ARF A;  2CG2 A;  4N3A A;  2GAQ A;  2XLM A;  3DSV A;  3ABK C;  4N5Q A;  2WL8 A;  2YNQ A;  3L54 A;  3FEY A;  3C63 A;  1YMP A;  3FUL A;  3O55 A;  4L23 A;  2F8X K;  2R2L A;  1D0Z A;  3U9W A;  4MND A;  3LJB A;  4I1O B;  1AP7 A;  2PNN A;  3M4B A;  4G24 A;  3IHY A;  4BWR A;  5BXU A;  1ZU5 A;  3RRU A;  3HG0 D;  5CED B;  5LCW J;  3EZH A;  1SZI A;  2JLB A;  2ZIR A;  3AGU A;  4URK A;  3CVU A;  4A4A A;  2FGY A;  2Y69 C;  4J8D A;  2A5U A;  3ASD A;  1DC2 A;  3Q15 A;  4CDV A;  1TNY A;  2QE9 A;  4K03 A;  4JEU A;  3FH5 A;  4J7Y A;  4WGY A;  1AWC B;  2GW1 A;  5D0O D;  4CZ2 D;  2LFD A;  2EPL X;  5JMN D;  3KYJ A;  1RKE B;  4XKC A;  4G25 A;  2J9Q A;  4G26 A;  4GA0 A;  2ZXO A;  2PM7 A;  3RQF A;  4H7X A;  3E9V A;  5D66 A;  4C7O B;  4DI4 A;  2LXM A;  3CVW A;  4TXR A;  2A68 F;  2XS8 A;  3CK7 A;  4MVM A;  4OIO F;  4ME2 A;  1PY1 A;  1OCC C;  1ZHT A;  2DZN A;  3D9P A;  2UY1 A;  2VGX B;  3ESL A;  3LS0 A;  4CT4 A;  4HRN A;  4AL0 A;  2X6F A;  5CEA A;  2WM9 A;  3AS8 A;  3ZYK A;  2BL2 A;  4BEP A;  5FZR A;  1ZU4 A;  2EIN C;  5E2Q A;  3NZS A;  2QYJ A;  4L2L A;  1FVF A;  1YZC A;  1NSG B;  5L3V A;  2HO1 A;  4JHR A;  3OAW A;  1UJK A;  2IEJ A;  3GZ2 A;  4RQI A;  2I6H A;  5KWD A;  3RIP A;  2AXU A;  5L0F A;  4EBK A;  3MYF A;  2F22 A;  3B13 A;  1VK5 A;  3QMK A;  4JCH A;  2WPV A;  4GCO A;  1J8M F;  4I17 A;  2FO1 E;  2OU6 A;  1YA9 A;  3K33 A;  2C0M A;  1N0Q A;  1Q0M A;  5BUZ A;  3AJM A;  3WOD F;  1TNB A;  4O1P A;  5DQT A;  3L1M A;  3ML9 A;  1TNO A;  3ESK A;  3PH0 C;  4X8Q A;  3V2O A;  1OWO A;  5ITZ F;  1EDU A;  3FVY A;  3HXB A;  4MVQ A;  3V30 A;  3LY8 A;  5LP0 A;  2AW6 A;  4O6Y A;  5JJ6 A;  3ZXS A;  1TFO B;  4MRU A;  1E86 A;  3HTK C;  3LJN A;  5CER B;  1OXB A;  2XHE A;  1S0P A;  2HYZ A;  2XL4 A;  4L9P A;  4N3C A;  5G05 C;  4LER A;  4LRZ A;  1IQR A;  2HSB A;  2XLW A;  4BJ5 A;  1LE2 A;  1S05 A;  5DS4 A;  3TJ6 A;  1LE4 A;  4AM9 A;  1FCH A;  3G2V A;  3S84 A;  3HXC A;  5KCM A;  2ZXW E;  1NI1 A;  3LEV A;  2Y3A A;  4U63 A;  1MHQ A;  4I6J A;  4DXW A;  2OVF A;  2P9I G;  1R4T A;  2YZS A;  3ABM E;  3VF0 A;  2L7A A;  2G3V A;  3RO3 A;  2J9W A;  5IY5 E;  2B0J A;  3O39 A;  2X6I A;  5FQ6 A;  1XNF A;  3ATP A;  2R7U A;  1E96 B;  1EPU A;  4JZA A;  1YAU O;  4JXT A;  2CFU A;  3RSE G;  1QYM A;  1O87 A;  1Y8M A;  1YYH A;  1ZZP A;  4JRZ A;  3AG1 E;  2KGO A;  5G04 C;  4BX9 A;  3FTY A;  5FQ4 A;  3HNK A;  3QWV A;  4J8E A;  2FFH A;  2HV6 A;  4Z9I A;  4IAQ A;  3JXI A;  4OYS A;  1T6I A;  4WGZ A;  2CHZ A;  3JUI A;  3E30 A;  3EGX B;  2WVN A;  2EIK C;  3JCU Q;  2BC5 A;  1BR2 A;  2E2E A;  3A11 A;  3APC A;  4EWC A;  5B1A E;  1EKY A;  2J7P D;  1BI8 B;  3IPM O;  5KBA A;  4O6M A;  3ZW3 A;  5J08 A;  2WXP A;  3PCV A;  1MJ0 A;  3CV0 A;  3QOU A;  2DVW A;  4GPM A;  5A7D B;  4DRH B;  2Z15 A;  4BPM A;  4UWF A;  4F53 A;  3DE8 A;  4XI9 A;  1FFT C;  4ANX A;  1BR1 A;  5T3W A;  4BX8 A;  3APD A;  3B7R L;  3HNL A;  3APF A;  1WGW A;  3CQZ A;  1JCR A;  3EHQ A;  4U95 D;  1L5J A;  2LO6 A;  1TN6 A;  3DAG A;  5LOZ A;  3UT8 A;  1MYO A;  4DI3 A;  1C17 M;  1YYJ A;  5JHA A;  2OVB A;  4HB5 A;  1V55 E;  3ZTM A;  2V26 A;  4CX9 A;  2TMV P;  2H6I A;  2PX0 A;  4YN0 B;  4YVQ C;  5T1D B;  3B71 A;  3S28 A;  4GZ5 A;  1SA5 A;  2GRM A;  1RMV A;  4BJ1 A;  1HE8 A;  1H6O A;  1OWP A;  2QTV A;  3ZSU A;  2X6H A;  4U8V D;  3FUJ A;  1O1T A;  1VMA A;  1JAF A;  3IQT A;  3CK8 A;  2YL0 A;  2XPI A;  3L8J A;  4NC3 A;  5L0C A;  3UT4 A;  2P2C P;  1U2V G;  2J8W A;  3D9H A;  3E37 A;  2KW3 C;  2CNW A;  2QFC A;  3DD7 A;  4JPS A;  3CVX A;  2HMQ A;  3U8P A;  4HFG A;  5J90 A;  3U5S A;  3ASN E;  1UG7 A;  4GPK A;  2WZL A;  2XL8 A;  3TWQ A;  2RSE B;  3SZR A;  5KYX A;  3I4G A;  2ZD9 A;  3SI5 A;  2VYI A;  3ZPJ A;  4HEA J;  3ASG A;  2YRF A;  2CCY A;  3UQ3 A;  2DI3 A;  5AQA A;  1HG2 A;  5T4Y A;  2PP4 A;  4CCA A;  1R5I D;  4CSA C;  3TWT A;  2Y3H A;  1YA0 A;  5K0I A;  4Z68 A;  1NFN A;  1OWN A;  4JA7 A;  3P1U A;  1HG5 A;  3EFO A;  4CBE A;  2BTD A;  1N94 A;  2MOW A;  2R05 A;  4BER A;  4I1A A;  1MND A;  1M2V A;  2P7V A;  1I5N A;  3F47 A;  4EPZ A;  3D9O A;  1M56 C;  1S63 A;  4BTA A;  2J9B A;  5JLI A;  1RW2 A;  2KCV A;  3BEH A;  2PQR A;  4C48 B;  4EHM A;  2BED A;  2VSO E;  1ORY A;  3ULE G;  2R25 A;  4O1O A;  3C8G B;  5IY5 C;  5ENN A;  3F46 A;  1UJJ A;  1UOH A;  4KZC A;  3ISM C;  3TGO A;  4OAU C;  5ENP D;  4U0U A;  2MRI A;  5EYL A;  2BF0 X;  1U89 A;  4MBG A;  2HZ8 A;  2MYS A;  3CHQ A;  3SHF A;  2LK4 A;  1O3U A;  3JUE A;  3FUK A;  4CIH A;  3DJN B;  3GEE A;  4EBA G;  3CEX A;  2EIL E;  1H6P A;  3CSK A;  2XEE A;  1QZX A;  2NC9 A;  2WXI A;  5AYW D;  1Z7Q c;  2NUT A;  4U5D E;  3JQ1 A;  3S7B A;  5JVE A;  3RH3 A;  1HS6 A;  2R17 C;  1FT2 A;  2XLE A;  5FQ7 A;  3ONK A;  3B7U X;  3SXK A;  5KYU B;  1OR2 A;  3FUN A;  3LNR A;  2XM0 A;  4HNA D;  2VAS A;  1EI7 A;  5ARG A;  4A2N B;  3FOP A;  4C9B B;  4JJG A;  4YT2 A;  3ABL C;  4U5F E;  4AXH A;  1K05 A;  2VTB B;  3RF3 A;  3RKO F;  1JCQ A;  1OY3 D;  3IQ6 A;  2P9P G;  3IHV A;  4U04 A;  4OIR F;  4KMO A;  3ZEF A;  2P9U G;  3BUA A;  2D4U A;  2R7Q A;  4E17 A;  4EBJ A;  3GZ1 A;  4RG9 A;  2CNW D;  2DYS E;  1QQE A;  5KJN A;  4U7E B;  2EPM X;  4FLH A;  3LXU X;  4HVB A;  2WXN A;  1MX2 A;  3MLG A;  4UUC A;  2XRY A;  5BV0 A;  4UWG A;  4W9R A;  1W2W A;  1E90 A;  3CHM A;  3SZ7 A;  5A6J A;  2LSV A;  3VLE A;  1WWP A;  4ANU A;  1LTX A;  2IO3 C;  4PR9 A;  3G50 A;  3QAQ A;  3FUI A;  2H8A A;  3TWW A;  5AC4 A;  2KBX A;  3WG7 E;  3T5V A;  2QY9 A;  4PFP A;  3NQP A;  3DSS A;  3AG2 E;  1YLM A;  4J30 B;  4GTP A;  1IYG A;  2J0W A;  1OCR E;  2ZU6 B;  5F5F A;  3I5Q A;  4MTG A;  3OXF A;  2RFA A;  1NFO A;  3E4B A;  3UGO A;  1N4S A;  4JHK A;  3LCA A;  1YJG A;  4EBB A;  3U4T A;  4ANW A;  4XZ4 A;  3GEI A;  3AG1 C;  3ZQY A;  2KZT A;  4DX5 D;  2WQ6 A;  4G0H A;  5BNW A;  3QZC A;  4HLE A;  1DVP A;  1IW7 F;  4CDN A;  3L82 A;  4GTR A;  2L9J A;  3DE9 A;  3FHE A;  3FDH A;  1U3C A;  3NZU A;  4RG6 A;  1M2V B;  1WM5 A;  3NYL A;  4NUR A;  2XLH A;  3DKA A;  5HQ8 A;  3HNJ A;  2KSF A;  3W4Y A;  4LLC A;  1N4P A;  1Y6I A;  3FTS A;  2R7O A;  4AEZ C;  1OW8 A;  5FQ8 A;  1Z3X A;  4N39 A;  2YLD A;  3MEK A;  4ATZ D;  3DSW A;  5B3S E;  4C3E A;  4H7Y A;  3TK0 A;  4FA6 A;  5CMW A;  1SF8 A;  4GA2 A;  1SQM A;  3LS1 A;  1DCE A;  4HI8 A;  3C98 A;  1G4W R;  4C3B A;  4ILG A;  1TN7 A;  4GB9 A;  3J5Q B;  4CS7 A;  3CK9 A;  2WMN A;  3NYJ A;  1TFK B;  3UKU G;  3T4R A;  2PM6 A;  3ZUV B;  4DBQ A;  3PZ1 A;  3EFO B;  3N2Z B;  3NKD A;  3QJZ A;  4F6R D;  1H19 A;  1L7C A;  2ASR A;  3L08 A;  1HE9 A;  3AG4 C;  1RXQ A;  5EN5 D;  2LAH A;  1N4Q A;  3T6J A;  3K1H A;  3QVZ A;  5KNH D;  4PS7 A;  5HS0 A;  1GGQ A;  1TQG A;  3OXL A;  1E84 A;  3W2W A;  4I1M A;  3FFL A;  4LAC B;  3FUM A;  1X81 A;  3ABM C;  3QVY A;  4JZY A;  2E0I A;  5CBN A;  3TXM A;  2PBE A;  2P9L G;  3GWL A;  3SO8 A;  2DYR E;  3B0U X;  2ZXW C;  2G3K A;  5B3I A;  3FEX A;  5JUA A;  1OCR C;  3L34 A;  4IUL A;  2AU5 A;  1TNU A;  1E2X A;  2HJM A;  4IB4 A;  2L6G A;  1D0Y A;  1QBQ A;  4FAD A;  1LS1 A;  2ZIS A;  1HY5 A;  2KNH A;  1UW4 B;  5FZS A;  1OW6 A;  4MVR A;  3WHN A;  3TXN A;  3DXM G;  1Z23 A;  3ASO C;  3ZQV A;  3KL4 A;  1C02 A;  3IQ5 A;  4IAR A;  4EEC A;  1AUE A;  1KTM A;  2HM8 A;  3F6Q A;  1VYI A;  3PE3 A;  4NTB A;  2WVO A;  3LPZ A;  3N71 A;  4GTT A;  5E3A A;  4ATG A;  3HDX A;  3FXH A;  3FU0 A;  3R7Q A;  1YDI A;  4B94 A;  3E34 A;  1BU9 A;  3ZNG A;  3N0T A;  4C0E A;  3A9C A;  4XPW A;  2YHC A;  5KYU A;  3M79 A;  4BES A;  2F8Y A;  4UI9 C;  1OKK A;  4BY6 A;  2WZF A;  4NCQ A;  4HS2 A;  4HOS A;  4I6G A;  3JZ0 A;  1MMG A;  5F5H A;  3FH7 A;  3UIO C;  4LEU A;  3MJW A;  3J06 A;  1HF8 A;  3EH1 A;  3NMK A;  3GW4 A;  3JSE O;  2L0I A;  3V5Y A;  3W2V A;  2J45 A;  2OJE D;  4BSZ B;  4CS9 C;  3KEA A;  3ZYQ A;  4PDX A;  2CYD A;  4MKT A;  3C72 A;  2PX3 A;  1OWM A;  2VB6 A;  3PZD A;  1LM3 B;  2P58 C;  2ION A;  1H9T A;  3FTZ A;  4KXK B;  2IY0 C;  4DLQ A;  1NBB A;  3R7R A;  1RKC A;  4G7Z F;  3Q6N A;  1OCC E;  2KC7 A;  3C62 A;  5T3R A;  1T9K A;  2EIL C;  5G55 A;  4U0S A;  3GOR A;  4GMR A;  2ETS A;  5HV9 A;  2E87 A;  4PFO A;  2DIW A;  5CRU A;  4DPR A;  1HH8 A;  1VYK A;  4G7O F;  5JJ7 A;  4LG6 A;  4ACK A;  4KC9 A;  1INZ A;  4JTA B;  1TKN A;  2Y3B A;  2V5Q C;  3UMV A;  4UI9 J;  3JCK C;  4HOU A;  2ZXR A;  1JWG A;  4LUN U;  5FWQ A;  5HI7 A;  1QVX A;  3FMS A;  4ANJ A;  2C2L A;  5E3C A;  5D0Q D;  3FTV A;  2LAI A;  3DXJ F;  3DMD A;  4HFF B;  4RD9 A;  2NUT B;  3CHS A;  3QDN A;  3LYA A;  3US6 A;  3U3F A;  3SQV A;  4CS8 C;  2IU1 A;  3CVN A;  4JTC B;  4IN3 B;  1E8Y A;  3SFZ A;  2VGY A;  4HRL A;  4HOQ A;  3VYW A;  2YHE A;  4O7G A;  2KXP C;  3I4R B;  3Q5M A;  4MVZ A;  2J8S D;  5COF A;  1VLS A;  3ASH A;  4GTV A;  3AU4 A;  2A6H F;  4J7W A;  4FJY A;  1C03 A;  1A0B A;  1VOM A;  3PMR A;  1APC A;  5EX0 A;  4JTD B;  5B1B C;  1E7U A;  4B0Z A;  4N5C A;  4JUR I;  3CGH A;  4C3D A;  5BQH A;  3FUF A;  4DK5 A;  1WAT A;  1Q2Z A;  2F37 A;  3GAN A;  1ZHY A;  4UWL A;  1OXK A;  1ZBP A;  5L0H A;  1NLX A;  4G23 A;  3FP3 A;  1OUV A;  1D1C A;  4RBN A;  5EHH A;  1B89 A;  4UWK A;  3OXG A;  4L7T A;  4IAO A;  4O6F A;  2A69 F;  1NZN A;  2PL2 A;  2XZT G;  3C3Q A;  4AV7 A;  4EQF A;  3ZXP A;  5KJK A;  1M2O A;  1WY6 A;  5C1D A;  4HE8 D;  3IXE A;  2YLI A;  1H6K A;  2W4M A;  1D1B A;  3POV A;  2H7V C;  1F1M A;  4F1S A;  2B0H A;  1LI5 A;  1T6Q A;  1GM5 A;  3MA5 A;  3EPV A;  3PNL B;  3CVY A;  3DI5 A;  2KCK A;  1QQ3 A;  2R9R B;  5FTP A;  2EIJ E;  4LNU D;  3EUV A;  2OOE A;  4U5C E;  5F28 E;  4L1B A;  5FT9 A;  3DZA A;  1JMW A;  5A6C A;  2J9U A;  3FTW A;  3PUJ A;  3EHN A;  4GQH A;  4N4W A;  2NXP A;  5JRA A;  3IHU A;  4Q69 A;  4GZC A;  5EDS A;  2J46 A;  2CHW A;  4FJZ A;  2XLO A;  4GTQ A;  3TAX A;  2BUG A;  4PUC A;  1RCP A;  3H65 A;  1TWH A;  1KT0 A;  1ZHZ A;  2WXQ A;  3B9Q A;  2KZT B;  3DSX A;  5EKQ D;  2KYH A;  1D9S A;  3Q78 A;  2C0L A;  3RQE A;  2XXA B;  3CHP A;  1OW7 A;  3MV3 B;  4AIF A;  5KYW B;  4NTA A;  3T6G B;  4IJJ A;  3ZHE A;  3EG9 A;  4JA9 A;  3TWS A;  2IF4 A;  5TJ5 E;  5AQ9 A;  3MV2 B;  5KJM A;  3SP1 A;  1K1A A;  1DOV A;  1NL4 A;  5B1A C;  4AJW A;  3FAJ A;  4N06 A;  4U5E E;  1MX4 A;  4ZHB A;  5DLJ A;  3LES A;  3UTM A;  3URZ A;  3SNX A;  2Q3T A;  1BLX B;  3EG9 B;  2J49 A;  3SD5 A;  1WG0 A;  2MHK A;  1N9A A;  5LFA A;  1FR0 A;  2LUH A;  4MVS A;  4RLY A;  3TWV A;  3QKY A;  4CDY A;  5CHE E;  1ST6 A;  3IEG A;  1A17 A;  1TR2 A;  3U66 A;  4BTB A;  2HV7 A;  2Y69 E;  3IV0 A;  4H54 A;  3DM5 A;  2LCH A;  5EGY A;  5FIN A;  3AOU A;  4BJ6 C;  3TWU A;  4CGW A;  2MHR A;  1FVH A;  4AX2 A;  5AIJ A;  1SR2 A;  4AVX A;  1W3B A;  4HFK B;  3BEE A;  2ICW G;  2P61 A;  3EGX A;  3B7B A;  4A1S A;  1UN9 A;  3AS4 A;  3HHM A;  5EIB E;  3ML8 A;  2YQY A;  3EZI A;  2LSU A;  2YL3 A;  1M6T A;  3PNT B;  3EIJ A;  1Z3Y A;  4XPX A;  4CJG A;  3RYL A;  3U8V A;  4DOZ A;  4BFR A;  1U0B B;  1N95 A;  4W8P A;  2GRR B;  4I44 A;  2P9K G;  1XWJ A;  2CGE A;  4BEJ A;  1T01 A;  3I4U A;  3JTL O;  3ZYM A;  5KNG A;  3EGD B;  4JIO A;  4YDE A;  4G7H F;  1FNT c;  3TUL A;  3U64 A;  3U3B A;  4XX5 A;  4B89 A;  3L6A A;  4MVO A;  3JRT A;  1U6H A;  3TG5 A;  4D10 C;  3SFX A;  3CQC B;  4DLO A;  4EKW A;  3SGH A;  3AJI A;  5EIL A;  3S90 A;  3ZVV A;  2HSQ A;  4Q7C A;  3IKO B;  3AQB A;  1N4R A;  2YL7 A;  4JC7 A;  3PZ3 A;  2LD6 A;  4J0U A;  2NUP A;  3EQL F;  2V8S E;  3SFY A;  3U3W A;  2R03 A;  2J0X A;  3QNK A;  2UUI A;  2NPU A;  4JW1 A;  3D9L A;  1G4U S;  1TWA A;  1E8W A;  2L0T B;  5ENR D;  4JJF A;  4GTS A;  1WAO 1;  5DS5 A;  4M63 A;  4YND A;  4JB8 P;  2M4E A;  2EIN E;  2GRL A;  2J08 A;  4FLB A;  3QW1 A;  1EQ1 A;  1VTM P;  4HBD A;  4U8H A;  2I1J A;  1T5O A;  1TN8 A;  4M7C A;  3NKE A;  4B93 B;  4EZL A;  4JD2 G;  2P6V A;  1Q0F A;  3JT1 A;  4PJM A;  4A55 A;  3HKK A;  3G2W A;  5CCL A;  1TWC A;  2AVP A;  3BQO A;  4EIY A;  3RKV A;  4B8C B;  1VB5 A;  2WZG A;  2WB2 A;  4JEH A;  1UG3 A;  3EDT B;  5JA4 D;  3H2V A;  3X1O A;  3T9K A;  2Y1L E;  3CKC A;  5CIV A;  1QKR A;  4XTK A;  3KKB A;  2LXL A;  1MZC A;  3U2M A;  4D4N A;  4YVO A;  2KQ9 A;  3T9O A;  2FI7 A;  4FHK A;  5G05 J;  3NOG D;  4APF A;  4UQY A;  2VCB A;  2XZD G;  3TJP A;  4NQ0 A;  2WB7 A;  2WVQ A;  2V5F A;  4A63 B;  1OCZ E;  1LVK A;  4YL3 A;  4EZK A;  1E83 A;  4PS8 A;  1FMV A;  1TYQ G;  1NG1 A;  1SYQ A;  2R7V A;  3PHF 2;  4A3T A; 
#chains in the Genus database with same CATH homology
 3I3N A;  4LLE A;  3MKR A;  4OVU A;  3S27 A;  4FP7 A;  3LY9 A;  3PRZ A;  3CQG B;  4AE4 B;  3UMK A;  2V3C C;  3S7F A;  1D1A A;  3NF1 A;  1FFH A;  4Q5S F;  5KYW A;  3T8M A;  1KLX A;  1QLE C;  1VDY A;  4TV3 A;  2VSN A;  3LKU A;  1ELW A;  4BG0 A;  2VGX A;  2WXL A;  4J8F A;  3JYS A;  3MGB A;  4GA1 A;  2IXN A;  4BJ6 A;  4AK9 A;  2X6J A;  5LCW C;  2WXK A;  4U0Z A;  5E33 A;  5KJL A;  4R7L A;  4HOT A;  4FX5 A;  4XI0 A;  1Z5Z A;  2WQH A;  3CEQ A;  4KBQ A;  4JL0 A;  4CEM A;  2PF4 E;  3D3M A;  2G62 A;  3UNG C;  3UPV A;  1TJC A;  2C03 A;  3DPD A;  3KMI A;  3PEU B;  2WXR A;  4N2Q A;  2HR2 A;  5CCM A;  2PFD A;  4KYO B;  4LCT A;  4WNG A;  2KCL A;  4BT8 A;  3CVL A;  4A1G A;  2XGM A;  1O5H A;  4OIQ F;  4RVB A;  3MKQ B;  4XLP F;  5FZQ A;  3UT7 A;  4W8K A;  2EIJ C;  2O9X A;  4F4B A;  3VLF A;  2J9V A;  4BT9 A;  4I9C A;  4WJ0 A;  3PS6 A;  4OD4 A;  3QWW A;  3D9I A;  1PCX A;  2X38 A;  5L3Q A;  3D9N A;  1H2U A;  3EGD A;  4PK4 A;  2AXV A;  3KD7 A;  2YIN A;  1Z3I X;  4FUL A;  3G2T A;  1JUQ A;  3IEE A;  4Y6C A;  2R7W A;  4Q4Z F;  5T3T A;  4HOR A;  3L0I A;  1E7V A;  5CMY A;  2XGS A;  3ZIB A;  4K0R A;  2Q9A A;  3SBS A;  3CHO A;  2VTB A;  4HXI A;  4OD5 A;  3L22 A;  1NZE A;  3GOD A;  2VQ2 A;  2WXH A;  4KBL A;  5FCL A;  3G2S A;  1NP7 A;  2IYL D;  3AG2 C;  1U3D A;  2L9B A;  5ANR A;  4C0M A;  2J7P A;  1X5B A;  3CSF A;  3FHD A;  1DNP A;  1E8Z A;  3MZL B;  4I6E A;  3ENE A;  3VAY A;  3D9J A;  3CKB A;  3HJC A;  1BPO A;  2X6K A;  4CDM A;  2EQX A;  4DVY P;  1KT1 A;  2MWQ A;  3OA1 A;  4CRW A;  3FU6 A;  1QZ2 A;  4Q96 A;  3ZGQ A;  1JPL A;  3ZHE B;  4ULW A;  3T5X A;  4GMJ A;  1MMN A;  2R59 A;  2LSE A;  3B7T A;  1EYH A;  3W8I A;  1V54 C;  3S7J A;  2WXM A;  1BR4 A;  4PJJ A;  3DAF A;  3ZVR A;  4FU3 A;  4J6I A;  1SZ9 A;  3ONL A;  4Y6W A;  3CIA A;  4G1T A;  3UX4 A;  4I43 A;  4FWV A;  3WG7 C;  5KYY B;  4WNE A;  5C2Y A;  2XCB A;  4K7B A;  1M57 C;  3MKQ A;  1JPN A;  3CVV A;  3SYN A;  4GYT A;  3UGP A;  1Z6T A;  4GYY A;  2EIM C;  4IWB A;  2QY7 A;  4FC8 A;  4G2V A;  4CSA A;  2NG1 A;  4AOF A;  3UUX A;  3SEO A;  1XGW A;  3RJV A;  4FES A;  4O6N A;  2DGJ A;  3PVL A;  2M63 A;  3NYM A;  3P2B A;  2X51 A;  2H7B A;  3L13 A;  3R9A B;  2VH3 A;  2DCP A;  2WQ7 A;  2XCC A;  3ZYL A;  2IOQ A;  4WWP A;  2XPZ A;  1HXI A;  5BW8 C;  1PC2 A;  2CFZ A;  2Q9C A;  2Q9B A;  1RJ9 A;  5JJT A;  4P6I C;  3CR3 A;  4GEH A;  3RK6 A;  4KNW A;  4JHJ A;  4CDR A;  3FY4 A;  4UQZ A;  2WXO A;  3LVQ E;  3ASN C;  4MQ9 F;  5FJY A;  4OIP F;  1EF1 C;  2VSX E;  3TL5 A;  4KZ0 A;  3LLI A;  4OVV A;  2XEV A;  2JD3 A;  4ACL A;  2W4B A;  3K6B A;  4GAA A;  4O79 A;  1HU3 A;  1PAQ A;  4DBR A;  3RO2 A;  3HYM B;  5JHB A;  2DYS C;  3B0P A;  2DYR C;  1HO8 A;  3PUK A;  4B6I A;  1SZA A;  1IQU A;  3RRN B;  3LDZ A;  3VLD A;  1V55 C;  2BE5 F;  4YJW A;  3LJ3 A;  2FBN A;  3L16 A;  1HX8 A;  3PE4 A;  4GYW A;  3SBT B;  5BPP A;  5A23 A;  3G2U A;  3Q4A B;  1H2T C;  2A1D D;  2I9C A;  4AY6 A;  3FTU A;  3KEZ A;  5BT1 A;  1N52 A;  2X3M A;  1N54 A;  3FWV A;  3K9I A;  4V3I A;  1MNE A;  4CS9 A;  2YHS A;  2OV8 A;  2R7R A;  2VSY A;  3CZ6 A;  5E76 A;  5B3S C;  2ZPA A;  4UQX A;  3S29 A;  1LKX A;  3RFY A;  4WWN A;  3Q7G A;  5T8I A;  5D92 A;  3S0X A;  2XRZ A;  3BG1 B;  3V7O A;  3MX3 A;  3B7S A;  4QFV A;  1JPJ A;  1N1C A;  2J07 A;  2LNI A;  3AS5 A;  2PQN A;  3ASF A;  3FUD A;  4H4K C;  4XWJ A;  2WVI A;  4KVM A;  4AE4 A;  3FU5 A;  4F3V A;  1ZHX A;  3EHM A;  5G04 J;  4XKB A;  4I2Z A;  1TWG A;  4IRU A;  2H7O A;  3FU3 A;  3PRE A;  5CI8 A;  5DQZ A;  1UN8 A;  4I2W A;  1J8Y F;  1MMA A;  3E70 C;  1KU2 A;  3MYV A;  4UWH A;  1H0A A;  3ITF A;  3NRH A;  3W8H A;  2D5R B;  3JSZ A;  4JC8 A;  3S7D A;  4MLP A;  3RU0 A;  4TRQ A;  3ZIM A;  5M72 A;  4GML A;  1OKK D;  2CHX A;  3EIQ C;  4C7O A;  3QK0 A;  3O48 A;  5DIZ A;  1TEZ A;  4UI9 K;  4I9E A;  4EBA A;  2Y3D A;  3ECS A;  5CI9 A;  2UY1 B;  5BUO A;  4E85 A;  3VTX A;  5EX3 A;  2FO7 A;  2GFH A;  4KI2 A;  3CVQ A;  3D9M A;  2NSZ A;  2GGF A;  4Q94 A;  2ILR A;  2Y39 A;  1ELK A;  3NDB B;  3DM9 B;  3TG4 A;  3QB2 A;  3Q47 B;  1P5Q A;  4BJT A;  4BJ5 C;  3O6X A;  1PD0 A;  3FH8 A;  2XXA A;  2XGO A;  4AP2 A;  3BG0 B;  4A3V A;  2KJG A;  3AU5 A;  3FTX A;  3HVE B;  3UR3 C;  4BSX A;  3UMI A;  4ANV A;  3HLZ A;  3B0V C;  4PJL A;  2OND A;  4I3M A;  3K1I C;  3HIZ A;  4GYO A;  4DJA A;  5AEN A;  5HSW A;  2RD0 A;  1JWF A;  3HVE A;  3X2Q C;  2AXZ A;  2IXO A;  2OG2 A;  3EJN A;  3N24 A;  4CGV A;  2IQC A;  2VJ8 A;  4G11 A;  3LLK A;  3LAY A;  4GZ3 A;  2IJG X;  3ZC4 A;  4RDA A;  4K0D A;  1RJ9 B;  2PZI A;  4MS6 A;  3D9K A;  2C04 A;  3ULQ A;  2RG8 A;  4GU5 A;  3QAR A;  3T6B A;  1MQS A;  1ZU2 A;  5DS6 A;  2L6J A;  3OEO A;  5AJD A;  1H2V C;  1G8X A;  3NG1 A;  4N3B A;  4B8A A;  4U5G A;  2W45 A;  3UMH A;  4WUY A;  2OCC C;  4E7Z A;  4ZLD A;  2V4L A;  3K66 A;  4QI0 A;  4PS3 A;  3SF4 A;  3JYH A;  4YT4 A;  4PJN A;  4J8S A;  3WXX A;  2WXG A;  4ILH B;  4OIN F;  3CLJ A;  4GCN A;  4FHJ A;  4P29 A;  2I8B A;  2Y4T A;  5DBK A;  4XIF A;  3SNH A;  2Y4U A;  4CT0 A;  1LF8 A;  1S7Z A;  3ZN3 A;  2ZXP A;  3RIB A;  4YT5 A;  5KYN A;  1NA3 A;  5DVW A;  2Q7F A;  4F7A A;  3ZG1 A;  2IXP A;  1NA0 A;  4M3O A;  1NU7 D;  1GW6 A;  4XE0 A;  2IOL A;  4IYP A;  2I2O A;  2KAT A;  2XSE A;  3PDN A;  1Z6A A;  1OWL A;  1MMD A;  2A6E F;  1IHG A;  5KYY A;  3QC1 A;  4NRH B;  4PH4 B;  2XQ0 A;  2DBA A;  3S2A A;  2JEK A;  1QNF A;  3EH2 A;  3RRM B;  4U07 A;  2R7T A;  1OCZ C;  2CG3 A;  2A4Z A;  2FUL A;  3Q7L A;  3L17 A;  5E75 A;  3DJU B;  4APO A;  5BV1 A;  4KT6 B;  3I5P A;  2XRH A;  1IZM A;  3OWT A;  2WXJ A;  2Y3G A;  4NAC A;  1PD1 A;  2V0P A;  1FTS A;  3DBS A;  2J4B A;  5LX8 A;  4XLN F;  2YEV A;  4WAF A;  4JVS A;  2XPY A;  2YQ8 A;  4ZLC A;  4KVO A;  4QI2 A;  2W9Y A;  2IXM A;  3AQC A;  3Q6M A;  4ABN A;  3ZFW A;  3CVP A;  4EZJ A;  3KAE A;  2I1K A;  2WMO A;  5G2N A;  1HZ4 A;  3Q49 B;  2CW0 F;  3KH2 A;  4DVZ A;  1ZYR F;  3CHR A;  3PEV B;  2J4D A;  5ANL A;  3GYZ A;  2R5S A;  4RSY A;  3LEW A;  2R7S A;  4KNV A;  3LS8 A;  4YT8 A;  4U5H A;  1ZHW A;  3VTY A;  3JQ0 A;  4QDL A;  2IFU A;  4CS8 A;  4WWO A;  3AG3 C;  3U66 A;  1Z63 A;  3LVR E;  4AY5 A;  2R7X A;  2NUP B;  3K7D A;  2IOS A;  4NY3 A;  2J09 A;  3OTN A;  4ILI A;  3ZRH A;  3GZS A;  3MCX A;  3M1C B;  1E8X A;  4U5B E;  4E7S A;  4E6H A;  5D91 A;  4L2Y A;  4YWQ A;  1TJF A;  1OCO C;  1D0X A;  2CDQ A;  4J32 B;  3KS2 A;  2L81 A;  3IBE A;  3O4Z A;  5AJL A;  4WND A;  4WNF A;  3QWP A;  1HFA A;  1ELR A;  2FEZ A;  3FUE A;  2KM4 A;  2UWJ G;  5KYX B;  2WXF A;  3TD7 A;  4TUU A;  3LY7 A;  1SMY F;  4GZD A;  3FDQ A;  4GZ6 A;  1NU9 C;  4N2S A;  4X0R A;  2AWI A;  1FMW A;  3FUH A;  2FF4 A;  5ARF A;  2CG2 A;  4N3A A;  3ABK C;  2WL8 A;  2YNQ A;  3L54 A;  3FEY A;  3FUL A;  4L23 A;  1D0Z A;  3U9W A;  4MND A;  3LJB A;  4I1O B;  4G24 A;  3IHY A;  4BWR A;  1ZU5 A;  3RRU A;  5LCW J;  3EZH A;  1SZI A;  2JLB A;  4URK A;  3CVU A;  2FGY A;  2Y69 C;  4J8D A;  2A5U A;  3ASD A;  3Q15 A;  4K03 A;  4JEU A;  3FH5 A;  2GW1 A;  5D0O D;  4XKC A;  4G25 A;  2J9Q A;  4G26 A;  4GA0 A;  2ZXO A;  2PM7 A;  4H7X A;  3E9V A;  4C7O B;  4DI4 A;  3CVW A;  2A68 F;  3CK7 A;  4OIO F;  4ME2 A;  1PY1 A;  1OCC C;  1ZHT A;  3D9P A;  2UY1 A;  2VGX B;  3ESL A;  3LS0 A;  4CT4 A;  2X6F A;  2WM9 A;  3AS8 A;  3ZYK A;  5FZR A;  1ZU4 A;  2EIN C;  5E2Q A;  3NZS A;  4L2L A;  1FVF A;  2HO1 A;  5L3V A;  4JHR A;  3OAW A;  1UJK A;  3GZ2 A;  2I6H A;  3RIP A;  2AXU A;  3B13 A;  1VK5 A;  3QMK A;  4JCH A;  2WPV A;  4GCO A;  1J8M F;  4I17 A;  3K33 A;  2C0M A;  5BUZ A;  3WOD F;  5DQT A;  3ML9 A;  3ESK A;  3PH0 C;  1OWO A;  1EDU A;  3FVY A;  3LY8 A;  5LP0 A;  2AW6 A;  4O6Y A;  5JJ6 A;  3ZXS A;  4MRU A;  3HTK C;  2XHE A;  1S0P A;  5G05 C;  2HYZ A;  2XL4 A;  4N3C A;  4LER A;  4LRZ A;  1IQR A;  4BJ5 A;  5DS4 A;  4AM9 A;  1FCH A;  3G2V A;  5KCM A;  3LEV A;  2Y3A A;  4U63 A;  1MHQ A;  4I6J A;  2OVF A;  2YZS A;  3RO3 A;  2G3V A;  2J9W A;  2B0J A;  3O39 A;  2X6I A;  5FQ6 A;  1XNF A;  2R7U A;  1E96 B;  1EPU A;  4JZA A;  4JXT A;  2CFU A;  1O87 A;  1Y8M A;  2KGO A;  5G04 C;  4BX9 A;  3FTY A;  5FQ4 A;  3QWV A;  4J8E A;  2FFH A;  2HV6 A;  4OYS A;  2CHZ A;  3JUI A;  3EGX B;  2WVN A;  2EIK C;  3JCU Q;  1BR2 A;  2E2E A;  3APC A;  4EWC A;  2J7P D;  4O6M A;  3ZW3 A;  5J08 A;  2WXP A;  3CV0 A;  3QOU A;  5A7D B;  2Z15 A;  4UWF A;  4F53 A;  4XI9 A;  1FFT C;  4ANX A;  1BR1 A;  5T3W A;  4BX8 A;  3APD A;  3B7R L;  3APF A;  1WGW A;  3CQZ A;  1L5J A;  2LO6 A;  5LOZ A;  3DAG A;  3UT8 A;  4DI3 A;  5JHA A;  2OVB A;  2V26 A;  2PX0 A;  4YN0 B;  4YVQ C;  5T1D B;  3S28 A;  4GZ5 A;  2GRM A;  4BJ1 A;  1HE8 A;  1OWP A;  2QTV A;  3ZSU A;  2X6H A;  3FUJ A;  1VMA A;  3CK8 A;  2XPI A;  3UT4 A;  2KW3 C;  2CNW A;  2QFC A;  3DD7 A;  4JPS A;  3CVX A;  4HFG A;  5J90 A;  4GPK A;  2WZL A;  3SZR A;  5KYX A;  3I4G A;  3SI5 A;  2VYI A;  3ZPJ A;  4HEA J;  3ASG A;  3UQ3 A;  5T4Y A;  1HG2 A;  4CCA A;  2PP4 A;  4CSA C;  2Y3H A;  1YA0 A;  1OWN A;  4JA7 A;  1HG5 A;  3EFO A;  4CBE A;  2BTD A;  2MOW A;  4I1A A;  1MND A;  1M2V A;  2P7V A;  3F47 A;  4EPZ A;  3D9O A;  1M56 C;  4BTA A;  2KCV A;  2PQR A;  2VSO E;  5IY5 C;  5ENN A;  3F46 A;  1UJJ A;  4KZC A;  3TGO A;  4U0U A;  2MRI A;  2BF0 X;  2MYS A;  3CHQ A;  3SHF A;  3FUK A;  4CIH A;  3DJN B;  4EBA G;  3CSK A;  1QZX A;  2NC9 A;  5AYW D;  2WXI A;  2NUT A;  4U5D E;  3JQ1 A;  3S7B A;  3RH3 A;  1HS6 A;  2R17 C;  5FQ7 A;  3ONK A;  3B7U X;  5KYU B;  3FUN A;  3LNR A;  2VAS A;  5ARG A;  4A2N B;  4C9B B;  4JJG A;  4U5F E;  3ABL C;  4YT2 A;  4AXH A;  2VTB B;  3RKO F;  3IHV A;  4U04 A;  4OIR F;  4KMO A;  3ZEF A;  2R7Q A;  3GZ1 A;  4RG9 A;  2CNW D;  1QQE A;  5KJN A;  4FLH A;  3LXU X;  4HVB A;  2WXN A;  3MLG A;  2XRY A;  5BV0 A;  4UWG A;  4W9R A;  1W2W A;  1E90 A;  3CHM A;  3SZ7 A;  2LSV A;  3VLE A;  4ANU A;  3QAQ A;  3FUI A;  3T5V A;  2QY9 A;  4PFP A;  3NQP A;  4J30 B;  1IYG A;  2J0W A;  2ZU6 B;  5F5F A;  3I5Q A;  3OXF A;  3E4B A;  3UGO A;  4JHK A;  3LCA A;  3U4T A;  4EBB A;  4ANW A;  4XZ4 A;  3AG1 C;  2KZT A;  2WQ6 A;  4G0H A;  5BNW A;  3QZC A;  4HLE A;  1DVP A;  1IW7 F;  4CDN A;  2L9J A;  3FHE A;  3FDH A;  1U3C A;  3NZU A;  4RG6 A;  1M2V B;  1WM5 A;  3NYL A;  4NUR A;  5HQ8 A;  4LLC A;  1Y6I A;  3FTS A;  2R7O A;  4AEZ C;  5FQ8 A;  1Z3X A;  4N39 A;  3MEK A;  4C3E A;  4H7Y A;  4FA6 A;  5CMW A;  1SF8 A;  4GA2 A;  1SQM A;  3LS1 A;  3C98 A;  4C3B A;  4ILG A;  4GB9 A;  4CS7 A;  3CK9 A;  2WMN A;  3NYJ A;  3T4R A;  2PM6 A;  4DBQ A;  3EFO B;  3N2Z B;  3NKD A;  3QJZ A;  1H19 A;  3L08 A;  3AG4 C;  2LAH A;  3T6J A;  3K1H A;  4PS7 A;  3OXL A;  3W2W A;  4I1M A;  3FFL A;  4LAC B;  3FUM A;  3ABM C;  4JZY A;  2E0I A;  3TXM A;  3B0U X;  2ZXW C;  2G3K A;  3FEX A;  4IUL A;  1OCR C;  3L34 A;  1D0Y A;  4FAD A;  1LS1 A;  2KNH A;  1UW4 B;  5FZS A;  3TXN A;  1Z23 A;  3ASO C;  3KL4 A;  4EEC A;  2HM8 A;  1VYI A;  3PE3 A;  2WVO A;  3LPZ A;  3N71 A;  5E3A A;  4ATG A;  3HDX A;  3FU0 A;  3R7Q A;  4B94 A;  3N0T A;  4C0E A;  2YHC A;  5KYU A;  4UI9 C;  1OKK A;  4BY6 A;  2WZF A;  4HOS A;  4HS2 A;  4I6G A;  1MMG A;  5F5H A;  3FH7 A;  4LEU A;  3MJW A;  1HF8 A;  3EH1 A;  3GW4 A;  2L0I A;  3W2V A;  2J45 A;  4CS9 C;  3ZYQ A;  4PDX A;  4MKT A;  2PX3 A;  1OWM A;  2VB6 A;  3PZD A;  2P58 C;  2ION A;  3FTZ A;  4KXK B;  4DLQ A;  3R7R A;  3Q6N A;  4G7Z F;  2KC7 A;  5T3R A;  2EIL C;  5G55 A;  4U0S A;  2E87 A;  4PFO A;  2DIW A;  4DPR A;  1HH8 A;  1VYK A;  4G7O F;  5JJ7 A;  4ACK A;  4KC9 A;  1INZ A;  1TKN A;  2Y3B A;  3UMV A;  3PHF 2;  4UI9 J;  3JCK C;  4HOU A;  2ZXR A;  1JWG A;  4LUN U;  5FWQ A;  5HI7 A;  4ANJ A;  2C2L A;  5E3C A;  5D0Q D;  3FTV A;  2LAI A;  3DXJ F;  3DMD A;  4HFF B;  4RD9 A;  2NUT B;  3CHS A;  3QDN A;  3LYA A;  4CS8 C;  2IU1 A;  3CVN A;  4IN3 B;  1E8Y A;  3SFZ A;  2VGY A;  4HOQ A;  3VYW A;  2YHE A;  4O7G A;  3I4R B;  3Q5M A;  3ASH A;  3AU4 A;  2A6H F;  4FJY A;  1VOM A;  3PMR A;  5EX0 A;  5B1B C;  1E7U A;  4B0Z A;  4N5C A;  4JUR I;  3CGH A;  4C3D A;  3FUF A;  4DK5 A;  3GAN A;  1ZHY A;  4UWL A;  1ZBP A;  4G23 A;  3FP3 A;  1OUV A;  1D1C A;  4RBN A;  5EHH A;  1B89 A;  4UWK A;  3OXG A;  4L7T A;  4IAO A;  4O6F A;  2A69 F;  1NZN A;  2PL2 A;  4AV7 A;  4EQF A;  5KJK A;  1M2O A;  1WY6 A;  5C1D A;  4HE8 D;  1H6K A;  2W4M A;  1D1B A;  3POV A;  2H7V C;  4F1S A;  3MA5 A;  3EPV A;  3PNL B;  3CVY A;  2KCK A;  5FTP A;  2OOE A;  4U5C E;  4L1B A;  5FT9 A;  3DZA A;  5A6C A;  2J9U A;  3FTW A;  3PUJ A;  3EHN A;  2NXP A;  4Q69 A;  4GZC A;  5EDS A;  2J46 A;  2CHW A;  4FJZ A;  3TAX A;  2BUG A;  4PUC A;  3H65 A;  1TWH A;  1KT0 A;  1ZHZ A;  2WXQ A;  3B9Q A;  2KZT B;  5EKQ D;  2XXA B;  2C0L A;  3CHP A;  3MV3 B;  4AIF A;  5KYW B;  4IJJ A;  3ZHE A;  3EG9 A;  4JA9 A;  2IF4 A;  3MV2 B;  5KJM A;  3SP1 A;  5B1A C;  4AJW A;  3FAJ A;  4N06 A;  4U5E E;  5DLJ A;  3LES A;  3URZ A;  3SNX A;  2Q3T A;  2J49 A;  3EG9 B;  3SD5 A;  2MHK A;  5LFA A;  3QKY A;  5CHE E;  1ST6 A;  3IEG A;  1A17 A;  1TR2 A;  4BTB A;  2HV7 A;  3IV0 A;  3DM5 A;  5EGY A;  4BJ6 C;  4CGW A;  1FVH A;  4AX2 A;  5AIJ A;  4AVX A;  1W3B A;  4HFK B;  3BEE A;  3EGX A;  4A1S A;  1UN9 A;  3AS4 A;  3HHM A;  3ML8 A;  3EZI A;  2LSU A;  3PNT B;  3EIJ A;  1Z3Y A;  3RYL A;  4DOZ A;  4BFR A;  4I44 A;  2CGE A;  4BEJ A;  3I4U A;  3ZYM A;  3EGD B;  4G7H F;  3U64 A;  4B89 A;  4XX5 A;  3L6A A;  4D10 C;  3JRT A;  3TG5 A;  3CQC B;  4DLO A;  3SGH A;  3ZVV A;  4Q7C A;  3IKO B;  3AQB A;  4J0U A;  2NUP A;  3EQL F;  2V8S E;  3U3W A;  2J0X A;  3QNK A;  4JW1 A;  3D9L A;  1TWA A;  1E8W A;  2L0T B;  4JJF A;  1WAO 1;  5DS5 A;  4M63 A;  4YND A;  2M4E A;  2GRL A;  2J08 A;  4FLB A;  4U8H A;  2I1J A;  3NKE A;  4EZL A;  2P6V A;  3JT1 A;  4PJM A;  4A55 A;  3G2W A;  5CCL A;  1TWC A;  2AVP A;  3RKV A;  4B8C B;  2WB2 A;  2WZG A;  4JEH A;  1UG3 A;  3EDT B;  3X1O A;  3CKC A;  4XTK A;  3KKB A;  4YVO A;  2KQ9 A;  2FI7 A;  4FHK A;  5G05 J;  4APF A;  4UQY A;  3TJP A;  4NQ0 A;  2WB7 A;  2WVQ A;  2V5F A;  1LVK A;  4EZK A;  4PS8 A;  1FMV A;  1NG1 A;  3P1U A;  2R7V A;  3CST A;  4A3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...