4IRUA

Crystal structure of lepb gap core in a transition state mimetic complex with rab1a and alf3
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
296
structure length
296
Chain Sequence
SLKPLTLLMTSSTSFSETINQWADILKTTDMEKFSFDSNPINLLELVKQFNLYVDELAITCEANNVWAKERIDSTPNLFALYDNSGGEAIHGHAFVPYYKESIVLRRLFTVDPNTFNLSRFAAFEGPCQLYCKEHKDSAWVKIQTLLTLGNGIINTLKIIKQAQAFGIDEAVTENLKALKEQFIAFQLAEADIKESLKAPSFAEPLPNKESEFFYPIDEKALAKMNGYQLATICLEELNSPKPSPLIERILSNKKFWKRINSAFESGVFKGRTDDPAGKIAKIREWHQLLQISGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Legionella pneumophila GTPase Activating Protein LepB Accelerates Rab1 Deactivation by a Non-canonical Hydrolytic Mechanism.
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase/hydrolase
molecule keywords LepB
total genus 109
structure length 296
sequence length 296
chains with identical sequence C, E
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2013-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18172 LepB_GAP_N LepB GAP domain N-terminal subdomain
A PF18227 LepB_GAP_C LepB GAP domain C-terminal subdomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1700 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4iruA01
1.25.40.830 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4iruA02
4JVSA 4IRUA 4JW1A 4I1MA 4I1OB
chains in the Genus database with same CATH superfamily
5A6AA 4BFRA 2WXMA 3HVEB 5C2YA 1V74B 3ABLC 3G4ZA 3BU8A 3CK9A 3I5QA 3T8KA 3CKCA 3E9VA 1Z6AA 3C5RA 3M79A 1ORSC 4ANXA 2J8WA 3FTSA 4IAQA 5AQ7A 4U5HA 4G8LA 2TMVP 4NCQA 1S05A 1E84A 1ELRA 2GRNB 1S0PA 3CHOA 2Q9AA 1V54E 1SZIA 3CVQA 3V31A 1T6IA 1OT8A 5COGA 2CW0F 1SZAA 2ETCA 1CGNA 3FUHA 4B0ZA 2BE5F 3ASHA 2Y3AA 1OCCE 3JYSA 3FUKA 3UPVA 2IXOA 1T9KA 4L6RA 5KNGA 1Z7Qc 4UQZA 3T9KA 4PJJA 3EH1A 3U5SA 3MX3A 2XEEA 3U9MA 5JJ6A 4KC9A 3E30A 2FULA 2KYHA 3FOOA 3D9LA 4N5QA 4J8FA 4G11A 1FCHA 4WGYA 4AM9A 3L08A 1EPUA 2AXUA 1N0RA 3NBNB 4JC8A 2OCCE 1MMDA 3S2AA 4BERA 2BTDA 3C7JA 3W9FA 4AK9A 2EPKX 2A5EA 4XQ1A 3QNKA 4CDNA 4OVVA 2Y1LE 3ENEA 4FESA 2NXPA 4BJ6C 3B13A 2KCLA 4L9PA 3PCVA 4Q94A 3LY8A 1WN0A 2YZSA 3WAQA 2J4DA 2MRIA 1Q2ZA 4MVMA 3Q4AB 2YL3A 4MRUA 3KPHA 4QI2A 2G3VA 2Q00A 3T9OA 4JIOA 3MFNA 2H8AA 5JHAA 1NP7A 5HI7A 3CKBA 3ML9A 1TNOA 2J08A 3WHNA 1P5QA 2XLVA 1Z5SC 4WJ0A 2LXLA 4BJTA 4ANUA 4NQFA 4O6YA 1D1CA 1FFHA 1HG5A 2HJMA 1OWNA 4F4BA 2RSEB 2KC3A 1EF1C 4U0SA 1OW6A 2KW3C 3NMIA 2L6JA 4G1TA 3NZUA 5AQ9A 1EKYA 2IYLD 4K5CA 4I9EA 2AVPA 4UQXA 5ANRA 5G05J 3ABKC 1MQSA 5H7PA 3EIQC 3AGUA 2F37A 4NTBA 2WM9A 4AEZC 4K5BA 2A69F 3SFYA 3CQCB 4CX9A 3DXMG 2ICWG 3GYZA 1HW2A 2DGJA 3SFXA 5ENPD 5AQAA 4HFGA 2NUPA 2KGOA 3V7OA 2XZTG 2GAQA 4RLYA 1AP7A 5FIOA 3FH5A 2QLAA 1IHGA 3ISMC 5AENA 2XL8A 2KQ9A 1T01A 3UMVA 2R7RA 3DD7A 4J8YA 5L0DA 4NTAA 1OCZE 4U5GA 2J09A 3C98A 5FQ8A 1TQGA 1ST6A 4JCZA 4UI9C 5BXUA 4U9DA 4OD4A 1J8MF 1WG0A 2HMZA 1LKXA 4ZLDA 2A6HF 2IO3C 3R7QA 4GTOA 3BRJA 3UKUG 3FHDA 3GEIA 3KL4A 3QDNA 3PZ4A 2WZLA 2P9UG 5G04J 2F8YA 3ULQA 5IY5C 1VLSA 3SNXA 3UT4A 5JMND 1HE1A 4G25A 5M72A 1PD1A 2LAIA 2V8SE 2LIGA 2IXNA 1ORYA 3LNMB 3G50A 2E0IA 2PM6A 3GEEA 1K40A 3RKVA 4AP2A 4H54A 3AS4A 3FU0A 1MYOA 3UMHA 3K1IC 4JL0A 4A1GA 3QVYA 4EIYA 2WXPA 1WATA 3A9CA 4N4WA 4FULA 4EUKB 4JPSA 3IPMO 2HE0A 4ME2A 5D0QD 4NQ0A 5EHHA 4LG6A 3WXXA 1OKKD 2XLDA 2P9SG 3JCKC 1OCRC 1H19A 5D2MC 2ZXOA 4JKVA 1K04A 3CEXA 5L0HA 4I2ZA 3SD5A 2CYDA 4HQDA 4WWNA 1MZCA 2OKUA 2F8XK 5KYYB 1A7VA 1HO8A 4N6HA 4YT5A 4ZLCA 2C0MA 4PJMA 3NYJA 3US6A 4AE4A 2O9XA 3HDXA 1ZHZA 1QKRA 2PNOA 5C1DA 5DIZA 2B0JA 1GGQA 3GWNA 2A5UA 5BUZA 2XL6A 1OY3D 3PS6A 3ECSA 2WQHA 3HXBA 3BEHA 1JUQA 4BESA 2HUJA 3TWRA 3M15A 1HE9A 2JX0A 4C7OA 2EPNA 3EG9B 1IYGA 3RIPA 5LX8A 2LNIA 4MS6A 5DQZA 3ESKA 4A2NB 2H6HA 2HM8A 4G23A 4F1PA 2PZIA 3PEUB 3UM2A 2BUGA 3LEOA 4NRHB 2EPOA 1NFIE 2WXLA 3AQBA 2KM4A 3QMKA 4HFFB 4MW8A 2IO2C 1D9SA 2I1KA 2V4LA 3G2TA 1YDIA 3ZXPA 2XLWA 4GA0A 3RW0A 5ENRD 5FTPA 3FTVA 4JHJA 3MYIA 4J7TA 5JHBA 2HJ3A 1L7CA 3ZIMA 1YMPA 4ACKA 3IQ5A 3D9NA 2P6VA 4B6IA 1MMNA 4IB4A 1TNBA 4G8KA 2Y3GA 4Q4ZF 1M57C 3PREA 2FI7A 3FUJA 3W9GA 1LS4A 5BV0A 2IQCA 2LSUA 3L17A 3B71A 2WXRA 4M3OA 2HYZA 3B7TA 4CS9A 2B0HA 2GWWA 4DI3A 4WNGA 3T8MA 2VCBA 2ZXRA 4OIQF 1E8YA 3NRHA 1N0QA 3FOPA 1BI8B 4GB9A 2CG3A 5BNWA 2X38A 1NU9C 2ETSA 4N39A 3TWVA 4WAFA 2CCYA 3U9JA 1W2WA 5JRAA 4TXPA 2LFFA 1WGWA 1TN6A 1RMVA 2Q7RA 3X2QC 1DVPA 3Q73A 3FXHA 2YVKA 3I3NA 5T1DB 1XWJA 3DWWA 4FA6A 2I2OA 2W4BA 1OCOE 3AU4A 2Q3TA 1UJKA 1FVHA 1EYHA 1TR2A 2CGEA 3T6GB 4BT9A 3ZGQA 3U66A 4ACLA 1H6KA 2WL8A 3D9MA 2WXIA 2FO7A 3PH0C 3UM0A 1ZW3A 3JSEO 5KYNA 3OXGA 2Y69E 2GRQB 1D1BA 3I4UA 3ZDLA 4CDMA 2J0WA 4J32B 4I1AA 2CNWA 3X2QE 4E85A 3AG3C 4G7HF 1Y6DA 1DNPA 1FT1A 4EZKA 3NYMA 3UGOA 3AG2C 1IQUA 2XQ0A 3RU0A 2LQGA 2OOCA 1IXVA 4HRNA 3L0IA 1OXBA 3K66A 1QQEA 2XXAA 5DS6A 3K9IA 3TWUA 5AIJA 1H7IA 3MV2B 5FQ4A 4O1PA 1QPUA 4C0EA 3JQ1A 1LVKA 1YYJA 4FWVA 4JA9A 3TWXA 2R7QA 3CHPA 4MVRA 5KYWB 1I5NA 1YJGA 4MVQA 4BJ5A 4ANWA 3S27A 4KI2A 2XRHA 3K6BA 5E76A 3JSZA 2WXGA 3UIOC 4UUCA 3ZXSA 3LLIA 1MX4A 2H6GA 4AX2A 4YL3A 1TWGA 3FUMA 1JWFA 3U2MA 2EIME 2IONA 4RBNA 3VAYA 4NURA 2ZPAA 2J45A 4MNDA 5B1AC 2FFHA 3SF4A 3U0CA 4UI9K 4I6GA 2L6BA 4RG6A 2OQMA 3UI2A 2Z15A 1G4WR 3ITFA 3G2WA 3ZHEB 4CRWA 3FAJA 3JZ0A 3DEOA 3FEXA 2XGOA 2L9JA 4P29A 3GM1A 2WMNA 4C9BB 2Y4TA 3V2XA 5JSLA 3L82A 1YA0A 2LCHA 3VRCA 4U07A 3LEVA 1LIHA 1FFTC 1OXJA 2HV6A 2XRZA 4AJWA 3MEKA 1Z5ZA 2QFCA 3FTUA 4XX5A 3R9MA 3GORA 3C62A 3KYJA 5CECB 3ZQYA 1G8XA 5L0IA 4XKCA 3K33A 5CI9A 5KYYA 4IAOA 2PX0A 2M63A 5BV1A 3V5XA 4JEUA 3Q78A 3ZYKA 4E18A 2WMOA 1ZHYA 1SA4A 5B1AE 1Z3IX 3DM5A 3Q15A 1QVXA 2AWCA 3AOUA 3MJWA 5CMWA 3S9OA 3MCXA 5KWDA 3HLZA 1MMAA 2AXZA 3Q9NC 4HOTA 4YT2A 2OEVA 2L9BA 1SMYF 4PR9A 1JPJA 5JT4A 1YA9A 5B1BE 3CVXA 3B0PA 2R9RB 3X1OA 2GRLA 5GPGB 5E3CA 3AQCA 2FF4A 2C2LA 4MTGA 2YHCA 1ELKA 5JUAA 4BWRA 3H65A 1HZ4A 2B0OE 4KBLA 4DBRA 3HXDA 1LE4A 1RXQA 3HHMA 1YYXA 4XPYA 1BR1A 4ABNA 1OCRE 4KXKB 5EIDA 5ENNA 2R5SA 5JP7A 3PE3A 4KMOA 4JHKA 3DEPA 3O6XA 3PZ2A 1TFOB 2KSFA 1Z6TA 3DJUB 4HI8A 2Q7FA 4I1MA 2OU6A 3OXLA 2YNQA 3CHSA 3APCA 4I6EA 1A5EA 1INZA 2VCCA 2V5FA 2NSFA 1ZW2A 1HH8A 1O87A 1KNYA 3DI5A 4MTOA 4GYYA 3CQZA 4GQHA 4YDYA 3LS0A 4D4NA 5DQTA 2VYIA 4BX8A 3CV0A 3FUNA 3C3RA 4ATGA 2CDQA 4AL0A 3UIPC 2DBAA 1N94A 2F22A 4U0ZA 3LS8A 3RAUA 5AN8A 3ZC4A 5COFA 1E2XA 1A0BA 2GRRB 2KCKA 4YDOA 3SZ7A 2D4UA 3EFOA 1NFNA 3L1MA 3EZHA 2RD0A 4XLNF 3FVYA 2VSOE 2HS5A 4FLHA 2NUPB 4MKTA 1SZ9A 2DCPA 2VJ8A 2YKZA 4C0MA 1QZ2A 2VSYA 3CEQA 2P61A 2EIKE 1PCXA 2XPIA 4ILIA 3QKYA 2X0CA 1OWPA 4MVOA 2AJAA 4LDQA 2GRPB 1VTMP 3HTKC 4PFOA 3ASOE 4HBDA 4UDVA 1HS6A 5FZSA 3ZVRA 4YNDA 2DZOA 4CYMD 4GCNA 4GMJA 3UQ3A 4GA1A 2XSEA 4PJLA 4YJWA 4X0RA 3ZG1A 4CT0A 4JD2G 1Z3YA 4XPWA 1LD8A 4PJNA 5D91A 4DJAA 1CGOA 2WVOA 2J07A 3TJPA 2J0XA 5CBNA 3PZDA 5E33A 3NQPA 2YLDA 4CJGA 1WAO1 3RRMB 4XLPF 3L6AA 2LAHA 4IGGA 3EU9A 3LY9A 2V4HC 2GRMA 3M4BA 4Z9HA 1WM5A 4EBAA 2VGEA 1Y8MA 1QLEC 1MMGA 4JVSA 3SXZA 3MZLB 3P1UA 1TR4A 3D9PA 2H7VC 2DYRC 5LP0A 3ZQVA 3AG1E 5CI8A 1OWLA 4FLBA 3JYHA 1RJ9A 3TAXA 4Q7CA 4W9RA 2XM0A 2NPUA 5K0IA 1IQRA 3EPVA 3RKOF 4CBEA 2GA0A 3G2VA 5FINA 4ILGA 4B89A 2Y39A 3T5VA 1YCSB 4DLOA 4LNGA 2IM8A 4MBGA 1VOMA 5FWQA 5KYUA 2QYUA 4JJFA 2FEZA 1LF8A 3TXNA 4AVXA 4AE4B 2XLEA 2R03A 2XZDG 5A6BD 2R7VA 3EDTB 2VTBB 3ESLA 3QARA 5HSWA 4GTTA 4APFA 1SQMA 4OINF 1OXKA 2P0NA 3TJ6A 2HKVA 3UMIA 2R17C 3WG7C 1SF8A 2J7PA 3EGXB 1G3NB 1A7DA 3HJCA 4FAPB 3EHQA 4GAAA 3Q49B 3V5YA 3ULYA 3LJBA 3S28A 4KZ0A 2EINE 1X5BA 2C03A 1E7UA 4CZ2D 2ZGGA 4OIOF 3FTWA 1NZEA 1K1AA 3L54A 3E33A 2RFAA 2P9LG 1JOGA 5HQ8A 2I9CA 3ZRHA 1ZYRF 4OAVB 3ZTMA 3TG4A 4UI9J 1N4SA 3TL5A 5JJTA 2JD3A 3G2SA 4CT4A 3CVVA 3HNIA 4K1OA 3DKAA 2IY0C 3ATPA 4GZ5A 3HNLA 1E8WA 1E96B 4WWOA 4JTDB 1SYQA 2DYSC 1FMVA 3HNJA 4YWQA 2HMQA 2PBEA 3L8JA 4O79A 1T5OA 2UUHA 5EILA 4UWLA 3O48A 2NYJA 2CHXA 2EIKC 3NAWA 5F5FA 4RSYA 3FFLA 3KSQA 1Y6IA 2X3MA 5FZTA 5KBAA 2EINC 1NLXA 1PV3A 3B0VC 3UT7A 3R7RA 2HFIA 2IF4A 3TJ5A 4HVBA 4PS7A 2YL1A 3MLGA 3MKQA 2X6IA 2WQ6A 4J8EA 5EDSA 2IXMA 4N06A 2C04A 3Q6MA 2PQNA 3FU5A 5L0CA 1FMWA 1GS9A 3FTYA 3AGTA 4GZ3A 1LS1A 4J8DA 5B1BC 5LFAA 4I3MA 2XPYA 5ARFA 2I8BA 3KAEA 4EHMA 4GZ6A 3U2LA 4CIHA 3DSXA 1UOHA 4N3BA 1DOWA 4ONSA 4BTAA 2QUPA 2ZXWC 3GZSA 3CSFA 3ML8A 4KYOB 3ONLA 3LLKA 2YHEA 1ZBPA 3DSTA 1TEZA 3DJNB 2VSNA 3DPYA 2QZAA 5CEDB 5B3SC 3B29A 3IXEA 3QW0A 3ZUVB 2R7XA 1F1MA 1HU3A 3J5PA 4UWGA 4F53A 1MNDA 4GMRA 3Q7LA 2NSGA 2MYSA 3IQCA 1N54A 4LSZE 1VB5A 4HB5A 3NG1A 1E90A 4Q96A 3IQTA 4FHKA 1PC2A 3PNLB 5ITZF 1HXIA 1NFOA 4ER9A 3SP1A 2FAPB 3LUTB 4U5DE 3LNRA 3FU3A 2A68F 4KZCA 2OVBA 4JTAB 1Z3XA 2DWZA 2J49A 1L3PA 4E6HA 1BR2A 1C03A 1NZNA 2NG1A 1BBHA 1E85A 4LCTA 2H6IA 1RKEB 3T4RA 2I6HA 3RO3A 3FDQA 3RJVA 1C02A 2WB7A 1HMDA 1BI7B 3PEVB 1LPEA 4TRQA 3EHNA 1TNUA 2OEWA 4H7YA 2XCBA 1Z23A 2WVIA 3CGHA 5HS0A 4XTKA 4D10C 1ZHXA 4XKBA 2QTVA 4BJ5C 5AQBA 2HR2A 3TK0A 1RKCA 3T5XA 1TYQG 1JCRA 4BG0A 5L0JA 1DC2A 3TWTA 3ZIBA 2E2EA 4BEMJ 2LSVA 2WB2A 1H2TC 4K7BA 3QVZA 2E87A 3E70C 3D3MA 5DLJA 2P58C 5COMA 4APOA 3K7DA 1V4AA 4HEAJ 4YDWA 4IRUA 3LYAA 2PM7A 4XWJA 3SNHA 4GU5A 3DWLG 3RFYA 5BQIA 4G7ZF 3FDHA 3LVRE 3NOGD 3V79K 4O1OA 2P9NG 1S70B 2CG2A 3IHVA 4OAUC 4TUUA 1N52A 5G2NA 1L5JA 2L6FA 4GMLA 3HKKA 1QSPA 4L23A 3UX4A 2MOWA 4EBKA 3BG0B 3VTXA 4PS3A 1HX8A 2BKKB 2FO1E 2HSQA 3HXEA 4BX9A 1HY5A 2J4BA 4K5AB 5CERB 3K1HA 5KYWA 4O6NA 2IOSA 5L0FA 4NACA 3AG3E 1H2UA 5LCWC 4I6JA 3D9JA 4PACA 3UKRG 1OWOA 3AG2E 3RVZA 3W2VA 2XM4A 5A6CA 3G2UA 2RD9A 3OXFA 1NSGB 1VLTA 4WWPA 2MYOA 5EN5D 2IBFA 4ULWA 3H2VA 4NTFA 3O55A 4G78A 1UFBA 1PAQA 3C63A 3ZWIA 4LLCA 1M2VB 2QY9A 3CVYA 2J9WA 4JEAA 5TJ5E 3SXKA 2YWAA 3FP3A 2WXJA 3LPZA 1OUVA 3ZYQA 4DJ9A 4KBQA 1YLMA 3B7BA 2OCCC 3DSSA 2I1JA 3KD7A 3LJ3A 2KCVA 3G4XA 1A41A 4EWCA 2I15A 1N11A 2DZNA 1BR4A 1JPLA 3JCUQ 4TXRA 3GM2A 1EI7A 1HFAA 3NZSA 3KH2A 2BC5A 3DE8A 2G3KA 4DI4A 1WDYA 2L0IA 3FUDA 3Q7FA 5AJLA 1M6TA 2L0TB 1K05A 1S7ZA 3JXJA 3N24A 4A63B 4OD5A 2W9YA 4C3EA 3SXYA 4WNFA 4GTQA 1NL4A 2HV7A 2V26A 5T4YA 2WVNA 2WZGA 1O1SA 4A4AA 2PF4E 4Y6WA 4BETA 1WOLA 3RQFA 1YYHA 1Q0GA 5ANLA 2VGXB 1TJFA 3FUFA 1SR2A 5ENQD 2Y3HA 2EILE 1KT0A 1DOVA 3CQGB 3Q6NA 3QAQA 4WABA 4IARA 2XEVA 3MYVA 4EZJA 2WVQA 4HRLA 3DSVA 3N0TA 1LTXA 3C18A 2HZ8A 2YL7A 1ZB1A 5EX3A 3UT8A 3Q47B 4XIFA 5JS5A 3FTXA 1XZPA 2ZISA 1OCZC 4P9FA 4C3DA 2AWIA 1ELWA 3ASNC 5BPPA 4N2SA 2IOLA 4G26A 1VK5A 3I5PA 3JQ0A 4LRZA 3UR3C 4AL1A 1JWGA 4H7XA 4NY3A 2JPUA 2VASA 1LM3B 1UG3A 4I2WA 4LUNU 2QE9A 3CIAA 4EQFA 4DRHB 4GYTA 3L9TA 1OQCA 4Q5SF 5EK0A 4EZLA 3LS1A 3QWVA 4DK5A 3QOUA 4CDYA 3AG1C 5EKQD 1O3UA 2P9IG 2J9BA 2V0PA 4I43A 4DPRA 3EJNA 2XCCA 3AAAC 4LDKA 3CK7A 1UW4B 1D0XA 5HV9A 1IHBA 2WZFA 4HLEA 2OOEA 1LD7A 4CDRA 2IOQA 4DXWA 1HMOA 4QQIA 2QY7A 1T6QA 1OR2A 4F6RD 4WNEA 3B7RL 1EQ1A 2XXAB 5F28E 4CIPA 3MGBA 2KNHA 3ZSUA 1UG7A 1EDUA 3QWPA 1V55E 2UUIA 3OEOA 3BEEA 5KJMA 4UWFA 4WNDA 4U95D 3AS8A 4EPZA 4G2VA 4FP7A 2R7UA 4EKWA 5FQ6A 4G0HA 4W8KA 3D9OA 2XPZA 5T3WA 3CSKA 4RG9A 1CGME 2L81A 2DB4A 5LCWJ 1JMWA 3QK0A 4QI0A 2J9QA 3SXMA 3U3BA 1OCOC 1XZQA 2XLMA 2ETBA 2ZIRA 5A23A 3EGDB 4CCAA 2WXFA 3S7DA 3FAPB 2IU1A 4BT8A 4RVBA 2XS8A 2JLBA 3FU6A 1LI7A 3JXIA 1UJJA 4U96D 2J9VA 2YL0A 4U5EE 2EIJE 1TNZA 2MHRA 1FPPA 1U3DA 2DI3A 2B6CA 4CGVA 1X81A 2JEKA 3GZ2A 5A69A 4AIFA 3TWSA 2W4MA 4EBBA 2Q4FA 5G55A 4RD9A 3RVYA 1H0AA 3EQLF 3M1CB 3FH8A 4GTPA 2VB6A 4N2QA 3DM9B 1JAFA 3UXGA 3R2PA 4AXHA 5J08A 256BA 3UTMA 4P6IC 3SI5A 1C17M 5KJNA 2XGSA 2XGMA 3UNGC 3UUXA 4B8AA 3C8GA 2XLHA 5D92A 1XGWA 4DUIA 3UMKA 2R02A 2X6FA 2X51A 2H7OA 2OEXA 3V5ZA 1CPRA 1FT2A 3FTZA 2A0BA 4TXQA 1E8ZA 3CZ6A 3HVEA 4XE0A 4K0DA 3E4BA 4EHPA 4U9EA 3EGDA 3W4YA 1Z63A 3TULA 3KMIA 4P9TA 3EH2A 3IQ6A 2EPLX 3M4CA 1TWHA 4CJOA 2IEJA 3RO2A 5BQGA 2M4EA 2BKGA 2ZXWE 4DX7D 5KNHD 1HF8A 4PH4B 2EIJC 4JZYA 2L7AA 4ANJA 3RK6A 3FUEA 5JJ7A 3I4GA 3AG4C 3T6JA 4N6CA 4XZ4A 2RKKA 3SFZA 1D8DA 3Q7AA 3ZNGA 3B0UX 2ZXPA 3VLDA 3IHYA 4J6IA 2YHSA 2QC9A 1Y4CA 4U5FE 4O6FA 4DX5D 4DBQA 3ZHEA 4U8YD 1DCQA 3MYFA 4DLQA 3WG7E 3LESA 1A17A 3SBTB 5AAOA 1FTSA 3E37A 1U89A 3U4TA 2AWYA 1ZU4A 2ZU6B 4CEMA 3I4RB 4GZDA 2GFHA 3NYLA 1Q0MA 1O1RA 5G05C 3FEYA 4O60A 2KXPC 1PY1A 3PE4A 5FCLA 1HW1A 3PUKA 4J8SA 3HIZA 1D0ZA 3KEZA 3CLJA 3SZRA 3LXUX 4YL0A 4R7LA 2LK4A 3L22A 4PUCA 3B7UX 4U8VD 3AG4E 3EZIA 4U7EB 2GROB 2LD6A 3CHMA 1YZAA 3EG9A 2CHWA 2BEDA 3IKOB 4BY6A 5G04C 4MVSA 2BF0X 4BTBA 3E34A 1O5HA 3R9AB 4A3TA 4HS2A 3ZTZA 4R32A 3SGHA 3ZVVA 3L34A 1E7VA 4HORA 5L0GA 3TWWA 2DYSE 3VLFA 3MKQB 4I17A 1BD8A 3L13A 2J46A 3PDNA 3GANA 3O10A 3VYWA 2PQRA 3S84A 3CVNA 4O6MA 2XLOA 4DX1A 1UN9A 3LJNA 5A7DB 4K03A 3CVPA 5EGYA 3LCAA 2OV8A 1MX6A 5IY5E 3DSWA 5AGFA 2VSXE 2UY1A 3QWWA 1MHQA 5BXOA 1OW8A 1ZHTA 2WXNA 2KJGA 3A11A 4LERA 5FZRA 4JW1A 3Q9UC 4ANVA 2Y0BG 1J8YF 4GEHA 3C8GB 3GZ1A 4UQYA 4MVUA 3S7BA 2EQXA 2NSZA 2PNNA 3GM3A 4Y6CA 3PUJA 4XEVA 2MHKA 4DOZA 3ONKA 4E0HA 4MQ9F 3ASGA 3FMSA 1NA3A 2VQ2A 5CCMA 3JUEA 2UY1B 1LI5A 2OJED 3T6BA 2FBNA 3DZAA 5BW8C 3UGPA 4DRIB 4YDEA 1AUEA 1U3CA 3NDBB 3QW1A 5DS5A 1IZMA 3JUIA 1FVFA 2Y69C 4ZHBA 4LACB 1H2VC 3B7SA 3HXFA 3E32A 5ENSD 3RQEA 4D4XA 4URKA 1E86A 3P2BA 3Q79A 3FH7A 5AYWD 4XEIG 3MKRA 3RYLA 1WTYA 4I1OB 3DE9A 3IEEA 4I44A 1DCEA 3ASFA 4GA2A 1ZU5A 3AS5A 3URZA 4DRXE 4AY6A 1M2VA 4U5BE 3SO8A 1QYMA 1NU7D 2H7BA 3NMKA 1TN8A 4CS7A 3F6QA 4B93B 3APFA 3ZPJA 1MQVA 2QYJA 3TD7A 2L6GA 5BQHA 5KYUB 1QNFA 2PX3A 3PRZA 1Q0FA 4U63A 3S0XA 4LNUD 4FX5A 4E0IA 2VTBA 1KZPA 4FJZA 2Q9CA 3LDZA 3LAYA 1R4TA 2NUTB 5KYXA 2AW6A 1SVXA 2M64A 3EHRA 3KSLA 4ZFHA 2R7OA 4JB8P 3RSEG 2LFDA 3FY4A 3GEHA 3AU5A 3NF1A 1SA5A 2P9KG 5T8IA 5CMYA 3K1IA 1H9TA 3HG0D 1TWAA 4V3IA 2OG2A 4HFKB 3U64A 3D9HA 5CRUA 5E2QA 2V3CC 3DAGA 3IEGA 1NA0A 4DX2A 2YQ8A 4NC3A 2PL2A 4WGZA 3AJIA 5KJLA 1KT1A 4Z9IA 3NKDA 3U3FA 2EILC 2UWJG 4ILHB 1M2OA 1O1TA 1VDYA 3F47A 3PVLA 2CFZA 4FU3A 3FULA 3GW4A 2AXVA 3VM6A 4C48B 2WXHA 3SEOA 1OR3A 2OVFA 4FJYA 1RJ9B 2C0LA 4HNAD 2GGFA 2A1DD 1ORJA 2EIMC 3ZYMA 2CNWD 3QTHA 4XEFA 2KZTB 3ASNE 3LY7A 4PS8A 3LEWA 1FNTc 1N4RA 1N9AA 4EECA 1OKKA 3KYIA 2Y4UA 3LKUA 4JHRA 5BUOA 1GQAA 4L7TA 1KPSB 1IKND 4A55A 4C3BA 3ABLE 3C8ZA 3QB2A 2J9UA 5FJYA 3PZ1A 2ETAA 1AVOB 4G24A 3D9IA 3ABKE 5BT1A 4BEJA 1B89A 3DRAA 3S7JA 3N71A 4JURI 2PP4A 1WASA 1VYKA 3TG5A 1QQ3A 3C8GD 4N5CA 3SBSA 4Z68A 4XPXA 2AVKA 4N3CA 2HO1A 4B8CB 5A6BA 1YVIA 4U8HA 1YZCA 4LDRA 1JRAA 2XEHA 4Q69A 3F46A 1VYIA 1BPOA 1TNYA 2LUHA 4G7OF 4X8QA 1TJCA 2W45A 2L6HA 3H2UA 1V55C 3GWLA 3CK8A 1K1BA 3C72A 3VTYA 5D0OD 4CGWA 2A6EF 1N4QA 3RIBA 5CEAA 1E83A 4C7OB 3L16A 3RRNB 3QZCA 3HXCA 4OIPF 5EX0A 2CHZA 2WQ7A 4E7ZA 3BUAA 3KKBA 3PMRA 2IFUA 5EYPF 3Q7GA 2IJGX 5AC4A 3EUVA 2LSEA 5F5HA 1K3ZD 1D1AA 3JYYA 2YINA 2ONDA 3HNKA 1ZU2A 5DBKA 4AY5A 1ZVZA 2YLGA 4GYWA 1E8XA 4M63A 3TOLA 1O5MA 2VGXA 3JRMO 5AC5A 2R05A 5EYLA 3BG1B 4CDAA 5DVWA 3UM3A 3RQGA 2X6KA 4XEKA 5HKPA 2R7SA 1GM5A 5CHEE 1GW6A 5CBOA 4GYOA 3CHQA 2DYRE 1N95A 4TV3A 2A0UA 5ENTD 4J7WA 1U2VG 3VF0A 2Q9BA 2QNLA 1H6OA 1RW2A 2R2LA 1H6GA 3ASOC 1KU2A 2R7TA 3ZU7B 4KVOA 3EFOB 3OAWA 1JCQA 4GTRA 4UWKA 5KCMA 3TWQA 2YQYA 5LOZA 1AEPA 2KK1A 2YRFA 4E7SA 4J30B 5HRYA 2ZGDA 1YARO 3EGXA 4CS8A 4GPMA 4TUMA 3IV0A 1UN8A 4GCOA 3SY2A 3RF3A 2P7VA 3ULEG 1JPNA 3TGOA 2GW1A 3SHFA 1H6PA 3S90A 4UWHA 3OTNA 3DXJF 3S29A 5L3VA 4EBJA 3ZFWA 4AV7A 2KZTA 3SYNA 3DSUA 1H9GA 1APCA 3U3WA 1NBBA 4BEPA 3AJMA 3B9QA 3JT1A 2XHEA 4XI0A 3S7FA 1FR0A 1M56C 3N2ZB 5EIBE 2NUTA 4U0UA 3V30A 1CPQA 5JVEA 3ABME 4RDAA 4IJJA 2XS1A 4J0UA 4KVMA 2R7WA 4LNBA 2LO6A 3PDMP 1OWMA 1I4ZA 4QFVA 1IW7F 5FQ7A 4K0RA 5KYXB 5E75A 2D5RB 3MA5A 1RCPA 5KJKA 2DIWA 3IBEA 3WODF 2Y3BA 4YK5A 4U04A 4PFPA 2H6FA 4JEBA 3ZN3A 3MBGA 4LLEA 4W8PA 4YVOA 3RH3A 5B3IA 2Y3DA 4MVZA 3EIJA 4CS8C 4JA7A 4LEUA 4OVUA 3U9WA 1ZHWA 4MW3A 4BSZB 4H4KC 4JZAA 1BLXB 5CRVA 1PD0A 2J7PD 2KATA 2P2CP 1QBQA 2FGYA 2AP3A 2RG8A 4JTCB 4WUYA 3J5QB 2ILRA 3DPDA 4M7CA 4FADA 4YT4A 2P1AA 4BJ6A 1TN7A 3QC1A 3JRTA 4MTFA 3Q5MA 4ULVA 5CCLA 2VH3A 3CVLA 2F0YA 2WPVA 1N4PA 4J7YA 4JJGA 3APDA 3ZEFA 1XNFA 2XENA 2R59A 4GTSA 3CR3A 1LE2A 3L8IA 4MLPA 2HSBA 3HYMB 4EBAG 4F3VA 1NG1A 2WXOA 4JCHA 3D9KA 1S63A 4PDXA 1BU9A 3DMDA 1SW6A 2NC9A 2V5QC 4HOQA 5AARA 3U8PA 4GZCA 4IYPA 3KEAA 3Q75A 4QDLA 4DRJB 4JC7A 2A4ZA 3PHF2 1OW7A 4KNWA 3VLEA 2KBXA 4L1BA 1R5ID 3ABMC 4CSAC 3DXKG 1WY6A 4HOUA 1HG2A 2KC7A 5L3QA 3CVWA 3HRAA 4HLLA 3EHMA 3KS2A 4YVQC 4DX6D 2YEVA 2WXQA 4HXIA 5T3TA 2DVWA 2VGYA 1JR8A 4KNVA 1W3BA 4OYSA 4NIKA 1U0BB 2EPMX 1FAPB 4JRZA 2JABA 1K8KG 2BL2A 4ATZD 1BDJB 3OA1A 1KZOA 3ZYLA 1TFKB 2ZD9A 3C3OA 1Q0KA 2VCAA 4CS9C 1RZ4A 2XL4A 1EA8A 4JXTA 3MV3B 4IN3B 1T6UA 4L2YA 3QJZA 3NB2A 2OJQA 3CVUA 1MJ0A 1YAUO 3O39A 3TQOA 5JA4D 5J90A 3NKEA 3PZ3A 1U6HA 4Z9JA 1BZ4A 2PFDA 2MWQA 2CFUA 5D66A 1WWPA 3OWTA 1TKNA 1D8EA 3CSTA 3CHRA 3FHEA 3B95A 5DS4A 4BPMA 4B94A 1JCSA 3IHUA 5T3RA 2P9PG 3R7CA 2XRYA 2X6JA 3BQOA 1KLXA 3W8IA 2J8SD 4FC8A 1S64A 4BSXA 3DAFA 3ZKJA 4IWBA 4DVZA 4MS2A 3CAXA 4CSAA 5B3SE 1A7EA 4N3AA 1G4US 1TWCA 4PK4A 3JTLO 4FHJA 1Q0DA 2VC9A 5ARGA 4HE8D 5JLIA 1G5ZA 4L2LA 2WXKA 2LXMA 1YA7O 4CDVA 3ASDA 1ZZPA 3FUIA 3UINC 5AJDA 1I4YA 3NOCD 3TXMA 4JEHA 1AWCB 4XI9A 5E3AA 3EU5A 4A3VA 4O7GA 4GTMA 3RRUA 4DVYP 3LVQE 1RKEA 3SQVA 3W2WA 4GTVA 5A6JA 2YLIA 1D0YA 3FWVA 3UM1A 2LP4A 1VMAA 1NI1A 2X6HA 3PNTB 4E17A 4HOSA 3DBSA 2RFMA 4BJ1A 4HI9A 3V2OA 5FT9A 4F7AA 4JE9A 1MNEA 3TOMA 2AU5A 5A6KA 1HE8A 3ZW3A 4F1SA 4KT6B 4HRMB 3J06A 4I9CA 1OCCC 4YL1A 1B68A 1QZXA 4YT8A 2G62A 3GODA 4RQIA 4AOFA 3O4ZA 4OIRF 2IXPA 4YN0B 2R25A 3C3QA 4A1SA 1N1CA 5ENOD 2ASRA 3NMJA 4U5CE 4GPKA 3W8HA 1KTMA 4IULA 2GDCA 5FZQA 1V54C 5CIVA 3U8VA 3POVA 1MX2A
chains in the Genus database with same CATH topology
4BFRA 2WXMA 3HVEB 5C2YA 3ABLC 3CK9A 3I5QA 3CKCA 3E9VA 1Z6AA 4ANXA 3FTSA 4U5HA 1ELRA 1S0PA 3CHOA 2Q9AA 1SZIA 3CVQA 2CW0F 1SZAA 3FUHA 4B0ZA 2BE5F 3ASHA 2Y3AA 3JYSA 3UPVA 3FUKA 2IXOA 4UQZA 4PJJA 3EH1A 3MX3A 5JJ6A 4KC9A 2FULA 3D9LA 4J8FA 4G11A 1FCHA 4AM9A 3L08A 1EPUA 2AXUA 4JC8A 1MMDA 3S2AA 2BTDA 4AK9A 3QNKA 4CDNA 4OVVA 3ENEA 4FESA 2NXPA 4BJ6C 3B13A 2KCLA 4Q94A 3LY8A 2YZSA 2J4DA 2MRIA 4MRUA 3Q4AB 4QI2A 2G3VA 5JHAA 1NP7A 5HI7A 3CKBA 3ML9A 2J08A 1P5QA 4WJ0A 4BJTA 4ANUA 4O6YA 1D1CA 1FFHA 1HG5A 1OWNA 4F4BA 1EF1C 4U0SA 2KW3C 2L6JA 4G1TA 3NZUA 2IYLD 4I9EA 2AVPA 4UQXA 5ANRA 5G05J 3ABKC 1MQSA 3EIQC 2WM9A 4AEZC 2A69F 3CQCB 3GYZA 2DGJA 4HFGA 2NUPA 2KGOA 3V7OA 3FH5A 1IHGA 5AENA 2KQ9A 3UMVA 3DD7A 2R7RA 2J09A 5FQ8A 4U5GA 3C98A 1ST6A 4UI9C 4OD4A 1J8MF 1LKXA 4ZLDA 2A6HF 3R7QA 3FHDA 3KL4A 3QDNA 2WZLA 5G04J 3ULQA 5IY5C 3SNXA 3UT4A 4G25A 5M72A 1PD1A 2LAIA 2V8SE 2IXNA 2E0IA 2PM6A 3RKVA 4AP2A 3AS4A 3FU0A 3UMHA 3K1IC 4JL0A 4A1GA 2WXPA 4FULA 4JPSA 4ME2A 5D0QD 4NQ0A 5EHHA 3WXXA 1OKKD 3JCKC 1OCRC 1H19A 2ZXOA 4I2ZA 3SD5A 4WWNA 4ZLCA 5KYYB 1HO8A 4YT5A 2C0MA 4PJMA 3NYJA 4AE4A 2O9XA 3HDXA 1ZHZA 5C1DA 5DIZA 2B0JA 2A5UA 5BUZA 3PS6A 3ECSA 2WQHA 1JUQA 4C7OA 3EG9B 1IYGA 3RIPA 5LX8A 2LNIA 4MS6A 5DQZA 3ESKA 4A2NB 2HM8A 4G23A 2PZIA 3PEUB 2BUGA 4NRHB 2WXLA 3AQBA 2KM4A 3QMKA 4HFFB 2I1KA 2V4LA 3G2TA 4GA0A 5FTPA 3FTVA 4JHJA 5JHBA 3ZIMA 4ACKA 3D9NA 2P6VA 4B6IA 1MMNA 2Y3GA 4Q4ZF 1M57C 3PREA 2FI7A 3FUJA 5BV0A 2IQCA 2LSUA 3L17A 2WXRA 4M3OA 2HYZA 3B7TA 4CS9A 4DI3A 4WNGA 3T8MA 2ZXRA 4OIQF 1E8YA 3NRHA 4GB9A 2CG3A 5BNWA 2X38A 1NU9C 4N39A 4WAFA 1W2WA 1WGWA 3X2QC 1DVPA 3I3NA 5T1DB 4FA6A 2I2OA 2W4BA 3AU4A 2Q3TA 1UJKA 1FVHA 1EYHA 1TR2A 2CGEA 4BT9A 3ZGQA 3U66A 4ACLA 1H6KA 2WL8A 3D9MA 2WXIA 2FO7A 3PH0C 5KYNA 3OXGA 1D1BA 3I4UA 4CDMA 2J0WA 4J32B 4I1AA 2CNWA 4E85A 3AG3C 4G7HF 1DNPA 4EZKA 3NYMA 3UGOA 3AG2C 1IQUA 2XQ0A 3RU0A 3L0IA 3K66A 1QQEA 5DS6A 2XXAA 3K9IA 5AIJA 3MV2B 5FQ4A 4C0EA 3JQ1A 1LVKA 4FWVA 4JA9A 2R7QA 3CHPA 5KYWB 4BJ5A 4ANWA 3S27A 4KI2A 2XRHA 3K6BA 5E76A 3JSZA 2WXGA 3ZXSA 3LLIA 4AX2A 1TWGA 3FUMA 1JWFA 2IONA 4NURA 4RBNA 3VAYA 2ZPAA 2J45A 4MNDA 5B1AC 2FFHA 3SF4A 4UI9K 4I6GA 4RG6A 2Z15A 3ITFA 3G2WA 3ZHEB 4CRWA 3FAJA 3FEXA 2XGOA 2L9JA 4P29A 2WMNA 4C9BB 2Y4TA 1YA0A 4U07A 3LEVA 1FFTC 2HV6A 2XRZA 4AJWA 3MEKA 1Z5ZA 2QFCA 3FTUA 4XX5A 1G8XA 4XKCA 3K33A 5CI9A 5KYYA 4IAOA 2PX0A 2M63A 5BV1A 4JEUA 3ZYKA 2WMOA 1ZHYA 1Z3IX 3DM5A 3Q15A 3MJWA 5CMWA 3MCXA 3HLZA 1MMAA 2AXZA 4HOTA 4YT2A 2L9BA 1SMYF 1JPJA 3CVXA 3B0PA 3X1OA 2GRLA 5E3CA 3AQCA 2FF4A 2C2LA 2YHCA 1ELKA 4BWRA 3H65A 1HZ4A 4KBLA 4DBRA 3HHMA 1BR1A 4ABNA 4KXKB 5ENNA 2R5SA 3PE3A 4KMOA 4JHKA 3O6XA 1Z6TA 3DJUB 2Q7FA 4I1MA 3OXLA 2YNQA 3CHSA 3APCA 4I6EA 1INZA 2V5FA 1HH8A 1O87A 4GYYA 3CQZA 3LS0A 2VYIA 5DQTA 4BX8A 3CV0A 3FUNA 4ATGA 2CDQA 2DBAA 4U0ZA 3LS8A 3ZC4A 2KCKA 3SZ7A 3EFOA 3EZHA 2RD0A 4XLNF 3FVYA 2VSOE 4FLHA 2NUPB 4MKTA 1SZ9A 2DCPA 2VJ8A 4C0MA 1QZ2A 2VSYA 3CEQA 1PCXA 2XPIA 4ILIA 3QKYA 1OWPA 3HTKC 4PFOA 1HS6A 5FZSA 3ZVRA 4YNDA 4GCNA 4GMJA 3UQ3A 4GA1A 2XSEA 4PJLA 4YJWA 4X0RA 3ZG1A 4CT0A 1Z3YA 4PJNA 5D91A 4DJAA 2WVOA 2J07A 3TJPA 2J0XA 3PZDA 5E33A 3NQPA 1WAO1 3RRMB 4XLPF 3L6AA 2LAHA 3LY9A 2GRMA 1WM5A 4EBAA 1Y8MA 1QLEC 1MMGA 4JVSA 3MZLB 3P1UA 3D9PA 2H7VC 2DYRC 5LP0A 5CI8A 1OWLA 4FLBA 3JYHA 1RJ9A 3TAXA 4Q7CA 4W9RA 1IQRA 3EPVA 3RKOF 4CBEA 3G2VA 4ILGA 4B89A 2Y39A 3T5VA 4DLOA 1VOMA 5FWQA 5KYUA 4JJFA 2FEZA 1LF8A 3TXNA 4AVXA 4AE4B 2R7VA 3EDTB 2VTBB 3ESLA 3QARA 5HSWA 4APFA 1SQMA 4OINF 3UMIA 2R17C 3WG7C 1SF8A 2J7PA 3EGXB 3HJCA 4GAAA 3Q49B 3LJBA 3S28A 4KZ0A 2C03A 1X5BA 1E7UA 3FTWA 4OIOF 1NZEA 3L54A 5HQ8A 2I9CA 3ZRHA 1ZYRF 3TG4A 4UI9J 3TL5A 5JJTA 2JD3A 3G2SA 4CT4A 3CVVA 4GZ5A 1E8WA 1E96B 4WWOA 2DYSC 1FMVA 4YWQA 4O79A 4UWLA 3O48A 2CHXA 2EIKC 5F5FA 4RSYA 3FFLA 1Y6IA 2X3MA 2EINC 3B0VC 3UT7A 3R7RA 2IF4A 4HVBA 4PS7A 3MLGA 3MKQA 2X6IA 2WQ6A 4J8EA 5EDSA 2IXMA 4N06A 2C04A 3Q6MA 2PQNA 3FU5A 1FMWA 3FTYA 4GZ3A 1LS1A 4J8DA 5B1BC 5LFAA 4I3MA 2XPYA 5ARFA 2I8BA 3KAEA 4GZ6A 4CIHA 4N3BA 4BTAA 2ZXWC 3GZSA 3CSFA 3ML8A 4KYOB 3ONLA 3LLKA 2YHEA 1ZBPA 1TEZA 3DJNB 2VSNA 5B3SC 2R7XA 1HU3A 4F53A 4UWGA 1MNDA 3Q7LA 2MYSA 1N54A 3NG1A 1E90A 4Q96A 4FHKA 1PC2A 3PNLB 1HXIA 3SP1A 4U5DE 3LNRA 3FU3A 2A68F 4KZCA 2OVBA 1Z3XA 2J49A 4E6HA 1BR2A 2NG1A 1NZNA 4LCTA 3T4RA 2I6HA 3RO3A 3FDQA 3RJVA 2WB7A 3PEVB 4TRQA 3EHNA 4H7YA 2XCBA 1Z23A 2WVIA 3CGHA 4XTKA 4D10C 1ZHXA 4XKBA 2QTVA 4BJ5C 2HR2A 3T5XA 4BG0A 3ZIBA 2E2EA 2LSVA 2WB2A 1H2TC 4K7BA 2E87A 3E70C 3D3MA 5DLJA 2P58C 4APOA 3K7DA 4HEAJ 4IRUA 3LYAA 2PM7A 4XWJA 3SNHA 4GU5A 3RFYA 4G7ZF 3FDHA 3LVRE 2CG2A 3IHVA 4TUUA 1N52A 5G2NA 1L5JA 4GMLA 4L23A 3UX4A 2MOWA 3BG0B 3VTXA 4PS3A 1HX8A 4BX9A 2J4BA 3K1HA 5KYWA 4O6NA 2IOSA 4NACA 1H2UA 5LCWC 4I6JA 3D9JA 1OWOA 3W2VA 5A6CA 3G2UA 3OXFA 4WWPA 4ULWA 1PAQA 4LLCA 1M2VB 2QY9A 3CVYA 2J9WA 3FP3A 2WXJA 3LPZA 1OUVA 3ZYQA 4KBQA 2OCCC 2I1JA 3KD7A 3LJ3A 2KCVA 4EWCA 1BR4A 1JPLA 3JCUQ 1HFAA 3NZSA 3KH2A 2G3KA 4DI4A 2L0IA 3FUDA 5AJLA 2L0TB 1S7ZA 3N24A 4OD5A 2W9YA 4C3EA 4WNFA 2HV7A 2V26A 5T4YA 2WVNA 2WZGA 2PF4E 4Y6WA 5ANLA 2VGXB 1TJFA 3FUFA 2Y3HA 1KT0A 3CQGB 3Q6NA 3QAQA 2XEVA 3MYVA 4EZJA 2WVQA 3N0TA 5EX3A 3UT8A 3Q47B 4XIFA 3FTXA 1OCZC 4C3DA 2AWIA 1ELWA 3ASNC 5BPPA 4N2SA 2IOLA 4G26A 1VK5A 3I5PA 3JQ0A 4LRZA 3UR3C 1JWGA 4H7XA 4NY3A 2VASA 4I2WA 1UG3A 4LUNU 3CIAA 4EQFA 4GYTA 4Q5SF 4EZLA 3LS1A 3QWVA 4DK5A 3QOUA 3AG1C 5EKQD 2V0PA 4I43A 4DPRA 3EJNA 2XCCA 3CK7A 1UW4B 1D0XA 2WZFA 4HLEA 2OOEA 4CDRA 2IOQA 2QY7A 4WNEA 3B7RL 2XXAB 3MGBA 2KNHA 3ZSUA 1EDUA 3QWPA 3OEOA 3BEEA 5KJMA 4UWFA 4WNDA 3AS8A 4EPZA 4G2VA 4FP7A 2R7UA 5FQ6A 4G0HA 4W8KA 3D9OA 2XPZA 5T3WA 3CSKA 4RG9A 2L81A 5LCWJ 3QK0A 4QI0A 2J9QA 1OCOC 5A23A 3EGDB 4CCAA 2WXFA 3S7DA 2IU1A 4BT8A 4RVBA 2JLBA 3FU6A 1UJJA 2J9VA 4U5EE 1U3DA 4CGVA 2JEKA 3GZ2A 4AIFA 2W4MA 4EBBA 5G55A 4RD9A 1H0AA 3EQLF 3M1CB 3FH8A 2VB6A 4N2QA 3DM9B 4AXHA 5J08A 4P6IC 3SI5A 5KJNA 2XGSA 2XGMA 3UNGC 3UUXA 4B8AA 5D92A 1XGWA 3UMKA 2X6FA 2X51A 2H7OA 3FTZA 1E8ZA 3CZ6A 3HVEA 4XE0A 4K0DA 3E4BA 3EGDA 1Z63A 3KMIA 3EH2A 1TWHA 3RO2A 2M4EA 1HF8A 4PH4B 2EIJC 4JZYA 4ANJA 3RK6A 3FUEA 5JJ7A 3I4GA 3AG4C 3T6JA 4XZ4A 3SFZA 3B0UX 2ZXPA 3VLDA 3IHYA 4J6IA 2YHSA 4U5FE 4O6FA 4DBQA 3ZHEA 4DLQA 3LESA 1A17A 3SBTB 1FTSA 3U4TA 1ZU4A 2ZU6B 4CEMA 3I4RB 4GZDA 2GFHA 3NYLA 5G05C 3FEYA 1PY1A 3PE4A 5FCLA 3PUKA 4J8SA 3HIZA 1D0ZA 3KEZA 3CLJA 3SZRA 3LXUX 4R7LA 3L22A 4PUCA 3B7UX 3EZIA 3CHMA 3EG9A 2CHWA 3IKOB 4BY6A 5G04C 2BF0X 4BTBA 1O5HA 3R9AB 4A3TA 4HS2A 3SGHA 3ZVVA 3L34A 1E7VA 4HORA 3VLFA 3MKQB 4I17A 3L13A 2J46A 3PDNA 3GANA 3VYWA 2PQRA 3CVNA 4O6MA 1UN9A 5A7DB 4K03A 3CVPA 5EGYA 3LCAA 2OV8A 2VSXE 2UY1A 3QWWA 1MHQA 1ZHTA 2WXNA 2KJGA 4LERA 5FZRA 4JW1A 4ANVA 1J8YF 4GEHA 3S7BA 3GZ1A 4UQYA 2EQXA 2NSZA 4Y6CA 3PUJA 2MHKA 3ONKA 4DOZA 4MQ9F 3ASGA 1NA3A 2VQ2A 5CCMA 2UY1B 3T6BA 2FBNA 3DZAA 5BW8C 3UGPA 1U3CA 3NDBB 5DS5A 1IZMA 3JUIA 1FVFA 2Y69C 4LACB 1H2VC 3B7SA 4URKA 3P2BA 3FH7A 5AYWD 3MKRA 3RYLA 4I1OB 3IEEA 4I44A 3ASFA 4GA2A 1ZU5A 3AS5A 3URZA 4AY6A 1M2VA 4U5BE 1NU7D 2H7BA 4CS7A 3APFA 3ZPJA 3TD7A 5KYUB 1QNFA 2PX3A 3PRZA 4U63A 3S0XA 4FX5A 2VTBA 4FJZA 2Q9CA 3LDZA 3LAYA 2NUTB 5KYXA 2AW6A 2R7OA 3FY4A 3AU5A 3NF1A 5T8IA 5CMYA 1TWAA 4V3IA 2OG2A 4HFKB 3U64A 5E2QA 2V3CC 3DAGA 3IEGA 1NA0A 2YQ8A 2PL2A 5KJLA 1KT1A 3NKDA 2EILC 2UWJG 4ILHB 1M2OA 1VDYA 3F47A 3PVLA 2CFZA 4FU3A 3FULA 3GW4A 2AXVA 2WXHA 3SEOA 2OVFA 4FJYA 1RJ9B 2C0LA 2GGFA 2A1DD 2EIMC 3ZYMA 2CNWD 2KZTB 4PS8A 3LY7A 3LEWA 4EECA 1OKKA 2Y4UA 3LKUA 4JHRA 5BUOA 4L7TA 4A55A 4C3BA 3QB2A 2J9UA 5FJYA 4G24A 3D9IA 5BT1A 4BEJA 1B89A 3S7JA 3N71A 4JURI 2PP4A 1VYKA 3TG5A 4N5CA 3SBSA 4N3CA 2HO1A 4B8CB 4U8HA 4Q69A 3F46A 1VYIA 1BPOA 4G7OF 1TJCA 2W45A 1V55C 3CK8A 3VTYA 5D0OD 4CGWA 2A6EF 3RIBA 4C7OB 3L16A 3RRNB 3QZCA 4OIPF 5EX0A 2CHZA 2WQ7A 4E7ZA 3KKBA 3PMRA 2IFUA 3Q7GA 2IJGX 2LSEA 5F5HA 1D1AA 2YINA 2ONDA 1ZU2A 5DBKA 4AY5A 4GYWA 1E8XA 4M63A 2VGXA 3BG1B 5DVWA 2X6KA 2R7SA 5CHEE 1GW6A 4GYOA 3CHQA 4TV3A 2Q9BA 3ASOC 1KU2A 2R7TA 4KVOA 3EFOB 3OAWA 4UWKA 5KCMA 5LOZA 4E7SA 4J30B 3EGXA 4CS8A 3IV0A 1UN8A 4GCOA 2P7VA 1JPNA 3TGOA 2GW1A 3SHFA 4UWHA 3OTNA 3DXJF 3S29A 5L3VA 3ZFWA 4AV7A 2KZTA 3SYNA 3U3WA 3B9QA 3JT1A 2XHEA 4XI0A 3S7FA 1M56C 3N2ZB 2NUTA 4U0UA 4RDAA 4IJJA 4J0UA 4KVMA 2R7WA 2LO6A 1OWMA 4QFVA 1IW7F 5FQ7A 4K0RA 5KYXB 5E75A 3MA5A 2D5RB 5KJKA 2DIWA 3IBEA 3WODF 2Y3BA 4U04A 3ZN3A 4PFPA 4LLEA 4YVOA 3RH3A 2Y3DA 3EIJA 4JA7A 4LEUA 4CS8C 4OVUA 3U9WA 1ZHWA 4H4KC 4JZAA 1PD0A 2J7PD 2KATA 2FGYA 2RG8A 4WUYA 2ILRA 3DPDA 4FADA 4YT4A 4BJ6A 3QC1A 3JRTA 3Q5MA 5CCLA 2VH3A 3CVLA 2WPVA 4JJGA 3APDA 3ZEFA 1XNFA 2R59A 3CR3A 4MLPA 3HYMB 4F3VA 4EBAG 1NG1A 2WXOA 4JCHA 3D9KA 4PDXA 3DMDA 2NC9A 4HOQA 4GZCA 4IYPA 4QDLA 2A4ZA 3PHF2 4KNWA 3VLEA 4L1BA 3ABMC 4CSAC 1WY6A 4HOUA 1HG2A 2KC7A 5L3QA 3CVWA 3EHMA 3KS2A 4YVQC 2YEVA 2WXQA 4HXIA 5T3TA 2VGYA 4KNVA 1W3BA 4OYSA 3OA1A 3ZYLA 4CS9C 2XL4A 4JXTA 3MV3B 4IN3B 4L2YA 3QJZA 3CVUA 3O39A 5J90A 3NKEA 2PFDA 2MWQA 2CFUA 3OWTA 1TKNA 3CSTA 3CHRA 3FHEA 5DS4A 4B94A 5T3RA 2XRYA 2X6JA 1KLXA 3W8IA 4FC8A 4BSXA 3DAFA 4IWBA 4DVZA 4CSAA 4N3AA 1TWCA 4PK4A 4FHJA 5ARGA 4HE8D 4L2LA 2WXKA 3ASDA 3FUIA 5AJDA 3TXMA 4JEHA 4XI9A 4A3VA 5E3AA 4O7GA 3RRUA 4DVYP 3LVQE 3W2WA 1D0YA 3FWVA 1VMAA 2X6HA 3PNTB 4HOSA 3DBSA 4BJ1A 5FT9A 4F7AA 1MNEA 1HE8A 3ZW3A 4F1SA 4KT6B 4I9CA 1OCCC 4YT8A 1QZXA 4AOFA 2G62A 3GODA 3O4ZA 4OIRF 2IXPA 4YN0B 4A1SA 1N1CA 4U5CE 4GPKA 3W8HA 4IULA 5FZQA 1V54C 3POVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JVS A;  4IRU A;  4JW1 A;  4I1M A;  4I1O B; 
#chains in the Genus database with same CATH topology
 5A6A A;  4BFR A;  2WXM A;  3HVE B;  5C2Y A;  1V74 B;  3ABL C;  3G4Z A;  3BU8 A;  3CK9 A;  3I5Q A;  3T8K A;  3CKC A;  3E9V A;  1Z6A A;  3C5R A;  3M79 A;  1ORS C;  4ANX A;  2J8W A;  3FTS A;  4IAQ A;  5AQ7 A;  4U5H A;  4G8L A;  2TMV P;  4NCQ A;  1S05 A;  1E84 A;  1ELR A;  2GRN B;  1S0P A;  3CHO A;  2Q9A A;  1V54 E;  1SZI A;  3CVQ A;  3V31 A;  1T6I A;  1OT8 A;  5COG A;  2CW0 F;  1SZA A;  2ETC A;  1CGN A;  3FUH A;  4B0Z A;  2BE5 F;  3ASH A;  2Y3A A;  1OCC E;  3JYS A;  3FUK A;  3UPV A;  2IXO A;  1T9K A;  4L6R A;  5KNG A;  1Z7Q c;  4UQZ A;  3T9K A;  4PJJ A;  3EH1 A;  3U5S A;  3MX3 A;  2XEE A;  3U9M A;  5JJ6 A;  4KC9 A;  3E30 A;  2FUL A;  2KYH A;  3FOO A;  3D9L A;  4N5Q A;  4J8F A;  4G11 A;  1FCH A;  4WGY A;  4AM9 A;  3L08 A;  1EPU A;  2AXU A;  1N0R A;  3NBN B;  4JC8 A;  2OCC E;  1MMD A;  3S2A A;  4BER A;  2BTD A;  3C7J A;  3W9F A;  4AK9 A;  2EPK X;  2A5E A;  4XQ1 A;  3QNK A;  4CDN A;  4OVV A;  2Y1L E;  3ENE A;  4FES A;  2NXP A;  4BJ6 C;  3B13 A;  2KCL A;  4L9P A;  3PCV A;  4Q94 A;  3LY8 A;  1WN0 A;  2YZS A;  3WAQ A;  2J4D A;  2MRI A;  1Q2Z A;  4MVM A;  3Q4A B;  2YL3 A;  4MRU A;  3KPH A;  4QI2 A;  2G3V A;  2Q00 A;  3T9O A;  4JIO A;  3MFN A;  2H8A A;  5JHA A;  1NP7 A;  5HI7 A;  3CKB A;  3ML9 A;  1TNO A;  2J08 A;  3WHN A;  1P5Q A;  2XLV A;  1Z5S C;  4WJ0 A;  2LXL A;  4BJT A;  4ANU A;  4NQF A;  4O6Y A;  1D1C A;  1FFH A;  1HG5 A;  2HJM A;  1OWN A;  4F4B A;  2RSE B;  2KC3 A;  1EF1 C;  4U0S A;  1OW6 A;  2KW3 C;  3NMI A;  2L6J A;  4G1T A;  3NZU A;  5AQ9 A;  1EKY A;  2IYL D;  4K5C A;  4I9E A;  2AVP A;  4UQX A;  5ANR A;  5G05 J;  3ABK C;  1MQS A;  5H7P A;  3EIQ C;  3AGU A;  2F37 A;  4NTB A;  2WM9 A;  4AEZ C;  4K5B A;  2A69 F;  3SFY A;  3CQC B;  4CX9 A;  3DXM G;  2ICW G;  3GYZ A;  1HW2 A;  2DGJ A;  3SFX A;  5ENP D;  5AQA A;  4HFG A;  2NUP A;  2KGO A;  3V7O A;  2XZT G;  2GAQ A;  4RLY A;  1AP7 A;  5FIO A;  3FH5 A;  2QLA A;  1IHG A;  3ISM C;  5AEN A;  2XL8 A;  2KQ9 A;  1T01 A;  3UMV A;  2R7R A;  3DD7 A;  4J8Y A;  5L0D A;  4NTA A;  1OCZ E;  4U5G A;  2J09 A;  3C98 A;  5FQ8 A;  1TQG A;  1ST6 A;  4JCZ A;  4UI9 C;  5BXU A;  4U9D A;  4OD4 A;  1J8M F;  1WG0 A;  2HMZ A;  1LKX A;  4ZLD A;  2A6H F;  2IO3 C;  3R7Q A;  4GTO A;  3BRJ A;  3UKU G;  3FHD A;  3GEI A;  3KL4 A;  3QDN A;  3PZ4 A;  2WZL A;  2P9U G;  5G04 J;  2F8Y A;  3ULQ A;  5IY5 C;  1VLS A;  3SNX A;  3UT4 A;  5JMN D;  1HE1 A;  4G25 A;  5M72 A;  1PD1 A;  2LAI A;  2V8S E;  2LIG A;  2IXN A;  1ORY A;  3LNM B;  3G50 A;  2E0I A;  2PM6 A;  3GEE A;  1K40 A;  3RKV A;  4AP2 A;  4H54 A;  3AS4 A;  3FU0 A;  1MYO A;  3UMH A;  3K1I C;  4JL0 A;  4A1G A;  3QVY A;  4EIY A;  2WXP A;  1WAT A;  3A9C A;  4N4W A;  4FUL A;  4EUK B;  4JPS A;  3IPM O;  2HE0 A;  4ME2 A;  5D0Q D;  4NQ0 A;  5EHH A;  4LG6 A;  3WXX A;  1OKK D;  2XLD A;  2P9S G;  3JCK C;  1OCR C;  1H19 A;  5D2M C;  2ZXO A;  4JKV A;  1K04 A;  3CEX A;  5L0H A;  4I2Z A;  3SD5 A;  2CYD A;  4HQD A;  4WWN A;  1MZC A;  2OKU A;  2F8X K;  5KYY B;  1A7V A;  1HO8 A;  4N6H A;  4YT5 A;  4ZLC A;  2C0M A;  4PJM A;  3NYJ A;  3US6 A;  4AE4 A;  2O9X A;  3HDX A;  1ZHZ A;  1QKR A;  2PNO A;  5C1D A;  5DIZ A;  2B0J A;  1GGQ A;  3GWN A;  2A5U A;  5BUZ A;  2XL6 A;  1OY3 D;  3PS6 A;  3ECS A;  2WQH A;  3HXB A;  3BEH A;  1JUQ A;  4BES A;  2HUJ A;  3TWR A;  3M15 A;  1HE9 A;  2JX0 A;  4C7O A;  2EPN A;  3EG9 B;  1IYG A;  3RIP A;  5LX8 A;  2LNI A;  4MS6 A;  5DQZ A;  3ESK A;  4A2N B;  2H6H A;  2HM8 A;  4G23 A;  4F1P A;  2PZI A;  3PEU B;  3UM2 A;  2BUG A;  3LEO A;  4NRH B;  2EPO A;  1NFI E;  2WXL A;  3AQB A;  2KM4 A;  3QMK A;  4HFF B;  4MW8 A;  2IO2 C;  1D9S A;  2I1K A;  2V4L A;  3G2T A;  1YDI A;  3ZXP A;  2XLW A;  4GA0 A;  3RW0 A;  5ENR D;  5FTP A;  3FTV A;  4JHJ A;  3MYI A;  4J7T A;  5JHB A;  2HJ3 A;  1L7C A;  3ZIM A;  1YMP A;  4ACK A;  3IQ5 A;  3D9N A;  2P6V A;  4B6I A;  1MMN A;  4IB4 A;  1TNB A;  4G8K A;  2Y3G A;  4Q4Z F;  1M57 C;  3PRE A;  2FI7 A;  3FUJ A;  3W9G A;  1LS4 A;  5BV0 A;  2IQC A;  2LSU A;  3L17 A;  3B71 A;  2WXR A;  4M3O A;  2HYZ A;  3B7T A;  4CS9 A;  2B0H A;  2GWW A;  4DI3 A;  4WNG A;  3T8M A;  2VCB A;  2ZXR A;  4OIQ F;  1E8Y A;  3NRH A;  1N0Q A;  3FOP A;  1BI8 B;  4GB9 A;  2CG3 A;  5BNW A;  2X38 A;  1NU9 C;  2ETS A;  4N39 A;  3TWV A;  4WAF A;  2CCY A;  3U9J A;  1W2W A;  5JRA A;  4TXP A;  2LFF A;  1WGW A;  1TN6 A;  1RMV A;  2Q7R A;  3X2Q C;  1DVP A;  3Q73 A;  3FXH A;  2YVK A;  3I3N A;  5T1D B;  1XWJ A;  3DWW A;  4FA6 A;  2I2O A;  2W4B A;  1OCO E;  3AU4 A;  2Q3T A;  1UJK A;  1FVH A;  1EYH A;  1TR2 A;  2CGE A;  3T6G B;  4BT9 A;  3ZGQ A;  3U66 A;  4ACL A;  1H6K A;  2WL8 A;  3D9M A;  2WXI A;  2FO7 A;  3PH0 C;  3UM0 A;  1ZW3 A;  3JSE O;  5KYN A;  3OXG A;  2Y69 E;  2GRQ B;  1D1B A;  3I4U A;  3ZDL A;  4CDM A;  2J0W A;  4J32 B;  4I1A A;  2CNW A;  3X2Q E;  4E85 A;  3AG3 C;  4G7H F;  1Y6D A;  1DNP A;  1FT1 A;  4EZK A;  3NYM A;  3UGO A;  3AG2 C;  1IQU A;  2XQ0 A;  3RU0 A;  2LQG A;  2OOC A;  1IXV A;  4HRN A;  3L0I A;  1OXB A;  3K66 A;  1QQE A;  2XXA A;  5DS6 A;  3K9I A;  3TWU A;  5AIJ A;  1H7I A;  3MV2 B;  5FQ4 A;  4O1P A;  1QPU A;  4C0E A;  3JQ1 A;  1LVK A;  1YYJ A;  4FWV A;  4JA9 A;  3TWX A;  2R7Q A;  3CHP A;  4MVR A;  5KYW B;  1I5N A;  1YJG A;  4MVQ A;  4BJ5 A;  4ANW A;  3S27 A;  4KI2 A;  2XRH A;  3K6B A;  5E76 A;  3JSZ A;  2WXG A;  3UIO C;  4UUC A;  3ZXS A;  3LLI A;  1MX4 A;  2H6G A;  4AX2 A;  4YL3 A;  1TWG A;  3FUM A;  1JWF A;  3U2M A;  2EIM E;  2ION A;  4RBN A;  3VAY A;  4NUR A;  2ZPA A;  2J45 A;  4MND A;  5B1A C;  2FFH A;  3SF4 A;  3U0C A;  4UI9 K;  4I6G A;  2L6B A;  4RG6 A;  2OQM A;  3UI2 A;  2Z15 A;  1G4W R;  3ITF A;  3G2W A;  3ZHE B;  4CRW A;  3FAJ A;  3JZ0 A;  3DEO A;  3FEX A;  2XGO A;  2L9J A;  4P29 A;  3GM1 A;  2WMN A;  4C9B B;  2Y4T A;  3V2X A;  5JSL A;  3L82 A;  1YA0 A;  2LCH A;  3VRC A;  4U07 A;  3LEV A;  1LIH A;  1FFT C;  1OXJ A;  2HV6 A;  2XRZ A;  4AJW A;  3MEK A;  1Z5Z A;  2QFC A;  3FTU A;  4XX5 A;  3R9M A;  3GOR A;  3C62 A;  3KYJ A;  5CEC B;  3ZQY A;  1G8X A;  5L0I A;  4XKC A;  3K33 A;  5CI9 A;  5KYY A;  4IAO A;  2PX0 A;  2M63 A;  5BV1 A;  3V5X A;  4JEU A;  3Q78 A;  3ZYK A;  4E18 A;  2WMO A;  1ZHY A;  1SA4 A;  5B1A E;  1Z3I X;  3DM5 A;  3Q15 A;  1QVX A;  2AWC A;  3AOU A;  3MJW A;  5CMW A;  3S9O A;  3MCX A;  5KWD A;  3HLZ A;  1MMA A;  2AXZ A;  3Q9N C;  4HOT A;  4YT2 A;  2OEV A;  2L9B A;  1SMY F;  4PR9 A;  1JPJ A;  5JT4 A;  1YA9 A;  5B1B E;  3CVX A;  3B0P A;  2R9R B;  3X1O A;  2GRL A;  5GPG B;  5E3C A;  3AQC A;  2FF4 A;  2C2L A;  4MTG A;  2YHC A;  1ELK A;  5JUA A;  4BWR A;  3H65 A;  1HZ4 A;  2B0O E;  4KBL A;  4DBR A;  3HXD A;  1LE4 A;  1RXQ A;  3HHM A;  1YYX A;  4XPY A;  1BR1 A;  4ABN A;  1OCR E;  4KXK B;  5EID A;  5ENN A;  2R5S A;  5JP7 A;  3PE3 A;  4KMO A;  4JHK A;  3DEP A;  3O6X A;  3PZ2 A;  1TFO B;  2KSF A;  1Z6T A;  3DJU B;  4HI8 A;  2Q7F A;  4I1M A;  2OU6 A;  3OXL A;  2YNQ A;  3CHS A;  3APC A;  4I6E A;  1A5E A;  1INZ A;  2VCC A;  2V5F A;  2NSF A;  1ZW2 A;  1HH8 A;  1O87 A;  1KNY A;  3DI5 A;  4MTO A;  4GYY A;  3CQZ A;  4GQH A;  4YDY A;  3LS0 A;  4D4N A;  5DQT A;  2VYI A;  4BX8 A;  3CV0 A;  3FUN A;  3C3R A;  4ATG A;  2CDQ A;  4AL0 A;  3UIP C;  2DBA A;  1N94 A;  2F22 A;  4U0Z A;  3LS8 A;  3RAU A;  5AN8 A;  3ZC4 A;  5COF A;  1E2X A;  1A0B A;  2GRR B;  2KCK A;  4YDO A;  3SZ7 A;  2D4U A;  3EFO A;  1NFN A;  3L1M A;  3EZH A;  2RD0 A;  4XLN F;  3FVY A;  2VSO E;  2HS5 A;  4FLH A;  2NUP B;  4MKT A;  1SZ9 A;  2DCP A;  2VJ8 A;  2YKZ A;  4C0M A;  1QZ2 A;  2VSY A;  3CEQ A;  2P61 A;  2EIK E;  1PCX A;  2XPI A;  4ILI A;  3QKY A;  2X0C A;  1OWP A;  4MVO A;  2AJA A;  4LDQ A;  2GRP B;  1VTM P;  3HTK C;  4PFO A;  3ASO E;  4HBD A;  4UDV A;  1HS6 A;  5FZS A;  3ZVR A;  4YND A;  2DZO A;  4CYM D;  4GCN A;  4GMJ A;  3UQ3 A;  4GA1 A;  2XSE A;  4PJL A;  4YJW A;  4X0R A;  3ZG1 A;  4CT0 A;  4JD2 G;  1Z3Y A;  4XPW A;  1LD8 A;  4PJN A;  5D91 A;  4DJA A;  1CGO A;  2WVO A;  2J07 A;  3TJP A;  2J0X A;  5CBN A;  3PZD A;  5E33 A;  3NQP A;  2YLD A;  4CJG A;  1WAO 1;  3RRM B;  4XLP F;  3L6A A;  2LAH A;  4IGG A;  3EU9 A;  3LY9 A;  2V4H C;  2GRM A;  3M4B A;  4Z9H A;  1WM5 A;  4EBA A;  2VGE A;  1Y8M A;  1QLE C;  1MMG A;  4JVS A;  3SXZ A;  3MZL B;  3P1U A;  1TR4 A;  3D9P A;  2H7V C;  2DYR C;  5LP0 A;  3ZQV A;  3AG1 E;  5CI8 A;  1OWL A;  4FLB A;  3JYH A;  1RJ9 A;  3TAX A;  4Q7C A;  4W9R A;  2XM0 A;  2NPU A;  5K0I A;  1IQR A;  3EPV A;  3RKO F;  4CBE A;  2GA0 A;  3G2V A;  5FIN A;  4ILG A;  4B89 A;  2Y39 A;  3T5V A;  1YCS B;  4DLO A;  4LNG A;  2IM8 A;  4MBG A;  1VOM A;  5FWQ A;  5KYU A;  2QYU A;  4JJF A;  2FEZ A;  1LF8 A;  3TXN A;  4AVX A;  4AE4 B;  2XLE A;  2R03 A;  2XZD G;  5A6B D;  2R7V A;  3EDT B;  2VTB B;  3ESL A;  3QAR A;  5HSW A;  4GTT A;  4APF A;  1SQM A;  4OIN F;  1OXK A;  2P0N A;  3TJ6 A;  2HKV A;  3UMI A;  2R17 C;  3WG7 C;  1SF8 A;  2J7P A;  3EGX B;  1G3N B;  1A7D A;  3HJC A;  4FAP B;  3EHQ A;  4GAA A;  3Q49 B;  3V5Y A;  3ULY A;  3LJB A;  3S28 A;  4KZ0 A;  2EIN E;  1X5B A;  2C03 A;  1E7U A;  4CZ2 D;  2ZGG A;  4OIO F;  3FTW A;  1NZE A;  1K1A A;  3L54 A;  3E33 A;  2RFA A;  2P9L G;  1JOG A;  5HQ8 A;  2I9C A;  3ZRH A;  1ZYR F;  4OAV B;  3ZTM A;  3TG4 A;  4UI9 J;  1N4S A;  3TL5 A;  5JJT A;  2JD3 A;  3G2S A;  4CT4 A;  3CVV A;  3HNI A;  4K1O A;  3DKA A;  2IY0 C;  3ATP A;  4GZ5 A;  3HNL A;  1E8W A;  1E96 B;  4WWO A;  4JTD B;  1SYQ A;  2DYS C;  1FMV A;  3HNJ A;  4YWQ A;  2HMQ A;  2PBE A;  3L8J A;  4O79 A;  1T5O A;  2UUH A;  5EIL A;  4UWL A;  3O48 A;  2NYJ A;  2CHX A;  2EIK C;  3NAW A;  5F5F A;  4RSY A;  3FFL A;  3KSQ A;  1Y6I A;  2X3M A;  5FZT A;  5KBA A;  2EIN C;  1NLX A;  1PV3 A;  3B0V C;  3UT7 A;  3R7R A;  2HFI A;  2IF4 A;  3TJ5 A;  4HVB A;  4PS7 A;  2YL1 A;  3MLG A;  3MKQ A;  2X6I A;  2WQ6 A;  4J8E A;  5EDS A;  2IXM A;  4N06 A;  2C04 A;  3Q6M A;  2PQN A;  3FU5 A;  5L0C A;  1FMW A;  1GS9 A;  3FTY A;  3AGT A;  4GZ3 A;  1LS1 A;  4J8D A;  5B1B C;  5LFA A;  4I3M A;  2XPY A;  5ARF A;  2I8B A;  3KAE A;  4EHM A;  4GZ6 A;  3U2L A;  4CIH A;  3DSX A;  1UOH A;  4N3B A;  1DOW A;  4ONS A;  4BTA A;  2QUP A;  2ZXW C;  3GZS A;  3CSF A;  3ML8 A;  4KYO B;  3ONL A;  3LLK A;  2YHE A;  1ZBP A;  3DST A;  1TEZ A;  3DJN B;  2VSN A;  3DPY A;  2QZA A;  5CED B;  5B3S C;  3B29 A;  3IXE A;  3QW0 A;  3ZUV B;  2R7X A;  1F1M A;  1HU3 A;  3J5P A;  4UWG A;  4F53 A;  1MND A;  4GMR A;  3Q7L A;  2NSG A;  2MYS A;  3IQC A;  1N54 A;  4LSZ E;  1VB5 A;  4HB5 A;  3NG1 A;  1E90 A;  4Q96 A;  3IQT A;  4FHK A;  1PC2 A;  3PNL B;  5ITZ F;  1HXI A;  1NFO A;  4ER9 A;  3SP1 A;  2FAP B;  3LUT B;  4U5D E;  3LNR A;  3FU3 A;  2A68 F;  4KZC A;  2OVB A;  4JTA B;  1Z3X A;  2DWZ A;  2J49 A;  1L3P A;  4E6H A;  1BR2 A;  1C03 A;  1NZN A;  2NG1 A;  1BBH A;  1E85 A;  4LCT A;  2H6I A;  1RKE B;  3T4R A;  2I6H A;  3RO3 A;  3FDQ A;  3RJV A;  1C02 A;  2WB7 A;  1HMD A;  1BI7 B;  3PEV B;  1LPE A;  4TRQ A;  3EHN A;  1TNU A;  2OEW A;  4H7Y A;  2XCB A;  1Z23 A;  2WVI A;  3CGH A;  5HS0 A;  4XTK A;  4D10 C;  1ZHX A;  4XKB A;  2QTV A;  4BJ5 C;  5AQB A;  2HR2 A;  3TK0 A;  1RKC A;  3T5X A;  1TYQ G;  1JCR A;  4BG0 A;  5L0J A;  1DC2 A;  3TWT A;  3ZIB A;  2E2E A;  4BEM J;  2LSV A;  2WB2 A;  1H2T C;  4K7B A;  3QVZ A;  2E87 A;  3E70 C;  3D3M A;  5DLJ A;  2P58 C;  5COM A;  4APO A;  3K7D A;  1V4A A;  4HEA J;  4YDW A;  4IRU A;  3LYA A;  2PM7 A;  4XWJ A;  3SNH A;  4GU5 A;  3DWL G;  3RFY A;  5BQI A;  4G7Z F;  3FDH A;  3LVR E;  3NOG D;  3V79 K;  4O1O A;  2P9N G;  1S70 B;  2CG2 A;  3IHV A;  4OAU C;  4TUU A;  1N52 A;  5G2N A;  1L5J A;  2L6F A;  4GML A;  3HKK A;  1QSP A;  4L23 A;  3UX4 A;  2MOW A;  4EBK A;  3BG0 B;  3VTX A;  4PS3 A;  1HX8 A;  2BKK B;  2FO1 E;  2HSQ A;  3HXE A;  4BX9 A;  1HY5 A;  2J4B A;  4K5A B;  5CER B;  3K1H A;  5KYW A;  4O6N A;  2IOS A;  5L0F A;  4NAC A;  3AG3 E;  1H2U A;  5LCW C;  4I6J A;  3D9J A;  4PAC A;  3UKR G;  1OWO A;  3AG2 E;  3RVZ A;  3W2V A;  2XM4 A;  5A6C A;  3G2U A;  2RD9 A;  3OXF A;  1NSG B;  1VLT A;  4WWP A;  2MYO A;  5EN5 D;  2IBF A;  4ULW A;  3H2V A;  4NTF A;  3O55 A;  4G78 A;  1UFB A;  1PAQ A;  3C63 A;  3ZWI A;  4LLC A;  1M2V B;  2QY9 A;  3CVY A;  2J9W A;  4JEA A;  5TJ5 E;  3SXK A;  2YWA A;  3FP3 A;  2WXJ A;  3LPZ A;  1OUV A;  3ZYQ A;  4DJ9 A;  4KBQ A;  1YLM A;  3B7B A;  2OCC C;  3DSS A;  2I1J A;  3KD7 A;  3LJ3 A;  2KCV A;  3G4X A;  1A41 A;  4EWC A;  2I15 A;  1N11 A;  2DZN A;  1BR4 A;  1JPL A;  3JCU Q;  4TXR A;  3GM2 A;  1EI7 A;  1HFA A;  3NZS A;  3KH2 A;  2BC5 A;  3DE8 A;  2G3K A;  4DI4 A;  1WDY A;  2L0I A;  3FUD A;  3Q7F A;  5AJL A;  1M6T A;  2L0T B;  1K05 A;  1S7Z A;  3JXJ A;  3N24 A;  4A63 B;  4OD5 A;  2W9Y A;  4C3E A;  3SXY A;  4WNF A;  4GTQ A;  1NL4 A;  2HV7 A;  2V26 A;  5T4Y A;  2WVN A;  2WZG A;  1O1S A;  4A4A A;  2PF4 E;  4Y6W A;  4BET A;  1WOL A;  3RQF A;  1YYH A;  1Q0G A;  5ANL A;  2VGX B;  1TJF A;  3FUF A;  1SR2 A;  5ENQ D;  2Y3H A;  2EIL E;  1KT0 A;  1DOV A;  3CQG B;  3Q6N A;  3QAQ A;  4WAB A;  4IAR A;  2XEV A;  3MYV A;  4EZJ A;  2WVQ A;  4HRL A;  3DSV A;  3N0T A;  1LTX A;  3C18 A;  2HZ8 A;  2YL7 A;  1ZB1 A;  5EX3 A;  3UT8 A;  3Q47 B;  4XIF A;  5JS5 A;  3FTX A;  1XZP A;  2ZIS A;  1OCZ C;  4P9F A;  4C3D A;  2AWI A;  1ELW A;  3ASN C;  5BPP A;  4N2S A;  2IOL A;  4G26 A;  1VK5 A;  3I5P A;  3JQ0 A;  4LRZ A;  3UR3 C;  4AL1 A;  1JWG A;  4H7X A;  4NY3 A;  2JPU A;  2VAS A;  1LM3 B;  1UG3 A;  4I2W A;  4LUN U;  2QE9 A;  3CIA A;  4EQF A;  4DRH B;  4GYT A;  3L9T A;  1OQC A;  4Q5S F;  5EK0 A;  4EZL A;  3LS1 A;  3QWV A;  4DK5 A;  3QOU A;  4CDY A;  3AG1 C;  5EKQ D;  1O3U A;  2P9I G;  2J9B A;  2V0P A;  4I43 A;  4DPR A;  3EJN A;  2XCC A;  3AAA C;  4LDK A;  3CK7 A;  1UW4 B;  1D0X A;  5HV9 A;  1IHB A;  2WZF A;  4HLE A;  2OOE A;  1LD7 A;  4CDR A;  2IOQ A;  4DXW A;  1HMO A;  4QQI A;  2QY7 A;  1T6Q A;  1OR2 A;  4F6R D;  4WNE A;  3B7R L;  1EQ1 A;  2XXA B;  5F28 E;  4CIP A;  3MGB A;  2KNH A;  3ZSU A;  1UG7 A;  1EDU A;  3QWP A;  1V55 E;  2UUI A;  3OEO A;  3BEE A;  5KJM A;  4UWF A;  4WND A;  4U95 D;  3AS8 A;  4EPZ A;  4G2V A;  4FP7 A;  2R7U A;  4EKW A;  5FQ6 A;  4G0H A;  4W8K A;  3D9O A;  2XPZ A;  5T3W A;  3CSK A;  4RG9 A;  1CGM E;  2L81 A;  2DB4 A;  5LCW J;  1JMW A;  3QK0 A;  4QI0 A;  2J9Q A;  3SXM A;  3U3B A;  1OCO C;  1XZQ A;  2XLM A;  2ETB A;  2ZIR A;  5A23 A;  3EGD B;  4CCA A;  2WXF A;  3S7D A;  3FAP B;  2IU1 A;  4BT8 A;  4RVB A;  2XS8 A;  2JLB A;  3FU6 A;  1LI7 A;  3JXI A;  1UJJ A;  4U96 D;  2J9V A;  2YL0 A;  4U5E E;  2EIJ E;  1TNZ A;  2MHR A;  1FPP A;  1U3D A;  2DI3 A;  2B6C A;  4CGV A;  1X81 A;  2JEK A;  3GZ2 A;  5A69 A;  4AIF A;  3TWS A;  2W4M A;  4EBB A;  2Q4F A;  5G55 A;  4RD9 A;  3RVY A;  1H0A A;  3EQL F;  3M1C B;  3FH8 A;  4GTP A;  2VB6 A;  4N2Q A;  3DM9 B;  1JAF A;  3UXG A;  3R2P A;  4AXH A;  5J08 A;  256B A;  3UTM A;  4P6I C;  3SI5 A;  1C17 M;  5KJN A;  2XGS A;  2XGM A;  3UNG C;  3UUX A;  4B8A A;  3C8G A;  2XLH A;  5D92 A;  1XGW A;  4DUI A;  3UMK A;  2R02 A;  2X6F A;  2X51 A;  2H7O A;  2OEX A;  3V5Z A;  1CPR A;  1FT2 A;  3FTZ A;  2A0B A;  4TXQ A;  1E8Z A;  3CZ6 A;  3HVE A;  4XE0 A;  4K0D A;  3E4B A;  4EHP A;  4U9E A;  3EGD A;  3W4Y A;  1Z63 A;  3TUL A;  3KMI A;  4P9T A;  3EH2 A;  3IQ6 A;  2EPL X;  3M4C A;  1TWH A;  4CJO A;  2IEJ A;  3RO2 A;  5BQG A;  2M4E A;  2BKG A;  2ZXW E;  4DX7 D;  5KNH D;  1HF8 A;  4PH4 B;  2EIJ C;  4JZY A;  2L7A A;  4ANJ A;  3RK6 A;  3FUE A;  5JJ7 A;  3I4G A;  3AG4 C;  3T6J A;  4N6C A;  4XZ4 A;  2RKK A;  3SFZ A;  1D8D A;  3Q7A A;  3ZNG A;  3B0U X;  2ZXP A;  3VLD A;  3IHY A;  4J6I A;  2YHS A;  2QC9 A;  1Y4C A;  4U5F E;  4O6F A;  4DX5 D;  4DBQ A;  3ZHE A;  4U8Y D;  1DCQ A;  3MYF A;  4DLQ A;  3WG7 E;  3LES A;  1A17 A;  3SBT B;  5AAO A;  1FTS A;  3E37 A;  1U89 A;  3U4T A;  2AWY A;  1ZU4 A;  2ZU6 B;  4CEM A;  3I4R B;  4GZD A;  2GFH A;  3NYL A;  1Q0M A;  1O1R A;  5G05 C;  3FEY A;  4O60 A;  2KXP C;  1PY1 A;  3PE4 A;  5FCL A;  1HW1 A;  3PUK A;  4J8S A;  3HIZ A;  1D0Z A;  3KEZ A;  3CLJ A;  3SZR A;  3LXU X;  4YL0 A;  4R7L A;  2LK4 A;  3L22 A;  4PUC A;  3B7U X;  4U8V D;  3AG4 E;  3EZI A;  4U7E B;  2GRO B;  2LD6 A;  3CHM A;  1YZA A;  3EG9 A;  2CHW A;  2BED A;  3IKO B;  4BY6 A;  5G04 C;  4MVS A;  2BF0 X;  4BTB A;  3E34 A;  1O5H A;  3R9A B;  4A3T A;  4HS2 A;  3ZTZ A;  4R32 A;  3SGH A;  3ZVV A;  3L34 A;  1E7V A;  4HOR A;  5L0G A;  3TWW A;  2DYS E;  3VLF A;  3MKQ B;  4I17 A;  1BD8 A;  3L13 A;  2J46 A;  3PDN A;  3GAN A;  3O10 A;  3VYW A;  2PQR A;  3S84 A;  3CVN A;  4O6M A;  2XLO A;  4DX1 A;  1UN9 A;  3LJN A;  5A7D B;  4K03 A;  3CVP A;  5EGY A;  3LCA A;  2OV8 A;  1MX6 A;  5IY5 E;  3DSW A;  5AGF A;  2VSX E;  2UY1 A;  3QWW A;  1MHQ A;  5BXO A;  1OW8 A;  1ZHT A;  2WXN A;  2KJG A;  3A11 A;  4LER A;  5FZR A;  4JW1 A;  3Q9U C;  4ANV A;  2Y0B G;  1J8Y F;  4GEH A;  3C8G B;  3GZ1 A;  4UQY A;  4MVU A;  3S7B A;  2EQX A;  2NSZ A;  2PNN A;  3GM3 A;  4Y6C A;  3PUJ A;  4XEV A;  2MHK A;  4DOZ A;  3ONK A;  4E0H A;  4MQ9 F;  3ASG A;  3FMS A;  1NA3 A;  2VQ2 A;  5CCM A;  3JUE A;  2UY1 B;  1LI5 A;  2OJE D;  3T6B A;  2FBN A;  3DZA A;  5BW8 C;  3UGP A;  4DRI B;  4YDE A;  1AUE A;  1U3C A;  3NDB B;  3QW1 A;  5DS5 A;  1IZM A;  3JUI A;  1FVF A;  2Y69 C;  4ZHB A;  4LAC B;  1H2V C;  3B7S A;  3HXF A;  3E32 A;  5ENS D;  3RQE A;  4D4X A;  4URK A;  1E86 A;  3P2B A;  3Q79 A;  3FH7 A;  5AYW D;  4XEI G;  3MKR A;  3RYL A;  1WTY A;  4I1O B;  3DE9 A;  3IEE A;  4I44 A;  1DCE A;  3ASF A;  4GA2 A;  1ZU5 A;  3AS5 A;  3URZ A;  4DRX E;  4AY6 A;  1M2V A;  4U5B E;  3SO8 A;  1QYM A;  1NU7 D;  2H7B A;  3NMK A;  1TN8 A;  4CS7 A;  3F6Q A;  4B93 B;  3APF A;  3ZPJ A;  1MQV A;  2QYJ A;  3TD7 A;  2L6G A;  5BQH A;  5KYU B;  1QNF A;  2PX3 A;  3PRZ A;  1Q0F A;  4U63 A;  3S0X A;  4LNU D;  4FX5 A;  4E0I A;  2VTB A;  1KZP A;  4FJZ A;  2Q9C A;  3LDZ A;  3LAY A;  1R4T A;  2NUT B;  5KYX A;  2AW6 A;  1SVX A;  2M64 A;  3EHR A;  3KSL A;  4ZFH A;  2R7O A;  4JB8 P;  3RSE G;  2LFD A;  3FY4 A;  3GEH A;  3AU5 A;  3NF1 A;  1SA5 A;  2P9K G;  5T8I A;  5CMY A;  3K1I A;  1H9T A;  3HG0 D;  1TWA A;  4V3I A;  2OG2 A;  4HFK B;  3U64 A;  3D9H A;  5CRU A;  5E2Q A;  2V3C C;  3DAG A;  3IEG A;  1NA0 A;  4DX2 A;  2YQ8 A;  4NC3 A;  2PL2 A;  4WGZ A;  3AJI A;  5KJL A;  1KT1 A;  4Z9I A;  3NKD A;  3U3F A;  2EIL C;  2UWJ G;  4ILH B;  1M2O A;  1O1T A;  1VDY A;  3F47 A;  3PVL A;  2CFZ A;  4FU3 A;  3FUL A;  3GW4 A;  2AXV A;  3VM6 A;  4C48 B;  2WXH A;  3SEO A;  1OR3 A;  2OVF A;  4FJY A;  1RJ9 B;  2C0L A;  4HNA D;  2GGF A;  2A1D D;  1ORJ A;  2EIM C;  3ZYM A;  2CNW D;  3QTH A;  4XEF A;  2KZT B;  3ASN E;  3LY7 A;  4PS8 A;  3LEW A;  1FNT c;  1N4R A;  1N9A A;  4EEC A;  1OKK A;  3KYI A;  2Y4U A;  3LKU A;  4JHR A;  5BUO A;  1GQA A;  4L7T A;  1KPS B;  1IKN D;  4A55 A;  4C3B A;  3ABL E;  3C8Z A;  3QB2 A;  2J9U A;  5FJY A;  3PZ1 A;  2ETA A;  1AVO B;  4G24 A;  3D9I A;  3ABK E;  5BT1 A;  4BEJ A;  1B89 A;  3DRA A;  3S7J A;  3N71 A;  4JUR I;  2PP4 A;  1WAS A;  1VYK A;  3TG5 A;  1QQ3 A;  3C8G D;  4N5C A;  3SBS A;  4Z68 A;  4XPX A;  2AVK A;  4N3C A;  2HO1 A;  4B8C B;  5A6B A;  1YVI A;  4U8H A;  1YZC A;  4LDR A;  1JRA A;  2XEH A;  4Q69 A;  3F46 A;  1VYI A;  1BPO A;  1TNY A;  2LUH A;  4G7O F;  4X8Q A;  1TJC A;  2W45 A;  2L6H A;  3H2U A;  1V55 C;  3GWL A;  3CK8 A;  1K1B A;  3C72 A;  3VTY A;  5D0O D;  4CGW A;  2A6E F;  1N4Q A;  3RIB A;  5CEA A;  1E83 A;  4C7O B;  3L16 A;  3RRN B;  3QZC A;  3HXC A;  4OIP F;  5EX0 A;  2CHZ A;  2WQ7 A;  4E7Z A;  3BUA A;  3KKB A;  3PMR A;  2IFU A;  5EYP F;  3Q7G A;  2IJG X;  5AC4 A;  3EUV A;  2LSE A;  5F5H A;  1K3Z D;  1D1A A;  3JYY A;  2YIN A;  2OND A;  3HNK A;  1ZU2 A;  5DBK A;  4AY5 A;  1ZVZ A;  2YLG A;  4GYW A;  1E8X A;  4M63 A;  3TOL A;  1O5M A;  2VGX A;  3JRM O;  5AC5 A;  2R05 A;  5EYL A;  3BG1 B;  4CDA A;  5DVW A;  3UM3 A;  3RQG A;  2X6K A;  4XEK A;  5HKP A;  2R7S A;  1GM5 A;  5CHE E;  1GW6 A;  5CBO A;  4GYO A;  3CHQ A;  2DYR E;  1N95 A;  4TV3 A;  2A0U A;  5ENT D;  4J7W A;  1U2V G;  3VF0 A;  2Q9B A;  2QNL A;  1H6O A;  1RW2 A;  2R2L A;  1H6G A;  3ASO C;  1KU2 A;  2R7T A;  3ZU7 B;  4KVO A;  3EFO B;  3OAW A;  1JCQ A;  4GTR A;  4UWK A;  5KCM A;  3TWQ A;  2YQY A;  5LOZ A;  1AEP A;  2KK1 A;  2YRF A;  4E7S A;  4J30 B;  5HRY A;  2ZGD A;  1YAR O;  3EGX A;  4CS8 A;  4GPM A;  4TUM A;  3IV0 A;  1UN8 A;  4GCO A;  3SY2 A;  3RF3 A;  2P7V A;  3ULE G;  1JPN A;  3TGO A;  2GW1 A;  3SHF A;  1H6P A;  3S90 A;  4UWH A;  3OTN A;  3DXJ F;  3S29 A;  5L3V A;  4EBJ A;  3ZFW A;  4AV7 A;  2KZT A;  3SYN A;  3DSU A;  1H9G A;  1APC A;  3U3W A;  1NBB A;  4BEP A;  3AJM A;  3B9Q A;  3JT1 A;  2XHE A;  4XI0 A;  3S7F A;  1FR0 A;  1M56 C;  3N2Z B;  5EIB E;  2NUT A;  4U0U A;  3V30 A;  1CPQ A;  5JVE A;  3ABM E;  4RDA A;  4IJJ A;  2XS1 A;  4J0U A;  4KVM A;  2R7W A;  4LNB A;  2LO6 A;  3PDM P;  1OWM A;  1I4Z A;  4QFV A;  1IW7 F;  5FQ7 A;  4K0R A;  5KYX B;  5E75 A;  2D5R B;  3MA5 A;  1RCP A;  5KJK A;  2DIW A;  3IBE A;  3WOD F;  2Y3B A;  4YK5 A;  4U04 A;  4PFP A;  2H6F A;  4JEB A;  3ZN3 A;  3MBG A;  4LLE A;  4W8P A;  4YVO A;  3RH3 A;  5B3I A;  2Y3D A;  4MVZ A;  3EIJ A;  4CS8 C;  4JA7 A;  4LEU A;  4OVU A;  3U9W A;  1ZHW A;  4MW3 A;  4BSZ B;  4H4K C;  4JZA A;  1BLX B;  5CRV A;  1PD0 A;  2J7P D;  2KAT A;  2P2C P;  1QBQ A;  2FGY A;  2AP3 A;  2RG8 A;  4JTC B;  4WUY A;  3J5Q B;  2ILR A;  3DPD A;  4M7C A;  4FAD A;  4YT4 A;  2P1A A;  4BJ6 A;  1TN7 A;  3QC1 A;  3JRT A;  4MTF A;  3Q5M A;  4ULV A;  5CCL A;  2VH3 A;  3CVL A;  2F0Y A;  2WPV A;  1N4P A;  4J7Y A;  4JJG A;  3APD A;  3ZEF A;  1XNF A;  2XEN A;  2R59 A;  4GTS A;  3CR3 A;  1LE2 A;  3L8I A;  4MLP A;  2HSB A;  3HYM B;  4EBA G;  4F3V A;  1NG1 A;  2WXO A;  4JCH A;  3D9K A;  1S63 A;  4PDX A;  1BU9 A;  3DMD A;  1SW6 A;  2NC9 A;  2V5Q C;  4HOQ A;  5AAR A;  3U8P A;  4GZC A;  4IYP A;  3KEA A;  3Q75 A;  4QDL A;  4DRJ B;  4JC7 A;  2A4Z A;  3PHF 2;  1OW7 A;  4KNW A;  3VLE A;  2KBX A;  4L1B A;  1R5I D;  3ABM C;  4CSA C;  3DXK G;  1WY6 A;  4HOU A;  1HG2 A;  2KC7 A;  5L3Q A;  3CVW A;  3HRA A;  4HLL A;  3EHM A;  3KS2 A;  4YVQ C;  4DX6 D;  2YEV A;  2WXQ A;  4HXI A;  5T3T A;  2DVW A;  2VGY A;  1JR8 A;  4KNV A;  1W3B A;  4OYS A;  4NIK A;  1U0B B;  2EPM X;  1FAP B;  4JRZ A;  2JAB A;  1K8K G;  2BL2 A;  4ATZ D;  1BDJ B;  3OA1 A;  1KZO A;  3ZYL A;  1TFK B;  2ZD9 A;  3C3O A;  1Q0K A;  2VCA A;  4CS9 C;  1RZ4 A;  2XL4 A;  1EA8 A;  4JXT A;  3MV3 B;  4IN3 B;  1T6U A;  4L2Y A;  3QJZ A;  3NB2 A;  2OJQ A;  3CVU A;  1MJ0 A;  1YAU O;  3O39 A;  3TQO A;  5JA4 D;  5J90 A;  3NKE A;  3PZ3 A;  1U6H A;  4Z9J A;  1BZ4 A;  2PFD A;  2MWQ A;  2CFU A;  5D66 A;  1WWP A;  3OWT A;  1TKN A;  1D8E A;  3CST A;  3CHR A;  3FHE A;  3B95 A;  5DS4 A;  4BPM A;  4B94 A;  1JCS A;  3IHU A;  5T3R A;  2P9P G;  3R7C A;  2XRY A;  2X6J A;  3BQO A;  1KLX A;  3W8I A;  2J8S D;  4FC8 A;  1S64 A;  4BSX A;  3DAF A;  3ZKJ A;  4IWB A;  4DVZ A;  4MS2 A;  3CAX A;  4CSA A;  5B3S E;  1A7E A;  4N3A A;  1G4U S;  1TWC A;  4PK4 A;  3JTL O;  4FHJ A;  1Q0D A;  2VC9 A;  5ARG A;  4HE8 D;  5JLI A;  1G5Z A;  4L2L A;  2WXK A;  2LXM A;  1YA7 O;  4CDV A;  3ASD A;  1ZZP A;  3FUI A;  3UIN C;  5AJD A;  1I4Y A;  3NOC D;  3TXM A;  4JEH A;  1AWC B;  4XI9 A;  5E3A A;  3EU5 A;  4A3V A;  4O7G A;  4GTM A;  3RRU A;  4DVY P;  3LVQ E;  1RKE A;  3SQV A;  3W2W A;  4GTV A;  5A6J A;  2YLI A;  1D0Y A;  3FWV A;  3UM1 A;  2LP4 A;  1VMA A;  1NI1 A;  2X6H A;  3PNT B;  4E17 A;  4HOS A;  3DBS A;  2RFM A;  4BJ1 A;  4HI9 A;  3V2O A;  5FT9 A;  4F7A A;  4JE9 A;  1MNE A;  3TOM A;  2AU5 A;  5A6K A;  1HE8 A;  3ZW3 A;  4F1S A;  4KT6 B;  4HRM B;  3J06 A;  4I9C A;  1OCC C;  4YL1 A;  1B68 A;  1QZX A;  4YT8 A;  2G62 A;  3GOD A;  4RQI A;  4AOF A;  3O4Z A;  4OIR F;  2IXP A;  4YN0 B;  2R25 A;  3C3Q A;  4A1S A;  1N1C A;  5ENO D;  2ASR A;  3NMJ A;  4U5C E;  4GPK A;  3W8H A;  1KTM A;  4IUL A;  2GDC A;  5FZQ A;  1V54 C;  5CIV A;  3U8V A;  3POV A;  1MX2 A; 
#chains in the Genus database with same CATH homology
 4BFR A;  2WXM A;  3HVE B;  5C2Y A;  3ABL C;  3CK9 A;  3I5Q A;  3CKC A;  3E9V A;  1Z6A A;  4ANX A;  3FTS A;  4U5H A;  1ELR A;  1S0P A;  3CHO A;  2Q9A A;  1SZI A;  3CVQ A;  2CW0 F;  1SZA A;  3FUH A;  4B0Z A;  2BE5 F;  3ASH A;  2Y3A A;  3JYS A;  3UPV A;  3FUK A;  2IXO A;  4UQZ A;  4PJJ A;  3EH1 A;  3MX3 A;  5JJ6 A;  4KC9 A;  2FUL A;  3D9L A;  4J8F A;  4G11 A;  1FCH A;  4AM9 A;  3L08 A;  1EPU A;  2AXU A;  4JC8 A;  1MMD A;  3S2A A;  2BTD A;  4AK9 A;  3QNK A;  4CDN A;  4OVV A;  3ENE A;  4FES A;  2NXP A;  4BJ6 C;  3B13 A;  2KCL A;  4Q94 A;  3LY8 A;  2YZS A;  2J4D A;  2MRI A;  4MRU A;  3Q4A B;  4QI2 A;  2G3V A;  5JHA A;  1NP7 A;  5HI7 A;  3CKB A;  3ML9 A;  2J08 A;  1P5Q A;  4WJ0 A;  4BJT A;  4ANU A;  4O6Y A;  1D1C A;  1FFH A;  1HG5 A;  1OWN A;  4F4B A;  1EF1 C;  4U0S A;  2KW3 C;  2L6J A;  4G1T A;  3NZU A;  2IYL D;  4I9E A;  2AVP A;  4UQX A;  5ANR A;  5G05 J;  3ABK C;  1MQS A;  3EIQ C;  2WM9 A;  4AEZ C;  2A69 F;  3CQC B;  3GYZ A;  2DGJ A;  4HFG A;  2NUP A;  2KGO A;  3V7O A;  3FH5 A;  1IHG A;  5AEN A;  2KQ9 A;  3UMV A;  3DD7 A;  2R7R A;  2J09 A;  5FQ8 A;  4U5G A;  3C98 A;  1ST6 A;  4UI9 C;  4OD4 A;  1J8M F;  1LKX A;  4ZLD A;  2A6H F;  3R7Q A;  3FHD A;  3KL4 A;  3QDN A;  2WZL A;  5G04 J;  3ULQ A;  5IY5 C;  3SNX A;  3UT4 A;  4G25 A;  5M72 A;  1PD1 A;  2LAI A;  2V8S E;  2IXN A;  2E0I A;  2PM6 A;  3RKV A;  4AP2 A;  3AS4 A;  3FU0 A;  3UMH A;  3K1I C;  4JL0 A;  4A1G A;  2WXP A;  4FUL A;  4JPS A;  4ME2 A;  5D0Q D;  4NQ0 A;  5EHH A;  3WXX A;  1OKK D;  3JCK C;  1OCR C;  1H19 A;  2ZXO A;  4I2Z A;  3SD5 A;  4WWN A;  4ZLC A;  5KYY B;  1HO8 A;  4YT5 A;  2C0M A;  4PJM A;  3NYJ A;  4AE4 A;  2O9X A;  3HDX A;  1ZHZ A;  5C1D A;  5DIZ A;  2B0J A;  2A5U A;  5BUZ A;  3PS6 A;  3ECS A;  2WQH A;  1JUQ A;  4C7O A;  3EG9 B;  1IYG A;  3RIP A;  5LX8 A;  2LNI A;  4MS6 A;  5DQZ A;  3ESK A;  4A2N B;  2HM8 A;  4G23 A;  2PZI A;  3PEU B;  2BUG A;  4NRH B;  2WXL A;  3AQB A;  2KM4 A;  3QMK A;  4HFF B;  2I1K A;  2V4L A;  3G2T A;  4GA0 A;  5FTP A;  3FTV A;  4JHJ A;  5JHB A;  3ZIM A;  4ACK A;  3D9N A;  2P6V A;  4B6I A;  1MMN A;  2Y3G A;  4Q4Z F;  1M57 C;  3PRE A;  2FI7 A;  3FUJ A;  5BV0 A;  2IQC A;  2LSU A;  3L17 A;  2WXR A;  4M3O A;  2HYZ A;  3B7T A;  4CS9 A;  4DI3 A;  4WNG A;  3T8M A;  2ZXR A;  4OIQ F;  1E8Y A;  3NRH A;  4GB9 A;  2CG3 A;  5BNW A;  2X38 A;  1NU9 C;  4N39 A;  4WAF A;  1W2W A;  1WGW A;  3X2Q C;  1DVP A;  3I3N A;  5T1D B;  4FA6 A;  2I2O A;  2W4B A;  3AU4 A;  2Q3T A;  1UJK A;  1FVH A;  1EYH A;  1TR2 A;  2CGE A;  4BT9 A;  3ZGQ A;  3U66 A;  4ACL A;  1H6K A;  2WL8 A;  3D9M A;  2WXI A;  2FO7 A;  3PH0 C;  5KYN A;  3OXG A;  1D1B A;  3I4U A;  4CDM A;  2J0W A;  4J32 B;  4I1A A;  2CNW A;  4E85 A;  3AG3 C;  4G7H F;  1DNP A;  4EZK A;  3NYM A;  3UGO A;  3AG2 C;  1IQU A;  2XQ0 A;  3RU0 A;  3L0I A;  3K66 A;  1QQE A;  5DS6 A;  2XXA A;  3K9I A;  5AIJ A;  3MV2 B;  5FQ4 A;  4C0E A;  3JQ1 A;  1LVK A;  4FWV A;  4JA9 A;  2R7Q A;  3CHP A;  5KYW B;  4BJ5 A;  4ANW A;  3S27 A;  4KI2 A;  2XRH A;  3K6B A;  5E76 A;  3JSZ A;  2WXG A;  3ZXS A;  3LLI A;  4AX2 A;  1TWG A;  3FUM A;  1JWF A;  2ION A;  4NUR A;  4RBN A;  3VAY A;  2ZPA A;  2J45 A;  4MND A;  5B1A C;  2FFH A;  3SF4 A;  4UI9 K;  4I6G A;  4RG6 A;  2Z15 A;  3ITF A;  3G2W A;  3ZHE B;  4CRW A;  3FAJ A;  3FEX A;  2XGO A;  2L9J A;  4P29 A;  2WMN A;  4C9B B;  2Y4T A;  1YA0 A;  4U07 A;  3LEV A;  1FFT C;  2HV6 A;  2XRZ A;  4AJW A;  3MEK A;  1Z5Z A;  2QFC A;  3FTU A;  4XX5 A;  1G8X A;  4XKC A;  3K33 A;  5CI9 A;  5KYY A;  4IAO A;  2PX0 A;  2M63 A;  5BV1 A;  4JEU A;  3ZYK A;  2WMO A;  1ZHY A;  1Z3I X;  3DM5 A;  3Q15 A;  3MJW A;  5CMW A;  3MCX A;  3HLZ A;  1MMA A;  2AXZ A;  4HOT A;  4YT2 A;  2L9B A;  1SMY F;  1JPJ A;  3CVX A;  3B0P A;  3X1O A;  2GRL A;  5E3C A;  3AQC A;  2FF4 A;  2C2L A;  2YHC A;  1ELK A;  4BWR A;  3H65 A;  1HZ4 A;  4KBL A;  4DBR A;  3HHM A;  1BR1 A;  4ABN A;  4KXK B;  5ENN A;  2R5S A;  3PE3 A;  4KMO A;  4JHK A;  3O6X A;  1Z6T A;  3DJU B;  2Q7F A;  4I1M A;  3OXL A;  2YNQ A;  3CHS A;  3APC A;  4I6E A;  1INZ A;  2V5F A;  1HH8 A;  1O87 A;  4GYY A;  3CQZ A;  3LS0 A;  2VYI A;  5DQT A;  4BX8 A;  3CV0 A;  3FUN A;  4ATG A;  2CDQ A;  2DBA A;  4U0Z A;  3LS8 A;  3ZC4 A;  2KCK A;  3SZ7 A;  3EFO A;  3EZH A;  2RD0 A;  4XLN F;  3FVY A;  2VSO E;  4FLH A;  2NUP B;  4MKT A;  1SZ9 A;  2DCP A;  2VJ8 A;  4C0M A;  1QZ2 A;  2VSY A;  3CEQ A;  1PCX A;  2XPI A;  4ILI A;  3QKY A;  1OWP A;  3HTK C;  4PFO A;  1HS6 A;  5FZS A;  3ZVR A;  4YND A;  4GCN A;  4GMJ A;  3UQ3 A;  4GA1 A;  2XSE A;  4PJL A;  4YJW A;  4X0R A;  3ZG1 A;  4CT0 A;  1Z3Y A;  4PJN A;  5D91 A;  4DJA A;  2WVO A;  2J07 A;  3TJP A;  2J0X A;  3PZD A;  5E33 A;  3NQP A;  1WAO 1;  3RRM B;  4XLP F;  3L6A A;  2LAH A;  3LY9 A;  2GRM A;  1WM5 A;  4EBA A;  1Y8M A;  1QLE C;  1MMG A;  4JVS A;  3MZL B;  3P1U A;  3D9P A;  2H7V C;  2DYR C;  5LP0 A;  5CI8 A;  1OWL A;  4FLB A;  3JYH A;  1RJ9 A;  3TAX A;  4Q7C A;  4W9R A;  1IQR A;  3EPV A;  3RKO F;  4CBE A;  3G2V A;  4ILG A;  4B89 A;  2Y39 A;  3T5V A;  4DLO A;  1VOM A;  5FWQ A;  5KYU A;  4JJF A;  2FEZ A;  1LF8 A;  3TXN A;  4AVX A;  4AE4 B;  2R7V A;  3EDT B;  2VTB B;  3ESL A;  3QAR A;  5HSW A;  4APF A;  1SQM A;  4OIN F;  3UMI A;  2R17 C;  3WG7 C;  1SF8 A;  2J7P A;  3EGX B;  3HJC A;  4GAA A;  3Q49 B;  3LJB A;  3S28 A;  4KZ0 A;  2C03 A;  1X5B A;  1E7U A;  3FTW A;  4OIO F;  1NZE A;  3L54 A;  5HQ8 A;  2I9C A;  3ZRH A;  1ZYR F;  3TG4 A;  4UI9 J;  3TL5 A;  5JJT A;  2JD3 A;  3G2S A;  4CT4 A;  3CVV A;  4GZ5 A;  1E8W A;  1E96 B;  4WWO A;  2DYS C;  1FMV A;  4YWQ A;  4O79 A;  4UWL A;  3O48 A;  2CHX A;  2EIK C;  5F5F A;  4RSY A;  3FFL A;  1Y6I A;  2X3M A;  2EIN C;  3B0V C;  3UT7 A;  3R7R A;  2IF4 A;  4HVB A;  4PS7 A;  3MLG A;  3MKQ A;  2X6I A;  2WQ6 A;  4J8E A;  5EDS A;  2IXM A;  4N06 A;  2C04 A;  3Q6M A;  2PQN A;  3FU5 A;  1FMW A;  3FTY A;  4GZ3 A;  1LS1 A;  4J8D A;  5B1B C;  5LFA A;  4I3M A;  2XPY A;  5ARF A;  2I8B A;  3KAE A;  4GZ6 A;  4CIH A;  4N3B A;  4BTA A;  2ZXW C;  3GZS A;  3CSF A;  3ML8 A;  4KYO B;  3ONL A;  3LLK A;  2YHE A;  1ZBP A;  1TEZ A;  3DJN B;  2VSN A;  5B3S C;  2R7X A;  1HU3 A;  4F53 A;  4UWG A;  1MND A;  3Q7L A;  2MYS A;  1N54 A;  3NG1 A;  1E90 A;  4Q96 A;  4FHK A;  1PC2 A;  3PNL B;  1HXI A;  3SP1 A;  4U5D E;  3LNR A;  3FU3 A;  2A68 F;  4KZC A;  2OVB A;  1Z3X A;  2J49 A;  4E6H A;  1BR2 A;  2NG1 A;  1NZN A;  4LCT A;  3T4R A;  2I6H A;  3RO3 A;  3FDQ A;  3RJV A;  2WB7 A;  3PEV B;  4TRQ A;  3EHN A;  4H7Y A;  2XCB A;  1Z23 A;  2WVI A;  3CGH A;  4XTK A;  4D10 C;  1ZHX A;  4XKB A;  2QTV A;  4BJ5 C;  2HR2 A;  3T5X A;  4BG0 A;  3ZIB A;  2E2E A;  2LSV A;  2WB2 A;  1H2T C;  4K7B A;  2E87 A;  3E70 C;  3D3M A;  5DLJ A;  2P58 C;  4APO A;  3K7D A;  4HEA J;  4IRU A;  3LYA A;  2PM7 A;  4XWJ A;  3SNH A;  4GU5 A;  3RFY A;  4G7Z F;  3FDH A;  3LVR E;  2CG2 A;  3IHV A;  4TUU A;  1N52 A;  5G2N A;  1L5J A;  4GML A;  4L23 A;  3UX4 A;  2MOW A;  3BG0 B;  3VTX A;  4PS3 A;  1HX8 A;  4BX9 A;  2J4B A;  3K1H A;  5KYW A;  4O6N A;  2IOS A;  4NAC A;  1H2U A;  5LCW C;  4I6J A;  3D9J A;  1OWO A;  3W2V A;  5A6C A;  3G2U A;  3OXF A;  4WWP A;  4ULW A;  1PAQ A;  4LLC A;  1M2V B;  2QY9 A;  3CVY A;  2J9W A;  3FP3 A;  2WXJ A;  3LPZ A;  1OUV A;  3ZYQ A;  4KBQ A;  2OCC C;  2I1J A;  3KD7 A;  3LJ3 A;  2KCV A;  4EWC A;  1BR4 A;  1JPL A;  3JCU Q;  1HFA A;  3NZS A;  3KH2 A;  2G3K A;  4DI4 A;  2L0I A;  3FUD A;  5AJL A;  2L0T B;  1S7Z A;  3N24 A;  4OD5 A;  2W9Y A;  4C3E A;  4WNF A;  2HV7 A;  2V26 A;  5T4Y A;  2WVN A;  2WZG A;  2PF4 E;  4Y6W A;  5ANL A;  2VGX B;  1TJF A;  3FUF A;  2Y3H A;  1KT0 A;  3CQG B;  3Q6N A;  3QAQ A;  2XEV A;  3MYV A;  4EZJ A;  2WVQ A;  3N0T A;  5EX3 A;  3UT8 A;  3Q47 B;  4XIF A;  3FTX A;  1OCZ C;  4C3D A;  2AWI A;  1ELW A;  3ASN C;  5BPP A;  4N2S A;  2IOL A;  4G26 A;  1VK5 A;  3I5P A;  3JQ0 A;  4LRZ A;  3UR3 C;  1JWG A;  4H7X A;  4NY3 A;  2VAS A;  4I2W A;  1UG3 A;  4LUN U;  3CIA A;  4EQF A;  4GYT A;  4Q5S F;  4EZL A;  3LS1 A;  3QWV A;  4DK5 A;  3QOU A;  3AG1 C;  5EKQ D;  2V0P A;  4I43 A;  4DPR A;  3EJN A;  2XCC A;  3CK7 A;  1UW4 B;  1D0X A;  2WZF A;  4HLE A;  2OOE A;  4CDR A;  2IOQ A;  2QY7 A;  4WNE A;  3B7R L;  2XXA B;  3MGB A;  2KNH A;  3ZSU A;  1EDU A;  3QWP A;  3OEO A;  3BEE A;  5KJM A;  4UWF A;  4WND A;  3AS8 A;  4EPZ A;  4G2V A;  4FP7 A;  2R7U A;  5FQ6 A;  4G0H A;  4W8K A;  3D9O A;  2XPZ A;  5T3W A;  3CSK A;  4RG9 A;  2L81 A;  5LCW J;  3QK0 A;  4QI0 A;  2J9Q A;  1OCO C;  5A23 A;  3EGD B;  4CCA A;  2WXF A;  3S7D A;  2IU1 A;  4BT8 A;  4RVB A;  2JLB A;  3FU6 A;  1UJJ A;  2J9V A;  4U5E E;  1U3D A;  4CGV A;  2JEK A;  3GZ2 A;  4AIF A;  2W4M A;  4EBB A;  5G55 A;  4RD9 A;  1H0A A;  3EQL F;  3M1C B;  3FH8 A;  2VB6 A;  4N2Q A;  3DM9 B;  4AXH A;  5J08 A;  4P6I C;  3SI5 A;  5KJN A;  2XGS A;  2XGM A;  3UNG C;  3UUX A;  4B8A A;  5D92 A;  1XGW A;  3UMK A;  2X6F A;  2X51 A;  2H7O A;  3FTZ A;  1E8Z A;  3CZ6 A;  3HVE A;  4XE0 A;  4K0D A;  3E4B A;  3EGD A;  1Z63 A;  3KMI A;  3EH2 A;  1TWH A;  3RO2 A;  2M4E A;  1HF8 A;  4PH4 B;  2EIJ C;  4JZY A;  4ANJ A;  3RK6 A;  3FUE A;  5JJ7 A;  3I4G A;  3AG4 C;  3T6J A;  4XZ4 A;  3SFZ A;  3B0U X;  2ZXP A;  3VLD A;  3IHY A;  4J6I A;  2YHS A;  4U5F E;  4O6F A;  4DBQ A;  3ZHE A;  4DLQ A;  3LES A;  1A17 A;  3SBT B;  1FTS A;  3U4T A;  1ZU4 A;  2ZU6 B;  4CEM A;  3I4R B;  4GZD A;  2GFH A;  3NYL A;  5G05 C;  3FEY A;  1PY1 A;  3PE4 A;  5FCL A;  3PUK A;  4J8S A;  3HIZ A;  1D0Z A;  3KEZ A;  3CLJ A;  3SZR A;  3LXU X;  4R7L A;  3L22 A;  4PUC A;  3B7U X;  3EZI A;  3CHM A;  3EG9 A;  2CHW A;  3IKO B;  4BY6 A;  5G04 C;  2BF0 X;  4BTB A;  1O5H A;  3R9A B;  4A3T A;  4HS2 A;  3SGH A;  3ZVV A;  3L34 A;  1E7V A;  4HOR A;  3VLF A;  3MKQ B;  4I17 A;  3L13 A;  2J46 A;  3PDN A;  3GAN A;  3VYW A;  2PQR A;  3CVN A;  4O6M A;  1UN9 A;  5A7D B;  4K03 A;  3CVP A;  5EGY A;  3LCA A;  2OV8 A;  2VSX E;  2UY1 A;  3QWW A;  1MHQ A;  1ZHT A;  2WXN A;  2KJG A;  4LER A;  5FZR A;  4JW1 A;  4ANV A;  1J8Y F;  4GEH A;  3S7B A;  3GZ1 A;  4UQY A;  2EQX A;  2NSZ A;  4Y6C A;  3PUJ A;  2MHK A;  3ONK A;  4DOZ A;  4MQ9 F;  3ASG A;  1NA3 A;  2VQ2 A;  5CCM A;  2UY1 B;  3T6B A;  2FBN A;  3DZA A;  5BW8 C;  3UGP A;  1U3C A;  3NDB B;  5DS5 A;  1IZM A;  3JUI A;  1FVF A;  2Y69 C;  4LAC B;  1H2V C;  3B7S A;  4URK A;  3P2B A;  3FH7 A;  5AYW D;  3MKR A;  3RYL A;  4I1O B;  3IEE A;  4I44 A;  3ASF A;  4GA2 A;  1ZU5 A;  3AS5 A;  3URZ A;  4AY6 A;  1M2V A;  4U5B E;  1NU7 D;  2H7B A;  4CS7 A;  3APF A;  3ZPJ A;  3TD7 A;  5KYU B;  1QNF A;  2PX3 A;  3PRZ A;  4U63 A;  3S0X A;  4FX5 A;  2VTB A;  4FJZ A;  2Q9C A;  3LDZ A;  3LAY A;  2NUT B;  5KYX A;  2AW6 A;  2R7O A;  3FY4 A;  3AU5 A;  3NF1 A;  5T8I A;  5CMY A;  1TWA A;  4V3I A;  2OG2 A;  4HFK B;  3U64 A;  5E2Q A;  2V3C C;  3DAG A;  3IEG A;  1NA0 A;  2YQ8 A;  2PL2 A;  5KJL A;  1KT1 A;  3NKD A;  2EIL C;  2UWJ G;  4ILH B;  1M2O A;  1VDY A;  3F47 A;  3PVL A;  2CFZ A;  4FU3 A;  3FUL A;  3GW4 A;  2AXV A;  2WXH A;  3SEO A;  2OVF A;  4FJY A;  1RJ9 B;  2C0L A;  2GGF A;  2A1D D;  2EIM C;  3ZYM A;  2CNW D;  2KZT B;  4PS8 A;  3LY7 A;  3LEW A;  4EEC A;  1OKK A;  2Y4U A;  3LKU A;  4JHR A;  5BUO A;  4L7T A;  4A55 A;  4C3B A;  3QB2 A;  2J9U A;  5FJY A;  4G24 A;  3D9I A;  5BT1 A;  4BEJ A;  1B89 A;  3S7J A;  3N71 A;  4JUR I;  2PP4 A;  1VYK A;  3TG5 A;  4N5C A;  3SBS A;  4N3C A;  2HO1 A;  4B8C B;  4U8H A;  4Q69 A;  3F46 A;  1VYI A;  1BPO A;  4G7O F;  1TJC A;  2W45 A;  1V55 C;  3CK8 A;  3VTY A;  5D0O D;  4CGW A;  2A6E F;  3RIB A;  4C7O B;  3L16 A;  3RRN B;  3QZC A;  4OIP F;  5EX0 A;  2CHZ A;  2WQ7 A;  4E7Z A;  3KKB A;  3PMR A;  2IFU A;  3Q7G A;  2IJG X;  2LSE A;  5F5H A;  1D1A A;  2YIN A;  2OND A;  1ZU2 A;  5DBK A;  4AY5 A;  4GYW A;  1E8X A;  4M63 A;  2VGX A;  3BG1 B;  5DVW A;  2X6K A;  2R7S A;  5CHE E;  1GW6 A;  4GYO A;  3CHQ A;  4TV3 A;  2Q9B A;  3ASO C;  1KU2 A;  2R7T A;  4KVO A;  3EFO B;  3OAW A;  4UWK A;  5KCM A;  5LOZ A;  4E7S A;  4J30 B;  3EGX A;  4CS8 A;  3IV0 A;  1UN8 A;  4GCO A;  2P7V A;  1JPN A;  3TGO A;  2GW1 A;  3SHF A;  4UWH A;  3OTN A;  3DXJ F;  3S29 A;  5L3V A;  3ZFW A;  4AV7 A;  2KZT A;  3SYN A;  3U3W A;  3B9Q A;  3JT1 A;  2XHE A;  4XI0 A;  3S7F A;  1M56 C;  3N2Z B;  2NUT A;  4U0U A;  4RDA A;  4IJJ A;  4J0U A;  4KVM A;  2R7W A;  2LO6 A;  1OWM A;  4QFV A;  1IW7 F;  5FQ7 A;  4K0R A;  5KYX B;  5E75 A;  3MA5 A;  2D5R B;  5KJK A;  2DIW A;  3IBE A;  3WOD F;  2Y3B A;  4U04 A;  3ZN3 A;  4PFP A;  4LLE A;  4YVO A;  3RH3 A;  2Y3D A;  3EIJ A;  4JA7 A;  4LEU A;  4CS8 C;  4OVU A;  3U9W A;  1ZHW A;  4H4K C;  4JZA A;  1PD0 A;  2J7P D;  2KAT A;  2FGY A;  2RG8 A;  4WUY A;  2ILR A;  3DPD A;  4FAD A;  4YT4 A;  4BJ6 A;  3QC1 A;  3JRT A;  3Q5M A;  5CCL A;  2VH3 A;  3CVL A;  2WPV A;  4JJG A;  3APD A;  3ZEF A;  1XNF A;  2R59 A;  3CR3 A;  4MLP A;  3HYM B;  4F3V A;  4EBA G;  1NG1 A;  2WXO A;  4JCH A;  3D9K A;  4PDX A;  3DMD A;  2NC9 A;  4HOQ A;  4GZC A;  4IYP A;  4QDL A;  2A4Z A;  3PHF 2;  4KNW A;  3VLE A;  4L1B A;  3ABM C;  4CSA C;  1WY6 A;  4HOU A;  1HG2 A;  2KC7 A;  5L3Q A;  3CVW A;  3EHM A;  3KS2 A;  4YVQ C;  2YEV A;  2WXQ A;  4HXI A;  5T3T A;  2VGY A;  4KNV A;  1W3B A;  4OYS A;  3OA1 A;  3ZYL A;  4CS9 C;  2XL4 A;  4JXT A;  3MV3 B;  4IN3 B;  4L2Y A;  3QJZ A;  3CVU A;  3O39 A;  5J90 A;  3NKE A;  2PFD A;  2MWQ A;  2CFU A;  3OWT A;  1TKN A;  3CST A;  3CHR A;  3FHE A;  5DS4 A;  4B94 A;  5T3R A;  2XRY A;  2X6J A;  1KLX A;  3W8I A;  4FC8 A;  4BSX A;  3DAF A;  4IWB A;  4DVZ A;  4CSA A;  4N3A A;  1TWC A;  4PK4 A;  4FHJ A;  5ARG A;  4HE8 D;  4L2L A;  2WXK A;  3ASD A;  3FUI A;  5AJD A;  3TXM A;  4JEH A;  4XI9 A;  4A3V A;  5E3A A;  4O7G A;  3RRU A;  4DVY P;  3LVQ E;  3W2W A;  1D0Y A;  3FWV A;  1VMA A;  2X6H A;  3PNT B;  4HOS A;  3DBS A;  4BJ1 A;  5FT9 A;  4F7A A;  1MNE A;  1HE8 A;  3ZW3 A;  4F1S A;  4KT6 B;  4I9C A;  1OCC C;  4YT8 A;  1QZX A;  4AOF A;  2G62 A;  3GOD A;  3O4Z A;  4OIR F;  2IXP A;  4YN0 B;  4A1S A;  1N1C A;  4U5C E;  4GPK A;  3W8H A;  4IUL A;  5FZQ A;  1V54 C;  3POV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...