4IRUA

Crystal structure of lepb gap core in a transition state mimetic complex with rab1a and alf3
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
296
structure length
296
Chain Sequence
SLKPLTLLMTSSTSFSETINQWADILKTTDMEKFSFDSNPINLLELVKQFNLYVDELAITCEANNVWAKERIDSTPNLFALYDNSGGEAIHGHAFVPYYKESIVLRRLFTVDPNTFNLSRFAAFEGPCQLYCKEHKDSAWVKIQTLLTLGNGIINTLKIIKQAQAFGIDEAVTENLKALKEQFIAFQLAEADIKESLKAPSFAEPLPNKESEFFYPIDEKALAKMNGYQLATICLEELNSPKPSPLIERILSNKKFWKRINSAFESGVFKGRTDDPAGKIAKIREWHQLLQISGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LepB
publication title The Legionella pneumophila GTPase Activating Protein LepB Accelerates Rab1 Deactivation by a Non-canonical Hydrolytic Mechanism.
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase/hydrolase
total genus 109
structure length 296
sequence length 296
chains with identical sequence C, E
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2013-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18172 LepB_GAP_N LepB GAP domain N-terminal subdomain
A PF18227 LepB_GAP_C LepB GAP domain C-terminal subdomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1700 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4iruA01
1.25.40.830 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4iruA02
4IRUA 4I1OB 4I1MA 4JW1A 4JVSA
chains in the Genus database with same CATH superfamily
3ZPJA 1YZAA 4BJTA 3N0TA 2QLAA 4GZCA 2R7RA 3ISMC 2M64A 3ZIBA 2BL2A 2BUGA 1WASA 4LRZA 2EIMC 2LK4A 2XPZA 3FTZA 5AARA 4EBBA 4G0HA 4JC7A 1HW1A 3GWNA 1FPPA 3WG7E 2PNNA 4C9BB 4N5QA 2X6HA 4YK5A 2XENA 5KYUA 4A1SA 3O48A 4DK5A 3KL4A 4FP7A 3TG4A 2XS1A 4Y6CA 5A7DB 2OJQA 5DLJA 2VGEA 3QZCA 3MX3A 2I2OA 2AW6A 3NBNB 2Y3AA 3T6GB 1ZW2A 2YWAA 2JD3A 5EIDA 3E33A 1MHQA 3LY8A 1ZU4A 3QAQA 3AS4A 3SHFA 4GMRA 1BR4A 3L9TA 4WNFA 3ZYMA 2HZ8A 5D91A 3FU3A 3ML8A 2R05A 3M15A 3R9MA 4NY3A 4X0RA 1O87A 4U9EA 1NLXA 3OXFA 1T6UA 3U9JA 4I3MA 3AG1C 2PFDA 1HF8A 2WPVA 4JC8A 2OOEA 3RFYA 1IQRA 2AP3A 3AOUA 3QOUA 2HSBA 3EG9B 4LG6A 3KMIA 4U9DA 1SZ9A 2DYRE 2DGJA 2CG3A 5AGFA 1E96B 3ASNE 4GCNA 1D1AA 4W8KA 2VYIA 5IY5C 3QTHA 3C7JA 2OV8A 4L6RA 4JEHA 4YDEA 4K0DA 2XGOA 4PS8A 4J8YA 2Y4UA 2GFHA 4Q7CA 2WXNA 1Z63A 4I6EA 4L9PA 4BEJA 4AEZC 3QW1A 4Z9IA 2YNQA 5FQ7A 1MX6A 3ULYA 1ORYA 4PK4A 3IQCA 2X6IA 4I2WA 3UM0A 2KZTB 4U5HA 4DRIB 1UW4B 1TFKB 3SF4A 4CT0A 5FT9A 5FZRA 4IARA 1ZVZA 3RF3A 2L6HA 5CI8A 2VGYA 3URZA 3L8JA 3AG3E 4I17A 2WVIA 3DJUB 5ANLA 3UTMA 2V3CC 3FH8A 3RW0A 4G11A 4H7XA 4U5CE 4CS9A 2E0IA 3QJZA 3KD7A 5AQBA 4K0RA 4QI2A 3KSQA 2KJGA 3D9KA 4Z9JA 4MS6A 1NU9C 5AAOA 4MBGA 3SBSA 1KPSB 2XLMA 4G1TA 4EZJA 2L9BA 4CS8A 3EHRA 1HMDA 3AS8A 1ZHYA 1HO8A 4JRZA 4RQIA 1LM3B 3B7SA 4OD5A 4J8EA 4CT4A 3DEOA 2LXMA 3NMIA 1PCXA 1YLMA 1QQEA 3V79K 5CBNA 2LXLA 5A23A 3RVYA 1NSGB 2KGOA 2V4HC 3UXGA 4W8PA 1XNFA 3TULA 3LEVA 3E37A 4C7OA 3C8ZA 2E2EA 3UT4A 5JVEA 5HV9A 4KI2A 3U0CA 3UIPC 4O7GA 2PL2A 3T9KA 3TWQA 4CRWA 2ETBA 2FBNA 1K1BA 1N4QA 2DYSC 1Q0MA 5B1AE 2KNHA 4WNGA 1LI5A 3S7FA 4CS7A 2WXFA 3NYLA 3RO2A 1H9GA 3R7QA 3UT8A 4J8SA 5FZSA 4G8LA 2A1DD 1F1MA 3FDHA 3TGOA 4G25A 2ZPAA 5GPGB 3EH2A 4XWJA 3Q79A 3TK0A 4EPZA 5ITZF 2XHEA 3H2VA 3C3OA 2J9QA 2J9VA 3HYMB 4X8QA 3CKCA 4TRQA 3DSUA 5LX8A 1QBQA 3PNTB 3V5XA 2XCCA 1BZ4A 4WWPA 1V55E 2IYLD 2I9CA 5L0IA 4UWFA 4DBRA 1HY5A 1M2VB 1UJKA 4RG6A 5HQ8A 2W45A 5AJLA 5BQHA 4R7LA 4M7CA 2B6CA 3I4GA 3UM1A 3L1MA 3KAEA 4HS2A 2RD9A 3ZN3A 3T9OA 3SO8A 3LXUX 2VGXB 5HS0A 3SEOA 3SXZA 1WN0A 3UMVA 3TWVA 2Y1LE 3Q7AA 1OWLA 3V5YA 1OCZC 4GPMA 1C03A 1FAPB 5JP7A 3MV3B 4CEMA 4UQYA 2NUPB 1ST6A 4XEVA 4YL3A 4BWRA 1YYHA 2J9UA 5B1BE 1OXBA 1QLEC 3LYAA 4JEUA 4G7HF 2ZIRA 3FUMA 3PE4A 3JYYA 2WXKA 2UY1A 4YDWA 2ICWG 2ETCA 5G55A 4J7YA 3GEHA 1KT0A 3CIAA 3UMKA 2BTDA 1LPEA 4JIOA 3LJNA 3RKOF 5DS4A 2LQGA 4FU3A 2YZSA 4G7ZF 5HI7A 4BT9A 2KXPC 1OCCE 3PUJA 3ABKE 4CSAC 4ACLA 1D0YA 4HOSA 3HXDA 1V54E 3QMKA 4D4NA 2DVWA 1OWNA 2J45A 2X6FA 1H2VC 3UM2A 3IHVA 1A5EA 3SNXA 1ZU5A 3BUAA 5T3TA 4UDVA 4DBQA 1BDJB 2JABA 4WUYA 3L54A 5K0IA 2C0MA 4N5CA 4PJJA 2D5RB 3FY4A 3UMHA 3IPMO 2QY9A 4BJ6C 2M63A 2H8AA 2Q9AA 1CGNA 1WAO1 2BEDA 1CPQA 4I2ZA 1PAQA 2YHSA 4L7TA 3ZXSA 3S7BA 1BI7B 4AL1A 1TN6A 5AJDA 2Y3DA 3TWTA 3UGOA 1MQSA 4P6IC 4EKWA 3GWLA 2ONDA 4LNBA 3UQ3A 2YQYA 3DMDA 1Z5SC 2EILE 4ANJA 4C3DA 5A6KA 2XZTG 4XPYA 4FLBA 2BKKB 1OY3D 3VLEA 1PY1A 3CVYA 1X81A 2XGSA 5EYLA 3CVXA 5G05J 2XLHA 1T6QA 4ACKA 3G2WA 4Y6WA 4WGZA 4MW8A 3SXKA 5EK0A 4I1AA 3RQFA 3NMJA 2R17C 3RU0A 3T8KA 1JPNA 4A3VA 4BTBA 2HS5A 2AWCA 1HG2A 4HOTA 3B71A 4OVVA 4XEFA 5JJTA 3UR3C 4GYOA 2IQCA 4AVXA 3LKUA 2XLEA 3X1OA 5JHBA 2F37A 1X5BA 1LKXA 4XEIG 3CK8A 3LNRA 3S28A 2P9KG 1L7CA 5KYWB 3PZ3A 4CS9C 3RSEG 3DSSA 4JPSA 4DXWA 4FLHA 2DB4A 3FDQA 4O1PA 5BW8C 3ZYQA 3CHSA 3ECSA 2KZTA 2KYHA 1D1CA 5CI9A 5ENTD 2HV6A 1YA7O 3QC1A 4F53A 2YHEA 3FAPB 1EKYA 3O4ZA 4RVBA 4EIYA 2XLWA 2EPMX 1ZHWA 1EF1C 2IOLA 3AJMA 1OR2A 1KTMA 4TUUA 1U6HA 3LY9A 3IQ6A 2IXMA 2B0OE 3CHMA 4UWKA 1ZHXA 3MKRA 2W4MA 4AY6A 1FFTC 2FF4A 1ZBPA 4ZLCA 4OIPF 4HRLA 5G05C 1WOLA 4XE0A 4NURA 4YN0B 3PH0C 3QWVA 1JRAA 1Q0GA 1W2WA 3NG1A 1KLXA 1QPUA 3KSLA 4RG9A 3RQEA 5CEAA 2ILRA 2P9IG 4E7SA 4ANXA 2WXQA 1AP7A 3EHNA 5B3IA 4U8YD 4FULA 4HI8A 3P2BA 3AGUA 3Q49B 1E90A 5BUOA 4GQHA 1WDYA 2J9WA 3K9IA 5CHEE 2W4BA 1O1RA 3PREA 1TWCA 4MVOA 4BERA 4N06A 3SXMA 4LERA 4Q96A 1MMAA 1YMPA 3ZEFA 4Q69A 3ZU7B 2GRRB 2YQ8A 2ZXWE 3ABLE 3EGXA 1YZCA 1BI8B 2ZXPA 5D92A 1L3PA 2Y3HA 3AGTA 3C8GA 5B3SC 4KXKB 4CJOA 3L6AA 1FVHA 4HRNA 2YHCA 3FH7A 1TQGA 5CBOA 3DE9A 5CIVA 1VTMP 3JTLO 2WQ7A 1RKEA 4ILHB 3FTWA 4I43A 3AG2C 2I8BA 3W4YA 4KC9A 2Y69E 5CCLA 2R7QA 2Z15A 5BXUA 3PUKA 5AC4A 3D9MA 1E86A 3ZKJA 4O79A 1ELRA 1S64A 2P0NA 2MYOA 3SFYA 2HSQA 2EINE 2IXNA 3CVWA 1BBHA 3QARA 3VM6A 3NQPA 4IAOA 1HE1A 3EU9A 3RIBA 3D9PA 2NG1A 1G5ZA 4NTAA 2LNIA 2HV7A 4PS7A 1GQAA 3FOPA 4CDVA 1ELKA 3EFOB 4IJJA 4JW1A 3JYSA 2R59A 2R03A 3DEPA 4FESA 2A6EF 1M2VA 3CEXA 2CG2A 3LJ3A 1LS4A 4XKBA 2VH3A 3IXEA 3V30A 3WODF 1O1TA 3FH5A 3L34A 2PM6A 4PR9A 5CMWA 2KATA 2F0YA 4U7EB 3J5QB 4HXIA 2OVFA 5CMYA 4G26A 3AU5A 5KYYB 3UI2A 2MRIA 2IBFA 3C3RA 1DCQA 4B0ZA 2KBXA 4AE4A 2HR2A 5FJYA 1AUEA 3AJIA 4DRHB 2WZFA 3SI5A 5KJKA 1FT1A 1MMDA 4BEMJ 3C72A 2R2LA 1MQVA 2AXUA 4MKTA 5T1DB 5EDSA 3EQLF 4JE9A 1Q0FA 2X6JA 2IU1A 3CKBA 4JD2G 2A0UA 2CDQA 2H6GA 4EBKA 3N2ZB 2YLDA 3EH1A 2C04A 4JVSA 3U66A 4HE8D 3U2LA 4HFKB 3CSTA 3MFNA 3NAWA 4CDMA 3PZDA 2B0JA 3DAFA 3SZ7A 5FCLA 3E9VA 2AXZA 2J4BA 2NXPA 4JA9A 3TG5A 3CK7A 2ZGDA 2R25A 4IYPA 1B68A 5L0GA 2CFZA 1TWAA 2LSVA 2PQNA 1H2UA 1NU7D 1TNUA 2KC7A 3Q15A 1XWJA 3K1IC 3I3NA 4NACA 2XS8A 2KSFA 4U04A 3HNLA 4JTCB 3G2SA 3Q7GA 4XPXA 4ONSA 4L23A 5DIZA 1QKRA 4CDRA 4KZ0A 4F6RD 1G4WR 2A6HF 3FUJA 4OIRF 3TD7A 4AV7A 2I1JA 3HJCA 3FUDA 3KYIA 3Q6NA 3ZQYA 4LUNU 2VCBA 3KEZA 3ZSUA 4I6GA 2DI3A 4IB4A 2HUJA 4BX8A 3EHQA 4A1GA 2XXAA 4JKVA 3BEEA 2C2LA 3VLFA 1NZEA 4K7BA 4YL1A 4AL0A 3E32A 4TUMA 3CVUA 4CX9A 4HLEA 3UPVA 2YL3A 5E76A 1MJ0A 256BA 4WJ0A 2QZAA 1TR4A 2WXMA 3U3FA 3U5SA 5ENSD 2OCCE 3FU6A 3DSXA 4Z9HA 2IM8A 1VOMA 2EIKC 3D9HA 4JL0A 4JEBA 3NKEA 3FU5A 4GB9A 3G4XA 1LVKA 2JPUA 3HG0D 5L0JA 1Q2ZA 2V0PA 4ILGA 2CNWD 4CSAA 4DPRA 4WWNA 3AG4E 2PBEA 4GMLA 1FTSA 4GTPA 3JCKC 2DBAA 2L0IA 5AYWD 2NUTB 1KZOA 2YVKA 4G24A 2P58C 1TYQG 3IEEA 1OT8A 3DZAA 4H4KC 5E2QA 3V2XA 4FADA 4PUCA 1T01A 4CCAA 1WWPA 1CGOA 2LAHA 3T8MA 1OKKD 3DPDA 3QWWA 4BJ6A 3UUXA 1HFAA 3Q7LA 4TXRA 3HRAA 3JT1A 3WHNA 3Q6MA 4YDOA 5KYWA 2L6GA 2EIJC 2DWZA 3R2PA 1LI7A 3JRTA 1YA0A 2LP4A 3QW0A 3US6A 5L3QA 5JS5A 1UN9A 2QYUA 3HXEA 3ESLA 2J08A 2PNOA 1EI7A 3DSTA 2L81A 3MGBA 1JCRA 1N4RA 1TN7A 2BE5F 3DJNB 2R7OA 2GROB 2CFUA 2OQMA 2GRLA 3HVEB 1S70B 3H65A 4PFOA 2QY7A 4MTFA 5JT4A 3DRAA 1JCSA 4DX5D 2LD6A 1RJ9B 3FAJA 1N54A 2H6HA 2J8SD 1IYGA 4HBDA 4GMJA 2LFDA 2HYZA 2R5SA 4OD4A 3DBSA 1UJJA 1NZNA 2LCHA 2W9YA 3M79A 3SXYA 2GRNB 5JA4D 3EGDA 2LFFA 4UWHA 3PHF2 2J0WA 3U64A 2ASRA 1SR2A 1RZ4A 3FFLA 1RKCA 3FUHA 3D9IA 4EZKA 3T6BA 3N24A 2WXIA 4OIOF 2WMNA 1V4AA 1LTXA 4E85A 2FAPB 3JSZA 4JEAA 5COMA 4UWLA 2DCPA 3G4ZA 3NOCD 4QQIA 1O1SA 5FQ8A 4N2QA 4U0ZA 1NBBA 1I4YA 3IV0A 2PF4E 1HE9A 4EECA 2QTVA 5ARGA 3U3BA 1JPJA 1N94A 2VSNA 2Y3GA 2RFAA 1M2OA 4UQZA 5AENA 1LE4A 1SA5A 3B7RL 3ZUVB 1S0PA 4PFPA 1U3DA 2VTBA 3C62A 3JRMO 5EN5D 1BPOA 1SA4A 4JZYA 4YL0A 3JQ1A 1YARO 4AX2A 2KM4A 2V4LA 4YNDA 5EGYA 2WXJA 1OCOE 3RAUA 3I5QA 2PP4A 4JCZA 2KC3A 1OWMA 1BU9A 1SZIA 3U9WA 3OEOA 2BC5A 5KJNA 3LS0A 3B95A 3VAYA 2X38A 5KCMA 2DZOA 5BNWA 3Q9NC 1C17M 1IXVA 3K1HA 4BJ5C 3M4BA 4PH4B 3MYIA 3V7OA 4BPMA 1A7DA 5TJ5E 2H7BA 4MLPA 1MMNA 1K05A 5G2NA 1EYHA 2DYRC 1S7ZA 4MVZA 3LPZA 3ASNC 3FXHA 4U96D 4GTOA 2R7TA 4DUIA 4AOFA 1NP7A 4F7AA 4GTSA 3ZXPA 1Q0DA 3FHDA 2L0TB 2XLVA 3CK9A 3TOMA 4M3OA 3UX4A 3CVQA 2LAIA 3GZSA 4EZLA 1WM5A 3CVVA 3UKUG 3CQCB 4HLLA 1E2XA 2A5EA 2WXRA 3C18A 3V5ZA 2G3VA 1RXQA 4GEHA 5DBKA 2EPNA 1GS9A 2A68F 1VLTA 3L8IA 1FMVA 1EQ1A 3TWXA 3L13A 2X51A 1R5ID 4XI9A 2GW1A 4EBJA 4YT8A 2Q4FA 1H0AA 3MKQA 3SYNA 1EDUA 4XX5A 2EQXA 4UQXA 3AG3C 4MQ9F 5F28E 2VSYA 2J9BA 3B7BA 3MYVA 4U07A 5HKPA 3NYJA 4GYTA 2XRYA 1XZQA 5JLIA 4QDLA 2FEZA 3FP3A 5EIBE 3S90A 2CHZA 4D4XA 3EDTB 1JUQA 1A0BA 1ORJA 3AU4A 4GYYA 3QVYA 3APCA 5KYXA 1OCRE 3PVLA 3T6JA 5BXOA 3ZHEB 4Z68A 1GGQA 1E83A 2FO1E 2A69F 4AM9A 5JRAA 4DRXE 3OTNA 1K3ZD 4YT5A 1E8ZA 4KVOA 3JYHA 2HE0A 4GCOA 4L1BA 4HQDA 4UI9K 1H6KA 3ONKA 3NZSA 2HO1A 4MVRA 3DM5A 1OR3A 3EIQC 1UFBA 3HLZA 5A69A 4KNVA 1K04A 3U4TA 3SFZA 5A6BD 2J4DA 4A3TA 2XPYA 1ZU2A 3FTUA 3FVYA 2YL1A 1XGWA 2HJ3A 3G2TA 5T8IA 3ZIMA 2NSGA 3DXJF 3GZ2A 3HHMA 2P9NG 4JURI 4YVQC 1OUVA 3VRCA 3X2QC 3HXCA 3IKOB 4K5AB 2OEVA 1NA0A 5B1AC 3B13A 2PZIA 1ZHZA 1Q0KA 3ZTZA 4RD9A 3U8VA 4P9FA 3SZRA 2IOQA 1VB5A 4RLYA 3TJPA 3HIZA 3TOLA 4GTTA 5BUZA 4FJZA 2EPOA 4GA0A 1G3NB 3E70C 4D10C 3K1IA 2A5UA 3PDMP 2OVBA 2F22A 4LDKA 2C0LA 2J46A 3B29A 3O6XA 3FEXA 3EHMA 5BQIA 1H6PA 3B0VC 2I6HA 3FTSA 4BT8A 2NUTA 3R7CA 3S27A 1MZCA 3OAWA 4HOQA 5EX0A 2NPUA 3TAXA 4I9EA 2RKKA 2GRQB 3RQGA 3JSEO 2CGEA 1RW2A 1V55C 3KH2A 3EIJA 4JHKA 2OEWA 1HU3A 3SFXA 4PS3A 4ULWA 1J8MF 5FIOA 3BEHA 1N95A 5KYUB 4XLNF 4ANVA 3GYZA 1OW8A 3EG9A 1O5HA 4KVMA 3GEIA 3B7TA 2VCAA 1DCEA 2XPIA 4ATGA 4U5GA 4FJYA 1NG1A 3HDXA 4YVOA 5BT1A 3N71A 2J7PA 1B89A 3C5RA 5H7PA 4YT4A 1YDIA 1BR1A 3U8PA 1KNYA 4NTBA 2F8XK 4ZLDA 4XKCA 1JAFA 3TXNA 2Q7FA 1BD8A 3FUIA 3IEGA 3QNKA 4N3BA 1HE8A 2LSEA 4MS2A 4N3AA 5ENQD 5B1BC 1JPLA 3D9JA 4N39A 5KNHD 3ZRHA 3FUFA 2AVPA 4FX5A 2X0CA 4AIFA 4EBAG 4WWOA 2L6BA 3PNLB 1TWHA 4DVYP 3MYFA 3FMSA 3RJVA 3FEYA 4OVUA 1DOVA 1NFOA 1HG5A 4RBNA 1TFOB 1E7UA 3UINC 3LEWA 4KNWA 4PJMA 3ASOE 1PD1A 5DQZA 2HMZA 3LNMB 1OCCC 3ABKC 3NMKA 4JTAB 3ABME 1IHBA 1U3CA 4DI3A 3GM3A 3VTYA 3MA5A 3RVZA 1IW7F 4LNUD 3RRUA 3OA1A 1SYQA 3D9NA 1V54C 5FINA 2TMVP 3NZUA 4HFFB 2ZU6B 5ENRD 1R4TA 4APFA 4PJLA 1QQ3A 2XRHA 1JCQA 5AC5A 1Y6DA 1UG7A 4ZHBA 3FU0A 3LS1A 4JXTA 4QI0A 3DAGA 2MYSA 4HOUA 2YINA 5JJ7A 3S7JA 5EX3A 4HNAD 4UI9J 3SY2A 2ZXRA 1N0RA 2QC9A 2P1AA 3UT7A 1SQMA 4KBLA 1ELWA 2UUHA 4URKA 1AEPA 3ZQVA 2QFCA 1YAUO 2EILC 2XLOA 2G3KA 2R02A 4GA2A 1UOHA 2R7VA 2OU6A 1SZAA 3S2AA 2EPLX 4ABNA 1UG3A 2VSOE 4G8KA 2R7XA 4DOZA 1AVOB 3HNIA 3G50A 1QZ2A 4C0EA 1QYMA 4J0UA 4BG0A 2I1KA 3BU8A 2CNWA 5T3WA 1I5NA 1YCSB 2XM0A 1DNPA 1Y8MA 2L7AA 4J8FA 2VASA 2KW3C 3KKBA 4GA1A 1ZB1A 2PM7A 2EIME 4BY6A 3ASDA 1T5OA 1JOGA 3LESA 1QSPA 4O6NA 1OKKA 3IHUA 3AAAC 5JSLA 5J90A 2Y4TA 4C7OB 2D4UA 3U9MA 3CEQA 2YRFA 2AXVA 2KQ9A 2J8WA 2PX3A 2OOCA 1FT2A 3W9FA 3LCAA 1YJGA 2FULA 3DSWA 4H54A 4UI9C 3VYWA 4BJ5A 1W3BA 3W2WA 2VGXA 1OW6A 4H7YA 3DXMG 4OAVB 2Y0BG 4XI0A 4E6HA 4YDYA 1IQUA 5CCMA 2H6IA 2P9LG 3VF0A 4QFVA 1SF8A 2RD0A 2IO3C 1TEZA 2KCVA 4DRJB 4YJWA 1D8EA 5T3RA 1RCPA 2LIGA 4XQ1A 4YT2A 4DX1A 3I4RB 5JMND 2Q9CA 4K1OA 1OWOA 2NUPA 4J32B 4TV3A 1ZHTA 1T9KA 4CDAA 2IEJA 3AG1E 3UNGC 1YYXA 1RMVA 1IHGA 1H9TA 3B7UX 3PZ4A 3ASGA 2WL8A 2Y39A 4G78A 5DQTA 5COFA 4JJGA 2P9UG 3PZ1A 4MNDA 5AQ7A 3JXIA 4U8VD 5AQAA 3PEUB 1EA8A 2EIJE 3CHRA 3FTXA 4HFGA 4ULVA 5ENOD 3VLDA 4AJWA 5IY5E 3BRJA 1VLSA 1J8YF 1Z23A 2JEKA 2X6KA 3TL5A 4DX7D 4U5FE 3UIOC 1TJCA 1ZZPA 3DM9B 3TQOA 2WVOA 2ZXWC 3ABLC 3W8HA 4E17A 4DX2A 1H6OA 4GU5A 4OYSA 3S9OA 4OIQF 5LFAA 3MBGA 3QK0A 5A6JA 4G23A 4A2NB 3GORA 5COGA 1HX8A 1WTYA 3BG0B 3POVA 3ULQA 2Y69C 1TR2A 2UY1B 1Z3YA 4JA7A 3GEEA 1P5QA 2GRMA 2WVNA 2IONA 1N9AA 4J6IA 4FHKA 2EINC 3BQOA 4JCHA 4U5DE 1WGWA 1H6GA 1NFNA 3KS2A 4NRHB 5ANRA 3C3QA 3D9LA 3S0XA 2VB6A 2R9RB 2XM4A 2AWYA 5T4YA 4LEUA 4OINF 2WXOA 2ZD9A 5EHHA 3QWPA 3MV2B 5LCWC 2WZGA 3CSKA 4F1SA 3CVNA 3DKAA 2AWIA 1LS1A 2IO2C 2XGMA 2WMOA 2Q9BA 3ZWIA 1TNBA 3V2OA 2R7UA 1NL4A 1K40A 3ZFWA 2IJGX 4J7WA 4NQ0A 3C8GD 4U8HA 3W9GA 4JZAA 2J09A 4IGGA 3L0IA 3CV0A 4IULA 4O6MA 3UM3A 4BSZB 3LVQE 2YEVA 3W8IA 2VJ8A 4IN3B 5BQGA 2P9PG 3T4RA 1N4PA 4C3BA 4MVMA 2PQRA 4E7ZA 4DX6D 3D9OA 5BPPA 3O39A 2XL8A 5CRUA 2L6FA 3ATPA 3JZ0A 4CGVA 3B0PA 1JWFA 4K5CA 1G8XA 2GWWA 1U0BB 3PDNA 4M63A 3TXMA 4HORA 4MVQA 4GTQA 3NOGD 5KNGA 4LLCA 4G2VA 5DS6A 3E34A 5KBAA 2DYSE 2AVKA 1DOWA 1QVXA 4U5BE 3Q75A 4ME2A 3KPHA 3I4UA 3LAYA 2I15A 5E3AA 1GW6A 2XRZA 3ZYKA 1A17A 4CGWA 3FTYA 2XZDG 2IXOA 3IHYA 1Z6AA 4BFRA 4WNDA 3EUVA 3U3WA 2FI7A 4HRMB 3GZ1A 5C1DA 4HI9A 2NC9A 1E7VA 5D0QD 1M6TA 3ZGQA 3V31A 3J5PA 3R7RA 2WXLA 4A55A 1D1BA 1E84A 3OXLA 4CIHA 4HB5A 4ANUA 1A7VA 3K66A 2H7VC 4LNGA 3DE8A 4B8CB 3K33A 4L2LA 3NKDA 2J07A 5KJMA 1WG0A 4FA6A 3SBTB 2HMQA 3JXJA 2ETSA 5L0DA 3SD5A 4F1PA 2G62A 2P2CP 3P1UA 5A6BA 4APOA 3WG7C 3PS6A 2WB7A 3C98A 4NTFA 3DPYA 3PE3A 1VDYA 4B93B 2WXGA 1WATA 3CLJA 4K5BA 3UKRG 4IWBA 4EQFA 5AN8A 3L16A 3QKYA 4LSZE 3APDA 2OCCC 2P6VA 4E0HA 4GTMA 1OCZE 4A4AA 3IBEA 1MX2A 1SW6A 1DC2A 3RO3A 2MHKA 1G4US 4GPKA 3F6QA 4NCQA 1Z6TA 1KZPA 1D0ZA 3PEVB 5EYPF 4U95D 5ENNA 3AG4C 2A4ZA 4A63B 3SQVA 1E8WA 3CR3A 1E85A 3EU5A 3ESKA 1TWGA 2LUHA 3A11A 3APFA 1LE2A 1EPUA 3MJWA 2IOSA 4XLPF 3G2UA 3ASFA 1D9SA 5AQ9A 4G7OF 2Q7RA 3MZLB 1A7EA 2R7WA 1N4SA 3LVRE 5L3VA 1ZW3A 3LY7A 2V5QC 2EPKX 3ENEA 4FWVA 3EGXB 3EFOA 4HEAJ 1CPRA 3GODA 3C8GB 5D0OD 2VQ2A 3DSVA 5E33A 3PCVA 4MVSA 3GANA 1TN8A 3Q9UC 1Z3XA 3X2QE 4N6HA 1SMYF 1RKEB 1T6IA 5A6CA 4C48B 3L17A 3AQBA 3HKKA 1ORSC 1NFIE 4CYMD 5KYYA 3TWSA 2M4EA 1TNZA 2L6JA 3ITFA 3MLGA 3DI5A 2V8SE 2F8YA 2GA0A 4LACB 5L0FA 2NSZA 3B9QA 3ZG1A 4EUKB 1INZA 3JQ0A 3W2VA 1FCHA 3CZ6A 4NC3A 5L0CA 1M56C 4BESA 4J8DA 4MRUA 3SNHA 1QNFA 2WVQA 3NDBB 4I1MA 3J06A 4UWGA 4GTRA 5M72A 1OW7A 3S7DA 3DWWA 3RIPA 2FO7A 5LOZA 1PD0A 4KMOA 4I44A 3LJBA 4FAPB 3TJ5A 2WXHA 3TJ6A 2A0BA 4E0IA 5JHAA 2C03A 5E75A 3FUKA 5CECB 1KT1A 2XSEA 4AE4B 3FHEA 1LF8A 4TXQA 3GM1A 5BV0A 4XEKA 5BV1A 3CQGB 2CW0F 2UUIA 3KEAA 4O1OA 4N4WA 3LLKA 1N0QA 4BEPA 1TNYA 4JTDB 5CERB 1V74B 4CDNA 1Y6IA 5D2MC 2CHWA 5FQ4A 3NB2A 3ZVRA 1OCOC 3R9AB 3CHQA 4EBAA 1TNOA 2KCLA 3FWVA 4GYWA 4B94A 4F3VA 3Q4AB 1MNDA 5KYNA 2XQ0A 2JX0A 4Q94A 5CEDB 3ASHA 2X3MA 2H6FA 3DWLG 1IZMA 1E8YA 1YA9A 3HNKA 1CGME 1FR0A 3QDNA 3Q7FA 1DVPA 2YLGA 1AWCB 3ML9A 3A9CA 4K03A 1FVFA 4CZ2D 3RYLA 3AQCA 2HFIA 4YWQA 1C02A 4LCTA 1ZYRF 2MOWA 2BF0X 4O6YA 3OXGA 1XZPA 3PRZA 3RRNB 4I1OB 2WQHA 1L5JA 5LP0A 5FWQA 3ZTMA 3EJNA 3MCXA 4OAUC 4R32A 2KK1A 4MTOA 2KCKA 2CYDA 4WGYA 2J0XA 4CDYA 3FUNA 5FZQA 1HS6A 3L82A 1HXIA 5G04J 1Z7Qc 4U0UA 3F47A 4I9CA 3LLIA 2XXAB 1JMWA 4J30B 2FFHA 2YL0A 4BTAA 4RDAA 5C2YA 1H7IA 2Y3BA 1VYIA 2IF4A 3O10A 1MNEA 4KBQA 3ZW3A 1I4ZA 3F46A 3I5PA 3FOOA 4I6JA 2WXPA 4LDQA 4IAQA 2Q3TA 3MEKA 1VMAA 5JUAA 2XCBA 5D66A 3CQZA 5EILA 3UGPA 1H2TC 4PDXA 1KU2A 2ZXOA 2NSFA 5B3SE 2QYJA 2RG8A 3L22A 4DJAA 3LDZA 3GM2A 3LS8A 4U0SA 3WXXA 3PZ2A 4FHJA 4U5EE 2R7SA 4NIKA 3Q73A 3EZIA 3AG2E 2OKUA 3BG1B 3H2UA 5ARFA 4EWCA 3DD7A 1HW2A 4GTVA 2P9SG 3HVEA 4BJ1A 4UUCA 1U89A 2RSEB 1S05A 1Z5ZA 1PC2A 3U2MA 2ZISA 3QB2A 2YLIA 1BLXB 1RJ9A 5KWDA 1D0XA 1K1AA 1OCRC 3IQTA 2UWJG 2VSXE 2H7OA 3KYJA 4LDRA 2DIWA 3RRMB 4DI4A 3ZVVA 2QNLA 1APCA 2O9XA 4DJ9A 2MWQA 3O55A 5G04C 4B8AA 1NA3A 3EZHA 3NF1A 4U63A 4PACA 5HRYA 4EHMA 4AK9A 2E87A 3CVLA 4AXHA 1OWPA 1MX4A 4WNEA 3ZNGA 4CIPA 4LLEA 3EPVA 3B0UX 4GZ6A 4CS8C 3OWTA 1S63A 1QZXA 3FULA 3WAQA 2J49A 2IXPA 2RFMA 3ZYLA 1JWGA 4GAAA 1FMWA 4ER9A 3QVZA 2Q00A 3SGHA 2P61A 1LD8A 4JJFA 3HXFA 5AIJA 3AS5A 3TWUA 2DZNA 2LO6A 4MTGA 2YKZA 4Q5SF 2GRPB 1O5MA 2ZGGA 4FC8A 4AY5A 2HM8A 2XEHA 4HVBA 2L9JA 2HJMA 2B0HA 3K7DA 2XL4A 1TJFA 4AP2A 5HSWA 3EGDB 5DS5A 4PJNA 4F4BA 1OQCA 1PV3A 4KZCA 4V3IA 3FTVA 3RK6A 4N6CA 2LSUA 1MYOA 4XIFA 1HZ4A 2QUPA 2AU5A 4GZ3A 2NYJA 4JB8P 4CBEA 3NRHA 1JR8A 1BR2A 2XEVA 2YL7A 2OJED 2VCCA 4P29A 4WAFA 2HKVA 2OEXA 4N3CA 3TWWA 2XLDA 3ULEG 2WB2A 2XL6A 2JLBA 3NYMA 1YYJA 2VTBB 1VK5A 3HXBA 3LEOA 5DVWA 2IFUA 3L08A 3ZDLA 3CAXA 3CVPA 5KJLA 2WQ6A 3LUTB 3UMIA 3IQ5A 4CJGA 4XTKA 3S84A 5L0HA 2VC9A 5JJ6A 3SP1A 2CHXA 3ONLA 3CHOA 1U2VG 3Q5MA 3GW4A 4W9RA 2AJAA 4ATZD 4DLQA 1SVXA 4DVZA 1LD7A 1M57C 4MW3A 3CHPA 5ENPD 1LIHA 2XEEA 1FFHA 3VTXA 4BETA 1Z3IX 2EIKE 4IRUA 1UN8A 2GAQA 4ZFHA 3DXKG 3E30A 4WABA 5F5HA 1FNTc 2WM9A 2V26A 1NI1A 4N2SA 1OXJA 3FUEA 3K6BA 4GZDA 1IKND 3ASOC 1N52A 3TWRA 1OXKA 4ILIA 1E8XA 3ABMC 4EHPA 1D8DA 1N11A 3G2VA 5CRVA 1YVIA 2J7PD 1WY6A 2GDCA 3PMRA 3HTKC 4GZ5A 4XPWA 4DLOA 5EKQD 4B89A 1GM5A 4O6FA 4TXPA 1HH8A 2WZLA 4JHJA 3M4CA 5LCWJ 1HMOA 4B6IA 4C3EA 2CCYA 3ZHEA 4BSXA 2FGYA 2IY0C 3Q47B 2GGFA 4KYOB 4JHRA 4C0MA 4Q4ZF 2BKGA 2OG2A 5E3CA 4E18A 3MKQB 2PX0A 1N1CA 3RH3A 4L2YA 5J08A 3T5XA 1VYKA 2ETAA 3HNJA 4MVUA 5A6AA 3JUIA 1O3UA 1MMGA 1TKNA 4RSYA 3CGHA 5FZTA 2P7VA 3CSFA 5FQ6A 3RKVA 3JCUQ 4BX9A 4J7TA 3S29A 1A41A 3Q78A 3ZC4A 2V5FA 3T5VA 4XZ4A 3D3MA 5F5FA 2MHRA 3C63A 3E4BA 4NQFA 4O60A 3M1CB 1Y4CA 1H19A 5KYXB 1K8KG 2QE9A 4ANWA 3JUEA 4P9TA 4KT6B 5FTPA
chains in the Genus database with same CATH topology
3ZPJA 4BJTA 3N0TA 4GZCA 2R7RA 3ZIBA 2BUGA 4LRZA 2EIMC 2XPZA 3FTZA 4EBBA 4G0HA 4C9BB 2X6HA 5KYUA 4A1SA 3O48A 4DK5A 3KL4A 4FP7A 3TG4A 4Y6CA 5A7DB 5DLJA 3QZCA 3MX3A 2I2OA 2AW6A 2Y3AA 2JD3A 1MHQA 3LY8A 1ZU4A 3QAQA 3AS4A 3SHFA 1BR4A 4WNFA 3ZYMA 5D91A 3FU3A 3ML8A 4NY3A 4X0RA 1O87A 3OXFA 4I3MA 3AG1C 2PFDA 1HF8A 2WPVA 4JC8A 2OOEA 3RFYA 1IQRA 3QOUA 3EG9B 3KMIA 1SZ9A 2DGJA 2CG3A 1E96B 4GCNA 1D1AA 4W8KA 2VYIA 5IY5C 2OV8A 4JEHA 4K0DA 2XGOA 4PS8A 2Y4UA 2GFHA 4Q7CA 2WXNA 1Z63A 4I6EA 4BEJA 4AEZC 2YNQA 5FQ7A 4PK4A 2X6IA 4I2WA 2KZTB 4U5HA 1UW4B 3SF4A 4CT0A 5FT9A 5FZRA 5CI8A 2VGYA 3URZA 4I17A 2WVIA 3DJUB 5ANLA 2V3CC 3FH8A 4G11A 4H7XA 4U5CE 4CS9A 2E0IA 3QJZA 3KD7A 4K0RA 4QI2A 2KJGA 3D9KA 4MS6A 1NU9C 3SBSA 4G1TA 4EZJA 2L9BA 4CS8A 3AS8A 1ZHYA 1HO8A 3B7SA 4OD5A 4J8EA 4CT4A 1PCXA 1QQEA 5A23A 2KGOA 1XNFA 3LEVA 4C7OA 3UT4A 2E2EA 4KI2A 4O7GA 2PL2A 4CRWA 2FBNA 2DYSC 2KNHA 4WNGA 3S7FA 4CS7A 2WXFA 3NYLA 3RO2A 3R7QA 3UT8A 4J8SA 5FZSA 2A1DD 3FDHA 3TGOA 4G25A 2ZPAA 3EH2A 4XWJA 4EPZA 2XHEA 2J9QA 2J9VA 3HYMB 3CKCA 4TRQA 5LX8A 3PNTB 2XCCA 4WWPA 2IYLD 2I9CA 4UWFA 4DBRA 1M2VB 1UJKA 4RG6A 5HQ8A 2W45A 5AJLA 4R7LA 3I4GA 3KAEA 4HS2A 3ZN3A 3LXUX 2VGXB 3SEOA 3UMVA 1OWLA 1OCZC 3MV3B 4CEMA 4UQYA 2NUPB 1ST6A 4BWRA 2J9UA 1QLEC 3LYAA 4JEUA 4G7HF 3FUMA 3PE4A 2WXKA 2UY1A 5G55A 1KT0A 3CIAA 3UMKA 2BTDA 3RKOF 5DS4A 4FU3A 5HI7A 2YZSA 4G7ZF 4BT9A 3PUJA 4CSAC 4ACLA 1D0YA 4HOSA 3QMKA 1OWNA 2J45A 2X6FA 1H2VC 3IHVA 3SNXA 1ZU5A 5T3TA 4DBQA 4WUYA 3L54A 2C0MA 4N5CA 4PJJA 2D5RB 3FY4A 3UMHA 2QY9A 4BJ6C 2M63A 2Q9AA 1WAO1 4I2ZA 1PAQA 2YHSA 4L7TA 3ZXSA 3S7BA 5AJDA 2Y3DA 3UGOA 1MQSA 4P6IC 2ONDA 3UQ3A 3DMDA 4ANJA 4C3DA 4FLBA 3VLEA 1PY1A 3CVYA 2XGSA 3CVXA 5G05J 4ACKA 3G2WA 4Y6WA 4I1AA 2R17C 3RU0A 1JPNA 4A3VA 4BTBA 1HG2A 4HOTA 4OVVA 5JJTA 3UR3C 4GYOA 2IQCA 4AVXA 3LKUA 3X1OA 5JHBA 1X5BA 1LKXA 3CK8A 3LNRA 3S28A 5KYWB 4CS9C 4JPSA 4FLHA 3FDQA 5BW8C 3ZYQA 3CHSA 3ECSA 2KZTA 1D1CA 5CI9A 2HV6A 3QC1A 4F53A 2YHEA 3O4ZA 4RVBA 1ZHWA 1EF1C 2IOLA 4TUUA 3LY9A 2IXMA 3CHMA 4UWKA 1ZHXA 3MKRA 2W4MA 4AY6A 1FFTC 2FF4A 1ZBPA 4ZLCA 4OIPF 5G05C 4XE0A 4NURA 4YN0B 3PH0C 3QWVA 1W2WA 3NG1A 1KLXA 4RG9A 2ILRA 4E7SA 4ANXA 2WXQA 3EHNA 4FULA 3P2BA 3Q49B 1E90A 5BUOA 2J9WA 3K9IA 5CHEE 2W4BA 3PREA 1TWCA 4N06A 4LERA 4Q96A 1MMAA 4Q69A 3ZEFA 2YQ8A 3EGXA 2ZXPA 5D92A 5B3SC 2Y3HA 4KXKB 3L6AA 1FVHA 2YHCA 3FH7A 2WQ7A 4ILHB 3FTWA 4I43A 3AG2C 2I8BA 4KC9A 5CCLA 2R7QA 2Z15A 3PUKA 3D9MA 4O79A 1ELRA 2IXNA 3CVWA 3QARA 3NQPA 4IAOA 3RIBA 3D9PA 2NG1A 2LNIA 2HV7A 4PS7A 1ELKA 3EFOB 4IJJA 4JW1A 3JYSA 2R59A 4FESA 2A6EF 1M2VA 2CG2A 3LJ3A 4XKBA 2VH3A 3WODF 3FH5A 3L34A 2PM6A 5CMWA 2KATA 4HXIA 2OVFA 5CMYA 4G26A 3AU5A 5KYYB 2MRIA 4B0ZA 4AE4A 2HR2A 5FJYA 3SI5A 5KJKA 2WZFA 1MMDA 2AXUA 4MKTA 5T1DB 5EDSA 3EQLF 2X6JA 2IU1A 3CKBA 2CDQA 3N2ZB 3EH1A 2C04A 4JVSA 3U66A 4HE8D 4HFKB 3CSTA 4CDMA 3PZDA 2B0JA 3DAFA 3SZ7A 5FCLA 3E9VA 2AXZA 2J4BA 2NXPA 4JA9A 3TG5A 3CK7A 4IYPA 2CFZA 1TWAA 2LSVA 2PQNA 1H2UA 1NU7D 2KC7A 3Q15A 3K1IC 3I3NA 4NACA 4U04A 3G2SA 3Q7GA 4L23A 5DIZA 4CDRA 4KZ0A 2A6HF 3FUJA 4OIRF 3TD7A 4AV7A 2I1JA 3HJCA 3FUDA 3Q6NA 4LUNU 3KEZA 3ZSUA 4I6GA 4BX8A 4A1GA 2XXAA 3BEEA 2C2LA 3VLFA 1NZEA 4K7BA 3CVUA 4HLEA 3UPVA 5E76A 4WJ0A 2WXMA 3FU6A 1VOMA 2EIKC 4JL0A 3NKEA 3FU5A 4GB9A 1LVKA 2V0PA 4ILGA 2CNWD 4CSAA 4DPRA 4WWNA 4GMLA 1FTSA 3JCKC 2DBAA 2L0IA 5AYWD 2NUTB 4G24A 2P58C 3IEEA 3DZAA 4H4KC 5E2QA 4FADA 4PUCA 4CCAA 2LAHA 3T8MA 1OKKD 3DPDA 3QWWA 4BJ6A 3UUXA 1HFAA 3Q7LA 3JT1A 3Q6MA 5KYWA 2EIJC 3JRTA 1YA0A 5L3QA 1UN9A 3ESLA 2J08A 2L81A 3MGBA 2BE5F 3DJNB 2R7OA 2CFUA 2GRLA 3HVEB 3H65A 4PFOA 2QY7A 1RJ9B 3FAJA 1N54A 1IYGA 4GMJA 2R5SA 2HYZA 4OD4A 3DBSA 1UJJA 1NZNA 2W9YA 3EGDA 4UWHA 3PHF2 2J0WA 3U64A 3FFLA 3FUHA 3D9IA 4EZKA 3T6BA 3N24A 2WXIA 4OIOF 2WMNA 4E85A 3JSZA 4UWLA 2DCPA 5FQ8A 4N2QA 4U0ZA 3IV0A 2PF4E 4EECA 2QTVA 5ARGA 1JPJA 2VSNA 2Y3GA 1M2OA 4UQZA 5AENA 3B7RL 1S0PA 4PFPA 1U3DA 2VTBA 1BPOA 4JZYA 3JQ1A 4AX2A 2KM4A 2V4LA 4YNDA 5EGYA 2WXJA 3I5QA 2PP4A 1OWMA 1SZIA 3U9WA 3OEOA 5KJNA 3LS0A 3VAYA 2X38A 5KCMA 5BNWA 3K1HA 4BJ5C 4PH4B 3V7OA 2H7BA 4MLPA 1MMNA 5G2NA 1EYHA 2DYRC 1S7ZA 3LPZA 3ASNC 2R7TA 4AOFA 1NP7A 4F7AA 3FHDA 2L0TB 3CK9A 3UX4A 4M3OA 3CVQA 2LAIA 3GZSA 4EZLA 1WM5A 3CVVA 3CQCB 2WXRA 2G3VA 4GEHA 5DBKA 2A68F 1FMVA 3L13A 2X51A 4XI9A 2GW1A 4YT8A 1H0AA 3MKQA 3SYNA 1EDUA 4XX5A 2EQXA 4UQXA 3AG3C 4MQ9F 2VSYA 3MYVA 4U07A 3NYJA 4GYTA 2XRYA 4QDLA 2FEZA 3FP3A 2CHZA 3EDTB 1JUQA 3AU4A 4GYYA 3APCA 5KYXA 3PVLA 3T6JA 3ZHEB 2A69F 4AM9A 3OTNA 4YT5A 1E8ZA 4KVOA 3JYHA 4GCOA 4L1BA 4UI9K 1H6KA 3ONKA 3NZSA 2HO1A 3DM5A 3EIQC 3HLZA 4KNVA 3U4TA 3SFZA 2J4DA 4A3TA 2XPYA 1ZU2A 3FTUA 3FVYA 1XGWA 3ZIMA 3G2TA 5T8IA 3DXJF 3GZ2A 3HHMA 4YVQC 4JURI 1OUVA 3X2QC 3IKOB 1NA0A 5B1AC 3B13A 2PZIA 1ZHZA 4RD9A 3SZRA 2IOQA 3TJPA 3HIZA 5BUZA 4FJZA 4GA0A 3E70C 4D10C 2A5UA 2OVBA 2C0LA 2J46A 3O6XA 3FEXA 3EHMA 3B0VC 2I6HA 3FTSA 4BT8A 2NUTA 3S27A 3OAWA 4HOQA 5EX0A 3TAXA 4I9EA 2CGEA 1V55C 3KH2A 3EIJA 4JHKA 1HU3A 4PS3A 4ULWA 1J8MF 5KYUB 4XLNF 4ANVA 3GYZA 3EG9A 1O5HA 4KVMA 3B7TA 2XPIA 4ATGA 4U5GA 4FJYA 1NG1A 3HDXA 4YVOA 5BT1A 3N71A 2J7PA 1B89A 4YT4A 1BR1A 4ZLDA 4XKCA 3TXNA 2Q7FA 3FUIA 3IEGA 3QNKA 4N3BA 1HE8A 2LSEA 4N3AA 5B1BC 1JPLA 3D9JA 4N39A 3ZRHA 3FUFA 2AVPA 4FX5A 4AIFA 4EBAG 4WWOA 3PNLB 1TWHA 4DVYP 3RJVA 3FEYA 4OVUA 1HG5A 4RBNA 1E7UA 3LEWA 4KNWA 4PJMA 1PD1A 5DQZA 1OCCC 3ABKC 1U3CA 4DI3A 3VTYA 3MA5A 1IW7F 3RRUA 3OA1A 3D9NA 1V54C 3NZUA 4HFFB 2ZU6B 4APFA 4PJLA 2XRHA 3FU0A 3LS1A 4JXTA 4QI0A 3DAGA 2MYSA 4HOUA 2YINA 5JJ7A 3S7JA 5EX3A 4UI9J 2ZXRA 3UT7A 1SQMA 4KBLA 1ELWA 4URKA 2QFCA 2EILC 2G3KA 4GA2A 2R7VA 1SZAA 3S2AA 4ABNA 1UG3A 2VSOE 2R7XA 4DOZA 1QZ2A 4C0EA 4J0UA 4BG0A 2I1KA 2CNWA 5T3WA 1DNPA 1Y8MA 4J8FA 2VASA 2KW3C 3KKBA 4GA1A 2PM7A 4BY6A 3ASDA 3LESA 4O6NA 1OKKA 5J90A 2Y4TA 4C7OB 3CEQA 2AXVA 2KQ9A 2PX3A 3LCAA 2FULA 4UI9C 3VYWA 4BJ5A 1W3BA 3W2WA 2VGXA 4H7YA 4XI0A 4E6HA 1IQUA 5CCMA 4QFVA 1SF8A 2RD0A 1TEZA 2KCVA 5T3RA 4YJWA 4YT2A 3I4RB 2Q9CA 1OWOA 2NUPA 4J32B 4TV3A 1ZHTA 3UNGC 1IHGA 3B7UX 3ASGA 2WL8A 2Y39A 5DQTA 4JJGA 4MNDA 3PEUB 3CHRA 3FTXA 4HFGA 3VLDA 4AJWA 1Z23A 1J8YF 2JEKA 2X6KA 3TL5A 4U5FE 1TJCA 3DM9B 2WVOA 2ZXWC 3ABLC 3W8HA 4GU5A 4OYSA 4OIQF 5LFAA 3QK0A 4G23A 4A2NB 1HX8A 3BG0B 3POVA 3ULQA 2Y69C 1TR2A 2UY1B 1Z3YA 4JA7A 2IONA 1P5QA 2GRMA 2WVNA 4J6IA 4FHKA 2EINC 4JCHA 4U5DE 1WGWA 3KS2A 4NRHB 5ANRA 3D9LA 3S0XA 2VB6A 5T4YA 4LEUA 4OINF 2WXOA 5EHHA 3QWPA 3MV2B 5LCWC 2WZGA 3CSKA 4F1SA 3CVNA 2AWIA 1LS1A 2XGMA 2WMOA 2Q9BA 2R7UA 3ZFWA 2IJGX 4NQ0A 4U8HA 4JZAA 2J09A 3L0IA 3CV0A 4IULA 4O6MA 3LVQE 2YEVA 3W8IA 2VJ8A 4IN3B 3T4RA 4C3BA 2PQRA 4E7ZA 3D9OA 5BPPA 3O39A 4CGVA 3B0PA 1JWFA 1G8XA 3PDNA 4M63A 3TXMA 4HORA 4LLCA 4G2VA 5DS6A 4U5BE 4ME2A 3LAYA 3I4UA 5E3AA 1GW6A 2XRZA 3ZYKA 1A17A 4CGWA 3FTYA 3IHYA 2IXOA 1Z6AA 4BFRA 4WNDA 3U3WA 2FI7A 3GZ1A 5C1DA 2NC9A 1E7VA 5D0QD 3ZGQA 3R7RA 2WXLA 4A55A 1D1BA 3OXLA 4CIHA 4ANUA 3K66A 2H7VC 4B8CB 3K33A 4L2LA 3NKDA 2J07A 5KJMA 4FA6A 3SBTB 3SD5A 2G62A 3P1UA 4APOA 3WG7C 3PS6A 2WB7A 3C98A 3PE3A 1VDYA 2WXGA 3CLJA 4IWBA 4EQFA 3L16A 3QKYA 3APDA 2OCCC 2P6VA 3IBEA 3RO3A 2MHKA 4GPKA 1Z6TA 1D0ZA 3PEVB 5ENNA 3AG4C 2A4ZA 1E8WA 3CR3A 3ESKA 1TWGA 3APFA 1EPUA 3MJWA 2IOSA 4XLPF 3G2UA 3ASFA 4G7OF 3MZLB 2R7WA 3LVRE 5L3VA 3LY7A 3ENEA 4FWVA 3EGXB 3EFOA 4HEAJ 3GODA 5D0OD 2VQ2A 5E33A 3GANA 1Z3XA 1SMYF 5A6CA 3L17A 3AQBA 5KYYA 2M4EA 2L6JA 3ITFA 3MLGA 2V8SE 4LACB 2NSZA 3B9QA 3ZG1A 1INZA 3JQ0A 3W2VA 1FCHA 3CZ6A 1M56C 4J8DA 4MRUA 3SNHA 1QNFA 2WVQA 3NDBB 4I1MA 4UWGA 5M72A 3S7DA 3RIPA 2FO7A 5LOZA 1PD0A 4KMOA 4I44A 3LJBA 2WXHA 5JHAA 2C03A 5E75A 3FUKA 1KT1A 2XSEA 4AE4B 3FHEA 1LF8A 5BV0A 5BV1A 3CQGB 2CW0F 3LLKA 4CDNA 1Y6IA 2CHWA 5FQ4A 3ZVRA 1OCOC 3R9AB 3CHQA 4EBAA 2KCLA 3FWVA 4GYWA 4B94A 4F3VA 3Q4AB 1MNDA 5KYNA 2XQ0A 4Q94A 3ASHA 2X3MA 1IZMA 1E8YA 3QDNA 1DVPA 3ML9A 4K03A 1FVFA 3RYLA 3AQCA 4YWQA 4LCTA 1ZYRF 2MOWA 2BF0X 4O6YA 3OXGA 3PRZA 3RRNB 4I1OB 2WQHA 1L5JA 5LP0A 5FWQA 3EJNA 3MCXA 2KCKA 2J0XA 3FUNA 5FZQA 1HS6A 1HXIA 5G04J 4U0UA 3F47A 4I9CA 3LLIA 2XXAB 4J30B 2FFHA 4BTAA 4RDAA 5C2YA 2Y3BA 1VYIA 2IF4A 1MNEA 4KBQA 3ZW3A 3F46A 3I5PA 4I6JA 2WXPA 2Q3TA 3MEKA 1VMAA 2XCBA 3CQZA 3UGPA 1H2TC 4PDXA 1KU2A 2ZXOA 2RG8A 3L22A 4DJAA 3LDZA 3LS8A 4U0SA 3WXXA 4FHJA 4U5EE 2R7SA 3EZIA 3BG1B 5ARFA 4EWCA 3DD7A 3HVEA 4BJ1A 1Z5ZA 1PC2A 3QB2A 1RJ9A 1D0XA 1OCRC 2UWJG 2VSXE 2H7OA 2DIWA 3RRMB 4DI4A 3ZVVA 2O9XA 2MWQA 5G04C 4B8AA 1NA3A 3EZHA 3NF1A 4U63A 4AK9A 2E87A 3CVLA 4AXHA 1OWPA 4WNEA 4LLEA 3EPVA 3B0UX 4GZ6A 4CS8C 3OWTA 1QZXA 3FULA 2J49A 2IXPA 3ZYLA 1JWGA 4GAAA 1FMWA 3SGHA 4JJFA 5AIJA 3AS5A 2LO6A 4Q5SF 4FC8A 4AY5A 2HM8A 4HVBA 2L9JA 3K7DA 2XL4A 1TJFA 4AP2A 5HSWA 3EGDB 5DS5A 4PJNA 4F4BA 4KZCA 4V3IA 3FTVA 3RK6A 2LSUA 4XIFA 1HZ4A 4GZ3A 4CBEA 3NRHA 1BR2A 2XEVA 4P29A 4WAFA 4N3CA 2WB2A 2JLBA 3NYMA 2VTBB 1VK5A 2IFUA 5DVWA 3L08A 2WQ6A 3CVPA 5KJLA 3UMIA 4XTKA 5JJ6A 3SP1A 2CHXA 3ONLA 3CHOA 3Q5MA 3GW4A 4W9RA 4DLQA 4DVZA 1M57C 3CHPA 1FFHA 3VTXA 1Z3IX 4IRUA 1UN8A 5F5HA 2WM9A 2V26A 4N2SA 3FUEA 3K6BA 4GZDA 3ASOC 1N52A 4ILIA 1E8XA 3ABMC 3G2VA 2J7PD 1WY6A 3PMRA 3HTKC 4GZ5A 4DLOA 5EKQD 4B89A 4O6FA 1HH8A 2WZLA 4JHJA 5LCWJ 4B6IA 4C3EA 3ZHEA 4BSXA 2FGYA 3Q47B 2GGFA 4KYOB 4JHRA 4C0MA 4Q4ZF 2OG2A 5E3CA 3MKQB 2PX0A 1N1CA 3RH3A 4L2YA 5J08A 3T5XA 1VYKA 3JUIA 1MMGA 1TKNA 4RSYA 3CGHA 5FQ6A 2P7VA 3CSFA 3RKVA 4BX9A 3JCUQ 3S29A 3ZC4A 2V5FA 3T5VA 4XZ4A 3D3MA 5F5FA 3E4BA 3M1CB 1H19A 5KYXB 4ANWA 4KT6B 5FTPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IRU A;  4I1O B;  4I1M A;  4JW1 A;  4JVS A; 
#chains in the Genus database with same CATH topology
 3ZPJ A;  1YZA A;  4BJT A;  3N0T A;  2QLA A;  4GZC A;  2R7R A;  3ISM C;  2M64 A;  3ZIB A;  2BL2 A;  2BUG A;  1WAS A;  4LRZ A;  2EIM C;  2LK4 A;  2XPZ A;  3FTZ A;  5AAR A;  4EBB A;  4G0H A;  4JC7 A;  1HW1 A;  3GWN A;  1FPP A;  3WG7 E;  2PNN A;  4C9B B;  4N5Q A;  2X6H A;  4YK5 A;  2XEN A;  5KYU A;  4A1S A;  3O48 A;  4DK5 A;  3KL4 A;  4FP7 A;  3TG4 A;  2XS1 A;  4Y6C A;  5A7D B;  2OJQ A;  5DLJ A;  2VGE A;  3QZC A;  3MX3 A;  2I2O A;  2AW6 A;  3NBN B;  2Y3A A;  3T6G B;  1ZW2 A;  2YWA A;  2JD3 A;  5EID A;  3E33 A;  1MHQ A;  3LY8 A;  1ZU4 A;  3QAQ A;  3AS4 A;  3SHF A;  4GMR A;  1BR4 A;  3L9T A;  4WNF A;  3ZYM A;  2HZ8 A;  5D91 A;  3FU3 A;  3ML8 A;  2R05 A;  3M15 A;  3R9M A;  4NY3 A;  4X0R A;  1O87 A;  4U9E A;  1NLX A;  3OXF A;  1T6U A;  3U9J A;  4I3M A;  3AG1 C;  2PFD A;  1HF8 A;  2WPV A;  4JC8 A;  2OOE A;  3RFY A;  1IQR A;  2AP3 A;  3AOU A;  3QOU A;  2HSB A;  3EG9 B;  4LG6 A;  3KMI A;  4U9D A;  1SZ9 A;  2DYR E;  2DGJ A;  2CG3 A;  5AGF A;  1E96 B;  3ASN E;  4GCN A;  1D1A A;  4W8K A;  2VYI A;  5IY5 C;  3QTH A;  3C7J A;  2OV8 A;  4L6R A;  4JEH A;  4YDE A;  4K0D A;  2XGO A;  4PS8 A;  4J8Y A;  2Y4U A;  2GFH A;  4Q7C A;  2WXN A;  1Z63 A;  4I6E A;  4L9P A;  4BEJ A;  4AEZ C;  3QW1 A;  4Z9I A;  2YNQ A;  5FQ7 A;  1MX6 A;  3ULY A;  1ORY A;  4PK4 A;  3IQC A;  2X6I A;  4I2W A;  3UM0 A;  2KZT B;  4U5H A;  4DRI B;  1UW4 B;  1TFK B;  3SF4 A;  4CT0 A;  5FT9 A;  5FZR A;  4IAR A;  1ZVZ A;  3RF3 A;  2L6H A;  5CI8 A;  2VGY A;  3URZ A;  3L8J A;  3AG3 E;  4I17 A;  2WVI A;  3DJU B;  5ANL A;  3UTM A;  2V3C C;  3FH8 A;  3RW0 A;  4G11 A;  4H7X A;  4U5C E;  4CS9 A;  2E0I A;  3QJZ A;  3KD7 A;  5AQB A;  4K0R A;  4QI2 A;  3KSQ A;  2KJG A;  3D9K A;  4Z9J A;  4MS6 A;  1NU9 C;  5AAO A;  4MBG A;  3SBS A;  1KPS B;  2XLM A;  4G1T A;  4EZJ A;  2L9B A;  4CS8 A;  3EHR A;  1HMD A;  3AS8 A;  1ZHY A;  1HO8 A;  4JRZ A;  4RQI A;  1LM3 B;  3B7S A;  4OD5 A;  4J8E A;  4CT4 A;  3DEO A;  2LXM A;  3NMI A;  1PCX A;  1YLM A;  1QQE A;  3V79 K;  5CBN A;  2LXL A;  5A23 A;  3RVY A;  1NSG B;  2KGO A;  2V4H C;  3UXG A;  4W8P A;  1XNF A;  3TUL A;  3LEV A;  3E37 A;  4C7O A;  3C8Z A;  2E2E A;  3UT4 A;  5JVE A;  5HV9 A;  4KI2 A;  3U0C A;  3UIP C;  4O7G A;  2PL2 A;  3T9K A;  3TWQ A;  4CRW A;  2ETB A;  2FBN A;  1K1B A;  1N4Q A;  2DYS C;  1Q0M A;  5B1A E;  2KNH A;  4WNG A;  1LI5 A;  3S7F A;  4CS7 A;  2WXF A;  3NYL A;  3RO2 A;  1H9G A;  3R7Q A;  3UT8 A;  4J8S A;  5FZS A;  4G8L A;  2A1D D;  1F1M A;  3FDH A;  3TGO A;  4G25 A;  2ZPA A;  5GPG B;  3EH2 A;  4XWJ A;  3Q79 A;  3TK0 A;  4EPZ A;  5ITZ F;  2XHE A;  3H2V A;  3C3O A;  2J9Q A;  2J9V A;  3HYM B;  4X8Q A;  3CKC A;  4TRQ A;  3DSU A;  5LX8 A;  1QBQ A;  3PNT B;  3V5X A;  2XCC A;  1BZ4 A;  4WWP A;  1V55 E;  2IYL D;  2I9C A;  5L0I A;  4UWF A;  4DBR A;  1HY5 A;  1M2V B;  1UJK A;  4RG6 A;  5HQ8 A;  2W45 A;  5AJL A;  5BQH A;  4R7L A;  4M7C A;  2B6C A;  3I4G A;  3UM1 A;  3L1M A;  3KAE A;  4HS2 A;  2RD9 A;  3ZN3 A;  3T9O A;  3SO8 A;  3LXU X;  2VGX B;  5HS0 A;  3SEO A;  3SXZ A;  1WN0 A;  3UMV A;  3TWV A;  2Y1L E;  3Q7A A;  1OWL A;  3V5Y A;  1OCZ C;  4GPM A;  1C03 A;  1FAP B;  5JP7 A;  3MV3 B;  4CEM A;  4UQY A;  2NUP B;  1ST6 A;  4XEV A;  4YL3 A;  4BWR A;  1YYH A;  2J9U A;  5B1B E;  1OXB A;  1QLE C;  3LYA A;  4JEU A;  4G7H F;  2ZIR A;  3FUM A;  3PE4 A;  3JYY A;  2WXK A;  2UY1 A;  4YDW A;  2ICW G;  2ETC A;  5G55 A;  4J7Y A;  3GEH A;  1KT0 A;  3CIA A;  3UMK A;  2BTD A;  1LPE A;  4JIO A;  3LJN A;  3RKO F;  5DS4 A;  2LQG A;  4FU3 A;  2YZS A;  4G7Z F;  5HI7 A;  4BT9 A;  2KXP C;  1OCC E;  3PUJ A;  3ABK E;  4CSA C;  4ACL A;  1D0Y A;  4HOS A;  3HXD A;  1V54 E;  3QMK A;  4D4N A;  2DVW A;  1OWN A;  2J45 A;  2X6F A;  1H2V C;  3UM2 A;  3IHV A;  1A5E A;  3SNX A;  1ZU5 A;  3BUA A;  5T3T A;  4UDV A;  4DBQ A;  1BDJ B;  2JAB A;  4WUY A;  3L54 A;  5K0I A;  2C0M A;  4N5C A;  4PJJ A;  2D5R B;  3FY4 A;  3UMH A;  3IPM O;  2QY9 A;  4BJ6 C;  2M63 A;  2H8A A;  2Q9A A;  1CGN A;  1WAO 1;  2BED A;  1CPQ A;  4I2Z A;  1PAQ A;  2YHS A;  4L7T A;  3ZXS A;  3S7B A;  1BI7 B;  4AL1 A;  1TN6 A;  5AJD A;  2Y3D A;  3TWT A;  3UGO A;  1MQS A;  4P6I C;  4EKW A;  3GWL A;  2OND A;  4LNB A;  3UQ3 A;  2YQY A;  3DMD A;  1Z5S C;  2EIL E;  4ANJ A;  4C3D A;  5A6K A;  2XZT G;  4XPY A;  4FLB A;  2BKK B;  1OY3 D;  3VLE A;  1PY1 A;  3CVY A;  1X81 A;  2XGS A;  5EYL A;  3CVX A;  5G05 J;  2XLH A;  1T6Q A;  4ACK A;  3G2W A;  4Y6W A;  4WGZ A;  4MW8 A;  3SXK A;  5EK0 A;  4I1A A;  3RQF A;  3NMJ A;  2R17 C;  3RU0 A;  3T8K A;  1JPN A;  4A3V A;  4BTB A;  2HS5 A;  2AWC A;  1HG2 A;  4HOT A;  3B71 A;  4OVV A;  4XEF A;  5JJT A;  3UR3 C;  4GYO A;  2IQC A;  4AVX A;  3LKU A;  2XLE A;  3X1O A;  5JHB A;  2F37 A;  1X5B A;  1LKX A;  4XEI G;  3CK8 A;  3LNR A;  3S28 A;  2P9K G;  1L7C A;  5KYW B;  3PZ3 A;  4CS9 C;  3RSE G;  3DSS A;  4JPS A;  4DXW A;  4FLH A;  2DB4 A;  3FDQ A;  4O1P A;  5BW8 C;  3ZYQ A;  3CHS A;  3ECS A;  2KZT A;  2KYH A;  1D1C A;  5CI9 A;  5ENT D;  2HV6 A;  1YA7 O;  3QC1 A;  4F53 A;  2YHE A;  3FAP B;  1EKY A;  3O4Z A;  4RVB A;  4EIY A;  2XLW A;  2EPM X;  1ZHW A;  1EF1 C;  2IOL A;  3AJM A;  1OR2 A;  1KTM A;  4TUU A;  1U6H A;  3LY9 A;  3IQ6 A;  2IXM A;  2B0O E;  3CHM A;  4UWK A;  1ZHX A;  3MKR A;  2W4M A;  4AY6 A;  1FFT C;  2FF4 A;  1ZBP A;  4ZLC A;  4OIP F;  4HRL A;  5G05 C;  1WOL A;  4XE0 A;  4NUR A;  4YN0 B;  3PH0 C;  3QWV A;  1JRA A;  1Q0G A;  1W2W A;  3NG1 A;  1KLX A;  1QPU A;  3KSL A;  4RG9 A;  3RQE A;  5CEA A;  2ILR A;  2P9I G;  4E7S A;  4ANX A;  2WXQ A;  1AP7 A;  3EHN A;  5B3I A;  4U8Y D;  4FUL A;  4HI8 A;  3P2B A;  3AGU A;  3Q49 B;  1E90 A;  5BUO A;  4GQH A;  1WDY A;  2J9W A;  3K9I A;  5CHE E;  2W4B A;  1O1R A;  3PRE A;  1TWC A;  4MVO A;  4BER A;  4N06 A;  3SXM A;  4LER A;  4Q96 A;  1MMA A;  1YMP A;  3ZEF A;  4Q69 A;  3ZU7 B;  2GRR B;  2YQ8 A;  2ZXW E;  3ABL E;  3EGX A;  1YZC A;  1BI8 B;  2ZXP A;  5D92 A;  1L3P A;  2Y3H A;  3AGT A;  3C8G A;  5B3S C;  4KXK B;  4CJO A;  3L6A A;  1FVH A;  4HRN A;  2YHC A;  3FH7 A;  1TQG A;  5CBO A;  3DE9 A;  5CIV A;  1VTM P;  3JTL O;  2WQ7 A;  1RKE A;  4ILH B;  3FTW A;  4I43 A;  3AG2 C;  2I8B A;  3W4Y A;  4KC9 A;  2Y69 E;  5CCL A;  2R7Q A;  2Z15 A;  5BXU A;  3PUK A;  5AC4 A;  3D9M A;  1E86 A;  3ZKJ A;  4O79 A;  1ELR A;  1S64 A;  2P0N A;  2MYO A;  3SFY A;  2HSQ A;  2EIN E;  2IXN A;  3CVW A;  1BBH A;  3QAR A;  3VM6 A;  3NQP A;  4IAO A;  1HE1 A;  3EU9 A;  3RIB A;  3D9P A;  2NG1 A;  1G5Z A;  4NTA A;  2LNI A;  2HV7 A;  4PS7 A;  1GQA A;  3FOP A;  4CDV A;  1ELK A;  3EFO B;  4IJJ A;  4JW1 A;  3JYS A;  2R59 A;  2R03 A;  3DEP A;  4FES A;  2A6E F;  1M2V A;  3CEX A;  2CG2 A;  3LJ3 A;  1LS4 A;  4XKB A;  2VH3 A;  3IXE A;  3V30 A;  3WOD F;  1O1T A;  3FH5 A;  3L34 A;  2PM6 A;  4PR9 A;  5CMW A;  2KAT A;  2F0Y A;  4U7E B;  3J5Q B;  4HXI A;  2OVF A;  5CMY A;  4G26 A;  3AU5 A;  5KYY B;  3UI2 A;  2MRI A;  2IBF A;  3C3R A;  1DCQ A;  4B0Z A;  2KBX A;  4AE4 A;  2HR2 A;  5FJY A;  1AUE A;  3AJI A;  4DRH B;  2WZF A;  3SI5 A;  5KJK A;  1FT1 A;  1MMD A;  4BEM J;  3C72 A;  2R2L A;  1MQV A;  2AXU A;  4MKT A;  5T1D B;  5EDS A;  3EQL F;  4JE9 A;  1Q0F A;  2X6J A;  2IU1 A;  3CKB A;  4JD2 G;  2A0U A;  2CDQ A;  2H6G A;  4EBK A;  3N2Z B;  2YLD A;  3EH1 A;  2C04 A;  4JVS A;  3U66 A;  4HE8 D;  3U2L A;  4HFK B;  3CST A;  3MFN A;  3NAW A;  4CDM A;  3PZD A;  2B0J A;  3DAF A;  3SZ7 A;  5FCL A;  3E9V A;  2AXZ A;  2J4B A;  2NXP A;  4JA9 A;  3TG5 A;  3CK7 A;  2ZGD A;  2R25 A;  4IYP A;  1B68 A;  5L0G A;  2CFZ A;  1TWA A;  2LSV A;  2PQN A;  1H2U A;  1NU7 D;  1TNU A;  2KC7 A;  3Q15 A;  1XWJ A;  3K1I C;  3I3N A;  4NAC A;  2XS8 A;  2KSF A;  4U04 A;  3HNL A;  4JTC B;  3G2S A;  3Q7G A;  4XPX A;  4ONS A;  4L23 A;  5DIZ A;  1QKR A;  4CDR A;  4KZ0 A;  4F6R D;  1G4W R;  2A6H F;  3FUJ A;  4OIR F;  3TD7 A;  4AV7 A;  2I1J A;  3HJC A;  3FUD A;  3KYI A;  3Q6N A;  3ZQY A;  4LUN U;  2VCB A;  3KEZ A;  3ZSU A;  4I6G A;  2DI3 A;  4IB4 A;  2HUJ A;  4BX8 A;  3EHQ A;  4A1G A;  2XXA A;  4JKV A;  3BEE A;  2C2L A;  3VLF A;  1NZE A;  4K7B A;  4YL1 A;  4AL0 A;  3E32 A;  4TUM A;  3CVU A;  4CX9 A;  4HLE A;  3UPV A;  2YL3 A;  5E76 A;  1MJ0 A;  256B A;  4WJ0 A;  2QZA A;  1TR4 A;  2WXM A;  3U3F A;  3U5S A;  5ENS D;  2OCC E;  3FU6 A;  3DSX A;  4Z9H A;  2IM8 A;  1VOM A;  2EIK C;  3D9H A;  4JL0 A;  4JEB A;  3NKE A;  3FU5 A;  4GB9 A;  3G4X A;  1LVK A;  2JPU A;  3HG0 D;  5L0J A;  1Q2Z A;  2V0P A;  4ILG A;  2CNW D;  4CSA A;  4DPR A;  4WWN A;  3AG4 E;  2PBE A;  4GML A;  1FTS A;  4GTP A;  3JCK C;  2DBA A;  2L0I A;  5AYW D;  2NUT B;  1KZO A;  2YVK A;  4G24 A;  2P58 C;  1TYQ G;  3IEE A;  1OT8 A;  3DZA A;  4H4K C;  5E2Q A;  3V2X A;  4FAD A;  4PUC A;  1T01 A;  4CCA A;  1WWP A;  1CGO A;  2LAH A;  3T8M A;  1OKK D;  3DPD A;  3QWW A;  4BJ6 A;  3UUX A;  1HFA A;  3Q7L A;  4TXR A;  3HRA A;  3JT1 A;  3WHN A;  3Q6M A;  4YDO A;  5KYW A;  2L6G A;  2EIJ C;  2DWZ A;  3R2P A;  1LI7 A;  3JRT A;  1YA0 A;  2LP4 A;  3QW0 A;  3US6 A;  5L3Q A;  5JS5 A;  1UN9 A;  2QYU A;  3HXE A;  3ESL A;  2J08 A;  2PNO A;  1EI7 A;  3DST A;  2L81 A;  3MGB A;  1JCR A;  1N4R A;  1TN7 A;  2BE5 F;  3DJN B;  2R7O A;  2GRO B;  2CFU A;  2OQM A;  2GRL A;  3HVE B;  1S70 B;  3H65 A;  4PFO A;  2QY7 A;  4MTF A;  5JT4 A;  3DRA A;  1JCS A;  4DX5 D;  2LD6 A;  1RJ9 B;  3FAJ A;  1N54 A;  2H6H A;  2J8S D;  1IYG A;  4HBD A;  4GMJ A;  2LFD A;  2HYZ A;  2R5S A;  4OD4 A;  3DBS A;  1UJJ A;  1NZN A;  2LCH A;  2W9Y A;  3M79 A;  3SXY A;  2GRN B;  5JA4 D;  3EGD A;  2LFF A;  4UWH A;  3PHF 2;  2J0W A;  3U64 A;  2ASR A;  1SR2 A;  1RZ4 A;  3FFL A;  1RKC A;  3FUH A;  3D9I A;  4EZK A;  3T6B A;  3N24 A;  2WXI A;  4OIO F;  2WMN A;  1V4A A;  1LTX A;  4E85 A;  2FAP B;  3JSZ A;  4JEA A;  5COM A;  4UWL A;  2DCP A;  3G4Z A;  3NOC D;  4QQI A;  1O1S A;  5FQ8 A;  4N2Q A;  4U0Z A;  1NBB A;  1I4Y A;  3IV0 A;  2PF4 E;  1HE9 A;  4EEC A;  2QTV A;  5ARG A;  3U3B A;  1JPJ A;  1N94 A;  2VSN A;  2Y3G A;  2RFA A;  1M2O A;  4UQZ A;  5AEN A;  1LE4 A;  1SA5 A;  3B7R L;  3ZUV B;  1S0P A;  4PFP A;  1U3D A;  2VTB A;  3C62 A;  3JRM O;  5EN5 D;  1BPO A;  1SA4 A;  4JZY A;  4YL0 A;  3JQ1 A;  1YAR O;  4AX2 A;  2KM4 A;  2V4L A;  4YND A;  5EGY A;  2WXJ A;  1OCO E;  3RAU A;  3I5Q A;  2PP4 A;  4JCZ A;  2KC3 A;  1OWM A;  1BU9 A;  1SZI A;  3U9W A;  3OEO A;  2BC5 A;  5KJN A;  3LS0 A;  3B95 A;  3VAY A;  2X38 A;  5KCM A;  2DZO A;  5BNW A;  3Q9N C;  1C17 M;  1IXV A;  3K1H A;  4BJ5 C;  3M4B A;  4PH4 B;  3MYI A;  3V7O A;  4BPM A;  1A7D A;  5TJ5 E;  2H7B A;  4MLP A;  1MMN A;  1K05 A;  5G2N A;  1EYH A;  2DYR C;  1S7Z A;  4MVZ A;  3LPZ A;  3ASN C;  3FXH A;  4U96 D;  4GTO A;  2R7T A;  4DUI A;  4AOF A;  1NP7 A;  4F7A A;  4GTS A;  3ZXP A;  1Q0D A;  3FHD A;  2L0T B;  2XLV A;  3CK9 A;  3TOM A;  4M3O A;  3UX4 A;  3CVQ A;  2LAI A;  3GZS A;  4EZL A;  1WM5 A;  3CVV A;  3UKU G;  3CQC B;  4HLL A;  1E2X A;  2A5E A;  2WXR A;  3C18 A;  3V5Z A;  2G3V A;  1RXQ A;  4GEH A;  5DBK A;  2EPN A;  1GS9 A;  2A68 F;  1VLT A;  3L8I A;  1FMV A;  1EQ1 A;  3TWX A;  3L13 A;  2X51 A;  1R5I D;  4XI9 A;  2GW1 A;  4EBJ A;  4YT8 A;  2Q4F A;  1H0A A;  3MKQ A;  3SYN A;  1EDU A;  4XX5 A;  2EQX A;  4UQX A;  3AG3 C;  4MQ9 F;  5F28 E;  2VSY A;  2J9B A;  3B7B A;  3MYV A;  4U07 A;  5HKP A;  3NYJ A;  4GYT A;  2XRY A;  1XZQ A;  5JLI A;  4QDL A;  2FEZ A;  3FP3 A;  5EIB E;  3S90 A;  2CHZ A;  4D4X A;  3EDT B;  1JUQ A;  1A0B A;  1ORJ A;  3AU4 A;  4GYY A;  3QVY A;  3APC A;  5KYX A;  1OCR E;  3PVL A;  3T6J A;  5BXO A;  3ZHE B;  4Z68 A;  1GGQ A;  1E83 A;  2FO1 E;  2A69 F;  4AM9 A;  5JRA A;  4DRX E;  3OTN A;  1K3Z D;  4YT5 A;  1E8Z A;  4KVO A;  3JYH A;  2HE0 A;  4GCO A;  4L1B A;  4HQD A;  4UI9 K;  1H6K A;  3ONK A;  3NZS A;  2HO1 A;  4MVR A;  3DM5 A;  1OR3 A;  3EIQ C;  1UFB A;  3HLZ A;  5A69 A;  4KNV A;  1K04 A;  3U4T A;  3SFZ A;  5A6B D;  2J4D A;  4A3T A;  2XPY A;  1ZU2 A;  3FTU A;  3FVY A;  2YL1 A;  1XGW A;  2HJ3 A;  3G2T A;  5T8I A;  3ZIM A;  2NSG A;  3DXJ F;  3GZ2 A;  3HHM A;  2P9N G;  4JUR I;  4YVQ C;  1OUV A;  3VRC A;  3X2Q C;  3HXC A;  3IKO B;  4K5A B;  2OEV A;  1NA0 A;  5B1A C;  3B13 A;  2PZI A;  1ZHZ A;  1Q0K A;  3ZTZ A;  4RD9 A;  3U8V A;  4P9F A;  3SZR A;  2IOQ A;  1VB5 A;  4RLY A;  3TJP A;  3HIZ A;  3TOL A;  4GTT A;  5BUZ A;  4FJZ A;  2EPO A;  4GA0 A;  1G3N B;  3E70 C;  4D10 C;  3K1I A;  2A5U A;  3PDM P;  2OVB A;  2F22 A;  4LDK A;  2C0L A;  2J46 A;  3B29 A;  3O6X A;  3FEX A;  3EHM A;  5BQI A;  1H6P A;  3B0V C;  2I6H A;  3FTS A;  4BT8 A;  2NUT A;  3R7C A;  3S27 A;  1MZC A;  3OAW A;  4HOQ A;  5EX0 A;  2NPU A;  3TAX A;  4I9E A;  2RKK A;  2GRQ B;  3RQG A;  3JSE O;  2CGE A;  1RW2 A;  1V55 C;  3KH2 A;  3EIJ A;  4JHK A;  2OEW A;  1HU3 A;  3SFX A;  4PS3 A;  4ULW A;  1J8M F;  5FIO A;  3BEH A;  1N95 A;  5KYU B;  4XLN F;  4ANV A;  3GYZ A;  1OW8 A;  3EG9 A;  1O5H A;  4KVM A;  3GEI A;  3B7T A;  2VCA A;  1DCE A;  2XPI A;  4ATG A;  4U5G A;  4FJY A;  1NG1 A;  3HDX A;  4YVO A;  5BT1 A;  3N71 A;  2J7P A;  1B89 A;  3C5R A;  5H7P A;  4YT4 A;  1YDI A;  1BR1 A;  3U8P A;  1KNY A;  4NTB A;  2F8X K;  4ZLD A;  4XKC A;  1JAF A;  3TXN A;  2Q7F A;  1BD8 A;  3FUI A;  3IEG A;  3QNK A;  4N3B A;  1HE8 A;  2LSE A;  4MS2 A;  4N3A A;  5ENQ D;  5B1B C;  1JPL A;  3D9J A;  4N39 A;  5KNH D;  3ZRH A;  3FUF A;  2AVP A;  4FX5 A;  2X0C A;  4AIF A;  4EBA G;  4WWO A;  2L6B A;  3PNL B;  1TWH A;  4DVY P;  3MYF A;  3FMS A;  3RJV A;  3FEY A;  4OVU A;  1DOV A;  1NFO A;  1HG5 A;  4RBN A;  1TFO B;  1E7U A;  3UIN C;  3LEW A;  4KNW A;  4PJM A;  3ASO E;  1PD1 A;  5DQZ A;  2HMZ A;  3LNM B;  1OCC C;  3ABK C;  3NMK A;  4JTA B;  3ABM E;  1IHB A;  1U3C A;  4DI3 A;  3GM3 A;  3VTY A;  3MA5 A;  3RVZ A;  1IW7 F;  4LNU D;  3RRU A;  3OA1 A;  1SYQ A;  3D9N A;  1V54 C;  5FIN A;  2TMV P;  3NZU A;  4HFF B;  2ZU6 B;  5ENR D;  1R4T A;  4APF A;  4PJL A;  1QQ3 A;  2XRH A;  1JCQ A;  5AC5 A;  1Y6D A;  1UG7 A;  4ZHB A;  3FU0 A;  3LS1 A;  4JXT A;  4QI0 A;  3DAG A;  2MYS A;  4HOU A;  2YIN A;  5JJ7 A;  3S7J A;  5EX3 A;  4HNA D;  4UI9 J;  3SY2 A;  2ZXR A;  1N0R A;  2QC9 A;  2P1A A;  3UT7 A;  1SQM A;  4KBL A;  1ELW A;  2UUH A;  4URK A;  1AEP A;  3ZQV A;  2QFC A;  1YAU O;  2EIL C;  2XLO A;  2G3K A;  2R02 A;  4GA2 A;  1UOH A;  2R7V A;  2OU6 A;  1SZA A;  3S2A A;  2EPL X;  4ABN A;  1UG3 A;  2VSO E;  4G8K A;  2R7X A;  4DOZ A;  1AVO B;  3HNI A;  3G50 A;  1QZ2 A;  4C0E A;  1QYM A;  4J0U A;  4BG0 A;  2I1K A;  3BU8 A;  2CNW A;  5T3W A;  1I5N A;  1YCS B;  2XM0 A;  1DNP A;  1Y8M A;  2L7A A;  4J8F A;  2VAS A;  2KW3 C;  3KKB A;  4GA1 A;  1ZB1 A;  2PM7 A;  2EIM E;  4BY6 A;  3ASD A;  1T5O A;  1JOG A;  3LES A;  1QSP A;  4O6N A;  1OKK A;  3IHU A;  3AAA C;  5JSL A;  5J90 A;  2Y4T A;  4C7O B;  2D4U A;  3U9M A;  3CEQ A;  2YRF A;  2AXV A;  2KQ9 A;  2J8W A;  2PX3 A;  2OOC A;  1FT2 A;  3W9F A;  3LCA A;  1YJG A;  2FUL A;  3DSW A;  4H54 A;  4UI9 C;  3VYW A;  4BJ5 A;  1W3B A;  3W2W A;  2VGX A;  1OW6 A;  4H7Y A;  3DXM G;  4OAV B;  2Y0B G;  4XI0 A;  4E6H A;  4YDY A;  1IQU A;  5CCM A;  2H6I A;  2P9L G;  3VF0 A;  4QFV A;  1SF8 A;  2RD0 A;  2IO3 C;  1TEZ A;  2KCV A;  4DRJ B;  4YJW A;  1D8E A;  5T3R A;  1RCP A;  2LIG A;  4XQ1 A;  4YT2 A;  4DX1 A;  3I4R B;  5JMN D;  2Q9C A;  4K1O A;  1OWO A;  2NUP A;  4J32 B;  4TV3 A;  1ZHT A;  1T9K A;  4CDA A;  2IEJ A;  3AG1 E;  3UNG C;  1YYX A;  1RMV A;  1IHG A;  1H9T A;  3B7U X;  3PZ4 A;  3ASG A;  2WL8 A;  2Y39 A;  4G78 A;  5DQT A;  5COF A;  4JJG A;  2P9U G;  3PZ1 A;  4MND A;  5AQ7 A;  3JXI A;  4U8V D;  5AQA A;  3PEU B;  1EA8 A;  2EIJ E;  3CHR A;  3FTX A;  4HFG A;  4ULV A;  5ENO D;  3VLD A;  4AJW A;  5IY5 E;  3BRJ A;  1VLS A;  1J8Y F;  1Z23 A;  2JEK A;  2X6K A;  3TL5 A;  4DX7 D;  4U5F E;  3UIO C;  1TJC A;  1ZZP A;  3DM9 B;  3TQO A;  2WVO A;  2ZXW C;  3ABL C;  3W8H A;  4E17 A;  4DX2 A;  1H6O A;  4GU5 A;  4OYS A;  3S9O A;  4OIQ F;  5LFA A;  3MBG A;  3QK0 A;  5A6J A;  4G23 A;  4A2N B;  3GOR A;  5COG A;  1HX8 A;  1WTY A;  3BG0 B;  3POV A;  3ULQ A;  2Y69 C;  1TR2 A;  2UY1 B;  1Z3Y A;  4JA7 A;  3GEE A;  1P5Q A;  2GRM A;  2WVN A;  2ION A;  1N9A A;  4J6I A;  4FHK A;  2EIN C;  3BQO A;  4JCH A;  4U5D E;  1WGW A;  1H6G A;  1NFN A;  3KS2 A;  4NRH B;  5ANR A;  3C3Q A;  3D9L A;  3S0X A;  2VB6 A;  2R9R B;  2XM4 A;  2AWY A;  5T4Y A;  4LEU A;  4OIN F;  2WXO A;  2ZD9 A;  5EHH A;  3QWP A;  3MV2 B;  5LCW C;  2WZG A;  3CSK A;  4F1S A;  3CVN A;  3DKA A;  2AWI A;  1LS1 A;  2IO2 C;  2XGM A;  2WMO A;  2Q9B A;  3ZWI A;  1TNB A;  3V2O A;  2R7U A;  1NL4 A;  1K40 A;  3ZFW A;  2IJG X;  4J7W A;  4NQ0 A;  3C8G D;  4U8H A;  3W9G A;  4JZA A;  2J09 A;  4IGG A;  3L0I A;  3CV0 A;  4IUL A;  4O6M A;  3UM3 A;  4BSZ B;  3LVQ E;  2YEV A;  3W8I A;  2VJ8 A;  4IN3 B;  5BQG A;  2P9P G;  3T4R A;  1N4P A;  4C3B A;  4MVM A;  2PQR A;  4E7Z A;  4DX6 D;  3D9O A;  5BPP A;  3O39 A;  2XL8 A;  5CRU A;  2L6F A;  3ATP A;  3JZ0 A;  4CGV A;  3B0P A;  1JWF A;  4K5C A;  1G8X A;  2GWW A;  1U0B B;  3PDN A;  4M63 A;  3TXM A;  4HOR A;  4MVQ A;  4GTQ A;  3NOG D;  5KNG A;  4LLC A;  4G2V A;  5DS6 A;  3E34 A;  5KBA A;  2DYS E;  2AVK A;  1DOW A;  1QVX A;  4U5B E;  3Q75 A;  4ME2 A;  3KPH A;  3I4U A;  3LAY A;  2I15 A;  5E3A A;  1GW6 A;  2XRZ A;  3ZYK A;  1A17 A;  4CGW A;  3FTY A;  2XZD G;  2IXO A;  3IHY A;  1Z6A A;  4BFR A;  4WND A;  3EUV A;  3U3W A;  2FI7 A;  4HRM B;  3GZ1 A;  5C1D A;  4HI9 A;  2NC9 A;  1E7V A;  5D0Q D;  1M6T A;  3ZGQ A;  3V31 A;  3J5P A;  3R7R A;  2WXL A;  4A55 A;  1D1B A;  1E84 A;  3OXL A;  4CIH A;  4HB5 A;  4ANU A;  1A7V A;  3K66 A;  2H7V C;  4LNG A;  3DE8 A;  4B8C B;  3K33 A;  4L2L A;  3NKD A;  2J07 A;  5KJM A;  1WG0 A;  4FA6 A;  3SBT B;  2HMQ A;  3JXJ A;  2ETS A;  5L0D A;  3SD5 A;  4F1P A;  2G62 A;  2P2C P;  3P1U A;  5A6B A;  4APO A;  3WG7 C;  3PS6 A;  2WB7 A;  3C98 A;  4NTF A;  3DPY A;  3PE3 A;  1VDY A;  4B93 B;  2WXG A;  1WAT A;  3CLJ A;  4K5B A;  3UKR G;  4IWB A;  4EQF A;  5AN8 A;  3L16 A;  3QKY A;  4LSZ E;  3APD A;  2OCC C;  2P6V A;  4E0H A;  4GTM A;  1OCZ E;  4A4A A;  3IBE A;  1MX2 A;  1SW6 A;  1DC2 A;  3RO3 A;  2MHK A;  1G4U S;  4GPK A;  3F6Q A;  4NCQ A;  1Z6T A;  1KZP A;  1D0Z A;  3PEV B;  5EYP F;  4U95 D;  5ENN A;  3AG4 C;  2A4Z A;  4A63 B;  3SQV A;  1E8W A;  3CR3 A;  1E85 A;  3EU5 A;  3ESK A;  1TWG A;  2LUH A;  3A11 A;  3APF A;  1LE2 A;  1EPU A;  3MJW A;  2IOS A;  4XLP F;  3G2U A;  3ASF A;  1D9S A;  5AQ9 A;  4G7O F;  2Q7R A;  3MZL B;  1A7E A;  2R7W A;  1N4S A;  3LVR E;  5L3V A;  1ZW3 A;  3LY7 A;  2V5Q C;  2EPK X;  3ENE A;  4FWV A;  3EGX B;  3EFO A;  4HEA J;  1CPR A;  3GOD A;  3C8G B;  5D0O D;  2VQ2 A;  3DSV A;  5E33 A;  3PCV A;  4MVS A;  3GAN A;  1TN8 A;  3Q9U C;  1Z3X A;  3X2Q E;  4N6H A;  1SMY F;  1RKE B;  1T6I A;  5A6C A;  4C48 B;  3L17 A;  3AQB A;  3HKK A;  1ORS C;  1NFI E;  4CYM D;  5KYY A;  3TWS A;  2M4E A;  1TNZ A;  2L6J A;  3ITF A;  3MLG A;  3DI5 A;  2V8S E;  2F8Y A;  2GA0 A;  4LAC B;  5L0F A;  2NSZ A;  3B9Q A;  3ZG1 A;  4EUK B;  1INZ A;  3JQ0 A;  3W2V A;  1FCH A;  3CZ6 A;  4NC3 A;  5L0C A;  1M56 C;  4BES A;  4J8D A;  4MRU A;  3SNH A;  1QNF A;  2WVQ A;  3NDB B;  4I1M A;  3J06 A;  4UWG A;  4GTR A;  5M72 A;  1OW7 A;  3S7D A;  3DWW A;  3RIP A;  2FO7 A;  5LOZ A;  1PD0 A;  4KMO A;  4I44 A;  3LJB A;  4FAP B;  3TJ5 A;  2WXH A;  3TJ6 A;  2A0B A;  4E0I A;  5JHA A;  2C03 A;  5E75 A;  3FUK A;  5CEC B;  1KT1 A;  2XSE A;  4AE4 B;  3FHE A;  1LF8 A;  4TXQ A;  3GM1 A;  5BV0 A;  4XEK A;  5BV1 A;  3CQG B;  2CW0 F;  2UUI A;  3KEA A;  4O1O A;  4N4W A;  3LLK A;  1N0Q A;  4BEP A;  1TNY A;  4JTD B;  5CER B;  1V74 B;  4CDN A;  1Y6I A;  5D2M C;  2CHW A;  5FQ4 A;  3NB2 A;  3ZVR A;  1OCO C;  3R9A B;  3CHQ A;  4EBA A;  1TNO A;  2KCL A;  3FWV A;  4GYW A;  4B94 A;  4F3V A;  3Q4A B;  1MND A;  5KYN A;  2XQ0 A;  2JX0 A;  4Q94 A;  5CED B;  3ASH A;  2X3M A;  2H6F A;  3DWL G;  1IZM A;  1E8Y A;  1YA9 A;  3HNK A;  1CGM E;  1FR0 A;  3QDN A;  3Q7F A;  1DVP A;  2YLG A;  1AWC B;  3ML9 A;  3A9C A;  4K03 A;  1FVF A;  4CZ2 D;  3RYL A;  3AQC A;  2HFI A;  4YWQ A;  1C02 A;  4LCT A;  1ZYR F;  2MOW A;  2BF0 X;  4O6Y A;  3OXG A;  1XZP A;  3PRZ A;  3RRN B;  4I1O B;  2WQH A;  1L5J A;  5LP0 A;  5FWQ A;  3ZTM A;  3EJN A;  3MCX A;  4OAU C;  4R32 A;  2KK1 A;  4MTO A;  2KCK A;  2CYD A;  4WGY A;  2J0X A;  4CDY A;  3FUN A;  5FZQ A;  1HS6 A;  3L82 A;  1HXI A;  5G04 J;  1Z7Q c;  4U0U A;  3F47 A;  4I9C A;  3LLI A;  2XXA B;  1JMW A;  4J30 B;  2FFH A;  2YL0 A;  4BTA A;  4RDA A;  5C2Y A;  1H7I A;  2Y3B A;  1VYI A;  2IF4 A;  3O10 A;  1MNE A;  4KBQ A;  3ZW3 A;  1I4Z A;  3F46 A;  3I5P A;  3FOO A;  4I6J A;  2WXP A;  4LDQ A;  4IAQ A;  2Q3T A;  3MEK A;  1VMA A;  5JUA A;  2XCB A;  5D66 A;  3CQZ A;  5EIL A;  3UGP A;  1H2T C;  4PDX A;  1KU2 A;  2ZXO A;  2NSF A;  5B3S E;  2QYJ A;  2RG8 A;  3L22 A;  4DJA A;  3LDZ A;  3GM2 A;  3LS8 A;  4U0S A;  3WXX A;  3PZ2 A;  4FHJ A;  4U5E E;  2R7S A;  4NIK A;  3Q73 A;  3EZI A;  3AG2 E;  2OKU A;  3BG1 B;  3H2U A;  5ARF A;  4EWC A;  3DD7 A;  1HW2 A;  4GTV A;  2P9S G;  3HVE A;  4BJ1 A;  4UUC A;  1U89 A;  2RSE B;  1S05 A;  1Z5Z A;  1PC2 A;  3U2M A;  2ZIS A;  3QB2 A;  2YLI A;  1BLX B;  1RJ9 A;  5KWD A;  1D0X A;  1K1A A;  1OCR C;  3IQT A;  2UWJ G;  2VSX E;  2H7O A;  3KYJ A;  4LDR A;  2DIW A;  3RRM B;  4DI4 A;  3ZVV A;  2QNL A;  1APC A;  2O9X A;  4DJ9 A;  2MWQ A;  3O55 A;  5G04 C;  4B8A A;  1NA3 A;  3EZH A;  3NF1 A;  4U63 A;  4PAC A;  5HRY A;  4EHM A;  4AK9 A;  2E87 A;  3CVL A;  4AXH A;  1OWP A;  1MX4 A;  4WNE A;  3ZNG A;  4CIP A;  4LLE A;  3EPV A;  3B0U X;  4GZ6 A;  4CS8 C;  3OWT A;  1S63 A;  1QZX A;  3FUL A;  3WAQ A;  2J49 A;  2IXP A;  2RFM A;  3ZYL A;  1JWG A;  4GAA A;  1FMW A;  4ER9 A;  3QVZ A;  2Q00 A;  3SGH A;  2P61 A;  1LD8 A;  4JJF A;  3HXF A;  5AIJ A;  3AS5 A;  3TWU A;  2DZN A;  2LO6 A;  4MTG A;  2YKZ A;  4Q5S F;  2GRP B;  1O5M A;  2ZGG A;  4FC8 A;  4AY5 A;  2HM8 A;  2XEH A;  4HVB A;  2L9J A;  2HJM A;  2B0H A;  3K7D A;  2XL4 A;  1TJF A;  4AP2 A;  5HSW A;  3EGD B;  5DS5 A;  4PJN A;  4F4B A;  1OQC A;  1PV3 A;  4KZC A;  4V3I A;  3FTV A;  3RK6 A;  4N6C A;  2LSU A;  1MYO A;  4XIF A;  1HZ4 A;  2QUP A;  2AU5 A;  4GZ3 A;  2NYJ A;  4JB8 P;  4CBE A;  3NRH A;  1JR8 A;  1BR2 A;  2XEV A;  2YL7 A;  2OJE D;  2VCC A;  4P29 A;  4WAF A;  2HKV A;  2OEX A;  4N3C A;  3TWW A;  2XLD A;  3ULE G;  2WB2 A;  2XL6 A;  2JLB A;  3NYM A;  1YYJ A;  2VTB B;  1VK5 A;  3HXB A;  3LEO A;  5DVW A;  2IFU A;  3L08 A;  3ZDL A;  3CAX A;  3CVP A;  5KJL A;  2WQ6 A;  3LUT B;  3UMI A;  3IQ5 A;  4CJG A;  4XTK A;  3S84 A;  5L0H A;  2VC9 A;  5JJ6 A;  3SP1 A;  2CHX A;  3ONL A;  3CHO A;  1U2V G;  3Q5M A;  3GW4 A;  4W9R A;  2AJA A;  4ATZ D;  4DLQ A;  1SVX A;  4DVZ A;  1LD7 A;  1M57 C;  4MW3 A;  3CHP A;  5ENP D;  1LIH A;  2XEE A;  1FFH A;  3VTX A;  4BET A;  1Z3I X;  2EIK E;  4IRU A;  1UN8 A;  2GAQ A;  4ZFH A;  3DXK G;  3E30 A;  4WAB A;  5F5H A;  1FNT c;  2WM9 A;  2V26 A;  1NI1 A;  4N2S A;  1OXJ A;  3FUE A;  3K6B A;  4GZD A;  1IKN D;  3ASO C;  1N52 A;  3TWR A;  1OXK A;  4ILI A;  1E8X A;  3ABM C;  4EHP A;  1D8D A;  1N11 A;  3G2V A;  5CRV A;  1YVI A;  2J7P D;  1WY6 A;  2GDC A;  3PMR A;  3HTK C;  4GZ5 A;  4XPW A;  4DLO A;  5EKQ D;  4B89 A;  1GM5 A;  4O6F A;  4TXP A;  1HH8 A;  2WZL A;  4JHJ A;  3M4C A;  5LCW J;  1HMO A;  4B6I A;  4C3E A;  2CCY A;  3ZHE A;  4BSX A;  2FGY A;  2IY0 C;  3Q47 B;  2GGF A;  4KYO B;  4JHR A;  4C0M A;  4Q4Z F;  2BKG A;  2OG2 A;  5E3C A;  4E18 A;  3MKQ B;  2PX0 A;  1N1C A;  3RH3 A;  4L2Y A;  5J08 A;  3T5X A;  1VYK A;  2ETA A;  3HNJ A;  4MVU A;  5A6A A;  3JUI A;  1O3U A;  1MMG A;  1TKN A;  4RSY A;  3CGH A;  5FZT A;  2P7V A;  3CSF A;  5FQ6 A;  3RKV A;  3JCU Q;  4BX9 A;  4J7T A;  3S29 A;  1A41 A;  3Q78 A;  3ZC4 A;  2V5F A;  3T5V A;  4XZ4 A;  3D3M A;  5F5F A;  2MHR A;  3C63 A;  3E4B A;  4NQF A;  4O60 A;  3M1C B;  1Y4C A;  1H19 A;  5KYX B;  1K8K G;  2QE9 A;  4ANW A;  3JUE A;  4P9T A;  4KT6 B;  5FTP A; 
#chains in the Genus database with same CATH homology
 3ZPJ A;  4BJT A;  3N0T A;  4GZC A;  2R7R A;  3ZIB A;  2BUG A;  4LRZ A;  2EIM C;  2XPZ A;  3FTZ A;  4EBB A;  4G0H A;  4C9B B;  2X6H A;  5KYU A;  4A1S A;  3O48 A;  4DK5 A;  3KL4 A;  4FP7 A;  3TG4 A;  4Y6C A;  5A7D B;  5DLJ A;  3QZC A;  3MX3 A;  2I2O A;  2AW6 A;  2Y3A A;  2JD3 A;  1MHQ A;  3LY8 A;  1ZU4 A;  3QAQ A;  3AS4 A;  3SHF A;  1BR4 A;  4WNF A;  3ZYM A;  5D91 A;  3FU3 A;  3ML8 A;  4NY3 A;  4X0R A;  1O87 A;  3OXF A;  4I3M A;  3AG1 C;  2PFD A;  1HF8 A;  2WPV A;  4JC8 A;  2OOE A;  3RFY A;  1IQR A;  3QOU A;  3EG9 B;  3KMI A;  1SZ9 A;  2DGJ A;  2CG3 A;  1E96 B;  4GCN A;  1D1A A;  4W8K A;  2VYI A;  5IY5 C;  2OV8 A;  4JEH A;  4K0D A;  2XGO A;  4PS8 A;  2Y4U A;  2GFH A;  4Q7C A;  2WXN A;  1Z63 A;  4I6E A;  4BEJ A;  4AEZ C;  2YNQ A;  5FQ7 A;  4PK4 A;  2X6I A;  4I2W A;  2KZT B;  4U5H A;  1UW4 B;  3SF4 A;  4CT0 A;  5FT9 A;  5FZR A;  5CI8 A;  2VGY A;  3URZ A;  4I17 A;  2WVI A;  3DJU B;  5ANL A;  2V3C C;  3FH8 A;  4G11 A;  4H7X A;  4U5C E;  4CS9 A;  2E0I A;  3QJZ A;  3KD7 A;  4K0R A;  4QI2 A;  2KJG A;  3D9K A;  4MS6 A;  1NU9 C;  3SBS A;  4G1T A;  4EZJ A;  2L9B A;  4CS8 A;  3AS8 A;  1ZHY A;  1HO8 A;  3B7S A;  4OD5 A;  4J8E A;  4CT4 A;  1PCX A;  1QQE A;  5A23 A;  2KGO A;  1XNF A;  3LEV A;  4C7O A;  3UT4 A;  2E2E A;  4KI2 A;  4O7G A;  2PL2 A;  4CRW A;  2FBN A;  2DYS C;  2KNH A;  4WNG A;  3S7F A;  4CS7 A;  2WXF A;  3NYL A;  3RO2 A;  3R7Q A;  3UT8 A;  4J8S A;  5FZS A;  2A1D D;  3FDH A;  3TGO A;  4G25 A;  2ZPA A;  3EH2 A;  4XWJ A;  4EPZ A;  2XHE A;  2J9Q A;  2J9V A;  3HYM B;  3CKC A;  4TRQ A;  5LX8 A;  3PNT B;  2XCC A;  4WWP A;  2IYL D;  2I9C A;  4UWF A;  4DBR A;  1M2V B;  1UJK A;  4RG6 A;  5HQ8 A;  2W45 A;  5AJL A;  4R7L A;  3I4G A;  3KAE A;  4HS2 A;  3ZN3 A;  3LXU X;  2VGX B;  3SEO A;  3UMV A;  1OWL A;  1OCZ C;  3MV3 B;  4CEM A;  4UQY A;  2NUP B;  1ST6 A;  4BWR A;  2J9U A;  1QLE C;  3LYA A;  4JEU A;  4G7H F;  3FUM A;  3PE4 A;  2WXK A;  2UY1 A;  5G55 A;  1KT0 A;  3CIA A;  3UMK A;  2BTD A;  3RKO F;  5DS4 A;  4FU3 A;  5HI7 A;  2YZS A;  4G7Z F;  4BT9 A;  3PUJ A;  4CSA C;  4ACL A;  1D0Y A;  4HOS A;  3QMK A;  1OWN A;  2J45 A;  2X6F A;  1H2V C;  3IHV A;  3SNX A;  1ZU5 A;  5T3T A;  4DBQ A;  4WUY A;  3L54 A;  2C0M A;  4N5C A;  4PJJ A;  2D5R B;  3FY4 A;  3UMH A;  2QY9 A;  4BJ6 C;  2M63 A;  2Q9A A;  1WAO 1;  4I2Z A;  1PAQ A;  2YHS A;  4L7T A;  3ZXS A;  3S7B A;  5AJD A;  2Y3D A;  3UGO A;  1MQS A;  4P6I C;  2OND A;  3UQ3 A;  3DMD A;  4ANJ A;  4C3D A;  4FLB A;  3VLE A;  1PY1 A;  3CVY A;  2XGS A;  3CVX A;  5G05 J;  4ACK A;  3G2W A;  4Y6W A;  4I1A A;  2R17 C;  3RU0 A;  1JPN A;  4A3V A;  4BTB A;  1HG2 A;  4HOT A;  4OVV A;  5JJT A;  3UR3 C;  4GYO A;  2IQC A;  4AVX A;  3LKU A;  3X1O A;  5JHB A;  1X5B A;  1LKX A;  3CK8 A;  3LNR A;  3S28 A;  5KYW B;  4CS9 C;  4JPS A;  4FLH A;  3FDQ A;  5BW8 C;  3ZYQ A;  3CHS A;  3ECS A;  2KZT A;  1D1C A;  5CI9 A;  2HV6 A;  3QC1 A;  4F53 A;  2YHE A;  3O4Z A;  4RVB A;  1ZHW A;  1EF1 C;  2IOL A;  4TUU A;  3LY9 A;  2IXM A;  3CHM A;  4UWK A;  1ZHX A;  3MKR A;  2W4M A;  4AY6 A;  1FFT C;  2FF4 A;  1ZBP A;  4ZLC A;  4OIP F;  5G05 C;  4XE0 A;  4NUR A;  4YN0 B;  3PH0 C;  3QWV A;  1W2W A;  3NG1 A;  1KLX A;  4RG9 A;  2ILR A;  4E7S A;  4ANX A;  2WXQ A;  3EHN A;  4FUL A;  3P2B A;  3Q49 B;  1E90 A;  5BUO A;  2J9W A;  3K9I A;  5CHE E;  2W4B A;  3PRE A;  1TWC A;  4N06 A;  4LER A;  4Q96 A;  1MMA A;  4Q69 A;  3ZEF A;  2YQ8 A;  3EGX A;  2ZXP A;  5D92 A;  5B3S C;  2Y3H A;  4KXK B;  3L6A A;  1FVH A;  2YHC A;  3FH7 A;  2WQ7 A;  4ILH B;  3FTW A;  4I43 A;  3AG2 C;  2I8B A;  4KC9 A;  5CCL A;  2R7Q A;  2Z15 A;  3PUK A;  3D9M A;  4O79 A;  1ELR A;  2IXN A;  3CVW A;  3QAR A;  3NQP A;  4IAO A;  3RIB A;  3D9P A;  2NG1 A;  2LNI A;  2HV7 A;  4PS7 A;  1ELK A;  3EFO B;  4IJJ A;  4JW1 A;  3JYS A;  2R59 A;  4FES A;  2A6E F;  1M2V A;  2CG2 A;  3LJ3 A;  4XKB A;  2VH3 A;  3WOD F;  3FH5 A;  3L34 A;  2PM6 A;  5CMW A;  2KAT A;  4HXI A;  2OVF A;  5CMY A;  4G26 A;  3AU5 A;  5KYY B;  2MRI A;  4B0Z A;  4AE4 A;  2HR2 A;  5FJY A;  3SI5 A;  5KJK A;  2WZF A;  1MMD A;  2AXU A;  4MKT A;  5T1D B;  5EDS A;  3EQL F;  2X6J A;  2IU1 A;  3CKB A;  2CDQ A;  3N2Z B;  3EH1 A;  2C04 A;  4JVS A;  3U66 A;  4HE8 D;  4HFK B;  3CST A;  4CDM A;  3PZD A;  2B0J A;  3DAF A;  3SZ7 A;  5FCL A;  3E9V A;  2AXZ A;  2J4B A;  2NXP A;  4JA9 A;  3TG5 A;  3CK7 A;  4IYP A;  2CFZ A;  1TWA A;  2LSV A;  2PQN A;  1H2U A;  1NU7 D;  2KC7 A;  3Q15 A;  3K1I C;  3I3N A;  4NAC A;  4U04 A;  3G2S A;  3Q7G A;  4L23 A;  5DIZ A;  4CDR A;  4KZ0 A;  2A6H F;  3FUJ A;  4OIR F;  3TD7 A;  4AV7 A;  2I1J A;  3HJC A;  3FUD A;  3Q6N A;  4LUN U;  3KEZ A;  3ZSU A;  4I6G A;  4BX8 A;  4A1G A;  2XXA A;  3BEE A;  2C2L A;  3VLF A;  1NZE A;  4K7B A;  3CVU A;  4HLE A;  3UPV A;  5E76 A;  4WJ0 A;  2WXM A;  3FU6 A;  1VOM A;  2EIK C;  4JL0 A;  3NKE A;  3FU5 A;  4GB9 A;  1LVK A;  2V0P A;  4ILG A;  2CNW D;  4CSA A;  4DPR A;  4WWN A;  4GML A;  1FTS A;  3JCK C;  2DBA A;  2L0I A;  5AYW D;  2NUT B;  4G24 A;  2P58 C;  3IEE A;  3DZA A;  4H4K C;  5E2Q A;  4FAD A;  4PUC A;  4CCA A;  2LAH A;  3T8M A;  1OKK D;  3DPD A;  3QWW A;  4BJ6 A;  3UUX A;  1HFA A;  3Q7L A;  3JT1 A;  3Q6M A;  5KYW A;  2EIJ C;  3JRT A;  1YA0 A;  5L3Q A;  1UN9 A;  3ESL A;  2J08 A;  2L81 A;  3MGB A;  2BE5 F;  3DJN B;  2R7O A;  2CFU A;  2GRL A;  3HVE B;  3H65 A;  4PFO A;  2QY7 A;  1RJ9 B;  3FAJ A;  1N54 A;  1IYG A;  4GMJ A;  2R5S A;  2HYZ A;  4OD4 A;  3DBS A;  1UJJ A;  1NZN A;  2W9Y A;  3EGD A;  4UWH A;  3PHF 2;  2J0W A;  3U64 A;  3FFL A;  3FUH A;  3D9I A;  4EZK A;  3T6B A;  3N24 A;  2WXI A;  4OIO F;  2WMN A;  4E85 A;  3JSZ A;  4UWL A;  2DCP A;  5FQ8 A;  4N2Q A;  4U0Z A;  3IV0 A;  2PF4 E;  4EEC A;  2QTV A;  5ARG A;  1JPJ A;  2VSN A;  2Y3G A;  1M2O A;  4UQZ A;  5AEN A;  3B7R L;  1S0P A;  4PFP A;  1U3D A;  2VTB A;  1BPO A;  4JZY A;  3JQ1 A;  4AX2 A;  2KM4 A;  2V4L A;  4YND A;  5EGY A;  2WXJ A;  3I5Q A;  2PP4 A;  1OWM A;  1SZI A;  3U9W A;  3OEO A;  5KJN A;  3LS0 A;  3VAY A;  2X38 A;  5KCM A;  5BNW A;  3K1H A;  4BJ5 C;  4PH4 B;  3V7O A;  2H7B A;  4MLP A;  1MMN A;  5G2N A;  1EYH A;  2DYR C;  1S7Z A;  3LPZ A;  3ASN C;  2R7T A;  4AOF A;  1NP7 A;  4F7A A;  3FHD A;  2L0T B;  3CK9 A;  3UX4 A;  4M3O A;  3CVQ A;  2LAI A;  3GZS A;  4EZL A;  1WM5 A;  3CVV A;  3CQC B;  2WXR A;  2G3V A;  4GEH A;  5DBK A;  2A68 F;  1FMV A;  3L13 A;  2X51 A;  4XI9 A;  2GW1 A;  4YT8 A;  1H0A A;  3MKQ A;  3SYN A;  1EDU A;  4XX5 A;  2EQX A;  4UQX A;  3AG3 C;  4MQ9 F;  2VSY A;  3MYV A;  4U07 A;  3NYJ A;  4GYT A;  2XRY A;  4QDL A;  2FEZ A;  3FP3 A;  2CHZ A;  3EDT B;  1JUQ A;  3AU4 A;  4GYY A;  3APC A;  5KYX A;  3PVL A;  3T6J A;  3ZHE B;  2A69 F;  4AM9 A;  3OTN A;  4YT5 A;  1E8Z A;  4KVO A;  3JYH A;  4GCO A;  4L1B A;  4UI9 K;  1H6K A;  3ONK A;  3NZS A;  2HO1 A;  3DM5 A;  3EIQ C;  3HLZ A;  4KNV A;  3U4T A;  3SFZ A;  2J4D A;  4A3T A;  2XPY A;  1ZU2 A;  3FTU A;  3FVY A;  1XGW A;  3ZIM A;  3G2T A;  5T8I A;  3DXJ F;  3GZ2 A;  3HHM A;  4YVQ C;  4JUR I;  1OUV A;  3X2Q C;  3IKO B;  1NA0 A;  5B1A C;  3B13 A;  2PZI A;  1ZHZ A;  4RD9 A;  3SZR A;  2IOQ A;  3TJP A;  3HIZ A;  5BUZ A;  4FJZ A;  4GA0 A;  3E70 C;  4D10 C;  2A5U A;  2OVB A;  2C0L A;  2J46 A;  3O6X A;  3FEX A;  3EHM A;  3B0V C;  2I6H A;  3FTS A;  4BT8 A;  2NUT A;  3S27 A;  3OAW A;  4HOQ A;  5EX0 A;  3TAX A;  4I9E A;  2CGE A;  1V55 C;  3KH2 A;  3EIJ A;  4JHK A;  1HU3 A;  4PS3 A;  4ULW A;  1J8M F;  5KYU B;  4XLN F;  4ANV A;  3GYZ A;  3EG9 A;  1O5H A;  4KVM A;  3B7T A;  2XPI A;  4ATG A;  4U5G A;  4FJY A;  1NG1 A;  3HDX A;  4YVO A;  5BT1 A;  3N71 A;  2J7P A;  1B89 A;  4YT4 A;  1BR1 A;  4ZLD A;  4XKC A;  3TXN A;  2Q7F A;  3FUI A;  3IEG A;  3QNK A;  4N3B A;  1HE8 A;  2LSE A;  4N3A A;  5B1B C;  1JPL A;  3D9J A;  4N39 A;  3ZRH A;  3FUF A;  2AVP A;  4FX5 A;  4AIF A;  4EBA G;  4WWO A;  3PNL B;  1TWH A;  4DVY P;  3RJV A;  3FEY A;  4OVU A;  1HG5 A;  4RBN A;  1E7U A;  3LEW A;  4KNW A;  4PJM A;  1PD1 A;  5DQZ A;  1OCC C;  3ABK C;  1U3C A;  4DI3 A;  3VTY A;  3MA5 A;  1IW7 F;  3RRU A;  3OA1 A;  3D9N A;  1V54 C;  3NZU A;  4HFF B;  2ZU6 B;  4APF A;  4PJL A;  2XRH A;  3FU0 A;  3LS1 A;  4JXT A;  4QI0 A;  3DAG A;  2MYS A;  4HOU A;  2YIN A;  5JJ7 A;  3S7J A;  5EX3 A;  4UI9 J;  2ZXR A;  3UT7 A;  1SQM A;  4KBL A;  1ELW A;  4URK A;  2QFC A;  2EIL C;  2G3K A;  4GA2 A;  2R7V A;  1SZA A;  3S2A A;  4ABN A;  1UG3 A;  2VSO E;  2R7X A;  4DOZ A;  1QZ2 A;  4C0E A;  4J0U A;  4BG0 A;  2I1K A;  2CNW A;  5T3W A;  1DNP A;  1Y8M A;  4J8F A;  2VAS A;  2KW3 C;  3KKB A;  4GA1 A;  2PM7 A;  4BY6 A;  3ASD A;  3LES A;  4O6N A;  1OKK A;  5J90 A;  2Y4T A;  4C7O B;  3CEQ A;  2AXV A;  2KQ9 A;  2PX3 A;  3LCA A;  2FUL A;  4UI9 C;  3VYW A;  4BJ5 A;  1W3B A;  3W2W A;  2VGX A;  4H7Y A;  4XI0 A;  4E6H A;  1IQU A;  5CCM A;  4QFV A;  1SF8 A;  2RD0 A;  1TEZ A;  2KCV A;  5T3R A;  4YJW A;  4YT2 A;  3I4R B;  2Q9C A;  1OWO A;  2NUP A;  4J32 B;  4TV3 A;  1ZHT A;  3UNG C;  1IHG A;  3B7U X;  3ASG A;  2WL8 A;  2Y39 A;  5DQT A;  4JJG A;  4MND A;  3PEU B;  3CHR A;  3FTX A;  4HFG A;  3VLD A;  4AJW A;  1Z23 A;  1J8Y F;  2JEK A;  2X6K A;  3TL5 A;  4U5F E;  1TJC A;  3DM9 B;  2WVO A;  2ZXW C;  3ABL C;  3W8H A;  4GU5 A;  4OYS A;  4OIQ F;  5LFA A;  3QK0 A;  4G23 A;  4A2N B;  1HX8 A;  3BG0 B;  3POV A;  3ULQ A;  2Y69 C;  1TR2 A;  2UY1 B;  1Z3Y A;  4JA7 A;  2ION A;  1P5Q A;  2GRM A;  2WVN A;  4J6I A;  4FHK A;  2EIN C;  4JCH A;  4U5D E;  1WGW A;  3KS2 A;  4NRH B;  5ANR A;  3D9L A;  3S0X A;  2VB6 A;  5T4Y A;  4LEU A;  4OIN F;  2WXO A;  5EHH A;  3QWP A;  3MV2 B;  5LCW C;  2WZG A;  3CSK A;  4F1S A;  3CVN A;  2AWI A;  1LS1 A;  2XGM A;  2WMO A;  2Q9B A;  2R7U A;  3ZFW A;  2IJG X;  4NQ0 A;  4U8H A;  4JZA A;  2J09 A;  3L0I A;  3CV0 A;  4IUL A;  4O6M A;  3LVQ E;  2YEV A;  3W8I A;  2VJ8 A;  4IN3 B;  3T4R A;  4C3B A;  2PQR A;  4E7Z A;  3D9O A;  5BPP A;  3O39 A;  4CGV A;  3B0P A;  1JWF A;  1G8X A;  3PDN A;  4M63 A;  3TXM A;  4HOR A;  4LLC A;  4G2V A;  5DS6 A;  4U5B E;  4ME2 A;  3LAY A;  3I4U A;  5E3A A;  1GW6 A;  2XRZ A;  3ZYK A;  1A17 A;  4CGW A;  3FTY A;  3IHY A;  2IXO A;  1Z6A A;  4BFR A;  4WND A;  3U3W A;  2FI7 A;  3GZ1 A;  5C1D A;  2NC9 A;  1E7V A;  5D0Q D;  3ZGQ A;  3R7R A;  2WXL A;  4A55 A;  1D1B A;  3OXL A;  4CIH A;  4ANU A;  3K66 A;  2H7V C;  4B8C B;  3K33 A;  4L2L A;  3NKD A;  2J07 A;  5KJM A;  4FA6 A;  3SBT B;  3SD5 A;  2G62 A;  3P1U A;  4APO A;  3WG7 C;  3PS6 A;  2WB7 A;  3C98 A;  3PE3 A;  1VDY A;  2WXG A;  3CLJ A;  4IWB A;  4EQF A;  3L16 A;  3QKY A;  3APD A;  2OCC C;  2P6V A;  3IBE A;  3RO3 A;  2MHK A;  4GPK A;  1Z6T A;  1D0Z A;  3PEV B;  5ENN A;  3AG4 C;  2A4Z A;  1E8W A;  3CR3 A;  3ESK A;  1TWG A;  3APF A;  1EPU A;  3MJW A;  2IOS A;  4XLP F;  3G2U A;  3ASF A;  4G7O F;  3MZL B;  2R7W A;  3LVR E;  5L3V A;  3LY7 A;  3ENE A;  4FWV A;  3EGX B;  3EFO A;  4HEA J;  3GOD A;  5D0O D;  2VQ2 A;  5E33 A;  3GAN A;  1Z3X A;  1SMY F;  5A6C A;  3L17 A;  3AQB A;  5KYY A;  2M4E A;  2L6J A;  3ITF A;  3MLG A;  2V8S E;  4LAC B;  2NSZ A;  3B9Q A;  3ZG1 A;  1INZ A;  3JQ0 A;  3W2V A;  1FCH A;  3CZ6 A;  1M56 C;  4J8D A;  4MRU A;  3SNH A;  1QNF A;  2WVQ A;  3NDB B;  4I1M A;  4UWG A;  5M72 A;  3S7D A;  3RIP A;  2FO7 A;  5LOZ A;  1PD0 A;  4KMO A;  4I44 A;  3LJB A;  2WXH A;  5JHA A;  2C03 A;  5E75 A;  3FUK A;  1KT1 A;  2XSE A;  4AE4 B;  3FHE A;  1LF8 A;  5BV0 A;  5BV1 A;  3CQG B;  2CW0 F;  3LLK A;  4CDN A;  1Y6I A;  2CHW A;  5FQ4 A;  3ZVR A;  1OCO C;  3R9A B;  3CHQ A;  4EBA A;  2KCL A;  3FWV A;  4GYW A;  4B94 A;  4F3V A;  3Q4A B;  1MND A;  5KYN A;  2XQ0 A;  4Q94 A;  3ASH A;  2X3M A;  1IZM A;  1E8Y A;  3QDN A;  1DVP A;  3ML9 A;  4K03 A;  1FVF A;  3RYL A;  3AQC A;  4YWQ A;  4LCT A;  1ZYR F;  2MOW A;  2BF0 X;  4O6Y A;  3OXG A;  3PRZ A;  3RRN B;  4I1O B;  2WQH A;  1L5J A;  5LP0 A;  5FWQ A;  3EJN A;  3MCX A;  2KCK A;  2J0X A;  3FUN A;  5FZQ A;  1HS6 A;  1HXI A;  5G04 J;  4U0U A;  3F47 A;  4I9C A;  3LLI A;  2XXA B;  4J30 B;  2FFH A;  4BTA A;  4RDA A;  5C2Y A;  2Y3B A;  1VYI A;  2IF4 A;  1MNE A;  4KBQ A;  3ZW3 A;  3F46 A;  3I5P A;  4I6J A;  2WXP A;  2Q3T A;  3MEK A;  1VMA A;  2XCB A;  3CQZ A;  3UGP A;  1H2T C;  4PDX A;  1KU2 A;  2ZXO A;  2RG8 A;  3L22 A;  4DJA A;  3LDZ A;  3LS8 A;  4U0S A;  3WXX A;  4FHJ A;  4U5E E;  2R7S A;  3EZI A;  3BG1 B;  5ARF A;  4EWC A;  3DD7 A;  3HVE A;  4BJ1 A;  1Z5Z A;  1PC2 A;  3QB2 A;  1RJ9 A;  1D0X A;  1OCR C;  2UWJ G;  2VSX E;  2H7O A;  2DIW A;  3RRM B;  4DI4 A;  3ZVV A;  2O9X A;  2MWQ A;  5G04 C;  4B8A A;  1NA3 A;  3EZH A;  3NF1 A;  4U63 A;  4AK9 A;  2E87 A;  3CVL A;  4AXH A;  1OWP A;  4WNE A;  4LLE A;  3EPV A;  3B0U X;  4GZ6 A;  4CS8 C;  3OWT A;  1QZX A;  3FUL A;  2J49 A;  2IXP A;  3ZYL A;  1JWG A;  4GAA A;  1FMW A;  3SGH A;  4JJF A;  5AIJ A;  3AS5 A;  2LO6 A;  4Q5S F;  4FC8 A;  4AY5 A;  2HM8 A;  4HVB A;  2L9J A;  3K7D A;  2XL4 A;  1TJF A;  4AP2 A;  5HSW A;  3EGD B;  5DS5 A;  4PJN A;  4F4B A;  4KZC A;  4V3I A;  3FTV A;  3RK6 A;  2LSU A;  4XIF A;  1HZ4 A;  4GZ3 A;  4CBE A;  3NRH A;  1BR2 A;  2XEV A;  4P29 A;  4WAF A;  4N3C A;  2WB2 A;  2JLB A;  3NYM A;  2VTB B;  1VK5 A;  2IFU A;  5DVW A;  3L08 A;  2WQ6 A;  3CVP A;  5KJL A;  3UMI A;  4XTK A;  5JJ6 A;  3SP1 A;  2CHX A;  3ONL A;  3CHO A;  3Q5M A;  3GW4 A;  4W9R A;  4DLQ A;  4DVZ A;  1M57 C;  3CHP A;  1FFH A;  3VTX A;  1Z3I X;  4IRU A;  1UN8 A;  5F5H A;  2WM9 A;  2V26 A;  4N2S A;  3FUE A;  3K6B A;  4GZD A;  3ASO C;  1N52 A;  4ILI A;  1E8X A;  3ABM C;  3G2V A;  2J7P D;  1WY6 A;  3PMR A;  3HTK C;  4GZ5 A;  4DLO A;  5EKQ D;  4B89 A;  4O6F A;  1HH8 A;  2WZL A;  4JHJ A;  5LCW J;  4B6I A;  4C3E A;  3ZHE A;  4BSX A;  2FGY A;  3Q47 B;  2GGF A;  4KYO B;  4JHR A;  4C0M A;  4Q4Z F;  2OG2 A;  5E3C A;  3MKQ B;  2PX0 A;  1N1C A;  3RH3 A;  4L2Y A;  5J08 A;  3T5X A;  1VYK A;  3JUI A;  1MMG A;  1TKN A;  4RSY A;  3CGH A;  5FQ6 A;  2P7V A;  3CSF A;  3RKV A;  4BX9 A;  3JCU Q;  3S29 A;  3ZC4 A;  2V5F A;  3T5V A;  4XZ4 A;  3D3M A;  5F5F A;  3E4B A;  3M1C B;  1H19 A;  5KYX B;  4ANW A;  4KT6 B;  5FTP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...