4IRUA

Crystal structure of lepb gap core in a transition state mimetic complex with rab1a and alf3
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
296
structure length
296
Chain Sequence
SLKPLTLLMTSSTSFSETINQWADILKTTDMEKFSFDSNPINLLELVKQFNLYVDELAITCEANNVWAKERIDSTPNLFALYDNSGGEAIHGHAFVPYYKESIVLRRLFTVDPNTFNLSRFAAFEGPCQLYCKEHKDSAWVKIQTLLTLGNGIINTLKIIKQAQAFGIDEAVTENLKALKEQFIAFQLAEADIKESLKAPSFAEPLPNKESEFFYPIDEKALAKMNGYQLATICLEELNSPKPSPLIERILSNKKFWKRINSAFESGVFKGRTDDPAGKIAKIREWHQLLQISGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase
molecule keywords LepB
publication title The Legionella pneumophila GTPase Activating Protein LepB Accelerates Rab1 Deactivation by a Non-canonical Hydrolytic Mechanism.
pubmed doi rcsb
source organism Legionella pneumophila
total genus 109
structure length 296
sequence length 296
chains with identical sequence C, E
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2013-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18172 LepB_GAP_N LepB GAP domain N-terminal subdomain
A PF18227 LepB_GAP_C LepB GAP domain C-terminal subdomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1700 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4iruA01
1.25.40.830 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4iruA02
4I1MA 4I1OB 4JVSA 4IRUA 4JW1A
chains in the Genus database with same CATH superfamily
2YL1A 2IXOA 3LJBA 3CLJA 3TQOA 3JCUQ 3UIOC 1SZIA 2WXLA 2EIME 3LUTB 2V5FA 2YINA 1ZHWA 1LPEA 5AC4A 5A6AA 3PEVB 1HG2A 3S28A 2Q7RA 4J8EA 4JA7A 5CCMA 2F37A 3J5QB 3QVZA 1O1RA 5ANRA 2CHXA 1D0ZA 2DCPA 2XS1A 2H6IA 1XZPA 4MTGA 4YL3A 5KYUB 1Z3YA 5A69A 4E17A 2KQ9A 4OD4A 3VF0A 2P9SG 2OVBA 3ASFA 5G2NA 1QVXA 4XEVA 2B0HA 1M2OA 2YVKA 3LJ3A 3Q15A 1K1BA 1XNFA 3ZDLA 3PUKA 4JVSA 4O6NA 1FR0A 5A23A 2ZXOA 4IAQA 3HLZA 3DSTA 4LNGA 4GMJA 4U8HA 2PX3A 3JSEO 5E3AA 2D4UA 2XLEA 2NUTB 2BKKB 2VGYA 4YL0A 3BEEA 1OCOE 5ENSD 5DS6A 4C0MA 1ZU5A 4BT8A 1IW7F 3RIBA 4MVZA 5KJLA 3HXCA 3CIAA 4DRHB 4I6JA 4JA9A 2VSYA 3K7DA 4B0ZA 5CHEE 4E85A 3PNLB 2KCVA 3ZYQA 4BERA 2AWCA 4Z9HA 4J7TA 4WABA 2Y3AA 2W4BA 4U0SA 4UWLA 1DCEA 3S9OA 3EHRA 4L6RA 3UMVA 3T6GB 1NFIE 3CHPA 3RFYA 3GEHA 1OXKA 2DYSE 4GMRA 4AE4B 1RZ4A 3U9JA 1TN6A 2B0OE 3EDTB 1O5MA 2OV8A 4EZKA 3IHUA 2R02A 2A6HF 3E70C 3QDNA 4CT4A 3HXDA 4I3MA 3PCVA 4UI9K 3DE9A 1TFKB 1Y4CA 4NURA 4EZJA 4WWPA 1CGNA 2XXAB 2KC3A 2YQ8A 1N94A 3MJWA 4GCOA 4FU3A 3APCA 4Q96A 4I44A 1TNUA 2OQMA 5ENTD 3US6A 3ML8A 1JPLA 5B3SC 1OXBA 1OXJA 5CEAA 3M79A 4CBEA 1C02A 4HS2A 4ZFHA 4HOUA 2YL7A 3QAQA 4A2NB 4E18A 4GZ6A 4U0UA 4BSXA 3FUHA 1GM5A 4HRLA 2KXPC 1SR2A 1H19A 2KCKA 4J7YA 4DK5A 4P9FA 4LDKA 3CSFA 4J6IA 2QYUA 4TXQA 5JUAA 2PBEA 4U96D 5JS5A 2AW6A 2M63A 3TG4A 3B0VC 4G11A 3ABKC 1BR1A 4NY3A 3NMKA 1A7DA 3RJVA 1QLEC 2NXPA 2XLDA 3IXEA 3PE4A 2WXKA 4XX5A 3CK7A 4MS2A 4HQDA 5BNWA 4LLCA 4G26A 2YKZA 4CT0A 2OVFA 4OVUA 1NP7A 3FU0A 1HU3A 1HH8A 2ETAA 4GA2A 1FFHA 3DZAA 2R7SA 4DPRA 2GWWA 3WG7C 1A5EA 3L22A 4TXPA 2P9LG 2R7UA 3ZQYA 4U9EA 3ABMC 2R7VA 1OWOA 4EECA 3EH1A 5EYPF 3S7JA 5KJKA 2FAPB 2EIKC 1D1BA 4DRIB 3JCKC 2Y39A 4O1PA 1B89A 1TYQG 3HG0D 4JURI 1VOMA 2DZOA 3ZUVB 5LCWJ 2UY1A 2IOSA 3CK8A 4W8KA 3S29A 1D0XA 4PR9A 2MOWA 5DLJA 4WGZA 5BV1A 1LS4A 3L1MA 3RKOF 2KATA 3GWNA 2WXOA 3AG2E 1NFOA 3FH8A 1TWHA 4ANWA 2LD6A 4AL1A 3FAJA 2AJAA 3UT4A 5CMWA 3C8GB 1KPSB 4ANVA 3AG1E 3ONLA 2P1AA 4GYWA 1JAFA 3ZXSA 4DOZA 2ZGGA 3PNTB 4Q69A 2XGOA 3KYJA 3V5YA 2WXGA 1W3BA 2VSNA 4GB9A 2GGFA 2PQNA 4DBRA 4KT6B 3QTHA 5DVWA 4JPSA 2J9WA 2XCBA 4PFPA 3AQBA 3RQFA 1Y8MA 2YHEA 1G3NB 1YYJA 2J45A 3LLKA 2XCCA 4JL0A 3LAYA 1YMPA 3FOPA 1UG3A 2XPZA 2L6FA 2R7XA 3Q75A 3DXKG 3ZTMA 2FULA 1U3DA 5ANLA 4Y6WA 3ZQVA 3U64A 1NFNA 4JC8A 5FINA 4KVOA 4RSYA 1T9KA 1D8EA 1LTXA 1H6OA 1M56C 4NRHB 3TG5A 3IV0A 2XZDG 3LEWA 4PS7A 2R9RB 1WATA 3PMRA 2IEJA 3PDNA 1S64A 4CDVA 3TK0A 1Z6AA 3SNHA 1KT1A 2E2EA 5DS4A 2DYRC 2J08A 3DM5A 3IQ5A 2QY9A 3PVLA 1NLXA 1UG7A 3ZU7B 3Q47B 1PD1A 3FUIA 3V2XA 1PC2A 3WHNA 2JX0A 5D91A 2VC9A 3TL5A 2DBAA 4FP7A 4LNUD 2J46A 4EBJA 3FDHA 4AP2A 2J8SD 1L7CA 4KI2A 2H7BA 1E8XA 3EQLF 3AJMA 3S7FA 4RBNA 3IPMO 1IXVA 5JA4D 4U5FE 4FJZA 5AQAA 3L08A 3LNRA 1ORYA 4GTMA 4UWFA 1OY3D 2YZSA 4C3BA 3BG1B 1M57C 3FUJA 3G50A 5LCWC 3DM9B 1C03A 4UI9C 1D1CA 2R2LA 2OJQA 4XI9A 1N4RA 1N4PA 3U8PA 5AYWD 3NKDA 4U0ZA 1N11A 1A7VA 4A3TA 2WXMA 4WWOA 1D0YA 1Y6DA 1DOVA 2Y69E 2P9NG 2VCBA 3PZ2A 3L6AA 3SBSA 4PJNA 3LS8A 2H7OA 4IB4A 3QWPA 4Z9JA 3W4YA 3B0UX 2HJ3A 2IBFA 3FUFA 1GQAA 3FHDA 1SVXA 1LI7A 1UOHA 4AV7A 5ENNA 1OCCC 1ZZPA 1A7EA 1PAQA 4AJWA 1VLSA 3B0PA 1OWLA 5EGYA 3UGOA 3EG9A 1WG0A 3S27A 5JVEA 1Q0FA 3VTYA 3WXXA 3EGDB 3SNXA 4WGYA 4BJTA 4YT8A 1K8KG 3SXZA 2FF4A 4I9EA 3UMIA 3B7TA 4PFOA 4N3BA 2DIWA 2J4BA 3LVRE 3TD7A 4N5QA 3ZYLA 3DEPA 5L3VA 3CVVA 1N9AA 2LXMA 3HXBA 4XLNF 2WQHA 3UMKA 3IEEA 1H0AA 4NC3A 1CPQA 2NPUA 4X0RA 1UJJA 1KT0A 3UUXA 3TJ5A 3ASOE 4LRZA 2IY0C 1SF8A 3RVZA 3LY7A 4ILHB 3EHQA 1Z3XA 4GTTA 2OKUA 1EDUA 3N2ZB 4AK9A 1HFAA 4NQ0A 3ZHEB 3TWUA 1VK5A 5BQHA 4LSZE 4G23A 3U9WA 4K5AB 4MLPA 3CAXA 1T6IA 4U5CE 4C7OA 1FMWA 1T5OA 2LFDA 2XPYA 3RIPA 3RRUA 2L7AA 3SFZA 3AOUA 3I4RB 3W8IA 5EN5D 1ZHXA 3T4RA 3FOOA 3U5SA 1YZCA 3CSTA 5D0OD 3IHVA 3QARA 4OD5A 4IN3B 4LNBA 1ZBPA 2L6BA 1HMOA 4JKVA 3AGUA 2AVKA 3ZN3A 2XEVA 1RKCA 3NOCD 1UJKA 3D9OA 1E85A 3I4UA 5EYLA 3U66A 1FT2A 4D10C 2GRNB 1V55E 2RFMA 3QB2A 3PH0C 4ULWA 2XHEA 1H7IA 4B93B 3RO2A 3ZGQA 3UKRG 4CSAC 2QY7A 1KTMA 5HI7A 3SGHA 3B95A 2NSFA 3HVEA 4PUCA 2HS5A 4GYOA 2NUPA 4B8CB 1IHGA 5ENPD 2QTVA 4XPYA 5CBOA 3AU4A 1SZ9A 2X6JA 4BEPA 1OWMA 2ZPAA 2C03A 2VCCA 4DX6D 2M4EA 3ULYA 4HLLA 4U7EB 1FAPB 3KKBA 4PJJA 2A0BA 4BT9A 5G05J 5T1DB 3CVPA 1QPUA 2KK1A 4Q94A 4HEAJ 4PJLA 3NMIA 2XEHA 2PQRA 4TXRA 4FJYA 4L7TA 4JC7A 3ASDA 1LS1A 2O9XA 4RD9A 2C04A 2V4LA 1E8WA 1M2VB 1FVHA 4MKTA 1RJ9A 2QLAA 4FLHA 5KJMA 2W4MA 4NTFA 3KS2A 2OEWA 2YNQA 4I9CA 4OIOF 2VQ2A 1VYKA 1HW2A 2A4ZA 2EQXA 2JD3A 4I43A 2HYZA 2E0IA 2DZNA 2R7OA 5AN8A 3C8GD 2AWIA 1U0BB 1T01A 3MBGA 1E86A 2R7WA 3CVLA 3PEUB 4CS7A 3TWVA 5BUOA 3P1UA 4YDYA 4U5BE 3UM0A 2XENA 4JJFA 1ORJA 3U3BA 4MQ9F 4BX8A 3MX3A 3QWWA 1TWAA 5B1AE 3CVWA 2Q3TA 2HUJA 4K0RA 3OXGA 3PZDA 1N4SA 2OOCA 1YA9A 1TR4A 3HYMB 3EGXA 3X1OA 1ZU2A 4N06A 4BJ6C 1N52A 1EYHA 3Q7LA 1O5HA 3WODF 3R9MA 3EJNA 2R17C 3EUVA 4IULA 2X38A 3UT7A 2FO7A 2HV6A 3JXIA 4G8LA 4EBBA 3TXMA 3AG4C 1PD0A 5F28E 3DBSA 4CS9A 2YRFA 4MVRA 5FZTA 4Q7CA 4CCAA 3Q4AB 1MJ0A 4K5BA 5KWDA 2WMOA 3G2SA 1QBQA 1JOGA 1LD8A 4NQFA 4L2YA 1MQVA 1MMGA 3HDXA 3Q7AA 3DI5A 2J7PA 1CGME 5TJ5E 3KYIA 3EH2A 3S90A 2P9KG 3AU5A 4WNFA 1ZW2A 4KVMA 1GGQA 2A5EA 3CHQA 2F8XK 1D1AA 1SA5A 3SI5A 3JRTA 2GAQA 3ZSUA 2NC9A 2GRMA 5LP0A 2PNNA 2JABA 4WNEA 3I5QA 4Q4ZF 4YWQA 4DX1A 4H54A 2H6GA 2XRZA 2L6HA 2R25A 3OWTA 5CRUA 1WDYA 3D9NA 2CW0F 5G05C 2XL8A 3JYYA 4DVZA 3RK6A 1DOWA 3JTLO 5EIDA 2X6IA 2V3CC 1Z5ZA 3LYAA 3SY2A 3FUMA 4K03A 4MS6A 4HFKB 3CHSA 3GODA 5A6BD 4GPMA 3SYNA 3EFOA 1OR3A 2LCHA 3FULA 4ONSA 3EU5A 4Z68A 2LIGA 4AL0A 3SZRA 1E8YA 3RO3A 5FJYA 2BTDA 1C17M 3R2PA 2EINC 5BQGA 3I3NA 5B1BC 3ML9A 4JIOA 4I6EA 2I1KA 4DJAA 4FHJA 3FP3A 3Q78A 3GEIA 3N71A 4IARA 1WGWA 4OAUC 2BE5F 4L23A 1HE9A 3PZ1A 3RSEG 3KSLA 3V31A 2J07A 4TRQA 2V0PA 4JZYA 3RAUA 3LLIA 1N54A 3HRAA 3VYWA 4FADA 5KYXA 2GDCA 4U8YD 1BDJB 1UFBA 4BPMA 4K5CA 4G1TA 3U4TA 1V74B 2PFDA 4G25A 4HORA 3VRCA 3EHNA 2A68F 4ZHBA 1K40A 1IYGA 4I1OB 4EIYA 1T6UA 4KBQA 4C3EA 2PM6A 3SBTB 5KYYB 1BBHA 2KZTB 5E76A 1X81A 4EZLA 2LO6A 3NAWA 1MMNA 4DJ9A 1KZOA 1I4YA 2QUPA 3KD7A 4A4AA 2DYSC 2AWYA 3JZ0A 3C63A 3MYFA 5JMND 4X8QA 1OWNA 5T3WA 3AS4A 4DI4A 3DAGA 2L0TB 3K33A 2YL0A 3ZIBA 3AJIA 4XEIG 3E37A 4U95D 4U04A 2ZXWC 3FTZA 3DSWA 4BSZB 3B29A 3ABLC 3FFLA 3CV0A 5BT1A 1Q0GA 1MHQA 2CHWA 1E2XA 2V5QC 2V26A 4O6MA 1UN8A 4OIQF 3OEOA 4AOFA 4G78A 5AARA 3DPDA 4BEJA 2YEVA 1NU9C 2H6HA 1MMDA 5AQ7A 1VDYA 3MV3B 3LS1A 3DXMG 3CVXA 1IKND 5B3SE 1KU2A 2B0JA 3O4ZA 2LXLA 1N1CA 1IHBA 4GYYA 5L0GA 5D2MC 3AS5A 1OKKA 2CGEA 3FUNA 4CDMA 1NI1A 2HMQA 2XGMA 4CDAA 4FC8A 4FWVA 4EBKA 3FTSA 3VLEA 1L3PA 1AEPA 3AAAC 4MTFA 3FHEA 4J8YA 3MKQA 2ILRA 5LFAA 2F22A 4CDYA 2NSGA 1O1SA 3ABKE 4N2SA 5E2QA 4JE9A 3V5ZA 2XLHA 5ARGA 4EPZA 2DGJA 3K1HA 4CS9C 3VLFA 3RU0A 4ATZD 4I6GA 3HTKC 4O60A 4U07A 2XGSA 4JHRA 4DX7D 1EF1C 1EPUA 3ITFA 1A17A 4EHMA 1AUEA 3D3MA 3HNKA 3NYMA 2WPVA 3ATPA 3DWWA 2Z15A 3EG9B 3B71A 2J9UA 3W9GA 4A1GA 2LUHA 3L8IA 1R4TA 2X51A 1QSPA 5J90A 5D0QD 3ABME 1GW6A 1E83A 4RDAA 1X5BA 2ZISA 1E90A 4H7YA 2J49A 1OCZC 3FUKA 2EIKE 4W8PA 3ASNC 3UNGC 1TNZA 5E33A 2Q00A 1HY5A 2GFHA 1D9SA 2UUHA 5DS5A 4HOSA 2IONA 2D5RB 1Q2ZA 4V3IA 2OG2A 3CGHA 3K9IA 2KW3C 3DPYA 1ZB1A 3E9VA 2ZXRA 2NG1A 2FGYA 4M7CA 1I5NA 1SMYF 2XLOA 2GRLA 4YNDA 2BC5A 1K1AA 1PY1A 1OCRE 4NACA 2V4HC 1HF8A 5J08A 1OR2A 2VCAA 3T8MA 4CRWA 1S70B 4C7OB 1TNBA 5COGA 1TJCA 4CSAA 1BD8A 5FQ4A 3DXJF 3CQCB 4JD2G 3CVYA 1I4ZA 1QQEA 4JTDB 4UQYA 1J8YF 3DE8A 2ONDA 2WZGA 3Q6MA 1VYIA 4F1SA 1TN8A 4GTSA 4CGWA 2WMNA 5T4YA 1H6GA 5L0FA 1Q0DA 4UUCA 2XL6A 2AXVA 3L8JA 2IFUA 3UQ3A 1HX8A 3UM1A 3UR3C 1WM5A 1HS6A 4ANJA 3H2VA 1DCQA 1SQMA 2L6GA 4QFVA 1ZHZA 2AXUA 3RQEA 3BQOA 4B6IA 1AWCB 3CHRA 3TWRA 3BRJA 4XPXA 1N95A 4ULVA 5IY5C 2XL4A 2X0CA 1G8XA 4RG6A 3GW4A 1S7ZA 3HVEB 3Q9UC 4E7SA 4ER9A 2NUPB 2ZD9A 1U2VG 4HRNA 1HMDA 3KL4A 3HXFA 5FZQA 3DMDA 4JRZA 1Q0MA 2KM4A 5C2YA 3CKBA 4Q5SF 3PE3A 2IOQA 3CR3A 4N6CA 2J4DA 1FMVA 1LE4A 3N0TA 3RKVA 1KNYA 1MZCA 2CFUA 2VGXB 2OEXA 3IBEA 3L9TA 3B7SA 3GM1A 4DLQA 1DVPA 3FU6A 4GZ3A 1Z6TA 2IQCA 3MYIA 3QMKA 1MNEA 3Q73A 2L0IA 2DYRE 1FNTc 4JCHA 2IOLA 4BTAA 2P58C 1WAO1 1EA8A 4MW3A 1YA0A 3L16A 4AVXA 3ENEA 3K6BA 4CYMD 1U89A 5EK0A 4CIPA 2XM0A 3G2WA 1EKYA 2UWJG 4XE0A 1FTSA 1RKEB 1BLXB 2OCCE 3Q9NC 2LP4A 4GZCA 1A0BA 2P2CP 4I17A 3CEQA 2C0MA 3UM3A 1OWPA 3K1IC 4J32B 3CQZA 3Q49B 4BJ6A 2WB2A 4GZ5A 1LKXA 1G4WR 1QYMA 1UN9A 2LQGA 3N24A 2CFZA 4D4XA 3LNMB 4OVVA 2I6HA 4J30B 4KXKB 5ENRD 1RXQA 3DAFA 3B7RL 4LEUA 3S7DA 1TEZA 1JMWA 4N5CA 1D8DA 5EILA 3BG0B 2MHRA 3LCAA 4NCQA 4KYOB 4HXIA 3NDBB 4AIFA 3APDA 1G4US 2H8AA 3RQGA 1EQ1A 2BEDA 3A9CA 3ASGA 3M15A 4LUNU 4O79A 3CZ6A 3NMJA 4YJWA 3ULQA 1JRAA 4BY6A 1K3ZD 4M63A 2F8YA 3OAWA 1S05A 2HJMA 3JYHA 5EX0A 1OCCE 4CEMA 1G5ZA 3DSXA 3MGBA 1AVOB 4UWGA 1SYQA 3U8VA 2TMVP 1YVIA 2H6FA 2PL2A 3C5RA 2WXNA 2BKGA 1ELRA 1GS9A 1QQ3A 1K04A 5HQ8A 4YN0B 3MYVA 3FTUA 4WNGA 4YT2A 3CHMA 3D9PA 3FEXA 3GZ1A 5EX3A 3JUIA 4TV3A 1ZHTA 4MRUA 4O6YA 1ORSC 4GCNA 3UGPA 5JSLA 5F5HA 2VTBA 3C72A 1E7VA 3DSVA 2R7RA 4J8FA 4KBLA 5CEDB 3AGTA 3MEKA 4ACKA 3C8GA 1MQSA 4UQZA 3ISMC 3NRHA 4HI9A 2XLWA 4U5HA 1HZ4A 5FQ6A 2PZIA 4LG6A 3ONKA 3UIPC 2ZGDA 4APOA 3GYZA 4GTQA 3TGOA 4UWHA 3GORA 1NA3A 3B13A 1TWGA 4HI8A 4J8SA 4DBQA 4ILGA 2Q4FA 1N0QA 2YLDA 2XZTG 1O3UA 1JR8A 3EFOB 2X6KA 3ZVRA 3V30A 2HM8A 2EIJC 2G3VA 2CYDA 4LLEA 4OIPF 4C9BB 4IJJA 5D92A 2AVPA 2NSZA 3F46A 1RW2A 2QYJA 5FT9A 3E32A 4YVOA 3CEXA 3EIJA 1E84A 4CZ2D 3L34A 1SA4A 3FTYA 4GQHA 2CG2A 4J7WA 2KNHA 3CVUA 4J8DA 2Y3DA 5EHHA 3S2AA 4ATGA 3DWLG 1VB5A 4CS8C 3UT8A 4DRJB 1U3CA 1WASA 3ZYKA 2LSVA 5L3QA 4BESA 1JWFA 2P9IG 2CHZA 4A1SA 3V79K 3FUDA 1W2WA 4ME2A 4Y6CA 1VLTA 2IM8A 3TWTA 4HOTA 5FQ8A 3GEEA 3ZC4A 5FWQA 1YLMA 5EKQD 1A41A 4I1MA 4DRXE 1LM3B 4CJOA 4C3DA 3QOUA 4A63B 4JTCB 3W8HA 2WM9A 4U9DA 3EU9A 4MVSA 1VTMP 4URKA 1YYHA 2GRPB 2CDQA 4XQ1A 2AXZA 5AJLA 1OT8A 3CK9A 3AG3C 1YARO 5HKPA 1RMVA 3G4XA 3DSSA 3HKKA 1IQUA 5H7PA 3ZTZA 4XKCA 2ASRA 4L2LA 4AEZC 4FULA 256BA 3TWWA 4MNDA 3HNIA 3D9JA 4XEKA 3L54A 2QFCA 1IZMA 1HW1A 2C0LA 5C1DA 5BXOA 2HV7A 3W9FA 3WAQA 4MTOA 3G2UA 3JQ1A 3X2QC 5A6BA 3TWQA 3S0XA 3CSKA 5JT4A 4O1OA 3PUJA 1JUQA 1TN7A 3KSQA 4DUIA 3V2OA 2J0WA 3NYLA 3QW1A 3QK0A 3OXLA 3HHMA 4RVBA 4XI0A 4MW8A 3KEZA 4F53A 2BF0X 3HXEA 1QNFA 3VM6A 4HVBA 1OQCA 1H2UA 1NZNA 2RD0A 3D9LA 1BU9A 3MV2B 1V54C 5CECB 5CI8A 5GPGB 3L17A 3R9AB 2P0NA 2Q9BA 3DRAA 2EILE 4GU5A 4DLOA 4OINF 3ZNGA 3FTXA 3M1CB 5KYNA 5CRVA 1NL4A 3B7BA 1QZ2A 1LF8A 4W9RA 3T8KA 4ANUA 5F5FA 3PZ4A 2ZXPA 3D9HA 5ITZF 3U9MA 2Y0BG 2XLVA 4GPKA 3F6QA 2R05A 1CGOA 1WTYA 5A6CA 2XS8A 3SF4A 4EBAA 2J9VA 1ELKA 5JHAA 1BZ4A 1DC2A 3MKQB 1H9TA 5DQTA 3G2TA 5AGFA 3LPZA 3H2UA 4FX5A 4TUUA 2XRYA 3LY8A 3R7QA 2J0XA 2IU1A 2HMZA 4I2ZA 2QC9A 3L82A 3CVNA 2XPIA 5T3RA 4YVQC 3ZVVA 2EIMC 4BJ1A 3M4CA 2EPMX 4AXHA 3NG1A 2HZ8A 1L5JA 3UKUG 3GM3A 2FBNA 1JCRA 2UY1B 4P9TA 4P6IC 3OXFA 3FMSA 1NSGB 3KH2A 5KYWA 2IO2C 3ZHEA 1PV3A 3HNLA 4J0UA 3FU5A 2JPUA 2XM4A 3MLGA 3JQ0A 1MX4A 3DJUB 1MNDA 3MKRA 3MA5A 5KJNA 3DEOA 2XEEA 3TULA 4JEBA 2IO3C 4WUYA 2CNWD 4YDOA 2DWZA 2WQ7A 1XWJA 4GTPA 5FQ7A 1S63A 2FO1E 2HO1A 3NQPA 3T9OA 3QC1A 3T6BA 4YL1A 1YJGA 2E87A 3FDQA 5D66A 1FVFA 4GYTA 3ZIMA 5CBNA 2V8SE 3IHYA 3EIQC 4ACLA 2QNLA 3SXYA 2IF4A 1MMAA 1OW6A 2W45A 4KZ0A 2Y3HA 4WJ0A 3U2MA 1OCOC 4BFRA 3FEYA 3V5XA 5E3CA 3MZLB 4B8AA 2EINE 1BI8B 5B1BE 4EUKB 4HE8D 2G3KA 5DBKA 1NU7D 4F4BA 3SQVA 3VLDA 1YA7O 5COMA 3SXKA 2I15A 2OOEA 5HS0A 3ZEFA 5AJDA 4WWNA 1BR4A 4IAOA 3ESLA 4G2VA 3EHMA 3CHOA 3KAEA 2ZIRA 1M6TA 4HLEA 3G4ZA 3S7BA 2YLGA 1FPPA 3Q6NA 4GTOA 1ZU4A 3SEOA 2BL2A 1UW4B 3PRZA 3LS0A 3CVQA 1H6KA 1M2VA 3LXUX 2VB6A 5K0IA 4IYPA 1J8MF 3Q7FA 3TXNA 4PK4A 2J7PD 3O48A 2XSEA 4AY6A 3O55A 3C3QA 4E6HA 3UI2A 3KMIA 4XEFA 4N2QA 2LSEA 1N0RA 1YZAA 3W2VA 1TNYA 2RD9A 2KYHA 3C62A 5EIBE 4Z9IA 3QZCA 4YK5A 3RVYA 4QDLA 1Q0KA 4F1PA 4QQIA 3BUAA 1TR2A 4N3AA 4TUMA 2M64A 5FZRA 2HFIA 3TJPA 3ZYMA 4BETA 4CX9A 3K1IA 4OAVB 5L0DA 4I1AA 3SXMA 2XQ0A 2ZXWE 5FCLA 3LJNA 3ESKA 2PM7A 3ABLE 2LFFA 5DIZA 1T6QA 5CMYA 3M4BA 4GEHA 3V7OA 3NKEA 3GZ2A 3DSUA 2YWAA 2P9UG 2MWQA 4FAPB 3GWLA 4HBDA 2Y3GA 4LDRA 3HIZA 2DI3A 2KC7A 2L9BA 4HFFB 5BQIA 4A3VA 3SZ7A 2HKVA 3HNJA 1HO8A 1Z5SC 4C0EA 5EDSA 4N4WA 3JYSA 3IQ6A 3CQGB 4JZAA 1HXIA 3APFA 2X6HA 5B3IA 5ENQD 5BW8C 3QVYA 3POVA 1LD7A 2A5UA 2A0UA 3QJZA 3Q79A 3FTVA 3NF1A 4YDWA 4EHPA 1JCSA 4FESA 2JLBA 2Q7FA 4JXTA 4IGGA 3VAYA 1E96B 1P5QA 4WNDA 2PF4E 2L6JA 3NBNB 4BJ5C 4JCZA 4DVYP 1B68A 1INZA 4JEHA 4DX5D 2FEZA 4KMOA 2H7VC 3O10A 1ST6A 4K0DA 4NTBA 1YDIA 3WG7E 4CDRA 3C8ZA 3IQTA 3W2WA 3ZWIA 2L9JA 5G04J 2C2LA 4HB5A 2KCLA 2WVQA 1NA0A 3E4BA 2I1JA 4E0HA 4C48B 3LESA 2YHCA 3EPVA 4AY5A 5L0JA 4UQXA 1Y6IA 3AG2C 1ZW3A 4QI0A 4XLPF 3QWVA 4MVMA 2ETBA 3SFXA 1N4QA 5ENOD 3LEOA 4GAAA 3JT1A 3GZSA 4IRUA 4CGVA 3RRMB 4UI9J 4CDNA 3AG1C 5E75A 3URZA 4GTVA 2WQ6A 2YQYA 5KYUA 1OCZE 5BUZA 4XWJA 3ASNE 4RLYA 2GRQB 1F1MA 1K05A 3RW0A 3F47A 3NYJA 2EPLX 4AX2A 2WXRA 3Q5MA 4U8VD 4JHKA 2VTBB 1OCRC 5LOZA 3RYLA 3SHFA 4XIFA 5A6KA 3UMHA 2J9BA 3JRMO 4XKBA 2GA0A 2NYJA 3PS6A 4U5DE 1VMAA 5KCMA 4YT5A 2IXPA 3TOLA 1PCXA 1BPOA 4ILIA 3MFNA 3ZXPA 4JHJA 3PHF2 2NUTA 3D9MA 2ICWG 4GZDA 4PS8A 4YT4A 4LDQA 4CS8A 2VJ8A 3JUEA 3NOGD 3LEVA 4K1OA 4JEUA 5CERB 4F7AA 4P29A 3ZRHA 3FH5A 3QW0A 3SO8A 3FU3A 1OKKD 1OW8A 3RRNB 3SFYA 2KSFA 2R7QA 3FAPB 3FTWA 2CG3A 3RH3A 4MBGA 5BV0A 3AQCA 1O87A 2AP3A 4M3OA 1XZQA 2AU5A 3ULEG 3ASHA 1MX2A 4GTRA 5L0CA 3T6JA 1QZXA 5KYYA 2KZTA 3NZUA 2HSQA 4EBAG 2VH3A 4JB8P 5DQZA 4E0IA 5LX8A 1OW7A 4D4NA 2ETCA 2I8BA 4R32A 5IY5E 2VYIA 1TKNA 4GA0A 3R7CA 4AE4A 1LIHA 5JP7A 2VGEA 2RSEB 4OIRF 2WZLA 1NZEA 2WB7A 5CCLA 4DXWA 4BTBA 3UTMA 1RJ9B 2RG8A 5L0IA 2XXAA 5FZSA 5T8IA 4R7LA 3FVYA 3ZG1A 3E34A 4G8KA 1H2VC 2RFAA 4UDVA 1MX6A 2RKKA 4LCTA 5KNGA 4A55A 1SW6A 3J06A 2F0YA 5HSWA 4XTKA 1E7UA 2MYOA 2OCCC 4O6FA 1XGWA 1H2TC 3K66A 2KBXA 5G04C 3CKCA 4ZLDA 2HE0A 2A69F 4YDEA 2YLIA 3GM2A 2R5SA 3TWXA 3H65A 4B89A 2OU6A 4ANXA 5HRYA 3T5VA 2EPKX 1IQRA 3TAXA 3U3FA 2VSOE 1WY6A 3VTXA 2Y69C 3I4GA 2G62A 1BI7B 2P61A 1TFOB 3IQCA 1H6PA 1AP7A 4K7BA 3QKYA 4E7ZA 3OTNA 1JCQA 4PDXA 4HOQA 3B9QA 3EGXB 3C3RA 2MYSA 4EWCA 3JXJA 1Z7Qc 3UPVA 2LSUA 1S0PA 4HRMB 3G2VA 3I5PA 2EPOA 3O39A 4HNAD 1JWGA 4ABNA 2IXNA 3PDMP 3O6XA 4NTAA 1APCA 5CI9A 4G7ZF 5JRAA 5FIOA 4BEMJ 1Z3IX 3C3OA 4WAFA 3R7RA 5KNHD 3LVQE 3ASOC 2J8WA 2KJGA 4PACA 4LERA 4GA1A 2GW1A 5CIVA 3D9KA 4PJMA 5ARFA 3ZW3A 1H9GA 4N39A 2WL8A 3TOMA 2Y4TA 2VSXE 3C7JA 1FCHA 4JTAB 4ZLCA 3ZFWA 3D9IA 1OUVA 3KPHA 4MVUA 5JLIA 4XPWA 3Q7GA 3TJ6A 4L9PA 2IXMA 4FHKA 2MRIA 4B94A 2R03A 4U5GA 4O7GA 4H4KC 1U6HA 3A11A 2WZFA 3C18A 1QKRA 1WOLA 4AM9A 3FXHA 5KYWB 2B6CA 3B7UX 1HE1A 2P9PG 5HV9A 5G55A 2Q9CA 2WVIA 1TQGA 2WXPA 1YAUO 2Y4UA 3DD7A 1FT1A 1HE8A 2J9QA 5JHBA 2XRHA 2CCYA 2FI7A 1FFTC 1DNPA 3NB2A 5L0HA 1V55C 2QZAA 3FWVA 3S84A 1MYOA 4F6RD 4BG0A 1JPNA 4N6HA 2WXJA 4F3VA 3L0IA 2WXFA 3U0CA 2DVWA 1EI7A 1ZYRF 4UWKA 1ZVZA 2Y1LE 1Z63A 2W9YA 4OYSA 1NG1A 1E8ZA 2MHKA 1JPJA 2EIJE 4PS3A 4QI2A 2IJGX 3OA1A 3U3WA 4RG9A 4EQFA 4IWBA 4G7OF 5A6JA 5KYXB 3QNKA 2R7TA 2LAHA 2L81A 4LACB 1HG5A 3MCXA 2UUIA 3PREA 3JSZA 4U63A 3HJCA 3BEHA 1WWPA 5BPPA 2I2OA 1R5ID 2Y3BA 5AQ9A 3ECSA 4L1BA 4XZ4A 2LK4A 2OJED 4PH4B 4BX9A 4GMLA 2WXIA 2PP4A 4CIHA 5AC5A 4RQIA 2PX0A 2VGXA 1Z23A 3LKUA 2A6EF 2WXQA 4EKWA 1LVKA 3T5XA 3EZIA 2VASA 3BU8A 2FFHA 5JJ7A 5AAOA 1KZPA 3ZPJA 4BWRA 4N3CA 3T9KA 2X6FA 5M72A 1KLXA 5COFA 5T3TA 3E33A 4I2WA 2Q9AA 2EPNA 2X3MA 4APFA 2HSBA 3AG3E 4JEAA 2J09A 2CNWA 2OEVA 2R59A 1WN0A 2YL3A 3RF3A 3ZKJA 3FH7A 4MVOA 1RKEA 1SZAA 2XLMA 2LAIA 5B1AC 2DB4A 2YHSA 3UM2A 4KNWA 4G7HF 1RCPA 4CJGA 2P7VA 4DI3A 5AQBA 2GROB 1O1TA 1TNOA 5KBAA 4G24A 1YYXA 2BUGA 1V4AA 2WXHA 3FUEA 3UX4A 5JJ6A 3X2QE 3IEGA 3DKAA 4U5EE 3KEAA 2KGOA 3L13A 2IYLD 1ELWA 3C98A 1BR2A 3LY9A 5JJTA 3LDZA 1LE2A 2P6VA 2EILC 3UINC 3P2BA 2ZU6B 3UXGA 3SD5A 2WVNA 4MVQA 1TWCA 1CPRA 5A7DB 3E30A 3NZSA 4FLBA 2ETSA 2GRRB 3PZ3A 4BJ5A 3FY4A 1V54E 2JEKA 4KNVA 3DJNB 3EZHA 2A1DD 4KC9A 2HR2A 3GANA 2I9CA 4DX2A 2PNOA 3EGDA 4NIKA 3AG4E 5AIJA 2LNIA 4JJGA 3J5PA 1ZHYA 1YCSB 3IKOB 4KZCA 2WVOA 1LI5A 4JW1A 3SP1A 4FA6A 3AS8A 1TJFA 3TWSA 4G0HA 1NBBA 4HFGA 5AENA 2QE9A 5FTPA 5BXUA 4H7XA 3U2LA
chains in the Genus database with same CATH topology
2IXOA 3LJBA 3CLJA 3JCUQ 1SZIA 2WXLA 2V5FA 2YINA 1ZHWA 3PEVB 1HG2A 3S28A 4J8EA 4JA7A 5CCMA 5ANRA 2CHXA 1D0ZA 2DCPA 5KYUB 1Z3YA 2KQ9A 4OD4A 2OVBA 3ASFA 5G2NA 1M2OA 3LJ3A 3Q15A 1XNFA 3PUKA 5A23A 4JVSA 4O6NA 2ZXOA 3HLZA 4GMJA 4U8HA 2PX3A 5E3AA 2NUTB 2VGYA 3BEEA 5DS6A 4C0MA 1ZU5A 4BT8A 1IW7F 3RIBA 5KJLA 3CIAA 4I6JA 4JA9A 2VSYA 3K7DA 4B0ZA 5CHEE 4E85A 3PNLB 2KCVA 3ZYQA 2Y3AA 2W4BA 4U0SA 4UWLA 3UMVA 3CHPA 3RFYA 4AE4B 3EDTB 4EZKA 2OV8A 2A6HF 3E70C 3QDNA 4CT4A 4I3MA 4UI9K 4NURA 4EZJA 4WWPA 2XXAB 2YQ8A 3MJWA 4GCOA 4FU3A 3APCA 4Q96A 4I44A 3ML8A 1JPLA 5B3SC 4CBEA 4HS2A 4HOUA 3QAQA 4A2NB 4GZ6A 4U0UA 4BSXA 3FUHA 1H19A 2KCKA 4DK5A 3CSFA 4J6IA 2AW6A 2M63A 3TG4A 3B0VC 4G11A 3ABKC 1BR1A 4NY3A 3RJVA 1QLEC 2NXPA 3PE4A 2WXKA 4XX5A 3CK7A 5BNWA 4LLCA 4G26A 4CT0A 2OVFA 4OVUA 1NP7A 3FU0A 1HU3A 1HH8A 4GA2A 1FFHA 3DZAA 2R7SA 4DPRA 3WG7C 3L22A 2R7UA 2R7VA 1OWOA 3ABMC 4EECA 3EH1A 3S7JA 5KJKA 2EIKC 1D1BA 3JCKC 2Y39A 1B89A 4JURI 1VOMA 5LCWJ 2UY1A 2IOSA 3CK8A 4W8KA 3S29A 1D0XA 2MOWA 5DLJA 5BV1A 3RKOF 2KATA 2WXOA 3FH8A 1TWHA 4ANWA 3FAJA 3UT4A 5CMWA 4ANVA 3ONLA 4GYWA 3ZXSA 4DOZA 3PNTB 4Q69A 2XGOA 2WXGA 1W3BA 2VSNA 4GB9A 2GGFA 2PQNA 4DBRA 4KT6B 5DVWA 4JPSA 2J9WA 2XCBA 4PFPA 3AQBA 1Y8MA 2YHEA 2J45A 3LLKA 2XCCA 4JL0A 3LAYA 1UG3A 2XPZA 2R7XA 2FULA 1U3DA 5ANLA 4Y6WA 3U64A 4JC8A 4KVOA 4RSYA 1M56C 4NRHB 3TG5A 3IV0A 3LEWA 4PS7A 3PMRA 3PDNA 1Z6AA 3SNHA 1KT1A 2E2EA 5DS4A 2DYRC 2J08A 3DM5A 2QY9A 3PVLA 3Q47B 1PD1A 3FUIA 1PC2A 5D91A 3TL5A 2DBAA 4FP7A 2J46A 3FDHA 4AP2A 4KI2A 2H7BA 1E8XA 3EQLF 3S7FA 4RBNA 4U5FE 4FJZA 3L08A 3LNRA 4UWFA 2YZSA 4C3BA 3BG1B 1M57C 3FUJA 5LCWC 3DM9B 4UI9C 1D1CA 4XI9A 5AYWD 3NKDA 4U0ZA 4A3TA 2WXMA 4WWOA 1D0YA 3L6AA 3SBSA 4PJNA 3LS8A 2H7OA 3QWPA 3B0UX 3FUFA 3FHDA 4AV7A 5ENNA 1OCCC 1PAQA 4AJWA 1OWLA 3B0PA 5EGYA 3UGOA 3EG9A 3S27A 3VTYA 3WXXA 3EGDB 3SNXA 4BJTA 4YT8A 4I9EA 2FF4A 3UMIA 3B7TA 4PFOA 4N3BA 2DIWA 2J4BA 3LVRE 3TD7A 3ZYLA 5L3VA 3CVVA 4XLNF 2WQHA 3UMKA 3IEEA 1H0AA 4X0RA 1UJJA 1KT0A 3UUXA 4LRZA 1SF8A 3LY7A 4ILHB 1Z3XA 1EDUA 3N2ZB 4AK9A 1HFAA 4NQ0A 3ZHEB 1VK5A 4G23A 3U9WA 4MLPA 4U5CE 1FMWA 4C7OA 2XPYA 3RIPA 3RRUA 3SFZA 3I4RB 3W8IA 1ZHXA 3T4RA 3CSTA 5D0OD 3IHVA 3QARA 4OD5A 4IN3B 1ZBPA 3ZN3A 2XEVA 1UJKA 3D9OA 3I4UA 3U66A 4D10C 3QB2A 3PH0C 4ULWA 2XHEA 3RO2A 3ZGQA 4CSAC 2QY7A 5HI7A 3SGHA 4PUCA 3HVEA 4GYOA 2NUPA 4B8CB 1IHGA 2QTVA 3AU4A 1SZ9A 2X6JA 1OWMA 2ZPAA 2C03A 2M4EA 3KKBA 4PJJA 4BT9A 5G05J 5T1DB 3CVPA 4Q94A 4HEAJ 4PJLA 2PQRA 4FJYA 4L7TA 3ASDA 1LS1A 2O9XA 4RD9A 2C04A 2V4LA 1E8WA 1M2VB 1FVHA 4MKTA 1RJ9A 4FLHA 5KJMA 2W4MA 3KS2A 2YNQA 4I9CA 4OIOF 2VQ2A 1VYKA 2A4ZA 2EQXA 2JD3A 4I43A 2HYZA 2E0IA 2R7OA 2AWIA 2R7WA 3CVLA 3PEUB 4CS7A 5BUOA 3P1UA 4U5BE 4JJFA 4MQ9F 4BX8A 3MX3A 3QWWA 1TWAA 3CVWA 2Q3TA 4K0RA 3OXGA 3PZDA 3HYMB 3EGXA 3X1OA 1ZU2A 4N06A 4BJ6C 1N52A 1EYHA 3Q7LA 1O5HA 3WODF 3EJNA 2R17C 3UT7A 4IULA 2X38A 2FO7A 2HV6A 4EBBA 3TXMA 3AG4C 1PD0A 3DBSA 4CS9A 4Q7CA 4CCAA 3Q4AB 2WMOA 3G2SA 4L2YA 1MMGA 3HDXA 2J7PA 3EH2A 3AU5A 4WNFA 4KVMA 3CHQA 1D1AA 3SI5A 3JRTA 3ZSUA 2NC9A 2GRMA 5LP0A 4WNEA 3I5QA 4Q4ZF 4YWQA 2XRZA 3OWTA 3D9NA 2CW0F 5G05C 4DVZA 3RK6A 2X6IA 2V3CC 1Z5ZA 3LYAA 3FUMA 4K03A 4MS6A 4HFKB 3CHSA 3GODA 3SYNA 3EFOA 3FULA 3SZRA 1E8YA 3RO3A 5FJYA 2BTDA 2EINC 3I3NA 5B1BC 3ML9A 4I6EA 2I1KA 4DJAA 4FHJA 3FP3A 3N71A 1WGWA 2BE5F 4L23A 2J07A 4TRQA 2V0PA 4JZYA 3LLIA 1N54A 4FADA 3VYWA 5KYXA 4G1TA 3U4TA 2PFDA 4G25A 4HORA 3EHNA 2A68F 1IYGA 4I1OB 4KBQA 4C3EA 2PM6A 3SBTB 5KYYB 2KZTB 5E76A 4EZLA 2LO6A 1MMNA 3KD7A 2DYSC 1OWNA 5T3WA 3AS4A 4DI4A 3DAGA 2L0TB 3K33A 3ZIBA 4U04A 2ZXWC 3FTZA 3ABLC 3FFLA 3CV0A 5BT1A 1MHQA 2CHWA 2V26A 4O6MA 1UN8A 4OIQF 3OEOA 4AOFA 3DPDA 4BEJA 2YEVA 1NU9C 1MMDA 1VDYA 3MV3B 3LS1A 3CVXA 1KU2A 2B0JA 3O4ZA 1N1CA 4GYYA 3AS5A 1OKKA 2CGEA 3FUNA 4CDMA 2XGMA 4FC8A 4FWVA 3FTSA 3VLEA 3FHEA 3MKQA 2ILRA 5LFAA 4N2SA 5E2QA 5ARGA 4EPZA 2DGJA 3K1HA 4CS9C 3VLFA 3RU0A 4I6GA 3HTKC 4U07A 2XGSA 4JHRA 1EF1C 1EPUA 3ITFA 1A17A 3D3MA 3NYMA 2WPVA 2Z15A 3EG9B 2J9UA 4A1GA 2X51A 5J90A 5D0QD 1GW6A 4RDAA 1X5BA 4H7YA 1E90A 2J49A 1OCZC 3FUKA 3ASNC 3UNGC 5E33A 2GFHA 5DS5A 4HOSA 2IONA 2D5RB 4V3IA 2OG2A 3CGHA 3K9IA 2KW3C 3E9VA 2ZXRA 2NG1A 2FGYA 1SMYF 2GRLA 4YNDA 1PY1A 4NACA 1HF8A 5J08A 3T8MA 4CRWA 4C7OB 1TJCA 4CSAA 5FQ4A 3DXJF 3CQCB 3CVYA 1QQEA 4UQYA 1J8YF 2ONDA 2WZGA 3Q6MA 1VYIA 4F1SA 4CGWA 2WMNA 5T4YA 2AXVA 2IFUA 3UQ3A 1HX8A 3UR3C 1WM5A 1HS6A 4ANJA 1SQMA 4QFVA 1ZHZA 2AXUA 4B6IA 3CHRA 5IY5C 2XL4A 4RG6A 1G8XA 3GW4A 1S7ZA 3HVEB 4E7SA 2NUPB 3KL4A 5FZQA 3DMDA 2KM4A 5C2YA 3CKBA 4Q5SF 3PE3A 2IOQA 3CR3A 2J4DA 1FMVA 3N0TA 3RKVA 2CFUA 2VGXB 3IBEA 3B7SA 4DLQA 1DVPA 3FU6A 4GZ3A 1Z6TA 2IQCA 3QMKA 1MNEA 2L0IA 4JCHA 2IOLA 4BTAA 2P58C 1WAO1 1YA0A 3L16A 4AVXA 3ENEA 3K6BA 3G2WA 2UWJG 4XE0A 1FTSA 4GZCA 4I17A 3CEQA 2C0MA 1OWPA 3K1IC 4J32B 3CQZA 3Q49B 4BJ6A 2WB2A 4GZ5A 1LKXA 1UN9A 3N24A 2CFZA 4OVVA 2I6HA 4J30B 4KXKB 3DAFA 3B7RL 4LEUA 3S7DA 1TEZA 4N5CA 3BG0B 3LCAA 4KYOB 4HXIA 3NDBB 4AIFA 3APDA 3ASGA 4LUNU 4O79A 3CZ6A 4YJWA 3ULQA 4BY6A 4M63A 3OAWA 3JYHA 5EX0A 4CEMA 3MGBA 4UWGA 2PL2A 2WXNA 1ELRA 5HQ8A 4YN0B 3MYVA 3FTUA 4WNGA 4YT2A 3CHMA 3D9PA 3FEXA 3GZ1A 5EX3A 3JUIA 4TV3A 1ZHTA 4MRUA 4O6YA 4GCNA 3UGPA 5F5HA 2VTBA 1E7VA 2R7RA 4J8FA 4KBLA 3MEKA 4ACKA 1MQSA 4UQZA 3NRHA 4U5HA 1HZ4A 5FQ6A 2PZIA 3ONKA 4APOA 3GYZA 3TGOA 4UWHA 3B13A 1NA3A 1TWGA 4J8SA 4DBQA 4ILGA 3EFOB 2X6KA 3ZVRA 2HM8A 2EIJC 2G3VA 4LLEA 4OIPF 4C9BB 4IJJA 5D92A 2AVPA 2NSZA 3F46A 5FT9A 4YVOA 3EIJA 3L34A 3FTYA 2CG2A 2KNHA 3CVUA 4J8DA 2Y3DA 5EHHA 3S2AA 4ATGA 4CS8C 3UT8A 3ZYKA 1U3CA 2LSVA 5L3QA 1JWFA 2CHZA 4A1SA 3FUDA 1W2WA 4ME2A 4Y6CA 4HOTA 5FQ8A 3ZC4A 5FWQA 5EKQD 4I1MA 4C3DA 3QOUA 3W8HA 2WM9A 4URKA 2CDQA 2AXZA 5AJLA 3CK9A 3AG3C 1IQUA 4XKCA 4AEZC 4L2LA 4FULA 4MNDA 3D9JA 3L54A 2QFCA 1IZMA 2C0LA 5C1DA 2HV7A 3G2UA 3JQ1A 3X2QC 3S0XA 3CSKA 3PUJA 1JUQA 2J0WA 3NYLA 3QK0A 3OXLA 3HHMA 4RVBA 4XI0A 3KEZA 4F53A 2BF0X 1QNFA 4HVBA 1H2UA 1NZNA 2RD0A 3D9LA 3MV2B 1V54C 5CI8A 3L17A 3R9AB 2Q9BA 4GU5A 4DLOA 4OINF 3FTXA 3M1CB 5KYNA 1QZ2A 1LF8A 4W9RA 4ANUA 5F5FA 2ZXPA 4GPKA 5A6CA 3SF4A 4EBAA 2J9VA 1ELKA 5JHAA 3MKQB 5DQTA 3G2TA 3LPZA 4FX5A 4TUUA 2XRYA 3LY8A 3R7QA 2J0XA 2IU1A 4I2ZA 3CVNA 2XPIA 5T3RA 4YVQC 3ZVVA 2EIMC 4BJ1A 4AXHA 3NG1A 1L5JA 2FBNA 2UY1B 4P6IC 3OXFA 3KH2A 5KYWA 3ZHEA 4J0UA 3FU5A 3MLGA 3JQ0A 3DJUB 1MNDA 3MKRA 3MA5A 5KJNA 4WUYA 2CNWD 2WQ7A 5FQ7A 2HO1A 3NQPA 3QC1A 3T6BA 2E87A 3FDQA 1FVFA 4GYTA 3ZIMA 2V8SE 3IHYA 3EIQC 4ACLA 2IF4A 1MMAA 2W45A 4KZ0A 2Y3HA 4WJ0A 1OCOC 4BFRA 3FEYA 5E3CA 3MZLB 4B8AA 4HE8D 2G3KA 5DBKA 1NU7D 4F4BA 3VLDA 2OOEA 3ZEFA 5AJDA 4WWNA 1BR4A 4IAOA 3ESLA 4G2VA 3EHMA 3CHOA 3KAEA 4HLEA 3S7BA 3Q6NA 1ZU4A 3SEOA 3PRZA 1UW4B 3LS0A 3CVQA 1H6KA 1M2VA 3LXUX 2VB6A 4IYPA 1J8MF 3TXNA 4PK4A 2J7PD 3O48A 2XSEA 4AY6A 4E6HA 4N2QA 3KMIA 2LSEA 3W2VA 3QZCA 4QDLA 1TR2A 4N3AA 5FZRA 3TJPA 3ZYMA 4I1AA 2XQ0A 5FCLA 3ESKA 2PM7A 5DIZA 5CMYA 4GEHA 3V7OA 3NKEA 3GZ2A 2MWQA 2Y3GA 3HIZA 2KC7A 2L9BA 4HFFB 4A3VA 3SZ7A 1HO8A 4C0EA 5EDSA 3JYSA 3CQGB 4JZAA 1HXIA 3APFA 2X6HA 5BW8C 3POVA 2A5UA 3QJZA 3FTVA 3NF1A 4FESA 2JLBA 2Q7FA 4JXTA 3VAYA 1E96B 1P5QA 4WNDA 2PF4E 2L6JA 4BJ5C 4DVYP 1INZA 4JEHA 2FEZA 4KMOA 2H7VC 1ST6A 4K0DA 4CDRA 3W2WA 2L9JA 5G04J 2C2LA 2KCLA 2WVQA 1NA0A 3E4BA 2I1JA 3LESA 2YHCA 3EPVA 4AY5A 4UQXA 1Y6IA 3AG2C 4QI0A 4XLPF 3QWVA 4GAAA 3JT1A 3GZSA 4IRUA 4CGVA 3RRMB 4UI9J 4CDNA 3AG1C 5E75A 3URZA 2WQ6A 5KYUA 5BUZA 4XWJA 4AX2A 3F47A 3NYJA 2WXRA 3Q5MA 2VTBB 4JHKA 1OCRC 5LOZA 3RYLA 3SHFA 4XIFA 3UMHA 4XKBA 3PS6A 4U5DE 1VMAA 5KCMA 4YT5A 2IXPA 4ILIA 1PCXA 1BPOA 4JHJA 3PHF2 2NUTA 3D9MA 4GZDA 4PS8A 4YT4A 4CS8A 2VJ8A 3LEVA 4JEUA 4F7AA 4P29A 3ZRHA 3FH5A 3FU3A 1OKKD 3RRNB 2R7QA 3FTWA 2CG3A 3RH3A 5BV0A 3AQCA 1O87A 4M3OA 3ASHA 3T6JA 1QZXA 5KYYA 2KZTA 3NZUA 4EBAG 2VH3A 5DQZA 5LX8A 2I8BA 2VYIA 1TKNA 4GA0A 4AE4A 4OIRF 2WZLA 1NZEA 2WB7A 5CCLA 4BTBA 1RJ9B 2RG8A 2XXAA 5FZSA 5T8IA 4R7LA 3FVYA 3ZG1A 1H2VC 4LCTA 4A55A 5HSWA 4XTKA 1E7UA 2OCCC 4O6FA 1XGWA 1H2TC 3K66A 5G04C 3CKCA 4ZLDA 2A69F 2R5SA 3H65A 4B89A 4ANXA 3T5VA 1IQRA 3TAXA 2VSOE 1WY6A 3VTXA 2Y69C 3I4GA 2G62A 4K7BA 3QKYA 4E7ZA 3OTNA 4PDXA 4HOQA 3B9QA 3EGXB 2MYSA 4EWCA 3UPVA 2LSUA 1S0PA 3G2VA 3I5PA 3O39A 1JWGA 4ABNA 2IXNA 3O6XA 5CI9A 4G7ZF 1Z3IX 4WAFA 3R7RA 3LVQE 3ASOC 2KJGA 4LERA 4GA1A 2GW1A 3D9KA 4PJMA 5ARFA 3ZW3A 4N39A 2WL8A 2Y4TA 2VSXE 1FCHA 4ZLCA 3ZFWA 3D9IA 1OUVA 3Q7GA 2IXMA 4FHKA 2MRIA 4B94A 4U5GA 4O7GA 4H4KC 2WZFA 4AM9A 5KYWB 3B7UX 5G55A 2Q9CA 2WVIA 2WXPA 2Y4UA 3DD7A 1HE8A 2J9QA 5JHBA 2XRHA 2FI7A 1FFTC 1DNPA 1V55C 3FWVA 4BG0A 1JPNA 2WXJA 4F3VA 3L0IA 2WXFA 1ZYRF 4UWKA 1Z63A 2W9YA 4OYSA 1NG1A 1E8ZA 2MHKA 1JPJA 4PS3A 4QI2A 2IJGX 3OA1A 3U3WA 4RG9A 4EQFA 4IWBA 4G7OF 5KYXB 3QNKA 2R7TA 2LAHA 2L81A 4LACB 1HG5A 3MCXA 3PREA 3JSZA 4U63A 3HJCA 5BPPA 2I2OA 2Y3BA 3ECSA 4L1BA 4XZ4A 4PH4B 4BX9A 4GMLA 2WXIA 2PP4A 4CIHA 2PX0A 2VGXA 1Z23A 3LKUA 2A6EF 2WXQA 1LVKA 3T5XA 3EZIA 2VASA 5JJ7A 2FFHA 3ZPJA 4BWRA 4N3CA 2X6FA 5M72A 1KLXA 5T3TA 4I2WA 2Q9AA 2X3MA 4APFA 2J09A 2CNWA 2R59A 3FH7A 1SZAA 2LAIA 5B1AC 2YHSA 4KNWA 4G7HF 2P7VA 4DI3A 4G24A 2BUGA 3UX4A 2WXHA 3FUEA 5JJ6A 3IEGA 4U5EE 2KGOA 3L13A 2IYLD 1ELWA 3C98A 1BR2A 3LY9A 5JJTA 3LDZA 2P6VA 2EILC 3P2BA 2ZU6B 3SD5A 2WVNA 1TWCA 5A7DB 3NZSA 4FLBA 4BJ5A 3FY4A 2JEKA 4KNVA 3DJNB 3EZHA 2A1DD 4KC9A 2HR2A 3GANA 2I9CA 3EGDA 5AIJA 2LNIA 4JJGA 1ZHYA 4KZCA 3IKOB 2WVOA 4JW1A 3SP1A 4FA6A 3AS8A 1TJFA 4G0HA 4HFGA 5AENA 5FTPA 4H7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I1M A;  4I1O B;  4JVS A;  4IRU A;  4JW1 A; 
#chains in the Genus database with same CATH topology
 2YL1 A;  2IXO A;  3LJB A;  3CLJ A;  3TQO A;  3JCU Q;  3UIO C;  1SZI A;  2WXL A;  2EIM E;  3LUT B;  2V5F A;  2YIN A;  1ZHW A;  1LPE A;  5AC4 A;  5A6A A;  3PEV B;  1HG2 A;  3S28 A;  2Q7R A;  4J8E A;  4JA7 A;  5CCM A;  2F37 A;  3J5Q B;  3QVZ A;  1O1R A;  5ANR A;  2CHX A;  1D0Z A;  2DCP A;  2XS1 A;  2H6I A;  1XZP A;  4MTG A;  4YL3 A;  5KYU B;  1Z3Y A;  5A69 A;  4E17 A;  2KQ9 A;  4OD4 A;  3VF0 A;  2P9S G;  2OVB A;  3ASF A;  5G2N A;  1QVX A;  4XEV A;  2B0H A;  1M2O A;  2YVK A;  3LJ3 A;  3Q15 A;  1K1B A;  1XNF A;  3ZDL A;  3PUK A;  4JVS A;  4O6N A;  1FR0 A;  5A23 A;  2ZXO A;  4IAQ A;  3HLZ A;  3DST A;  4LNG A;  4GMJ A;  4U8H A;  2PX3 A;  3JSE O;  5E3A A;  2D4U A;  2XLE A;  2NUT B;  2BKK B;  2VGY A;  4YL0 A;  3BEE A;  1OCO E;  5ENS D;  5DS6 A;  4C0M A;  1ZU5 A;  4BT8 A;  1IW7 F;  3RIB A;  4MVZ A;  5KJL A;  3HXC A;  3CIA A;  4DRH B;  4I6J A;  4JA9 A;  2VSY A;  3K7D A;  4B0Z A;  5CHE E;  4E85 A;  3PNL B;  2KCV A;  3ZYQ A;  4BER A;  2AWC A;  4Z9H A;  4J7T A;  4WAB A;  2Y3A A;  2W4B A;  4U0S A;  4UWL A;  1DCE A;  3S9O A;  3EHR A;  4L6R A;  3UMV A;  3T6G B;  1NFI E;  3CHP A;  3RFY A;  3GEH A;  1OXK A;  2DYS E;  4GMR A;  4AE4 B;  1RZ4 A;  3U9J A;  1TN6 A;  2B0O E;  3EDT B;  1O5M A;  2OV8 A;  4EZK A;  3IHU A;  2R02 A;  2A6H F;  3E70 C;  3QDN A;  4CT4 A;  3HXD A;  4I3M A;  3PCV A;  4UI9 K;  3DE9 A;  1TFK B;  1Y4C A;  4NUR A;  4EZJ A;  4WWP A;  1CGN A;  2XXA B;  2KC3 A;  2YQ8 A;  1N94 A;  3MJW A;  4GCO A;  4FU3 A;  3APC A;  4Q96 A;  4I44 A;  1TNU A;  2OQM A;  5ENT D;  3US6 A;  3ML8 A;  1JPL A;  5B3S C;  1OXB A;  1OXJ A;  5CEA A;  3M79 A;  4CBE A;  1C02 A;  4HS2 A;  4ZFH A;  4HOU A;  2YL7 A;  3QAQ A;  4A2N B;  4E18 A;  4GZ6 A;  4U0U A;  4BSX A;  3FUH A;  1GM5 A;  4HRL A;  2KXP C;  1SR2 A;  1H19 A;  2KCK A;  4J7Y A;  4DK5 A;  4P9F A;  4LDK A;  3CSF A;  4J6I A;  2QYU A;  4TXQ A;  5JUA A;  2PBE A;  4U96 D;  5JS5 A;  2AW6 A;  2M63 A;  3TG4 A;  3B0V C;  4G11 A;  3ABK C;  1BR1 A;  4NY3 A;  3NMK A;  1A7D A;  3RJV A;  1QLE C;  2NXP A;  2XLD A;  3IXE A;  3PE4 A;  2WXK A;  4XX5 A;  3CK7 A;  4MS2 A;  4HQD A;  5BNW A;  4LLC A;  4G26 A;  2YKZ A;  4CT0 A;  2OVF A;  4OVU A;  1NP7 A;  3FU0 A;  1HU3 A;  1HH8 A;  2ETA A;  4GA2 A;  1FFH A;  3DZA A;  2R7S A;  4DPR A;  2GWW A;  3WG7 C;  1A5E A;  3L22 A;  4TXP A;  2P9L G;  2R7U A;  3ZQY A;  4U9E A;  3ABM C;  2R7V A;  1OWO A;  4EEC A;  3EH1 A;  5EYP F;  3S7J A;  5KJK A;  2FAP B;  2EIK C;  1D1B A;  4DRI B;  3JCK C;  2Y39 A;  4O1P A;  1B89 A;  1TYQ G;  3HG0 D;  4JUR I;  1VOM A;  2DZO A;  3ZUV B;  5LCW J;  2UY1 A;  2IOS A;  3CK8 A;  4W8K A;  3S29 A;  1D0X A;  4PR9 A;  2MOW A;  5DLJ A;  4WGZ A;  5BV1 A;  1LS4 A;  3L1M A;  3RKO F;  2KAT A;  3GWN A;  2WXO A;  3AG2 E;  1NFO A;  3FH8 A;  1TWH A;  4ANW A;  2LD6 A;  4AL1 A;  3FAJ A;  2AJA A;  3UT4 A;  5CMW A;  3C8G B;  1KPS B;  4ANV A;  3AG1 E;  3ONL A;  2P1A A;  4GYW A;  1JAF A;  3ZXS A;  4DOZ A;  2ZGG A;  3PNT B;  4Q69 A;  2XGO A;  3KYJ A;  3V5Y A;  2WXG A;  1W3B A;  2VSN A;  4GB9 A;  2GGF A;  2PQN A;  4DBR A;  4KT6 B;  3QTH A;  5DVW A;  4JPS A;  2J9W A;  2XCB A;  4PFP A;  3AQB A;  3RQF A;  1Y8M A;  2YHE A;  1G3N B;  1YYJ A;  2J45 A;  3LLK A;  2XCC A;  4JL0 A;  3LAY A;  1YMP A;  3FOP A;  1UG3 A;  2XPZ A;  2L6F A;  2R7X A;  3Q75 A;  3DXK G;  3ZTM A;  2FUL A;  1U3D A;  5ANL A;  4Y6W A;  3ZQV A;  3U64 A;  1NFN A;  4JC8 A;  5FIN A;  4KVO A;  4RSY A;  1T9K A;  1D8E A;  1LTX A;  1H6O A;  1M56 C;  4NRH B;  3TG5 A;  3IV0 A;  2XZD G;  3LEW A;  4PS7 A;  2R9R B;  1WAT A;  3PMR A;  2IEJ A;  3PDN A;  1S64 A;  4CDV A;  3TK0 A;  1Z6A A;  3SNH A;  1KT1 A;  2E2E A;  5DS4 A;  2DYR C;  2J08 A;  3DM5 A;  3IQ5 A;  2QY9 A;  3PVL A;  1NLX A;  1UG7 A;  3ZU7 B;  3Q47 B;  1PD1 A;  3FUI A;  3V2X A;  1PC2 A;  3WHN A;  2JX0 A;  5D91 A;  2VC9 A;  3TL5 A;  2DBA A;  4FP7 A;  4LNU D;  2J46 A;  4EBJ A;  3FDH A;  4AP2 A;  2J8S D;  1L7C A;  4KI2 A;  2H7B A;  1E8X A;  3EQL F;  3AJM A;  3S7F A;  4RBN A;  3IPM O;  1IXV A;  5JA4 D;  4U5F E;  4FJZ A;  5AQA A;  3L08 A;  3LNR A;  1ORY A;  4GTM A;  4UWF A;  1OY3 D;  2YZS A;  4C3B A;  3BG1 B;  1M57 C;  3FUJ A;  3G50 A;  5LCW C;  3DM9 B;  1C03 A;  4UI9 C;  1D1C A;  2R2L A;  2OJQ A;  4XI9 A;  1N4R A;  1N4P A;  3U8P A;  5AYW D;  3NKD A;  4U0Z A;  1N11 A;  1A7V A;  4A3T A;  2WXM A;  4WWO A;  1D0Y A;  1Y6D A;  1DOV A;  2Y69 E;  2P9N G;  2VCB A;  3PZ2 A;  3L6A A;  3SBS A;  4PJN A;  3LS8 A;  2H7O A;  4IB4 A;  3QWP A;  4Z9J A;  3W4Y A;  3B0U X;  2HJ3 A;  2IBF A;  3FUF A;  1GQA A;  3FHD A;  1SVX A;  1LI7 A;  1UOH A;  4AV7 A;  5ENN A;  1OCC C;  1ZZP A;  1A7E A;  1PAQ A;  4AJW A;  1VLS A;  3B0P A;  1OWL A;  5EGY A;  3UGO A;  3EG9 A;  1WG0 A;  3S27 A;  5JVE A;  1Q0F A;  3VTY A;  3WXX A;  3EGD B;  3SNX A;  4WGY A;  4BJT A;  4YT8 A;  1K8K G;  3SXZ A;  2FF4 A;  4I9E A;  3UMI A;  3B7T A;  4PFO A;  4N3B A;  2DIW A;  2J4B A;  3LVR E;  3TD7 A;  4N5Q A;  3ZYL A;  3DEP A;  5L3V A;  3CVV A;  1N9A A;  2LXM A;  3HXB A;  4XLN F;  2WQH A;  3UMK A;  3IEE A;  1H0A A;  4NC3 A;  1CPQ A;  2NPU A;  4X0R A;  1UJJ A;  1KT0 A;  3UUX A;  3TJ5 A;  3ASO E;  4LRZ A;  2IY0 C;  1SF8 A;  3RVZ A;  3LY7 A;  4ILH B;  3EHQ A;  1Z3X A;  4GTT A;  2OKU A;  1EDU A;  3N2Z B;  4AK9 A;  1HFA A;  4NQ0 A;  3ZHE B;  3TWU A;  1VK5 A;  5BQH A;  4LSZ E;  4G23 A;  3U9W A;  4K5A B;  4MLP A;  3CAX A;  1T6I A;  4U5C E;  4C7O A;  1FMW A;  1T5O A;  2LFD A;  2XPY A;  3RIP A;  3RRU A;  2L7A A;  3SFZ A;  3AOU A;  3I4R B;  3W8I A;  5EN5 D;  1ZHX A;  3T4R A;  3FOO A;  3U5S A;  1YZC A;  3CST A;  5D0O D;  3IHV A;  3QAR A;  4OD5 A;  4IN3 B;  4LNB A;  1ZBP A;  2L6B A;  1HMO A;  4JKV A;  3AGU A;  2AVK A;  3ZN3 A;  2XEV A;  1RKC A;  3NOC D;  1UJK A;  3D9O A;  1E85 A;  3I4U A;  5EYL A;  3U66 A;  1FT2 A;  4D10 C;  2GRN B;  1V55 E;  2RFM A;  3QB2 A;  3PH0 C;  4ULW A;  2XHE A;  1H7I A;  4B93 B;  3RO2 A;  3ZGQ A;  3UKR G;  4CSA C;  2QY7 A;  1KTM A;  5HI7 A;  3SGH A;  3B95 A;  2NSF A;  3HVE A;  4PUC A;  2HS5 A;  4GYO A;  2NUP A;  4B8C B;  1IHG A;  5ENP D;  2QTV A;  4XPY A;  5CBO A;  3AU4 A;  1SZ9 A;  2X6J A;  4BEP A;  1OWM A;  2ZPA A;  2C03 A;  2VCC A;  4DX6 D;  2M4E A;  3ULY A;  4HLL A;  4U7E B;  1FAP B;  3KKB A;  4PJJ A;  2A0B A;  4BT9 A;  5G05 J;  5T1D B;  3CVP A;  1QPU A;  2KK1 A;  4Q94 A;  4HEA J;  4PJL A;  3NMI A;  2XEH A;  2PQR A;  4TXR A;  4FJY A;  4L7T A;  4JC7 A;  3ASD A;  1LS1 A;  2O9X A;  4RD9 A;  2C04 A;  2V4L A;  1E8W A;  1M2V B;  1FVH A;  4MKT A;  1RJ9 A;  2QLA A;  4FLH A;  5KJM A;  2W4M A;  4NTF A;  3KS2 A;  2OEW A;  2YNQ A;  4I9C A;  4OIO F;  2VQ2 A;  1VYK A;  1HW2 A;  2A4Z A;  2EQX A;  2JD3 A;  4I43 A;  2HYZ A;  2E0I A;  2DZN A;  2R7O A;  5AN8 A;  3C8G D;  2AWI A;  1U0B B;  1T01 A;  3MBG A;  1E86 A;  2R7W A;  3CVL A;  3PEU B;  4CS7 A;  3TWV A;  5BUO A;  3P1U A;  4YDY A;  4U5B E;  3UM0 A;  2XEN A;  4JJF A;  1ORJ A;  3U3B A;  4MQ9 F;  4BX8 A;  3MX3 A;  3QWW A;  1TWA A;  5B1A E;  3CVW A;  2Q3T A;  2HUJ A;  4K0R A;  3OXG A;  3PZD A;  1N4S A;  2OOC A;  1YA9 A;  1TR4 A;  3HYM B;  3EGX A;  3X1O A;  1ZU2 A;  4N06 A;  4BJ6 C;  1N52 A;  1EYH A;  3Q7L A;  1O5H A;  3WOD F;  3R9M A;  3EJN A;  2R17 C;  3EUV A;  4IUL A;  2X38 A;  3UT7 A;  2FO7 A;  2HV6 A;  3JXI A;  4G8L A;  4EBB A;  3TXM A;  3AG4 C;  1PD0 A;  5F28 E;  3DBS A;  4CS9 A;  2YRF A;  4MVR A;  5FZT A;  4Q7C A;  4CCA A;  3Q4A B;  1MJ0 A;  4K5B A;  5KWD A;  2WMO A;  3G2S A;  1QBQ A;  1JOG A;  1LD8 A;  4NQF A;  4L2Y A;  1MQV A;  1MMG A;  3HDX A;  3Q7A A;  3DI5 A;  2J7P A;  1CGM E;  5TJ5 E;  3KYI A;  3EH2 A;  3S90 A;  2P9K G;  3AU5 A;  4WNF A;  1ZW2 A;  4KVM A;  1GGQ A;  2A5E A;  3CHQ A;  2F8X K;  1D1A A;  1SA5 A;  3SI5 A;  3JRT A;  2GAQ A;  3ZSU A;  2NC9 A;  2GRM A;  5LP0 A;  2PNN A;  2JAB A;  4WNE A;  3I5Q A;  4Q4Z F;  4YWQ A;  4DX1 A;  4H54 A;  2H6G A;  2XRZ A;  2L6H A;  2R25 A;  3OWT A;  5CRU A;  1WDY A;  3D9N A;  2CW0 F;  5G05 C;  2XL8 A;  3JYY A;  4DVZ A;  3RK6 A;  1DOW A;  3JTL O;  5EID A;  2X6I A;  2V3C C;  1Z5Z A;  3LYA A;  3SY2 A;  3FUM A;  4K03 A;  4MS6 A;  4HFK B;  3CHS A;  3GOD A;  5A6B D;  4GPM A;  3SYN A;  3EFO A;  1OR3 A;  2LCH A;  3FUL A;  4ONS A;  3EU5 A;  4Z68 A;  2LIG A;  4AL0 A;  3SZR A;  1E8Y A;  3RO3 A;  5FJY A;  2BTD A;  1C17 M;  3R2P A;  2EIN C;  5BQG A;  3I3N A;  5B1B C;  3ML9 A;  4JIO A;  4I6E A;  2I1K A;  4DJA A;  4FHJ A;  3FP3 A;  3Q78 A;  3GEI A;  3N71 A;  4IAR A;  1WGW A;  4OAU C;  2BE5 F;  4L23 A;  1HE9 A;  3PZ1 A;  3RSE G;  3KSL A;  3V31 A;  2J07 A;  4TRQ A;  2V0P A;  4JZY A;  3RAU A;  3LLI A;  1N54 A;  3HRA A;  3VYW A;  4FAD A;  5KYX A;  2GDC A;  4U8Y D;  1BDJ B;  1UFB A;  4BPM A;  4K5C A;  4G1T A;  3U4T A;  1V74 B;  2PFD A;  4G25 A;  4HOR A;  3VRC A;  3EHN A;  2A68 F;  4ZHB A;  1K40 A;  1IYG A;  4I1O B;  4EIY A;  1T6U A;  4KBQ A;  4C3E A;  2PM6 A;  3SBT B;  5KYY B;  1BBH A;  2KZT B;  5E76 A;  1X81 A;  4EZL A;  2LO6 A;  3NAW A;  1MMN A;  4DJ9 A;  1KZO A;  1I4Y A;  2QUP A;  3KD7 A;  4A4A A;  2DYS C;  2AWY A;  3JZ0 A;  3C63 A;  3MYF A;  5JMN D;  4X8Q A;  1OWN A;  5T3W A;  3AS4 A;  4DI4 A;  3DAG A;  2L0T B;  3K33 A;  2YL0 A;  3ZIB A;  3AJI A;  4XEI G;  3E37 A;  4U95 D;  4U04 A;  2ZXW C;  3FTZ A;  3DSW A;  4BSZ B;  3B29 A;  3ABL C;  3FFL A;  3CV0 A;  5BT1 A;  1Q0G A;  1MHQ A;  2CHW A;  1E2X A;  2V5Q C;  2V26 A;  4O6M A;  1UN8 A;  4OIQ F;  3OEO A;  4AOF A;  4G78 A;  5AAR A;  3DPD A;  4BEJ A;  2YEV A;  1NU9 C;  2H6H A;  1MMD A;  5AQ7 A;  1VDY A;  3MV3 B;  3LS1 A;  3DXM G;  3CVX A;  1IKN D;  5B3S E;  1KU2 A;  2B0J A;  3O4Z A;  2LXL A;  1N1C A;  1IHB A;  4GYY A;  5L0G A;  5D2M C;  3AS5 A;  1OKK A;  2CGE A;  3FUN A;  4CDM A;  1NI1 A;  2HMQ A;  2XGM A;  4CDA A;  4FC8 A;  4FWV A;  4EBK A;  3FTS A;  3VLE A;  1L3P A;  1AEP A;  3AAA C;  4MTF A;  3FHE A;  4J8Y A;  3MKQ A;  2ILR A;  5LFA A;  2F22 A;  4CDY A;  2NSG A;  1O1S A;  3ABK E;  4N2S A;  5E2Q A;  4JE9 A;  3V5Z A;  2XLH A;  5ARG A;  4EPZ A;  2DGJ A;  3K1H A;  4CS9 C;  3VLF A;  3RU0 A;  4ATZ D;  4I6G A;  3HTK C;  4O60 A;  4U07 A;  2XGS A;  4JHR A;  4DX7 D;  1EF1 C;  1EPU A;  3ITF A;  1A17 A;  4EHM A;  1AUE A;  3D3M A;  3HNK A;  3NYM A;  2WPV A;  3ATP A;  3DWW A;  2Z15 A;  3EG9 B;  3B71 A;  2J9U A;  3W9G A;  4A1G A;  2LUH A;  3L8I A;  1R4T A;  2X51 A;  1QSP A;  5J90 A;  5D0Q D;  3ABM E;  1GW6 A;  1E83 A;  4RDA A;  1X5B A;  2ZIS A;  1E90 A;  4H7Y A;  2J49 A;  1OCZ C;  3FUK A;  2EIK E;  4W8P A;  3ASN C;  3UNG C;  1TNZ A;  5E33 A;  2Q00 A;  1HY5 A;  2GFH A;  1D9S A;  2UUH A;  5DS5 A;  4HOS A;  2ION A;  2D5R B;  1Q2Z A;  4V3I A;  2OG2 A;  3CGH A;  3K9I A;  2KW3 C;  3DPY A;  1ZB1 A;  3E9V A;  2ZXR A;  2NG1 A;  2FGY A;  4M7C A;  1I5N A;  1SMY F;  2XLO A;  2GRL A;  4YND A;  2BC5 A;  1K1A A;  1PY1 A;  1OCR E;  4NAC A;  2V4H C;  1HF8 A;  5J08 A;  1OR2 A;  2VCA A;  3T8M A;  4CRW A;  1S70 B;  4C7O B;  1TNB A;  5COG A;  1TJC A;  4CSA A;  1BD8 A;  5FQ4 A;  3DXJ F;  3CQC B;  4JD2 G;  3CVY A;  1I4Z A;  1QQE A;  4JTD B;  4UQY A;  1J8Y F;  3DE8 A;  2OND A;  2WZG A;  3Q6M A;  1VYI A;  4F1S A;  1TN8 A;  4GTS A;  4CGW A;  2WMN A;  5T4Y A;  1H6G A;  5L0F A;  1Q0D A;  4UUC A;  2XL6 A;  2AXV A;  3L8J A;  2IFU A;  3UQ3 A;  1HX8 A;  3UM1 A;  3UR3 C;  1WM5 A;  1HS6 A;  4ANJ A;  3H2V A;  1DCQ A;  1SQM A;  2L6G A;  4QFV A;  1ZHZ A;  2AXU A;  3RQE A;  3BQO A;  4B6I A;  1AWC B;  3CHR A;  3TWR A;  3BRJ A;  4XPX A;  1N95 A;  4ULV A;  5IY5 C;  2XL4 A;  2X0C A;  1G8X A;  4RG6 A;  3GW4 A;  1S7Z A;  3HVE B;  3Q9U C;  4E7S A;  4ER9 A;  2NUP B;  2ZD9 A;  1U2V G;  4HRN A;  1HMD A;  3KL4 A;  3HXF A;  5FZQ A;  3DMD A;  4JRZ A;  1Q0M A;  2KM4 A;  5C2Y A;  3CKB A;  4Q5S F;  3PE3 A;  2IOQ A;  3CR3 A;  4N6C A;  2J4D A;  1FMV A;  1LE4 A;  3N0T A;  3RKV A;  1KNY A;  1MZC A;  2CFU A;  2VGX B;  2OEX A;  3IBE A;  3L9T A;  3B7S A;  3GM1 A;  4DLQ A;  1DVP A;  3FU6 A;  4GZ3 A;  1Z6T A;  2IQC A;  3MYI A;  3QMK A;  1MNE A;  3Q73 A;  2L0I A;  2DYR E;  1FNT c;  4JCH A;  2IOL A;  4BTA A;  2P58 C;  1WAO 1;  1EA8 A;  4MW3 A;  1YA0 A;  3L16 A;  4AVX A;  3ENE A;  3K6B A;  4CYM D;  1U89 A;  5EK0 A;  4CIP A;  2XM0 A;  3G2W A;  1EKY A;  2UWJ G;  4XE0 A;  1FTS A;  1RKE B;  1BLX B;  2OCC E;  3Q9N C;  2LP4 A;  4GZC A;  1A0B A;  2P2C P;  4I17 A;  3CEQ A;  2C0M A;  3UM3 A;  1OWP A;  3K1I C;  4J32 B;  3CQZ A;  3Q49 B;  4BJ6 A;  2WB2 A;  4GZ5 A;  1LKX A;  1G4W R;  1QYM A;  1UN9 A;  2LQG A;  3N24 A;  2CFZ A;  4D4X A;  3LNM B;  4OVV A;  2I6H A;  4J30 B;  4KXK B;  5ENR D;  1RXQ A;  3DAF A;  3B7R L;  4LEU A;  3S7D A;  1TEZ A;  1JMW A;  4N5C A;  1D8D A;  5EIL A;  3BG0 B;  2MHR A;  3LCA A;  4NCQ A;  4KYO B;  4HXI A;  3NDB B;  4AIF A;  3APD A;  1G4U S;  2H8A A;  3RQG A;  1EQ1 A;  2BED A;  3A9C A;  3ASG A;  3M15 A;  4LUN U;  4O79 A;  3CZ6 A;  3NMJ A;  4YJW A;  3ULQ A;  1JRA A;  4BY6 A;  1K3Z D;  4M63 A;  2F8Y A;  3OAW A;  1S05 A;  2HJM A;  3JYH A;  5EX0 A;  1OCC E;  4CEM A;  1G5Z A;  3DSX A;  3MGB A;  1AVO B;  4UWG A;  1SYQ A;  3U8V A;  2TMV P;  1YVI A;  2H6F A;  2PL2 A;  3C5R A;  2WXN A;  2BKG A;  1ELR A;  1GS9 A;  1QQ3 A;  1K04 A;  5HQ8 A;  4YN0 B;  3MYV A;  3FTU A;  4WNG A;  4YT2 A;  3CHM A;  3D9P A;  3FEX A;  3GZ1 A;  5EX3 A;  3JUI A;  4TV3 A;  1ZHT A;  4MRU A;  4O6Y A;  1ORS C;  4GCN A;  3UGP A;  5JSL A;  5F5H A;  2VTB A;  3C72 A;  1E7V A;  3DSV A;  2R7R A;  4J8F A;  4KBL A;  5CED B;  3AGT A;  3MEK A;  4ACK A;  3C8G A;  1MQS A;  4UQZ A;  3ISM C;  3NRH A;  4HI9 A;  2XLW A;  4U5H A;  1HZ4 A;  5FQ6 A;  2PZI A;  4LG6 A;  3ONK A;  3UIP C;  2ZGD A;  4APO A;  3GYZ A;  4GTQ A;  3TGO A;  4UWH A;  3GOR A;  1NA3 A;  3B13 A;  1TWG A;  4HI8 A;  4J8S A;  4DBQ A;  4ILG A;  2Q4F A;  1N0Q A;  2YLD A;  2XZT G;  1O3U A;  1JR8 A;  3EFO B;  2X6K A;  3ZVR A;  3V30 A;  2HM8 A;  2EIJ C;  2G3V A;  2CYD A;  4LLE A;  4OIP F;  4C9B B;  4IJJ A;  5D92 A;  2AVP A;  2NSZ A;  3F46 A;  1RW2 A;  2QYJ A;  5FT9 A;  3E32 A;  4YVO A;  3CEX A;  3EIJ A;  1E84 A;  4CZ2 D;  3L34 A;  1SA4 A;  3FTY A;  4GQH A;  2CG2 A;  4J7W A;  2KNH A;  3CVU A;  4J8D A;  2Y3D A;  5EHH A;  3S2A A;  4ATG A;  3DWL G;  1VB5 A;  4CS8 C;  3UT8 A;  4DRJ B;  1U3C A;  1WAS A;  3ZYK A;  2LSV A;  5L3Q A;  4BES A;  1JWF A;  2P9I G;  2CHZ A;  4A1S A;  3V79 K;  3FUD A;  1W2W A;  4ME2 A;  4Y6C A;  1VLT A;  2IM8 A;  3TWT A;  4HOT A;  5FQ8 A;  3GEE A;  3ZC4 A;  5FWQ A;  1YLM A;  5EKQ D;  1A41 A;  4I1M A;  4DRX E;  1LM3 B;  4CJO A;  4C3D A;  3QOU A;  4A63 B;  4JTC B;  3W8H A;  2WM9 A;  4U9D A;  3EU9 A;  4MVS A;  1VTM P;  4URK A;  1YYH A;  2GRP B;  2CDQ A;  4XQ1 A;  2AXZ A;  5AJL A;  1OT8 A;  3CK9 A;  3AG3 C;  1YAR O;  5HKP A;  1RMV A;  3G4X A;  3DSS A;  3HKK A;  1IQU A;  5H7P A;  3ZTZ A;  4XKC A;  2ASR A;  4L2L A;  4AEZ C;  4FUL A;  256B A;  3TWW A;  4MND A;  3HNI A;  3D9J A;  4XEK A;  3L54 A;  2QFC A;  1IZM A;  1HW1 A;  2C0L A;  5C1D A;  5BXO A;  2HV7 A;  3W9F A;  3WAQ A;  4MTO A;  3G2U A;  3JQ1 A;  3X2Q C;  5A6B A;  3TWQ A;  3S0X A;  3CSK A;  5JT4 A;  4O1O A;  3PUJ A;  1JUQ A;  1TN7 A;  3KSQ A;  4DUI A;  3V2O A;  2J0W A;  3NYL A;  3QW1 A;  3QK0 A;  3OXL A;  3HHM A;  4RVB A;  4XI0 A;  4MW8 A;  3KEZ A;  4F53 A;  2BF0 X;  3HXE A;  1QNF A;  3VM6 A;  4HVB A;  1OQC A;  1H2U A;  1NZN A;  2RD0 A;  3D9L A;  1BU9 A;  3MV2 B;  1V54 C;  5CEC B;  5CI8 A;  5GPG B;  3L17 A;  3R9A B;  2P0N A;  2Q9B A;  3DRA A;  2EIL E;  4GU5 A;  4DLO A;  4OIN F;  3ZNG A;  3FTX A;  3M1C B;  5KYN A;  5CRV A;  1NL4 A;  3B7B A;  1QZ2 A;  1LF8 A;  4W9R A;  3T8K A;  4ANU A;  5F5F A;  3PZ4 A;  2ZXP A;  3D9H A;  5ITZ F;  3U9M A;  2Y0B G;  2XLV A;  4GPK A;  3F6Q A;  2R05 A;  1CGO A;  1WTY A;  5A6C A;  2XS8 A;  3SF4 A;  4EBA A;  2J9V A;  1ELK A;  5JHA A;  1BZ4 A;  1DC2 A;  3MKQ B;  1H9T A;  5DQT A;  3G2T A;  5AGF A;  3LPZ A;  3H2U A;  4FX5 A;  4TUU A;  2XRY A;  3LY8 A;  3R7Q A;  2J0X A;  2IU1 A;  2HMZ A;  4I2Z A;  2QC9 A;  3L82 A;  3CVN A;  2XPI A;  5T3R A;  4YVQ C;  3ZVV A;  2EIM C;  4BJ1 A;  3M4C A;  2EPM X;  4AXH A;  3NG1 A;  2HZ8 A;  1L5J A;  3UKU G;  3GM3 A;  2FBN A;  1JCR A;  2UY1 B;  4P9T A;  4P6I C;  3OXF A;  3FMS A;  1NSG B;  3KH2 A;  5KYW A;  2IO2 C;  3ZHE A;  1PV3 A;  3HNL A;  4J0U A;  3FU5 A;  2JPU A;  2XM4 A;  3MLG A;  3JQ0 A;  1MX4 A;  3DJU B;  1MND A;  3MKR A;  3MA5 A;  5KJN A;  3DEO A;  2XEE A;  3TUL A;  4JEB A;  2IO3 C;  4WUY A;  2CNW D;  4YDO A;  2DWZ A;  2WQ7 A;  1XWJ A;  4GTP A;  5FQ7 A;  1S63 A;  2FO1 E;  2HO1 A;  3NQP A;  3T9O A;  3QC1 A;  3T6B A;  4YL1 A;  1YJG A;  2E87 A;  3FDQ A;  5D66 A;  1FVF A;  4GYT A;  3ZIM A;  5CBN A;  2V8S E;  3IHY A;  3EIQ C;  4ACL A;  2QNL A;  3SXY A;  2IF4 A;  1MMA A;  1OW6 A;  2W45 A;  4KZ0 A;  2Y3H A;  4WJ0 A;  3U2M A;  1OCO C;  4BFR A;  3FEY A;  3V5X A;  5E3C A;  3MZL B;  4B8A A;  2EIN E;  1BI8 B;  5B1B E;  4EUK B;  4HE8 D;  2G3K A;  5DBK A;  1NU7 D;  4F4B A;  3SQV A;  3VLD A;  1YA7 O;  5COM A;  3SXK A;  2I15 A;  2OOE A;  5HS0 A;  3ZEF A;  5AJD A;  4WWN A;  1BR4 A;  4IAO A;  3ESL A;  4G2V A;  3EHM A;  3CHO A;  3KAE A;  2ZIR A;  1M6T A;  4HLE A;  3G4Z A;  3S7B A;  2YLG A;  1FPP A;  3Q6N A;  4GTO A;  1ZU4 A;  3SEO A;  2BL2 A;  1UW4 B;  3PRZ A;  3LS0 A;  3CVQ A;  1H6K A;  1M2V A;  3LXU X;  2VB6 A;  5K0I A;  4IYP A;  1J8M F;  3Q7F A;  3TXN A;  4PK4 A;  2J7P D;  3O48 A;  2XSE A;  4AY6 A;  3O55 A;  3C3Q A;  4E6H A;  3UI2 A;  3KMI A;  4XEF A;  4N2Q A;  2LSE A;  1N0R A;  1YZA A;  3W2V A;  1TNY A;  2RD9 A;  2KYH A;  3C62 A;  5EIB E;  4Z9I A;  3QZC A;  4YK5 A;  3RVY A;  4QDL A;  1Q0K A;  4F1P A;  4QQI A;  3BUA A;  1TR2 A;  4N3A A;  4TUM A;  2M64 A;  5FZR A;  2HFI A;  3TJP A;  3ZYM A;  4BET A;  4CX9 A;  3K1I A;  4OAV B;  5L0D A;  4I1A A;  3SXM A;  2XQ0 A;  2ZXW E;  5FCL A;  3LJN A;  3ESK A;  2PM7 A;  3ABL E;  2LFF A;  5DIZ A;  1T6Q A;  5CMY A;  3M4B A;  4GEH A;  3V7O A;  3NKE A;  3GZ2 A;  3DSU A;  2YWA A;  2P9U G;  2MWQ A;  4FAP B;  3GWL A;  4HBD A;  2Y3G A;  4LDR A;  3HIZ A;  2DI3 A;  2KC7 A;  2L9B A;  4HFF B;  5BQI A;  4A3V A;  3SZ7 A;  2HKV A;  3HNJ A;  1HO8 A;  1Z5S C;  4C0E A;  5EDS A;  4N4W A;  3JYS A;  3IQ6 A;  3CQG B;  4JZA A;  1HXI A;  3APF A;  2X6H A;  5B3I A;  5ENQ D;  5BW8 C;  3QVY A;  3POV A;  1LD7 A;  2A5U A;  2A0U A;  3QJZ A;  3Q79 A;  3FTV A;  3NF1 A;  4YDW A;  4EHP A;  1JCS A;  4FES A;  2JLB A;  2Q7F A;  4JXT A;  4IGG A;  3VAY A;  1E96 B;  1P5Q A;  4WND A;  2PF4 E;  2L6J A;  3NBN B;  4BJ5 C;  4JCZ A;  4DVY P;  1B68 A;  1INZ A;  4JEH A;  4DX5 D;  2FEZ A;  4KMO A;  2H7V C;  3O10 A;  1ST6 A;  4K0D A;  4NTB A;  1YDI A;  3WG7 E;  4CDR A;  3C8Z A;  3IQT A;  3W2W A;  3ZWI A;  2L9J A;  5G04 J;  2C2L A;  4HB5 A;  2KCL A;  2WVQ A;  1NA0 A;  3E4B A;  2I1J A;  4E0H A;  4C48 B;  3LES A;  2YHC A;  3EPV A;  4AY5 A;  5L0J A;  4UQX A;  1Y6I A;  3AG2 C;  1ZW3 A;  4QI0 A;  4XLP F;  3QWV A;  4MVM A;  2ETB A;  3SFX A;  1N4Q A;  5ENO D;  3LEO A;  4GAA A;  3JT1 A;  3GZS A;  4IRU A;  4CGV A;  3RRM B;  4UI9 J;  4CDN A;  3AG1 C;  5E75 A;  3URZ A;  4GTV A;  2WQ6 A;  2YQY A;  5KYU A;  1OCZ E;  5BUZ A;  4XWJ A;  3ASN E;  4RLY A;  2GRQ B;  1F1M A;  1K05 A;  3RW0 A;  3F47 A;  3NYJ A;  2EPL X;  4AX2 A;  2WXR A;  3Q5M A;  4U8V D;  4JHK A;  2VTB B;  1OCR C;  5LOZ A;  3RYL A;  3SHF A;  4XIF A;  5A6K A;  3UMH A;  2J9B A;  3JRM O;  4XKB A;  2GA0 A;  2NYJ A;  3PS6 A;  4U5D E;  1VMA A;  5KCM A;  4YT5 A;  2IXP A;  3TOL A;  1PCX A;  1BPO A;  4ILI A;  3MFN A;  3ZXP A;  4JHJ A;  3PHF 2;  2NUT A;  3D9M A;  2ICW G;  4GZD A;  4PS8 A;  4YT4 A;  4LDQ A;  4CS8 A;  2VJ8 A;  3JUE A;  3NOG D;  3LEV A;  4K1O A;  4JEU A;  5CER B;  4F7A A;  4P29 A;  3ZRH A;  3FH5 A;  3QW0 A;  3SO8 A;  3FU3 A;  1OKK D;  1OW8 A;  3RRN B;  3SFY A;  2KSF A;  2R7Q A;  3FAP B;  3FTW A;  2CG3 A;  3RH3 A;  4MBG A;  5BV0 A;  3AQC A;  1O87 A;  2AP3 A;  4M3O A;  1XZQ A;  2AU5 A;  3ULE G;  3ASH A;  1MX2 A;  4GTR A;  5L0C A;  3T6J A;  1QZX A;  5KYY A;  2KZT A;  3NZU A;  2HSQ A;  4EBA G;  2VH3 A;  4JB8 P;  5DQZ A;  4E0I A;  5LX8 A;  1OW7 A;  4D4N A;  2ETC A;  2I8B A;  4R32 A;  5IY5 E;  2VYI A;  1TKN A;  4GA0 A;  3R7C A;  4AE4 A;  1LIH A;  5JP7 A;  2VGE A;  2RSE B;  4OIR F;  2WZL A;  1NZE A;  2WB7 A;  5CCL A;  4DXW A;  4BTB A;  3UTM A;  1RJ9 B;  2RG8 A;  5L0I A;  2XXA A;  5FZS A;  5T8I A;  4R7L A;  3FVY A;  3ZG1 A;  3E34 A;  4G8K A;  1H2V C;  2RFA A;  4UDV A;  1MX6 A;  2RKK A;  4LCT A;  5KNG A;  4A55 A;  1SW6 A;  3J06 A;  2F0Y A;  5HSW A;  4XTK A;  1E7U A;  2MYO A;  2OCC C;  4O6F A;  1XGW A;  1H2T C;  3K66 A;  2KBX A;  5G04 C;  3CKC A;  4ZLD A;  2HE0 A;  2A69 F;  4YDE A;  2YLI A;  3GM2 A;  2R5S A;  3TWX A;  3H65 A;  4B89 A;  2OU6 A;  4ANX A;  5HRY A;  3T5V A;  2EPK X;  1IQR A;  3TAX A;  3U3F A;  2VSO E;  1WY6 A;  3VTX A;  2Y69 C;  3I4G A;  2G62 A;  1BI7 B;  2P61 A;  1TFO B;  3IQC A;  1H6P A;  1AP7 A;  4K7B A;  3QKY A;  4E7Z A;  3OTN A;  1JCQ A;  4PDX A;  4HOQ A;  3B9Q A;  3EGX B;  3C3R A;  2MYS A;  4EWC A;  3JXJ A;  1Z7Q c;  3UPV A;  2LSU A;  1S0P A;  4HRM B;  3G2V A;  3I5P A;  2EPO A;  3O39 A;  4HNA D;  1JWG A;  4ABN A;  2IXN A;  3PDM P;  3O6X A;  4NTA A;  1APC A;  5CI9 A;  4G7Z F;  5JRA A;  5FIO A;  4BEM J;  1Z3I X;  3C3O A;  4WAF A;  3R7R A;  5KNH D;  3LVQ E;  3ASO C;  2J8W A;  2KJG A;  4PAC A;  4LER A;  4GA1 A;  2GW1 A;  5CIV A;  3D9K A;  4PJM A;  5ARF A;  3ZW3 A;  1H9G A;  4N39 A;  2WL8 A;  3TOM A;  2Y4T A;  2VSX E;  3C7J A;  1FCH A;  4JTA B;  4ZLC A;  3ZFW A;  3D9I A;  1OUV A;  3KPH A;  4MVU A;  5JLI A;  4XPW A;  3Q7G A;  3TJ6 A;  4L9P A;  2IXM A;  4FHK A;  2MRI A;  4B94 A;  2R03 A;  4U5G A;  4O7G A;  4H4K C;  1U6H A;  3A11 A;  2WZF A;  3C18 A;  1QKR A;  1WOL A;  4AM9 A;  3FXH A;  5KYW B;  2B6C A;  3B7U X;  1HE1 A;  2P9P G;  5HV9 A;  5G55 A;  2Q9C A;  2WVI A;  1TQG A;  2WXP A;  1YAU O;  2Y4U A;  3DD7 A;  1FT1 A;  1HE8 A;  2J9Q A;  5JHB A;  2XRH A;  2CCY A;  2FI7 A;  1FFT C;  1DNP A;  3NB2 A;  5L0H A;  1V55 C;  2QZA A;  3FWV A;  3S84 A;  1MYO A;  4F6R D;  4BG0 A;  1JPN A;  4N6H A;  2WXJ A;  4F3V A;  3L0I A;  2WXF A;  3U0C A;  2DVW A;  1EI7 A;  1ZYR F;  4UWK A;  1ZVZ A;  2Y1L E;  1Z63 A;  2W9Y A;  4OYS A;  1NG1 A;  1E8Z A;  2MHK A;  1JPJ A;  2EIJ E;  4PS3 A;  4QI2 A;  2IJG X;  3OA1 A;  3U3W A;  4RG9 A;  4EQF A;  4IWB A;  4G7O F;  5A6J A;  5KYX B;  3QNK A;  2R7T A;  2LAH A;  2L81 A;  4LAC B;  1HG5 A;  3MCX A;  2UUI A;  3PRE A;  3JSZ A;  4U63 A;  3HJC A;  3BEH A;  1WWP A;  5BPP A;  2I2O A;  1R5I D;  2Y3B A;  5AQ9 A;  3ECS A;  4L1B A;  4XZ4 A;  2LK4 A;  2OJE D;  4PH4 B;  4BX9 A;  4GML A;  2WXI A;  2PP4 A;  4CIH A;  5AC5 A;  4RQI A;  2PX0 A;  2VGX A;  1Z23 A;  3LKU A;  2A6E F;  2WXQ A;  4EKW A;  1LVK A;  3T5X A;  3EZI A;  2VAS A;  3BU8 A;  2FFH A;  5JJ7 A;  5AAO A;  1KZP A;  3ZPJ A;  4BWR A;  4N3C A;  3T9K A;  2X6F A;  5M72 A;  1KLX A;  5COF A;  5T3T A;  3E33 A;  4I2W A;  2Q9A A;  2EPN A;  2X3M A;  4APF A;  2HSB A;  3AG3 E;  4JEA A;  2J09 A;  2CNW A;  2OEV A;  2R59 A;  1WN0 A;  2YL3 A;  3RF3 A;  3ZKJ A;  3FH7 A;  4MVO A;  1RKE A;  1SZA A;  2XLM A;  2LAI A;  5B1A C;  2DB4 A;  2YHS A;  3UM2 A;  4KNW A;  4G7H F;  1RCP A;  4CJG A;  2P7V A;  4DI3 A;  5AQB A;  2GRO B;  1O1T A;  1TNO A;  5KBA A;  4G24 A;  1YYX A;  2BUG A;  1V4A A;  2WXH A;  3FUE A;  3UX4 A;  5JJ6 A;  3X2Q E;  3IEG A;  3DKA A;  4U5E E;  3KEA A;  2KGO A;  3L13 A;  2IYL D;  1ELW A;  3C98 A;  1BR2 A;  3LY9 A;  5JJT A;  3LDZ A;  1LE2 A;  2P6V A;  2EIL C;  3UIN C;  3P2B A;  2ZU6 B;  3UXG A;  3SD5 A;  2WVN A;  4MVQ A;  1TWC A;  1CPR A;  5A7D B;  3E30 A;  3NZS A;  4FLB A;  2ETS A;  2GRR B;  3PZ3 A;  4BJ5 A;  3FY4 A;  1V54 E;  2JEK A;  4KNV A;  3DJN B;  3EZH A;  2A1D D;  4KC9 A;  2HR2 A;  3GAN A;  2I9C A;  4DX2 A;  2PNO A;  3EGD A;  4NIK A;  3AG4 E;  5AIJ A;  2LNI A;  4JJG A;  3J5P A;  1ZHY A;  1YCS B;  3IKO B;  4KZC A;  2WVO A;  1LI5 A;  4JW1 A;  3SP1 A;  4FA6 A;  3AS8 A;  1TJF A;  3TWS A;  4G0H A;  1NBB A;  4HFG A;  5AEN A;  2QE9 A;  5FTP A;  5BXU A;  4H7X A;  3U2L A; 
#chains in the Genus database with same CATH homology
 2IXO A;  3LJB A;  3CLJ A;  3JCU Q;  1SZI A;  2WXL A;  2V5F A;  2YIN A;  1ZHW A;  3PEV B;  1HG2 A;  3S28 A;  4J8E A;  4JA7 A;  5CCM A;  5ANR A;  2CHX A;  1D0Z A;  2DCP A;  5KYU B;  1Z3Y A;  2KQ9 A;  4OD4 A;  2OVB A;  3ASF A;  5G2N A;  1M2O A;  3LJ3 A;  3Q15 A;  1XNF A;  3PUK A;  5A23 A;  4JVS A;  4O6N A;  2ZXO A;  3HLZ A;  4GMJ A;  4U8H A;  2PX3 A;  5E3A A;  2NUT B;  2VGY A;  3BEE A;  5DS6 A;  4C0M A;  1ZU5 A;  4BT8 A;  1IW7 F;  3RIB A;  5KJL A;  3CIA A;  4I6J A;  4JA9 A;  2VSY A;  3K7D A;  4B0Z A;  5CHE E;  4E85 A;  3PNL B;  2KCV A;  3ZYQ A;  2Y3A A;  2W4B A;  4U0S A;  4UWL A;  3UMV A;  3CHP A;  3RFY A;  4AE4 B;  3EDT B;  4EZK A;  2OV8 A;  2A6H F;  3E70 C;  3QDN A;  4CT4 A;  4I3M A;  4UI9 K;  4NUR A;  4EZJ A;  4WWP A;  2XXA B;  2YQ8 A;  3MJW A;  4GCO A;  4FU3 A;  3APC A;  4Q96 A;  4I44 A;  3ML8 A;  1JPL A;  5B3S C;  4CBE A;  4HS2 A;  4HOU A;  3QAQ A;  4A2N B;  4GZ6 A;  4U0U A;  4BSX A;  3FUH A;  1H19 A;  2KCK A;  4DK5 A;  3CSF A;  4J6I A;  2AW6 A;  2M63 A;  3TG4 A;  3B0V C;  4G11 A;  3ABK C;  1BR1 A;  4NY3 A;  3RJV A;  1QLE C;  2NXP A;  3PE4 A;  2WXK A;  4XX5 A;  3CK7 A;  5BNW A;  4LLC A;  4G26 A;  4CT0 A;  2OVF A;  4OVU A;  1NP7 A;  3FU0 A;  1HU3 A;  1HH8 A;  4GA2 A;  1FFH A;  3DZA A;  2R7S A;  4DPR A;  3WG7 C;  3L22 A;  2R7U A;  2R7V A;  1OWO A;  3ABM C;  4EEC A;  3EH1 A;  3S7J A;  5KJK A;  2EIK C;  1D1B A;  3JCK C;  2Y39 A;  1B89 A;  4JUR I;  1VOM A;  5LCW J;  2UY1 A;  2IOS A;  3CK8 A;  4W8K A;  3S29 A;  1D0X A;  2MOW A;  5DLJ A;  5BV1 A;  3RKO F;  2KAT A;  2WXO A;  3FH8 A;  1TWH A;  4ANW A;  3FAJ A;  3UT4 A;  5CMW A;  4ANV A;  3ONL A;  4GYW A;  3ZXS A;  4DOZ A;  3PNT B;  4Q69 A;  2XGO A;  2WXG A;  1W3B A;  2VSN A;  4GB9 A;  2GGF A;  2PQN A;  4DBR A;  4KT6 B;  5DVW A;  4JPS A;  2J9W A;  2XCB A;  4PFP A;  3AQB A;  1Y8M A;  2YHE A;  2J45 A;  3LLK A;  2XCC A;  4JL0 A;  3LAY A;  1UG3 A;  2XPZ A;  2R7X A;  2FUL A;  1U3D A;  5ANL A;  4Y6W A;  3U64 A;  4JC8 A;  4KVO A;  4RSY A;  1M56 C;  4NRH B;  3TG5 A;  3IV0 A;  3LEW A;  4PS7 A;  3PMR A;  3PDN A;  1Z6A A;  3SNH A;  1KT1 A;  2E2E A;  5DS4 A;  2DYR C;  2J08 A;  3DM5 A;  2QY9 A;  3PVL A;  3Q47 B;  1PD1 A;  3FUI A;  1PC2 A;  5D91 A;  3TL5 A;  2DBA A;  4FP7 A;  2J46 A;  3FDH A;  4AP2 A;  4KI2 A;  2H7B A;  1E8X A;  3EQL F;  3S7F A;  4RBN A;  4U5F E;  4FJZ A;  3L08 A;  3LNR A;  4UWF A;  2YZS A;  4C3B A;  3BG1 B;  1M57 C;  3FUJ A;  5LCW C;  3DM9 B;  4UI9 C;  1D1C A;  4XI9 A;  5AYW D;  3NKD A;  4U0Z A;  4A3T A;  2WXM A;  4WWO A;  1D0Y A;  3L6A A;  3SBS A;  4PJN A;  3LS8 A;  2H7O A;  3QWP A;  3B0U X;  3FUF A;  3FHD A;  4AV7 A;  5ENN A;  1OCC C;  1PAQ A;  4AJW A;  1OWL A;  3B0P A;  5EGY A;  3UGO A;  3EG9 A;  3S27 A;  3VTY A;  3WXX A;  3EGD B;  3SNX A;  4BJT A;  4YT8 A;  4I9E A;  2FF4 A;  3UMI A;  3B7T A;  4PFO A;  4N3B A;  2DIW A;  2J4B A;  3LVR E;  3TD7 A;  3ZYL A;  5L3V A;  3CVV A;  4XLN F;  2WQH A;  3UMK A;  3IEE A;  1H0A A;  4X0R A;  1UJJ A;  1KT0 A;  3UUX A;  4LRZ A;  1SF8 A;  3LY7 A;  4ILH B;  1Z3X A;  1EDU A;  3N2Z B;  4AK9 A;  1HFA A;  4NQ0 A;  3ZHE B;  1VK5 A;  4G23 A;  3U9W A;  4MLP A;  4U5C E;  1FMW A;  4C7O A;  2XPY A;  3RIP A;  3RRU A;  3SFZ A;  3I4R B;  3W8I A;  1ZHX A;  3T4R A;  3CST A;  5D0O D;  3IHV A;  3QAR A;  4OD5 A;  4IN3 B;  1ZBP A;  3ZN3 A;  2XEV A;  1UJK A;  3D9O A;  3I4U A;  3U66 A;  4D10 C;  3QB2 A;  3PH0 C;  4ULW A;  2XHE A;  3RO2 A;  3ZGQ A;  4CSA C;  2QY7 A;  5HI7 A;  3SGH A;  4PUC A;  3HVE A;  4GYO A;  2NUP A;  4B8C B;  1IHG A;  2QTV A;  3AU4 A;  1SZ9 A;  2X6J A;  1OWM A;  2ZPA A;  2C03 A;  2M4E A;  3KKB A;  4PJJ A;  4BT9 A;  5G05 J;  5T1D B;  3CVP A;  4Q94 A;  4HEA J;  4PJL A;  2PQR A;  4FJY A;  4L7T A;  3ASD A;  1LS1 A;  2O9X A;  4RD9 A;  2C04 A;  2V4L A;  1E8W A;  1M2V B;  1FVH A;  4MKT A;  1RJ9 A;  4FLH A;  5KJM A;  2W4M A;  3KS2 A;  2YNQ A;  4I9C A;  4OIO F;  2VQ2 A;  1VYK A;  2A4Z A;  2EQX A;  2JD3 A;  4I43 A;  2HYZ A;  2E0I A;  2R7O A;  2AWI A;  2R7W A;  3CVL A;  3PEU B;  4CS7 A;  5BUO A;  3P1U A;  4U5B E;  4JJF A;  4MQ9 F;  4BX8 A;  3MX3 A;  3QWW A;  1TWA A;  3CVW A;  2Q3T A;  4K0R A;  3OXG A;  3PZD A;  3HYM B;  3EGX A;  3X1O A;  1ZU2 A;  4N06 A;  4BJ6 C;  1N52 A;  1EYH A;  3Q7L A;  1O5H A;  3WOD F;  3EJN A;  2R17 C;  3UT7 A;  4IUL A;  2X38 A;  2FO7 A;  2HV6 A;  4EBB A;  3TXM A;  3AG4 C;  1PD0 A;  3DBS A;  4CS9 A;  4Q7C A;  4CCA A;  3Q4A B;  2WMO A;  3G2S A;  4L2Y A;  1MMG A;  3HDX A;  2J7P A;  3EH2 A;  3AU5 A;  4WNF A;  4KVM A;  3CHQ A;  1D1A A;  3SI5 A;  3JRT A;  3ZSU A;  2NC9 A;  2GRM A;  5LP0 A;  4WNE A;  3I5Q A;  4Q4Z F;  4YWQ A;  2XRZ A;  3OWT A;  3D9N A;  2CW0 F;  5G05 C;  4DVZ A;  3RK6 A;  2X6I A;  2V3C C;  1Z5Z A;  3LYA A;  3FUM A;  4K03 A;  4MS6 A;  4HFK B;  3CHS A;  3GOD A;  3SYN A;  3EFO A;  3FUL A;  3SZR A;  1E8Y A;  3RO3 A;  5FJY A;  2BTD A;  2EIN C;  3I3N A;  5B1B C;  3ML9 A;  4I6E A;  2I1K A;  4DJA A;  4FHJ A;  3FP3 A;  3N71 A;  1WGW A;  2BE5 F;  4L23 A;  2J07 A;  4TRQ A;  2V0P A;  4JZY A;  3LLI A;  1N54 A;  4FAD A;  3VYW A;  5KYX A;  4G1T A;  3U4T A;  2PFD A;  4G25 A;  4HOR A;  3EHN A;  2A68 F;  1IYG A;  4I1O B;  4KBQ A;  4C3E A;  2PM6 A;  3SBT B;  5KYY B;  2KZT B;  5E76 A;  4EZL A;  2LO6 A;  1MMN A;  3KD7 A;  2DYS C;  1OWN A;  5T3W A;  3AS4 A;  4DI4 A;  3DAG A;  2L0T B;  3K33 A;  3ZIB A;  4U04 A;  2ZXW C;  3FTZ A;  3ABL C;  3FFL A;  3CV0 A;  5BT1 A;  1MHQ A;  2CHW A;  2V26 A;  4O6M A;  1UN8 A;  4OIQ F;  3OEO A;  4AOF A;  3DPD A;  4BEJ A;  2YEV A;  1NU9 C;  1MMD A;  1VDY A;  3MV3 B;  3LS1 A;  3CVX A;  1KU2 A;  2B0J A;  3O4Z A;  1N1C A;  4GYY A;  3AS5 A;  1OKK A;  2CGE A;  3FUN A;  4CDM A;  2XGM A;  4FC8 A;  4FWV A;  3FTS A;  3VLE A;  3FHE A;  3MKQ A;  2ILR A;  5LFA A;  4N2S A;  5E2Q A;  5ARG A;  4EPZ A;  2DGJ A;  3K1H A;  4CS9 C;  3VLF A;  3RU0 A;  4I6G A;  3HTK C;  4U07 A;  2XGS A;  4JHR A;  1EF1 C;  1EPU A;  3ITF A;  1A17 A;  3D3M A;  3NYM A;  2WPV A;  2Z15 A;  3EG9 B;  2J9U A;  4A1G A;  2X51 A;  5J90 A;  5D0Q D;  1GW6 A;  4RDA A;  1X5B A;  4H7Y A;  1E90 A;  2J49 A;  1OCZ C;  3FUK A;  3ASN C;  3UNG C;  5E33 A;  2GFH A;  5DS5 A;  4HOS A;  2ION A;  2D5R B;  4V3I A;  2OG2 A;  3CGH A;  3K9I A;  2KW3 C;  3E9V A;  2ZXR A;  2NG1 A;  2FGY A;  1SMY F;  2GRL A;  4YND A;  1PY1 A;  4NAC A;  1HF8 A;  5J08 A;  3T8M A;  4CRW A;  4C7O B;  1TJC A;  4CSA A;  5FQ4 A;  3DXJ F;  3CQC B;  3CVY A;  1QQE A;  4UQY A;  1J8Y F;  2OND A;  2WZG A;  3Q6M A;  1VYI A;  4F1S A;  4CGW A;  2WMN A;  5T4Y A;  2AXV A;  2IFU A;  3UQ3 A;  1HX8 A;  3UR3 C;  1WM5 A;  1HS6 A;  4ANJ A;  1SQM A;  4QFV A;  1ZHZ A;  2AXU A;  4B6I A;  3CHR A;  5IY5 C;  2XL4 A;  4RG6 A;  1G8X A;  3GW4 A;  1S7Z A;  3HVE B;  4E7S A;  2NUP B;  3KL4 A;  5FZQ A;  3DMD A;  2KM4 A;  5C2Y A;  3CKB A;  4Q5S F;  3PE3 A;  2IOQ A;  3CR3 A;  2J4D A;  1FMV A;  3N0T A;  3RKV A;  2CFU A;  2VGX B;  3IBE A;  3B7S A;  4DLQ A;  1DVP A;  3FU6 A;  4GZ3 A;  1Z6T A;  2IQC A;  3QMK A;  1MNE A;  2L0I A;  4JCH A;  2IOL A;  4BTA A;  2P58 C;  1WAO 1;  1YA0 A;  3L16 A;  4AVX A;  3ENE A;  3K6B A;  3G2W A;  2UWJ G;  4XE0 A;  1FTS A;  4GZC A;  4I17 A;  3CEQ A;  2C0M A;  1OWP A;  3K1I C;  4J32 B;  3CQZ A;  3Q49 B;  4BJ6 A;  2WB2 A;  4GZ5 A;  1LKX A;  1UN9 A;  3N24 A;  2CFZ A;  4OVV A;  2I6H A;  4J30 B;  4KXK B;  3DAF A;  3B7R L;  4LEU A;  3S7D A;  1TEZ A;  4N5C A;  3BG0 B;  3LCA A;  4KYO B;  4HXI A;  3NDB B;  4AIF A;  3APD A;  3ASG A;  4LUN U;  4O79 A;  3CZ6 A;  4YJW A;  3ULQ A;  4BY6 A;  4M63 A;  3OAW A;  3JYH A;  5EX0 A;  4CEM A;  3MGB A;  4UWG A;  2PL2 A;  2WXN A;  1ELR A;  5HQ8 A;  4YN0 B;  3MYV A;  3FTU A;  4WNG A;  4YT2 A;  3CHM A;  3D9P A;  3FEX A;  3GZ1 A;  5EX3 A;  3JUI A;  4TV3 A;  1ZHT A;  4MRU A;  4O6Y A;  4GCN A;  3UGP A;  5F5H A;  2VTB A;  1E7V A;  2R7R A;  4J8F A;  4KBL A;  3MEK A;  4ACK A;  1MQS A;  4UQZ A;  3NRH A;  4U5H A;  1HZ4 A;  5FQ6 A;  2PZI A;  3ONK A;  4APO A;  3GYZ A;  3TGO A;  4UWH A;  3B13 A;  1NA3 A;  1TWG A;  4J8S A;  4DBQ A;  4ILG A;  3EFO B;  2X6K A;  3ZVR A;  2HM8 A;  2EIJ C;  2G3V A;  4LLE A;  4OIP F;  4C9B B;  4IJJ A;  5D92 A;  2AVP A;  2NSZ A;  3F46 A;  5FT9 A;  4YVO A;  3EIJ A;  3L34 A;  3FTY A;  2CG2 A;  2KNH A;  3CVU A;  4J8D A;  2Y3D A;  5EHH A;  3S2A A;  4ATG A;  4CS8 C;  3UT8 A;  3ZYK A;  1U3C A;  2LSV A;  5L3Q A;  1JWF A;  2CHZ A;  4A1S A;  3FUD A;  1W2W A;  4ME2 A;  4Y6C A;  4HOT A;  5FQ8 A;  3ZC4 A;  5FWQ A;  5EKQ D;  4I1M A;  4C3D A;  3QOU A;  3W8H A;  2WM9 A;  4URK A;  2CDQ A;  2AXZ A;  5AJL A;  3CK9 A;  3AG3 C;  1IQU A;  4XKC A;  4AEZ C;  4L2L A;  4FUL A;  4MND A;  3D9J A;  3L54 A;  2QFC A;  1IZM A;  2C0L A;  5C1D A;  2HV7 A;  3G2U A;  3JQ1 A;  3X2Q C;  3S0X A;  3CSK A;  3PUJ A;  1JUQ A;  2J0W A;  3NYL A;  3QK0 A;  3OXL A;  3HHM A;  4RVB A;  4XI0 A;  3KEZ A;  4F53 A;  2BF0 X;  1QNF A;  4HVB A;  1H2U A;  1NZN A;  2RD0 A;  3D9L A;  3MV2 B;  1V54 C;  5CI8 A;  3L17 A;  3R9A B;  2Q9B A;  4GU5 A;  4DLO A;  4OIN F;  3FTX A;  3M1C B;  5KYN A;  1QZ2 A;  1LF8 A;  4W9R A;  4ANU A;  5F5F A;  2ZXP A;  4GPK A;  5A6C A;  3SF4 A;  4EBA A;  2J9V A;  1ELK A;  5JHA A;  3MKQ B;  5DQT A;  3G2T A;  3LPZ A;  4FX5 A;  4TUU A;  2XRY A;  3LY8 A;  3R7Q A;  2J0X A;  2IU1 A;  4I2Z A;  3CVN A;  2XPI A;  5T3R A;  4YVQ C;  3ZVV A;  2EIM C;  4BJ1 A;  4AXH A;  3NG1 A;  1L5J A;  2FBN A;  2UY1 B;  4P6I C;  3OXF A;  3KH2 A;  5KYW A;  3ZHE A;  4J0U A;  3FU5 A;  3MLG A;  3JQ0 A;  3DJU B;  1MND A;  3MKR A;  3MA5 A;  5KJN A;  4WUY A;  2CNW D;  2WQ7 A;  5FQ7 A;  2HO1 A;  3NQP A;  3QC1 A;  3T6B A;  2E87 A;  3FDQ A;  1FVF A;  4GYT A;  3ZIM A;  2V8S E;  3IHY A;  3EIQ C;  4ACL A;  2IF4 A;  1MMA A;  2W45 A;  4KZ0 A;  2Y3H A;  4WJ0 A;  1OCO C;  4BFR A;  3FEY A;  5E3C A;  3MZL B;  4B8A A;  4HE8 D;  2G3K A;  5DBK A;  1NU7 D;  4F4B A;  3VLD A;  2OOE A;  3ZEF A;  5AJD A;  4WWN A;  1BR4 A;  4IAO A;  3ESL A;  4G2V A;  3EHM A;  3CHO A;  3KAE A;  4HLE A;  3S7B A;  3Q6N A;  1ZU4 A;  3SEO A;  3PRZ A;  1UW4 B;  3LS0 A;  3CVQ A;  1H6K A;  1M2V A;  3LXU X;  2VB6 A;  4IYP A;  1J8M F;  3TXN A;  4PK4 A;  2J7P D;  3O48 A;  2XSE A;  4AY6 A;  4E6H A;  4N2Q A;  3KMI A;  2LSE A;  3W2V A;  3QZC A;  4QDL A;  1TR2 A;  4N3A A;  5FZR A;  3TJP A;  3ZYM A;  4I1A A;  2XQ0 A;  5FCL A;  3ESK A;  2PM7 A;  5DIZ A;  5CMY A;  4GEH A;  3V7O A;  3NKE A;  3GZ2 A;  2MWQ A;  2Y3G A;  3HIZ A;  2KC7 A;  2L9B A;  4HFF B;  4A3V A;  3SZ7 A;  1HO8 A;  4C0E A;  5EDS A;  3JYS A;  3CQG B;  4JZA A;  1HXI A;  3APF A;  2X6H A;  5BW8 C;  3POV A;  2A5U A;  3QJZ A;  3FTV A;  3NF1 A;  4FES A;  2JLB A;  2Q7F A;  4JXT A;  3VAY A;  1E96 B;  1P5Q A;  4WND A;  2PF4 E;  2L6J A;  4BJ5 C;  4DVY P;  1INZ A;  4JEH A;  2FEZ A;  4KMO A;  2H7V C;  1ST6 A;  4K0D A;  4CDR A;  3W2W A;  2L9J A;  5G04 J;  2C2L A;  2KCL A;  2WVQ A;  1NA0 A;  3E4B A;  2I1J A;  3LES A;  2YHC A;  3EPV A;  4AY5 A;  4UQX A;  1Y6I A;  3AG2 C;  4QI0 A;  4XLP F;  3QWV A;  4GAA A;  3JT1 A;  3GZS A;  4IRU A;  4CGV A;  3RRM B;  4UI9 J;  4CDN A;  3AG1 C;  5E75 A;  3URZ A;  2WQ6 A;  5KYU A;  5BUZ A;  4XWJ A;  4AX2 A;  3F47 A;  3NYJ A;  2WXR A;  3Q5M A;  2VTB B;  4JHK A;  1OCR C;  5LOZ A;  3RYL A;  3SHF A;  4XIF A;  3UMH A;  4XKB A;  3PS6 A;  4U5D E;  1VMA A;  5KCM A;  4YT5 A;  2IXP A;  4ILI A;  1PCX A;  1BPO A;  4JHJ A;  3PHF 2;  2NUT A;  3D9M A;  4GZD A;  4PS8 A;  4YT4 A;  4CS8 A;  2VJ8 A;  3LEV A;  4JEU A;  4F7A A;  4P29 A;  3ZRH A;  3FH5 A;  3FU3 A;  1OKK D;  3RRN B;  2R7Q A;  3FTW A;  2CG3 A;  3RH3 A;  5BV0 A;  3AQC A;  1O87 A;  4M3O A;  3ASH A;  3T6J A;  1QZX A;  5KYY A;  2KZT A;  3NZU A;  4EBA G;  2VH3 A;  5DQZ A;  5LX8 A;  2I8B A;  2VYI A;  1TKN A;  4GA0 A;  4AE4 A;  4OIR F;  2WZL A;  1NZE A;  2WB7 A;  5CCL A;  4BTB A;  1RJ9 B;  2RG8 A;  2XXA A;  5FZS A;  5T8I A;  4R7L A;  3FVY A;  3ZG1 A;  1H2V C;  4LCT A;  4A55 A;  5HSW A;  4XTK A;  1E7U A;  2OCC C;  4O6F A;  1XGW A;  1H2T C;  3K66 A;  5G04 C;  3CKC A;  4ZLD A;  2A69 F;  2R5S A;  3H65 A;  4B89 A;  4ANX A;  3T5V A;  1IQR A;  3TAX A;  2VSO E;  1WY6 A;  3VTX A;  2Y69 C;  3I4G A;  2G62 A;  4K7B A;  3QKY A;  4E7Z A;  3OTN A;  4PDX A;  4HOQ A;  3B9Q A;  3EGX B;  2MYS A;  4EWC A;  3UPV A;  2LSU A;  1S0P A;  3G2V A;  3I5P A;  3O39 A;  1JWG A;  4ABN A;  2IXN A;  3O6X A;  5CI9 A;  4G7Z F;  1Z3I X;  4WAF A;  3R7R A;  3LVQ E;  3ASO C;  2KJG A;  4LER A;  4GA1 A;  2GW1 A;  3D9K A;  4PJM A;  5ARF A;  3ZW3 A;  4N39 A;  2WL8 A;  2Y4T A;  2VSX E;  1FCH A;  4ZLC A;  3ZFW A;  3D9I A;  1OUV A;  3Q7G A;  2IXM A;  4FHK A;  2MRI A;  4B94 A;  4U5G A;  4O7G A;  4H4K C;  2WZF A;  4AM9 A;  5KYW B;  3B7U X;  5G55 A;  2Q9C A;  2WVI A;  2WXP A;  2Y4U A;  3DD7 A;  1HE8 A;  2J9Q A;  5JHB A;  2XRH A;  2FI7 A;  1FFT C;  1DNP A;  1V55 C;  3FWV A;  4BG0 A;  1JPN A;  2WXJ A;  4F3V A;  3L0I A;  2WXF A;  1ZYR F;  4UWK A;  1Z63 A;  2W9Y A;  4OYS A;  1NG1 A;  1E8Z A;  2MHK A;  1JPJ A;  4PS3 A;  4QI2 A;  2IJG X;  3OA1 A;  3U3W A;  4RG9 A;  4EQF A;  4IWB A;  4G7O F;  5KYX B;  3QNK A;  2R7T A;  2LAH A;  2L81 A;  4LAC B;  1HG5 A;  3MCX A;  3PRE A;  3JSZ A;  4U63 A;  3HJC A;  5BPP A;  2I2O A;  2Y3B A;  3ECS A;  4L1B A;  4XZ4 A;  4PH4 B;  4BX9 A;  4GML A;  2WXI A;  2PP4 A;  4CIH A;  2PX0 A;  2VGX A;  1Z23 A;  3LKU A;  2A6E F;  2WXQ A;  1LVK A;  3T5X A;  3EZI A;  2VAS A;  5JJ7 A;  2FFH A;  3ZPJ A;  4BWR A;  4N3C A;  2X6F A;  5M72 A;  1KLX A;  5T3T A;  4I2W A;  2Q9A A;  2X3M A;  4APF A;  2J09 A;  2CNW A;  2R59 A;  3FH7 A;  1SZA A;  2LAI A;  5B1A C;  2YHS A;  4KNW A;  4G7H F;  2P7V A;  4DI3 A;  4G24 A;  2BUG A;  3UX4 A;  2WXH A;  3FUE A;  5JJ6 A;  3IEG A;  4U5E E;  2KGO A;  3L13 A;  2IYL D;  1ELW A;  3C98 A;  1BR2 A;  3LY9 A;  5JJT A;  3LDZ A;  2P6V A;  2EIL C;  3P2B A;  2ZU6 B;  3SD5 A;  2WVN A;  1TWC A;  5A7D B;  3NZS A;  4FLB A;  4BJ5 A;  3FY4 A;  2JEK A;  4KNV A;  3DJN B;  3EZH A;  2A1D D;  4KC9 A;  2HR2 A;  3GAN A;  2I9C A;  3EGD A;  5AIJ A;  2LNI A;  4JJG A;  1ZHY A;  4KZC A;  3IKO B;  2WVO A;  4JW1 A;  3SP1 A;  4FA6 A;  3AS8 A;  1TJF A;  4G0H A;  4HFG A;  5AEN A;  5FTP A;  4H7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...