1W2WA

Crystal structure of yeast ypr118w, a methylthioribose-1-phosphate isomerase related to regulatory eif2b subunits
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
211
structure length
211
Chain Sequence
MSLEAIVFDRSEPENVSVKVLDQLLLPYTTKYVPIHTIDDGYSVIKSMQVRGAPAIAIVGSLSVLTEVQLIKHNPTSDVATLYSLVNWESTKTVLNKRLDFLLSSRPTAVNLSNSLVEIKNILKSSSDLKAFDGSLYNYVCELIDEDLANNMKMGDNGAKYLIDVLQKDGFKDEFAVLTICNTGSLATSGYGTALGVIRSLWKDSLAKTDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords 5-METHYLTHIORIBOSE-1-PHOSPHATE ISOMERASE
publication title Crystal Structure of Yeast Ypr118W, a Methylthioribose-1-Phosphate Isomerase Related to Regulatory Eif2B Subunits
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 76
structure length 211
sequence length 211
chains with identical sequence E, I, M
ec nomenclature ec 5.3.1.23: S-methyl-5-thioribose-1-phosphate isomerase.
pdb deposition date 2004-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1840 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1w2wA00
1W2WA
chains in the Genus database with same CATH superfamily
4C7OA 3M1CB 5COFA 1R5ID 4IB4A 2LFFA 4MVQA 4N6HA 3RYLA 1WWPA 2YRFA 3CAXA 3O6XA 3SEOA 1OW8A 3EGDB 3U2LA 5DS4A 3EG9B 3B0UX 4P6IC 2R7RA 3DM9B 3T6JA 1N1CA 3BRJA 3U5SA 3RQEA 1LS1A 3NMKA 1JR8A 3U2MA 4JRZA 1H7IA 4C3BA 4CS9A 4D4NA 1YLMA 1ZVZA 3GM3A 2QY9A 4JTDB 4LLEA 3U9JA 5AC4A 5T3TA 4JTCB 5KYXB 3KPHA 1Q0FA 4JIOA 2J9WA 3FAJA 1MMAA 1HW2A 3HLZA 2ZXOA 3TJ6A 3W2WA 4IWBA 2EIJC 1TQGA 2BE5F 2H7OA 1APCA 2J9VA 2UUIA 3AG2C 3JT1A 3QW1A 4JTAB 1WTYA 5JSLA 4J7TA 3AG3C 4E0HA 4G78A 5A6AA 3JTLO 4BG0A 3M15A 4G7HF 1YZAA 4XPYA 1IW7F 2RSEB 2H7VC 4CDYA 5DVWA 3C7JA 3DAFA 4XQ1A 3EZHA 5K0IA 3L8JA 5JS5A 4U9EA 1L7CA 4O6MA 2PBEA 1IZMA 2EPMX 2H8AA 1Z6AA 3EH2A 3W2VA 2XLDA 2GDCA 3A9CA 4U9DA 1TWGA 1T5OA 3DWWA 4L6RA 3W8IA 1T6QA 3HNIA 2HV6A 4BJ6A 3ZQVA 3WAQA 3HNJA 3GORA 1OR3A 1YA9A 2UUHA 1XZQA 4QI0A 1PCXA 4AL0A 2OKUA 4JVSA 3TOMA 2IXOA 4MTOA 1NFNA 2KQ9A 5E33A 3G4XA 3EGDA 5L0GA 4I1OB 1Z23A 4DXWA 3DZAA 3DKAA 5CI8A 5BUOA 2IXNA 4P9FA 5JRAA 2HS5A 2B0HA 4N4WA 4LLCA 2XL6A 1T6UA 4CJGA 3JCUQ 4PJNA 3UNGC 4E7SA 5L0CA 2J7PA 2WZLA 5KYXA 1ZU5A 4BPMA 2YWAA 4PFPA 3U8VA 1MMDA 3IQ5A 3KH2A 1BR1A 3HNKA 3LUTB 3Q6MA 5CI9A 1G5ZA 4IJJA 1MMGA 3M4CA 4DVZA 3ZDLA 4DVYP 2EPKX 3L0IA 4IAOA 1M2OA 2LCHA 3EJNA 256BA 3LNMB 4N06A 3RKOF 3UMKA 5JT4A 3K6BA 1ZW3A 3DXJF 4PJLA 1G8XA 5T3WA 4JURI 1LPEA 3RIPA 4NCQA 2JPUA 2EPOA 2R7WA 4IARA 2XL8A 4O79A 5IY5C 2KJGA 5KYUA 5BQGA 2OJED 2YEVA 2A0UA 4BJ6C 3S84A 3O55A 4QI2A 1LM3B 3C8ZA 2A68F 4RD9A 2E87A 1A0BA 3JYHA 2W45A 4RDAA 1GS9A 2X0CA 3DJUB 4K7BA 3C18A 3E9VA 1T6IA 3MX3A 2YL0A 4EUKB 4NTFA 2XLMA 3KYJA 4YJWA 4UDVA 1T9KA 2V3CC 1EKYA 3FOPA 1OKKD 1U0BB 3V5XA 4EHPA 4LDRA 1D0YA 2YQYA 4C7OB 4ER9A 1UG7A 4JEAA 2PNOA 3BEHA 4ZLCA 1VYIA 1Y4CA 3C62A 2ZXPA 1FMWA 5E2QA 2ZXRA 4IAQA 2FFHA 3TULA 2VH3A 2KK1A 4JW1A 4MS2A 2IOQA 4MVOA 4Z9HA 4I3MA 3RW0A 3JSZA 2I8BA 4CIHA 3TD7A 2HSBA 4W8PA 2XLVA 2ZPAA 3QMKA 5A6BD 3MYIA 2AWCA 3G50A 2JX0A 4LDQA 2WVNA 3UGOA 2IYLD 3ABMC 4XTKA 1EA8A 3PDMP 1S7ZA 1YYJA 2MWQA 3IQCA 5FCLA 2XXAB 1QQ3A 1Z5ZA 1OR2A 1Q0KA 3C8GD 4XEFA 2G62A 3GWLA 4OINF 3LAYA 4JC7A 3T6BA 3U3FA 2KC3A 5L0DA 5DQTA 3FDQA 2A0BA 2HJ3A 2XRHA 2LQGA 3EQLF 3IPMO 4G0HA 4AX2A 4EIYA 3TJ5A 4YWQA 1E84A 1VYKA 1T01A 3R2PA 1NSGB 2DB4A 4DOZA 1V55C 2AWYA 1EQ1A 1KNYA 3H2UA 1YDIA 3PCVA 1FFTC 1I4YA 3GM2A 3B0VC 4BEJA 3DI5A 1NBBA 3JZ0A 5JVEA 2EPLX 1QPUA 3DE8A 4GEHA 1GM5A 2Y3HA 2NSFA 3NMJA 2XM0A 5L0JA 4G7OF 1ZYRF 2CNWA 3FVYA 1FNTc 4CDVA 1XWJA 2HZ8A 4U5BE 3DD7A 3RVZA 4W8KA 2R7TA 3TQOA 3V5ZA 1CGME 2XS1A 2QNLA 2ZXWC 2HMZA 3KL4A 4HE8D 3IQTA 4YT5A 1F1MA 3E70C 5L0HA 1Z63A 4MW8A 4Z9IA 1RJ9A 1RKCA 2HSQA 2PFDA 2NUTA 1HE9A 3CEXA 2AP3A 3U8PA 2J9BA 3K1HA 2LP4A 2WL8A 4MNDA 4U5EE 2XXAA 3DM5A 5L0FA 3K7DA 1JPJA 2VCAA 1LKXA 1R4TA 1HW1A 2W4BA 3F46A 2R7QA 1OCRC 2HJMA 4HFKB 4X0RA 4A2NB 5AC5A 3UGPA 1A41A 1Z3IX 2OCCC 2EINC 3SZRA 2FAPB 4FWVA 5F5HA 1QKRA 5AGFA 1E2XA 5T1DB 1JMWA 3RFYA 3X2QC 4YT4A 4Q5SF 5KYUB 2D5RB 3R7CA 1JAFA 1HY5A 3S90A 4CIPA 2XM4A 4M63A 1QVXA 2P1AA 3GWNA 4I1MA 4OIQF 1VMAA 5L3QA 4PACA 2EILC 3S0XA 3EGXA 3O10A 3VF0A 3AG1C 2R7VA 4NTAA 2YL1A 4P9TA 1NZEA 2KW3C 2OEXA 2P7VA 2A6EF 5FZTA 3ZTMA 4KBLA 4BJ5C 4G7ZF 1SR2A 5F5FA 1M6TA 1ZHZA 2L9JA 2BL2A 2Y3GA 4XEVA 3QVYA 1ZHXA 5KYWA 2L6GA 2ASRA 1A7DA 2HUJA 4DBQA 1YJGA 5DQZA 1NU9C 2Y69C 4DJ9A 3N2ZB 5KYYB 2L6HA 1E83A 3O39A 1VB5A 1SF8A 3EH1A 4O6NA 2F22A 1AVOB 5TJ5E 4XPXA 4U5FE 4NTBA 3SXYA 1TWHA 5D91A 3L8IA 1OW7A 2VB6A 4Q4ZF 2PP4A 1LE2A 2MYSA 2QUPA 2YVKA 1TKNA 1DOVA 1TR2A 4AE4A 1QZXA 2IXMA 2MHRA 4N6CA 1Q0DA 2IXPA 3S27A 3SNHA 3ZG1A 1TFOB 5B1BC 2CDQA 2L6FA 4YT8A 3GM1A 2Q9CA 2XSEA 1JRAA 3FHDA 2Q7RA 1FMVA 2O9XA 1K04A 4EKWA 4DRJB 4KI2A 2WZGA 1TWCA 2R7SA 1KU2A 3LS0A 3J06A 3DMDA 3V5YA 1BR2A 1SZIA 3NYJA 1HMDA 4DRHB 3FOOA 4MW3A 3RQFA 3AJMA 3S9OA 2RD9A 1O3UA 1YVIA 1C02A 3TK0A 2EIMC 4EBKA 4A4AA 1V54C 1CPQA 2G3VA 3CSKA 1BZ4A 3NKEA 1D1AA 2C04A 3ATPA 4I44A 4MTGA 4O7GA 3IQ6A 4XWJA 1BDJB 4B6IA 4YK5A 3N24A 2M4EA 4BJ5A 2YL3A 5B3SC 3T9OA 2ICWG 3MBGA 4XEKA 4OIPF 1OW6A 1PD0A 1O5HA 3QZCA 3GEEA 1D1BA 4OD4A 1H9TA 4E18A 2VCBA 5KYYA 3ABLC 2A69F 1VOMA 2Y3BA 2I15A 1DOWA 2Q9AA 3WG7C 3OWTA 1MNDA 1I5NA 4FESA 3UMHA 1ZHYA 4H54A 1MQVA 4CS7A 3JRTA 1SMYF 4MVMA 1FFHA 2Q4FA 1NG1A 3A11A 3L34A 3W8HA 1JOGA 1VK5A 1J8MF 1OXBA 1K05A 1LI5A 4ULVA 1RJ9B 2ETSA 2R7OA 3VM6A 4CX9A 2NUTB 1OCOC 2LK4A 3NYLA 2XLOA 5E3CA 5DS6A 4CSAC 2IM8A 4OD5A 1YYXA 3QTHA 1ZHWA 2LD6A 3IHUA 1FAPB 4MVZA 3JSEO 2J0XA 4YN0B 2CYDA 2AU5A 5JP7A 1EI7A 3V7OA 3WHNA 3L1MA 4JZAA 4NC3A 3WODF 4WGYA 5A6KA 3AG4C 1H6GA 2QLAA 2R25A 5COMA 1YARO 3Q6NA 1A7VA 3EHMA 2NSGA 3NYMA 5DS5A 2YLIA 2W4MA 4E7ZA 1K40A 4LDKA 3QW0A 3GODA 4BJ1A 3ZC4A 2EPNA 3EHNA 3K66A 3NDBB 2VC9A 1MMNA 4JCZA 4J30B 2OG2A 4WJ0A 5EK0A 1RKEB 2HMQA 1VTMP 1TFKB 4NQFA 3EFOB 3EGXB 2C03A 4O6YA 2L81A 1ORYA 4LACB 5CIVA 1BR4A 4MQ9F 3N0TA 1WATA 2R03A 4C3EA 3U0CA 2HV7A 2J7PD 5GPGB 1PD1A 2PF4E 2GA0A 1QSPA 5KYNA 3AQCA 2P0NA 3H65A 4JEBA 2L7AA 2P61A 4ONSA 3NKDA 3TOLA 1SYQA 1ZHTA 4QDLA 2PX3A 2Q9BA 2XS8A 3C8GB 4JJGA 2NG1A 3NMIA 2Z15A 3SXKA 1PV3A 2CGEA 3RVYA 3LNRA 3LEOA 2R9RB 3CQZA 4IGGA 4YL0A 4C3DA 2OJQA 3QVZA 1E86A 1YA7O 3IEEA 1NFOA 1XZPA 1VLTA 2J9UA 1JPNA 2J45A 2YKZA 3SP1A 3DJNB 4CSAA 3GANA 4CDAA 1YAUO 3ZSUA 1OKKA 1OQCA 1CGNA 2JD3A 2W9YA 2LIGA 3C63A 4YL1A 4AE4B 1D0ZA 1BBHA 3W4YA 2R7UA 5HV9A 2A6HF 1UFBA 2J0WA 2QTVA 5HSWA 3MFNA 4EWCA 3B71A 3M79A 2WZFA 4DRIB 5F28E 4RBNA 4PJJA 2YZSA 1A7EA 1G4WR 2NUPB 4YL3A 2WVQA 3X1OA 1RKEA 4J32B 3RH3A 2GWWA 4J7YA 2OEVA 3T4RA 3EFOA 3S29A 5A6JA 3Q7GA 1ORSC 1W2WA 5A6BA 4WGZA 2YHSA 1OXKA 3KYIA 3RQGA 1LIHA 1WGWA 3H2VA 4ZLDA 4U5CE 1C17M 2J8WA 1U89A 3LLIA 2A1DD 1Q0GA 4IRUA 1U6HA 1RMVA 2KSFA 2GFHA 4KNVA 4MVRA 3B29A 3C8GA 1TWAA 3ECSA 2PX0A 2YLGA 2R05A 4U5GA 1I4ZA 3EZIA 2X51A 4OIOF 1V74B 3B0PA 1ZZPA 3LESA 4PR9A 1AUEA 3MYFA 2LFDA 3U9MA 3NG1A 3SYNA 2IBFA 2DGJA 2YL7A 5JLIA 2OQMA 2XLWA 3HKKA 3PHF2 1WOLA 2CW0F 3EG9A 3Q7LA 3AQBA 2P6VA 5D92A 2BC5A 4XLPF 2HKVA 3UMIA 2QE9A 4CS8C 2D4UA 4AL1A 3AGUA 1KTMA 2Y39A 2NPUA 4EBJA 5KYWB 1E85A 2KNHA 4JCHA 3K1IC 4GQHA 4H4KC 1O87A 2XLEA 4U5DE 2NUPA 2GAQA 2WB7A 1OCZC 4MTFA 1ZU4A 4CBEA 2M64A 1MNEA 2XL4A 4FAPB 2KGOA 1LVKA 5EGYA 3GEIA 2ZD9A 2VASA 4E0IA 3AOUA 1NU7D 2CNWD 4BEMJ 1YZCA 1M2VB 2G3KA 4DBRA 5E3AA 3VRCA 4MVUA 3VAYA 3LS1A 4MVSA 1GGQA 1LI7A 1Z7Qc 4CJOA 2TMVP 3US6A 4HFFB 1B68A 4YT2A 2Q3TA 3RF3A 3U3BA 3HJCA 1V4AA 3LLKA 3G4ZA 4LERA 4OIRF 4BJTA 5B3IA 1CGOA 1AEPA 3ASNC 3SXZA 4XPWA 4Z9JA 4JE9A 5L3VA 4Q7CA 2WVOA 1CPRA 4U5HA 3GEHA 4D4XA 3SXMA 5EHHA 3ABKC 3I5QA 3OEOA 4JJFA 1FR0A 1FTSA 1QLEC 2J46A 2VCCA 2DYRC 3ITFA 2KYHA 4PJMA 3UR3C 4E17A 1ST6A 4K0DA 2R7XA 3FAPB 3T6GB 1Y6DA 4CS8A 2B0JA 3I5PA 4KC9A 1HMOA 3B9QA 3F47A 4AK9A 3HNLA 3CZ6A 1ZW2A 2AVKA 4PFOA 1D1CA 4GYTA 4ULWA 3K1IA 4K1OA 5COGA 2H7BA 2XLHA 3S28A 1HE1A 2CCYA 2DYSC 3EPVA 5B1AC 3POVA 4ANJA 1RXQA 1WASA 1OCCC 3JYYA 3LEVA 2LSEA 3PMRA 4JKVA 4CS9C 4KNWA 3KKBA 1LS4A 1M56C 1J8YF 2YLDA 3AGTA 3JRMO 3ZTZA 1RCPA 3ZIBA 2R02A 3ZWIA 1VLSA 2V26A 3KMIA 5BQIA 1NLXA 5JUAA 3DE9A 1D0XA 1L3PA 1M2VA 1ORJA 3MLGA 3M4BA 4EBBA 1M57C 3DAGA 2FGYA 5DLJA 1WN0A 1Q0MA 4HEAJ 1S05A 3ASOC 2OOCA 2Q00A 1LE4A 3VYWA 3ZQYA 1GQAA 2HFIA 3OA1A 3NRHA 5BQHA 3LJBA 4NY3A 3FXHA 3ZVRA 4FX5A 2Y3DA 2OU6A 4PK4A 4WABA 3HTKC 3FMSA 4XLNF 1G4US 2DI3A 3I4UA 5L0IA 2EIKC 3K33A 1C03A 5A69A 4R32A 4F4BA 1H9GA
chains in the Genus database with same CATH topology
4C7OA 3M1CB 3RYLA 3SEOA 3O6XA 5DS4A 3EGDB 3EG9B 3B0UX 4P6IC 2R7RA 3DM9B 3T6JA 1N1CA 1LS1A 4CS9A 4C3BA 2QY9A 4LLEA 5T3TA 5KYXB 2J9WA 3FAJA 1MMAA 3HLZA 2ZXOA 3W2WA 4IWBA 2EIJC 2BE5F 2H7OA 2J9VA 3AG2C 3JT1A 3AG3C 4BG0A 4G7HF 1IW7F 2H7VC 5DVWA 3DAFA 3EZHA 4O6MA 1IZMA 3W2VA 3EH2A 1Z6AA 1TWGA 3W8IA 2HV6A 4BJ6A 4QI0A 1PCXA 4JVSA 2IXOA 2KQ9A 5E33A 3EGDA 4I1OB 1Z23A 3DZAA 5CI8A 5BUOA 2IXNA 4LLCA 3JCUQ 4PJNA 3UNGC 4E7SA 2J7PA 2WZLA 5KYXA 1ZU5A 3B0VC 4PFPA 3W8HA 4AX2A 1MMDA 3KH2A 1BR1A 3Q6MA 5CI9A 4IJJA 1MMGA 4DVZA 4DVYP 4IAOA 3L0IA 1M2OA 3EJNA 3RKOF 3UMKA 4N06A 3K6BA 3DXJF 4PJLA 1G8XA 5T3WA 4JURI 3RIPA 2R7WA 4O79A 5IY5C 2KJGA 5KYUA 2YEVA 4QI2A 2A68F 4RD9A 2E87A 3JYHA 2W45A 4RDAA 3DJUB 4K7BA 3E9VA 3MX3A 4YJWA 2V3CC 1OKKD 1D0YA 4C7OB 4ZLCA 1VYIA 2ZXPA 1FMWA 5E2QA 2ZXRA 2FFHA 2VH3A 4JW1A 2IOQA 4I3MA 3JSZA 2I8BA 4CIHA 3TD7A 2ZPAA 3QMKA 2WVNA 3UGOA 2IYLD 3ABMC 4XTKA 1S7ZA 2MWQA 5FCLA 2XXAB 1Z5ZA 2G62A 4OINF 3LAYA 3T6BA 3FDQA 5DQTA 4G0HA 2XRHA 3EQLF 4YWQA 1VYKA 4DOZA 1V55C 1FFTC 4BEJA 4GEHA 2Y3HA 4G7OF 1ZYRF 2CNWA 3FVYA 4U5BE 3DD7A 4W8KA 2R7TA 2ZXWC 3KL4A 4HE8D 4YT5A 3E70C 1Z63A 1RJ9A 2PFDA 2NUTA 3K1HA 4MNDA 2WL8A 4U5EE 2XXAA 3DM5A 3K7DA 1JPJA 1LKXA 2W4BA 3F46A 2R7QA 1OCRC 4HFKB 4A2NB 4X0RA 3UGPA 1Z3IX 2OCCC 2EINC 3SZRA 4FWVA 5F5HA 5T1DB 3RFYA 3X2QC 4Q5SF 4YT4A 5KYUB 2D5RB 4M63A 4I1MA 4OIQF 1VMAA 2EILC 3S0XA 3EGXA 3AG1C 2R7VA 1NZEA 2KW3C 2P7VA 2A6EF 4KBLA 4BJ5C 4G7ZF 5F5FA 1ZHZA 2L9JA 2Y3GA 1ZHXA 4DBQA 5DQZA 1NU9C 2Y69C 3N2ZB 5KYYB 3O39A 1SF8A 3EH1A 4O6NA 4U5FE 1TWHA 5D91A 2VB6A 4Q4ZF 2PP4A 2MYSA 1TKNA 1TR2A 4AE4A 1QZXA 2IXMA 3SNHA 3S27A 2IXPA 3ZG1A 5B1BC 2CDQA 4YT8A 2Q9CA 2XSEA 3FHDA 1FMVA 2O9XA 4KI2A 2WZGA 1TWCA 2R7SA 1KU2A 3LS0A 3DMDA 1BR2A 1SZIA 3NYJA 2EIMC 1V54C 2G3VA 3CSKA 3NKEA 1D1AA 2C04A 4I44A 4O7GA 4XWJA 4B6IA 4BJ5A 5B3SC 3N24A 2M4EA 4OIPF 1PD0A 1O5HA 3QZCA 1D1BA 4OD4A 5KYYA 3ABLC 2A69F 1VOMA 2Y3BA 2Q9AA 3WG7C 3OWTA 1MNDA 4FESA 3UMHA 1ZHYA 4CS7A 3JRTA 1SMYF 1FFHA 1NG1A 3L34A 1VK5A 1J8MF 1RJ9B 2R7OA 2NUTB 1OCOC 3NYLA 5DS6A 5E3CA 4CSAC 4OD5A 1ZHWA 4YN0B 5KYWA 5L3QA 2J0XA 3V7OA 5KYNA 3WODF 4JZAA 3AG4C 3Q6NA 3EHMA 3NYMA 5DS5A 2W4MA 4E7ZA 3GODA 4BJ1A 3ZC4A 3EHNA 3K66A 3NDBB 1MMNA 4J30B 2OG2A 4WJ0A 3EFOB 3EGXB 2C03A 4O6YA 2L81A 4LACB 1BR4A 4MQ9F 3N0TA 4C3EA 2HV7A 2J7PD 1PD1A 2PF4E 3AQCA 3H65A 3NKDA 1ZHTA 4QDLA 2PX3A 2Q9BA 4JJGA 2NG1A 2Z15A 2CGEA 3LNRA 3CQZA 4C3DA 3IEEA 2J9UA 4CSAA 1JPNA 2J45A 3SP1A 3DJNB 3GANA 3ZSUA 1OKKA 2W9YA 2JD3A 4AE4B 1D0ZA 2R7UA 2A6HF 2J0WA 2QTVA 5HSWA 4EWCA 2WZFA 4RBNA 4PJJA 2YZSA 2NUPB 3X1OA 2WVQA 4J32B 3RH3A 3T4RA 3EFOA 3S29A 3Q7GA 1W2WA 2YHSA 4ZLDA 1WGWA 4U5CE 3LLIA 2A1DD 4IRUA 2GFHA 4KNVA 1TWAA 3ECSA 2PX0A 4U5GA 3EZIA 2X51A 4OIOF 3B0PA 3LESA 3NG1A 3SYNA 2DGJA 3PHF2 2CW0F 3EG9A 3Q7LA 3AQBA 2P6VA 5D92A 4XLPF 3UMIA 4CS8C 2Y39A 5KYWB 2KNHA 4JCHA 3K1IC 4H4KC 1O87A 4U5DE 2NUPA 2WB7A 1OCZC 1ZU4A 4CBEA 1MNEA 2XL4A 5EGYA 2KGOA 1LVKA 2VASA 1NU7D 2CNWD 1M2VB 2G3KA 4DBRA 5E3AA 3VAYA 3LS1A 4HFFB 4YT2A 2Q3TA 3HJCA 3LLKA 4LERA 4OIRF 4BJTA 3ASNC 5L3VA 4Q7CA 2WVOA 4U5HA 5EHHA 3ABKC 3I5QA 3OEOA 4JJFA 1FTSA 1QLEC 2J46A 3ITFA 2DYRC 4PJMA 3UR3C 1ST6A 4K0DA 2R7XA 4CS8A 2B0JA 3I5PA 4KC9A 3B9QA 3F47A 4AK9A 3CZ6A 4PFOA 1D1CA 4GYTA 4ULWA 3S28A 2H7BA 2DYSC 3EPVA 5B1AC 3POVA 4ANJA 3PMRA 1OCCC 3LEVA 2LSEA 4CS9C 4KNWA 3KKBA 1M56C 1J8YF 3ZIBA 2V26A 3KMIA 1D0XA 1M2VA 3MLGA 4EBBA 1M57C 3DAGA 2FGYA 5DLJA 4HEAJ 3ASOC 3VYWA 3OA1A 3NRHA 3LJBA 4NY3A 3ZVRA 4FX5A 2Y3DA 4PK4A 3HTKC 4XLNF 3I4UA 2EIKC 3K33A 4F4BA 4BJ6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W2W A; 
#chains in the Genus database with same CATH topology
 4C7O A;  3M1C B;  5COF A;  1R5I D;  4IB4 A;  2LFF A;  4MVQ A;  4N6H A;  3RYL A;  1WWP A;  2YRF A;  3CAX A;  3O6X A;  3SEO A;  1OW8 A;  3EGD B;  3U2L A;  5DS4 A;  3EG9 B;  3B0U X;  4P6I C;  2R7R A;  3DM9 B;  3T6J A;  1N1C A;  3BRJ A;  3U5S A;  3RQE A;  1LS1 A;  3NMK A;  1JR8 A;  3U2M A;  4JRZ A;  1H7I A;  4C3B A;  4CS9 A;  4D4N A;  1YLM A;  1ZVZ A;  3GM3 A;  2QY9 A;  4JTD B;  4LLE A;  3U9J A;  5AC4 A;  5T3T A;  4JTC B;  5KYX B;  3KPH A;  1Q0F A;  4JIO A;  2J9W A;  3FAJ A;  1MMA A;  1HW2 A;  3HLZ A;  2ZXO A;  3TJ6 A;  3W2W A;  4IWB A;  2EIJ C;  1TQG A;  2BE5 F;  2H7O A;  1APC A;  2J9V A;  2UUI A;  3AG2 C;  3JT1 A;  3QW1 A;  4JTA B;  1WTY A;  5JSL A;  4J7T A;  3AG3 C;  4E0H A;  4G78 A;  5A6A A;  3JTL O;  4BG0 A;  3M15 A;  4G7H F;  1YZA A;  4XPY A;  1IW7 F;  2RSE B;  2H7V C;  4CDY A;  5DVW A;  3C7J A;  3DAF A;  4XQ1 A;  3EZH A;  5K0I A;  3L8J A;  5JS5 A;  4U9E A;  1L7C A;  4O6M A;  2PBE A;  1IZM A;  2EPM X;  2H8A A;  1Z6A A;  3EH2 A;  3W2V A;  2XLD A;  2GDC A;  3A9C A;  4U9D A;  1TWG A;  1T5O A;  3DWW A;  4L6R A;  3W8I A;  1T6Q A;  3HNI A;  2HV6 A;  4BJ6 A;  3ZQV A;  3WAQ A;  3HNJ A;  3GOR A;  1OR3 A;  1YA9 A;  2UUH A;  1XZQ A;  4QI0 A;  1PCX A;  4AL0 A;  2OKU A;  4JVS A;  3TOM A;  2IXO A;  4MTO A;  1NFN A;  2KQ9 A;  5E33 A;  3G4X A;  3EGD A;  5L0G A;  4I1O B;  1Z23 A;  4DXW A;  3DZA A;  3DKA A;  5CI8 A;  5BUO A;  2IXN A;  4P9F A;  5JRA A;  2HS5 A;  2B0H A;  4N4W A;  4LLC A;  2XL6 A;  1T6U A;  4CJG A;  3JCU Q;  4PJN A;  3UNG C;  4E7S A;  5L0C A;  2J7P A;  2WZL A;  5KYX A;  1ZU5 A;  4BPM A;  2YWA A;  4PFP A;  3U8V A;  1MMD A;  3IQ5 A;  3KH2 A;  1BR1 A;  3HNK A;  3LUT B;  3Q6M A;  5CI9 A;  1G5Z A;  4IJJ A;  1MMG A;  3M4C A;  4DVZ A;  3ZDL A;  4DVY P;  2EPK X;  3L0I A;  4IAO A;  1M2O A;  2LCH A;  3EJN A;  256B A;  3LNM B;  4N06 A;  3RKO F;  3UMK A;  5JT4 A;  3K6B A;  1ZW3 A;  3DXJ F;  4PJL A;  1G8X A;  5T3W A;  4JUR I;  1LPE A;  3RIP A;  4NCQ A;  2JPU A;  2EPO A;  2R7W A;  4IAR A;  2XL8 A;  4O79 A;  5IY5 C;  2KJG A;  5KYU A;  5BQG A;  2OJE D;  2YEV A;  2A0U A;  4BJ6 C;  3S84 A;  3O55 A;  4QI2 A;  1LM3 B;  3C8Z A;  2A68 F;  4RD9 A;  2E87 A;  1A0B A;  3JYH A;  2W45 A;  4RDA A;  1GS9 A;  2X0C A;  3DJU B;  4K7B A;  3C18 A;  3E9V A;  1T6I A;  3MX3 A;  2YL0 A;  4EUK B;  4NTF A;  2XLM A;  3KYJ A;  4YJW A;  4UDV A;  1T9K A;  2V3C C;  1EKY A;  3FOP A;  1OKK D;  1U0B B;  3V5X A;  4EHP A;  4LDR A;  1D0Y A;  2YQY A;  4C7O B;  4ER9 A;  1UG7 A;  4JEA A;  2PNO A;  3BEH A;  4ZLC A;  1VYI A;  1Y4C A;  3C62 A;  2ZXP A;  1FMW A;  5E2Q A;  2ZXR A;  4IAQ A;  2FFH A;  3TUL A;  2VH3 A;  2KK1 A;  4JW1 A;  4MS2 A;  2IOQ A;  4MVO A;  4Z9H A;  4I3M A;  3RW0 A;  3JSZ A;  2I8B A;  4CIH A;  3TD7 A;  2HSB A;  4W8P A;  2XLV A;  2ZPA A;  3QMK A;  5A6B D;  3MYI A;  2AWC A;  3G50 A;  2JX0 A;  4LDQ A;  2WVN A;  3UGO A;  2IYL D;  3ABM C;  4XTK A;  1EA8 A;  3PDM P;  1S7Z A;  1YYJ A;  2MWQ A;  3IQC A;  5FCL A;  2XXA B;  1QQ3 A;  1Z5Z A;  1OR2 A;  1Q0K A;  3C8G D;  4XEF A;  2G62 A;  3GWL A;  4OIN F;  3LAY A;  4JC7 A;  3T6B A;  3U3F A;  2KC3 A;  5L0D A;  5DQT A;  3FDQ A;  2A0B A;  2HJ3 A;  2XRH A;  2LQG A;  3EQL F;  3IPM O;  4G0H A;  4AX2 A;  4EIY A;  3TJ5 A;  4YWQ A;  1E84 A;  1VYK A;  1T01 A;  3R2P A;  1NSG B;  2DB4 A;  4DOZ A;  1V55 C;  2AWY A;  1EQ1 A;  1KNY A;  3H2U A;  1YDI A;  3PCV A;  1FFT C;  1I4Y A;  3GM2 A;  3B0V C;  4BEJ A;  3DI5 A;  1NBB A;  3JZ0 A;  5JVE A;  2EPL X;  1QPU A;  3DE8 A;  4GEH A;  1GM5 A;  2Y3H A;  2NSF A;  3NMJ A;  2XM0 A;  5L0J A;  4G7O F;  1ZYR F;  2CNW A;  3FVY A;  1FNT c;  4CDV A;  1XWJ A;  2HZ8 A;  4U5B E;  3DD7 A;  3RVZ A;  4W8K A;  2R7T A;  3TQO A;  3V5Z A;  1CGM E;  2XS1 A;  2QNL A;  2ZXW C;  2HMZ A;  3KL4 A;  4HE8 D;  3IQT A;  4YT5 A;  1F1M A;  3E70 C;  5L0H A;  1Z63 A;  4MW8 A;  4Z9I A;  1RJ9 A;  1RKC A;  2HSQ A;  2PFD A;  2NUT A;  1HE9 A;  3CEX A;  2AP3 A;  3U8P A;  2J9B A;  3K1H A;  2LP4 A;  2WL8 A;  4MND A;  4U5E E;  2XXA A;  3DM5 A;  5L0F A;  3K7D A;  1JPJ A;  2VCA A;  1LKX A;  1R4T A;  1HW1 A;  2W4B A;  3F46 A;  2R7Q A;  1OCR C;  2HJM A;  4HFK B;  4X0R A;  4A2N B;  5AC5 A;  3UGP A;  1A41 A;  1Z3I X;  2OCC C;  2EIN C;  3SZR A;  2FAP B;  4FWV A;  5F5H A;  1QKR A;  5AGF A;  1E2X A;  5T1D B;  1JMW A;  3RFY A;  3X2Q C;  4YT4 A;  4Q5S F;  5KYU B;  2D5R B;  3R7C A;  1JAF A;  1HY5 A;  3S90 A;  4CIP A;  2XM4 A;  4M63 A;  1QVX A;  2P1A A;  3GWN A;  4I1M A;  4OIQ F;  1VMA A;  5L3Q A;  4PAC A;  2EIL C;  3S0X A;  3EGX A;  3O10 A;  3VF0 A;  3AG1 C;  2R7V A;  4NTA A;  2YL1 A;  4P9T A;  1NZE A;  2KW3 C;  2OEX A;  2P7V A;  2A6E F;  5FZT A;  3ZTM A;  4KBL A;  4BJ5 C;  4G7Z F;  1SR2 A;  5F5F A;  1M6T A;  1ZHZ A;  2L9J A;  2BL2 A;  2Y3G A;  4XEV A;  3QVY A;  1ZHX A;  5KYW A;  2L6G A;  2ASR A;  1A7D A;  2HUJ A;  4DBQ A;  1YJG A;  5DQZ A;  1NU9 C;  2Y69 C;  4DJ9 A;  3N2Z B;  5KYY B;  2L6H A;  1E83 A;  3O39 A;  1VB5 A;  1SF8 A;  3EH1 A;  4O6N A;  2F22 A;  1AVO B;  5TJ5 E;  4XPX A;  4U5F E;  4NTB A;  3SXY A;  1TWH A;  5D91 A;  3L8I A;  1OW7 A;  2VB6 A;  4Q4Z F;  2PP4 A;  1LE2 A;  2MYS A;  2QUP A;  2YVK A;  1TKN A;  1DOV A;  1TR2 A;  4AE4 A;  1QZX A;  2IXM A;  2MHR A;  4N6C A;  1Q0D A;  2IXP A;  3S27 A;  3SNH A;  3ZG1 A;  1TFO B;  5B1B C;  2CDQ A;  2L6F A;  4YT8 A;  3GM1 A;  2Q9C A;  2XSE A;  1JRA A;  3FHD A;  2Q7R A;  1FMV A;  2O9X A;  1K04 A;  4EKW A;  4DRJ B;  4KI2 A;  2WZG A;  1TWC A;  2R7S A;  1KU2 A;  3LS0 A;  3J06 A;  3DMD A;  3V5Y A;  1BR2 A;  1SZI A;  3NYJ A;  1HMD A;  4DRH B;  3FOO A;  4MW3 A;  3RQF A;  3AJM A;  3S9O A;  2RD9 A;  1O3U A;  1YVI A;  1C02 A;  3TK0 A;  2EIM C;  4EBK A;  4A4A A;  1V54 C;  1CPQ A;  2G3V A;  3CSK A;  1BZ4 A;  3NKE A;  1D1A A;  2C04 A;  3ATP A;  4I44 A;  4MTG A;  4O7G A;  3IQ6 A;  4XWJ A;  1BDJ B;  4B6I A;  4YK5 A;  3N24 A;  2M4E A;  4BJ5 A;  2YL3 A;  5B3S C;  3T9O A;  2ICW G;  3MBG A;  4XEK A;  4OIP F;  1OW6 A;  1PD0 A;  1O5H A;  3QZC A;  3GEE A;  1D1B A;  4OD4 A;  1H9T A;  4E18 A;  2VCB A;  5KYY A;  3ABL C;  2A69 F;  1VOM A;  2Y3B A;  2I15 A;  1DOW A;  2Q9A A;  3WG7 C;  3OWT A;  1MND A;  1I5N A;  4FES A;  3UMH A;  1ZHY A;  4H54 A;  1MQV A;  4CS7 A;  3JRT A;  1SMY F;  4MVM A;  1FFH A;  2Q4F A;  1NG1 A;  3A11 A;  3L34 A;  3W8H A;  1JOG A;  1VK5 A;  1J8M F;  1OXB A;  1K05 A;  1LI5 A;  4ULV A;  1RJ9 B;  2ETS A;  2R7O A;  3VM6 A;  4CX9 A;  2NUT B;  1OCO C;  2LK4 A;  3NYL A;  2XLO A;  5E3C A;  5DS6 A;  4CSA C;  2IM8 A;  4OD5 A;  1YYX A;  3QTH A;  1ZHW A;  2LD6 A;  3IHU A;  1FAP B;  4MVZ A;  3JSE O;  2J0X A;  4YN0 B;  2CYD A;  2AU5 A;  5JP7 A;  1EI7 A;  3V7O A;  3WHN A;  3L1M A;  4JZA A;  4NC3 A;  3WOD F;  4WGY A;  5A6K A;  3AG4 C;  1H6G A;  2QLA A;  2R25 A;  5COM A;  1YAR O;  3Q6N A;  1A7V A;  3EHM A;  2NSG A;  3NYM A;  5DS5 A;  2YLI A;  2W4M A;  4E7Z A;  1K40 A;  4LDK A;  3QW0 A;  3GOD A;  4BJ1 A;  3ZC4 A;  2EPN A;  3EHN A;  3K66 A;  3NDB B;  2VC9 A;  1MMN A;  4JCZ A;  4J30 B;  2OG2 A;  4WJ0 A;  5EK0 A;  1RKE B;  2HMQ A;  1VTM P;  1TFK B;  4NQF A;  3EFO B;  3EGX B;  2C03 A;  4O6Y A;  2L81 A;  1ORY A;  4LAC B;  5CIV A;  1BR4 A;  4MQ9 F;  3N0T A;  1WAT A;  2R03 A;  4C3E A;  3U0C A;  2HV7 A;  2J7P D;  5GPG B;  1PD1 A;  2PF4 E;  2GA0 A;  1QSP A;  5KYN A;  3AQC A;  2P0N A;  3H65 A;  4JEB A;  2L7A A;  2P61 A;  4ONS A;  3NKD A;  3TOL A;  1SYQ A;  1ZHT A;  4QDL A;  2PX3 A;  2Q9B A;  2XS8 A;  3C8G B;  4JJG A;  2NG1 A;  3NMI A;  2Z15 A;  3SXK A;  1PV3 A;  2CGE A;  3RVY A;  3LNR A;  3LEO A;  2R9R B;  3CQZ A;  4IGG A;  4YL0 A;  4C3D A;  2OJQ A;  3QVZ A;  1E86 A;  1YA7 O;  3IEE A;  1NFO A;  1XZP A;  1VLT A;  2J9U A;  1JPN A;  2J45 A;  2YKZ A;  3SP1 A;  3DJN B;  4CSA A;  3GAN A;  4CDA A;  1YAU O;  3ZSU A;  1OKK A;  1OQC A;  1CGN A;  2JD3 A;  2W9Y A;  2LIG A;  3C63 A;  4YL1 A;  4AE4 B;  1D0Z A;  1BBH A;  3W4Y A;  2R7U A;  5HV9 A;  2A6H F;  1UFB A;  2J0W A;  2QTV A;  5HSW A;  3MFN A;  4EWC A;  3B71 A;  3M79 A;  2WZF A;  4DRI B;  5F28 E;  4RBN A;  4PJJ A;  2YZS A;  1A7E A;  1G4W R;  2NUP B;  4YL3 A;  2WVQ A;  3X1O A;  1RKE A;  4J32 B;  3RH3 A;  2GWW A;  4J7Y A;  2OEV A;  3T4R A;  3EFO A;  3S29 A;  5A6J A;  3Q7G A;  1ORS C;  1W2W A;  5A6B A;  4WGZ A;  2YHS A;  1OXK A;  3KYI A;  3RQG A;  1LIH A;  1WGW A;  3H2V A;  4ZLD A;  4U5C E;  1C17 M;  2J8W A;  1U89 A;  3LLI A;  2A1D D;  1Q0G A;  4IRU A;  1U6H A;  1RMV A;  2KSF A;  2GFH A;  4KNV A;  4MVR A;  3B29 A;  3C8G A;  1TWA A;  3ECS A;  2PX0 A;  2YLG A;  2R05 A;  4U5G A;  1I4Z A;  3EZI A;  2X51 A;  4OIO F;  1V74 B;  3B0P A;  1ZZP A;  3LES A;  4PR9 A;  1AUE A;  3MYF A;  2LFD A;  3U9M A;  3NG1 A;  3SYN A;  2IBF A;  2DGJ A;  2YL7 A;  5JLI A;  2OQM A;  2XLW A;  3HKK A;  3PHF 2;  1WOL A;  2CW0 F;  3EG9 A;  3Q7L A;  3AQB A;  2P6V A;  5D92 A;  2BC5 A;  4XLP F;  2HKV A;  3UMI A;  2QE9 A;  4CS8 C;  2D4U A;  4AL1 A;  3AGU A;  1KTM A;  2Y39 A;  2NPU A;  4EBJ A;  5KYW B;  1E85 A;  2KNH A;  4JCH A;  3K1I C;  4GQH A;  4H4K C;  1O87 A;  2XLE A;  4U5D E;  2NUP A;  2GAQ A;  2WB7 A;  1OCZ C;  4MTF A;  1ZU4 A;  4CBE A;  2M64 A;  1MNE A;  2XL4 A;  4FAP B;  2KGO A;  1LVK A;  5EGY A;  3GEI A;  2ZD9 A;  2VAS A;  4E0I A;  3AOU A;  1NU7 D;  2CNW D;  4BEM J;  1YZC A;  1M2V B;  2G3K A;  4DBR A;  5E3A A;  3VRC A;  4MVU A;  3VAY A;  3LS1 A;  4MVS A;  1GGQ A;  1LI7 A;  1Z7Q c;  4CJO A;  2TMV P;  3US6 A;  4HFF B;  1B68 A;  4YT2 A;  2Q3T A;  3RF3 A;  3U3B A;  3HJC A;  1V4A A;  3LLK A;  3G4Z A;  4LER A;  4OIR F;  4BJT A;  5B3I A;  1CGO A;  1AEP A;  3ASN C;  3SXZ A;  4XPW A;  4Z9J A;  4JE9 A;  5L3V A;  4Q7C A;  2WVO A;  1CPR A;  4U5H A;  3GEH A;  4D4X A;  3SXM A;  5EHH A;  3ABK C;  3I5Q A;  3OEO A;  4JJF A;  1FR0 A;  1FTS A;  1QLE C;  2J46 A;  2VCC A;  2DYR C;  3ITF A;  2KYH A;  4PJM A;  3UR3 C;  4E17 A;  1ST6 A;  4K0D A;  2R7X A;  3FAP B;  3T6G B;  1Y6D A;  4CS8 A;  2B0J A;  3I5P A;  4KC9 A;  1HMO A;  3B9Q A;  3F47 A;  4AK9 A;  3HNL A;  3CZ6 A;  1ZW2 A;  2AVK A;  4PFO A;  1D1C A;  4GYT A;  4ULW A;  3K1I A;  4K1O A;  5COG A;  2H7B A;  2XLH A;  3S28 A;  1HE1 A;  2CCY A;  2DYS C;  3EPV A;  5B1A C;  3POV A;  4ANJ A;  1RXQ A;  1WAS A;  1OCC C;  3JYY A;  3LEV A;  2LSE A;  3PMR A;  4JKV A;  4CS9 C;  4KNW A;  3KKB A;  1LS4 A;  1M56 C;  1J8Y F;  2YLD A;  3AGT A;  3JRM O;  3ZTZ A;  1RCP A;  3ZIB A;  2R02 A;  3ZWI A;  1VLS A;  2V26 A;  3KMI A;  5BQI A;  1NLX A;  5JUA A;  3DE9 A;  1D0X A;  1L3P A;  1M2V A;  1ORJ A;  3MLG A;  3M4B A;  4EBB A;  1M57 C;  3DAG A;  2FGY A;  5DLJ A;  1WN0 A;  1Q0M A;  4HEA J;  1S05 A;  3ASO C;  2OOC A;  2Q00 A;  1LE4 A;  3VYW A;  3ZQY A;  1GQA A;  2HFI A;  3OA1 A;  3NRH A;  5BQH A;  3LJB A;  4NY3 A;  3FXH A;  3ZVR A;  4FX5 A;  2Y3D A;  2OU6 A;  4PK4 A;  4WAB A;  3HTK C;  3FMS A;  4XLN F;  1G4U S;  2DI3 A;  3I4U A;  5L0I A;  2EIK C;  3K33 A;  1C03 A;  5A69 A;  4R32 A;  4F4B A;  1H9G A; 
#chains in the Genus database with same CATH homology
 4C7O A;  3M1C B;  3RYL A;  3SEO A;  3O6X A;  5DS4 A;  3EGD B;  3EG9 B;  3B0U X;  4P6I C;  2R7R A;  3DM9 B;  3T6J A;  1N1C A;  1LS1 A;  4CS9 A;  4C3B A;  2QY9 A;  4LLE A;  5T3T A;  5KYX B;  2J9W A;  3FAJ A;  1MMA A;  3HLZ A;  2ZXO A;  3W2W A;  4IWB A;  2EIJ C;  2BE5 F;  2H7O A;  2J9V A;  3AG2 C;  3JT1 A;  3AG3 C;  4BG0 A;  4G7H F;  1IW7 F;  2H7V C;  5DVW A;  3DAF A;  3EZH A;  4O6M A;  1IZM A;  3W2V A;  3EH2 A;  1Z6A A;  1TWG A;  3W8I A;  2HV6 A;  4BJ6 A;  4QI0 A;  1PCX A;  4JVS A;  2IXO A;  2KQ9 A;  5E33 A;  3EGD A;  4I1O B;  1Z23 A;  3DZA A;  5CI8 A;  5BUO A;  2IXN A;  4LLC A;  3JCU Q;  4PJN A;  3UNG C;  4E7S A;  2J7P A;  2WZL A;  5KYX A;  1ZU5 A;  3B0V C;  4PFP A;  3W8H A;  4AX2 A;  1MMD A;  3KH2 A;  1BR1 A;  3Q6M A;  5CI9 A;  4IJJ A;  1MMG A;  4DVZ A;  4DVY P;  4IAO A;  3L0I A;  1M2O A;  3EJN A;  3RKO F;  3UMK A;  4N06 A;  3K6B A;  3DXJ F;  4PJL A;  1G8X A;  5T3W A;  4JUR I;  3RIP A;  2R7W A;  4O79 A;  5IY5 C;  2KJG A;  5KYU A;  2YEV A;  4QI2 A;  2A68 F;  4RD9 A;  2E87 A;  3JYH A;  2W45 A;  4RDA A;  3DJU B;  4K7B A;  3E9V A;  3MX3 A;  4YJW A;  2V3C C;  1OKK D;  1D0Y A;  4C7O B;  4ZLC A;  1VYI A;  2ZXP A;  1FMW A;  5E2Q A;  2ZXR A;  2FFH A;  2VH3 A;  4JW1 A;  2IOQ A;  4I3M A;  3JSZ A;  2I8B A;  4CIH A;  3TD7 A;  2ZPA A;  3QMK A;  2WVN A;  3UGO A;  2IYL D;  3ABM C;  4XTK A;  1S7Z A;  2MWQ A;  5FCL A;  2XXA B;  1Z5Z A;  2G62 A;  4OIN F;  3LAY A;  3T6B A;  3FDQ A;  5DQT A;  4G0H A;  2XRH A;  3EQL F;  4YWQ A;  1VYK A;  4DOZ A;  1V55 C;  1FFT C;  4BEJ A;  4GEH A;  2Y3H A;  4G7O F;  1ZYR F;  2CNW A;  3FVY A;  4U5B E;  3DD7 A;  4W8K A;  2R7T A;  2ZXW C;  3KL4 A;  4HE8 D;  4YT5 A;  3E70 C;  1Z63 A;  1RJ9 A;  2PFD A;  2NUT A;  3K1H A;  4MND A;  2WL8 A;  4U5E E;  2XXA A;  3DM5 A;  3K7D A;  1JPJ A;  1LKX A;  2W4B A;  3F46 A;  2R7Q A;  1OCR C;  4HFK B;  4A2N B;  4X0R A;  3UGP A;  1Z3I X;  2OCC C;  2EIN C;  3SZR A;  4FWV A;  5F5H A;  5T1D B;  3RFY A;  3X2Q C;  4Q5S F;  4YT4 A;  5KYU B;  2D5R B;  4M63 A;  4I1M A;  4OIQ F;  1VMA A;  2EIL C;  3S0X A;  3EGX A;  3AG1 C;  2R7V A;  1NZE A;  2KW3 C;  2P7V A;  2A6E F;  4KBL A;  4BJ5 C;  4G7Z F;  5F5F A;  1ZHZ A;  2L9J A;  2Y3G A;  1ZHX A;  4DBQ A;  5DQZ A;  1NU9 C;  2Y69 C;  3N2Z B;  5KYY B;  3O39 A;  1SF8 A;  3EH1 A;  4O6N A;  4U5F E;  1TWH A;  5D91 A;  2VB6 A;  4Q4Z F;  2PP4 A;  2MYS A;  1TKN A;  1TR2 A;  4AE4 A;  1QZX A;  2IXM A;  3SNH A;  3S27 A;  2IXP A;  3ZG1 A;  5B1B C;  2CDQ A;  4YT8 A;  2Q9C A;  2XSE A;  3FHD A;  1FMV A;  2O9X A;  4KI2 A;  2WZG A;  1TWC A;  2R7S A;  1KU2 A;  3LS0 A;  3DMD A;  1BR2 A;  1SZI A;  3NYJ A;  2EIM C;  1V54 C;  2G3V A;  3CSK A;  3NKE A;  1D1A A;  2C04 A;  4I44 A;  4O7G A;  4XWJ A;  4B6I A;  4BJ5 A;  5B3S C;  3N24 A;  2M4E A;  4OIP F;  1PD0 A;  1O5H A;  3QZC A;  1D1B A;  4OD4 A;  5KYY A;  3ABL C;  2A69 F;  1VOM A;  2Y3B A;  2Q9A A;  3WG7 C;  3OWT A;  1MND A;  4FES A;  3UMH A;  1ZHY A;  4CS7 A;  3JRT A;  1SMY F;  1FFH A;  1NG1 A;  3L34 A;  1VK5 A;  1J8M F;  1RJ9 B;  2R7O A;  2NUT B;  1OCO C;  3NYL A;  5DS6 A;  5E3C A;  4CSA C;  4OD5 A;  1ZHW A;  4YN0 B;  5KYW A;  5L3Q A;  2J0X A;  3V7O A;  5KYN A;  3WOD F;  4JZA A;  3AG4 C;  3Q6N A;  3EHM A;  3NYM A;  5DS5 A;  2W4M A;  4E7Z A;  3GOD A;  4BJ1 A;  3ZC4 A;  3EHN A;  3K66 A;  3NDB B;  1MMN A;  4J30 B;  2OG2 A;  4WJ0 A;  3EFO B;  3EGX B;  2C03 A;  4O6Y A;  2L81 A;  4LAC B;  1BR4 A;  4MQ9 F;  3N0T A;  4C3E A;  2HV7 A;  2J7P D;  1PD1 A;  2PF4 E;  3AQC A;  3H65 A;  3NKD A;  1ZHT A;  4QDL A;  2PX3 A;  2Q9B A;  4JJG A;  2NG1 A;  2Z15 A;  2CGE A;  3LNR A;  3CQZ A;  4C3D A;  3IEE A;  2J9U A;  4CSA A;  1JPN A;  2J45 A;  3SP1 A;  3DJN B;  3GAN A;  3ZSU A;  1OKK A;  2W9Y A;  2JD3 A;  4AE4 B;  1D0Z A;  2R7U A;  2A6H F;  2J0W A;  2QTV A;  5HSW A;  4EWC A;  2WZF A;  4RBN A;  4PJJ A;  2YZS A;  2NUP B;  3X1O A;  2WVQ A;  4J32 B;  3RH3 A;  3T4R A;  3EFO A;  3S29 A;  3Q7G A;  1W2W A;  2YHS A;  4ZLD A;  1WGW A;  4U5C E;  3LLI A;  2A1D D;  4IRU A;  2GFH A;  4KNV A;  1TWA A;  3ECS A;  2PX0 A;  4U5G A;  3EZI A;  2X51 A;  4OIO F;  3B0P A;  3LES A;  3NG1 A;  3SYN A;  2DGJ A;  3PHF 2;  2CW0 F;  3EG9 A;  3Q7L A;  3AQB A;  2P6V A;  5D92 A;  4XLP F;  3UMI A;  4CS8 C;  2Y39 A;  5KYW B;  2KNH A;  4JCH A;  3K1I C;  4H4K C;  1O87 A;  4U5D E;  2NUP A;  2WB7 A;  1OCZ C;  1ZU4 A;  4CBE A;  1MNE A;  2XL4 A;  5EGY A;  2KGO A;  1LVK A;  2VAS A;  1NU7 D;  2CNW D;  1M2V B;  2G3K A;  4DBR A;  5E3A A;  3VAY A;  3LS1 A;  4HFF B;  4YT2 A;  2Q3T A;  3HJC A;  3LLK A;  4LER A;  4OIR F;  4BJT A;  3ASN C;  5L3V A;  4Q7C A;  2WVO A;  4U5H A;  5EHH A;  3ABK C;  3I5Q A;  3OEO A;  4JJF A;  1FTS A;  1QLE C;  2J46 A;  3ITF A;  2DYR C;  4PJM A;  3UR3 C;  1ST6 A;  4K0D A;  2R7X A;  4CS8 A;  2B0J A;  3I5P A;  4KC9 A;  3B9Q A;  3F47 A;  4AK9 A;  3CZ6 A;  4PFO A;  1D1C A;  4GYT A;  4ULW A;  3S28 A;  2H7B A;  2DYS C;  3EPV A;  5B1A C;  3POV A;  4ANJ A;  3PMR A;  1OCC C;  3LEV A;  2LSE A;  4CS9 C;  4KNW A;  3KKB A;  1M56 C;  1J8Y F;  3ZIB A;  2V26 A;  3KMI A;  1D0X A;  1M2V A;  3MLG A;  4EBB A;  1M57 C;  3DAG A;  2FGY A;  5DLJ A;  4HEA J;  3ASO C;  3VYW A;  3OA1 A;  3NRH A;  3LJB A;  4NY3 A;  3ZVR A;  4FX5 A;  2Y3D A;  4PK4 A;  3HTK C;  4XLN F;  3I4U A;  2EIK C;  3K33 A;  4F4B A;  4BJ6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...