1W2WA

Crystal structure of yeast ypr118w, a methylthioribose-1-phosphate isomerase related to regulatory eif2b subunits
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
211
structure length
211
Chain Sequence
MSLEAIVFDRSEPENVSVKVLDQLLLPYTTKYVPIHTIDDGYSVIKSMQVRGAPAIAIVGSLSVLTEVQLIKHNPTSDVATLYSLVNWESTKTVLNKRLDFLLSSRPTAVNLSNSLVEIKNILKSSSDLKAFDGSLYNYVCELIDEDLANNMKMGDNGAKYLIDVLQKDGFKDEFAVLTICNTGSLATSGYGTALGVIRSLWKDSLAKTDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5-METHYLTHIORIBOSE-1-PHOSPHATE ISOMERASE
publication title Crystal Structure of Yeast Ypr118W, a Methylthioribose-1-Phosphate Isomerase Related to Regulatory Eif2B Subunits
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Isomerase
total genus 76
structure length 211
sequence length 211
chains with identical sequence E, I, M
ec nomenclature ec 5.3.1.23: S-methyl-5-thioribose-1-phosphate isomerase.
pdb deposition date 2004-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1840 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1w2wA00
1W2WA
chains in the Genus database with same CATH superfamily
2KQ9A 2HSQA 4PJMA 4XWJA 3KYIA 1VLTA 4I44A 4MVUA 2CYDA 2Q4FA 2VCAA 4LLEA 5FZTA 2XXAA 4B6IA 4CJOA 3DE8A 3UMIA 2MHRA 2V26A 3H65A 2FFHA 4N06A 1H9TA 1D0YA 1KTMA 3KL4A 3GODA 3ASNC 2WB7A 3OWTA 3AOUA 1LE2A 3ATPA 4BJ6A 2Y3GA 5B1AC 3U3BA 3EZIA 1NLXA 3M79A 3JSZA 3VF0A 4ULWA 1XZQA 4U5DE 3SYNA 3T6GB 1Z3IX 1C02A 4Q5SF 2Y39A 1OR3A 3W2VA 3A9CA 2KK1A 2YWAA 4BJ5A 1Y6DA 3V5YA 4JVSA 2HMQA 1V74B 1G5ZA 2J0WA 3JYYA 3LEVA 1DOWA 4PFOA 4OINF 3S9OA 3RKOF 1L7CA 1TQGA 1YAUO 2ETSA 3UMHA 2EPMX 3C8ZA 3ZG1A 5JRAA 1CGOA 4RDAA 2YKZA 4U5FE 1S7ZA 2XL8A 2I8BA 2J9VA 3DD7A 1M2OA 1S05A 1TFOB 4IRUA 2H7BA 4J30B 3M1CB 4J7YA 3RFYA 4BJ6C 3FDQA 2J8WA 2IBFA 2R7QA 3UMKA 4D4NA 5FCLA 3DMDA 3LNMB 2R02A 2LCHA 4U5GA 4HFFB 5DS6A 3LLIA 1LM3B 2Q9CA 2WL8A 2AVKA 3EFOA 1APCA 5JUAA 1D0ZA 3HLZA 1JRAA 4IWBA 4BJ5C 4OIQF 3L8JA 2OEVA 2HV7A 2HZ8A 3DM5A 4MNDA 4U5CE 4DJ9A 1GGQA 2XS8A 4U9EA 4XPWA 3X1OA 3V5ZA 3Q7GA 2AWCA 5A69A 3AGUA 1EKYA 4YL1A 4K7BA 3OEOA 1PV3A 5B1BC 1GS9A 3S84A 3LJBA 3CAXA 5KYXA 2MWQA 3OA1A 5E3AA 1JR8A 2H7OA 2DYSC 1HMDA 1IZMA 1YA9A 4MW3A 4NTAA 2FGYA 4PJLA 3MX3A 4FWVA 1GQAA 1ZVZA 4YWQA 2IOQA 2A69F 2O9XA 2RSEB 3ZQYA 3ZWIA 1E84A 2QLAA 4PK4A 2XLEA 3VRCA 2OCCC 1BR2A 4ER9A 3H2VA 1MMAA 1LPEA 1A41A 5COGA 4ZLCA 4JTAB 4DXWA 1ZHYA 1O5HA 1SF8A 3J06A 3MFNA 2W9YA 2YZSA 3FMSA 4JC7A 5T3WA 4DBQA 3U0CA 2BL2A 2PP4A 3JTLO 3LS0A 1VYKA 2J9UA 2XLVA 2A0BA 1W2WA 2VCCA 3T9OA 3TOMA 3B9QA 3RW0A 4OIOF 3Q6MA 3JT1A 1F1MA 5D92A 4W8PA 1BR1A 4IGGA 3IPMO 4ULVA 3RIPA 4EBKA 3RF3A 3ABMC 1M56C 2Y3DA 4HFKB 4Z9JA 4BJ1A 4NCQA 2KSFA 4H54A 4YN0B 2LQGA 1O87A 2C04A 3GEEA 5JVEA 3TD7A 3PMRA 2R7UA 1NBBA 1OKKD 2L7AA 3UGOA 4G7OF 2AU5A 4DVZA 5E2QA 2J46A 2VH3A 3DE9A 4MVQA 2XLDA 3U8PA 3TULA 3EHNA 1VYIA 2WVNA 3NKEA 3KYJA 2QNLA 4ZLDA 3AQCA 2G3VA 3KKBA 1HE9A 4OD5A 2DI3A 4AE4A 4E18A 1ZW2A 1RJ9A 2Q9BA 1BR4A 1YARO 4JIOA 5DQZA 3C18A 3FVYA 5F5FA 2NUPA 4C7OA 5GPGB 2AWYA 3K33A 3EGXA 4G7ZF 2YVKA 2ZD9A 2NSGA 5KYNA 2JX0A 1J8YF 2HS5A 2OKUA 1MNDA 3QZCA 2R7VA 1EQ1A 1Q0KA 5KYWA 1RKCA 4LDKA 1AVOB 3B29A 3TJ6A 5DS4A 3DJNB 4JCZA 3PDMP 1U89A 5KYUB 2DGJA 4N6HA 4N6CA 1YDIA 4DRHB 2NG1A 3R2PA 1ZU4A 2KYHA 4LDRA 3MBGA 1Q0GA 3NMKA 4MVSA 4CIPA 1E85A 2OJQA 1XZPA 4KNVA 4O79A 3GORA 1BDJB 1NSGB 2GA0A 3DI5A 3KPHA 1M6TA 1R4TA 1J8MF 1WATA 2Q00A 4NY3A 4CS9A 1WWPA 4JURI 2LSEA 4GYTA 3V5XA 1M2VB 2EPKX 2G3KA 1KNYA 3NMIA 2HFIA 1SMYF 3L8IA 4A4AA 5EHHA 3IQCA 1H9GA 2P7VA 1LKXA 1OCZC 2OG2A 3DAGA 4FX5A 3ZSUA 4RBNA 3LESA 3C8GB 3ZQVA 2Y3BA 4IARA 1FR0A 3CSKA 4IB4A 5AC5A 2Z15A 4E0IA 1B68A 3EH1A 4MTOA 4BPMA 1E86A 2YL0A 3S90A 3EQLF 3L1MA 2YHSA 3GWNA 3RVZA 2WVQA 3H2UA 4YT8A 1RKEB 3O6XA 3NYLA 2R7SA 3BEHA 2YLGA 1ORYA 3EHMA 3G4XA 3TQOA 3ITFA 1NU9C 2PBEA 3JRTA 5AGFA 2LFFA 3O10A 4CS9C 1OKKA 2IYLD 1CGME 1TR2A 4PJNA 4RD9A 1PD1A 5L3QA 2A1DD 2LIGA 4C3DA 1CPQA 5A6BD 2D5RB 1VB5A 2VASA 4EBBA 1Z63A 1NFNA 3ABKC 1HW1A 3ZIBA 3W8HA 4IAQA 4EKWA 4NTBA 4EUKB 1TKNA 3NRHA 3S27A 256BA 3LLKA 3SNHA 4DOZA 3S28A 2OQMA 2FAPB 1RCPA 4P9TA 2HV6A 2CW0F 2A0UA 2HMZA 1QPUA 1WOLA 2H8AA 2OOCA 3T6BA 1MMGA 1FMVA 4BEMJ 3POVA 1KU2A 4CDVA 4MQ9F 4P6IC 3AQBA 5L0GA 2MYSA 1L3PA 3B0PA 2A68F 2YEVA 4J32B 2Y69C 2C03A 1UG7A 3HNIA 2WZGA 3M15A 4E7ZA 4EBJA 5B3IA 4U5BE 4I3MA 1FMWA 3EG9B 4LERA 3WODF 4YT5A 2HKVA 4DBRA 5HV9A 4FESA 4E0HA 5JLIA 2TMVP 2Q9AA 1LS4A 4PJJA 4JRZA 4K1OA 2OEXA 2R03A 4U9DA 3U9MA 3FOOA 3PCVA 4F4BA 3I5PA 4OIRF 3JYHA 1T5OA 2CGEA 1VMAA 2A6EF 4HE8D 1Z23A 3SXMA 2YL1A 3S29A 1A7VA 2F22A 1JPJA 4AL0A 3FAPB 2JD3A 4GQHA 2BE5F 1U6HA 4O7GA 4JZAA 4EHPA 1ZHWA 3QVZA 3LAYA 2L81A 3BRJA 3US6A 2NUTB 2XLWA 2ZXOA 2YRFA 2KW3C 2YL7A 4NC3A 4CDAA 2PX3A 5DQTA 5KYYB 1AUEA 2HJMA 4MTFA 2DYRC 3N0TA 4JKVA 3NG1A 3SP1A 3FHDA 1JMWA 4A2NB 1MMDA 1HW2A 4E17A 3TOLA 4XPXA 2PF4E 1YA7O 1ZHXA 2YQYA 5L3VA 2GFHA 5A6BA 1OW8A 3RYLA 2R25A 1DOVA 4Z9HA 1SZIA 3MLGA 1TFKB 3MYIA 4Z9IA 4XLNF 3DM9B 3DXJF 3B71A 2ZXRA 3ASOC 1RXQA 2X0CA 2KNHA 2W4MA 4CX9A 1E83A 4XEVA 4I1OB 4YJWA 1T9KA 3MYFA 5AC4A 4FAPB 3A11A 2KC3A 1XWJA 1G4US 1K04A 1OW6A 2YL3A 3HKKA 2ZPAA 4CS7A 1HMOA 2RD9A 5IY5C 1Q0DA 3UGPA 3C63A 3DZAA 5COFA 1G4WR 1VK5A 2G62A 3EGDB 3JRMO 1QSPA 4MW8A 3U5SA 2XS1A 3FOPA 3K1HA 1NU7D 1QZXA 3G50A 3EPVA 3V7OA 3EJNA 3W4YA 1R5ID 3RH3A 2XLMA 4U5EE 1PD0A 2QE9A 3NYJA 3C8GD 3VAYA 2ASRA 3GM1A 2L6FA 1D1AA 3GM3A 2XXAB 1A7EA 3LS1A 2J45A 1WN0A 5L0CA 4QI0A 2L6GA 2A6HF 4YT4A 1SR2A 1AEPA 3F46A 1MQVA 2XLOA 2XSEA 3T4RA 4IAOA 3JCUQ 3PHF2 3ZTZA 1OR2A 1HE1A 1D1CA 1LIHA 3C7JA 1LE4A 4XEFA 5L0FA 4UDVA 1EI7A 1LVKA 2X51A 4O6YA 3N24A 1YZCA 4DVYP 1OXKA 2JPUA 3E70C 1I4ZA 4WJ0A 2R7OA 1YJGA 1Z7Qc 3U8VA 3AG3C 2E87A 3VYWA 1Q0FA 2DB4A 4XPYA 5DLJA 2IM8A 4QI2A 2IXOA 3W2WA 3O39A 3DWWA 4JCHA 3U9JA 1QKRA 1ZW3A 1E2XA 3U3FA 5T1DB 4CJGA 1FFTC 1MNEA 1OCOC 2NSFA 3AG4C 1C17M 3M4BA 2R7WA 1FNTc 2PNOA 4CIHA 3RQFA 5JP7A 3R7CA 3EFOB 2YLDA 4JW1A 1NZEA 2PX0A 3Q6NA 4N4WA 5KYUA 4G0HA 4P9FA 3TJ5A 3GANA 4LLCA 2EIKC 1H7IA 1PCXA 3RQGA 3AGTA 1ST6A 3QTHA 4O6MA 3NDBB 5K0IA 1I4YA 1MMNA 2Y3HA 1U0BB 5CIVA 3AG2C 5KYXB 4CBEA 3JSEO 3S0XA 3NKDA 2CNWD 1WASA 2LD6A 3HNJA 1OQCA 3HNKA 3LNRA 3CEXA 1M2VA 1TWCA 3HNLA 3SXKA 4C3EA 4KC9A 3SEOA 5TJ5E 1V54C 3I5QA 1CGNA 4KNWA 3SZRA 4MVMA 1UFBA 5F28E 2KGOA 4Q7CA 4LDQA 1RMVA 2B0HA 3C8GA 1YLMA 3E9VA 4MVRA 3LUTB 4JEAA 1EA8A 2AP3A 3WAQA 2J9BA 1FFHA 3IEEA 4X0RA 3K6BA 4LACB 4BJTA 1K40A 4JJGA 4G7HF 2LK4A 3QMKA 1RKEA 3ZTMA 3IQ6A 4CSAA 2XL4A 1M57C 4GEHA 5CI9A 1FTSA 5A6JA 3K66A 2D4UA 3F47A 4OD4A 1YYJA 2IXMA 5BUOA 4Q4ZF 1D1BA 3IHUA 4YL0A 1OCCC 5JS5A 1TWAA 2L6HA 3HTKC 1ZHZA 5L0IA 3GWLA 4XLPF 1LS1A 1G8XA 3B0UX 1FAPB 2UUIA 3N2ZB 1A0BA 2M64A 2QTVA 2WVOA 4JTCB 2EILC 2EPOA 3FXHA 3GM2A 4MS2A 2OU6A 5BQIA 1N1CA 3FAJA 3TK0A 5JT4A 2EPLX 5B3SC 3SXZA 4AK9A 2GAQA 1QLEC 5L0JA 4CS8A 3QW0A 4R32A 2W4BA 4CSAC 2KJGA 4YK5A 4DRJB 1OXBA 2M4EA 1NFOA 2R7TA 1YZAA 4MVOA 1BBHA 1WGWA 2J9WA 3M4CA 3NMJA 3QVYA 4JTDB 2NPUA 3ZDLA 2J7PD 4AE4B 4OIPF 5EK0A 5DS5A 4XQ1A 4JE9A 5E3CA 1RJ9B 1C03A 2WZFA 2XRHA 5EGYA 5L0DA 5L0HA 2IXNA 4EWCA 1LI7A 2NUPB 4C7OB 1TWHA 3O55A 2EIJC 5COMA 3W8IA 2Q7RA 1Z6AA 1ZHTA 3EG9A 3EGXB 2HJ3A 3DAFA 3K1IA 4PR9A 3IQTA 1I5NA 5E33A 3SXYA 1IW7F 3Q7LA 3K7DA 3U2LA 2R7XA 1CPRA 1SYQA 2GDCA 4JJFA 3KMIA 2XL6A 4M63A 5D91A 5F5HA 4CS8C 5KYWB 4KI2A 3U2MA 2P6VA 3X2QC 2QY9A 1T6IA 2CNWA 4BEJA 5CI8A 1OW7A 3G4ZA 1K05A 4KBLA 3JZ0A 4QDLA 2R9RB 2ZXPA 1T6QA 2R05A 3QW1A 1O3UA 1NG1A 4ANJA 4CDYA 2EPNA 3T6JA 2BC5A 2R7RA 2P1AA 2B0JA 4YT2A 3DKAA 3ZC4A 2HSBA 1T01A 2NUTA 3ZVRA 2Q3TA 4J7TA 3K1IC 2IXPA 3GEHA 2ICWG 1TWGA 2W45A 1H6GA 1LI5A 2HUJA 2ZXWC 4C3BA 1QQ3A 4E7SA 5KYYA 2PFDA 4BG0A 2I15A 1BZ4A 4U5HA 4AL1A 3L34A 4K0DA 5DVWA 2WZLA 1ORSC 2UUHA 3CZ6A 4D4XA 2LFDA 4W8KA 4IJJA 3IQ5A 3RQEA 3UR3C 3B0VC 2V3CC 2H7VC 3ECSA 4XTKA 1Y4CA 2XLHA 2J0XA 3AJMA 3WHNA 3KH2A 4G78A 4HEAJ 2OJED 3ABLC 3CQZA 4I1MA 4NTFA 2YLIA 2P0NA 5JSLA 1JOGA 4ONSA 1JAFA 1ZZPA 4H4KC 4PACA 3VM6A 4MVZA 3DJUB 1D0XA 2P61A 4L6RA 3RVYA 4YL3A 4DRIB 2EINC 1YVIA 1V4AA 2VCBA 2VB6A 3AG1C 3UNGC 5HSWA 4WABA 3EZHA 2QUPA 4WGYA 2VC9A 3L0IA 3I4UA 4PFPA 5BQGA 2EIMC 3EH2A 2GWWA 1ZYRF 1Z5ZA 3WG7C 1A7DA 2J7PA 1T6UA 4WGZA 1HY5A 2CCYA 3HJCA 5T3TA 1GM5A 2XM4A 2LP4A 3NYMA 5BQHA 1VOMA 3EGDA 2CDQA 4JEBA 4XEKA 4EIYA 1QVXA 4O6NA 1JPNA 2XM0A 4NQFA 1ORJA 3GEIA 1ZU5A 5A6AA 1V55C 4MTGA 5A6KA 1VTMP 3C62A 1YYXA 3LEOA 1VLSA 1OCRC 2L9JA 1Q0MA 1WTYA 4AX2A
chains in the Genus database with same CATH topology
2KQ9A 4XWJA 4PJMA 4I44A 4LLEA 2XXAA 4B6IA 3UMIA 3H65A 2V26A 2FFHA 4N06A 1D0YA 3KL4A 3GODA 3ASNC 2WB7A 3OWTA 4BJ6A 2Y3GA 5B1AC 3EZIA 3JSZA 4ULWA 4U5DE 3SYNA 1Z3IX 4Q5SF 2Y39A 3W2VA 4BJ5A 4JVSA 3LEVA 2J0WA 4PFOA 4OINF 3RKOF 3ZG1A 3UMHA 4RDAA 4U5FE 1S7ZA 3DD7A 2I8BA 2J9VA 1M2OA 4J30B 4BJ6C 4IRUA 2H7BA 3RFYA 3M1CB 3FDQA 3UMKA 2R7QA 5FCLA 3DMDA 4U5GA 4HFFB 5DS6A 3LLIA 2Q9CA 2WL8A 3EFOA 1D0ZA 3HLZA 4IWBA 4BJ5C 4OIQF 2HV7A 3DM5A 4U5CE 4MNDA 3X1OA 3Q7GA 4K7BA 3OEOA 5B1BC 3LJBA 5KYXA 2MWQA 3OA1A 5E3AA 2H7OA 2DYSC 1IZMA 4PJLA 2FGYA 3MX3A 4FWVA 4YWQA 2IOQA 2A69F 2O9XA 4PK4A 2OCCC 1BR2A 1MMAA 4ZLCA 1ZHYA 1O5HA 1SF8A 5T3WA 2W9YA 2YZSA 4DBQA 2PP4A 3LS0A 1VYKA 2J9UA 4OIOF 1W2WA 3B9QA 3Q6MA 3JT1A 5D92A 1BR1A 3RIPA 3ABMC 1M56C 2Y3DA 4HFKB 4BJ1A 4YN0B 1O87A 2C04A 3TD7A 3PMRA 2R7UA 4G7OF 1OKKD 3UGOA 4DVZA 5E2QA 2J46A 2VH3A 3EHNA 1VYIA 2WVNA 3NKEA 4ZLDA 3AQCA 2G3VA 3KKBA 4OD5A 4AE4A 1RJ9A 2Q9BA 1BR4A 5DQZA 3FVYA 5F5FA 2NUPA 4C7OA 3K33A 3EGXA 4G7ZF 5KYNA 1J8YF 2R7VA 3QZCA 1MNDA 5KYWA 5DS4A 3DJNB 5KYUB 2DGJA 2NG1A 1ZU4A 4O79A 4KNVA 1J8MF 4NY3A 4CS9A 4JURI 2LSEA 4GYTA 1M2VB 2G3KA 1SMYF 5EHHA 2P7VA 1LKXA 1OCZC 2OG2A 3DAGA 4FX5A 3ZSUA 4RBNA 3LESA 2Y3BA 3CSKA 2Z15A 3EH1A 3EQLF 2YHSA 2WVQA 4YT8A 3O6XA 3NYLA 2R7SA 3EHMA 3ITFA 1NU9C 4CS9C 3JRTA 1OKKA 2IYLD 1TR2A 4PJNA 4RD9A 1PD1A 5L3QA 2A1DD 4C3DA 1Z63A 2D5RB 2VASA 4EBBA 3ABKC 3ZIBA 3W8HA 1TKNA 3NRHA 3S27A 3LLKA 3SNHA 4DOZA 3S28A 2HV6A 2CW0F 3T6BA 1MMGA 1FMVA 3POVA 1KU2A 2V3CC 4MQ9F 4P6IC 3AQBA 2MYSA 3B0PA 4J32B 2A68F 2YEVA 2Y69C 2C03A 4E7ZA 2WZGA 4U5BE 4I3MA 1FMWA 3EG9B 4LERA 3WODF 4YT5A 4DBRA 4FESA 2Q9AA 4PJJA 4F4BA 3I5PA 4OIRF 3JYHA 2CGEA 1VMAA 2A6EF 4HE8D 1Z23A 3S29A 1JPJA 2JD3A 2BE5F 4O7GA 4JZAA 1ZHWA 3LAYA 2L81A 2NUTB 2ZXOA 2KW3C 2PX3A 5DQTA 5KYYB 2DYRC 3N0TA 3SP1A 3NG1A 3FHDA 4A2NB 1MMDA 2PF4E 1ZHXA 5L3VA 2GFHA 3RYLA 1SZIA 3MLGA 4XLNF 3DM9B 3DXJF 2ZXRA 3ASOC 2KNHA 2W4MA 4I1OB 4YJWA 2ZPAA 4CS7A 5IY5C 3UGPA 3DZAA 1VK5A 2G62A 3EGDB 3K1HA 1NU7D 1QZXA 3EPVA 3V7OA 3EJNA 3RH3A 4U5EE 1PD0A 3NYJA 3VAYA 1D1AA 2XXAB 3LS1A 2J45A 4QI0A 2A6HF 4YT4A 3F46A 2XSEA 3T4RA 4IAOA 3JCUQ 3PHF2 1D1CA 1LVKA 2X51A 4O6YA 3N24A 4DVYP 3E70C 4WJ0A 2R7OA 1OCRC 3AG3C 2E87A 3VYWA 5DLJA 4QI2A 2IXOA 3W2WA 3O39A 4JCHA 5T1DB 1FFTC 1MNEA 1OCOC 3AG4C 2R7WA 4CIHA 3EFOB 4JW1A 1NZEA 2PX0A 3Q6NA 5KYUA 4G0HA 3GANA 4LLCA 2EIKC 1PCXA 1ST6A 4O6MA 3NDBB 1MMNA 2Y3HA 3AG2C 5KYXB 4CBEA 3S0XA 3NKDA 2CNWD 3LNRA 4Q4ZF 1M2VA 1TWCA 4C3EA 4KC9A 3SEOA 1V54C 3I5QA 3SZRA 4KNWA 2KGOA 4Q7CA 3E9VA 4G7HF 1FFHA 3IEEA 4X0RA 3K6BA 4LACB 4BJTA 4JJGA 3QMKA 4CSAA 2XL4A 1M57C 4GEHA 5CI9A 1FTSA 3K66A 3F47A 4OD4A 2IXMA 5BUOA 1D1BA 1OCCC 1TWAA 3HTKC 4XLPF 1ZHZA 1LS1A 1G8XA 3B0UX 3N2ZB 2QTVA 2WVOA 2EILC 3FAJA 5B3SC 4AK9A 1QLEC 4CS8A 4CSAC 2W4BA 2KJGA 2M4EA 2R7TA 1WGWA 2J9WA 2J7PD 4AE4B 4OIPF 5DS5A 5E3CA 1RJ9B 2XRHA 2WZFA 5EGYA 2IXNA 4EWCA 2NUPB 4C7OB 1TWHA 2EIJC 3W8IA 1Z6AA 1ZHTA 3EG9A 3EGXB 3DAFA 5E33A 1IW7F 3Q7LA 3K7DA 2R7XA 5F5HA 4JJFA 4M63A 3KMIA 5D91A 4CS8C 5KYWB 4KI2A 3X2QC 2P6VA 2QY9A 2CNWA 4BEJA 5CI8A 4KBLA 4QDLA 2ZXPA 4ANJA 1NG1A 3T6JA 2R7RA 2B0JA 4YT2A 3ZC4A 2NUTA 3ZVRA 2Q3TA 3K1IC 2IXPA 1TWGA 2W45A 4C3BA 4E7SA 5KYYA 2ZXWC 2PFDA 4BG0A 4U5HA 3L34A 4K0DA 5DVWA 2WZLA 3CZ6A 4W8KA 4IJJA 3UR3C 3B0VC 2H7VC 3ECSA 4XTKA 2J0XA 3KH2A 4HEAJ 3ABLC 3CQZA 4I1MA 4H4KC 3DJUB 1D0XA 5HSWA 2EINC 3UNGC 2VB6A 3AG1C 3EZHA 3L0IA 4PFPA 3I4UA 2EIMC 3EH2A 1ZYRF 1Z5ZA 3WG7C 2J7PA 3HJCA 5T3TA 3NYMA 1VOMA 3EGDA 2CDQA 4O6NA 1JPNA 1ZU5A 1V55C 1N1CA 2L9JA 4AX2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W2W A; 
#chains in the Genus database with same CATH topology
 2KQ9 A;  2HSQ A;  4PJM A;  4XWJ A;  3KYI A;  1VLT A;  4I44 A;  4MVU A;  2CYD A;  2Q4F A;  2VCA A;  4LLE A;  5FZT A;  2XXA A;  4B6I A;  4CJO A;  3DE8 A;  3UMI A;  2MHR A;  2V26 A;  3H65 A;  2FFH A;  4N06 A;  1H9T A;  1D0Y A;  1KTM A;  3KL4 A;  3GOD A;  3ASN C;  2WB7 A;  3OWT A;  3AOU A;  1LE2 A;  3ATP A;  4BJ6 A;  2Y3G A;  5B1A C;  3U3B A;  3EZI A;  1NLX A;  3M79 A;  3JSZ A;  3VF0 A;  4ULW A;  1XZQ A;  4U5D E;  3SYN A;  3T6G B;  1Z3I X;  1C02 A;  4Q5S F;  2Y39 A;  1OR3 A;  3W2V A;  3A9C A;  2KK1 A;  2YWA A;  4BJ5 A;  1Y6D A;  3V5Y A;  4JVS A;  2HMQ A;  1V74 B;  1G5Z A;  2J0W A;  3JYY A;  3LEV A;  1DOW A;  4PFO A;  4OIN F;  3S9O A;  3RKO F;  1L7C A;  1TQG A;  1YAU O;  2ETS A;  3UMH A;  2EPM X;  3C8Z A;  3ZG1 A;  5JRA A;  1CGO A;  4RDA A;  2YKZ A;  4U5F E;  1S7Z A;  2XL8 A;  2I8B A;  2J9V A;  3DD7 A;  1M2O A;  1S05 A;  1TFO B;  4IRU A;  2H7B A;  4J30 B;  3M1C B;  4J7Y A;  3RFY A;  4BJ6 C;  3FDQ A;  2J8W A;  2IBF A;  2R7Q A;  3UMK A;  4D4N A;  5FCL A;  3DMD A;  3LNM B;  2R02 A;  2LCH A;  4U5G A;  4HFF B;  5DS6 A;  3LLI A;  1LM3 B;  2Q9C A;  2WL8 A;  2AVK A;  3EFO A;  1APC A;  5JUA A;  1D0Z A;  3HLZ A;  1JRA A;  4IWB A;  4BJ5 C;  4OIQ F;  3L8J A;  2OEV A;  2HV7 A;  2HZ8 A;  3DM5 A;  4MND A;  4U5C E;  4DJ9 A;  1GGQ A;  2XS8 A;  4U9E A;  4XPW A;  3X1O A;  3V5Z A;  3Q7G A;  2AWC A;  5A69 A;  3AGU A;  1EKY A;  4YL1 A;  4K7B A;  3OEO A;  1PV3 A;  5B1B C;  1GS9 A;  3S84 A;  3LJB A;  3CAX A;  5KYX A;  2MWQ A;  3OA1 A;  5E3A A;  1JR8 A;  2H7O A;  2DYS C;  1HMD A;  1IZM A;  1YA9 A;  4MW3 A;  4NTA A;  2FGY A;  4PJL A;  3MX3 A;  4FWV A;  1GQA A;  1ZVZ A;  4YWQ A;  2IOQ A;  2A69 F;  2O9X A;  2RSE B;  3ZQY A;  3ZWI A;  1E84 A;  2QLA A;  4PK4 A;  2XLE A;  3VRC A;  2OCC C;  1BR2 A;  4ER9 A;  3H2V A;  1MMA A;  1LPE A;  1A41 A;  5COG A;  4ZLC A;  4JTA B;  4DXW A;  1ZHY A;  1O5H A;  1SF8 A;  3J06 A;  3MFN A;  2W9Y A;  2YZS A;  3FMS A;  4JC7 A;  5T3W A;  4DBQ A;  3U0C A;  2BL2 A;  2PP4 A;  3JTL O;  3LS0 A;  1VYK A;  2J9U A;  2XLV A;  2A0B A;  1W2W A;  2VCC A;  3T9O A;  3TOM A;  3B9Q A;  3RW0 A;  4OIO F;  3Q6M A;  3JT1 A;  1F1M A;  5D92 A;  4W8P A;  1BR1 A;  4IGG A;  3IPM O;  4ULV A;  3RIP A;  4EBK A;  3RF3 A;  3ABM C;  1M56 C;  2Y3D A;  4HFK B;  4Z9J A;  4BJ1 A;  4NCQ A;  2KSF A;  4H54 A;  4YN0 B;  2LQG A;  1O87 A;  2C04 A;  3GEE A;  5JVE A;  3TD7 A;  3PMR A;  2R7U A;  1NBB A;  1OKK D;  2L7A A;  3UGO A;  4G7O F;  2AU5 A;  4DVZ A;  5E2Q A;  2J46 A;  2VH3 A;  3DE9 A;  4MVQ A;  2XLD A;  3U8P A;  3TUL A;  3EHN A;  1VYI A;  2WVN A;  3NKE A;  3KYJ A;  2QNL A;  4ZLD A;  3AQC A;  2G3V A;  3KKB A;  1HE9 A;  4OD5 A;  2DI3 A;  4AE4 A;  4E18 A;  1ZW2 A;  1RJ9 A;  2Q9B A;  1BR4 A;  1YAR O;  4JIO A;  5DQZ A;  3C18 A;  3FVY A;  5F5F A;  2NUP A;  4C7O A;  5GPG B;  2AWY A;  3K33 A;  3EGX A;  4G7Z F;  2YVK A;  2ZD9 A;  2NSG A;  5KYN A;  2JX0 A;  1J8Y F;  2HS5 A;  2OKU A;  1MND A;  3QZC A;  2R7V A;  1EQ1 A;  1Q0K A;  5KYW A;  1RKC A;  4LDK A;  1AVO B;  3B29 A;  3TJ6 A;  5DS4 A;  3DJN B;  4JCZ A;  3PDM P;  1U89 A;  5KYU B;  2DGJ A;  4N6H A;  4N6C A;  1YDI A;  4DRH B;  2NG1 A;  3R2P A;  1ZU4 A;  2KYH A;  4LDR A;  3MBG A;  1Q0G A;  3NMK A;  4MVS A;  4CIP A;  1E85 A;  2OJQ A;  1XZP A;  4KNV A;  4O79 A;  3GOR A;  1BDJ B;  1NSG B;  2GA0 A;  3DI5 A;  3KPH A;  1M6T A;  1R4T A;  1J8M F;  1WAT A;  2Q00 A;  4NY3 A;  4CS9 A;  1WWP A;  4JUR I;  2LSE A;  4GYT A;  3V5X A;  1M2V B;  2EPK X;  2G3K A;  1KNY A;  3NMI A;  2HFI A;  1SMY F;  3L8I A;  4A4A A;  5EHH A;  3IQC A;  1H9G A;  2P7V A;  1LKX A;  1OCZ C;  2OG2 A;  3DAG A;  4FX5 A;  3ZSU A;  4RBN A;  3LES A;  3C8G B;  3ZQV A;  2Y3B A;  4IAR A;  1FR0 A;  3CSK A;  4IB4 A;  5AC5 A;  2Z15 A;  4E0I A;  1B68 A;  3EH1 A;  4MTO A;  4BPM A;  1E86 A;  2YL0 A;  3S90 A;  3EQL F;  3L1M A;  2YHS A;  3GWN A;  3RVZ A;  2WVQ A;  3H2U A;  4YT8 A;  1RKE B;  3O6X A;  3NYL A;  2R7S A;  3BEH A;  2YLG A;  1ORY A;  3EHM A;  3G4X A;  3TQO A;  3ITF A;  1NU9 C;  2PBE A;  3JRT A;  5AGF A;  2LFF A;  3O10 A;  4CS9 C;  1OKK A;  2IYL D;  1CGM E;  1TR2 A;  4PJN A;  4RD9 A;  1PD1 A;  5L3Q A;  2A1D D;  2LIG A;  4C3D A;  1CPQ A;  5A6B D;  2D5R B;  1VB5 A;  2VAS A;  4EBB A;  1Z63 A;  1NFN A;  3ABK C;  1HW1 A;  3ZIB A;  3W8H A;  4IAQ A;  4EKW A;  4NTB A;  4EUK B;  1TKN A;  3NRH A;  3S27 A;  256B A;  3LLK A;  3SNH A;  4DOZ A;  3S28 A;  2OQM A;  2FAP B;  1RCP A;  4P9T A;  2HV6 A;  2CW0 F;  2A0U A;  2HMZ A;  1QPU A;  1WOL A;  2H8A A;  2OOC A;  3T6B A;  1MMG A;  1FMV A;  4BEM J;  3POV A;  1KU2 A;  4CDV A;  4MQ9 F;  4P6I C;  3AQB A;  5L0G A;  2MYS A;  1L3P A;  3B0P A;  2A68 F;  2YEV A;  4J32 B;  2Y69 C;  2C03 A;  1UG7 A;  3HNI A;  2WZG A;  3M15 A;  4E7Z A;  4EBJ A;  5B3I A;  4U5B E;  4I3M A;  1FMW A;  3EG9 B;  4LER A;  3WOD F;  4YT5 A;  2HKV A;  4DBR A;  5HV9 A;  4FES A;  4E0H A;  5JLI A;  2TMV P;  2Q9A A;  1LS4 A;  4PJJ A;  4JRZ A;  4K1O A;  2OEX A;  2R03 A;  4U9D A;  3U9M A;  3FOO A;  3PCV A;  4F4B A;  3I5P A;  4OIR F;  3JYH A;  1T5O A;  2CGE A;  1VMA A;  2A6E F;  4HE8 D;  1Z23 A;  3SXM A;  2YL1 A;  3S29 A;  1A7V A;  2F22 A;  1JPJ A;  4AL0 A;  3FAP B;  2JD3 A;  4GQH A;  2BE5 F;  1U6H A;  4O7G A;  4JZA A;  4EHP A;  1ZHW A;  3QVZ A;  3LAY A;  2L81 A;  3BRJ A;  3US6 A;  2NUT B;  2XLW A;  2ZXO A;  2YRF A;  2KW3 C;  2YL7 A;  4NC3 A;  4CDA A;  2PX3 A;  5DQT A;  5KYY B;  1AUE A;  2HJM A;  4MTF A;  2DYR C;  3N0T A;  4JKV A;  3NG1 A;  3SP1 A;  3FHD A;  1JMW A;  4A2N B;  1MMD A;  1HW2 A;  4E17 A;  3TOL A;  4XPX A;  2PF4 E;  1YA7 O;  1ZHX A;  2YQY A;  5L3V A;  2GFH A;  5A6B A;  1OW8 A;  3RYL A;  2R25 A;  1DOV A;  4Z9H A;  1SZI A;  3MLG A;  1TFK B;  3MYI A;  4Z9I A;  4XLN F;  3DM9 B;  3DXJ F;  3B71 A;  2ZXR A;  3ASO C;  1RXQ A;  2X0C A;  2KNH A;  2W4M A;  4CX9 A;  1E83 A;  4XEV A;  4I1O B;  4YJW A;  1T9K A;  3MYF A;  5AC4 A;  4FAP B;  3A11 A;  2KC3 A;  1XWJ A;  1G4U S;  1K04 A;  1OW6 A;  2YL3 A;  3HKK A;  2ZPA A;  4CS7 A;  1HMO A;  2RD9 A;  5IY5 C;  1Q0D A;  3UGP A;  3C63 A;  3DZA A;  5COF A;  1G4W R;  1VK5 A;  2G62 A;  3EGD B;  3JRM O;  1QSP A;  4MW8 A;  3U5S A;  2XS1 A;  3FOP A;  3K1H A;  1NU7 D;  1QZX A;  3G50 A;  3EPV A;  3V7O A;  3EJN A;  3W4Y A;  1R5I D;  3RH3 A;  2XLM A;  4U5E E;  1PD0 A;  2QE9 A;  3NYJ A;  3C8G D;  3VAY A;  2ASR A;  3GM1 A;  2L6F A;  1D1A A;  3GM3 A;  2XXA B;  1A7E A;  3LS1 A;  2J45 A;  1WN0 A;  5L0C A;  4QI0 A;  2L6G A;  2A6H F;  4YT4 A;  1SR2 A;  1AEP A;  3F46 A;  1MQV A;  2XLO A;  2XSE A;  3T4R A;  4IAO A;  3JCU Q;  3PHF 2;  3ZTZ A;  1OR2 A;  1HE1 A;  1D1C A;  1LIH A;  3C7J A;  1LE4 A;  4XEF A;  5L0F A;  4UDV A;  1EI7 A;  1LVK A;  2X51 A;  4O6Y A;  3N24 A;  1YZC A;  4DVY P;  1OXK A;  2JPU A;  3E70 C;  1I4Z A;  4WJ0 A;  2R7O A;  1YJG A;  1Z7Q c;  3U8V A;  3AG3 C;  2E87 A;  3VYW A;  1Q0F A;  2DB4 A;  4XPY A;  5DLJ A;  2IM8 A;  4QI2 A;  2IXO A;  3W2W A;  3O39 A;  3DWW A;  4JCH A;  3U9J A;  1QKR A;  1ZW3 A;  1E2X A;  3U3F A;  5T1D B;  4CJG A;  1FFT C;  1MNE A;  1OCO C;  2NSF A;  3AG4 C;  1C17 M;  3M4B A;  2R7W A;  1FNT c;  2PNO A;  4CIH A;  3RQF A;  5JP7 A;  3R7C A;  3EFO B;  2YLD A;  4JW1 A;  1NZE A;  2PX0 A;  3Q6N A;  4N4W A;  5KYU A;  4G0H A;  4P9F A;  3TJ5 A;  3GAN A;  4LLC A;  2EIK C;  1H7I A;  1PCX A;  3RQG A;  3AGT A;  1ST6 A;  3QTH A;  4O6M A;  3NDB B;  5K0I A;  1I4Y A;  1MMN A;  2Y3H A;  1U0B B;  5CIV A;  3AG2 C;  5KYX B;  4CBE A;  3JSE O;  3S0X A;  3NKD A;  2CNW D;  1WAS A;  2LD6 A;  3HNJ A;  1OQC A;  3HNK A;  3LNR A;  3CEX A;  1M2V A;  1TWC A;  3HNL A;  3SXK A;  4C3E A;  4KC9 A;  3SEO A;  5TJ5 E;  1V54 C;  3I5Q A;  1CGN A;  4KNW A;  3SZR A;  4MVM A;  1UFB A;  5F28 E;  2KGO A;  4Q7C A;  4LDQ A;  1RMV A;  2B0H A;  3C8G A;  1YLM A;  3E9V A;  4MVR A;  3LUT B;  4JEA A;  1EA8 A;  2AP3 A;  3WAQ A;  2J9B A;  1FFH A;  3IEE A;  4X0R A;  3K6B A;  4LAC B;  4BJT A;  1K40 A;  4JJG A;  4G7H F;  2LK4 A;  3QMK A;  1RKE A;  3ZTM A;  3IQ6 A;  4CSA A;  2XL4 A;  1M57 C;  4GEH A;  5CI9 A;  1FTS A;  5A6J A;  3K66 A;  2D4U A;  3F47 A;  4OD4 A;  1YYJ A;  2IXM A;  5BUO A;  4Q4Z F;  1D1B A;  3IHU A;  4YL0 A;  1OCC C;  5JS5 A;  1TWA A;  2L6H A;  3HTK C;  1ZHZ A;  5L0I A;  3GWL A;  4XLP F;  1LS1 A;  1G8X A;  3B0U X;  1FAP B;  2UUI A;  3N2Z B;  1A0B A;  2M64 A;  2QTV A;  2WVO A;  4JTC B;  2EIL C;  2EPO A;  3FXH A;  3GM2 A;  4MS2 A;  2OU6 A;  5BQI A;  1N1C A;  3FAJ A;  3TK0 A;  5JT4 A;  2EPL X;  5B3S C;  3SXZ A;  4AK9 A;  2GAQ A;  1QLE C;  5L0J A;  4CS8 A;  3QW0 A;  4R32 A;  2W4B A;  4CSA C;  2KJG A;  4YK5 A;  4DRJ B;  1OXB A;  2M4E A;  1NFO A;  2R7T A;  1YZA A;  4MVO A;  1BBH A;  1WGW A;  2J9W A;  3M4C A;  3NMJ A;  3QVY A;  4JTD B;  2NPU A;  3ZDL A;  2J7P D;  4AE4 B;  4OIP F;  5EK0 A;  5DS5 A;  4XQ1 A;  4JE9 A;  5E3C A;  1RJ9 B;  1C03 A;  2WZF A;  2XRH A;  5EGY A;  5L0D A;  5L0H A;  2IXN A;  4EWC A;  1LI7 A;  2NUP B;  4C7O B;  1TWH A;  3O55 A;  2EIJ C;  5COM A;  3W8I A;  2Q7R A;  1Z6A A;  1ZHT A;  3EG9 A;  3EGX B;  2HJ3 A;  3DAF A;  3K1I A;  4PR9 A;  3IQT A;  1I5N A;  5E33 A;  3SXY A;  1IW7 F;  3Q7L A;  3K7D A;  3U2L A;  2R7X A;  1CPR A;  1SYQ A;  2GDC A;  4JJF A;  3KMI A;  2XL6 A;  4M63 A;  5D91 A;  5F5H A;  4CS8 C;  5KYW B;  4KI2 A;  3U2M A;  2P6V A;  3X2Q C;  2QY9 A;  1T6I A;  2CNW A;  4BEJ A;  5CI8 A;  1OW7 A;  3G4Z A;  1K05 A;  4KBL A;  3JZ0 A;  4QDL A;  2R9R B;  2ZXP A;  1T6Q A;  2R05 A;  3QW1 A;  1O3U A;  1NG1 A;  4ANJ A;  4CDY A;  2EPN A;  3T6J A;  2BC5 A;  2R7R A;  2P1A A;  2B0J A;  4YT2 A;  3DKA A;  3ZC4 A;  2HSB A;  1T01 A;  2NUT A;  3ZVR A;  2Q3T A;  4J7T A;  3K1I C;  2IXP A;  3GEH A;  2ICW G;  1TWG A;  2W45 A;  1H6G A;  1LI5 A;  2HUJ A;  2ZXW C;  4C3B A;  1QQ3 A;  4E7S A;  5KYY A;  2PFD A;  4BG0 A;  2I15 A;  1BZ4 A;  4U5H A;  4AL1 A;  3L34 A;  4K0D A;  5DVW A;  2WZL A;  1ORS C;  2UUH A;  3CZ6 A;  4D4X A;  2LFD A;  4W8K A;  4IJJ A;  3IQ5 A;  3RQE A;  3UR3 C;  3B0V C;  2V3C C;  2H7V C;  3ECS A;  4XTK A;  1Y4C A;  2XLH A;  2J0X A;  3AJM A;  3WHN A;  3KH2 A;  4G78 A;  4HEA J;  2OJE D;  3ABL C;  3CQZ A;  4I1M A;  4NTF A;  2YLI A;  2P0N A;  5JSL A;  1JOG A;  4ONS A;  1JAF A;  1ZZP A;  4H4K C;  4PAC A;  3VM6 A;  4MVZ A;  3DJU B;  1D0X A;  2P61 A;  4L6R A;  3RVY A;  4YL3 A;  4DRI B;  2EIN C;  1YVI A;  1V4A A;  2VCB A;  2VB6 A;  3AG1 C;  3UNG C;  5HSW A;  4WAB A;  3EZH A;  2QUP A;  4WGY A;  2VC9 A;  3L0I A;  3I4U A;  4PFP A;  5BQG A;  2EIM C;  3EH2 A;  2GWW A;  1ZYR F;  1Z5Z A;  3WG7 C;  1A7D A;  2J7P A;  1T6U A;  4WGZ A;  1HY5 A;  2CCY A;  3HJC A;  5T3T A;  1GM5 A;  2XM4 A;  2LP4 A;  3NYM A;  5BQH A;  1VOM A;  3EGD A;  2CDQ A;  4JEB A;  4XEK A;  4EIY A;  1QVX A;  4O6N A;  1JPN A;  2XM0 A;  4NQF A;  1ORJ A;  3GEI A;  1ZU5 A;  5A6A A;  1V55 C;  4MTG A;  5A6K A;  1VTM P;  3C62 A;  1YYX A;  3LEO A;  1VLS A;  1OCR C;  2L9J A;  1Q0M A;  1WTY A;  4AX2 A; 
#chains in the Genus database with same CATH homology
 2KQ9 A;  4XWJ A;  4PJM A;  4I44 A;  4LLE A;  2XXA A;  4B6I A;  3UMI A;  3H65 A;  2V26 A;  2FFH A;  4N06 A;  1D0Y A;  3KL4 A;  3GOD A;  3ASN C;  2WB7 A;  3OWT A;  4BJ6 A;  2Y3G A;  5B1A C;  3EZI A;  3JSZ A;  4ULW A;  4U5D E;  3SYN A;  1Z3I X;  4Q5S F;  2Y39 A;  3W2V A;  4BJ5 A;  4JVS A;  3LEV A;  2J0W A;  4PFO A;  4OIN F;  3RKO F;  3ZG1 A;  3UMH A;  4RDA A;  4U5F E;  1S7Z A;  3DD7 A;  2I8B A;  2J9V A;  1M2O A;  4J30 B;  4BJ6 C;  4IRU A;  2H7B A;  3RFY A;  3M1C B;  3FDQ A;  3UMK A;  2R7Q A;  5FCL A;  3DMD A;  4U5G A;  4HFF B;  5DS6 A;  3LLI A;  2Q9C A;  2WL8 A;  3EFO A;  1D0Z A;  3HLZ A;  4IWB A;  4BJ5 C;  4OIQ F;  2HV7 A;  3DM5 A;  4U5C E;  4MND A;  3X1O A;  3Q7G A;  4K7B A;  3OEO A;  5B1B C;  3LJB A;  5KYX A;  2MWQ A;  3OA1 A;  5E3A A;  2H7O A;  2DYS C;  1IZM A;  4PJL A;  2FGY A;  3MX3 A;  4FWV A;  4YWQ A;  2IOQ A;  2A69 F;  2O9X A;  4PK4 A;  2OCC C;  1BR2 A;  1MMA A;  4ZLC A;  1ZHY A;  1O5H A;  1SF8 A;  5T3W A;  2W9Y A;  2YZS A;  4DBQ A;  2PP4 A;  3LS0 A;  1VYK A;  2J9U A;  4OIO F;  1W2W A;  3B9Q A;  3Q6M A;  3JT1 A;  5D92 A;  1BR1 A;  3RIP A;  3ABM C;  1M56 C;  2Y3D A;  4HFK B;  4BJ1 A;  4YN0 B;  1O87 A;  2C04 A;  3TD7 A;  3PMR A;  2R7U A;  4G7O F;  1OKK D;  3UGO A;  4DVZ A;  5E2Q A;  2J46 A;  2VH3 A;  3EHN A;  1VYI A;  2WVN A;  3NKE A;  4ZLD A;  3AQC A;  2G3V A;  3KKB A;  4OD5 A;  4AE4 A;  1RJ9 A;  2Q9B A;  1BR4 A;  5DQZ A;  3FVY A;  5F5F A;  2NUP A;  4C7O A;  3K33 A;  3EGX A;  4G7Z F;  5KYN A;  1J8Y F;  2R7V A;  3QZC A;  1MND A;  5KYW A;  5DS4 A;  3DJN B;  5KYU B;  2DGJ A;  2NG1 A;  1ZU4 A;  4O79 A;  4KNV A;  1J8M F;  4NY3 A;  4CS9 A;  4JUR I;  2LSE A;  4GYT A;  1M2V B;  2G3K A;  1SMY F;  5EHH A;  2P7V A;  1LKX A;  1OCZ C;  2OG2 A;  3DAG A;  4FX5 A;  3ZSU A;  4RBN A;  3LES A;  2Y3B A;  3CSK A;  2Z15 A;  3EH1 A;  3EQL F;  2YHS A;  2WVQ A;  4YT8 A;  3O6X A;  3NYL A;  2R7S A;  3EHM A;  3ITF A;  1NU9 C;  4CS9 C;  3JRT A;  1OKK A;  2IYL D;  1TR2 A;  4PJN A;  4RD9 A;  1PD1 A;  5L3Q A;  2A1D D;  4C3D A;  1Z63 A;  2D5R B;  2VAS A;  4EBB A;  3ABK C;  3ZIB A;  3W8H A;  1TKN A;  3NRH A;  3S27 A;  3LLK A;  3SNH A;  4DOZ A;  3S28 A;  2HV6 A;  2CW0 F;  3T6B A;  1MMG A;  1FMV A;  3POV A;  1KU2 A;  2V3C C;  4MQ9 F;  4P6I C;  3AQB A;  2MYS A;  3B0P A;  4J32 B;  2A68 F;  2YEV A;  2Y69 C;  2C03 A;  4E7Z A;  2WZG A;  4U5B E;  4I3M A;  1FMW A;  3EG9 B;  4LER A;  3WOD F;  4YT5 A;  4DBR A;  4FES A;  2Q9A A;  4PJJ A;  4F4B A;  3I5P A;  4OIR F;  3JYH A;  2CGE A;  1VMA A;  2A6E F;  4HE8 D;  1Z23 A;  3S29 A;  1JPJ A;  2JD3 A;  2BE5 F;  4O7G A;  4JZA A;  1ZHW A;  3LAY A;  2L81 A;  2NUT B;  2ZXO A;  2KW3 C;  2PX3 A;  5DQT A;  5KYY B;  2DYR C;  3N0T A;  3SP1 A;  3NG1 A;  3FHD A;  4A2N B;  1MMD A;  2PF4 E;  1ZHX A;  5L3V A;  2GFH A;  3RYL A;  1SZI A;  3MLG A;  4XLN F;  3DM9 B;  3DXJ F;  2ZXR A;  3ASO C;  2KNH A;  2W4M A;  4I1O B;  4YJW A;  2ZPA A;  4CS7 A;  5IY5 C;  3UGP A;  3DZA A;  1VK5 A;  2G62 A;  3EGD B;  3K1H A;  1NU7 D;  1QZX A;  3EPV A;  3V7O A;  3EJN A;  3RH3 A;  4U5E E;  1PD0 A;  3NYJ A;  3VAY A;  1D1A A;  2XXA B;  3LS1 A;  2J45 A;  4QI0 A;  2A6H F;  4YT4 A;  3F46 A;  2XSE A;  3T4R A;  4IAO A;  3JCU Q;  3PHF 2;  1D1C A;  1LVK A;  2X51 A;  4O6Y A;  3N24 A;  4DVY P;  3E70 C;  4WJ0 A;  2R7O A;  1OCR C;  3AG3 C;  2E87 A;  3VYW A;  5DLJ A;  4QI2 A;  2IXO A;  3W2W A;  3O39 A;  4JCH A;  5T1D B;  1FFT C;  1MNE A;  1OCO C;  3AG4 C;  2R7W A;  4CIH A;  3EFO B;  4JW1 A;  1NZE A;  2PX0 A;  3Q6N A;  5KYU A;  4G0H A;  3GAN A;  4LLC A;  2EIK C;  1PCX A;  1ST6 A;  4O6M A;  3NDB B;  1MMN A;  2Y3H A;  3AG2 C;  5KYX B;  4CBE A;  3S0X A;  3NKD A;  2CNW D;  3LNR A;  4Q4Z F;  1M2V A;  1TWC A;  4C3E A;  4KC9 A;  3SEO A;  1V54 C;  3I5Q A;  3SZR A;  4KNW A;  2KGO A;  4Q7C A;  3E9V A;  4G7H F;  1FFH A;  3IEE A;  4X0R A;  3K6B A;  4LAC B;  4BJT A;  4JJG A;  3QMK A;  4CSA A;  2XL4 A;  1M57 C;  4GEH A;  5CI9 A;  1FTS A;  3K66 A;  3F47 A;  4OD4 A;  2IXM A;  5BUO A;  1D1B A;  1OCC C;  1TWA A;  3HTK C;  4XLP F;  1ZHZ A;  1LS1 A;  1G8X A;  3B0U X;  3N2Z B;  2QTV A;  2WVO A;  2EIL C;  3FAJ A;  5B3S C;  4AK9 A;  1QLE C;  4CS8 A;  4CSA C;  2W4B A;  2KJG A;  2M4E A;  2R7T A;  1WGW A;  2J9W A;  2J7P D;  4AE4 B;  4OIP F;  5DS5 A;  5E3C A;  1RJ9 B;  2XRH A;  2WZF A;  5EGY A;  2IXN A;  4EWC A;  2NUP B;  4C7O B;  1TWH A;  2EIJ C;  3W8I A;  1Z6A A;  1ZHT A;  3EG9 A;  3EGX B;  3DAF A;  5E33 A;  1IW7 F;  3Q7L A;  3K7D A;  2R7X A;  5F5H A;  4JJF A;  4M63 A;  3KMI A;  5D91 A;  4CS8 C;  5KYW B;  4KI2 A;  3X2Q C;  2P6V A;  2QY9 A;  2CNW A;  4BEJ A;  5CI8 A;  4KBL A;  4QDL A;  2ZXP A;  4ANJ A;  1NG1 A;  3T6J A;  2R7R A;  2B0J A;  4YT2 A;  3ZC4 A;  2NUT A;  3ZVR A;  2Q3T A;  3K1I C;  2IXP A;  1TWG A;  2W45 A;  4C3B A;  4E7S A;  5KYY A;  2ZXW C;  2PFD A;  4BG0 A;  4U5H A;  3L34 A;  4K0D A;  5DVW A;  2WZL A;  3CZ6 A;  4W8K A;  4IJJ A;  3UR3 C;  3B0V C;  2H7V C;  3ECS A;  4XTK A;  2J0X A;  3KH2 A;  4HEA J;  3ABL C;  3CQZ A;  4I1M A;  4H4K C;  3DJU B;  1D0X A;  5HSW A;  2EIN C;  3UNG C;  2VB6 A;  3AG1 C;  3EZH A;  3L0I A;  4PFP A;  3I4U A;  2EIM C;  3EH2 A;  1ZYR F;  1Z5Z A;  3WG7 C;  2J7P A;  3HJC A;  5T3T A;  3NYM A;  1VOM A;  3EGD A;  2CDQ A;  4O6N A;  1JPN A;  1ZU5 A;  1V55 C;  1N1C A;  2L9J A;  4AX2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...