1W2WA

Crystal structure of yeast ypr118w, a methylthioribose-1-phosphate isomerase related to regulatory eif2b subunits
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
211
structure length
211
Chain Sequence
MSLEAIVFDRSEPENVSVKVLDQLLLPYTTKYVPIHTIDDGYSVIKSMQVRGAPAIAIVGSLSVLTEVQLIKHNPTSDVATLYSLVNWESTKTVLNKRLDFLLSSRPTAVNLSNSLVEIKNILKSSSDLKAFDGSLYNYVCELIDEDLANNMKMGDNGAKYLIDVLQKDGFKDEFAVLTICNTGSLATSGYGTALGVIRSLWKDSLAKTDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Yeast Ypr118W, a Methylthioribose-1-Phosphate Isomerase Related to Regulatory Eif2B Subunits
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Isomerase
molecule keywords 5-METHYLTHIORIBOSE-1-PHOSPHATE ISOMERASE
total genus 76
structure length 211
sequence length 211
chains with identical sequence E, I, M
ec nomenclature ec 5.3.1.23: S-methyl-5-thioribose-1-phosphate isomerase.
pdb deposition date 2004-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1840 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1w2wA00
1W2WA
chains in the Genus database with same CATH superfamily
1FTSA 4AE4A 3HKKA 1S7ZA 1RKCA 2IM8A 3RF3A 2GA0A 5JRAA 3GEIA 1D0XA 4ULVA 1ZU4A 2KW3C 3VAYA 4CBEA 1ZZPA 3L8JA 5KYWB 3FOPA 3AG4C 5IY5C 4AL1A 1OW8A 1RKEB 4YT8A 5A6AA 3U9MA 3WG7C 3HTKC 4A4AA 256BA 1UG7A 3DWWA 3L1MA 3GORA 4H4KC 4MVOA 5L0HA 1LI7A 1LS1A 1E2XA 3I4UA 4JC7A 3A11A 2DGJA 2OJED 4PJNA 1WGWA 2NUPB 2GWWA 1A7DA 1FFTC 3U2LA 2AWYA 2PX0A 1E85A 1H6GA 3CAXA 4MS2A 2XLWA 4EKWA 2FFHA 4ZLCA 1T01A 4U5GA 5FZTA 4J7YA 3EPVA 2L6HA 3Q7GA 2A69F 2P7VA 2VB6A 1D0YA 4P6IC 3GEEA 3GWNA 4OINF 4W8KA 4IAQA 2WZLA 4U5FE 3I5PA 4JRZA 2KYHA 4N6HA 3BRJA 2P61A 2XLEA 4NC3A 3TJ6A 3UGPA 3B71A 4X0RA 1OR2A 1TWAA 5A6BD 2OOCA 2V3CC 4CJGA 2YKZA 2CDQA 2L9JA 3C62A 1AVOB 3E9VA 3FOOA 2L7AA 4LDKA 1TR2A 3U5SA 5GPGB 3U3BA 4PJJA 2PNOA 4J32B 3GODA 5BQHA 1ORYA 3N2ZB 1MMAA 3QMKA 2EPNA 2OG2A 2TMVP 2H7VC 3JSEO 1T5OA 1A7EA 2ZPAA 4IJJA 4U9EA 5B3IA 3GEHA 3C7JA 1IZMA 2ASRA 1EQ1A 2HZ8A 4F4BA 3QVYA 5DQTA 1FNTc 4CS9C 2EILC 2Q9CA 3ZDLA 3U9JA 3FHDA 3K1IA 3T4RA 2YEVA 1OXKA 4WJ0A 2J45A 3LS0A 4BPMA 3SEOA 3T6BA 4EBKA 5KYXB 1M2VA 4M63A 1HY5A 1T6UA 3NKEA 2HUJA 3O10A 4U5BE 2EPKX 3G4ZA 1BBHA 1XZPA 2Y39A 1V55C 4JW1A 3MYIA 1O5HA 2A1DD 2HJ3A 2LK4A 1JPJA 2MWQA 2B0JA 3HLZA 4HEAJ 1D1BA 3UR3C 3IQCA 1JPNA 5COGA 2R7OA 1Q0DA 3AGTA 2NPUA 2KSFA 5T1DB 4Q4ZF 2A6EF 5E3AA 5COMA 3UNGC 4CDAA 1D1AA 3QW1A 4RDAA 2Y3GA 3US6A 3ZIBA 4DJ9A 3EQLF 5JVEA 1SMYF 3C8GD 1VOMA 2HS5A 2Y3HA 4PR9A 2OJQA 3SXMA 3EH2A 3TOMA 1WN0A 2LSEA 3RQFA 1BR2A 3ZSUA 1HMDA 3ZTZA 1C02A 2LD6A 2XLOA 4PJMA 4NY3A 5L0IA 2MYSA 2XL4A 4JCZA 1M57C 3ZTMA 1VTMP 2HSQA 1EI7A 3DM9B 4CDVA 3MFNA 3HNKA 4G7ZF 2R25A 1YA9A 4XPXA 3EHMA 4AE4B 1LE2A 4EWCA 5L0DA 4JJGA 3W8IA 4O79A 1KU2A 3PMRA 5L0JA 3WAQA 3POVA 3C63A 5E33A 1HW2A 1D1CA 1WOLA 1JAFA 4BG0A 2R7WA 2R02A 3FAPB 2IXMA 1CGME 4W8PA 1M56C 3ZQVA 5L0GA 2QY9A 2YWAA 3RYLA 3SYNA 3E70C 1U89A 2IOQA 4C3DA 2B0HA 3I5QA 2P1AA 5EK0A 3M1CB 4DRHB 1GM5A 4NTBA 2XLMA 2DYSC 3RH3A 4KNWA 4E18A 4GQHA 1IW7F 2HSBA 3QTHA 4N4WA 1RJ9B 2AU5A 1K05A 2AP3A 3EH1A 2PF4E 4Q7CA 4PFOA 3T6JA 3U2MA 1OCCC 1YVIA 1M6TA 3EGXB 4G7HF 3ABLC 1TQGA 3EG9B 2WVOA 4MTOA 2LFDA 4JURI 2GFHA 5BQIA 1AUEA 1DOVA 1YZAA 3LLKA 1ZHYA 1RJ9A 3ZC4A 4AX2A 3LLIA 1YA7O 1VK5A 1FFHA 3LAYA 2YVKA 3SP1A 2A0UA 2A0BA 2RSEB 3AOUA 3DKAA 4MVQA 4WGZA 2ZXPA 2ETSA 1QPUA 5F5HA 2XS1A 3R7CA 3U3FA 4XLNF 3HNIA 4L6RA 2XS8A 1YJGA 1ZHZA 4C7OA 1K40A 2XM4A 1OKKA 2LCHA 4CIPA 1U6HA 3EGDA 2EINC 2IXOA 1TFKB 2D5RB 3K6BA 1PD0A 3B29A 3NMIA 1E84A 1C03A 3S29A 1U0BB 1B68A 1OXBA 4IGGA 3LS1A 4I3MA 3TQOA 2WZFA 2CNWD 5B3SC 1NFOA 2DB4A 3NYJA 4MNDA 3PCVA 1YLMA 4LDQA 1LKXA 4OIQF 4Z9HA 3AQCA 3HJCA 2H7OA 2XLVA 4U5HA 3NRHA 1D0ZA 1QZXA 4CX9A 2VH3A 3K66A 2XLHA 4I44A 3O6XA 3EHNA 1TFOB 1WATA 4LDRA 3V5XA 4MVRA 2VASA 3C8ZA 2ZD9A 2YLDA 3LUTB 3WHNA 1GS9A 2KC3A 5BQGA 4OIPF 2NUPA 3UGOA 4LLEA 1LE4A 5L0CA 1SR2A 3EZHA 2HMZA 1VYIA 3PDMP 2NUTA 3A9CA 1N1CA 3KH2A 4XQ1A 3C18A 3S27A 3O55A 4EHPA 5A6KA 3LEVA 1ZVZA 1CPQA 1VLSA 2YHSA 4H54A 4PACA 1A0BA 1FR0A 1OKKD 4CIHA 1NSGB 4NCQA 5JS5A 3K1HA 1LPEA 1ZHTA 4JTDB 3LJBA 5KYUA 4P9TA 1PD1A 1TWHA 3DAGA 4C3EA 3Q6MA 3ATPA 4FX5A 1G4WR 1JRAA 3CEXA 4HFKB 4XEFA 3UMIA 4EBBA 2XLDA 4BJ5C 4MVZA 4FAPB 3H2VA 2YL1A 2YL7A 4MTGA 2HV7A 5D91A 1HMOA 2IBFA 4YJWA 2VCCA 3DD7A 4XWJA 3KYJA 1LIHA 5KYUB 1Y6DA 1JR8A 4N06A 2H8AA 3JT1A 2HJMA 1QVXA 2L81A 5HSWA 2R05A 3L0IA 3M4CA 2XXAB 3AJMA 3U8VA 1BZ4A 1L3PA 5E3CA 5CIVA 4J30B 3GWLA 3MLGA 4PK4A 3Q6NA 4Q5SF 4C7OB 1YARO 4PFPA 1V74B 4KC9A 1M2OA 4JVSA 2O9XA 2XL8A 3F46A 3JTLO 3JYHA 2KGOA 4YN0B 3AG3C 4YL1A 1A7VA 2UUIA 3RIPA 2WB7A 3O39A 4HFFB 3DZAA 1A41A 2AVKA 4EBJA 2UUHA 4MQ9F 4JTCB 5B1BC 3NMKA 4NTFA 1ZHXA 4O6NA 4QI2A 1XWJA 1ZU5A 2KQ9A 1LS4A 5F5FA 5A6JA 3H2UA 3V7OA 2Y3DA 4YT5A 3TULA 2WVQA 2LFFA 1ORSC 4DOZA 3DE8A 3CSKA 1Q0FA 1V54C 3C8GA 4WABA 2WVNA 4C3BA 4EIYA 2NSFA 2OEXA 2G3VA 1Z6AA 2W4MA 4A2NB 4Z9IA 1AEPA 1I5NA 3FXHA 3RQEA 2PFDA 4MW3A 1Z3IX 3DM5A 5AGFA 2AWCA 1NLXA 1OQCA 3IQ6A 3B9QA 1XZQA 1J8YF 5DVWA 4D4XA 3JZ0A 4OD5A 5JP7A 1V4AA 1WASA 2L6FA 2X0CA 5KYXA 2J7PD 5K0IA 3PHF2 3S84A 2W9YA 2Z15A 2QUPA 3EG9A 1T6IA 3GM2A 4FESA 3W2WA 1MNDA 2G3KA 3QVZA 2XL6A 2I15A 3ASOC 2CW0F 4KBLA 5L0FA 3SZRA 3IPMO 2P0NA 2QLAA 4U5DE 1R4TA 4JEAA 3TOLA 1OW6A 2C04A 4J7TA 4DRJB 2ZXWC 4R32A 2ZXRA 4YL3A 3MYFA 1JMWA 4IB4A 2J7PA 5E2QA 3U0CA 1TWCA 3UMHA 1CGOA 2G62A 4OIOF 2EPMX 5L3QA 4JE9A 1L7CA 1Q0MA 1RKEA 3MBGA 4JTAB 4AK9A 3S9OA 4BJ6A 3Q7LA 3NDBB 4N6CA 4PJLA 4HE8D 2WL8A 1E83A 1R5ID 4E0IA 2HMQA 3AGUA 3RW0A 2YRFA 3V5YA 1KTMA 1ZYRF 2J46A 5BUOA 1OCZC 5JUAA 3HNLA 4OD4A 4ZLDA 2RD9A 2Q9AA 4Z9JA 4LERA 2J9UA 5KYNA 3KMIA 3DI5A 5B1AC 2A6HF 1JOGA 1Y4CA 4D4NA 4CS7A 3KL4A 2OCCC 3NYLA 3TK0A 1CGNA 2J0XA 2KNHA 3OA1A 4K7BA 4MVUA 2QTVA 2Q00A 3FAJA 5CI8A 2FAPB 3SNHA 3OEOA 2EPOA 3DXJF 1KNYA 4IWBA 1OCRC 2C03A 4JJFA 4MW8A 2OKUA 3T9OA 3K33A 1G4US 4O7GA 1BR4A 5DS6A 3S90A 2Q4FA 4CDYA 3VF0A 4CSAA 1FMVA 3DE9A 2Q3TA 3ZWIA 1S05A 2IXNA 2JPUA 3EJNA 3RFYA 3W4YA 4DRIB 3EFOB 1O87A 2I8BA 3EZIA 2E87A 3NYMA 4RD9A 4BJ1A 2HFIA 1Z7Qc 2OQMA 4RBNA 2R7SA 1RCPA 1T9KA 4DVZA 4YL0A 4XPYA 2HV6A 1NG1A 2X51A 3L8IA 2GAQA 2J9VA 3MX3A 1FAPB 2YLIA 2BL2A 2FGYA 3OWTA 3JRTA 2VC9A 3EFOA 3FDQA 1HE9A 4CS8C 1HE1A 2R7TA 1F1MA 2JD3A 1MMNA 2CCYA 5EGYA 3UMKA 2YL0A 4YWQA 2Y69C 4XEVA 1PCXA 3RKOF 1WTYA 3ABKC 1BDJB 1YZCA 1NFNA 3ECSA 4QI0A 4U5EE 3U8PA 3DMDA 4ULWA 1ZW3A 1GGQA 2R7RA 1SYQA 2CGEA 1C17M 3CZ6A 3JSZA 1NBBA 2MHRA 2Y3BA 3AQBA 4ER9A 1CPRA 3LNMB 1I4ZA 2PBEA 1Q0GA 4I1OB 3KPHA 1OW7A 1RMVA 4XTKA 2D4UA 4CS9A 4ONSA 3B0UX 1OCOC 2R7XA 4IARA 3IQTA 5AC5A 1HW1A 2ICWG 1Z5ZA 3ZG1A 1EKYA 3T6GB 4FWVA 1YDIA 4E0HA 3LEOA 3B0VC 2R7QA 5JT4A 4YT4A 4BJ6C 5D92A 1Z23A 4BJ5A 2DYRC 3EGDB 3G4XA 1J8MF 3V5ZA 2IXPA 1UFBA 1VYKA 3JCUQ 4YK5A 3KKBA 2EPLX 3M15A 3NKDA 4JIOA 3DJNB 2VCBA 1MMGA 3L34A 3VM6A 3R2PA 3ZVRA 4U5CE 5JSLA 5TJ5E 3DJUB 1ZHWA 3EGXA 4OIRF 1LVKA 3CQZA 3JRMO 3IHUA 5KYYA 2M4EA 2PX3A 3SXZA 5L3VA 2Q9BA 3M79A 2BE5F 2LQGA 2H7BA 4DBRA 5T3TA 1MNEA 1BR1A 1O3UA 2A68F 1MMDA 3IQ5A 1PV3A 4LACB 4MTFA 3VYWA 2GDCA 4BEMJ 4DVYP 3TD7A 4BEJA 3ZQYA 5FCLA 4YT2A 2YQYA 4G7OF 1QLEC 3VRCA 3ASNC 2J8WA 2M64A 5DQZA 3G50A 4CSAC 4GEHA 4B6IA 1QSPA 2XRHA 1YYJA 3B0PA 3GM3A 2V26A 5T3WA 2NUTB 3BEHA 2YLGA 2W4BA 2XXAA 2OU6A 4XEKA 5JLIA 1M2VB 2J9WA 1SZIA 3X2QC 2KK1A 1APCA 2NG1A 2PP4A 2LIGA 3RVZA 5HV9A 2CNWA 4MVMA 2L6GA 5A6BA 4I1MA 4ANJA 1Q0KA 2J9BA 2KJGA 1OR3A 3QZCA 1FMWA 4JKVA 1NU9C 4K1OA 4AL0A 3GM1A 1ORJA 3ABMC 2Q7RA 2J0WA 4NQFA 5F28E 4CS8A 4E7ZA 2CYDA 4MVSA 3S0XA 1VB5A 1W2WA 2BC5A 2EIJC 2P6VA 3DAFA 1SF8A 3RVYA 3WODF 2WZGA 2YZSA 4NTAA 5DLJA 2NSGA 2IYLD 1ZW2A 1ST6A 2LP4A 5EHHA 4UDVA 1K04A 2QE9A 4P9FA 4WGYA 1H9GA 2DI3A 4JZAA 3TJ5A 4KI2A 1NU7D 1YYXA 1LM3B 1QKRA 4KNVA 1G5ZA 3FMSA 3W2VA 3X1OA 1GQAA 3AG1C 4CJOA 4JCHA 3HNJA 1H7IA 4LLCA 3JYYA 3C8GB 3N24A 3M4BA 3F47A 3RQGA 1VLTA 3K7DA 4BJTA 1WWPA 2R9RB 4EUKB 3SXKA 4E7SA 1E86A 3ITFA 3LNRA 4G0HA 5DS4A 3K1IC 4U9DA 3H65A 5AC4A 4GYTA 1DOWA 3W8HA 4E17A 2ZXOA 2XM0A 2VCAA 5COFA 5A69A 5DS5A 2EIMC 4O6MA 2EIKC 3IEEA 5CI9A 1I4YA 4O6YA 1YAUO 3GANA 4IRUA 3S28A 2JX0A 2F22A 1G8XA 2XSEA 3N0TA 3LESA 3KYIA 4QDLA 4DBQA 5KYYB 3J06A 1TWGA 2R7VA 4DXWA 1MQVA 1T6QA 3AG2C 1QQ3A 2YL3A 4XLPF 1RXQA 1Z63A 1NZEA 5KYWA 2W45A 2QNLA 3NG1A 1TKNA 2R7UA 1EA8A 1LI5A 3NMJA 2OEVA 4G78A 3FVYA 4JEBA 2R03A 2HKVA 4IAOA 1VMAA 4K0DA 4XPWA 3QW0A 3SXYA 1H9TA
chains in the Genus database with same CATH topology
1FTSA 4AE4A 1S7ZA 3VAYA 1D0XA 1ZU4A 2KW3C 4CBEA 5KYWB 3AG4C 5IY5C 4YT8A 3WG7C 3HTKC 4H4KC 1LS1A 3I4UA 2DGJA 4PJNA 1WGWA 2NUPB 1FFTC 2PX0A 2FFHA 4ZLCA 4U5GA 3EPVA 3Q7GA 2A69F 2P7VA 2VB6A 1D0YA 4P6IC 4OINF 4W8KA 2WZLA 4U5FE 3I5PA 3UGPA 4X0RA 1TWAA 2V3CC 2CDQA 2L9JA 3E9VA 1TR2A 4PJJA 4J32B 3GODA 3N2ZB 1MMAA 3QMKA 2OG2A 2H7VC 2ZPAA 4IJJA 1IZMA 4F4BA 5DQTA 4CS9C 2EILC 2Q9CA 3FHDA 3T4RA 2YEVA 4WJ0A 2J45A 3LS0A 3SEOA 3T6BA 5KYXB 1M2VA 4M63A 3NKEA 4U5BE 4JW1A 2Y39A 1V55C 1O5HA 2A1DD 1JPJA 2MWQA 2B0JA 3HLZA 4HEAJ 1D1BA 3UR3C 1JPNA 2R7OA 5T1DB 4Q4ZF 2A6EF 5E3AA 3UNGC 1D1AA 4RDAA 2Y3GA 3ZIBA 3EQLF 1SMYF 1VOMA 2Y3HA 3EH2A 2LSEA 1BR2A 3ZSUA 4PJMA 4NY3A 2MYSA 2XL4A 1M57C 3DM9B 4G7ZF 3EHMA 4AE4B 4EWCA 4JJGA 3W8IA 4O79A 1KU2A 3PMRA 3POVA 5E33A 1D1CA 4BG0A 2R7WA 2IXMA 1M56C 2QY9A 3RYLA 3SYNA 4C3DA 3E70C 2IOQA 3I5QA 3M1CB 2DYSC 3RH3A 4KNWA 1IW7F 1RJ9B 3EH1A 2PF4E 4Q7CA 4PFOA 3T6JA 1OCCC 4G7HF 3EGXB 3ABLC 3EG9B 2WVOA 4JURI 2GFHA 3LLKA 1ZHYA 1RJ9A 3ZC4A 4AX2A 3LLIA 1VK5A 1FFHA 3LAYA 3SP1A 5F5HA 4G7OF 2ZXPA 4XLNF 4C7OA 1ZHZA 1OKKA 3EGDA 2EINC 2IXOA 2D5RB 3K6BA 1PD0A 3S29A 3LS1A 4I3MA 2WZFA 2CNWD 5B3SC 4MNDA 3NYJA 1LKXA 4OIQF 3AQCA 3HJCA 2H7OA 4U5HA 3NRHA 1D0ZA 1QZXA 2VH3A 3K66A 4I44A 3O6XA 3EHNA 2VASA 4OIPF 2NUPA 3UGOA 4LLEA 3EZHA 1VYIA 2NUTA 1N1CA 3KH2A 3S27A 3LEVA 2YHSA 1OKKD 4CIHA 3K1HA 1ZHTA 3LJBA 5KYUA 1PD1A 1TWHA 3DAGA 4C3EA 3Q6MA 4FX5A 4EBBA 4HFKB 3UMIA 4BJ5C 5D91A 2HV7A 4YJWA 3DD7A 4XWJA 5KYUB 4N06A 3JT1A 2L81A 5HSWA 3L0IA 2XXAB 5E3CA 4J30B 3MLGA 4PK4A 3Q6NA 4Q5SF 4C7OB 4PFPA 1M2OA 4JVSA 2O9XA 3F46A 3JYHA 2KGOA 4YN0B 3AG3C 3RIPA 2WB7A 3O39A 4HFFB 3DZAA 4MQ9F 5B1BC 1ZHXA 4O6NA 4QI2A 1ZU5A 2KQ9A 5F5FA 3V7OA 2Y3DA 4YT5A 2WVQA 4DOZA 3CSKA 1V54C 2WVNA 4C3BA 2W4MA 2G3VA 1Z6AA 4A2NB 2PFDA 1Z3IX 3DM5A 3B9QA 1J8YF 5DVWA 4OD5A 5KYXA 3PHF2 2J7PD 2W9YA 2Z15A 3EG9A 4FESA 3W2WA 1MNDA 2G3KA 3ASOC 2CW0F 4KBLA 3SZRA 4U5DE 2C04A 2ZXWC 2ZXRA 2J7PA 5E2QA 1TWCA 3UMHA 2G62A 4OIOF 5L3QA 3NDBB 4AK9A 4BJ6A 3Q7LA 4PJLA 4HE8D 2WL8A 1ZYRF 2J46A 5BUOA 1OCZC 4OD4A 4ZLDA 2Q9AA 4LERA 2J9UA 5KYNA 3KMIA 5B1AC 2A6HF 4CS7A 3KL4A 2OCCC 3NYLA 2J0XA 2KNHA 3OA1A 4K7BA 5CI8A 2QTVA 3FAJA 3SNHA 3OEOA 3DXJF 4IWBA 1OCRC 2C03A 4JJFA 3K33A 4O7GA 5DS6A 1BR4A 4CSAA 1FMVA 2Q3TA 2IXNA 3EJNA 3RFYA 3EFOB 1O87A 2I8BA 3EZIA 2E87A 3NYMA 4RD9A 4BJ1A 4RBNA 2R7SA 4DVZA 2HV6A 1NG1A 2X51A 2J9VA 3MX3A 2FGYA 3OWTA 3JRTA 3EFOA 3FDQA 4CS8C 2R7TA 2JD3A 1MMNA 5EGYA 3UMKA 4YWQA 2Y69C 1PCXA 3RKOF 3ABKC 4U5EE 3ECSA 4QI0A 3DMDA 4ULWA 2R7RA 2CGEA 3CZ6A 3JSZA 2Y3BA 3AQBA 4I1OB 4XTKA 4CS9A 3B0UX 1OCOC 2R7XA 1Z5ZA 3ZG1A 4FWVA 3B0VC 2R7QA 4YT4A 4BJ6C 5D92A 1Z23A 4BJ5A 2DYRC 3EGDB 1J8MF 2IXPA 1VYKA 3JCUQ 3KKBA 3NKDA 3DJNB 1MMGA 3L34A 3ZVRA 4U5CE 4OIRF 3DJUB 1ZHWA 3EGXA 1LVKA 3CQZA 5KYYA 2M4EA 2PX3A 5L3VA 2Q9BA 2BE5F 2H7BA 4DBRA 5T3TA 1MNEA 1BR1A 2A68F 1MMDA 4LACB 3VYWA 4DVYP 3TD7A 4BEJA 5FCLA 4YT2A 1QLEC 3ASNC 5DQZA 4CSAC 4GEHA 4B6IA 2XRHA 3B0PA 2V26A 5T3WA 2NUTB 2W4BA 2XXAA 1M2VB 2J9WA 1SZIA 3X2QC 2NG1A 2PP4A 2CNWA 4I1MA 4ANJA 2KJGA 3QZCA 1FMWA 1NU9C 3ABMC 4CS8A 2J0WA 4E7ZA 3S0XA 1W2WA 2EIJC 3DAFA 2P6VA 3WODF 1SF8A 5DLJA 2WZGA 2YZSA 2IYLD 1ST6A 5EHHA 4JZAA 4KI2A 1NU7D 4KNVA 3W2VA 3X1OA 3AG1C 4JCHA 4LLCA 3N24A 3F47A 3K7DA 4BJTA 4E7SA 3ITFA 3LNRA 4G0HA 5DS4A 3K1IC 3H65A 4GYTA 3W8HA 2ZXOA 5DS5A 2EIMC 4O6MA 2EIKC 3IEEA 5CI9A 4O6YA 3GANA 4IRUA 3S28A 3N0TA 2XSEA 1G8XA 4QDLA 4DBQA 3LESA 5KYYB 2R7VA 1TWGA 3AG2C 4XLPF 1Z63A 1NZEA 5KYWA 2W45A 2R7UA 3NG1A 1TKNA 4K0DA 3FVYA 4IAOA 4KC9A 1VMAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W2W A; 
#chains in the Genus database with same CATH topology
 1FTS A;  4AE4 A;  3HKK A;  1S7Z A;  1RKC A;  2IM8 A;  3RF3 A;  2GA0 A;  5JRA A;  3GEI A;  1D0X A;  4ULV A;  1ZU4 A;  2KW3 C;  3VAY A;  4CBE A;  1ZZP A;  3L8J A;  5KYW B;  3FOP A;  3AG4 C;  5IY5 C;  4AL1 A;  1OW8 A;  1RKE B;  4YT8 A;  5A6A A;  3U9M A;  3WG7 C;  3HTK C;  4A4A A;  256B A;  1UG7 A;  3DWW A;  3L1M A;  3GOR A;  4H4K C;  4MVO A;  5L0H A;  1LI7 A;  1LS1 A;  1E2X A;  3I4U A;  4JC7 A;  3A11 A;  2DGJ A;  2OJE D;  4PJN A;  1WGW A;  2NUP B;  2GWW A;  1A7D A;  1FFT C;  3U2L A;  2AWY A;  2PX0 A;  1E85 A;  1H6G A;  3CAX A;  4MS2 A;  2XLW A;  4EKW A;  2FFH A;  4ZLC A;  1T01 A;  4U5G A;  5FZT A;  4J7Y A;  3EPV A;  2L6H A;  3Q7G A;  2A69 F;  2P7V A;  2VB6 A;  1D0Y A;  4P6I C;  3GEE A;  3GWN A;  4OIN F;  4W8K A;  4IAQ A;  2WZL A;  4U5F E;  3I5P A;  4JRZ A;  2KYH A;  4N6H A;  3BRJ A;  2P61 A;  2XLE A;  4NC3 A;  3TJ6 A;  3UGP A;  3B71 A;  4X0R A;  1OR2 A;  1TWA A;  5A6B D;  2OOC A;  2V3C C;  4CJG A;  2YKZ A;  2CDQ A;  2L9J A;  3C62 A;  1AVO B;  3E9V A;  3FOO A;  2L7A A;  4LDK A;  1TR2 A;  3U5S A;  5GPG B;  3U3B A;  4PJJ A;  2PNO A;  4J32 B;  3GOD A;  5BQH A;  1ORY A;  3N2Z B;  1MMA A;  3QMK A;  2EPN A;  2OG2 A;  2TMV P;  2H7V C;  3JSE O;  1T5O A;  1A7E A;  2ZPA A;  4IJJ A;  4U9E A;  5B3I A;  3GEH A;  3C7J A;  1IZM A;  2ASR A;  1EQ1 A;  2HZ8 A;  4F4B A;  3QVY A;  5DQT A;  1FNT c;  4CS9 C;  2EIL C;  2Q9C A;  3ZDL A;  3U9J A;  3FHD A;  3K1I A;  3T4R A;  2YEV A;  1OXK A;  4WJ0 A;  2J45 A;  3LS0 A;  4BPM A;  3SEO A;  3T6B A;  4EBK A;  5KYX B;  1M2V A;  4M63 A;  1HY5 A;  1T6U A;  3NKE A;  2HUJ A;  3O10 A;  4U5B E;  2EPK X;  3G4Z A;  1BBH A;  1XZP A;  2Y39 A;  1V55 C;  4JW1 A;  3MYI A;  1O5H A;  2A1D D;  2HJ3 A;  2LK4 A;  1JPJ A;  2MWQ A;  2B0J A;  3HLZ A;  4HEA J;  1D1B A;  3UR3 C;  3IQC A;  1JPN A;  5COG A;  2R7O A;  1Q0D A;  3AGT A;  2NPU A;  2KSF A;  5T1D B;  4Q4Z F;  2A6E F;  5E3A A;  5COM A;  3UNG C;  4CDA A;  1D1A A;  3QW1 A;  4RDA A;  2Y3G A;  3US6 A;  3ZIB A;  4DJ9 A;  3EQL F;  5JVE A;  1SMY F;  3C8G D;  1VOM A;  2HS5 A;  2Y3H A;  4PR9 A;  2OJQ A;  3SXM A;  3EH2 A;  3TOM A;  1WN0 A;  2LSE A;  3RQF A;  1BR2 A;  3ZSU A;  1HMD A;  3ZTZ A;  1C02 A;  2LD6 A;  2XLO A;  4PJM A;  4NY3 A;  5L0I A;  2MYS A;  2XL4 A;  4JCZ A;  1M57 C;  3ZTM A;  1VTM P;  2HSQ A;  1EI7 A;  3DM9 B;  4CDV A;  3MFN A;  3HNK A;  4G7Z F;  2R25 A;  1YA9 A;  4XPX A;  3EHM A;  4AE4 B;  1LE2 A;  4EWC A;  5L0D A;  4JJG A;  3W8I A;  4O79 A;  1KU2 A;  3PMR A;  5L0J A;  3WAQ A;  3POV A;  3C63 A;  5E33 A;  1HW2 A;  1D1C A;  1WOL A;  1JAF A;  4BG0 A;  2R7W A;  2R02 A;  3FAP B;  2IXM A;  1CGM E;  4W8P A;  1M56 C;  3ZQV A;  5L0G A;  2QY9 A;  2YWA A;  3RYL A;  3SYN A;  3E70 C;  1U89 A;  2IOQ A;  4C3D A;  2B0H A;  3I5Q A;  2P1A A;  5EK0 A;  3M1C B;  4DRH B;  1GM5 A;  4NTB A;  2XLM A;  2DYS C;  3RH3 A;  4KNW A;  4E18 A;  4GQH A;  1IW7 F;  2HSB A;  3QTH A;  4N4W A;  1RJ9 B;  2AU5 A;  1K05 A;  2AP3 A;  3EH1 A;  2PF4 E;  4Q7C A;  4PFO A;  3T6J A;  3U2M A;  1OCC C;  1YVI A;  1M6T A;  3EGX B;  4G7H F;  3ABL C;  1TQG A;  3EG9 B;  2WVO A;  4MTO A;  2LFD A;  4JUR I;  2GFH A;  5BQI A;  1AUE A;  1DOV A;  1YZA A;  3LLK A;  1ZHY A;  1RJ9 A;  3ZC4 A;  4AX2 A;  3LLI A;  1YA7 O;  1VK5 A;  1FFH A;  3LAY A;  2YVK A;  3SP1 A;  2A0U A;  2A0B A;  2RSE B;  3AOU A;  3DKA A;  4MVQ A;  4WGZ A;  2ZXP A;  2ETS A;  1QPU A;  5F5H A;  2XS1 A;  3R7C A;  3U3F A;  4XLN F;  3HNI A;  4L6R A;  2XS8 A;  1YJG A;  1ZHZ A;  4C7O A;  1K40 A;  2XM4 A;  1OKK A;  2LCH A;  4CIP A;  1U6H A;  3EGD A;  2EIN C;  2IXO A;  1TFK B;  2D5R B;  3K6B A;  1PD0 A;  3B29 A;  3NMI A;  1E84 A;  1C03 A;  3S29 A;  1U0B B;  1B68 A;  1OXB A;  4IGG A;  3LS1 A;  4I3M A;  3TQO A;  2WZF A;  2CNW D;  5B3S C;  1NFO A;  2DB4 A;  3NYJ A;  4MND A;  3PCV A;  1YLM A;  4LDQ A;  1LKX A;  4OIQ F;  4Z9H A;  3AQC A;  3HJC A;  2H7O A;  2XLV A;  4U5H A;  3NRH A;  1D0Z A;  1QZX A;  4CX9 A;  2VH3 A;  3K66 A;  2XLH A;  4I44 A;  3O6X A;  3EHN A;  1TFO B;  1WAT A;  4LDR A;  3V5X A;  4MVR A;  2VAS A;  3C8Z A;  2ZD9 A;  2YLD A;  3LUT B;  3WHN A;  1GS9 A;  2KC3 A;  5BQG A;  4OIP F;  2NUP A;  3UGO A;  4LLE A;  1LE4 A;  5L0C A;  1SR2 A;  3EZH A;  2HMZ A;  1VYI A;  3PDM P;  2NUT A;  3A9C A;  1N1C A;  3KH2 A;  4XQ1 A;  3C18 A;  3S27 A;  3O55 A;  4EHP A;  5A6K A;  3LEV A;  1ZVZ A;  1CPQ A;  1VLS A;  2YHS A;  4H54 A;  4PAC A;  1A0B A;  1FR0 A;  1OKK D;  4CIH A;  1NSG B;  4NCQ A;  5JS5 A;  3K1H A;  1LPE A;  1ZHT A;  4JTD B;  3LJB A;  5KYU A;  4P9T A;  1PD1 A;  1TWH A;  3DAG A;  4C3E A;  3Q6M A;  3ATP A;  4FX5 A;  1G4W R;  1JRA A;  3CEX A;  4HFK B;  4XEF A;  3UMI A;  4EBB A;  2XLD A;  4BJ5 C;  4MVZ A;  4FAP B;  3H2V A;  2YL1 A;  2YL7 A;  4MTG A;  2HV7 A;  5D91 A;  1HMO A;  2IBF A;  4YJW A;  2VCC A;  3DD7 A;  4XWJ A;  3KYJ A;  1LIH A;  5KYU B;  1Y6D A;  1JR8 A;  4N06 A;  2H8A A;  3JT1 A;  2HJM A;  1QVX A;  2L81 A;  5HSW A;  2R05 A;  3L0I A;  3M4C A;  2XXA B;  3AJM A;  3U8V A;  1BZ4 A;  1L3P A;  5E3C A;  5CIV A;  4J30 B;  3GWL A;  3MLG A;  4PK4 A;  3Q6N A;  4Q5S F;  4C7O B;  1YAR O;  4PFP A;  1V74 B;  4KC9 A;  1M2O A;  4JVS A;  2O9X A;  2XL8 A;  3F46 A;  3JTL O;  3JYH A;  2KGO A;  4YN0 B;  3AG3 C;  4YL1 A;  1A7V A;  2UUI A;  3RIP A;  2WB7 A;  3O39 A;  4HFF B;  3DZA A;  1A41 A;  2AVK A;  4EBJ A;  2UUH A;  4MQ9 F;  4JTC B;  5B1B C;  3NMK A;  4NTF A;  1ZHX A;  4O6N A;  4QI2 A;  1XWJ A;  1ZU5 A;  2KQ9 A;  1LS4 A;  5F5F A;  5A6J A;  3H2U A;  3V7O A;  2Y3D A;  4YT5 A;  3TUL A;  2WVQ A;  2LFF A;  1ORS C;  4DOZ A;  3DE8 A;  3CSK A;  1Q0F A;  1V54 C;  3C8G A;  4WAB A;  2WVN A;  4C3B A;  4EIY A;  2NSF A;  2OEX A;  2G3V A;  1Z6A A;  2W4M A;  4A2N B;  4Z9I A;  1AEP A;  1I5N A;  3FXH A;  3RQE A;  2PFD A;  4MW3 A;  1Z3I X;  3DM5 A;  5AGF A;  2AWC A;  1NLX A;  1OQC A;  3IQ6 A;  3B9Q A;  1XZQ A;  1J8Y F;  5DVW A;  4D4X A;  3JZ0 A;  4OD5 A;  5JP7 A;  1V4A A;  1WAS A;  2L6F A;  2X0C A;  5KYX A;  2J7P D;  5K0I A;  3PHF 2;  3S84 A;  2W9Y A;  2Z15 A;  2QUP A;  3EG9 A;  1T6I A;  3GM2 A;  4FES A;  3W2W A;  1MND A;  2G3K A;  3QVZ A;  2XL6 A;  2I15 A;  3ASO C;  2CW0 F;  4KBL A;  5L0F A;  3SZR A;  3IPM O;  2P0N A;  2QLA A;  4U5D E;  1R4T A;  4JEA A;  3TOL A;  1OW6 A;  2C04 A;  4J7T A;  4DRJ B;  2ZXW C;  4R32 A;  2ZXR A;  4YL3 A;  3MYF A;  1JMW A;  4IB4 A;  2J7P A;  5E2Q A;  3U0C A;  1TWC A;  3UMH A;  1CGO A;  2G62 A;  4OIO F;  2EPM X;  5L3Q A;  4JE9 A;  1L7C A;  1Q0M A;  1RKE A;  3MBG A;  4JTA B;  4AK9 A;  3S9O A;  4BJ6 A;  3Q7L A;  3NDB B;  4N6C A;  4PJL A;  4HE8 D;  2WL8 A;  1E83 A;  1R5I D;  4E0I A;  2HMQ A;  3AGU A;  3RW0 A;  2YRF A;  3V5Y A;  1KTM A;  1ZYR F;  2J46 A;  5BUO A;  1OCZ C;  5JUA A;  3HNL A;  4OD4 A;  4ZLD A;  2RD9 A;  2Q9A A;  4Z9J A;  4LER A;  2J9U A;  5KYN A;  3KMI A;  3DI5 A;  5B1A C;  2A6H F;  1JOG A;  1Y4C A;  4D4N A;  4CS7 A;  3KL4 A;  2OCC C;  3NYL A;  3TK0 A;  1CGN A;  2J0X A;  2KNH A;  3OA1 A;  4K7B A;  4MVU A;  2QTV A;  2Q00 A;  3FAJ A;  5CI8 A;  2FAP B;  3SNH A;  3OEO A;  2EPO A;  3DXJ F;  1KNY A;  4IWB A;  1OCR C;  2C03 A;  4JJF A;  4MW8 A;  2OKU A;  3T9O A;  3K33 A;  1G4U S;  4O7G A;  1BR4 A;  5DS6 A;  3S90 A;  2Q4F A;  4CDY A;  3VF0 A;  4CSA A;  1FMV A;  3DE9 A;  2Q3T A;  3ZWI A;  1S05 A;  2IXN A;  2JPU A;  3EJN A;  3RFY A;  3W4Y A;  4DRI B;  3EFO B;  1O87 A;  2I8B A;  3EZI A;  2E87 A;  3NYM A;  4RD9 A;  4BJ1 A;  2HFI A;  1Z7Q c;  2OQM A;  4RBN A;  2R7S A;  1RCP A;  1T9K A;  4DVZ A;  4YL0 A;  4XPY A;  2HV6 A;  1NG1 A;  2X51 A;  3L8I A;  2GAQ A;  2J9V A;  3MX3 A;  1FAP B;  2YLI A;  2BL2 A;  2FGY A;  3OWT A;  3JRT A;  2VC9 A;  3EFO A;  3FDQ A;  1HE9 A;  4CS8 C;  1HE1 A;  2R7T A;  1F1M A;  2JD3 A;  1MMN A;  2CCY A;  5EGY A;  3UMK A;  2YL0 A;  4YWQ A;  2Y69 C;  4XEV A;  1PCX A;  3RKO F;  1WTY A;  3ABK C;  1BDJ B;  1YZC A;  1NFN A;  3ECS A;  4QI0 A;  4U5E E;  3U8P A;  3DMD A;  4ULW A;  1ZW3 A;  1GGQ A;  2R7R A;  1SYQ A;  2CGE A;  1C17 M;  3CZ6 A;  3JSZ A;  1NBB A;  2MHR A;  2Y3B A;  3AQB A;  4ER9 A;  1CPR A;  3LNM B;  1I4Z A;  2PBE A;  1Q0G A;  4I1O B;  3KPH A;  1OW7 A;  1RMV A;  4XTK A;  2D4U A;  4CS9 A;  4ONS A;  3B0U X;  1OCO C;  2R7X A;  4IAR A;  3IQT A;  5AC5 A;  1HW1 A;  2ICW G;  1Z5Z A;  3ZG1 A;  1EKY A;  3T6G B;  4FWV A;  1YDI A;  4E0H A;  3LEO A;  3B0V C;  2R7Q A;  5JT4 A;  4YT4 A;  4BJ6 C;  5D92 A;  1Z23 A;  4BJ5 A;  2DYR C;  3EGD B;  3G4X A;  1J8M F;  3V5Z A;  2IXP A;  1UFB A;  1VYK A;  3JCU Q;  4YK5 A;  3KKB A;  2EPL X;  3M15 A;  3NKD A;  4JIO A;  3DJN B;  2VCB A;  1MMG A;  3L34 A;  3VM6 A;  3R2P A;  3ZVR A;  4U5C E;  5JSL A;  5TJ5 E;  3DJU B;  1ZHW A;  3EGX A;  4OIR F;  1LVK A;  3CQZ A;  3JRM O;  3IHU A;  5KYY A;  2M4E A;  2PX3 A;  3SXZ A;  5L3V A;  2Q9B A;  3M79 A;  2BE5 F;  2LQG A;  2H7B A;  4DBR A;  5T3T A;  1MNE A;  1BR1 A;  1O3U A;  2A68 F;  1MMD A;  3IQ5 A;  1PV3 A;  4LAC B;  4MTF A;  3VYW A;  2GDC A;  4BEM J;  4DVY P;  3TD7 A;  4BEJ A;  3ZQY A;  5FCL A;  4YT2 A;  2YQY A;  4G7O F;  1QLE C;  3VRC A;  3ASN C;  2J8W A;  2M64 A;  5DQZ A;  3G50 A;  4CSA C;  4GEH A;  4B6I A;  1QSP A;  2XRH A;  1YYJ A;  3B0P A;  3GM3 A;  2V26 A;  5T3W A;  2NUT B;  3BEH A;  2YLG A;  2W4B A;  2XXA A;  2OU6 A;  4XEK A;  5JLI A;  1M2V B;  2J9W A;  1SZI A;  3X2Q C;  2KK1 A;  1APC A;  2NG1 A;  2PP4 A;  2LIG A;  3RVZ A;  5HV9 A;  2CNW A;  4MVM A;  2L6G A;  5A6B A;  4I1M A;  4ANJ A;  1Q0K A;  2J9B A;  2KJG A;  1OR3 A;  3QZC A;  1FMW A;  4JKV A;  1NU9 C;  4K1O A;  4AL0 A;  3GM1 A;  1ORJ A;  3ABM C;  2Q7R A;  2J0W A;  4NQF A;  5F28 E;  4CS8 A;  4E7Z A;  2CYD A;  4MVS A;  3S0X A;  1VB5 A;  1W2W A;  2BC5 A;  2EIJ C;  2P6V A;  3DAF A;  1SF8 A;  3RVY A;  3WOD F;  2WZG A;  2YZS A;  4NTA A;  5DLJ A;  2NSG A;  2IYL D;  1ZW2 A;  1ST6 A;  2LP4 A;  5EHH A;  4UDV A;  1K04 A;  2QE9 A;  4P9F A;  4WGY A;  1H9G A;  2DI3 A;  4JZA A;  3TJ5 A;  4KI2 A;  1NU7 D;  1YYX A;  1LM3 B;  1QKR A;  4KNV A;  1G5Z A;  3FMS A;  3W2V A;  3X1O A;  1GQA A;  3AG1 C;  4CJO A;  4JCH A;  3HNJ A;  1H7I A;  4LLC A;  3JYY A;  3C8G B;  3N24 A;  3M4B A;  3F47 A;  3RQG A;  1VLT A;  3K7D A;  4BJT A;  1WWP A;  2R9R B;  4EUK B;  3SXK A;  4E7S A;  1E86 A;  3ITF A;  3LNR A;  4G0H A;  5DS4 A;  3K1I C;  4U9D A;  3H65 A;  5AC4 A;  4GYT A;  1DOW A;  3W8H A;  4E17 A;  2ZXO A;  2XM0 A;  2VCA A;  5COF A;  5A69 A;  5DS5 A;  2EIM C;  4O6M A;  2EIK C;  3IEE A;  5CI9 A;  1I4Y A;  4O6Y A;  1YAU O;  3GAN A;  4IRU A;  3S28 A;  2JX0 A;  2F22 A;  1G8X A;  2XSE A;  3N0T A;  3LES A;  3KYI A;  4QDL A;  4DBQ A;  5KYY B;  3J06 A;  1TWG A;  2R7V A;  4DXW A;  1MQV A;  1T6Q A;  3AG2 C;  1QQ3 A;  2YL3 A;  4XLP F;  1RXQ A;  1Z63 A;  1NZE A;  5KYW A;  2W45 A;  2QNL A;  3NG1 A;  1TKN A;  2R7U A;  1EA8 A;  1LI5 A;  3NMJ A;  2OEV A;  4G78 A;  3FVY A;  4JEB A;  2R03 A;  2HKV A;  4IAO A;  1VMA A;  4K0D A;  4XPW A;  3QW0 A;  3SXY A;  1H9T A; 
#chains in the Genus database with same CATH homology
 1FTS A;  4AE4 A;  1S7Z A;  3VAY A;  1D0X A;  1ZU4 A;  2KW3 C;  4CBE A;  5KYW B;  3AG4 C;  5IY5 C;  4YT8 A;  3WG7 C;  3HTK C;  4H4K C;  1LS1 A;  3I4U A;  2DGJ A;  4PJN A;  1WGW A;  2NUP B;  1FFT C;  2PX0 A;  2FFH A;  4ZLC A;  4U5G A;  3EPV A;  3Q7G A;  2A69 F;  2P7V A;  2VB6 A;  1D0Y A;  4P6I C;  4OIN F;  4W8K A;  2WZL A;  4U5F E;  3I5P A;  3UGP A;  4X0R A;  1TWA A;  2V3C C;  2CDQ A;  2L9J A;  3E9V A;  1TR2 A;  4PJJ A;  4J32 B;  3GOD A;  3N2Z B;  1MMA A;  3QMK A;  2OG2 A;  2H7V C;  2ZPA A;  4IJJ A;  1IZM A;  4F4B A;  5DQT A;  4CS9 C;  2EIL C;  2Q9C A;  3FHD A;  3T4R A;  2YEV A;  4WJ0 A;  2J45 A;  3LS0 A;  3SEO A;  3T6B A;  5KYX B;  1M2V A;  4M63 A;  3NKE A;  4U5B E;  4JW1 A;  2Y39 A;  1V55 C;  1O5H A;  2A1D D;  1JPJ A;  2MWQ A;  2B0J A;  3HLZ A;  4HEA J;  1D1B A;  3UR3 C;  1JPN A;  2R7O A;  5T1D B;  4Q4Z F;  2A6E F;  5E3A A;  3UNG C;  1D1A A;  4RDA A;  2Y3G A;  3ZIB A;  3EQL F;  1SMY F;  1VOM A;  2Y3H A;  3EH2 A;  2LSE A;  1BR2 A;  3ZSU A;  4PJM A;  4NY3 A;  2MYS A;  2XL4 A;  1M57 C;  3DM9 B;  4G7Z F;  3EHM A;  4AE4 B;  4EWC A;  4JJG A;  3W8I A;  4O79 A;  1KU2 A;  3PMR A;  3POV A;  5E33 A;  1D1C A;  4BG0 A;  2R7W A;  2IXM A;  1M56 C;  2QY9 A;  3RYL A;  3SYN A;  4C3D A;  3E70 C;  2IOQ A;  3I5Q A;  3M1C B;  2DYS C;  3RH3 A;  4KNW A;  1IW7 F;  1RJ9 B;  3EH1 A;  2PF4 E;  4Q7C A;  4PFO A;  3T6J A;  1OCC C;  4G7H F;  3EGX B;  3ABL C;  3EG9 B;  2WVO A;  4JUR I;  2GFH A;  3LLK A;  1ZHY A;  1RJ9 A;  3ZC4 A;  4AX2 A;  3LLI A;  1VK5 A;  1FFH A;  3LAY A;  3SP1 A;  5F5H A;  4G7O F;  2ZXP A;  4XLN F;  4C7O A;  1ZHZ A;  1OKK A;  3EGD A;  2EIN C;  2IXO A;  2D5R B;  3K6B A;  1PD0 A;  3S29 A;  3LS1 A;  4I3M A;  2WZF A;  2CNW D;  5B3S C;  4MND A;  3NYJ A;  1LKX A;  4OIQ F;  3AQC A;  3HJC A;  2H7O A;  4U5H A;  3NRH A;  1D0Z A;  1QZX A;  2VH3 A;  3K66 A;  4I44 A;  3O6X A;  3EHN A;  2VAS A;  4OIP F;  2NUP A;  3UGO A;  4LLE A;  3EZH A;  1VYI A;  2NUT A;  1N1C A;  3KH2 A;  3S27 A;  3LEV A;  2YHS A;  1OKK D;  4CIH A;  3K1H A;  1ZHT A;  3LJB A;  5KYU A;  1PD1 A;  1TWH A;  3DAG A;  4C3E A;  3Q6M A;  4FX5 A;  4EBB A;  4HFK B;  3UMI A;  4BJ5 C;  5D91 A;  2HV7 A;  4YJW A;  3DD7 A;  4XWJ A;  5KYU B;  4N06 A;  3JT1 A;  2L81 A;  5HSW A;  3L0I A;  2XXA B;  5E3C A;  4J30 B;  3MLG A;  4PK4 A;  3Q6N A;  4Q5S F;  4C7O B;  4PFP A;  1M2O A;  4JVS A;  2O9X A;  3F46 A;  3JYH A;  2KGO A;  4YN0 B;  3AG3 C;  3RIP A;  2WB7 A;  3O39 A;  4HFF B;  3DZA A;  4MQ9 F;  5B1B C;  1ZHX A;  4O6N A;  4QI2 A;  1ZU5 A;  2KQ9 A;  5F5F A;  3V7O A;  2Y3D A;  4YT5 A;  2WVQ A;  4DOZ A;  3CSK A;  1V54 C;  2WVN A;  4C3B A;  2W4M A;  2G3V A;  1Z6A A;  4A2N B;  2PFD A;  1Z3I X;  3DM5 A;  3B9Q A;  1J8Y F;  5DVW A;  4OD5 A;  5KYX A;  3PHF 2;  2J7P D;  2W9Y A;  2Z15 A;  3EG9 A;  4FES A;  3W2W A;  1MND A;  2G3K A;  3ASO C;  2CW0 F;  4KBL A;  3SZR A;  4U5D E;  2C04 A;  2ZXW C;  2ZXR A;  2J7P A;  5E2Q A;  1TWC A;  3UMH A;  2G62 A;  4OIO F;  5L3Q A;  3NDB B;  4AK9 A;  4BJ6 A;  3Q7L A;  4PJL A;  4HE8 D;  2WL8 A;  1ZYR F;  2J46 A;  5BUO A;  1OCZ C;  4OD4 A;  4ZLD A;  2Q9A A;  4LER A;  2J9U A;  5KYN A;  3KMI A;  5B1A C;  2A6H F;  4CS7 A;  3KL4 A;  2OCC C;  3NYL A;  2J0X A;  2KNH A;  3OA1 A;  4K7B A;  5CI8 A;  2QTV A;  3FAJ A;  3SNH A;  3OEO A;  3DXJ F;  4IWB A;  1OCR C;  2C03 A;  4JJF A;  3K33 A;  4O7G A;  5DS6 A;  1BR4 A;  4CSA A;  1FMV A;  2Q3T A;  2IXN A;  3EJN A;  3RFY A;  3EFO B;  1O87 A;  2I8B A;  3EZI A;  2E87 A;  3NYM A;  4RD9 A;  4BJ1 A;  4RBN A;  2R7S A;  4DVZ A;  2HV6 A;  1NG1 A;  2X51 A;  2J9V A;  3MX3 A;  2FGY A;  3OWT A;  3JRT A;  3EFO A;  3FDQ A;  4CS8 C;  2R7T A;  2JD3 A;  1MMN A;  5EGY A;  3UMK A;  4YWQ A;  2Y69 C;  1PCX A;  3RKO F;  3ABK C;  4U5E E;  3ECS A;  4QI0 A;  3DMD A;  4ULW A;  2R7R A;  2CGE A;  3CZ6 A;  3JSZ A;  2Y3B A;  3AQB A;  4I1O B;  4XTK A;  4CS9 A;  3B0U X;  1OCO C;  2R7X A;  1Z5Z A;  3ZG1 A;  4FWV A;  3B0V C;  2R7Q A;  4YT4 A;  4BJ6 C;  5D92 A;  1Z23 A;  4BJ5 A;  2DYR C;  3EGD B;  1J8M F;  2IXP A;  1VYK A;  3JCU Q;  3KKB A;  3NKD A;  3DJN B;  1MMG A;  3L34 A;  3ZVR A;  4U5C E;  4OIR F;  3DJU B;  1ZHW A;  3EGX A;  1LVK A;  3CQZ A;  5KYY A;  2M4E A;  2PX3 A;  5L3V A;  2Q9B A;  2BE5 F;  2H7B A;  4DBR A;  5T3T A;  1MNE A;  1BR1 A;  2A68 F;  1MMD A;  4LAC B;  3VYW A;  4DVY P;  3TD7 A;  4BEJ A;  5FCL A;  4YT2 A;  1QLE C;  3ASN C;  5DQZ A;  4CSA C;  4GEH A;  4B6I A;  2XRH A;  3B0P A;  2V26 A;  5T3W A;  2NUT B;  2W4B A;  2XXA A;  1M2V B;  2J9W A;  1SZI A;  3X2Q C;  2NG1 A;  2PP4 A;  2CNW A;  4I1M A;  4ANJ A;  2KJG A;  3QZC A;  1FMW A;  1NU9 C;  3ABM C;  4CS8 A;  2J0W A;  4E7Z A;  3S0X A;  1W2W A;  2EIJ C;  3DAF A;  2P6V A;  3WOD F;  1SF8 A;  5DLJ A;  2WZG A;  2YZS A;  2IYL D;  1ST6 A;  5EHH A;  4JZA A;  4KI2 A;  1NU7 D;  4KNV A;  3W2V A;  3X1O A;  3AG1 C;  4JCH A;  4LLC A;  3N24 A;  3F47 A;  3K7D A;  4BJT A;  4E7S A;  3ITF A;  3LNR A;  4G0H A;  5DS4 A;  3K1I C;  3H65 A;  4GYT A;  3W8H A;  2ZXO A;  5DS5 A;  2EIM C;  4O6M A;  2EIK C;  3IEE A;  5CI9 A;  4O6Y A;  3GAN A;  4IRU A;  3S28 A;  3N0T A;  2XSE A;  1G8X A;  4QDL A;  4DBQ A;  3LES A;  5KYY B;  2R7V A;  1TWG A;  3AG2 C;  4XLP F;  1Z63 A;  1NZE A;  5KYW A;  2W45 A;  2R7U A;  3NG1 A;  1TKN A;  4K0D A;  3FVY A;  4IAO A;  4KC9 A;  1VMA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...