1W2WA

Crystal structure of yeast ypr118w, a methylthioribose-1-phosphate isomerase related to regulatory eif2b subunits
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
211
structure length
211
Chain Sequence
b'MSLEAIVFDRSEPENVSVKVLDQLLLPYTTKYVPIHTIDDGYSVIKSMQVRGAPAIAIVGSLSVLTEVQLIKHNPTSDVATLYSLVNWESTKTVLNKRLDFLLSSRPTAVNLSNSLVEIKNILKSSSDLKAFDGSLYNYVCELIDEDLANNMKMGDNGAKYLIDVLQKDGFKDEFAVLTICNTGSLATSGYGTALGVIRSLWKDSLAKTDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5-METHYLTHIORIBOSE-1-PHOSPHATE ISOMERASE
publication title Crystal Structure of Yeast Ypr118W, a Methylthioribose-1-Phosphate Isomerase Related to Regulatory Eif2B Subunits
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Isomerase
total genus 76
structure length 211
sequence length 211
chains with identical sequence E, I, M
ec nomenclature ec 5.3.1.23: S-methyl-5-thioribose-1-phosphate isomerase.
pdb deposition date 2004-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1840 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1w2wA00
1W2WA
chains in the Genus database with same CATH superfamily
2UUHA 2W45A 5L3QA 2YL3A 3M15A 3AOUA 1KU2A 3U8PA 3Q6NA 3FHDA 3MYFA 1SMYF 2Z15A 2G62A 3Q7GA 4YL1A 5B3SC 3B9QA 4XEKA 1VYIA 1TFOB 1KTMA 4KI2A 2QNLA 3ECSA 2FFHA 3R2PA 2P1AA 3W2VA 3PDMP 1B68A 2J7PD 3ASNC 2XLWA 2RD9A 5T3TA 1TWHA 1MMDA 2AU5A 1ZZPA 3NYLA 3NDBB 3LNRA 2EINC 5DQTA 4JTDB 1XZPA 1BBHA 4CS9C 3DE9A 1L3PA 1LM3B 1NU9C 4DRHB 2FAPB 3HTKC 1QPUA 2H8AA 4CDYA 3JSEO 3AG3C 3NYJA 1J8MF 3VAYA 3DWWA 2IOQA 3K1IC 3U9MA 4JJFA 4DBRA 3C8ZA 1CGNA 1UFBA 4I1OB 4DOZA 3HNKA 2ETSA 1FMWA 1YYJA 4IAOA 3TJ5A 4O6YA 3JRTA 4YK5A 4IRUA 1D1AA 1EI7A 2HV7A 4J7TA 4PFPA 3VYWA 1CGME 1WASA 2X0CA 3JSZA 4WGZA 1DOVA 1F1MA 5D91A 5FCLA 4J30B 2L9JA 4EWCA 4YT4A 3A11A 4BJTA 1G4US 4OD5A 3B71A 1FAPB 4E17A 4OINF 4G7OF 4YWQA 4K1OA 1WN0A 256BA 2WVOA 2Y3BA 3KPHA 4K7BA 4N6HA 4OIOF 3PHF2 4XPXA 3E70C 3H2VA 3GANA 3GODA 3FXHA 4YT5A 4CDVA 4BJ6C 5JVEA 1Z6AA 1JAFA 2IXNA 2JX0A 1TKNA 1SF8A 3IQTA 1ORYA 3GEEA 2A1DD 1A7EA 3RF3A 5A6JA 4MVOA 3SXMA 4AL0A 1Q0FA 1UG7A 1MNDA 2DGJA 3HJCA 2J7PA 2IYLD 2Q9BA 2TMVP 1QQ3A 2GDCA 1NBBA 2VCAA 3CEXA 3EZHA 1ZU5A 4E18A 1HW1A 1PV3A 3U2LA 1QZXA 5KYWB 1O5HA 2EILC 3LEVA 2EPMX 2OEVA 2AP3A 3ZQVA 3QMKA 2F22A 1OW6A 3DZAA 1C03A 1BR2A 2YRFA 2QE9A 3SP1A 1MMAA 4AL1A 4DVZA 2KYHA 2QLAA 3QVZA 5L0HA 1J8YF 1LI7A 1T5OA 1VMAA 2LFDA 3ABLC 3QW1A 4FESA 3RKOF 1YYXA 1L7CA 4JRZA 4U5GA 4U5HA 1K40A 4MVZA 4H54A 3LJBA 3VRCA 3G4ZA 3C63A 2E87A 3S9OA 2Y39A 3TOMA 1K05A 2Q3TA 2R7TA 1K04A 2GAQA 2PFDA 2YQYA 3WHNA 2M4EA 2J45A 3EGDB 3S90A 1GGQA 1C17M 1OR3A 3BRJA 1V74B 2KW3C 2OEXA 1LI5A 1N1CA 3F47A 3Q6MA 4UDVA 2DYSC 2XM4A 3GWLA 1OR2A 5A6BD 2YEVA 1YLMA 2DYRC 5F5HA 3W2WA 3UMIA 3C8GD 1RKCA 3MYIA 1PD0A 5EK0A 3EG9A 1KNYA 2NPUA 3EH1A 2A6EF 3C7JA 4B6IA 2JD3A 1QVXA 2LK4A 3TOLA 3K1HA 3N0TA 3DAFA 3KH2A 3KYIA 4EIYA 3NMJA 4PJJA 3R7CA 1U89A 1I5NA 1E85A 1LVKA 2PX0A 3K6BA 1NFNA 4IB4A 1OCOC 4KBLA 4OIQF 2HZ8A 3M4BA 4AE4A 4CS7A 4BJ5C 4LLCA 2XXAB 3TQOA 4HFFB 1T6IA 1ZHWA 3JYHA 4YT2A 1D0ZA 2BE5F 4G7ZF 5AC4A 2W4BA 4JEBA 4N6CA 3I5PA 2WB7A 3I4UA 1PD1A 2MWQA 2L6GA 2LQGA 3AG4C 3L8JA 4X0RA 1JPJA 3W8HA 5JRAA 3LNMB 1ZHYA 1CGOA 3GWNA 5KYYB 3POVA 2DI3A 4KNWA 4XEFA 2C03A 2XLOA 2A68F 2XS1A 3EGXB 3NMIA 4G78A 5KYYA 1U0BB 3U3FA 3GEHA 1Q0GA 4CSAC 1V55C 2J0XA 3IQCA 1W2WA 3ATPA 4JTAB 1DOWA 3RVZA 5JS5A 1H9GA 3H2UA 2RSEB 1H7IA 2OJED 1Z5ZA 4XEVA 4BEJA 5A6BA 3C8GB 3MLGA 1M56C 3DE8A 3EHNA 3SXKA 4O79A 5DLJA 4GYTA 1Q0DA 5A69A 2Q4FA 4P6IC 3CAXA 2KSFA 5E2QA 5BQHA 5CIVA 5COFA 3QW0A 5JUAA 3S28A 1FR0A 4Z9IA 3ZQYA 4NTAA 4PJNA 5JP7A 5L0GA 2D4UA 2WVNA 2XSEA 1A7VA 4E0HA 4NQFA 4ONSA 3ZWIA 1JR8A 1OXKA 3HNJA 3NMKA 3GM2A 1RCPA 2XLMA 1YAUO 4LERA 2YWAA 2H7VC 3GM3A 2YLIA 3HLZA 5E33A 3UGPA 1LE4A 3C62A 1SZIA 3WAQA 4XPWA 2VC9A 4MW8A 1APCA 1TWAA 1M57C 3DMDA 2OG2A 4JURI 1XWJA 1ZHXA 2C04A 1FFTC 4WABA 3VM6A 3OA1A 4MS2A 5L0DA 4FX5A 1E84A 1D1CA 5EGYA 3H65A 2HKVA 4ER9A 1Z3IX 1TWGA 3HNLA 1OKKD 3LLKA 3NKDA 4YL0A 1MNEA 2H7OA 2MHRA 2YLGA 3V5YA 1JPNA 1JRAA 4C3BA 1YJGA 1E2XA 1FFHA 1Z7Qc 2AWCA 1OXBA 4ZLCA 1NZEA 1HW2A 3FOPA 3GORA 4P9TA 4CS8A 1OW7A 2Y3DA 3X2QC 5B3IA 4EBBA 1Y6DA 2BL2A 4G7HF 2BC5A 2YL7A 3AG2C 2QY9A 3KMIA 2GWWA 2YVKA 3AG1C 4HFKB 4JC7A 4NTBA 1ORJA 3LS0A 4FAPB 1V54C 4JZAA 5D92A 1I4YA 3CSKA 4MTOA 3AGUA 3MX3A 4W8PA 3US6A 3LLIA 5T1DB 3VF0A 2EIMC 2PF4E 3S27A 1ZW2A 5L0CA 4MVUA 3ASOC 3ZC4A 4CJOA 2EPOA 5KYWA 2P6VA 2G3KA 2ZXOA 2XRHA 1TR2A 1EKYA 5JSLA 1LS4A 1RKEB 2IXMA 1HE9A 3N24A 5DQZA 3DM9B 2CCYA 2NG1A 5KYNA 1RKEA 2NSGA 3SZRA 3L8IA 1WWPA 2ICWG 1YA7O 3RQGA 2J46A 5BQIA 2IBFA 4KNVA 1A0BA 4JCHA 3JZ0A 4IWBA 3DAGA 2PNOA 1VLSA 1ORSC 1IW7F 3IHUA 2MYSA 3B29A 1OQCA 4BG0A 4GEHA 2VASA 3M1CB 2ZD9A 4C7OB 4Z9HA 1GQAA 4CS9A 4C7OA 4Q5SF 4XPYA 3RQFA 2L81A 2EPKX 3K7DA 1C02A 1OKKA 2GA0A 4KC9A 2Q00A 1Z23A 5A6KA 2VCCA 2IXOA 2OU6A 2OJQA 2LP4A 2QTVA 3EGDA 2J0WA 5DS5A 2OKUA 3K1IA 4J32B 3S29A 4YT8A 2HMZA 4NY3A 2CNWD 1E83A 3T6GB 4D4NA 3RQEA 4IJJA 4O6MA 2R7SA 2XS8A 2EPLX 1R5ID 2HJ3A 3ZSUA 3O55A 3G50A 4XLNF 1E86A 1VK5A 2VH3A 3MBGA 2JPUA 3JTLO 2DB4A 3PMRA 4YL3A 1RXQA 3SNHA 1M2VB 2V26A 4MVRA 4ULVA 1A7DA 1M2VA 3ABMC 3EPVA 2HUJA 4DVYP 4MTGA 3HNIA 3ZVRA 1LPEA 3DJNB 4NC3A 3F46A 4NTFA 1BDJB 3K66A 4L6RA 4LDKA 5B1BC 1WOLA 3JYYA 5E3CA 3V5ZA 3QVYA 5COMA 2B0JA 3FMSA 4BJ6A 1D0XA 1LE2A 3AQCA 2XXAA 4JIOA 4O6NA 3T4RA 2CW0F 4IARA 2PBEA 3KL4A 4E0IA 1Q0MA 4M63A 4CX9A 4PJMA 5BQGA 4U5EE 3RFYA 4XQ1A 2YL1A 3T9OA 4ZLDA 1GS9A 2YKZA 4N06A 5B1AC 3U3BA 1ZYRF 3TD7A 1H9TA 2IXPA 3NRHA 3SEOA 3UNGC 2J9BA 2P7VA 4MQ9F 1HE1A 4DBQA 2FGYA 4JEAA 4WGYA 3ITFA 4PR9A 3EGXA 2KJGA 2AWYA 2R7XA 3ZTMA 4RD9A 1NFOA 5GPGB 4DRJB 3V5XA 3OWTA 2Y69C 1T9KA 2CNWA 4CJGA 1YZAA 2PX3A 2HSBA 2ASRA 2W9YA 3C8GA 4DJ9A 4EBJA 3KYJA 1MMGA 1O87A 1G5ZA 3KKBA 3LAYA 4WJ0A 4XWJA 3TJ6A 5AGFA 2XLVA 1NSGB 2HV6A 2ZXPA 5KYUB 3Q7LA 2B0HA 1GM5A 2R7VA 5KYUA 4OIRF 1ZU4A 1OCRC 3AQBA 1R4TA 1AEPA 2A0UA 2XL4A 2ZPAA 2ZXRA 3O6XA 4E7ZA 3T6BA 1H6GA 4D4XA 3EJNA 3B0VC 2YL0A 1LKXA 2WZFA 4XTKA 5T3WA 1RMVA 2HFIA 2R9RB 1T6QA 2A0BA 3U8VA 4AK9A 4ANJA 3EQLF 1VTMP 4U5DE 4MVMA 3T6JA 3ZDLA 1U6HA 3EZIA 2A6HF 5FZTA 1TQGA 5TJ5E 4CDAA 4J7YA 1RJ9B 5A6AA 1WATA 2LIGA 4U5BE 1RJ9A 4IGGA 2J9UA 3PCVA 4GQHA 4JCZA 4Z9JA 5L0JA 1CPQA 2R02A 4EKWA 1BR1A 3FOOA 2J8WA 4PJLA 5AC5A 4BJ5A 4QI2A 3L1MA 3M4CA 4P9FA 3W4YA 3A9CA 4MW3A 2KK1A 2R7RA 1ZVZA 1ZW3A 2YHSA 2KC3A 3UMHA 1VYKA 2XLEA 2XLHA 1LIHA 3EFOB 4NCQA 3RIPA 2CGEA 4C3DA 3EFOA 3IPMO 4K0DA 1Q0KA 1YDIA 3L34A 3W8IA 4Q4ZF 4RDAA 5L3VA 4OIPF 1TWCA 2H7BA 3QZCA 2Q9AA 4A4AA 1G4WR 5E3AA 4E7SA 5DS6A 4I1MA 1Z63A 2L6FA 3O10A 2WL8A 3C18A 4I44A 4JVSA 1G8XA 1NU7D 2Y3GA 4W8KA 4YN0B 4BJ1A 2R7UA 4JJGA 3FAJA 4C3EA 3ABKC 3UGOA 4CSAA 4OD4A 2L7AA 2QUPA 4R32A 1MMNA 4PK4A 4EBKA 2NUTB 4MNDA 4AX2A 3WG7C 2NUTA 1AUEA 4U5CE 4BPMA 2R7WA 2GFHA 2NSFA 3LEOA 3N2ZB 4MVQA 3LS1A 2NUPB 4JTCB 1SR2A 1XZQA 2P61A 2NUPA 1EA8A 2XM0A 2HJMA 3CQZA 3GM1A 3UMKA 3ZTZA 4LACB 5KYXB 3ZG1A 2Q9CA 1VLTA 2R03A 5KYXA 2OCCC 4JKVA 1CPRA 2KQ9A 2ZXWC 3CZ6A 3JRMO 1FNTc 4U9DA 3ZIBA 3DXJF 2W4MA 3S84A 3FVYA 3S0XA 3U2MA 3EH2A 5DVWA 1JMWA 3TK0A 5K0IA 4PACA 1OCCC 2EPNA 2OOCA 2IM8A 1WGWA 1IZMA 2KNHA 3O39A 1JOGA 4H4KC 1A41A 3K33A 4I3MA 2AVKA 1YVIA 2J9WA 2PP4A 1MQVA 4HE8D 1OCZC 3U9JA 3NKEA 4JW1A 1D1BA 1FMVA 2XL6A 3DI5A 1S7ZA 3NYMA 4CIHA 1FTSA 5CI9A 1EQ1A 3TULA 1YA9A 4U9EA 3J06A 3E9VA 1D0YA 3NG1A 2OQMA 3LUTB 2WVQA 4Q7CA 3B0UX 3HKKA 4N4WA 1NLXA 2O9XA 1PCXA 5COGA 3BEHA 4LDQA 3U0CA 3JCUQ 4A2NB 1HMDA 1NG1A 1M6TA 2R25A 2Q7RA 4QI0A 4PFOA 1TFKB 4CIPA 3DKAA 4EUKB 3X1OA 1YZCA 2LSEA 4QDLA 1ZHTA 1M2OA 2KGOA 3I5QA 1O3UA 3M79A 1HMOA 1V4AA 2VB6A 5CI8A 4BEMJ 3L0IA 2UUIA 2P0NA 1I4ZA 2HS5A 2I8BA 3EG9B 3U5SA 4XLPF 3QTHA 5BUOA 2V3CC 3SXZA 2LCHA 4U5FE 2X51A 3RW0A 2EIJC 4LLEA 1VB5A 1AVOB 1T6UA 2R7OA 2Y3HA 3EHMA 3G4XA 4FWVA 5F28E 3IEEA 4G0HA 2HMQA 3AJMA 5L0FA 1WTYA 1QKRA 4DRIB 4EHPA 2J9VA 3DJUB 4CBEA 3RVYA 3B0PA 3WODF 2G3VA 2WZLA 2CDQA 1QSPA 2LD6A 3SYNA 2XL8A 2YZSA 4AE4B 5F5FA 2M64A 2LFFA 4HEAJ 3RYLA 1VOMA 4MVSA 3LESA 2EIKC 5EHHA 5HV9A 5JT4A 5IY5C 5HSWA 2L6HA 3SXYA 2WZGA 1YARO 3FAPB 4IAQA 4JE9A 4ULWA 5JLIA 1Y4CA 2HSQA 3AGTA 2A69F 3FDQA 4CS8C 4LDRA 3JT1A 3MFNA 4RBNA 4YJWA 5DS4A 5L0IA 2CYDA 3IQ5A 2YLDA 4DXWA 3DD7A 4F4BA 2I15A 3V7OA 3RH3A 1ST6A 2VCBA 1SYQA 2R7QA 4O7GA 1HY5A 3DM5A 1S05A 2D5RB 3OEOA 3UR3C 1BR4A 1QLEC 1T01A 1BZ4A 1LS1A 1ZHZA 3GEIA 4MTFA 1OW8A 2XLDA 3IQ6A 2R05A
chains in the Genus database with same CATH topology
2W45A 5L3QA 1KU2A 3Q6NA 3FHDA 1SMYF 2Z15A 2G62A 3Q7GA 5B3SC 3B9QA 1VYIA 3ECSA 2FFHA 3W2VA 2J7PD 3ASNC 5T3TA 1TWHA 1MMDA 3NYLA 3NDBB 3LNRA 2EINC 5DQTA 4CS9C 1NU9C 3HTKC 3AG3C 3NYJA 1J8MF 3VAYA 2IOQA 3K1IC 4JJFA 4DBRA 4DOZA 4I1OB 1FMWA 4IAOA 4O6YA 3JRTA 4IRUA 1D1AA 2HV7A 4PFPA 3VYWA 5FCLA 3JSZA 5D91A 4J30B 2L9JA 4EWCA 4YT4A 4BJTA 4OD5A 4OINF 4G7OF 4YWQA 2WVOA 2Y3BA 4K7BA 4OIOF 3PHF2 3E70C 3GANA 3GODA 4YT5A 4BJ6C 1Z6AA 2IXNA 1TKNA 1SF8A 2A1DD 1MNDA 2DGJA 3HJCA 2J7PA 2IYLD 2Q9BA 3EZHA 1ZU5A 5KYWB 1QZXA 1O5HA 2EILC 3LEVA 3QMKA 3DZAA 1BR2A 3SP1A 1MMAA 4DVZA 1J8YF 1VMAA 3ABLC 4FESA 3RKOF 4U5GA 4U5HA 3LJBA 2E87A 2Y39A 2Q3TA 2R7TA 2PFDA 2M4EA 2J45A 3EGDB 2KW3C 3F47A 3Q6MA 1N1CA 2DYSC 2YEVA 5F5HA 2DYRC 3W2WA 3UMIA 1PD0A 3EG9A 3EH1A 2A6EF 4B6IA 2JD3A 3K1HA 3N0TA 3DAFA 3KH2A 4PJJA 1LVKA 2PX0A 3K6BA 4KBLA 4OIQF 1OCOC 4AE4A 4CS7A 4BJ5C 4LLCA 2XXAB 4HFFB 1ZHWA 3JYHA 4YT2A 1D0ZA 2BE5F 4G7ZF 2W4BA 3I5PA 2WB7A 3I4UA 1PD1A 2MWQA 3AG4C 4X0RA 1JPJA 3W8HA 1ZHYA 5KYYB 3POVA 4KNWA 2C03A 3EGXB 2A68F 5KYYA 4CSAC 1V55C 2J0XA 1W2WA 1Z5ZA 4BEJA 3MLGA 1M56C 3EHNA 4O79A 5DLJA 4GYTA 4P6IC 5E2QA 3S28A 4PJNA 2WVNA 2XSEA 4LERA 2H7VC 5E33A 3HLZA 3UGPA 1SZIA 1TWAA 1M57C 3DMDA 2OG2A 4JURI 1ZHXA 2C04A 1FFTC 3OA1A 4FX5A 1D1CA 5EGYA 3H65A 1Z3IX 1TWGA 3LLKA 1OKKD 3NKDA 1MNEA 2H7OA 4C3BA 1JPNA 1FFHA 4ZLCA 1NZEA 4CS8A 2Y3DA 3X2QC 4EBBA 4G7HF 3KMIA 3AG2C 2QY9A 3AG1C 4HFKB 3LS0A 1V54C 4JZAA 5D92A 3CSKA 3MX3A 3LLIA 5T1DB 2EIMC 2PF4E 3S27A 3ASOC 3ZC4A 5KYWA 2P6VA 2G3KA 2ZXOA 2XRHA 1TR2A 2IXMA 3N24A 5DQZA 3DM9B 2NG1A 5KYNA 3SZRA 2J46A 4KNVA 4JCHA 4IWBA 3DAGA 4BG0A 1IW7F 2MYSA 4GEHA 2VASA 3M1CB 4C7OB 4CS9A 4C7OA 4Q5SF 2L81A 4KC9A 3K7DA 1OKKA 1Z23A 2IXOA 3EGDA 2QTVA 5DS5A 2J0WA 4J32B 3S29A 4YT8A 4NY3A 2CNWD 4IJJA 4O6MA 2R7SA 3ZSUA 4XLNF 1VK5A 2VH3A 3PMRA 3SNHA 1M2VB 2V26A 1M2VA 3ABMC 3EPVA 4DVYP 3ZVRA 3DJNB 3F46A 5B1BC 3K66A 5E3CA 2B0JA 4BJ6A 1D0XA 3AQCA 2XXAA 4O6NA 3T4RA 2CW0F 3KL4A 4M63A 4PJMA 4U5EE 3RFYA 4ZLDA 4N06A 5B1AC 1ZYRF 3TD7A 2IXPA 3NRHA 3SEOA 3UNGC 2P7VA 4MQ9F 4DBQA 2FGYA 3ITFA 3EGXA 2KJGA 2R7XA 4RD9A 3OWTA 2Y69C 2CNWA 2PX3A 2W9YA 1MMGA 1O87A 3LAYA 3KKBA 4WJ0A 4XWJA 2ZXPA 2HV6A 5KYUB 3Q7LA 2R7VA 5KYUA 4OIRF 1ZU4A 1OCRC 3AQBA 2XL4A 2ZPAA 2ZXRA 3B0VC 4E7ZA 3O6XA 3T6BA 3EJNA 1LKXA 2WZFA 4XTKA 5T3WA 4AK9A 4ANJA 3EQLF 4U5DE 3T6JA 3EZIA 2A6HF 1RJ9B 4U5BE 1RJ9A 2J9UA 1BR1A 4PJLA 4BJ5A 4QI2A 2R7RA 2YHSA 3UMHA 1VYKA 3EFOB 4C3DA 3RIPA 2CGEA 3EFOA 4K0DA 3L34A 3W8IA 4Q4ZF 4RDAA 5L3VA 4OIPF 1TWCA 2H7BA 3QZCA 2Q9AA 5E3AA 4E7SA 5DS6A 4I1MA 1Z63A 4W8KA 2WL8A 4JVSA 4I44A 1G8XA 1NU7D 2Y3GA 4BJ1A 4YN0B 2R7UA 4JJGA 3FAJA 4C3EA 3ABKC 3UGOA 4CSAA 4OD4A 1MMNA 4PK4A 2NUTB 4MNDA 4AX2A 3WG7C 2NUTA 4U5CE 2R7WA 2GFHA 3N2ZB 3LS1A 2NUPB 2NUPA 3UMKA 3CQZA 5KYXB 4LACB 3ZG1A 2Q9CA 5KYXA 2OCCC 2KQ9A 2ZXWC 3CZ6A 3ZIBA 3DXJF 2W4MA 3FVYA 3S0XA 3EH2A 5DVWA 4KI2A 1OCCC 2KNHA 1WGWA 1IZMA 4H4KC 3O39A 3K33A 4I3MA 2PP4A 2J9WA 4HE8D 1OCZC 3NKEA 4JW1A 1FMVA 1D1BA 1S7ZA 3NYMA 4CIHA 1FTSA 5CI9A 3E9VA 1D0YA 3NG1A 4Q7CA 2WVQA 3B0UX 2O9XA 1PCXA 3JCUQ 4A2NB 1NG1A 4QI0A 4PFOA 3X1OA 2LSEA 4QDLA 1ZHTA 1M2OA 2KGOA 3I5QA 5CI8A 2VB6A 3L0IA 2I8BA 3EG9B 4XLPF 5BUOA 2V3CC 4U5FE 2X51A 2EIJC 4LLEA 2R7OA 3EHMA 2Y3HA 4FWVA 3IEEA 4G0HA 2J9VA 3DJUB 4CBEA 3B0PA 3WODF 2G3VA 2WZLA 2CDQA 3SYNA 5F5FA 2YZSA 4AE4B 4HEAJ 3RYLA 5EHHA 1VOMA 3LESA 2EIKC 5HSWA 5IY5C 2WZGA 4ULWA 3FDQA 2A69F 4CS8C 3JT1A 4RBNA 5DS4A 3DD7A 4F4BA 3V7OA 3RH3A 1ST6A 2R7QA 4O7GA 3DM5A 2D5RB 3OEOA 3UR3C 1BR4A 1QLEC 1LS1A 1ZHZA 4YJWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W2W A; 
#chains in the Genus database with same CATH topology
 2UUH A;  2W45 A;  5L3Q A;  2YL3 A;  3M15 A;  3AOU A;  1KU2 A;  3U8P A;  3Q6N A;  3FHD A;  3MYF A;  1SMY F;  2Z15 A;  2G62 A;  3Q7G A;  4YL1 A;  5B3S C;  3B9Q A;  4XEK A;  1VYI A;  1TFO B;  1KTM A;  4KI2 A;  2QNL A;  3ECS A;  2FFH A;  3R2P A;  2P1A A;  3W2V A;  3PDM P;  1B68 A;  2J7P D;  3ASN C;  2XLW A;  2RD9 A;  5T3T A;  1TWH A;  1MMD A;  2AU5 A;  1ZZP A;  3NYL A;  3NDB B;  3LNR A;  2EIN C;  5DQT A;  4JTD B;  1XZP A;  1BBH A;  4CS9 C;  3DE9 A;  1L3P A;  1LM3 B;  1NU9 C;  4DRH B;  2FAP B;  3HTK C;  1QPU A;  2H8A A;  4CDY A;  3JSE O;  3AG3 C;  3NYJ A;  1J8M F;  3VAY A;  3DWW A;  2IOQ A;  3K1I C;  3U9M A;  4JJF A;  4DBR A;  3C8Z A;  1CGN A;  1UFB A;  4I1O B;  4DOZ A;  3HNK A;  2ETS A;  1FMW A;  1YYJ A;  4IAO A;  3TJ5 A;  4O6Y A;  3JRT A;  4YK5 A;  4IRU A;  1D1A A;  1EI7 A;  2HV7 A;  4J7T A;  4PFP A;  3VYW A;  1CGM E;  1WAS A;  2X0C A;  3JSZ A;  4WGZ A;  1DOV A;  1F1M A;  5D91 A;  5FCL A;  4J30 B;  2L9J A;  4EWC A;  4YT4 A;  3A11 A;  4BJT A;  1G4U S;  4OD5 A;  3B71 A;  1FAP B;  4E17 A;  4OIN F;  4G7O F;  4YWQ A;  4K1O A;  1WN0 A;  256B A;  2WVO A;  2Y3B A;  3KPH A;  4K7B A;  4N6H A;  4OIO F;  3PHF 2;  4XPX A;  3E70 C;  3H2V A;  3GAN A;  3GOD A;  3FXH A;  4YT5 A;  4CDV A;  4BJ6 C;  5JVE A;  1Z6A A;  1JAF A;  2IXN A;  2JX0 A;  1TKN A;  1SF8 A;  3IQT A;  1ORY A;  3GEE A;  2A1D D;  1A7E A;  3RF3 A;  5A6J A;  4MVO A;  3SXM A;  4AL0 A;  1Q0F A;  1UG7 A;  1MND A;  2DGJ A;  3HJC A;  2J7P A;  2IYL D;  2Q9B A;  2TMV P;  1QQ3 A;  2GDC A;  1NBB A;  2VCA A;  3CEX A;  3EZH A;  1ZU5 A;  4E18 A;  1HW1 A;  1PV3 A;  3U2L A;  1QZX A;  5KYW B;  1O5H A;  2EIL C;  3LEV A;  2EPM X;  2OEV A;  2AP3 A;  3ZQV A;  3QMK A;  2F22 A;  1OW6 A;  3DZA A;  1C03 A;  1BR2 A;  2YRF A;  2QE9 A;  3SP1 A;  1MMA A;  4AL1 A;  4DVZ A;  2KYH A;  2QLA A;  3QVZ A;  5L0H A;  1J8Y F;  1LI7 A;  1T5O A;  1VMA A;  2LFD A;  3ABL C;  3QW1 A;  4FES A;  3RKO F;  1YYX A;  1L7C A;  4JRZ A;  4U5G A;  4U5H A;  1K40 A;  4MVZ A;  4H54 A;  3LJB A;  3VRC A;  3G4Z A;  3C63 A;  2E87 A;  3S9O A;  2Y39 A;  3TOM A;  1K05 A;  2Q3T A;  2R7T A;  1K04 A;  2GAQ A;  2PFD A;  2YQY A;  3WHN A;  2M4E A;  2J45 A;  3EGD B;  3S90 A;  1GGQ A;  1C17 M;  1OR3 A;  3BRJ A;  1V74 B;  2KW3 C;  2OEX A;  1LI5 A;  1N1C A;  3F47 A;  3Q6M A;  4UDV A;  2DYS C;  2XM4 A;  3GWL A;  1OR2 A;  5A6B D;  2YEV A;  1YLM A;  2DYR C;  5F5H A;  3W2W A;  3UMI A;  3C8G D;  1RKC A;  3MYI A;  1PD0 A;  5EK0 A;  3EG9 A;  1KNY A;  2NPU A;  3EH1 A;  2A6E F;  3C7J A;  4B6I A;  2JD3 A;  1QVX A;  2LK4 A;  3TOL A;  3K1H A;  3N0T A;  3DAF A;  3KH2 A;  3KYI A;  4EIY A;  3NMJ A;  4PJJ A;  3R7C A;  1U89 A;  1I5N A;  1E85 A;  1LVK A;  2PX0 A;  3K6B A;  1NFN A;  4IB4 A;  1OCO C;  4KBL A;  4OIQ F;  2HZ8 A;  3M4B A;  4AE4 A;  4CS7 A;  4BJ5 C;  4LLC A;  2XXA B;  3TQO A;  4HFF B;  1T6I A;  1ZHW A;  3JYH A;  4YT2 A;  1D0Z A;  2BE5 F;  4G7Z F;  5AC4 A;  2W4B A;  4JEB A;  4N6C A;  3I5P A;  2WB7 A;  3I4U A;  1PD1 A;  2MWQ A;  2L6G A;  2LQG A;  3AG4 C;  3L8J A;  4X0R A;  1JPJ A;  3W8H A;  5JRA A;  3LNM B;  1ZHY A;  1CGO A;  3GWN A;  5KYY B;  3POV A;  2DI3 A;  4KNW A;  4XEF A;  2C03 A;  2XLO A;  2A68 F;  2XS1 A;  3EGX B;  3NMI A;  4G78 A;  5KYY A;  1U0B B;  3U3F A;  3GEH A;  1Q0G A;  4CSA C;  1V55 C;  2J0X A;  3IQC A;  1W2W A;  3ATP A;  4JTA B;  1DOW A;  3RVZ A;  5JS5 A;  1H9G A;  3H2U A;  2RSE B;  1H7I A;  2OJE D;  1Z5Z A;  4XEV A;  4BEJ A;  5A6B A;  3C8G B;  3MLG A;  1M56 C;  3DE8 A;  3EHN A;  3SXK A;  4O79 A;  5DLJ A;  4GYT A;  1Q0D A;  5A69 A;  2Q4F A;  4P6I C;  3CAX A;  2KSF A;  5E2Q A;  5BQH A;  5CIV A;  5COF A;  3QW0 A;  5JUA A;  3S28 A;  1FR0 A;  4Z9I A;  3ZQY A;  4NTA A;  4PJN A;  5JP7 A;  5L0G A;  2D4U A;  2WVN A;  2XSE A;  1A7V A;  4E0H A;  4NQF A;  4ONS A;  3ZWI A;  1JR8 A;  1OXK A;  3HNJ A;  3NMK A;  3GM2 A;  1RCP A;  2XLM A;  1YAU O;  4LER A;  2YWA A;  2H7V C;  3GM3 A;  2YLI A;  3HLZ A;  5E33 A;  3UGP A;  1LE4 A;  3C62 A;  1SZI A;  3WAQ A;  4XPW A;  2VC9 A;  4MW8 A;  1APC A;  1TWA A;  1M57 C;  3DMD A;  2OG2 A;  4JUR I;  1XWJ A;  1ZHX A;  2C04 A;  1FFT C;  4WAB A;  3VM6 A;  3OA1 A;  4MS2 A;  5L0D A;  4FX5 A;  1E84 A;  1D1C A;  5EGY A;  3H65 A;  2HKV A;  4ER9 A;  1Z3I X;  1TWG A;  3HNL A;  1OKK D;  3LLK A;  3NKD A;  4YL0 A;  1MNE A;  2H7O A;  2MHR A;  2YLG A;  3V5Y A;  1JPN A;  1JRA A;  4C3B A;  1YJG A;  1E2X A;  1FFH A;  1Z7Q c;  2AWC A;  1OXB A;  4ZLC A;  1NZE A;  1HW2 A;  3FOP A;  3GOR A;  4P9T A;  4CS8 A;  1OW7 A;  2Y3D A;  3X2Q C;  5B3I A;  4EBB A;  1Y6D A;  2BL2 A;  4G7H F;  2BC5 A;  2YL7 A;  3AG2 C;  2QY9 A;  3KMI A;  2GWW A;  2YVK A;  3AG1 C;  4HFK B;  4JC7 A;  4NTB A;  1ORJ A;  3LS0 A;  4FAP B;  1V54 C;  4JZA A;  5D92 A;  1I4Y A;  3CSK A;  4MTO A;  3AGU A;  3MX3 A;  4W8P A;  3US6 A;  3LLI A;  5T1D B;  3VF0 A;  2EIM C;  2PF4 E;  3S27 A;  1ZW2 A;  5L0C A;  4MVU A;  3ASO C;  3ZC4 A;  4CJO A;  2EPO A;  5KYW A;  2P6V A;  2G3K A;  2ZXO A;  2XRH A;  1TR2 A;  1EKY A;  5JSL A;  1LS4 A;  1RKE B;  2IXM A;  1HE9 A;  3N24 A;  5DQZ A;  3DM9 B;  2CCY A;  2NG1 A;  5KYN A;  1RKE A;  2NSG A;  3SZR A;  3L8I A;  1WWP A;  2ICW G;  1YA7 O;  3RQG A;  2J46 A;  5BQI A;  2IBF A;  4KNV A;  1A0B A;  4JCH A;  3JZ0 A;  4IWB A;  3DAG A;  2PNO A;  1VLS A;  1ORS C;  1IW7 F;  3IHU A;  2MYS A;  3B29 A;  1OQC A;  4BG0 A;  4GEH A;  2VAS A;  3M1C B;  2ZD9 A;  4C7O B;  4Z9H A;  1GQA A;  4CS9 A;  4C7O A;  4Q5S F;  4XPY A;  3RQF A;  2L81 A;  2EPK X;  3K7D A;  1C02 A;  1OKK A;  2GA0 A;  4KC9 A;  2Q00 A;  1Z23 A;  5A6K A;  2VCC A;  2IXO A;  2OU6 A;  2OJQ A;  2LP4 A;  2QTV A;  3EGD A;  2J0W A;  5DS5 A;  2OKU A;  3K1I A;  4J32 B;  3S29 A;  4YT8 A;  2HMZ A;  4NY3 A;  2CNW D;  1E83 A;  3T6G B;  4D4N A;  3RQE A;  4IJJ A;  4O6M A;  2R7S A;  2XS8 A;  2EPL X;  1R5I D;  2HJ3 A;  3ZSU A;  3O55 A;  3G50 A;  4XLN F;  1E86 A;  1VK5 A;  2VH3 A;  3MBG A;  2JPU A;  3JTL O;  2DB4 A;  3PMR A;  4YL3 A;  1RXQ A;  3SNH A;  1M2V B;  2V26 A;  4MVR A;  4ULV A;  1A7D A;  1M2V A;  3ABM C;  3EPV A;  2HUJ A;  4DVY P;  4MTG A;  3HNI A;  3ZVR A;  1LPE A;  3DJN B;  4NC3 A;  3F46 A;  4NTF A;  1BDJ B;  3K66 A;  4L6R A;  4LDK A;  5B1B C;  1WOL A;  3JYY A;  5E3C A;  3V5Z A;  3QVY A;  5COM A;  2B0J A;  3FMS A;  4BJ6 A;  1D0X A;  1LE2 A;  3AQC A;  2XXA A;  4JIO A;  4O6N A;  3T4R A;  2CW0 F;  4IAR A;  2PBE A;  3KL4 A;  4E0I A;  1Q0M A;  4M63 A;  4CX9 A;  4PJM A;  5BQG A;  4U5E E;  3RFY A;  4XQ1 A;  2YL1 A;  3T9O A;  4ZLD A;  1GS9 A;  2YKZ A;  4N06 A;  5B1A C;  3U3B A;  1ZYR F;  3TD7 A;  1H9T A;  2IXP A;  3NRH A;  3SEO A;  3UNG C;  2J9B A;  2P7V A;  4MQ9 F;  1HE1 A;  4DBQ A;  2FGY A;  4JEA A;  4WGY A;  3ITF A;  4PR9 A;  3EGX A;  2KJG A;  2AWY A;  2R7X A;  3ZTM A;  4RD9 A;  1NFO A;  5GPG B;  4DRJ B;  3V5X A;  3OWT A;  2Y69 C;  1T9K A;  2CNW A;  4CJG A;  1YZA A;  2PX3 A;  2HSB A;  2ASR A;  2W9Y A;  3C8G A;  4DJ9 A;  4EBJ A;  3KYJ A;  1MMG A;  1O87 A;  1G5Z A;  3KKB A;  3LAY A;  4WJ0 A;  4XWJ A;  3TJ6 A;  5AGF A;  2XLV A;  1NSG B;  2HV6 A;  2ZXP A;  5KYU B;  3Q7L A;  2B0H A;  1GM5 A;  2R7V A;  5KYU A;  4OIR F;  1ZU4 A;  1OCR C;  3AQB A;  1R4T A;  1AEP A;  2A0U A;  2XL4 A;  2ZPA A;  2ZXR A;  3O6X A;  4E7Z A;  3T6B A;  1H6G A;  4D4X A;  3EJN A;  3B0V C;  2YL0 A;  1LKX A;  2WZF A;  4XTK A;  5T3W A;  1RMV A;  2HFI A;  2R9R B;  1T6Q A;  2A0B A;  3U8V A;  4AK9 A;  4ANJ A;  3EQL F;  1VTM P;  4U5D E;  4MVM A;  3T6J A;  3ZDL A;  1U6H A;  3EZI A;  2A6H F;  5FZT A;  1TQG A;  5TJ5 E;  4CDA A;  4J7Y A;  1RJ9 B;  5A6A A;  1WAT A;  2LIG A;  4U5B E;  1RJ9 A;  4IGG A;  2J9U A;  3PCV A;  4GQH A;  4JCZ A;  4Z9J A;  5L0J A;  1CPQ A;  2R02 A;  4EKW A;  1BR1 A;  3FOO A;  2J8W A;  4PJL A;  5AC5 A;  4BJ5 A;  4QI2 A;  3L1M A;  3M4C A;  4P9F A;  3W4Y A;  3A9C A;  4MW3 A;  2KK1 A;  2R7R A;  1ZVZ A;  1ZW3 A;  2YHS A;  2KC3 A;  3UMH A;  1VYK A;  2XLE A;  2XLH A;  1LIH A;  3EFO B;  4NCQ A;  3RIP A;  2CGE A;  4C3D A;  3EFO A;  3IPM O;  4K0D A;  1Q0K A;  1YDI A;  3L34 A;  3W8I A;  4Q4Z F;  4RDA A;  5L3V A;  4OIP F;  1TWC A;  2H7B A;  3QZC A;  2Q9A A;  4A4A A;  1G4W R;  5E3A A;  4E7S A;  5DS6 A;  4I1M A;  1Z63 A;  2L6F A;  3O10 A;  2WL8 A;  3C18 A;  4I44 A;  4JVS A;  1G8X A;  1NU7 D;  2Y3G A;  4W8K A;  4YN0 B;  4BJ1 A;  2R7U A;  4JJG A;  3FAJ A;  4C3E A;  3ABK C;  3UGO A;  4CSA A;  4OD4 A;  2L7A A;  2QUP A;  4R32 A;  1MMN A;  4PK4 A;  4EBK A;  2NUT B;  4MND A;  4AX2 A;  3WG7 C;  2NUT A;  1AUE A;  4U5C E;  4BPM A;  2R7W A;  2GFH A;  2NSF A;  3LEO A;  3N2Z B;  4MVQ A;  3LS1 A;  2NUP B;  4JTC B;  1SR2 A;  1XZQ A;  2P61 A;  2NUP A;  1EA8 A;  2XM0 A;  2HJM A;  3CQZ A;  3GM1 A;  3UMK A;  3ZTZ A;  4LAC B;  5KYX B;  3ZG1 A;  2Q9C A;  1VLT A;  2R03 A;  5KYX A;  2OCC C;  4JKV A;  1CPR A;  2KQ9 A;  2ZXW C;  3CZ6 A;  3JRM O;  1FNT c;  4U9D A;  3ZIB A;  3DXJ F;  2W4M A;  3S84 A;  3FVY A;  3S0X A;  3U2M A;  3EH2 A;  5DVW A;  1JMW A;  3TK0 A;  5K0I A;  4PAC A;  1OCC C;  2EPN A;  2OOC A;  2IM8 A;  1WGW A;  1IZM A;  2KNH A;  3O39 A;  1JOG A;  4H4K C;  1A41 A;  3K33 A;  4I3M A;  2AVK A;  1YVI A;  2J9W A;  2PP4 A;  1MQV A;  4HE8 D;  1OCZ C;  3U9J A;  3NKE A;  4JW1 A;  1D1B A;  1FMV A;  2XL6 A;  3DI5 A;  1S7Z A;  3NYM A;  4CIH A;  1FTS A;  5CI9 A;  1EQ1 A;  3TUL A;  1YA9 A;  4U9E A;  3J06 A;  3E9V A;  1D0Y A;  3NG1 A;  2OQM A;  3LUT B;  2WVQ A;  4Q7C A;  3B0U X;  3HKK A;  4N4W A;  1NLX A;  2O9X A;  1PCX A;  5COG A;  3BEH A;  4LDQ A;  3U0C A;  3JCU Q;  4A2N B;  1HMD A;  1NG1 A;  1M6T A;  2R25 A;  2Q7R A;  4QI0 A;  4PFO A;  1TFK B;  4CIP A;  3DKA A;  4EUK B;  3X1O A;  1YZC A;  2LSE A;  4QDL A;  1ZHT A;  1M2O A;  2KGO A;  3I5Q A;  1O3U A;  3M79 A;  1HMO A;  1V4A A;  2VB6 A;  5CI8 A;  4BEM J;  3L0I A;  2UUI A;  2P0N A;  1I4Z A;  2HS5 A;  2I8B A;  3EG9 B;  3U5S A;  4XLP F;  3QTH A;  5BUO A;  2V3C C;  3SXZ A;  2LCH A;  4U5F E;  2X51 A;  3RW0 A;  2EIJ C;  4LLE A;  1VB5 A;  1AVO B;  1T6U A;  2R7O A;  2Y3H A;  3EHM A;  3G4X A;  4FWV A;  5F28 E;  3IEE A;  4G0H A;  2HMQ A;  3AJM A;  5L0F A;  1WTY A;  1QKR A;  4DRI B;  4EHP A;  2J9V A;  3DJU B;  4CBE A;  3RVY A;  3B0P A;  3WOD F;  2G3V A;  2WZL A;  2CDQ A;  1QSP A;  2LD6 A;  3SYN A;  2XL8 A;  2YZS A;  4AE4 B;  5F5F A;  2M64 A;  2LFF A;  4HEA J;  3RYL A;  1VOM A;  4MVS A;  3LES A;  2EIK C;  5EHH A;  5HV9 A;  5JT4 A;  5IY5 C;  5HSW A;  2L6H A;  3SXY A;  2WZG A;  1YAR O;  3FAP B;  4IAQ A;  4JE9 A;  4ULW A;  5JLI A;  1Y4C A;  2HSQ A;  3AGT A;  2A69 F;  3FDQ A;  4CS8 C;  4LDR A;  3JT1 A;  3MFN A;  4RBN A;  4YJW A;  5DS4 A;  5L0I A;  2CYD A;  3IQ5 A;  2YLD A;  4DXW A;  3DD7 A;  4F4B A;  2I15 A;  3V7O A;  3RH3 A;  1ST6 A;  2VCB A;  1SYQ A;  2R7Q A;  4O7G A;  1HY5 A;  3DM5 A;  1S05 A;  2D5R B;  3OEO A;  3UR3 C;  1BR4 A;  1QLE C;  1T01 A;  1BZ4 A;  1LS1 A;  1ZHZ A;  3GEI A;  4MTF A;  1OW8 A;  2XLD A;  3IQ6 A;  2R05 A; 
#chains in the Genus database with same CATH homology
 2W45 A;  5L3Q A;  1KU2 A;  3Q6N A;  3FHD A;  1SMY F;  2Z15 A;  2G62 A;  3Q7G A;  5B3S C;  3B9Q A;  1VYI A;  3ECS A;  2FFH A;  3W2V A;  2J7P D;  3ASN C;  5T3T A;  1TWH A;  1MMD A;  3NYL A;  3NDB B;  3LNR A;  2EIN C;  5DQT A;  4CS9 C;  1NU9 C;  3HTK C;  3AG3 C;  3NYJ A;  1J8M F;  3VAY A;  2IOQ A;  3K1I C;  4JJF A;  4DBR A;  4DOZ A;  4I1O B;  1FMW A;  4IAO A;  4O6Y A;  3JRT A;  4IRU A;  1D1A A;  2HV7 A;  4PFP A;  3VYW A;  5FCL A;  3JSZ A;  5D91 A;  4J30 B;  2L9J A;  4EWC A;  4YT4 A;  4BJT A;  4OD5 A;  4OIN F;  4G7O F;  4YWQ A;  2WVO A;  2Y3B A;  4K7B A;  4OIO F;  3PHF 2;  3E70 C;  3GAN A;  3GOD A;  4YT5 A;  4BJ6 C;  1Z6A A;  2IXN A;  1TKN A;  1SF8 A;  2A1D D;  1MND A;  2DGJ A;  3HJC A;  2J7P A;  2IYL D;  2Q9B A;  3EZH A;  1ZU5 A;  5KYW B;  1QZX A;  1O5H A;  2EIL C;  3LEV A;  3QMK A;  3DZA A;  1BR2 A;  3SP1 A;  1MMA A;  4DVZ A;  1J8Y F;  1VMA A;  3ABL C;  4FES A;  3RKO F;  4U5G A;  4U5H A;  3LJB A;  2E87 A;  2Y39 A;  2Q3T A;  2R7T A;  2PFD A;  2M4E A;  2J45 A;  3EGD B;  2KW3 C;  3F47 A;  3Q6M A;  1N1C A;  2DYS C;  2YEV A;  5F5H A;  2DYR C;  3W2W A;  3UMI A;  1PD0 A;  3EG9 A;  3EH1 A;  2A6E F;  4B6I A;  2JD3 A;  3K1H A;  3N0T A;  3DAF A;  3KH2 A;  4PJJ A;  1LVK A;  2PX0 A;  3K6B A;  4KBL A;  4OIQ F;  1OCO C;  4AE4 A;  4CS7 A;  4BJ5 C;  4LLC A;  2XXA B;  4HFF B;  1ZHW A;  3JYH A;  4YT2 A;  1D0Z A;  2BE5 F;  4G7Z F;  2W4B A;  3I5P A;  2WB7 A;  3I4U A;  1PD1 A;  2MWQ A;  3AG4 C;  4X0R A;  1JPJ A;  3W8H A;  1ZHY A;  5KYY B;  3POV A;  4KNW A;  2C03 A;  3EGX B;  2A68 F;  5KYY A;  4CSA C;  1V55 C;  2J0X A;  1W2W A;  1Z5Z A;  4BEJ A;  3MLG A;  1M56 C;  3EHN A;  4O79 A;  5DLJ A;  4GYT A;  4P6I C;  5E2Q A;  3S28 A;  4PJN A;  2WVN A;  2XSE A;  4LER A;  2H7V C;  5E33 A;  3HLZ A;  3UGP A;  1SZI A;  1TWA A;  1M57 C;  3DMD A;  2OG2 A;  4JUR I;  1ZHX A;  2C04 A;  1FFT C;  3OA1 A;  4FX5 A;  1D1C A;  5EGY A;  3H65 A;  1Z3I X;  1TWG A;  3LLK A;  1OKK D;  3NKD A;  1MNE A;  2H7O A;  4C3B A;  1JPN A;  1FFH A;  4ZLC A;  1NZE A;  4CS8 A;  2Y3D A;  3X2Q C;  4EBB A;  4G7H F;  3KMI A;  3AG2 C;  2QY9 A;  3AG1 C;  4HFK B;  3LS0 A;  1V54 C;  4JZA A;  5D92 A;  3CSK A;  3MX3 A;  3LLI A;  5T1D B;  2EIM C;  2PF4 E;  3S27 A;  3ASO C;  3ZC4 A;  5KYW A;  2P6V A;  2G3K A;  2ZXO A;  2XRH A;  1TR2 A;  2IXM A;  3N24 A;  5DQZ A;  3DM9 B;  2NG1 A;  5KYN A;  3SZR A;  2J46 A;  4KNV A;  4JCH A;  4IWB A;  3DAG A;  4BG0 A;  1IW7 F;  2MYS A;  4GEH A;  2VAS A;  3M1C B;  4C7O B;  4CS9 A;  4C7O A;  4Q5S F;  2L81 A;  4KC9 A;  3K7D A;  1OKK A;  1Z23 A;  2IXO A;  3EGD A;  2QTV A;  5DS5 A;  2J0W A;  4J32 B;  3S29 A;  4YT8 A;  4NY3 A;  2CNW D;  4IJJ A;  4O6M A;  2R7S A;  3ZSU A;  4XLN F;  1VK5 A;  2VH3 A;  3PMR A;  3SNH A;  1M2V B;  2V26 A;  1M2V A;  3ABM C;  3EPV A;  4DVY P;  3ZVR A;  3DJN B;  3F46 A;  5B1B C;  3K66 A;  5E3C A;  2B0J A;  4BJ6 A;  1D0X A;  3AQC A;  2XXA A;  4O6N A;  3T4R A;  2CW0 F;  3KL4 A;  4M63 A;  4PJM A;  4U5E E;  3RFY A;  4ZLD A;  4N06 A;  5B1A C;  1ZYR F;  3TD7 A;  2IXP A;  3NRH A;  3SEO A;  3UNG C;  2P7V A;  4MQ9 F;  4DBQ A;  2FGY A;  3ITF A;  3EGX A;  2KJG A;  2R7X A;  4RD9 A;  3OWT A;  2Y69 C;  2CNW A;  2PX3 A;  2W9Y A;  1MMG A;  1O87 A;  3LAY A;  3KKB A;  4WJ0 A;  4XWJ A;  2ZXP A;  2HV6 A;  5KYU B;  3Q7L A;  2R7V A;  5KYU A;  4OIR F;  1ZU4 A;  1OCR C;  3AQB A;  2XL4 A;  2ZPA A;  2ZXR A;  3B0V C;  4E7Z A;  3O6X A;  3T6B A;  3EJN A;  1LKX A;  2WZF A;  4XTK A;  5T3W A;  4AK9 A;  4ANJ A;  3EQL F;  4U5D E;  3T6J A;  3EZI A;  2A6H F;  1RJ9 B;  4U5B E;  1RJ9 A;  2J9U A;  1BR1 A;  4PJL A;  4BJ5 A;  4QI2 A;  2R7R A;  2YHS A;  3UMH A;  1VYK A;  3EFO B;  4C3D A;  3RIP A;  2CGE A;  3EFO A;  4K0D A;  3L34 A;  3W8I A;  4Q4Z F;  4RDA A;  5L3V A;  4OIP F;  1TWC A;  2H7B A;  3QZC A;  2Q9A A;  5E3A A;  4E7S A;  5DS6 A;  4I1M A;  1Z63 A;  4W8K A;  2WL8 A;  4JVS A;  4I44 A;  1G8X A;  1NU7 D;  2Y3G A;  4BJ1 A;  4YN0 B;  2R7U A;  4JJG A;  3FAJ A;  4C3E A;  3ABK C;  3UGO A;  4CSA A;  4OD4 A;  1MMN A;  4PK4 A;  2NUT B;  4MND A;  4AX2 A;  3WG7 C;  2NUT A;  4U5C E;  2R7W A;  2GFH A;  3N2Z B;  3LS1 A;  2NUP B;  2NUP A;  3UMK A;  3CQZ A;  5KYX B;  4LAC B;  3ZG1 A;  2Q9C A;  5KYX A;  2OCC C;  2KQ9 A;  2ZXW C;  3CZ6 A;  3ZIB A;  3DXJ F;  2W4M A;  3FVY A;  3S0X A;  3EH2 A;  5DVW A;  4KI2 A;  1OCC C;  2KNH A;  1WGW A;  1IZM A;  4H4K C;  3O39 A;  3K33 A;  4I3M A;  2PP4 A;  2J9W A;  4HE8 D;  1OCZ C;  3NKE A;  4JW1 A;  1FMV A;  1D1B A;  1S7Z A;  3NYM A;  4CIH A;  1FTS A;  5CI9 A;  3E9V A;  1D0Y A;  3NG1 A;  4Q7C A;  2WVQ A;  3B0U X;  2O9X A;  1PCX A;  3JCU Q;  4A2N B;  1NG1 A;  4QI0 A;  4PFO A;  3X1O A;  2LSE A;  4QDL A;  1ZHT A;  1M2O A;  2KGO A;  3I5Q A;  5CI8 A;  2VB6 A;  3L0I A;  2I8B A;  3EG9 B;  4XLP F;  5BUO A;  2V3C C;  4U5F E;  2X51 A;  2EIJ C;  4LLE A;  2R7O A;  3EHM A;  2Y3H A;  4FWV A;  3IEE A;  4G0H A;  2J9V A;  3DJU B;  4CBE A;  3B0P A;  3WOD F;  2G3V A;  2WZL A;  2CDQ A;  3SYN A;  5F5F A;  2YZS A;  4AE4 B;  4HEA J;  3RYL A;  5EHH A;  1VOM A;  3LES A;  2EIK C;  5HSW A;  5IY5 C;  2WZG A;  4ULW A;  3FDQ A;  2A69 F;  4CS8 C;  3JT1 A;  4RBN A;  5DS4 A;  3DD7 A;  4F4B A;  3V7O A;  3RH3 A;  1ST6 A;  2R7Q A;  4O7G A;  3DM5 A;  2D5R B;  3OEO A;  3UR3 C;  1BR4 A;  1QLE C;  1LS1 A;  1ZHZ A;  4YJW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...