1W2WA

Crystal structure of yeast ypr118w, a methylthioribose-1-phosphate isomerase related to regulatory eif2b subunits
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
211
structure length
211
Chain Sequence
MSLEAIVFDRSEPENVSVKVLDQLLLPYTTKYVPIHTIDDGYSVIKSMQVRGAPAIAIVGSLSVLTEVQLIKHNPTSDVATLYSLVNWESTKTVLNKRLDFLLSSRPTAVNLSNSLVEIKNILKSSSDLKAFDGSLYNYVCELIDEDLANNMKMGDNGAKYLIDVLQKDGFKDEFAVLTICNTGSLATSGYGTALGVIRSLWKDSLAKTDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5-METHYLTHIORIBOSE-1-PHOSPHATE ISOMERASE
publication title Crystal Structure of Yeast Ypr118W, a Methylthioribose-1-Phosphate Isomerase Related to Regulatory Eif2B Subunits
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Isomerase
total genus 76
structure length 211
sequence length 211
chains with identical sequence E, I, M
ec nomenclature ec 5.3.1.23: S-methyl-5-thioribose-1-phosphate isomerase.
pdb deposition date 2004-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1840 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1w2wA00
1W2WA
chains in the Genus database with same CATH superfamily
2I8BA 1EI7A 2OOCA 2LIGA 4OIOF 1BDJB 1VLTA 3NKEA 3VM6A 4DOZA 4JCZA 3X1OA 2P1AA 3RVZA 1Z63A 3K66A 1VK5A 2XL4A 3I5QA 4EKWA 3GWNA 1GM5A 3A9CA 5A6JA 3H65A 1H6GA 3U8PA 5B1BC 2VCBA 3HLZA 1OKKD 2Y3GA 3LNRA 4JJGA 3X2QC 1RKEB 1KNYA 2L7AA 4MVOA 3M4CA 2KW3C 5B1AC 3LS1A 2Y3BA 4C7OB 4LDKA 4D4XA 3AG3C 3OWTA 4W8PA 3EFOA 3L8IA 1Z5ZA 1T5OA 1YA7O 2AWCA 3SNHA 1OCRC 4IWBA 3UMKA 3O55A 2J0XA 4CX9A 4MVRA 3M4BA 4LLCA 5T3TA 5T3WA 5A6AA 2LD6A 5L0FA 1KU2A 2OCCC 4JEAA 1YAUO 2W4MA 3SXKA 1Q0GA 2YHSA 4MTFA 3T9OA 1VB5A 2WVNA 1AVOB 4NTFA 1ZHWA 3RQFA 4XLNF 5CIVA 4XLPF 3JT1A 4KNWA 3U9JA 1YARO 3KKBA 4U5DE 2VH3A 4JKVA 1LIHA 4PJLA 2R7UA 4NQFA 1YYXA 1VLSA 4PJMA 2XLWA 4YK5A 5TJ5E 2EPMX 1EKYA 3L1MA 1HE9A 2XM0A 3LJBA 1TQGA 4MW3A 3LEOA 1CPQA 3I5PA 4G0HA 2AU5A 2R05A 3HNJA 2QUPA 3MYFA 1SR2A 2HZ8A 3DI5A 3DWWA 2CCYA 3K33A 3K1IA 2Q9AA 3FAJA 4MVZA 4N06A 5E3CA 5JP7A 2YLIA 3H2VA 1GQAA 1K40A 2NUTA 4AL1A 5JT4A 2W9YA 1GS9A 4O6MA 1YA9A 3CZ6A 4Z9JA 4YJWA 3SEOA 3G4ZA 1FMVA 2QTVA 2UUIA 1WGWA 1D1CA 4YT4A 3G4XA 1MQVA 3AGTA 3GEHA 4KBLA 1MNEA 3KPHA 3NRHA 4YL1A 3TOLA 2YL1A 1RKCA 1N1CA 4IARA 3U8VA 3S90A 2IXMA 5E3AA 2DB4A 2DI3A 2IXNA 5DS6A 2EPKX 2Y3DA 4IGGA 4CS9A 3ZDLA 3EG9B 2R7SA 1R4TA 2W4BA 4KNVA 2L81A 2EILC 4MS2A 3TK0A 3B0VC 3ZSUA 2OQMA 2J0WA 1FAPB 2KNHA 2LCHA 2MYSA 2VC9A 1JRAA 1Y6DA 3U2LA 1TWAA 2XLDA 2H7OA 1QZXA 2HUJA 2M64A 3S29A 1OR3A 5IY5C 4DRIB 4KC9A 1JR8A 2OU6A 1NZEA 1SZIA 2XL6A 4K1OA 3RIPA 3DAFA 1ZW2A 4BJ5C 2A69F 1YVIA 3L34A 1RMVA 1MMDA 4RBNA 5KYXB 5HSWA 1JPNA 1RJ9A 2NUPA 4BG0A 1U89A 4BEJA 3HNKA 3G50A 4E7SA 3ZQVA 1Q0FA 3C7JA 3DM5A 3ITFA 2R7VA 3UGOA 3T6GB 3CQZA 3EZIA 2A0BA 4P9FA 2XS1A 4NTAA 2HV7A 2PNOA 1D0ZA 2P0NA 3Q6NA 4MTOA 2IYLD 4JC7A 4DVZA 3RF3A 2Y69C 4N4WA 5L3QA 2CGEA 1V4AA 2YWAA 4DBQA 2OJQA 1EQ1A 1LS1A 3BEHA 3N0TA 5F5HA 3LS0A 3U3BA 2YL3A 3L0IA 4DRJB 3NYJA 1E84A 2OKUA 1C17M 4X0RA 5DQTA 4DBRA 3MBGA 4JURI 4FESA 4HEAJ 2G3KA 1CGME 1YLMA 4XPWA 1JOGA 1Y4CA 2HJMA 3EFOB 1YJGA 2J45A 3WHNA 4OIPF 2VCAA 4FWVA 4JJFA 3ZC4A 4J7YA 5L0GA 1LI7A 2KQ9A 5L3VA 1WTYA 4UDVA 3R2PA 3RW0A 4AK9A 5BQGA 4GYTA 4M63A 2G3VA 4XWJA 3V5XA 4BJ6A 2HS5A 2QY9A 4EBJA 1Q0DA 2XLVA 3FDQA 3KYJA 4W8KA 3Q6MA 5KYYA 3GM2A 4AE4A 1ORSC 3QVZA 1OXBA 3IEEA 1OQCA 3QTHA 2YZSA 4MVSA 3RFYA 1TKNA 4CBEA 4LERA 2KC3A 3U9MA 1VMAA 1VTMP 2WVQA 2PFDA 3KL4A 3S84A 3BRJA 1TFKB 4DJ9A 4MVUA 2YLGA 1YZCA 2GDCA 1TR2A 2MWQA 4NC3A 3V7OA 4BJ1A 5B3SC 3MFNA 5EGYA 4JEBA 1F1MA 2TMVP 4LACB 2HSQA 5B3IA 1PD1A 2H8AA 3ZG1A 1YYJA 3A11A 1VOMA 1ZHZA 3AOUA 3LLIA 4LLEA 1FMWA 1OR2A 2L9JA 3JZ0A 3WAQA 3FMSA 4CS8C 2Q3TA 4E0HA 2W45A 3LESA 2NUTB 1WOLA 1BR1A 1WN0A 2ICWG 1NSGB 4MNDA 1H9GA 1ORJA 3C8ZA 1OCOC 2NPUA 4O6YA 2CDQA 2KSFA 2R7WA 4QI0A 3OEOA 4FX5A 2EINC 4XPYA 1GGQA 1ZHTA 3UMIA 3NMKA 1T6IA 1E83A 3W8HA 2BE5F 3E9VA 3GEIA 1AUEA 2CNWD 4L6RA 4WGYA 5GPGB 2IBFA 3EZHA 3O39A 3W4YA 4EHPA 2RD9A 1HY5A 4YT5A 5JVEA 1JPJA 3DMDA 3B29A 1TWHA 3IQ6A 2C04A 4H4KC 4O6NA 4JTDB 4G7HF 3DAGA 1UFBA 1J8YF 3AG2C 2A6EF 5A6KA 2Q00A 5BUOA 5L0IA 3PMRA 1D1AA 2RSEB 1QVXA 1MMGA 2A1DD 2HV6A 3B71A 3KYIA 4GEHA 4JZAA 1WATA 2J46A 2GWWA 1CGNA 4P9TA 5JSLA 1VYKA 4YL3A 4Q4ZF 3FOOA 1A7VA 1RJ9B 2NUPB 3W2VA 4B6IA 3NKDA 1HMOA 1O87A 2AWYA 3GODA 3CSKA 3EH2A 5CI9A 5EK0A 3B0UX 4OIQF 1QLEC 2QNLA 3HTKC 1I4YA 1M2OA 3H2UA 2YLDA 2B0JA 2L6HA 3LAYA 2UUHA 2LSEA 4ULVA 2PBEA 4XEFA 4EIYA 4G7ZF 3U3FA 1U0BB 5JRAA 4PK4A 3ASOC 3JCUQ 3NMJA 1ZW3A 4WABA 4I3MA 4MQ9F 2R7XA 3EPVA 4CSAC 4YT8A 2KJGA 1J8MF 5E2QA 2YRFA 3L8JA 1CPRA 1QKRA 4JW1A 1L7CA 2J9WA 2Y3HA 4C3EA 2ASRA 2KGOA 3EGXA 4K0DA 3OA1A 3JSZA 4XEVA 3RQEA 1WASA 4H54A 3KH2A 1VYIA 2HKVA 3N2ZB 4PACA 4KI2A 1ZHXA 2J7PD 4O79A 4U5GA 5T1DB 3DKAA 1PCXA 1M6TA 4OINF 5A69A 2HFIA 1V54C 1ST6A 3QW0A 4HFFB 2EIMC 3C8GD 2A6HF 5COMA 4PJNA 5E33A 5A6BD 3C62A 4Z9HA 5F28E 1K04A 1OKKA 5KYYB 1A0BA 2IXPA 3M79A 4AE4B 2LK4A 4J30B 4C3BA 3S28A 2Z15A 1FFHA 1G5ZA 1PV3A 2GFHA 2OEXA 4HE8D 3RVYA 1V55C 5F5FA 4WGZA 2ZD9A 2ZXWC 4CS7A 2WL8A 3JYYA 4QDLA 2DYSC 4OIRF 5AC4A 2ZXOA 5JS5A 3JRTA 1APCA 2DGJA 3F46A 1EA8A 1PD0A 1FR0A 3AJMA 4O7GA 3ZWIA 1YZAA 3Q7LA 4JCHA 3DXJF 2PX3A 4JTCB 1A7DA 3PHF2 2YVKA 4JIOA 3M15A 4D4NA 4AX2A 1H9TA 1JAFA 1LE2A 1LI5A 2WB7A 4IB4A 4CJGA 3EHNA 3N24A 3DJNB 1HMDA 1OW8A 4MTGA 3NYMA 3QVYA 4E17A 3GM1A 3W2WA 2R25A 1FFTC 3SXMA 4Q5SF 4OD5A 2AP3A 1ZU5A 2P7VA 1HW2A 4EWCA 2HJ3A 4XQ1A 4LDRA 3HKKA 1D1BA 3ABKC 2GA0A 1HE1A 3GWLA 3LNMB 1M57C 1B68A 2J8WA 2WZGA 1LS4A 1T9KA 2XLMA 4U5BE 3FVYA 3RYLA 2A0UA 4MVQA 4P6IC 4ER9A 3NG1A 4DVYP 4F4BA 1LM3B 1O5HA 2R02A 1E2XA 1QPUA 4IRUA 3B0PA 2O9XA 2QE9A 3DE8A 3UGPA 4CIHA 1DOWA 2LFFA 2EIKC 2M4EA 1C02A 1MMAA 2ETSA 1OCCC 1H7IA 2P61A 3EGDA 4HFKB 4E7ZA 2XXAA 3RQGA 5DS5A 1I4ZA 1SMYF 3HJCA 1TWGA 3IQCA 3W8IA 1K05A 1T6QA 3O6XA 4PR9A 1YDIA 1D0YA 3GEEA 1Z23A 2IM8A 4YT2A 1T01A 1U6HA 2JPUA 2JX0A 2Q7RA 5KYUA 4BJ5A 5D92A 1ZYRF 2J9BA 3DM9B 1ORYA 5KYWA 3C8GA 4IJJA 5A6BA 5L0HA 3K1IC 3IPMO 4U5EE 2D5RB 1OW6A 3VYWA 1NLXA 3US6A 4ZLCA 3ZTMA 2XRHA 4N6CA 2D4UA 3T6BA 4G78A 5L0DA 1M56C 4Z9IA 4FAPB 3PCVA 3CAXA 3VRCA 1NU9C 3GANA 5JLIA 3EGXB 5HV9A 4JVSA 5COGA 3GM3A 4U5HA 2F22A 2C03A 3VF0A 4CS9C 4EBBA 2Q4FA 3MYIA 5COFA 2HMZA 4RDAA 1NU7D 4RD9A 2VB6A 2JD3A 1OXKA 3S27A 3NYLA 4A4AA 5DS4A 1XZQA 3B9QA 2XS8A 4NCQA 5DQZA 1LE4A 2R7RA 1XWJA 2J9UA 3FOPA 2OG2A 1W2WA 2KK1A 5D91A 2LP4A 3EQLF 1TWCA 4PFOA 3RH3A 3TQOA 1TFOB 1M2VA 1OCZC 3EJNA 3J06A 1Z6AA 3MX3A 4XEKA 1LKXA 1FTSA 2R7TA 2PP4A 4PFPA 2NG1A 3NDBB 1RCPA 3HNIA 3U2MA 2L6GA 3U5SA 2XSEA 4CJOA 3SZRA 1HW1A 4DRHB 4I1OB 1R5ID 1G8XA 4U5FE 1C03A 3ZVRA 1XZPA 5AC5A 5EHHA 1G4US 2A68F 3KMIA 3POVA 2VCCA 2YL0A 3HNLA 1V74B 2XL8A 1Q0MA 3LEVA 4CDAA 2X0CA 3WODF 5BQIA 2Q9BA 1JMWA 5CI8A 256BA 4NY3A 3TD7A 1FNTc 3I4UA 4XPXA 3ABMC 5BQHA 2WVOA 2DYRC 3DZAA 2YKZA 2Y39A 1NG1A 4EBKA 4CDVA 2FFHA 3FXHA 2XLHA 1RKEA 4Q7CA 1ZVZA 3JTLO 3DE9A 2EPOA 4U5CE 4ULWA 4CDYA 4CS8A 4I44A 4C7OA 2PF4E 3UMHA 5L0JA 1A41A 2IOQA 3DD7A 3AG4C 4EUKB 5FZTA 3E70C 4BJ6C 1S7ZA 4E0IA 2G62A 2E87A 1NFOA 3C63A 3NMIA 4JRZA 1RXQA 2X51A 2XM4A 3EH1A 2FAPB 4OD4A 1MMNA 3AQCA 3R7CA 5K0IA 4E18A 2XLEA 1UG7A 4QI2A 3V5YA 2B0HA 3DJUB 4MVMA 1Z7Qc 1QSPA 2XLOA 2ZPAA 3ABLC 4GQHA 4A2NB 2XXAB 2YL7A 3EGDB 3JRMO 4C3DA 2R7QA 2BC5A 3LLKA 3ECSA 3LUTB 4J32B 3GORA 4BPMA 2P6VA 3UR3C 1A7EA 2GAQA 2ZXPA 2CNWA 4JE9A 5AGFA 3T6JA 3AQBA 3JSEO 2HSBA 2J9VA 2V3CC 3RKOF 3VAYA 1Q0KA 5FCLA 1MNDA 1LPEA 1DOVA 2LFDA 2NSGA 2R9RB 2R03A 4U9EA 4XTKA 4YL0A 5KYUB 1NBBA 4CIPA 2IXOA 4MW8A 2CYDA 5KYWB 1NFNA 3S0XA 3C8GB 3SXZA 2EIJC 4BJTA 1SYQA 3FAPB 4IAQA 4AL0A 3V5ZA 3ZTZA 3FHDA 4N6HA 4ANJA 2AVKA 2L6FA 3TJ5A 1CGOA 3T4RA 1AEPA 3AGUA 4BEMJ 1BR4A 2LQGA 2R7OA 3AG1C 1OW7A 4I1MA 2EPNA 3Q7GA 2KYHA 2V26A 3ASNC 1LVKA 5L0CA 2QLAA 5KYNA 1BBHA 2H7BA 2H7VC 3M1CB 4NTBA 1ZHYA 2YEVA 3K6BA 4U9DA 4LDQA 3SP1A 4DXWA 3K1HA 1WWPA 1IW7F 3O10A 3SXYA 3ZIBA 1QQ3A 3QW1A 4CSAA 4YN0B 3S9OA 3WG7C 3QMKA 2ZXRA 3F47A 1ZZPA 2CW0F 2I15A 3UNGC 1KTMA 3CEXA 4G7OF 2OEVA 1SF8A 3TULA 2Q9CA 3MLGA 2WZFA 3EG9A 2HMQA 3IQ5A 3ATPA 2OJED 3QZCA 3TJ6A 5DLJA 1IZMA 4WJ0A 4R32A 2WZLA 1E86A 1S05A 1BZ4A 2YQYA 2FGYA 4J7TA 1M2VB 4JTAB 5DVWA 5JUAA 3JYHA 2J7PA 1D0XA 3C18A 1I5NA 4PJJA 4YWQA 1ZU4A 1O3UA 1L3PA 1G4WR 2VASA 4K7BA 3TOMA 3ZQYA 5KYXA 3PDMP 3EHMA 1T6UA 2NSFA 3SYNA 3IQTA 3IHUA 4ONSA 4IAOA 3U0CA 3K7DA 4ZLDA 1E85A 2MHRA 2BL2A 2EPLX 1Z3IX 1BR2A 2PX0A
chains in the Genus database with same CATH topology
2I8BA 4OIOF 3NKEA 4DOZA 3X1OA 1Z63A 3K66A 1VK5A 2XL4A 3I5QA 3H65A 5B1BC 3HLZA 1OKKD 2Y3GA 3LNRA 4JJGA 3X2QC 2KW3C 5B1AC 3LS1A 2Y3BA 4C7OB 3AG3C 3OWTA 3EFOA 1Z5ZA 3SNHA 1OCRC 4IWBA 3UMKA 2J0XA 4LLCA 5T3TA 5T3WA 1KU2A 2OCCC 2W4MA 2YHSA 2WVNA 1ZHWA 4XLNF 4XLPF 3JT1A 4KNWA 3KKBA 4U5DE 2VH3A 4PJLA 2R7UA 4PJMA 3LJBA 3I5PA 4G0HA 3K33A 2Q9AA 3FAJA 4N06A 5E3CA 2NUTA 2W9YA 4O6MA 3CZ6A 4YJWA 3SEOA 1FMVA 2QTVA 1WGWA 1D1CA 4YT4A 4KBLA 1MNEA 3NRHA 1N1CA 2IXMA 5E3AA 5DS6A 2IXNA 3UGOA 2R7SA 2Y3DA 4CS9A 3EG9B 2W4BA 4KNVA 2L81A 2EILC 3B0VC 3ZSUA 2J0WA 2KNHA 2MYSA 1TWAA 2H7OA 1QZXA 3S29A 5IY5C 4KC9A 3RIPA 1NZEA 1SZIA 3DAFA 4BJ5C 2A69F 3L34A 1MMDA 4RBNA 5KYXB 5HSWA 1JPNA 1RJ9A 2NUPA 4BG0A 4BEJA 4E7SA 3DM5A 3ITFA 2R7VA 3CQZA 3EZIA 2HV7A 1D0ZA 3Q6NA 2IYLD 4DVZA 2Y69C 5L3QA 2CGEA 4DBQA 1LS1A 3N0TA 5F5HA 3LS0A 3L0IA 3NYJA 4X0RA 5DQTA 4DBRA 4JURI 4FESA 4HEAJ 2G3KA 3EFOB 4OIPF 2J45A 4FWVA 4JJFA 3ZC4A 2KQ9A 5L3VA 4AK9A 4GYTA 4M63A 2G3VA 4XWJA 4BJ6A 2QY9A 3FDQA 4W8KA 3Q6MA 5KYYA 4AE4A 3IEEA 2YZSA 3RFYA 1TKNA 4CBEA 4LERA 1VMAA 2WVQA 2PFDA 3KL4A 2MWQA 1TR2A 3V7OA 4BJ1A 5B3SC 5EGYA 4LACB 1PD1A 3ZG1A 1VOMA 1ZHZA 3LLIA 4LLEA 1FMWA 2L9JA 4CS8C 2Q3TA 2W45A 3LESA 2NUTB 1BR1A 4MNDA 4O6YA 1OCOC 2CDQA 2R7WA 4QI0A 3OEOA 4FX5A 2EINC 1ZHTA 3UMIA 3W8HA 2BE5F 3E9VA 2CNWD 3EZHA 3O39A 4YT5A 1JPJA 3DMDA 4H4KC 1TWHA 4O6NA 2C04A 4G7HF 3DAGA 1J8YF 3AG2C 2A6EF 5BUOA 3PMRA 1D1AA 2HV6A 1MMGA 2A1DD 4GEHA 4JZAA 2J46A 1VYKA 4Q4ZF 3W2VA 1RJ9B 2NUPB 4B6IA 3NKDA 1O87A 3GODA 5CI9A 3CSKA 3EH2A 3B0UX 4OIQF 1QLEC 3HTKC 1M2OA 2B0JA 3LAYA 2LSEA 4G7ZF 4PK4A 3ASOC 3JCUQ 4I3MA 4MQ9F 2R7XA 3EPVA 4CSAC 4YT8A 2KJGA 1J8MF 5E2QA 4C3EA 4JW1A 2Y3HA 2J9WA 2KGOA 3EGXA 4K0DA 3OA1A 3JSZA 3KH2A 1VYIA 4KI2A 3N2ZB 1ZHXA 2J7PD 4O79A 4U5GA 5T1DB 1PCXA 4OINF 1V54C 1ST6A 5E33A 4HFFB 2EIMC 2A6HF 4PJNA 1OKKA 5KYYB 2IXPA 4AE4B 4C3BA 4J30B 3S28A 2Z15A 1FFHA 2GFHA 4HE8D 1V55C 5F5FA 2ZXWC 4CS7A 2WL8A 4OIRF 4QDLA 2DYSC 2ZXOA 3JRTA 2DGJA 3F46A 1PD0A 4O7GA 3Q7LA 4JCHA 3DXJF 2PX3A 3PHF2 4AX2A 2WB7A 3EHNA 3N24A 3DJNB 3NYMA 3W2WA 1FFTC 4Q5SF 4OD5A 2P7VA 1ZU5A 4EWCA 1D1BA 3ABKC 1M57C 2WZGA 4U5BE 3FVYA 3RYLA 4F4BA 4P6IC 3NG1A 4DVYP 1O5HA 4IRUA 3B0PA 2O9XA 3UGPA 4CIHA 2EIKC 2M4EA 1MMAA 2XXAA 4E7ZA 1OCCC 4HFKB 3EGDA 5DS5A 1SMYF 3HJCA 1TWGA 3W8IA 3O6XA 1D0YA 1Z23A 4YT2A 5KYUA 4BJ5A 5D92A 1ZYRF 3DM9B 5KYWA 4IJJA 3K1IC 4U5EE 2D5RB 3VYWA 4ZLCA 2XRHA 3T6BA 1M56C 1NU9C 3GANA 3EGXB 4JVSA 4U5HA 4EBBA 2C03A 4CS9C 4RDAA 1NU7D 4RD9A 2VB6A 2JD3A 3S27A 3NYLA 5DS4A 3B9QA 5DQZA 2R7RA 2J9UA 2OG2A 1W2WA 5D91A 3EQLF 1TWCA 4PFOA 3RH3A 1M2VA 1OCZC 3EJNA 1Z6AA 3MX3A 1LKXA 1FTSA 2R7TA 2PP4A 4PFPA 2NG1A 3NDBB 2XSEA 3SZRA 4I1OB 1G8XA 4U5FE 3ZVRA 5EHHA 2A68F 3KMIA 3POVA 3LEVA 3WODF 2Q9BA 5CI8A 4NY3A 3TD7A 3I4UA 3ABMC 2WVOA 2DYRC 3DZAA 2Y39A 1NG1A 2FFHA 4C3DA 4U5CE 4Q7CA 4ULWA 4CS8A 4I44A 4C7OA 2PF4E 3UMHA 2IOQA 3DD7A 3AG4C 3E70C 4BJ6C 1S7ZA 2G62A 2E87A 2X51A 3EH1A 4OD4A 1MMNA 3AQCA 4QI2A 3DJUB 2ZPAA 3ABLC 4A2NB 2XXAB 3EGDB 2R7QA 3LLKA 3ECSA 4J32B 2P6VA 3UR3C 2ZXPA 2CNWA 3T6JA 3AQBA 2V3CC 2J9VA 3RKOF 3VAYA 5FCLA 1MNDA 4XTKA 5KYUB 2IXOA 5KYWB 3S0XA 2EIJC 4BJTA 3FHDA 4ANJA 3T4RA 1BR4A 3AG1C 2R7OA 4I1MA 3Q7GA 2V26A 3ASNC 1LVKA 5KYNA 2H7BA 2H7VC 3M1CB 1ZHYA 2YEVA 3K6BA 3SP1A 3K1HA 3ZIBA 1IW7F 4CSAA 4YN0B 3WG7C 3QMKA 2ZXRA 3F47A 2CW0F 3UNGC 4G7OF 1SF8A 2Q9CA 3MLGA 2WZFA 3EG9A 3QZCA 5DLJA 1IZMA 4WJ0A 2WZLA 2FGYA 5DVWA 1M2VB 3JYHA 2J7PA 1D0XA 4PJJA 4YWQA 1ZU4A 2VASA 4K7BA 5KYXA 3EHMA 3SYNA 4IAOA 4ZLDA 3K7DA 1Z3IX 1BR2A 2PX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W2W A; 
#chains in the Genus database with same CATH topology
 2I8B A;  1EI7 A;  2OOC A;  2LIG A;  4OIO F;  1BDJ B;  1VLT A;  3NKE A;  3VM6 A;  4DOZ A;  4JCZ A;  3X1O A;  2P1A A;  3RVZ A;  1Z63 A;  3K66 A;  1VK5 A;  2XL4 A;  3I5Q A;  4EKW A;  3GWN A;  1GM5 A;  3A9C A;  5A6J A;  3H65 A;  1H6G A;  3U8P A;  5B1B C;  2VCB A;  3HLZ A;  1OKK D;  2Y3G A;  3LNR A;  4JJG A;  3X2Q C;  1RKE B;  1KNY A;  2L7A A;  4MVO A;  3M4C A;  2KW3 C;  5B1A C;  3LS1 A;  2Y3B A;  4C7O B;  4LDK A;  4D4X A;  3AG3 C;  3OWT A;  4W8P A;  3EFO A;  3L8I A;  1Z5Z A;  1T5O A;  1YA7 O;  2AWC A;  3SNH A;  1OCR C;  4IWB A;  3UMK A;  3O55 A;  2J0X A;  4CX9 A;  4MVR A;  3M4B A;  4LLC A;  5T3T A;  5T3W A;  5A6A A;  2LD6 A;  5L0F A;  1KU2 A;  2OCC C;  4JEA A;  1YAU O;  2W4M A;  3SXK A;  1Q0G A;  2YHS A;  4MTF A;  3T9O A;  1VB5 A;  2WVN A;  1AVO B;  4NTF A;  1ZHW A;  3RQF A;  4XLN F;  5CIV A;  4XLP F;  3JT1 A;  4KNW A;  3U9J A;  1YAR O;  3KKB A;  4U5D E;  2VH3 A;  4JKV A;  1LIH A;  4PJL A;  2R7U A;  4NQF A;  1YYX A;  1VLS A;  4PJM A;  2XLW A;  4YK5 A;  5TJ5 E;  2EPM X;  1EKY A;  3L1M A;  1HE9 A;  2XM0 A;  3LJB A;  1TQG A;  4MW3 A;  3LEO A;  1CPQ A;  3I5P A;  4G0H A;  2AU5 A;  2R05 A;  3HNJ A;  2QUP A;  3MYF A;  1SR2 A;  2HZ8 A;  3DI5 A;  3DWW A;  2CCY A;  3K33 A;  3K1I A;  2Q9A A;  3FAJ A;  4MVZ A;  4N06 A;  5E3C A;  5JP7 A;  2YLI A;  3H2V A;  1GQA A;  1K40 A;  2NUT A;  4AL1 A;  5JT4 A;  2W9Y A;  1GS9 A;  4O6M A;  1YA9 A;  3CZ6 A;  4Z9J A;  4YJW A;  3SEO A;  3G4Z A;  1FMV A;  2QTV A;  2UUI A;  1WGW A;  1D1C A;  4YT4 A;  3G4X A;  1MQV A;  3AGT A;  3GEH A;  4KBL A;  1MNE A;  3KPH A;  3NRH A;  4YL1 A;  3TOL A;  2YL1 A;  1RKC A;  1N1C A;  4IAR A;  3U8V A;  3S90 A;  2IXM A;  5E3A A;  2DB4 A;  2DI3 A;  2IXN A;  5DS6 A;  2EPK X;  2Y3D A;  4IGG A;  4CS9 A;  3ZDL A;  3EG9 B;  2R7S A;  1R4T A;  2W4B A;  4KNV A;  2L81 A;  2EIL C;  4MS2 A;  3TK0 A;  3B0V C;  3ZSU A;  2OQM A;  2J0W A;  1FAP B;  2KNH A;  2LCH A;  2MYS A;  2VC9 A;  1JRA A;  1Y6D A;  3U2L A;  1TWA A;  2XLD A;  2H7O A;  1QZX A;  2HUJ A;  2M64 A;  3S29 A;  1OR3 A;  5IY5 C;  4DRI B;  4KC9 A;  1JR8 A;  2OU6 A;  1NZE A;  1SZI A;  2XL6 A;  4K1O A;  3RIP A;  3DAF A;  1ZW2 A;  4BJ5 C;  2A69 F;  1YVI A;  3L34 A;  1RMV A;  1MMD A;  4RBN A;  5KYX B;  5HSW A;  1JPN A;  1RJ9 A;  2NUP A;  4BG0 A;  1U89 A;  4BEJ A;  3HNK A;  3G50 A;  4E7S A;  3ZQV A;  1Q0F A;  3C7J A;  3DM5 A;  3ITF A;  2R7V A;  3UGO A;  3T6G B;  3CQZ A;  3EZI A;  2A0B A;  4P9F A;  2XS1 A;  4NTA A;  2HV7 A;  2PNO A;  1D0Z A;  2P0N A;  3Q6N A;  4MTO A;  2IYL D;  4JC7 A;  4DVZ A;  3RF3 A;  2Y69 C;  4N4W A;  5L3Q A;  2CGE A;  1V4A A;  2YWA A;  4DBQ A;  2OJQ A;  1EQ1 A;  1LS1 A;  3BEH A;  3N0T A;  5F5H A;  3LS0 A;  3U3B A;  2YL3 A;  3L0I A;  4DRJ B;  3NYJ A;  1E84 A;  2OKU A;  1C17 M;  4X0R A;  5DQT A;  4DBR A;  3MBG A;  4JUR I;  4FES A;  4HEA J;  2G3K A;  1CGM E;  1YLM A;  4XPW A;  1JOG A;  1Y4C A;  2HJM A;  3EFO B;  1YJG A;  2J45 A;  3WHN A;  4OIP F;  2VCA A;  4FWV A;  4JJF A;  3ZC4 A;  4J7Y A;  5L0G A;  1LI7 A;  2KQ9 A;  5L3V A;  1WTY A;  4UDV A;  3R2P A;  3RW0 A;  4AK9 A;  5BQG A;  4GYT A;  4M63 A;  2G3V A;  4XWJ A;  3V5X A;  4BJ6 A;  2HS5 A;  2QY9 A;  4EBJ A;  1Q0D A;  2XLV A;  3FDQ A;  3KYJ A;  4W8K A;  3Q6M A;  5KYY A;  3GM2 A;  4AE4 A;  1ORS C;  3QVZ A;  1OXB A;  3IEE A;  1OQC A;  3QTH A;  2YZS A;  4MVS A;  3RFY A;  1TKN A;  4CBE A;  4LER A;  2KC3 A;  3U9M A;  1VMA A;  1VTM P;  2WVQ A;  2PFD A;  3KL4 A;  3S84 A;  3BRJ A;  1TFK B;  4DJ9 A;  4MVU A;  2YLG A;  1YZC A;  2GDC A;  1TR2 A;  2MWQ A;  4NC3 A;  3V7O A;  4BJ1 A;  5B3S C;  3MFN A;  5EGY A;  4JEB A;  1F1M A;  2TMV P;  4LAC B;  2HSQ A;  5B3I A;  1PD1 A;  2H8A A;  3ZG1 A;  1YYJ A;  3A11 A;  1VOM A;  1ZHZ A;  3AOU A;  3LLI A;  4LLE A;  1FMW A;  1OR2 A;  2L9J A;  3JZ0 A;  3WAQ A;  3FMS A;  4CS8 C;  2Q3T A;  4E0H A;  2W45 A;  3LES A;  2NUT B;  1WOL A;  1BR1 A;  1WN0 A;  2ICW G;  1NSG B;  4MND A;  1H9G A;  1ORJ A;  3C8Z A;  1OCO C;  2NPU A;  4O6Y A;  2CDQ A;  2KSF A;  2R7W A;  4QI0 A;  3OEO A;  4FX5 A;  2EIN C;  4XPY A;  1GGQ A;  1ZHT A;  3UMI A;  3NMK A;  1T6I A;  1E83 A;  3W8H A;  2BE5 F;  3E9V A;  3GEI A;  1AUE A;  2CNW D;  4L6R A;  4WGY A;  5GPG B;  2IBF A;  3EZH A;  3O39 A;  3W4Y A;  4EHP A;  2RD9 A;  1HY5 A;  4YT5 A;  5JVE A;  1JPJ A;  3DMD A;  3B29 A;  1TWH A;  3IQ6 A;  2C04 A;  4H4K C;  4O6N A;  4JTD B;  4G7H F;  3DAG A;  1UFB A;  1J8Y F;  3AG2 C;  2A6E F;  5A6K A;  2Q00 A;  5BUO A;  5L0I A;  3PMR A;  1D1A A;  2RSE B;  1QVX A;  1MMG A;  2A1D D;  2HV6 A;  3B71 A;  3KYI A;  4GEH A;  4JZA A;  1WAT A;  2J46 A;  2GWW A;  1CGN A;  4P9T A;  5JSL A;  1VYK A;  4YL3 A;  4Q4Z F;  3FOO A;  1A7V A;  1RJ9 B;  2NUP B;  3W2V A;  4B6I A;  3NKD A;  1HMO A;  1O87 A;  2AWY A;  3GOD A;  3CSK A;  3EH2 A;  5CI9 A;  5EK0 A;  3B0U X;  4OIQ F;  1QLE C;  2QNL A;  3HTK C;  1I4Y A;  1M2O A;  3H2U A;  2YLD A;  2B0J A;  2L6H A;  3LAY A;  2UUH A;  2LSE A;  4ULV A;  2PBE A;  4XEF A;  4EIY A;  4G7Z F;  3U3F A;  1U0B B;  5JRA A;  4PK4 A;  3ASO C;  3JCU Q;  3NMJ A;  1ZW3 A;  4WAB A;  4I3M A;  4MQ9 F;  2R7X A;  3EPV A;  4CSA C;  4YT8 A;  2KJG A;  1J8M F;  5E2Q A;  2YRF A;  3L8J A;  1CPR A;  1QKR A;  4JW1 A;  1L7C A;  2J9W A;  2Y3H A;  4C3E A;  2ASR A;  2KGO A;  3EGX A;  4K0D A;  3OA1 A;  3JSZ A;  4XEV A;  3RQE A;  1WAS A;  4H54 A;  3KH2 A;  1VYI A;  2HKV A;  3N2Z B;  4PAC A;  4KI2 A;  1ZHX A;  2J7P D;  4O79 A;  4U5G A;  5T1D B;  3DKA A;  1PCX A;  1M6T A;  4OIN F;  5A69 A;  2HFI A;  1V54 C;  1ST6 A;  3QW0 A;  4HFF B;  2EIM C;  3C8G D;  2A6H F;  5COM A;  4PJN A;  5E33 A;  5A6B D;  3C62 A;  4Z9H A;  5F28 E;  1K04 A;  1OKK A;  5KYY B;  1A0B A;  2IXP A;  3M79 A;  4AE4 B;  2LK4 A;  4J30 B;  4C3B A;  3S28 A;  2Z15 A;  1FFH A;  1G5Z A;  1PV3 A;  2GFH A;  2OEX A;  4HE8 D;  3RVY A;  1V55 C;  5F5F A;  4WGZ A;  2ZD9 A;  2ZXW C;  4CS7 A;  2WL8 A;  3JYY A;  4QDL A;  2DYS C;  4OIR F;  5AC4 A;  2ZXO A;  5JS5 A;  3JRT A;  1APC A;  2DGJ A;  3F46 A;  1EA8 A;  1PD0 A;  1FR0 A;  3AJM A;  4O7G A;  3ZWI A;  1YZA A;  3Q7L A;  4JCH A;  3DXJ F;  2PX3 A;  4JTC B;  1A7D A;  3PHF 2;  2YVK A;  4JIO A;  3M15 A;  4D4N A;  4AX2 A;  1H9T A;  1JAF A;  1LE2 A;  1LI5 A;  2WB7 A;  4IB4 A;  4CJG A;  3EHN A;  3N24 A;  3DJN B;  1HMD A;  1OW8 A;  4MTG A;  3NYM A;  3QVY A;  4E17 A;  3GM1 A;  3W2W A;  2R25 A;  1FFT C;  3SXM A;  4Q5S F;  4OD5 A;  2AP3 A;  1ZU5 A;  2P7V A;  1HW2 A;  4EWC A;  2HJ3 A;  4XQ1 A;  4LDR A;  3HKK A;  1D1B A;  3ABK C;  2GA0 A;  1HE1 A;  3GWL A;  3LNM B;  1M57 C;  1B68 A;  2J8W A;  2WZG A;  1LS4 A;  1T9K A;  2XLM A;  4U5B E;  3FVY A;  3RYL A;  2A0U A;  4MVQ A;  4P6I C;  4ER9 A;  3NG1 A;  4DVY P;  4F4B A;  1LM3 B;  1O5H A;  2R02 A;  1E2X A;  1QPU A;  4IRU A;  3B0P A;  2O9X A;  2QE9 A;  3DE8 A;  3UGP A;  4CIH A;  1DOW A;  2LFF A;  2EIK C;  2M4E A;  1C02 A;  1MMA A;  2ETS A;  1OCC C;  1H7I A;  2P61 A;  3EGD A;  4HFK B;  4E7Z A;  2XXA A;  3RQG A;  5DS5 A;  1I4Z A;  1SMY F;  3HJC A;  1TWG A;  3IQC A;  3W8I A;  1K05 A;  1T6Q A;  3O6X A;  4PR9 A;  1YDI A;  1D0Y A;  3GEE A;  1Z23 A;  2IM8 A;  4YT2 A;  1T01 A;  1U6H A;  2JPU A;  2JX0 A;  2Q7R A;  5KYU A;  4BJ5 A;  5D92 A;  1ZYR F;  2J9B A;  3DM9 B;  1ORY A;  5KYW A;  3C8G A;  4IJJ A;  5A6B A;  5L0H A;  3K1I C;  3IPM O;  4U5E E;  2D5R B;  1OW6 A;  3VYW A;  1NLX A;  3US6 A;  4ZLC A;  3ZTM A;  2XRH A;  4N6C A;  2D4U A;  3T6B A;  4G78 A;  5L0D A;  1M56 C;  4Z9I A;  4FAP B;  3PCV A;  3CAX A;  3VRC A;  1NU9 C;  3GAN A;  5JLI A;  3EGX B;  5HV9 A;  4JVS A;  5COG A;  3GM3 A;  4U5H A;  2F22 A;  2C03 A;  3VF0 A;  4CS9 C;  4EBB A;  2Q4F A;  3MYI A;  5COF A;  2HMZ A;  4RDA A;  1NU7 D;  4RD9 A;  2VB6 A;  2JD3 A;  1OXK A;  3S27 A;  3NYL A;  4A4A A;  5DS4 A;  1XZQ A;  3B9Q A;  2XS8 A;  4NCQ A;  5DQZ A;  1LE4 A;  2R7R A;  1XWJ A;  2J9U A;  3FOP A;  2OG2 A;  1W2W A;  2KK1 A;  5D91 A;  2LP4 A;  3EQL F;  1TWC A;  4PFO A;  3RH3 A;  3TQO A;  1TFO B;  1M2V A;  1OCZ C;  3EJN A;  3J06 A;  1Z6A A;  3MX3 A;  4XEK A;  1LKX A;  1FTS A;  2R7T A;  2PP4 A;  4PFP A;  2NG1 A;  3NDB B;  1RCP A;  3HNI A;  3U2M A;  2L6G A;  3U5S A;  2XSE A;  4CJO A;  3SZR A;  1HW1 A;  4DRH B;  4I1O B;  1R5I D;  1G8X A;  4U5F E;  1C03 A;  3ZVR A;  1XZP A;  5AC5 A;  5EHH A;  1G4U S;  2A68 F;  3KMI A;  3POV A;  2VCC A;  2YL0 A;  3HNL A;  1V74 B;  2XL8 A;  1Q0M A;  3LEV A;  4CDA A;  2X0C A;  3WOD F;  5BQI A;  2Q9B A;  1JMW A;  5CI8 A;  256B A;  4NY3 A;  3TD7 A;  1FNT c;  3I4U A;  4XPX A;  3ABM C;  5BQH A;  2WVO A;  2DYR C;  3DZA A;  2YKZ A;  2Y39 A;  1NG1 A;  4EBK A;  4CDV A;  2FFH A;  3FXH A;  2XLH A;  1RKE A;  4Q7C A;  1ZVZ A;  3JTL O;  3DE9 A;  2EPO A;  4U5C E;  4ULW A;  4CDY A;  4CS8 A;  4I44 A;  4C7O A;  2PF4 E;  3UMH A;  5L0J A;  1A41 A;  2IOQ A;  3DD7 A;  3AG4 C;  4EUK B;  5FZT A;  3E70 C;  4BJ6 C;  1S7Z A;  4E0I A;  2G62 A;  2E87 A;  1NFO A;  3C63 A;  3NMI A;  4JRZ A;  1RXQ A;  2X51 A;  2XM4 A;  3EH1 A;  2FAP B;  4OD4 A;  1MMN A;  3AQC A;  3R7C A;  5K0I A;  4E18 A;  2XLE A;  1UG7 A;  4QI2 A;  3V5Y A;  2B0H A;  3DJU B;  4MVM A;  1Z7Q c;  1QSP A;  2XLO A;  2ZPA A;  3ABL C;  4GQH A;  4A2N B;  2XXA B;  2YL7 A;  3EGD B;  3JRM O;  4C3D A;  2R7Q A;  2BC5 A;  3LLK A;  3ECS A;  3LUT B;  4J32 B;  3GOR A;  4BPM A;  2P6V A;  3UR3 C;  1A7E A;  2GAQ A;  2ZXP A;  2CNW A;  4JE9 A;  5AGF A;  3T6J A;  3AQB A;  3JSE O;  2HSB A;  2J9V A;  2V3C C;  3RKO F;  3VAY A;  1Q0K A;  5FCL A;  1MND A;  1LPE A;  1DOV A;  2LFD A;  2NSG A;  2R9R B;  2R03 A;  4U9E A;  4XTK A;  4YL0 A;  5KYU B;  1NBB A;  4CIP A;  2IXO A;  4MW8 A;  2CYD A;  5KYW B;  1NFN A;  3S0X A;  3C8G B;  3SXZ A;  2EIJ C;  4BJT A;  1SYQ A;  3FAP B;  4IAQ A;  4AL0 A;  3V5Z A;  3ZTZ A;  3FHD A;  4N6H A;  4ANJ A;  2AVK A;  2L6F A;  3TJ5 A;  1CGO A;  3T4R A;  1AEP A;  3AGU A;  4BEM J;  1BR4 A;  2LQG A;  2R7O A;  3AG1 C;  1OW7 A;  4I1M A;  2EPN A;  3Q7G A;  2KYH A;  2V26 A;  3ASN C;  1LVK A;  5L0C A;  2QLA A;  5KYN A;  1BBH A;  2H7B A;  2H7V C;  3M1C B;  4NTB A;  1ZHY A;  2YEV A;  3K6B A;  4U9D A;  4LDQ A;  3SP1 A;  4DXW A;  3K1H A;  1WWP A;  1IW7 F;  3O10 A;  3SXY A;  3ZIB A;  1QQ3 A;  3QW1 A;  4CSA A;  4YN0 B;  3S9O A;  3WG7 C;  3QMK A;  2ZXR A;  3F47 A;  1ZZP A;  2CW0 F;  2I15 A;  3UNG C;  1KTM A;  3CEX A;  4G7O F;  2OEV A;  1SF8 A;  3TUL A;  2Q9C A;  3MLG A;  2WZF A;  3EG9 A;  2HMQ A;  3IQ5 A;  3ATP A;  2OJE D;  3QZC A;  3TJ6 A;  5DLJ A;  1IZM A;  4WJ0 A;  4R32 A;  2WZL A;  1E86 A;  1S05 A;  1BZ4 A;  2YQY A;  2FGY A;  4J7T A;  1M2V B;  4JTA B;  5DVW A;  5JUA A;  3JYH A;  2J7P A;  1D0X A;  3C18 A;  1I5N A;  4PJJ A;  4YWQ A;  1ZU4 A;  1O3U A;  1L3P A;  1G4W R;  2VAS A;  4K7B A;  3TOM A;  3ZQY A;  5KYX A;  3PDM P;  3EHM A;  1T6U A;  2NSF A;  3SYN A;  3IQT A;  3IHU A;  4ONS A;  4IAO A;  3U0C A;  3K7D A;  4ZLD A;  1E85 A;  2MHR A;  2BL2 A;  2EPL X;  1Z3I X;  1BR2 A;  2PX0 A; 
#chains in the Genus database with same CATH homology
 2I8B A;  4OIO F;  3NKE A;  4DOZ A;  3X1O A;  1Z63 A;  3K66 A;  1VK5 A;  2XL4 A;  3I5Q A;  3H65 A;  5B1B C;  3HLZ A;  1OKK D;  2Y3G A;  3LNR A;  4JJG A;  3X2Q C;  2KW3 C;  5B1A C;  3LS1 A;  2Y3B A;  4C7O B;  3AG3 C;  3OWT A;  3EFO A;  1Z5Z A;  3SNH A;  1OCR C;  4IWB A;  3UMK A;  2J0X A;  4LLC A;  5T3T A;  5T3W A;  1KU2 A;  2OCC C;  2W4M A;  2YHS A;  2WVN A;  1ZHW A;  4XLN F;  4XLP F;  3JT1 A;  4KNW A;  3KKB A;  4U5D E;  2VH3 A;  4PJL A;  2R7U A;  4PJM A;  3LJB A;  3I5P A;  4G0H A;  3K33 A;  2Q9A A;  3FAJ A;  4N06 A;  5E3C A;  2NUT A;  2W9Y A;  4O6M A;  3CZ6 A;  4YJW A;  3SEO A;  1FMV A;  2QTV A;  1WGW A;  1D1C A;  4YT4 A;  4KBL A;  1MNE A;  3NRH A;  1N1C A;  2IXM A;  5E3A A;  5DS6 A;  2IXN A;  3UGO A;  2R7S A;  2Y3D A;  4CS9 A;  3EG9 B;  2W4B A;  4KNV A;  2L81 A;  2EIL C;  3B0V C;  3ZSU A;  2J0W A;  2KNH A;  2MYS A;  1TWA A;  2H7O A;  1QZX A;  3S29 A;  5IY5 C;  4KC9 A;  3RIP A;  1NZE A;  1SZI A;  3DAF A;  4BJ5 C;  2A69 F;  3L34 A;  1MMD A;  4RBN A;  5KYX B;  5HSW A;  1JPN A;  1RJ9 A;  2NUP A;  4BG0 A;  4BEJ A;  4E7S A;  3DM5 A;  3ITF A;  2R7V A;  3CQZ A;  3EZI A;  2HV7 A;  1D0Z A;  3Q6N A;  2IYL D;  4DVZ A;  2Y69 C;  5L3Q A;  2CGE A;  4DBQ A;  1LS1 A;  3N0T A;  5F5H A;  3LS0 A;  3L0I A;  3NYJ A;  4X0R A;  5DQT A;  4DBR A;  4JUR I;  4FES A;  4HEA J;  2G3K A;  3EFO B;  4OIP F;  2J45 A;  4FWV A;  4JJF A;  3ZC4 A;  2KQ9 A;  5L3V A;  4AK9 A;  4GYT A;  4M63 A;  2G3V A;  4XWJ A;  4BJ6 A;  2QY9 A;  3FDQ A;  4W8K A;  3Q6M A;  5KYY A;  4AE4 A;  3IEE A;  2YZS A;  3RFY A;  1TKN A;  4CBE A;  4LER A;  1VMA A;  2WVQ A;  2PFD A;  3KL4 A;  2MWQ A;  1TR2 A;  3V7O A;  4BJ1 A;  5B3S C;  5EGY A;  4LAC B;  1PD1 A;  3ZG1 A;  1VOM A;  1ZHZ A;  3LLI A;  4LLE A;  1FMW A;  2L9J A;  4CS8 C;  2Q3T A;  2W45 A;  3LES A;  2NUT B;  1BR1 A;  4MND A;  4O6Y A;  1OCO C;  2CDQ A;  2R7W A;  4QI0 A;  3OEO A;  4FX5 A;  2EIN C;  1ZHT A;  3UMI A;  3W8H A;  2BE5 F;  3E9V A;  2CNW D;  3EZH A;  3O39 A;  4YT5 A;  1JPJ A;  3DMD A;  4H4K C;  1TWH A;  4O6N A;  2C04 A;  4G7H F;  3DAG A;  1J8Y F;  3AG2 C;  2A6E F;  5BUO A;  3PMR A;  1D1A A;  2HV6 A;  1MMG A;  2A1D D;  4GEH A;  4JZA A;  2J46 A;  1VYK A;  4Q4Z F;  3W2V A;  1RJ9 B;  2NUP B;  4B6I A;  3NKD A;  1O87 A;  3GOD A;  5CI9 A;  3CSK A;  3EH2 A;  3B0U X;  4OIQ F;  1QLE C;  3HTK C;  1M2O A;  2B0J A;  3LAY A;  2LSE A;  4G7Z F;  4PK4 A;  3ASO C;  3JCU Q;  4I3M A;  4MQ9 F;  2R7X A;  3EPV A;  4CSA C;  4YT8 A;  2KJG A;  1J8M F;  5E2Q A;  4C3E A;  4JW1 A;  2Y3H A;  2J9W A;  2KGO A;  3EGX A;  4K0D A;  3OA1 A;  3JSZ A;  3KH2 A;  1VYI A;  4KI2 A;  3N2Z B;  1ZHX A;  2J7P D;  4O79 A;  4U5G A;  5T1D B;  1PCX A;  4OIN F;  1V54 C;  1ST6 A;  5E33 A;  4HFF B;  2EIM C;  2A6H F;  4PJN A;  1OKK A;  5KYY B;  2IXP A;  4AE4 B;  4C3B A;  4J30 B;  3S28 A;  2Z15 A;  1FFH A;  2GFH A;  4HE8 D;  1V55 C;  5F5F A;  2ZXW C;  4CS7 A;  2WL8 A;  4OIR F;  4QDL A;  2DYS C;  2ZXO A;  3JRT A;  2DGJ A;  3F46 A;  1PD0 A;  4O7G A;  3Q7L A;  4JCH A;  3DXJ F;  2PX3 A;  3PHF 2;  4AX2 A;  2WB7 A;  3EHN A;  3N24 A;  3DJN B;  3NYM A;  3W2W A;  1FFT C;  4Q5S F;  4OD5 A;  2P7V A;  1ZU5 A;  4EWC A;  1D1B A;  3ABK C;  1M57 C;  2WZG A;  4U5B E;  3FVY A;  3RYL A;  4F4B A;  4P6I C;  3NG1 A;  4DVY P;  1O5H A;  4IRU A;  3B0P A;  2O9X A;  3UGP A;  4CIH A;  2EIK C;  2M4E A;  1MMA A;  2XXA A;  4E7Z A;  1OCC C;  4HFK B;  3EGD A;  5DS5 A;  1SMY F;  3HJC A;  1TWG A;  3W8I A;  3O6X A;  1D0Y A;  1Z23 A;  4YT2 A;  5KYU A;  4BJ5 A;  5D92 A;  1ZYR F;  3DM9 B;  5KYW A;  4IJJ A;  3K1I C;  4U5E E;  2D5R B;  3VYW A;  4ZLC A;  2XRH A;  3T6B A;  1M56 C;  1NU9 C;  3GAN A;  3EGX B;  4JVS A;  4U5H A;  4EBB A;  2C03 A;  4CS9 C;  4RDA A;  1NU7 D;  4RD9 A;  2VB6 A;  2JD3 A;  3S27 A;  3NYL A;  5DS4 A;  3B9Q A;  5DQZ A;  2R7R A;  2J9U A;  2OG2 A;  1W2W A;  5D91 A;  3EQL F;  1TWC A;  4PFO A;  3RH3 A;  1M2V A;  1OCZ C;  3EJN A;  1Z6A A;  3MX3 A;  1LKX A;  1FTS A;  2R7T A;  2PP4 A;  4PFP A;  2NG1 A;  3NDB B;  2XSE A;  3SZR A;  4I1O B;  1G8X A;  4U5F E;  3ZVR A;  5EHH A;  2A68 F;  3KMI A;  3POV A;  3LEV A;  3WOD F;  2Q9B A;  5CI8 A;  4NY3 A;  3TD7 A;  3I4U A;  3ABM C;  2WVO A;  2DYR C;  3DZA A;  2Y39 A;  1NG1 A;  2FFH A;  4C3D A;  4U5C E;  4Q7C A;  4ULW A;  4CS8 A;  4I44 A;  4C7O A;  2PF4 E;  3UMH A;  2IOQ A;  3DD7 A;  3AG4 C;  3E70 C;  4BJ6 C;  1S7Z A;  2G62 A;  2E87 A;  2X51 A;  3EH1 A;  4OD4 A;  1MMN A;  3AQC A;  4QI2 A;  3DJU B;  2ZPA A;  3ABL C;  4A2N B;  2XXA B;  3EGD B;  2R7Q A;  3LLK A;  3ECS A;  4J32 B;  2P6V A;  3UR3 C;  2ZXP A;  2CNW A;  3T6J A;  3AQB A;  2V3C C;  2J9V A;  3RKO F;  3VAY A;  5FCL A;  1MND A;  4XTK A;  5KYU B;  2IXO A;  5KYW B;  3S0X A;  2EIJ C;  4BJT A;  3FHD A;  4ANJ A;  3T4R A;  1BR4 A;  3AG1 C;  2R7O A;  4I1M A;  3Q7G A;  2V26 A;  3ASN C;  1LVK A;  5KYN A;  2H7B A;  2H7V C;  3M1C B;  1ZHY A;  2YEV A;  3K6B A;  3SP1 A;  3K1H A;  3ZIB A;  1IW7 F;  4CSA A;  4YN0 B;  3WG7 C;  3QMK A;  2ZXR A;  3F47 A;  2CW0 F;  3UNG C;  4G7O F;  1SF8 A;  2Q9C A;  3MLG A;  2WZF A;  3EG9 A;  3QZC A;  5DLJ A;  1IZM A;  4WJ0 A;  2WZL A;  2FGY A;  5DVW A;  1M2V B;  3JYH A;  2J7P A;  1D0X A;  4PJJ A;  4YWQ A;  1ZU4 A;  2VAS A;  4K7B A;  5KYX A;  3EHM A;  3SYN A;  4IAO A;  4ZLD A;  3K7D A;  1Z3I X;  1BR2 A;  2PX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...