1YA7O

Implications for interactions of proteasome with pan and pa700 from the 1.9 a structure of a proteasome-11s activator complex
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
228
structure length
218
Chain Sequence
KRAALIQNLRDSYTETSSFAVIEEWAAGTLQEIEGIAKAAAEAHGVIRNSTYGRAQAEKSPEQLLGVLQRYQDLCHNVYCQAETIRTVIAIRIPEHKEEDNLGVAVQHAVLKIIDELEIKTLGSGEKSGSGGAPTPIGMYALREYLSARSTVEDKLLGGGSQSPSLLLELRQIDADFMLKVELATTHLSTMVRAVINAYLLNWKKLIQPRTGSDHMVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteasome alpha subunit
publication title The 1.9 A structure of a proteasome-11S activator complex and implications for proteasome-PAN/PA700 interactions.
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase/hydrolase activator
total genus 84
structure length 218
sequence length 228
chains with identical sequence P, Q, R, S, T, U
ec nomenclature
pdb deposition date 2004-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF02252 PA28_beta Proteasome activator pa28 beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.180 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Proteasome activator pa28, C-terminal domain 1ya7O01
1YA7O 1FNTc 1YARO 3IPMO 1Z7Qc 3JTLO 1YAUO 3JRMO 1AVOB 3JSEO
chains in the Genus database with same CATH superfamily
3NYLA 1YA7O 3NMKA 1JOGA 4CSAA 4CS7A 4RBNA 1ZHWA 2XS8A 4WJ0A 3GORA 3LLIA 2P7VA 1LE2A 5KYWB 2VCBA 3O39A 2V3CC 4OIOF 3CSKA 1YA9A 2LQGA 4GEHA 3U2MA 3EH1A 1TWGA 2J9UA 3LEOA 3ABLC 1I4ZA 1GS9A 2YQYA 5JS5A 3U5SA 4C3DA 2FGYA 1ZU5A 4I1OB 4YJWA 3AGUA 3RW0A 3W8IA 3S84A 3GEIA 3X2QC 2XRHA 3JTLO 2J0WA 3S9OA 4N6HA 3JYYA 1CGNA 3HNIA 1LI5A 2BE5F 3QZCA 2DYRC 4OIRF 3SXKA 3TOLA 3DM9B 4KNWA 4MTFA 2P61A 3FHDA 4U9EA 2HSQA 4M63A 4HEAJ 4G0HA 3DE9A 3GM1A 5B3SC 3WAQA 1SMYF 5L0GA 1JR8A 1NG1A 2EPLX 4CDVA 4ZLCA 3GWLA 4WGZA 5D91A 2NUTA 3EZHA 3SXMA 3LUTB 2OU6A 3KKBA 3M1CB 5AGFA 2W4BA 2LD6A 4NY3A 3ZQVA 4JE9A 1QKRA 3U8PA 2P1AA 3DJNB 2EIKC 1YZAA 3C7JA 2OKUA 3B29A 1NZEA 3OEOA 4PR9A 4NCQA 5COGA 5T1DB 2VCCA 1WGWA 1XZQA 2HSBA 3IQTA 4JTAB 1ZVZA 4BEJA 4JJGA 1RMVA 1LE4A 3JRTA 4N4WA 3RQFA 2FAPB 1VOMA 2KSFA 2XLWA 2NUPA 3AG3C 3NMJA 5T3WA 5A6JA 1EQ1A 1TFKB 4LDRA 2P6VA 4YN0B 2EIMC 4E17A 1MQVA 2CCYA 4R32A 3HNJA 2IXNA 4KI2A 3JYHA 4YT5A 3R7CA 1VK5A 2YRFA 4XLPF 3ITFA 2R7QA 2YLIA 1GGQA 3Q6NA 4IB4A 4JC7A 1HY5A 4MNDA 4Z9HA 1I4YA 4CS8A 3K33A 2MWQA 3EFOA 3EG9A 4DOZA 3PCVA 4P6IC 1ZW2A 4H54A 3HNKA 4GQHA 2KW3C 1RJ9B 1NFNA 3R2PA 2YEVA 3M79A 1O87A 4U5EE 1LM3B 3B0VC 4JW1A 3FAJA 4AE4B 3T6BA 2JPUA 3G50A 2CW0F 3S90A 4KNVA 5KYUB 3SNHA 4AL1A 3T4RA 1HMOA 1ZHTA 1BR1A 2CGEA 4LLCA 2JX0A 3F46A 4K0DA 1QVXA 3LS1A 2R25A 5E33A 1OCOC 4DRJB 1M2VB 2R05A 2RD9A 4LDKA 3U8VA 4RDAA 3CQZA 3QVZA 5A6BD 2ZPAA 1WN0A 4IAOA 5JVEA 2A1DD 1FFHA 5CIVA 3UNGC 3VRCA 5GPGB 1H9TA 5BUOA 4EUKB 1HE9A 3KYIA 1A7DA 1G4WR 1U0BB 2C04A 4XQ1A 4PACA 4D4XA 2Q7RA 2M4EA 3A11A 256BA 2EPOA 2J45A 2GA0A 4BEMJ 4ER9A 1L7CA 2GDCA 1YARO 2WVNA 4IJJA 4DRHB 5L0IA 2Q00A 3FXHA 3LS0A 4FESA 4U9DA 3C8GD 1T6QA 1BR4A 3FVYA 3NDBB 2E87A 1TQGA 3A9CA 4PJLA 1V54C 2L6HA 1OKKA 1S7ZA 1FFTC 1Z5ZA 1NFOA 2Q3TA 2KJGA 3E70C 1A41A 3EHNA 1J8YF 5E3AA 3ZSUA 5TJ5E 2M64A 5FZTA 2Q9AA 4MTGA 2A0UA 1SYQA 1Z23A 3TOMA 4BJ1A 5KYWA 3FDQA 2PNOA 1LKXA 2QLAA 2XM0A 3IHUA 4W8PA 4QDLA 1YYJA 1RXQA 2XLHA 4XPYA 4Q4ZF 2C03A 1NLXA 4G7HF 1TWHA 2YLGA 4MS2A 2D5RB 4C3EA 2KGOA 2G62A 4OIQF 2W9YA 2X51A 1LIHA 4N06A 4IWBA 3N2ZB 4LDQA 1CPRA 2B0HA 4O7GA 1SR2A 2OEXA 5HSWA 1E2XA 2J7PD 2XL4A 4DVYP 3I5PA 1WOLA 2A69F 3JCUQ 1ZZPA 1NSGB 4GYTA 4JEBA 4EBKA 1ZHXA 1V4AA 4PJMA 2OCCC 3F47A 5DS4A 2MYSA 2HV7A 1QPUA 2X0CA 4OINF 1T6IA 3S27A 3U3FA 4ANJA 4JKVA 1SZIA 2ICWG 1FAPB 3HKKA 3L0IA 4BG0A 1E83A 3DE8A 2J0XA 1YVIA 1CPQA 3K6BA 5A69A 1MMAA 1MNEA 3K66A 1H6GA 1OW7A 3J06A 3SEOA 3LLKA 1ZYRF 2PX0A 4BPMA 2G3VA 1GM5A 4E0IA 1YDIA 1YYXA 3PHF2 1Q0GA 2ASRA 1M2OA 3IQCA 4NTAA 1V74B 1CGME 3WODF 2YHSA 2EPMX 3WHNA 5B3IA 1K05A 1DOVA 2HUJA 3JSEO 4XWJA 1C17M 4YWQA 3KL4A 2PP4A 2YL0A 3FOOA 5B1AC 2R7TA 2XLMA 1E86A 1VYKA 3HNLA 4KC9A 4BJTA 1KU2A 4OD4A 1VB5A 1YAUO 4JURI 1ZHYA 1B68A 2YZSA 1JPNA 3NKDA 1VLSA 1V55C 2A0BA 3JT1A 2QY9A 2OJQA 2AVKA 3CAXA 4IGGA 3US6A 5KYYB 2R7VA 1EI7A 2GFHA 2V26A 1C03A 5JSLA 3H2UA 5L3QA 2LFDA 4CJGA 2DYSC 4H4KC 2DGJA 2L9JA 3PMRA 5L3VA 1RJ9A 4PJJA 5L0DA 3RF3A 4U5GA 2YL1A 2CNWD 3K7DA 2L7AA 3CZ6A 1QQ3A 4EIYA 5IY5C 3RVZA 5L0JA 2IXMA 2H7VC 1OR2A 1R5ID 3EHMA 4AE4A 3NRHA 1O5HA 4ULVA 4CS9A 5F5FA 3T6JA 4X0RA 1FR0A 1YZCA 3LEVA 2W4MA 1M57C 5KYUA 3U9JA 3O55A 1APCA 3TD7A 2Y3BA 1Q0KA 4XLNF 3S28A 2VCAA 3K1IC 1YLMA 1M56C 1M2VA 2OG2A 1JRAA 3MLGA 1Z6AA 3SXZA 3W2WA 1Y6DA 4PFPA 1D0YA 1HE1A 4HFFB 3B0UX 3EPVA 4LACB 4XEVA 2DI3A 1I5NA 3UMHA 1E85A 3C18A 3L34A 1KTMA 5FCLA 1NU7D 2IM8A 3POVA 3AG2C 3N24A 5COMA 1BZ4A 4J32B 2R7WA 1D0ZA 4ONSA 4Q5SF 2FFHA 4O6YA 3AGTA 3O6XA 4CJOA 2ZXWC 3MBGA 3DJUB 3H65A 2AWYA 1MNDA 3AG1C 3T6GB 4BJ6A 3G4XA 4BJ5C 1LS4A 4I44A 2CYDA 1Y4CA 1OCZC 2H7OA 1A0BA 3VM6A 5BQGA 4E0HA 2Y69C 1TWCA 2LSEA 4IAQA 4P9FA 4J7TA 2TMVP 4YT8A 2R7UA 3C62A 3I5QA 1OQCA 2XL8A 2XXAB 4CIHA 4O6MA 2WZFA 1T01A 4CIPA 4AK9A 5KYXB 1C02A 4WGYA 3ATPA 4PJNA 3WG7C 3EGXB 2KK1A 4ULWA 4PFOA 2YWAA 3KMIA 4G78A 2J7PA 1Z3IX 4WABA 2R7RA 4Z9JA 4YK5A 2EIJC 4CSAC 1DOWA 2KC3A 2J46A 3UMKA 2J9BA 1KNYA 4I1MA 2AU5A 3TQOA 2NG1A 3C8GB 1OW8A 2GWWA 3X1OA 3LAYA 4NC3A 3ZTMA 4EBJA 5AC4A 1WASA 1CGOA 1HW1A 2I15A 3ABMC 1BDJB 4NTFA 4C7OB 3DAFA 1K40A 1NU9C 4KBLA 3V5ZA 4CDYA 1R4TA 2HJ3A 1MMDA 4YL3A 4MVMA 3V5YA 3UGPA 3HTKC 1OR3A 3DXJF 4FX5A 3DZAA 1G5ZA 2EPNA 3C63A 3EGDA 4HFKB 3GEHA 1FNTc 3S0XA 2R03A 2VB6A 2I8BA 3H2VA 4A4AA 4E7ZA 1MMGA 5F5HA 4DBRA 5JUAA 2HMQA 2DB4A 3ZTZA 4MW8A 1GQAA 3U0CA 4OIPF 2W45A 4JRZA 3L8IA 3KYJA 1AUEA 2XL6A 5E3CA 4FAPB 1ORYA 2P0NA 1A7EA 2KYHA 2UUIA 3B9QA 5KYNA 2HJMA 2HKVA 2PX3A 3VAYA 1D0XA 1AEPA 2YLDA 4IARA 3GANA 2AWCA 3DWWA 1UG7A 1RKEB 4W8KA 4EHPA 2Y3HA 3AQCA 3ZDLA 2QTVA 3S29A 2O9XA 1RKCA 3IQ6A 3U9MA 4DBQA 2L6FA 2KNHA 1PV3A 1QZXA 1OXKA 3B0PA 5KYYA 3IQ5A 2PBEA 4U5BE 2OEVA 4U5DE 3EGDB 3DD7A 3QW0A 3UR3C 4RD9A 4EWCA 1W2WA 5T3TA 2PF4E 3E9VA 2WL8A 2LFFA 3MYFA 1IZMA 1G4US 2EILC 2XSEA 3W8HA 1ST6A 2ZXRA 3ZWIA 1ZU4A 2IXOA 2NSGA 2GAQA 3LNRA 5D92A 4CS8C 2EPKX 1Q0DA 2R9RB 2YL7A 4J30B 4XPWA 3HJCA 2QNLA 2YVKA 3SXYA 4K1OA 4BJ6C 3GM2A 4CX9A 5F28E 2BL2A 3PDMP 3ZC4A 1PD0A 1QSPA 4N6CA 3AG4C 4OD5A 5E2QA 2LCHA 4F4BA 4JVSA 2LK4A 2Q9CA 3SP1A 2ETSA 2AP3A 2HZ8A 3EJNA 3IPMO 5L0CA 1H7IA 2VH3A 2Q4FA 1OKKD 1PCXA 1Q0MA 4MVSA 3RQEA 3CEXA 5JLIA 4U5HA 1BBHA 3U2LA 2LP4A 3DKAA 1FMVA 2EINC 5EK0A 3RFYA 3RKOF 4MQ9F 1G8XA 4DRIB 3M15A 3QMKA 3RVYA 3N0TA 3MX3A 2J9VA 1LS1A 1YJGA 1N1CA 4MVOA 4FWVA 4A2NB 5DQZA 5DS6A 2J8WA 4JTCB 3Q7LA 3RQGA 1FTSA 5L0FA 1U89A 3JRMO 4G7OF 1K04A 3RH3A 3UGOA 3Q7GA 2BC5A 2CDQA 1Q0FA 5L0HA 3NMIA 4JCZA 5A6BA 2XXAA 2WZLA 3QW1A 5KYXA 2VC9A 3UMIA 2F22A 2L81A 2WVOA 1LPEA 1JMWA 1L3PA 3EGXA 3ABKC 1Z63A 1O3UA 2KQ9A 1FMWA 5JP7A 4DXWA 2HV6A 3JSZA 3GEEA 2LIGA 3BEHA 4K7BA 2JD3A 3OWTA 5CI9A 1D1AA 2A6EF 2WZGA 3AOUA 4LERA 5JRAA 5A6KA 3NG1A 3ASOC 1T5OA 2R02A 4NQFA 2A68F 1UFBA 1XZPA 2PFDA 3C8GA 1SF8A 2OQMA 2Y3GA 3NKEA 4I3MA 4YL1A 2QUPA 1TFOB 4EBBA 4C7OA 2Q9BA 4XEKA 2A6HF 4JIOA 2ZXPA 4XTKA 4EKWA 3AQBA 3QVYA 3KH2A 5BQHA 4D4NA 3L8JA 3LNMB 4XPXA 4E18A 1D1BA 1U6HA 2J9WA 3ZVRA 1VMAA 2YL3A 3NYJA 2MHRA 1F1MA 2WVQA 2D4UA 3NYMA 4MVQA 2Y39A 2HS5A 2XLDA 3Q6MA 4QI2A 2R7SA 5CI8A 3W4YA 4P9TA 3LESA 4JCHA 5B1BC 2Z15A 2NUTB 3TJ6A 1MMNA 2R7OA 3W2VA 3K1HA 4L6RA 1ORJA 5DVWA 2ZD9A 3DM5A 1A7VA 2IYLD 3GODA 3OA1A 2UUHA 4LLEA 5COFA 2XM4A 1RKEA 4MVZA 4YL0A 2Y3DA 1ZHZA 2L6GA 2RSEB 2OOCA 5HV9A 3ZG1A 4C3BA 4U5CE 2ZXOA 3EH2A 4Z9IA 5A6AA 4U5FE 3DI5A 3MFNA 3MYIA 3V5XA 4CDAA 1LVKA 3TJ5A 5EHHA 2NPUA 1XWJA 2NUPB 4JJFA 1TR2A 3SZRA 5DS5A 3QTHA 2YKZA 3JZ0A 4JEAA 3VYWA 1E84A 4AL0A 1QLEC 1VTMP 1JPJA 2OJED 4O6NA 4QI0A 3U3BA 3KPHA 2VASA 2HMZA 3ZQYA 3HLZA 1WATA 4YT4A 2H7BA 3ECSA 4PK4A 1WWPA 4XEFA 3ZIBA 4Q7CA 3SYNA 1T9KA 2HFIA 3EFOB 3EG9B 3FMSA 3TK0A 2H8AA 2R7XA 2NSFA 3ASNC 2IXPA 4MW3A 4DJ9A 3L1MA 5K0IA 1S05A 3M4CA 1IW7F 3EZIA 3EQLF 3K1IA 3LJBA 5AC5A 3AJMA 2XLVA 1M6TA 1RCPA 1ORSC 1OW6A 1VYIA 4O79A 4B6IA 1TWAA 2G3KA 3BRJA 1EA8A 3VF0A 2XLOA 4CS9C 1OXBA 3C8ZA 3M4BA 3TULA 5EGYA 1HMDA 4YT2A 2IBFA 4JTDB 1OCCC 4MTOA 4CBEA 4JZAA 2XLEA 4E7SA 3GM3A 3O10A 1AVOB 1H9GA 1OCRC 1BR2A 1TKNA 2CNWA 2WB7A 3T9OA 5DQTA 4UDVA 3DAGA 1EKYA 4NTBA 2QE9A 3GWNA 5BQIA 4MVUA 4G7ZF 4BJ5A 2XS1A 1J8MF 1T6UA 1JAFA 3G4ZA 1ZW3A 1VLTA 4IRUA 1PD1A 4HE8D 3IEEA 1Z7Qc 3RIPA 3V7OA 3I4UA 1D1CA 3FAPB 4AX2A 5DLJA 1NBBA 2IOQA 3DMDA 3FOPA 4MVRA 1LI7A 1HW2A 2B0JA 5JT4A 4ZLDA 3RYLA 3B71A 4DVZA 1WTYA 4J7YA
chains in the Genus database with same CATH topology
1YA7O 1FNTc 1YARO 3IPMO 1Z7Qc 3JTLO 1YAUO 3JRMO 1AVOB 3JSEO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YA7 O;  1FNT c;  1YAR O;  3IPM O;  1Z7Q c;  3JTL O;  1YAU O;  3JRM O;  1AVO B;  3JSE O; 
#chains in the Genus database with same CATH topology
 3NYL A;  1YA7 O;  3NMK A;  1JOG A;  4CSA A;  4CS7 A;  4RBN A;  1ZHW A;  2XS8 A;  4WJ0 A;  3GOR A;  3LLI A;  2P7V A;  1LE2 A;  5KYW B;  2VCB A;  3O39 A;  2V3C C;  4OIO F;  3CSK A;  1YA9 A;  2LQG A;  4GEH A;  3U2M A;  3EH1 A;  1TWG A;  2J9U A;  3LEO A;  3ABL C;  1I4Z A;  1GS9 A;  2YQY A;  5JS5 A;  3U5S A;  4C3D A;  2FGY A;  1ZU5 A;  4I1O B;  4YJW A;  3AGU A;  3RW0 A;  3W8I A;  3S84 A;  3GEI A;  3X2Q C;  2XRH A;  3JTL O;  2J0W A;  3S9O A;  4N6H A;  3JYY A;  1CGN A;  3HNI A;  1LI5 A;  2BE5 F;  3QZC A;  2DYR C;  4OIR F;  3SXK A;  3TOL A;  3DM9 B;  4KNW A;  4MTF A;  2P61 A;  3FHD A;  4U9E A;  2HSQ A;  4M63 A;  4HEA J;  4G0H A;  3DE9 A;  3GM1 A;  5B3S C;  3WAQ A;  1SMY F;  5L0G A;  1JR8 A;  1NG1 A;  2EPL X;  4CDV A;  4ZLC A;  3GWL A;  4WGZ A;  5D91 A;  2NUT A;  3EZH A;  3SXM A;  3LUT B;  2OU6 A;  3KKB A;  3M1C B;  5AGF A;  2W4B A;  2LD6 A;  4NY3 A;  3ZQV A;  4JE9 A;  1QKR A;  3U8P A;  2P1A A;  3DJN B;  2EIK C;  1YZA A;  3C7J A;  2OKU A;  3B29 A;  1NZE A;  3OEO A;  4PR9 A;  4NCQ A;  5COG A;  5T1D B;  2VCC A;  1WGW A;  1XZQ A;  2HSB A;  3IQT A;  4JTA B;  1ZVZ A;  4BEJ A;  4JJG A;  1RMV A;  1LE4 A;  3JRT A;  4N4W A;  3RQF A;  2FAP B;  1VOM A;  2KSF A;  2XLW A;  2NUP A;  3AG3 C;  3NMJ A;  5T3W A;  5A6J A;  1EQ1 A;  1TFK B;  4LDR A;  2P6V A;  4YN0 B;  2EIM C;  4E17 A;  1MQV A;  2CCY A;  4R32 A;  3HNJ A;  2IXN A;  4KI2 A;  3JYH A;  4YT5 A;  3R7C A;  1VK5 A;  2YRF A;  4XLP F;  3ITF A;  2R7Q A;  2YLI A;  1GGQ A;  3Q6N A;  4IB4 A;  4JC7 A;  1HY5 A;  4MND A;  4Z9H A;  1I4Y A;  4CS8 A;  3K33 A;  2MWQ A;  3EFO A;  3EG9 A;  4DOZ A;  3PCV A;  4P6I C;  1ZW2 A;  4H54 A;  3HNK A;  4GQH A;  2KW3 C;  1RJ9 B;  1NFN A;  3R2P A;  2YEV A;  3M79 A;  1O87 A;  4U5E E;  1LM3 B;  3B0V C;  4JW1 A;  3FAJ A;  4AE4 B;  3T6B A;  2JPU A;  3G50 A;  2CW0 F;  3S90 A;  4KNV A;  5KYU B;  3SNH A;  4AL1 A;  3T4R A;  1HMO A;  1ZHT A;  1BR1 A;  2CGE A;  4LLC A;  2JX0 A;  3F46 A;  4K0D A;  1QVX A;  3LS1 A;  2R25 A;  5E33 A;  1OCO C;  4DRJ B;  1M2V B;  2R05 A;  2RD9 A;  4LDK A;  3U8V A;  4RDA A;  3CQZ A;  3QVZ A;  5A6B D;  2ZPA A;  1WN0 A;  4IAO A;  5JVE A;  2A1D D;  1FFH A;  5CIV A;  3UNG C;  3VRC A;  5GPG B;  1H9T A;  5BUO A;  4EUK B;  1HE9 A;  3KYI A;  1A7D A;  1G4W R;  1U0B B;  2C04 A;  4XQ1 A;  4PAC A;  4D4X A;  2Q7R A;  2M4E A;  3A11 A;  256B A;  2EPO A;  2J45 A;  2GA0 A;  4BEM J;  4ER9 A;  1L7C A;  2GDC A;  1YAR O;  2WVN A;  4IJJ A;  4DRH B;  5L0I A;  2Q00 A;  3FXH A;  3LS0 A;  4FES A;  4U9D A;  3C8G D;  1T6Q A;  1BR4 A;  3FVY A;  3NDB B;  2E87 A;  1TQG A;  3A9C A;  4PJL A;  1V54 C;  2L6H A;  1OKK A;  1S7Z A;  1FFT C;  1Z5Z A;  1NFO A;  2Q3T A;  2KJG A;  3E70 C;  1A41 A;  3EHN A;  1J8Y F;  5E3A A;  3ZSU A;  5TJ5 E;  2M64 A;  5FZT A;  2Q9A A;  4MTG A;  2A0U A;  1SYQ A;  1Z23 A;  3TOM A;  4BJ1 A;  5KYW A;  3FDQ A;  2PNO A;  1LKX A;  2QLA A;  2XM0 A;  3IHU A;  4W8P A;  4QDL A;  1YYJ A;  1RXQ A;  2XLH A;  4XPY A;  4Q4Z F;  2C03 A;  1NLX A;  4G7H F;  1TWH A;  2YLG A;  4MS2 A;  2D5R B;  4C3E A;  2KGO A;  2G62 A;  4OIQ F;  2W9Y A;  2X51 A;  1LIH A;  4N06 A;  4IWB A;  3N2Z B;  4LDQ A;  1CPR A;  2B0H A;  4O7G A;  1SR2 A;  2OEX A;  5HSW A;  1E2X A;  2J7P D;  2XL4 A;  4DVY P;  3I5P A;  1WOL A;  2A69 F;  3JCU Q;  1ZZP A;  1NSG B;  4GYT A;  4JEB A;  4EBK A;  1ZHX A;  1V4A A;  4PJM A;  2OCC C;  3F47 A;  5DS4 A;  2MYS A;  2HV7 A;  1QPU A;  2X0C A;  4OIN F;  1T6I A;  3S27 A;  3U3F A;  4ANJ A;  4JKV A;  1SZI A;  2ICW G;  1FAP B;  3HKK A;  3L0I A;  4BG0 A;  1E83 A;  3DE8 A;  2J0X A;  1YVI A;  1CPQ A;  3K6B A;  5A69 A;  1MMA A;  1MNE A;  3K66 A;  1H6G A;  1OW7 A;  3J06 A;  3SEO A;  3LLK A;  1ZYR F;  2PX0 A;  4BPM A;  2G3V A;  1GM5 A;  4E0I A;  1YDI A;  1YYX A;  3PHF 2;  1Q0G A;  2ASR A;  1M2O A;  3IQC A;  4NTA A;  1V74 B;  1CGM E;  3WOD F;  2YHS A;  2EPM X;  3WHN A;  5B3I A;  1K05 A;  1DOV A;  2HUJ A;  3JSE O;  4XWJ A;  1C17 M;  4YWQ A;  3KL4 A;  2PP4 A;  2YL0 A;  3FOO A;  5B1A C;  2R7T A;  2XLM A;  1E86 A;  1VYK A;  3HNL A;  4KC9 A;  4BJT A;  1KU2 A;  4OD4 A;  1VB5 A;  1YAU O;  4JUR I;  1ZHY A;  1B68 A;  2YZS A;  1JPN A;  3NKD A;  1VLS A;  1V55 C;  2A0B A;  3JT1 A;  2QY9 A;  2OJQ A;  2AVK A;  3CAX A;  4IGG A;  3US6 A;  5KYY B;  2R7V A;  1EI7 A;  2GFH A;  2V26 A;  1C03 A;  5JSL A;  3H2U A;  5L3Q A;  2LFD A;  4CJG A;  2DYS C;  4H4K C;  2DGJ A;  2L9J A;  3PMR A;  5L3V A;  1RJ9 A;  4PJJ A;  5L0D A;  3RF3 A;  4U5G A;  2YL1 A;  2CNW D;  3K7D A;  2L7A A;  3CZ6 A;  1QQ3 A;  4EIY A;  5IY5 C;  3RVZ A;  5L0J A;  2IXM A;  2H7V C;  1OR2 A;  1R5I D;  3EHM A;  4AE4 A;  3NRH A;  1O5H A;  4ULV A;  4CS9 A;  5F5F A;  3T6J A;  4X0R A;  1FR0 A;  1YZC A;  3LEV A;  2W4M A;  1M57 C;  5KYU A;  3U9J A;  3O55 A;  1APC A;  3TD7 A;  2Y3B A;  1Q0K A;  4XLN F;  3S28 A;  2VCA A;  3K1I C;  1YLM A;  1M56 C;  1M2V A;  2OG2 A;  1JRA A;  3MLG A;  1Z6A A;  3SXZ A;  3W2W A;  1Y6D A;  4PFP A;  1D0Y A;  1HE1 A;  4HFF B;  3B0U X;  3EPV A;  4LAC B;  4XEV A;  2DI3 A;  1I5N A;  3UMH A;  1E85 A;  3C18 A;  3L34 A;  1KTM A;  5FCL A;  1NU7 D;  2IM8 A;  3POV A;  3AG2 C;  3N24 A;  5COM A;  1BZ4 A;  4J32 B;  2R7W A;  1D0Z A;  4ONS A;  4Q5S F;  2FFH A;  4O6Y A;  3AGT A;  3O6X A;  4CJO A;  2ZXW C;  3MBG A;  3DJU B;  3H65 A;  2AWY A;  1MND A;  3AG1 C;  3T6G B;  4BJ6 A;  3G4X A;  4BJ5 C;  1LS4 A;  4I44 A;  2CYD A;  1Y4C A;  1OCZ C;  2H7O A;  1A0B A;  3VM6 A;  5BQG A;  4E0H A;  2Y69 C;  1TWC A;  2LSE A;  4IAQ A;  4P9F A;  4J7T A;  2TMV P;  4YT8 A;  2R7U A;  3C62 A;  3I5Q A;  1OQC A;  2XL8 A;  2XXA B;  4CIH A;  4O6M A;  2WZF A;  1T01 A;  4CIP A;  4AK9 A;  5KYX B;  1C02 A;  4WGY A;  3ATP A;  4PJN A;  3WG7 C;  3EGX B;  2KK1 A;  4ULW A;  4PFO A;  2YWA A;  3KMI A;  4G78 A;  2J7P A;  1Z3I X;  4WAB A;  2R7R A;  4Z9J A;  4YK5 A;  2EIJ C;  4CSA C;  1DOW A;  2KC3 A;  2J46 A;  3UMK A;  2J9B A;  1KNY A;  4I1M A;  2AU5 A;  3TQO A;  2NG1 A;  3C8G B;  1OW8 A;  2GWW A;  3X1O A;  3LAY A;  4NC3 A;  3ZTM A;  4EBJ A;  5AC4 A;  1WAS A;  1CGO A;  1HW1 A;  2I15 A;  3ABM C;  1BDJ B;  4NTF A;  4C7O B;  3DAF A;  1K40 A;  1NU9 C;  4KBL A;  3V5Z A;  4CDY A;  1R4T A;  2HJ3 A;  1MMD A;  4YL3 A;  4MVM A;  3V5Y A;  3UGP A;  3HTK C;  1OR3 A;  3DXJ F;  4FX5 A;  3DZA A;  1G5Z A;  2EPN A;  3C63 A;  3EGD A;  4HFK B;  3GEH A;  1FNT c;  3S0X A;  2R03 A;  2VB6 A;  2I8B A;  3H2V A;  4A4A A;  4E7Z A;  1MMG A;  5F5H A;  4DBR A;  5JUA A;  2HMQ A;  2DB4 A;  3ZTZ A;  4MW8 A;  1GQA A;  3U0C A;  4OIP F;  2W45 A;  4JRZ A;  3L8I A;  3KYJ A;  1AUE A;  2XL6 A;  5E3C A;  4FAP B;  1ORY A;  2P0N A;  1A7E A;  2KYH A;  2UUI A;  3B9Q A;  5KYN A;  2HJM A;  2HKV A;  2PX3 A;  3VAY A;  1D0X A;  1AEP A;  2YLD A;  4IAR A;  3GAN A;  2AWC A;  3DWW A;  1UG7 A;  1RKE B;  4W8K A;  4EHP A;  2Y3H A;  3AQC A;  3ZDL A;  2QTV A;  3S29 A;  2O9X A;  1RKC A;  3IQ6 A;  3U9M A;  4DBQ A;  2L6F A;  2KNH A;  1PV3 A;  1QZX A;  1OXK A;  3B0P A;  5KYY A;  3IQ5 A;  2PBE A;  4U5B E;  2OEV A;  4U5D E;  3EGD B;  3DD7 A;  3QW0 A;  3UR3 C;  4RD9 A;  4EWC A;  1W2W A;  5T3T A;  2PF4 E;  3E9V A;  2WL8 A;  2LFF A;  3MYF A;  1IZM A;  1G4U S;  2EIL C;  2XSE A;  3W8H A;  1ST6 A;  2ZXR A;  3ZWI A;  1ZU4 A;  2IXO A;  2NSG A;  2GAQ A;  3LNR A;  5D92 A;  4CS8 C;  2EPK X;  1Q0D A;  2R9R B;  2YL7 A;  4J30 B;  4XPW A;  3HJC A;  2QNL A;  2YVK A;  3SXY A;  4K1O A;  4BJ6 C;  3GM2 A;  4CX9 A;  5F28 E;  2BL2 A;  3PDM P;  3ZC4 A;  1PD0 A;  1QSP A;  4N6C A;  3AG4 C;  4OD5 A;  5E2Q A;  2LCH A;  4F4B A;  4JVS A;  2LK4 A;  2Q9C A;  3SP1 A;  2ETS A;  2AP3 A;  2HZ8 A;  3EJN A;  3IPM O;  5L0C A;  1H7I A;  2VH3 A;  2Q4F A;  1OKK D;  1PCX A;  1Q0M A;  4MVS A;  3RQE A;  3CEX A;  5JLI A;  4U5H A;  1BBH A;  3U2L A;  2LP4 A;  3DKA A;  1FMV A;  2EIN C;  5EK0 A;  3RFY A;  3RKO F;  4MQ9 F;  1G8X A;  4DRI B;  3M15 A;  3QMK A;  3RVY A;  3N0T A;  3MX3 A;  2J9V A;  1LS1 A;  1YJG A;  1N1C A;  4MVO A;  4FWV A;  4A2N B;  5DQZ A;  5DS6 A;  2J8W A;  4JTC B;  3Q7L A;  3RQG A;  1FTS A;  5L0F A;  1U89 A;  3JRM O;  4G7O F;  1K04 A;  3RH3 A;  3UGO A;  3Q7G A;  2BC5 A;  2CDQ A;  1Q0F A;  5L0H A;  3NMI A;  4JCZ A;  5A6B A;  2XXA A;  2WZL A;  3QW1 A;  5KYX A;  2VC9 A;  3UMI A;  2F22 A;  2L81 A;  2WVO A;  1LPE A;  1JMW A;  1L3P A;  3EGX A;  3ABK C;  1Z63 A;  1O3U A;  2KQ9 A;  1FMW A;  5JP7 A;  4DXW A;  2HV6 A;  3JSZ A;  3GEE A;  2LIG A;  3BEH A;  4K7B A;  2JD3 A;  3OWT A;  5CI9 A;  1D1A A;  2A6E F;  2WZG A;  3AOU A;  4LER A;  5JRA A;  5A6K A;  3NG1 A;  3ASO C;  1T5O A;  2R02 A;  4NQF A;  2A68 F;  1UFB A;  1XZP A;  2PFD A;  3C8G A;  1SF8 A;  2OQM A;  2Y3G A;  3NKE A;  4I3M A;  4YL1 A;  2QUP A;  1TFO B;  4EBB A;  4C7O A;  2Q9B A;  4XEK A;  2A6H F;  4JIO A;  2ZXP A;  4XTK A;  4EKW A;  3AQB A;  3QVY A;  3KH2 A;  5BQH A;  4D4N A;  3L8J A;  3LNM B;  4XPX A;  4E18 A;  1D1B A;  1U6H A;  2J9W A;  3ZVR A;  1VMA A;  2YL3 A;  3NYJ A;  2MHR A;  1F1M A;  2WVQ A;  2D4U A;  3NYM A;  4MVQ A;  2Y39 A;  2HS5 A;  2XLD A;  3Q6M A;  4QI2 A;  2R7S A;  5CI8 A;  3W4Y A;  4P9T A;  3LES A;  4JCH A;  5B1B C;  2Z15 A;  2NUT B;  3TJ6 A;  1MMN A;  2R7O A;  3W2V A;  3K1H A;  4L6R A;  1ORJ A;  5DVW A;  2ZD9 A;  3DM5 A;  1A7V A;  2IYL D;  3GOD A;  3OA1 A;  2UUH A;  4LLE A;  5COF A;  2XM4 A;  1RKE A;  4MVZ A;  4YL0 A;  2Y3D A;  1ZHZ A;  2L6G A;  2RSE B;  2OOC A;  5HV9 A;  3ZG1 A;  4C3B A;  4U5C E;  2ZXO A;  3EH2 A;  4Z9I A;  5A6A A;  4U5F E;  3DI5 A;  3MFN A;  3MYI A;  3V5X A;  4CDA A;  1LVK A;  3TJ5 A;  5EHH A;  2NPU A;  1XWJ A;  2NUP B;  4JJF A;  1TR2 A;  3SZR A;  5DS5 A;  3QTH A;  2YKZ A;  3JZ0 A;  4JEA A;  3VYW A;  1E84 A;  4AL0 A;  1QLE C;  1VTM P;  1JPJ A;  2OJE D;  4O6N A;  4QI0 A;  3U3B A;  3KPH A;  2VAS A;  2HMZ A;  3ZQY A;  3HLZ A;  1WAT A;  4YT4 A;  2H7B A;  3ECS A;  4PK4 A;  1WWP A;  4XEF A;  3ZIB A;  4Q7C A;  3SYN A;  1T9K A;  2HFI A;  3EFO B;  3EG9 B;  3FMS A;  3TK0 A;  2H8A A;  2R7X A;  2NSF A;  3ASN C;  2IXP A;  4MW3 A;  4DJ9 A;  3L1M A;  5K0I A;  1S05 A;  3M4C A;  1IW7 F;  3EZI A;  3EQL F;  3K1I A;  3LJB A;  5AC5 A;  3AJM A;  2XLV A;  1M6T A;  1RCP A;  1ORS C;  1OW6 A;  1VYI A;  4O79 A;  4B6I A;  1TWA A;  2G3K A;  3BRJ A;  1EA8 A;  3VF0 A;  2XLO A;  4CS9 C;  1OXB A;  3C8Z A;  3M4B A;  3TUL A;  5EGY A;  1HMD A;  4YT2 A;  2IBF A;  4JTD B;  1OCC C;  4MTO A;  4CBE A;  4JZA A;  2XLE A;  4E7S A;  3GM3 A;  3O10 A;  1AVO B;  1H9G A;  1OCR C;  1BR2 A;  1TKN A;  2CNW A;  2WB7 A;  3T9O A;  5DQT A;  4UDV A;  3DAG A;  1EKY A;  4NTB A;  2QE9 A;  3GWN A;  5BQI A;  4MVU A;  4G7Z F;  4BJ5 A;  2XS1 A;  1J8M F;  1T6U A;  1JAF A;  3G4Z A;  1ZW3 A;  1VLT A;  4IRU A;  1PD1 A;  4HE8 D;  3IEE A;  1Z7Q c;  3RIP A;  3V7O A;  3I4U A;  1D1C A;  3FAP B;  4AX2 A;  5DLJ A;  1NBB A;  2IOQ A;  3DMD A;  3FOP A;  4MVR A;  1LI7 A;  1HW2 A;  2B0J A;  5JT4 A;  4ZLD A;  3RYL A;  3B71 A;  4DVZ A;  1WTY A;  4J7Y A; 
#chains in the Genus database with same CATH homology
 1YA7 O;  1FNT c;  1YAR O;  3IPM O;  1Z7Q c;  3JTL O;  1YAU O;  3JRM O;  1AVO B;  3JSE O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...