1YA7O

Implications for interactions of proteasome with pan and pa700 from the 1.9 a structure of a proteasome-11s activator complex
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
228
structure length
218
Chain Sequence
KRAALIQNLRDSYTETSSFAVIEEWAAGTLQEIEGIAKAAAEAHGVIRNSTYGRAQAEKSPEQLLGVLQRYQDLCHNVYCQAETIRTVIAIRIPEHKEEDNLGVAVQHAVLKIIDELEIKTLGSGEKSGSGGAPTPIGMYALREYLSARSTVEDKLLGGGSQSPSLLLELRQIDADFMLKVELATTHLSTMVRAVINAYLLNWKKLIQPRTGSDHMVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase activator
molecule keywords Proteasome alpha subunit
publication title The 1.9 A structure of a proteasome-11S activator complex and implications for proteasome-PAN/PA700 interactions.
pubmed doi rcsb
source organism Thermoplasma acidophilum
total genus 84
structure length 218
sequence length 228
chains with identical sequence P, Q, R, S, T, U
ec nomenclature
pdb deposition date 2004-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF02252 PA28_beta Proteasome activator pa28 beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.180 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Proteasome activator pa28, C-terminal domain 1ya7O01
3JTLO 1YA7O 1Z7Qc 1AVOB 1YAUO 3JRMO 1FNTc 3JSEO 1YARO 3IPMO
chains in the Genus database with same CATH superfamily
1BDJB 2KC3A 4O79A 2OEXA 5JSLA 1VTMP 2PBEA 2QTVA 4OD4A 4CS8A 2GFHA 2VB6A 2AU5A 1TWGA 3NMKA 4XLNF 4E7ZA 3LJBA 5K0IA 5L0GA 2M64A 1HE1A 4PR9A 5DQTA 2BL2A 3T6GB 2BC5A 5L3QA 2CNWA 3U5SA 3KPHA 3GEEA 4C3DA 4YWQA 3M4BA 4KC9A 2R9RB 2YEVA 4IJJA 4EIYA 1K40A 2OCCC 2KW3C 2W45A 2XLOA 4MVSA 4BEMJ 2R7RA 1ORJA 5A6KA 1OCZC 1J8MF 4RBNA 3JRTA 2I8BA 4PFPA 4MTGA 4AL0A 1HW2A 1FNTc 3LS0A 1BZ4A 2EIKC 5BQGA 2H7VC 2HFIA 3LEOA 3N0TA 5JRAA 2EPNA 1BBHA 1WOLA 3HJCA 4U5DE 3TK0A 2J46A 1TFOB 2HSQA 1MMNA 3ZWIA 4X0RA 1OXKA 1Q0MA 4DRIB 3PHF2 1E85A 1D0YA 1HMOA 1YJGA 2A6EF 3W2VA 4EBKA 1LIHA 1L7CA 5BQHA 4CSAA 3O6XA 2YKZA 3EFOB 5A6JA 1VMAA 1NFNA 2J0XA 2WB7A 4A4AA 1I5NA 3EGXB 4A2NB 2J7PD 3V5YA 3GM2A 4U9DA 4E0HA 5EGYA 3ZC4A 1HE9A 2ETSA 1M56C 3IEEA 4YL3A 1U89A 2CNWD 3GANA 1YVIA 3ASNC 3SYNA 2EPMX 4XEKA 5B3IA 1A0BA 1PD1A 2NSGA 4D4XA 1WWPA 3FAJA 4U5HA 4IAQA 3UMIA 3U9MA 2HKVA 3U8VA 4YT4A 4CIPA 1K05A 3HKKA 1JPNA 4IWBA 1QQ3A 4J32B 3RQFA 3UGPA 2WL8A 2MWQA 4LERA 3RVYA 1H6GA 4FWVA 1NU7D 2MYSA 2WZLA 4FX5A 3EG9B 5AGFA 3RFYA 3ZTZA 4XEVA 1SMYF 2YRFA 1LKXA 3S84A 1VYIA 3GWNA 2XXAA 3VYWA 5L0DA 2R7UA 3NKDA 3DKAA 3MYIA 4NY3A 1SZIA 4GYTA 2AWCA 4NC3A 4HFFB 4WGYA 3VF0A 4JURI 4FAPB 5EHHA 3PDMP 3JCUQ 3OEOA 1I4ZA 4N6CA 4MTOA 3TULA 1RMVA 3S28A 2A6HF 4BJ5C 4DJ9A 2NSFA 1L3PA 2A0BA 3O55A 1AEPA 4OIRF 3DI5A 3M4CA 3MBGA 1JOGA 5CI9A 1APCA 2DYRC 2NPUA 4D4NA 5L0FA 2UUIA 2GDCA 1MMGA 2EPLX 4K0DA 5COGA 2XS8A 2P61A 4P6IC 1QPUA 1BR4A 4AX2A 1VLTA 2EINC 3HLZA 3Q6MA 4JE9A 4Q4ZF 3U0CA 2Q9BA 4AE4B 1YLMA 1Q0DA 3G4XA 2VCBA 1MNDA 1TQGA 2PX0A 2D4UA 4HE8D 5DVWA 2NUPB 3OA1A 2CDQA 2F22A 4G7ZF 2CGEA 3KMIA 4L6RA 4U5BE 3C8GB 3KL4A 1Z3IX 3K1IA 5E3AA 2W9YA 3UGOA 4ULWA 1OQCA 2NG1A 3BRJA 5A69A 1NU9C 1V4AA 3GM3A 3G50A 4N4WA 5D91A 3SXYA 3CQZA 2R7OA 1ZU4A 3M1CB 4H4KC 4G0HA 3HTKC 2XM4A 1Q0FA 1QKRA 2MHRA 1QLEC 2OJQA 3SP1A 4CS7A 2JD3A 1U0BB 1ZVZA 3JRMO 1LE2A 3NMJA 1NBBA 1OW6A 2V26A 3DE9A 4DOZA 2X51A 2LFDA 2Q00A 3AJMA 3RYLA 4G7HF 3K33A 4N6HA 1VB5A 3EGXA 1C02A 1OCCC 3A11A 3C63A 3DAFA 4YL1A 4ANJA 4CDAA 1Z23A 3JTLO 1XZPA 2Q3TA 1TWCA 1C17M 4JTCB 4U9EA 2V3CC 1FFHA 2DYSC 3EJNA 2L6HA 4YT5A 1M6TA 4LDQA 3VRCA 3T6BA 1M2VB 1MQVA 2OG2A 1WN0A 2YL1A 1A7VA 3GODA 3TOLA 4BG0A 1LE4A 2J7PA 4JRZA 4ONSA 5COMA 1TFKB 2PP4A 3RVZA 2R7TA 5IY5C 2RD9A 4OIOF 4RD9A 2JPUA 5B1BC 4Z9HA 5E3CA 3QZCA 1YZCA 1ZW3A 2FAPB 3X1OA 4R32A 4HFKB 5CI8A 4CIHA 1B68A 1H9TA 3U8PA 1FAPB 1V74B 2GAQA 2PFDA 2DB4A 2Q9AA 1V54C 2WVNA 1VK5A 2YVKA 2H7BA 2KGOA 1TWHA 3DWWA 3EG9A 3EH1A 4XWJA 2G3VA 2KNHA 4MW3A 5JT4A 3DE8A 3LUTB 256BA 3POVA 1S05A 4DXWA 4G7OF 2FGYA 2HZ8A 1OW8A 3C8ZA 4P9TA 4LLEA 4MVUA 3FXHA 3KKBA 1CGME 3N24A 3SXMA 4CJGA 3GM1A 2P6VA 1H9GA 1T6UA 2XSEA 3NYJA 3V7OA 5T3TA 4IGGA 1FMWA 1D0XA 1TR2A 2EILC 5TJ5E 4KI2A 3AGTA 4JCHA 1Z7Qc 1RCPA 2XL6A 4XEFA 2Y3BA 3EPVA 3VAYA 4E18A 4OIQF 3PMRA 4M63A 4YK5A 1OKKA 2YQYA 4XPYA 4EWCA 3IQTA 3MLGA 2ZD9A 1UFBA 2VC9A 3JZ0A 2R05A 3LNRA 3V5XA 2R02A 1I4YA 4P9FA 3UNGC 1ZHTA 4B6IA 1U6HA 3WHNA 4AE4A 4JEBA 4C7OB 3V5ZA 3EZHA 4IARA 1FTSA 1QSPA 1JPJA 2YLIA 3LS1A 1NFOA 3IQ5A 2LSEA 3JT1A 4MS2A 2NUTB 2L81A 3K7DA 2NUPA 1HY5A 3N2ZB 4BJTA 1FFTC 3JSEO 2HJ3A 4O6NA 2HS5A 2WVOA 2YZSA 3C8GA 3MFNA 4J7YA 4QI0A 3WG7C 2D5RB 1LS1A 3K66A 4NQFA 1T6IA 3DAGA 4LDKA 2EPOA 2BE5F 3QW1A 3K6BA 1JMWA 2YL3A 4MVMA 3RQEA 3G4ZA 4EBJA 5A6BA 3WAQA 3VM6A 2LD6A 3NG1A 2FFHA 2EIJC 1LVKA 1VLSA 2J0WA 3ZVRA 4I44A 4WJ0A 5JVEA 1ORSC 4UDVA 1DOWA 2PNOA 4U5CE 1S7ZA 5D92A 3I5PA 2AWYA 3RQGA 2YL7A 4G78A 2L6FA 2Y3GA 3AGUA 3M15A 2IXMA 2L9JA 2KQ9A 4J7TA 4KNVA 4OINF 4YJWA 4C7OA 1K04A 1D0ZA 3EH2A 2P7VA 2IYLD 3ZDLA 1N1CA 2Q9CA 4MW8A 1ZYRF 1OKKD 3UMHA 1SYQA 3JYYA 2PF4E 3H2VA 1AUEA 4C3EA 3RH3A 1SR2A 3TOMA 2LK4A 2A68F 3E9VA 2E87A 2OOCA 1WTYA 2IOQA 5KYWB 1M2VA 2R7VA 4ZLCA 4CS9C 1ZU5A 1HMDA 3FOOA 3MYFA 2RSEB 3B71A 3RW0A 3CZ6A 1E86A 3W4YA 3RKOF 3RIPA 4DVYP 1E84A 3CSKA 3L34A 5DS5A 3C18A 1OXBA 1ST6A 2AVKA 3C8GD 1IW7F 1RKEB 4JW1A 3AQBA 1Z63A 1V55C 2P0NA 5A6BD 4DBQA 3FOPA 3I4UA 2A1DD 1JRAA 2QE9A 1RJ9B 2XLEA 5KYXB 4EBBA 1M2OA 3K1IC 3NYLA 2HV6A 4K7BA 1DOVA 5F28E 3ZG1A 1PD0A 4OIPF 5T1DB 2XLMA 4MVOA 4N06A 2C04A 3DD7A 4K1OA 3GEHA 1CPQA 1WATA 3JSZA 4ULVA 5BQIA 4MNDA 3L8IA 2LCHA 3SEOA 4EHPA 5F5HA 4BJ6C 5JP7A 2R7XA 3E70C 2GWWA 4PJNA 3FVYA 3X2QC 1IZMA 1ORYA 2QLAA 2L7AA 1LPEA 4Z9JA 3AG3C 2YL0A 2HMZA 1D1AA 4MQ9F 5AC4A 2QNLA 1TKNA 4WGZA 2YWAA 1QVXA 4JJFA 3EFOA 1YA9A 2C03A 1A41A 1BR2A 2KSFA 5E33A 4EKWA 5L3VA 1C03A 2J9VA 4DRHB 1JR8A 1E2XA 1W2WA 1A7EA 2CYDA 2VCAA 2Y69C 3ABMC 1EKYA 4O6MA 2H7OA 3UR3C 1WGWA 3U3BA 3H2UA 4CDYA 2LFFA 4XLPF 3U3FA 3DM5A 1YARO 1ZZPA 3FAPB 2OEVA 1ZHWA 3ABKC 2NUTA 4FESA 2L6GA 3EGDB 4RDAA 4U5FE 3T4RA 4BJ1A 1UG7A 2IM8A 5BUOA 3ABLC 2VASA 4CS8C 1E83A 4JTAB 4DVZA 4O7GA 3DXJF 3QMKA 3CAXA 4CBEA 4JIOA 3EHMA 2J9UA 1R5ID 2VCCA 4XTKA 3PCVA 1NZEA 2ASRA 1PCXA 3I5QA 3S29A 2DI3A 2B0HA 3AQCA 4E7SA 2EPKX 3IPMO 3LLKA 3O39A 3C7JA 1GM5A 2EIMC 3TJ6A 3LESA 1QZXA 3AOUA 3LLIA 3TD7A 2YLDA 4JCZA 4QDLA 3NYMA 3LNMB 1ZHYA 3S90A 1XWJA 4XQ1A 3RF3A 2HSBA 5F5FA 3NRHA 1KTMA 4KNWA 4IRUA 1CGOA 2XRHA 1Q0KA 3LEVA 4PJMA 4EUKB 1A7DA 5DS4A 3HNJA 2KK1A 2J9WA 2CW0F 1OR3A 3OWTA 1F1MA 2JX0A 3NDBB 4YT2A 3J06A 2O9XA 4GQHA 5CIVA 3FDQA 2QUPA 1CPRA 3MX3A 5KYWA 2Q7RA 1OW7A 2LP4A 2P1AA 4I3MA 4YT8A 1FR0A 4CSAC 4KBLA 5KYUB 2OU6A 3HNIA 4I1MA 1Z6AA 2PX3A 3EHNA 4NTFA 1D1CA 3S0XA 2YLGA 2XLDA 3A9CA 4GEHA 1G5ZA 1Q0GA 1LM3B 1RKEA 1T5OA 4BEJA 5KYYB 2QY9A 3ECSA 3FHDA 4Q5SF 5FZTA 3ZQYA 3B0VC 5HV9A 4CDVA 5EK0A 5JLIA 2ZXRA 4H54A 5DLJA 1LS4A 2IBFA 4YN0B 2G62A 3QW0A 4W8KA 1RKCA 3DZAA 5DQZA 3NKEA 4C3BA 1GS9A 1RJ9A 2ICWG 5L0CA 3GWLA 5KYXA 2TMVP 2Z15A 3K1HA 4W8PA 5E2QA 4MTFA 4NTBA 1GGQA 1J8YF 2W4MA 3R7CA 5B1AC 4XPWA 3LAYA 1O5HA 3ZQVA 1KU2A 3S9OA 2YHSA 2CCYA 1Y4CA 3DJUB 1G4US 3SXKA 3NMIA 3B0UX 1T6QA 1Y6DA 2HUJA 1YYXA 3Q6NA 3EQLF 2B0JA 3B29A 5COFA 2XLHA 1G8XA 2Y39A 2ZXPA 5AC5A 1T9KA 2G3KA 4MVRA 1MMDA 5HSWA 3U2MA 1D1BA 1VYKA 3IHUA 3UMKA 1YAUO 3AG4C 3HNLA 4Q7CA 3AG2C 5A6AA 1VOMA 1TWAA 1XZQA 1ZHZA 4J30B 2Y3DA 5JS5A 2R25A 4F4BA 3B9QA 1MMAA 4IB4A 5DS6A 4NCQA 3ASOC 3ZSUA 3L8JA 3AG1C 2XM0A 3T9OA 3EGDA 4AK9A 4CJOA 3W2WA 4WABA 5L0JA 4JZAA 1HW1A 2WZFA 4E17A 2OJED 2Y3HA 1O87A 4JC7A 3U9JA 1JAFA 1RXQA 3C62A 1GQAA 3EZIA 3IQCA 2KJGA 3TQOA 2DGJA 1NLXA 1OCRC 3F46A 1T01A 2Q4FA 3US6A 3U2LA 4MVQA 3ZTMA 1NSGB 1OR2A 2LIGA 1EA8A 4ER9A 2ZXOA 2R7SA 1WASA 2UUHA 2HV7A 2I15A 2WZGA 4IAOA 4XPXA 2ZPAA 4PJLA 3SNHA 2VH3A 2OQMA 4BJ5A 4CS9A 3DM9B 3CEXA 1H7IA 4NTAA 2ZXWC 1CGNA 5L0IA 1OCOC 4Z9IA 3L1MA 2XL4A 1YYJA 2AP3A 1MNEA 2J9BA 3GORA 4OD5A 1NG1A 5GPGB 4DBRA 3KYIA 4JKVA 2X0CA 5KYNA 3FMSA 2GA0A 3JYHA 3ZIBA 5FCLA 4LDRA 3M79A 1EI7A 3KYJA 3W8IA 3S27A 2IXNA 3WODF 1Z5ZA 3Q7GA 2LQGA 5KYUA 1G4WR 3HNKA 1SF8A 3GEIA 4JJGA 5B3SC 1R4TA 1BR1A 1FMVA 4E0IA 2XL8A 3QVYA 3L0IA 4U5GA 1YZAA 2R7QA 2WVQA 4CX9A 3DJNB 3DMDA 5KYYA 3F47A 2XS1A 4JEAA 2KYHA 4QI2A 4ZLDA 5L0HA 4O6YA 3QTHA 3W8HA 1ZW2A 2R7WA 2HMQA 1O3UA 3ATPA 3IQ6A 2R03A 3Q7LA 4LACB 4PK4A 4I1OB 2H8AA 3H65A 3ITFA 2XLWA 4PJJA 4BJ6A 4HEAJ 2A0UA 2M4EA 1KNYA 3QVZA 1AVOB 1LI5A 2A69F 5T3WA 2XXAB 4JVSA 4JTDB 4PFOA 4LLCA 3O10A 1EQ1A 1M57C 4YL0A 2IXPA 2J8WA 3B0PA 4AL1A 5JUAA 4PACA 4U5EE 3T6JA 1YDIA 2HJMA 4MVZA 3SXZA 1YA7O 4BPMA 2OKUA 2XLVA 2IXOA 1ZHXA 2W4BA 3BEHA 3KH2A 4DRJB 3R2PA 3SZRA 1PV3A 1LI7A 3TJ5A 2J45A
chains in the Genus database with same CATH topology
3JTLO 1YA7O 1Z7Qc 1AVOB 1YAUO 3JRMO 1FNTc 3JSEO 1YARO 3IPMO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JTL O;  1YA7 O;  1Z7Q c;  1AVO B;  1YAU O;  3JRM O;  1FNT c;  3JSE O;  1YAR O;  3IPM O; 
#chains in the Genus database with same CATH topology
 1BDJ B;  2KC3 A;  4O79 A;  2OEX A;  5JSL A;  1VTM P;  2PBE A;  2QTV A;  4OD4 A;  4CS8 A;  2GFH A;  2VB6 A;  2AU5 A;  1TWG A;  3NMK A;  4XLN F;  4E7Z A;  3LJB A;  5K0I A;  5L0G A;  2M64 A;  1HE1 A;  4PR9 A;  5DQT A;  2BL2 A;  3T6G B;  2BC5 A;  5L3Q A;  2CNW A;  3U5S A;  3KPH A;  3GEE A;  4C3D A;  4YWQ A;  3M4B A;  4KC9 A;  2R9R B;  2YEV A;  4IJJ A;  4EIY A;  1K40 A;  2OCC C;  2KW3 C;  2W45 A;  2XLO A;  4MVS A;  4BEM J;  2R7R A;  1ORJ A;  5A6K A;  1OCZ C;  1J8M F;  4RBN A;  3JRT A;  2I8B A;  4PFP A;  4MTG A;  4AL0 A;  1HW2 A;  1FNT c;  3LS0 A;  1BZ4 A;  2EIK C;  5BQG A;  2H7V C;  2HFI A;  3LEO A;  3N0T A;  5JRA A;  2EPN A;  1BBH A;  1WOL A;  3HJC A;  4U5D E;  3TK0 A;  2J46 A;  1TFO B;  2HSQ A;  1MMN A;  3ZWI A;  4X0R A;  1OXK A;  1Q0M A;  4DRI B;  3PHF 2;  1E85 A;  1D0Y A;  1HMO A;  1YJG A;  2A6E F;  3W2V A;  4EBK A;  1LIH A;  1L7C A;  5BQH A;  4CSA A;  3O6X A;  2YKZ A;  3EFO B;  5A6J A;  1VMA A;  1NFN A;  2J0X A;  2WB7 A;  4A4A A;  1I5N A;  3EGX B;  4A2N B;  2J7P D;  3V5Y A;  3GM2 A;  4U9D A;  4E0H A;  5EGY A;  3ZC4 A;  1HE9 A;  2ETS A;  1M56 C;  3IEE A;  4YL3 A;  1U89 A;  2CNW D;  3GAN A;  1YVI A;  3ASN C;  3SYN A;  2EPM X;  4XEK A;  5B3I A;  1A0B A;  1PD1 A;  2NSG A;  4D4X A;  1WWP A;  3FAJ A;  4U5H A;  4IAQ A;  3UMI A;  3U9M A;  2HKV A;  3U8V A;  4YT4 A;  4CIP A;  1K05 A;  3HKK A;  1JPN A;  4IWB A;  1QQ3 A;  4J32 B;  3RQF A;  3UGP A;  2WL8 A;  2MWQ A;  4LER A;  3RVY A;  1H6G A;  4FWV A;  1NU7 D;  2MYS A;  2WZL A;  4FX5 A;  3EG9 B;  5AGF A;  3RFY A;  3ZTZ A;  4XEV A;  1SMY F;  2YRF A;  1LKX A;  3S84 A;  1VYI A;  3GWN A;  2XXA A;  3VYW A;  5L0D A;  2R7U A;  3NKD A;  3DKA A;  3MYI A;  4NY3 A;  1SZI A;  4GYT A;  2AWC A;  4NC3 A;  4HFF B;  4WGY A;  3VF0 A;  4JUR I;  4FAP B;  5EHH A;  3PDM P;  3JCU Q;  3OEO A;  1I4Z A;  4N6C A;  4MTO A;  3TUL A;  1RMV A;  3S28 A;  2A6H F;  4BJ5 C;  4DJ9 A;  2NSF A;  1L3P A;  2A0B A;  3O55 A;  1AEP A;  4OIR F;  3DI5 A;  3M4C A;  3MBG A;  1JOG A;  5CI9 A;  1APC A;  2DYR C;  2NPU A;  4D4N A;  5L0F A;  2UUI A;  2GDC A;  1MMG A;  2EPL X;  4K0D A;  5COG A;  2XS8 A;  2P61 A;  4P6I C;  1QPU A;  1BR4 A;  4AX2 A;  1VLT A;  2EIN C;  3HLZ A;  3Q6M A;  4JE9 A;  4Q4Z F;  3U0C A;  2Q9B A;  4AE4 B;  1YLM A;  1Q0D A;  3G4X A;  2VCB A;  1MND A;  1TQG A;  2PX0 A;  2D4U A;  4HE8 D;  5DVW A;  2NUP B;  3OA1 A;  2CDQ A;  2F22 A;  4G7Z F;  2CGE A;  3KMI A;  4L6R A;  4U5B E;  3C8G B;  3KL4 A;  1Z3I X;  3K1I A;  5E3A A;  2W9Y A;  3UGO A;  4ULW A;  1OQC A;  2NG1 A;  3BRJ A;  5A69 A;  1NU9 C;  1V4A A;  3GM3 A;  3G50 A;  4N4W A;  5D91 A;  3SXY A;  3CQZ A;  2R7O A;  1ZU4 A;  3M1C B;  4H4K C;  4G0H A;  3HTK C;  2XM4 A;  1Q0F A;  1QKR A;  2MHR A;  1QLE C;  2OJQ A;  3SP1 A;  4CS7 A;  2JD3 A;  1U0B B;  1ZVZ A;  3JRM O;  1LE2 A;  3NMJ A;  1NBB A;  1OW6 A;  2V26 A;  3DE9 A;  4DOZ A;  2X51 A;  2LFD A;  2Q00 A;  3AJM A;  3RYL A;  4G7H F;  3K33 A;  4N6H A;  1VB5 A;  3EGX A;  1C02 A;  1OCC C;  3A11 A;  3C63 A;  3DAF A;  4YL1 A;  4ANJ A;  4CDA A;  1Z23 A;  3JTL O;  1XZP A;  2Q3T A;  1TWC A;  1C17 M;  4JTC B;  4U9E A;  2V3C C;  1FFH A;  2DYS C;  3EJN A;  2L6H A;  4YT5 A;  1M6T A;  4LDQ A;  3VRC A;  3T6B A;  1M2V B;  1MQV A;  2OG2 A;  1WN0 A;  2YL1 A;  1A7V A;  3GOD A;  3TOL A;  4BG0 A;  1LE4 A;  2J7P A;  4JRZ A;  4ONS A;  5COM A;  1TFK B;  2PP4 A;  3RVZ A;  2R7T A;  5IY5 C;  2RD9 A;  4OIO F;  4RD9 A;  2JPU A;  5B1B C;  4Z9H A;  5E3C A;  3QZC A;  1YZC A;  1ZW3 A;  2FAP B;  3X1O A;  4R32 A;  4HFK B;  5CI8 A;  4CIH A;  1B68 A;  1H9T A;  3U8P A;  1FAP B;  1V74 B;  2GAQ A;  2PFD A;  2DB4 A;  2Q9A A;  1V54 C;  2WVN A;  1VK5 A;  2YVK A;  2H7B A;  2KGO A;  1TWH A;  3DWW A;  3EG9 A;  3EH1 A;  4XWJ A;  2G3V A;  2KNH A;  4MW3 A;  5JT4 A;  3DE8 A;  3LUT B;  256B A;  3POV A;  1S05 A;  4DXW A;  4G7O F;  2FGY A;  2HZ8 A;  1OW8 A;  3C8Z A;  4P9T A;  4LLE A;  4MVU A;  3FXH A;  3KKB A;  1CGM E;  3N24 A;  3SXM A;  4CJG A;  3GM1 A;  2P6V A;  1H9G A;  1T6U A;  2XSE A;  3NYJ A;  3V7O A;  5T3T A;  4IGG A;  1FMW A;  1D0X A;  1TR2 A;  2EIL C;  5TJ5 E;  4KI2 A;  3AGT A;  4JCH A;  1Z7Q c;  1RCP A;  2XL6 A;  4XEF A;  2Y3B A;  3EPV A;  3VAY A;  4E18 A;  4OIQ F;  3PMR A;  4M63 A;  4YK5 A;  1OKK A;  2YQY A;  4XPY A;  4EWC A;  3IQT A;  3MLG A;  2ZD9 A;  1UFB A;  2VC9 A;  3JZ0 A;  2R05 A;  3LNR A;  3V5X A;  2R02 A;  1I4Y A;  4P9F A;  3UNG C;  1ZHT A;  4B6I A;  1U6H A;  3WHN A;  4AE4 A;  4JEB A;  4C7O B;  3V5Z A;  3EZH A;  4IAR A;  1FTS A;  1QSP A;  1JPJ A;  2YLI A;  3LS1 A;  1NFO A;  3IQ5 A;  2LSE A;  3JT1 A;  4MS2 A;  2NUT B;  2L81 A;  3K7D A;  2NUP A;  1HY5 A;  3N2Z B;  4BJT A;  1FFT C;  3JSE O;  2HJ3 A;  4O6N A;  2HS5 A;  2WVO A;  2YZS A;  3C8G A;  3MFN A;  4J7Y A;  4QI0 A;  3WG7 C;  2D5R B;  1LS1 A;  3K66 A;  4NQF A;  1T6I A;  3DAG A;  4LDK A;  2EPO A;  2BE5 F;  3QW1 A;  3K6B A;  1JMW A;  2YL3 A;  4MVM A;  3RQE A;  3G4Z A;  4EBJ A;  5A6B A;  3WAQ A;  3VM6 A;  2LD6 A;  3NG1 A;  2FFH A;  2EIJ C;  1LVK A;  1VLS A;  2J0W A;  3ZVR A;  4I44 A;  4WJ0 A;  5JVE A;  1ORS C;  4UDV A;  1DOW A;  2PNO A;  4U5C E;  1S7Z A;  5D92 A;  3I5P A;  2AWY A;  3RQG A;  2YL7 A;  4G78 A;  2L6F A;  2Y3G A;  3AGU A;  3M15 A;  2IXM A;  2L9J A;  2KQ9 A;  4J7T A;  4KNV A;  4OIN F;  4YJW A;  4C7O A;  1K04 A;  1D0Z A;  3EH2 A;  2P7V A;  2IYL D;  3ZDL A;  1N1C A;  2Q9C A;  4MW8 A;  1ZYR F;  1OKK D;  3UMH A;  1SYQ A;  3JYY A;  2PF4 E;  3H2V A;  1AUE A;  4C3E A;  3RH3 A;  1SR2 A;  3TOM A;  2LK4 A;  2A68 F;  3E9V A;  2E87 A;  2OOC A;  1WTY A;  2IOQ A;  5KYW B;  1M2V A;  2R7V A;  4ZLC A;  4CS9 C;  1ZU5 A;  1HMD A;  3FOO A;  3MYF A;  2RSE B;  3B71 A;  3RW0 A;  3CZ6 A;  1E86 A;  3W4Y A;  3RKO F;  3RIP A;  4DVY P;  1E84 A;  3CSK A;  3L34 A;  5DS5 A;  3C18 A;  1OXB A;  1ST6 A;  2AVK A;  3C8G D;  1IW7 F;  1RKE B;  4JW1 A;  3AQB A;  1Z63 A;  1V55 C;  2P0N A;  5A6B D;  4DBQ A;  3FOP A;  3I4U A;  2A1D D;  1JRA A;  2QE9 A;  1RJ9 B;  2XLE A;  5KYX B;  4EBB A;  1M2O A;  3K1I C;  3NYL A;  2HV6 A;  4K7B A;  1DOV A;  5F28 E;  3ZG1 A;  1PD0 A;  4OIP F;  5T1D B;  2XLM A;  4MVO A;  4N06 A;  2C04 A;  3DD7 A;  4K1O A;  3GEH A;  1CPQ A;  1WAT A;  3JSZ A;  4ULV A;  5BQI A;  4MND A;  3L8I A;  2LCH A;  3SEO A;  4EHP A;  5F5H A;  4BJ6 C;  5JP7 A;  2R7X A;  3E70 C;  2GWW A;  4PJN A;  3FVY A;  3X2Q C;  1IZM A;  1ORY A;  2QLA A;  2L7A A;  1LPE A;  4Z9J A;  3AG3 C;  2YL0 A;  2HMZ A;  1D1A A;  4MQ9 F;  5AC4 A;  2QNL A;  1TKN A;  4WGZ A;  2YWA A;  1QVX A;  4JJF A;  3EFO A;  1YA9 A;  2C03 A;  1A41 A;  1BR2 A;  2KSF A;  5E33 A;  4EKW A;  5L3V A;  1C03 A;  2J9V A;  4DRH B;  1JR8 A;  1E2X A;  1W2W A;  1A7E A;  2CYD A;  2VCA A;  2Y69 C;  3ABM C;  1EKY A;  4O6M A;  2H7O A;  3UR3 C;  1WGW A;  3U3B A;  3H2U A;  4CDY A;  2LFF A;  4XLP F;  3U3F A;  3DM5 A;  1YAR O;  1ZZP A;  3FAP B;  2OEV A;  1ZHW A;  3ABK C;  2NUT A;  4FES A;  2L6G A;  3EGD B;  4RDA A;  4U5F E;  3T4R A;  4BJ1 A;  1UG7 A;  2IM8 A;  5BUO A;  3ABL C;  2VAS A;  4CS8 C;  1E83 A;  4JTA B;  4DVZ A;  4O7G A;  3DXJ F;  3QMK A;  3CAX A;  4CBE A;  4JIO A;  3EHM A;  2J9U A;  1R5I D;  2VCC A;  4XTK A;  3PCV A;  1NZE A;  2ASR A;  1PCX A;  3I5Q A;  3S29 A;  2DI3 A;  2B0H A;  3AQC A;  4E7S A;  2EPK X;  3IPM O;  3LLK A;  3O39 A;  3C7J A;  1GM5 A;  2EIM C;  3TJ6 A;  3LES A;  1QZX A;  3AOU A;  3LLI A;  3TD7 A;  2YLD A;  4JCZ A;  4QDL A;  3NYM A;  3LNM B;  1ZHY A;  3S90 A;  1XWJ A;  4XQ1 A;  3RF3 A;  2HSB A;  5F5F A;  3NRH A;  1KTM A;  4KNW A;  4IRU A;  1CGO A;  2XRH A;  1Q0K A;  3LEV A;  4PJM A;  4EUK B;  1A7D A;  5DS4 A;  3HNJ A;  2KK1 A;  2J9W A;  2CW0 F;  1OR3 A;  3OWT A;  1F1M A;  2JX0 A;  3NDB B;  4YT2 A;  3J06 A;  2O9X A;  4GQH A;  5CIV A;  3FDQ A;  2QUP A;  1CPR A;  3MX3 A;  5KYW A;  2Q7R A;  1OW7 A;  2LP4 A;  2P1A A;  4I3M A;  4YT8 A;  1FR0 A;  4CSA C;  4KBL A;  5KYU B;  2OU6 A;  3HNI A;  4I1M A;  1Z6A A;  2PX3 A;  3EHN A;  4NTF A;  1D1C A;  3S0X A;  2YLG A;  2XLD A;  3A9C A;  4GEH A;  1G5Z A;  1Q0G A;  1LM3 B;  1RKE A;  1T5O A;  4BEJ A;  5KYY B;  2QY9 A;  3ECS A;  3FHD A;  4Q5S F;  5FZT A;  3ZQY A;  3B0V C;  5HV9 A;  4CDV A;  5EK0 A;  5JLI A;  2ZXR A;  4H54 A;  5DLJ A;  1LS4 A;  2IBF A;  4YN0 B;  2G62 A;  3QW0 A;  4W8K A;  1RKC A;  3DZA A;  5DQZ A;  3NKE A;  4C3B A;  1GS9 A;  1RJ9 A;  2ICW G;  5L0C A;  3GWL A;  5KYX A;  2TMV P;  2Z15 A;  3K1H A;  4W8P A;  5E2Q A;  4MTF A;  4NTB A;  1GGQ A;  1J8Y F;  2W4M A;  3R7C A;  5B1A C;  4XPW A;  3LAY A;  1O5H A;  3ZQV A;  1KU2 A;  3S9O A;  2YHS A;  2CCY A;  1Y4C A;  3DJU B;  1G4U S;  3SXK A;  3NMI A;  3B0U X;  1T6Q A;  1Y6D A;  2HUJ A;  1YYX A;  3Q6N A;  3EQL F;  2B0J A;  3B29 A;  5COF A;  2XLH A;  1G8X A;  2Y39 A;  2ZXP A;  5AC5 A;  1T9K A;  2G3K A;  4MVR A;  1MMD A;  5HSW A;  3U2M A;  1D1B A;  1VYK A;  3IHU A;  3UMK A;  1YAU O;  3AG4 C;  3HNL A;  4Q7C A;  3AG2 C;  5A6A A;  1VOM A;  1TWA A;  1XZQ A;  1ZHZ A;  4J30 B;  2Y3D A;  5JS5 A;  2R25 A;  4F4B A;  3B9Q A;  1MMA A;  4IB4 A;  5DS6 A;  4NCQ A;  3ASO C;  3ZSU A;  3L8J A;  3AG1 C;  2XM0 A;  3T9O A;  3EGD A;  4AK9 A;  4CJO A;  3W2W A;  4WAB A;  5L0J A;  4JZA A;  1HW1 A;  2WZF A;  4E17 A;  2OJE D;  2Y3H A;  1O87 A;  4JC7 A;  3U9J A;  1JAF A;  1RXQ A;  3C62 A;  1GQA A;  3EZI A;  3IQC A;  2KJG A;  3TQO A;  2DGJ A;  1NLX A;  1OCR C;  3F46 A;  1T01 A;  2Q4F A;  3US6 A;  3U2L A;  4MVQ A;  3ZTM A;  1NSG B;  1OR2 A;  2LIG A;  1EA8 A;  4ER9 A;  2ZXO A;  2R7S A;  1WAS A;  2UUH A;  2HV7 A;  2I15 A;  2WZG A;  4IAO A;  4XPX A;  2ZPA A;  4PJL A;  3SNH A;  2VH3 A;  2OQM A;  4BJ5 A;  4CS9 A;  3DM9 B;  3CEX A;  1H7I A;  4NTA A;  2ZXW C;  1CGN A;  5L0I A;  1OCO C;  4Z9I A;  3L1M A;  2XL4 A;  1YYJ A;  2AP3 A;  1MNE A;  2J9B A;  3GOR A;  4OD5 A;  1NG1 A;  5GPG B;  4DBR A;  3KYI A;  4JKV A;  2X0C A;  5KYN A;  3FMS A;  2GA0 A;  3JYH A;  3ZIB A;  5FCL A;  4LDR A;  3M79 A;  1EI7 A;  3KYJ A;  3W8I A;  3S27 A;  2IXN A;  3WOD F;  1Z5Z A;  3Q7G A;  2LQG A;  5KYU A;  1G4W R;  3HNK A;  1SF8 A;  3GEI A;  4JJG A;  5B3S C;  1R4T A;  1BR1 A;  1FMV A;  4E0I A;  2XL8 A;  3QVY A;  3L0I A;  4U5G A;  1YZA A;  2R7Q A;  2WVQ A;  4CX9 A;  3DJN B;  3DMD A;  5KYY A;  3F47 A;  2XS1 A;  4JEA A;  2KYH A;  4QI2 A;  4ZLD A;  5L0H A;  4O6Y A;  3QTH A;  3W8H A;  1ZW2 A;  2R7W A;  2HMQ A;  1O3U A;  3ATP A;  3IQ6 A;  2R03 A;  3Q7L A;  4LAC B;  4PK4 A;  4I1O B;  2H8A A;  3H65 A;  3ITF A;  2XLW A;  4PJJ A;  4BJ6 A;  4HEA J;  2A0U A;  2M4E A;  1KNY A;  3QVZ A;  1AVO B;  1LI5 A;  2A69 F;  5T3W A;  2XXA B;  4JVS A;  4JTD B;  4PFO A;  4LLC A;  3O10 A;  1EQ1 A;  1M57 C;  4YL0 A;  2IXP A;  2J8W A;  3B0P A;  4AL1 A;  5JUA A;  4PAC A;  4U5E E;  3T6J A;  1YDI A;  2HJM A;  4MVZ A;  3SXZ A;  1YA7 O;  4BPM A;  2OKU A;  2XLV A;  2IXO A;  1ZHX A;  2W4B A;  3BEH A;  3KH2 A;  4DRJ B;  3R2P A;  3SZR A;  1PV3 A;  1LI7 A;  3TJ5 A;  2J45 A; 
#chains in the Genus database with same CATH homology
 3JTL O;  1YA7 O;  1Z7Q c;  1AVO B;  1YAU O;  3JRM O;  1FNT c;  3JSE O;  1YAR O;  3IPM O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...