1YA7O

Implications for interactions of proteasome with pan and pa700 from the 1.9 a structure of a proteasome-11s activator complex
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
228
structure length
218
Chain Sequence
KRAALIQNLRDSYTETSSFAVIEEWAAGTLQEIEGIAKAAAEAHGVIRNSTYGRAQAEKSPEQLLGVLQRYQDLCHNVYCQAETIRTVIAIRIPEHKEEDNLGVAVQHAVLKIIDELEIKTLGSGEKSGSGGAPTPIGMYALREYLSARSTVEDKLLGGGSQSPSLLLELRQIDADFMLKVELATTHLSTMVRAVINAYLLNWKKLIQPRTGSDHMVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteasome alpha subunit
publication title The 1.9 A structure of a proteasome-11S activator complex and implications for proteasome-PAN/PA700 interactions.
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase/hydrolase activator
total genus 84
structure length 218
sequence length 228
chains with identical sequence P, Q, R, S, T, U
ec nomenclature
pdb deposition date 2004-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF02252 PA28_beta Proteasome activator pa28 beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.180 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Proteasome activator pa28, C-terminal domain 1ya7O01
1YARO 3JTLO 1FNTc 1YA7O 1YAUO 1AVOB 3IPMO 3JSEO 1Z7Qc 3JRMO
chains in the Genus database with same CATH superfamily
4LLEA 4N6CA 4G78A 4L6RA 2W4MA 2OKUA 2WVOA 3MX3A 2DI3A 2W45A 3G4ZA 1MMAA 5E3AA 3NYMA 5A6BA 2XL6A 4G7ZF 3GWLA 3H65A 2GFHA 2DGJA 5B1BC 4EWCA 2XM4A 3AJMA 1NU7D 2JD3A 3M4CA 1YVIA 4YK5A 2BL2A 4C7OB 4N4WA 2WB7A 4JJFA 1CGOA 3GM3A 4U5BE 1QKRA 4P6IC 4BG0A 5FCLA 1G4US 1A7DA 1LIHA 2KNHA 1FTSA 3KYJA 3LS0A 4JW1A 2KQ9A 3OEOA 3RIPA 1OW6A 3T6GB 1LE2A 4XTKA 5HV9A 2R9RB 3U9MA 3T6BA 3FHDA 2IOQA 3AOUA 4AL0A 1LI7A 4JEBA 4ER9A 4Q5SF 1C17M 2PFDA 4XWJA 3CSKA 3ATPA 2CW0F 3IPMO 4NCQA 1N1CA 3IQ6A 3DJNB 2NUTB 3T4RA 3LNRA 1G5ZA 3GWNA 3EG9A 4PJMA 1I4ZA 1QPUA 2EIJC 3HNIA 2NG1A 1H7IA 2J46A 4MVMA 2WVNA 3RYLA 3HNJA 1XZPA 1RMVA 1LS4A 2HJMA 1J8YF 4JEAA 3U8PA 1OCZC 2J9BA 4HEAJ 4KI2A 3U2LA 1MMNA 4GQHA 2XS8A 2I8BA 3NMJA 3S28A 1IZMA 3SP1A 1CPQA 3ZWIA 4DRIB 1Z6AA 2VCBA 1FMVA 3DI5A 4JKVA 4ANJA 2AVKA 4G0HA 4OIQF 3RKOF 4J7TA 2Y69C 1O5HA 2J9VA 3I4UA 3S9OA 1JPNA 1V55C 4C3DA 1SMYF 3B29A 2R7SA 4DRHB 3QW1A 1K40A 4J30B 3RVZA 3KH2A 2QE9A 2WZGA 2HUJA 1LI5A 3C18A 4ZLCA 3FVYA 4I44A 1D1CA 4IJJA 2KK1A 1Q0GA 3NYLA 1B68A 3HLZA 3O6XA 3IHUA 2FFHA 4IAQA 3X2QC 4YJWA 2RD9A 3SNHA 2A69F 3POVA 2HMZA 3AG3C 4BJ1A 1YZAA 3UMIA 1LS1A 3C63A 3M15A 3MBGA 2J7PD 2Q9CA 1T6QA 2B0HA 2OOCA 3W8IA 1WGWA 1Y6DA 3E9VA 3H2UA 4F4BA 4MNDA 1YYJA 4AL1A 2EPLX 1FR0A 2L81A 2P0NA 5E3CA 4LLCA 2HV6A 3TOLA 2XSEA 2Y39A 3FXHA 4I1MA 1E83A 5CIVA 1HE1A 4A2NB 1M2VA 4CDVA 4MW8A 3U0CA 3Q7LA 2CNWD 1DOVA 1YA9A 1ZZPA 2OQMA 4CJGA 1RJ9A 2DYSC 3LAYA 1GM5A 5KYUA 1TWHA 2Y3GA 2FGYA 1NBBA 3FOPA 1OCOC 3RH3A 4OINF 4CIPA 4CIHA 3DE8A 2HV7A 2NPUA 2XLMA 1LE4A 4PK4A 2XLOA 3K7DA 3F46A 4U5DE 4DOZA 3EFOA 2KGOA 2OG2A 3I5PA 3S29A 1O87A 4KNWA 1C02A 3AG2C 4WGYA 2ZXRA 2EPMX 2YHSA 4PJLA 3ITFA 4G7HF 1ST6A 1XZQA 1Q0FA 3NMKA 4XPYA 5DQTA 2A6HF 3I5QA 2PBEA 2G3KA 1LVKA 2Y3DA 1UFBA 2R03A 2YVKA 1OCCC 1QSPA 1TFKB 1U0BB 1OXBA 1QVXA 4FX5A 3U3BA 1LM3B 4K0DA 1CPRA 4LDKA 4OD4A 5KYYB 3K1IA 2ZXPA 4U5EE 3LJBA 4YT2A 1E2XA 4YN0B 1WATA 2H7VC 2W9YA 1Z5ZA 2HS5A 2YEVA 2O9XA 2NSFA 1OR3A 2Q9AA 3MYFA 3EHNA 3EGDB 2BE5F 1M57C 4H4KC 5COFA 2OU6A 1ZHWA 3VF0A 3NDBB 1E84A 4E0HA 3B0PA 3BEHA 4GEHA 1YZCA 1YYXA 1G8XA 3EZHA 4XLNF 2C04A 2YL1A 1H6GA 2M4EA 3JYYA 1VLSA 4RD9A 3JTLO 3DZAA 5EGYA 2HKVA 2V26A 5K0IA 3V5ZA 5L0JA 1ZW2A 1AUEA 3C8GB 2AWCA 2KSFA 4YL3A 1E86A 1YA7O 1M56C 4WGZA 1JMWA 1MNDA 3O55A 2PF4E 2L6GA 3KMIA 1D0XA 2P6VA 3AG4C 3DWWA 2G62A 4XEVA 3ZDLA 5KYWB 5HSWA 3NRHA 2A6EF 2YL0A 1EQ1A 3SXYA 4CS8A 3AQBA 3T6JA 4CJOA 3UGOA 3CAXA 5CI8A 1SR2A 3DAFA 1OKKD 2OEVA 2LSEA 3NKDA 4PR9A 3L34A 3QVZA 4FESA 4JURI 4CBEA 3N0TA 3PDMP 1LKXA 1OW8A 2NUPB 2J7PA 2L6FA 3IQ5A 3Q7GA 2VCCA 4DRJB 1NG1A 1ORYA 2KYHA 4QI0A 2MYSA 256BA 3UNGC 5JLIA 2J8WA 1GS9A 2Q4FA 2EILC 1E85A 3GORA 4CDAA 2ZXWC 5B3IA 2IYLD 2F22A 4MVSA 2KW3C 4XPWA 1OQCA 3Q6NA 5JP7A 3VRCA 4N06A 5F28E 3EGXA 4JTDB 3OA1A 2EINC 3JZ0A 3ZSUA 3TD7A 2R7UA 5KYXA 4PACA 1LPEA 2CNWA 2ETSA 3EHMA 2KJGA 3K6BA 3KL4A 4MVZA 5T1DB 4E18A 3UR3C 3CEXA 2J9UA 3S0XA 4X0RA 2HSQA 3HNKA 3NG1A 1MQVA 5L0CA 4LDQA 1R4TA 3DE9A 3DKAA 4CS7A 4O79A 2XXAB 2R7XA 4CS9A 1TWAA 3FOOA 4J32B 2A0BA 2J9WA 1D0ZA 4E17A 4AE4B 3PHF2 1QZXA 4U5GA 5DVWA 4W8PA 1U6HA 3ECSA 4KC9A 2FAPB 2IBFA 3SXKA 3K66A 1L3PA 1ZHXA 2IXOA 1PV3A 4NQFA 5JS5A 1JPJA 4MVOA 4XPXA 2EPNA 2VB6A 1I4YA 3DXJF 3Q6MA 4XEKA 4JRZA 4JCHA 3IEEA 2R7RA 4BPMA 3N24A 2OEXA 3W4YA 2HFIA 3EPVA 3O39A 4WJ0A 2OJED 3DM9B 4AX2A 2AU5A 4DVZA 1SZIA 5BUOA 2P1AA 4OD5A 2LD6A 4BJ5A 4W8KA 2OCCC 5DLJA 1WASA 2XLVA 4U5HA 3QMKA 1FAPB 1T6IA 3N2ZB 4IGGA 2H8AA 2XLWA 4QDLA 5EHHA 3WG7C 2IXNA 4FWVA 3L8JA 3KYIA 4MTFA 3R7CA 3U9JA 2V3CC 3U2MA 1NFNA 1EI7A 2Y3BA 3ABMC 1RKEA 5KYNA 4PJJA 4EBKA 4OIOF 1V4AA 1Q0MA 5JRAA 3LEOA 4CS9C 3FDQA 3G4XA 3PMRA 3GM1A 3U5SA 3QW0A 5B3SC 1CGNA 2Y3HA 2AP3A 2P61A 4JTAB 1C03A 2JPUA 4LDRA 3GM2A 4JVSA 4K1OA 2PX0A 1NFOA 3GODA 3TK0A 1TKNA 1YJGA 3R2PA 4IWBA 5F5HA 3LNMB 5T3WA 3ABKC 3W2WA 4ULWA 1WN0A 5E2QA 5F5FA 4U5FE 2VH3A 3C62A 1FMWA 4IARA 4NTFA 3EG9B 4FAPB 4LERA 3TULA 4U9EA 1S7ZA 2GA0A 2RSEB 3FAJA 2A1DD 1JAFA 1OCRC 2Q9BA 3CQZA 3MYIA 5E33A 1OKKA 3NMIA 1VLTA 1CGME 3ZVRA 3O10A 4RBNA 5A6AA 4Z9IA 3HKKA 4BJ5C 1ZVZA 4JTCB 5A69A 4N6HA 1H9TA 1YLMA 2Q7RA 2QUPA 3G50A 1OW7A 2J45A 2CGEA 2OJQA 3HTKC 4XEFA 5BQHA 5L0DA 2BC5A 1T5OA 2M64A 3QTHA 2PP4A 4MS2A 4MTOA 2IXMA 4Z9JA 4BEJA 4A4AA 1T6UA 2GAQA 3B9QA 3ASOC 4PFPA 4CSAA 2ICWG 3CZ6A 2DYRC 4C7OA 4ZLDA 4MW3A 2YL3A 3JRTA 3JT1A 4G7OF 1DOWA 1RXQA 2WVQA 2ZD9A 3MFNA 1K04A 1ORSC 4EUKB 3M1CB 2GDCA 1ORJA 3LESA 5L0GA 2XLEA 4DXWA 1A7VA 2Q00A 3US6A 1TQGA 1S05A 1ZHTA 3RF3A 4MQ9F 4O6YA 3SXZA 4PJNA 2H7OA 1YARO 3VAYA 1M2OA 4E7ZA 3F47A 2NUTA 1V54C 1YDIA 3SXMA 4KBLA 3WAQA 5JSLA 5JUAA 4CX9A 3B0VC 3W2VA 2QY9A 3LEVA 2C03A 5CI9A 4U9DA 5BQIA 1Z23A 1M2VB 2L9JA 4YL1A 4EBBA 2EIKC 5EK0A 1Z7Qc 3ZTZA 1GGQA 1RJ9B 2HJ3A 5KYUB 2XL4A 2YLGA 3C8GD 3EJNA 1GQAA 3H2VA 5T3TA 3V5YA 3WHNA 5BQGA 3K1IC 4YT4A 3A9CA 2R7WA 1NSGB 2J0XA 5L0FA 3ZQVA 1VK5A 4JCZA 4OIPF 1JOGA 1OXKA 2R05A 3EFOB 4D4NA 1HMDA 1D1AA 3RQEA 3TJ6A 2MWQA 1VMAA 2G3VA 4LACB 1HW2A 4P9TA 3TJ5A 5AGFA 1ZYRF 4Q4ZF 2EPKX 3ASNC 4EKWA 2QNLA 1HW1A 3E70C 2GWWA 4H54A 4BJ6A 1PD0A 1BDJB 2Z15A 4IRUA 5DS4A 3KPHA 4DJ9A 5GPGB 4O6MA 2LQGA 2P7VA 3DJUB 3L1MA 3LS1A 4KNVA 3QZCA 3EH1A 2E87A 3DAGA 2CDQA 2LP4A 4XQ1A 3RVYA 3C8ZA 4C3BA 1Q0KA 2QLAA 4NTBA 1ZU5A 2HZ8A 4NC3A 4YT5A 3SYNA 4ULVA 4CS8C 4C3EA 1BZ4A 3L0IA 2YLDA 3W8HA 1T9KA 3RQGA 3KKBA 1SYQA 4K7BA 1QLEC 5JT4A 5IY5C 2XM0A 4R32A 4JZAA 3LUTB 2VC9A 1A0BA 4NY3A 4DBRA 3JYHA 1BR2A 3B0UX 2A68F 1KTMA 1EA8A 1F1MA 3T9OA 1Y4CA 3SEOA 3VYWA 1W2WA 4JIOA 3JCUQ 4RDAA 1K05A 4EBJA 1PD1A 1FNTc 3IQCA 2WL8A 1YAUO 3DM5A 3LLKA 5COGA 2R7VA 1WOLA 2YKZA 3UGPA 1VB5A 4BJ6C 1APCA 1R5ID 1BR4A 1UG7A 4MVRA 1KU2A 3V7OA 5L0HA 3S27A 3NYJA 3OWTA 1QQ3A 4YL0A 1ZW3A 2VCAA 2HSBA 3ABLC 3FAPB 5D92A 1O3UA 1U89A 4JJGA 4I1OB 1ZHZA 2LFFA 5KYYA 2ASRA 1G4WR 2YQYA 2YWAA 3ZC4A 4EIYA 1H9GA 1JR8A 1D0YA 2EPOA 5L3VA 2NSGA 3TOMA 4JC7A 2A0UA 3GEHA 2YL7A 3U8VA 3GEIA 3M4BA 3WODF 4B6IA 4D4XA 5A6BD 4U5CE 1VYKA 3V5XA 4ONSA 4YWQA 3EGDA 1A7EA 1MMDA 2YLIA 4MVUA 3FMSA 2LK4A 1HMOA 4NTAA 3JSEO 5B1AC 3ZTMA 1KNYA 2IM8A 3AQCA 3EGXB 3C7JA 3JRMO 3NKEA 4DBQA 1MNEA 3GEEA 4OIRF 5KYXB 1RKCA 2TMVP 3AGUA 4O7GA 1RCPA 1EKYA 3HNLA 2YZSA 3M79A 1V74B 2H7BA 3B71A 3C8GA 4IB4A 3QVYA 4Z9HA 5L0IA 3EQLF 1VYIA 1XWJA 2D4UA 3IQTA 3PCVA 4YT8A 1IW7F 1BBHA 2CYDA 5KYWA 5DS5A 2HMQA 2L7AA 4AK9A 1HY5A 4Q7CA 4M63A 2MHRA 1FFHA 5AC4A 2XL8A 1M6TA 4J7YA 2W4BA 2R7OA 2B0JA 2Q3TA 5L3QA 4PFOA 2XLDA 3S90A 3DMDA 2EIMC 1VTMP 1VOMA 2WZLA 3DD7A 2R02A 4P9FA 1JRAA 3AGTA 2UUIA 2XRHA 2XLHA 1HE9A 2NUPA 3VM6A 4HFKB 2LFDA 1TWCA 3BRJA 4E0IA 3S84A 4MVQA 4BJTA 1BR1A 5AC5A 1TWGA 1ZHYA 1Z3IX 2XS1A 4GYTA 1WTYA 4O6NA 3SZRA 3K33A 1TFOB 3ZQYA 1NLXA 4DVYP 2X51A 3X1OA 1NU9C 1Z63A 4MTGA 4CDYA 2IXPA 4QI2A 3K1HA 2R7QA 3RW0A 5DQZA 2KC3A 1AEPA 3LLIA 1D1BA 5A6JA 5FZTA 2I15A 1I5NA 1RKEB 4UDVA 2WZFA 2JX0A 1MMGA 5TJ5E 3ZIBA 3GANA 5DS6A 2R25A 4IAOA 2L6HA 4WABA 2XXAA 4I3MA 4XLPF 3TQOA 3A11A 3JSZA 3ZG1A 3EH2A 4EHPA 2AWYA 1TR2A 3J06A 3AG1C 2VASA 4AE4A 3U3FA 2QTVA 2ZXOA 4E7SA 1FFTC 1PCXA 2LIGA 1T01A 4HFFB 2PNOA 4CSAC 3UMKA 1J8MF 1ZU4A 5COMA 2CCYA 5D91A 2DB4A 2D5RB 2PX3A 2LCHA 4HE8D 4BEMJ 5A6KA 1A41A 2X0CA 1WWPA 5JVEA 1OR2A 2YRFA 4JE9A 3UMHA 2UUHA 2R7TA 1L7CA 1AVOB 1NZEA 1SF8A 3HJCA 3MLGA 3RFYA 2J0WA 2ZPAA 1Q0DA 3RQFA 3L8IA 3EZIA
chains in the Genus database with same CATH topology
1YARO 3JTLO 1FNTc 1YA7O 1YAUO 1AVOB 3IPMO 3JSEO 1Z7Qc 3JRMO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YAR O;  3JTL O;  1FNT c;  1YA7 O;  1YAU O;  1AVO B;  3IPM O;  3JSE O;  1Z7Q c;  3JRM O; 
#chains in the Genus database with same CATH topology
 4LLE A;  4N6C A;  4G78 A;  4L6R A;  2W4M A;  2OKU A;  2WVO A;  3MX3 A;  2DI3 A;  2W45 A;  3G4Z A;  1MMA A;  5E3A A;  3NYM A;  5A6B A;  2XL6 A;  4G7Z F;  3GWL A;  3H65 A;  2GFH A;  2DGJ A;  5B1B C;  4EWC A;  2XM4 A;  3AJM A;  1NU7 D;  2JD3 A;  3M4C A;  1YVI A;  4YK5 A;  2BL2 A;  4C7O B;  4N4W A;  2WB7 A;  4JJF A;  1CGO A;  3GM3 A;  4U5B E;  1QKR A;  4P6I C;  4BG0 A;  5FCL A;  1G4U S;  1A7D A;  1LIH A;  2KNH A;  1FTS A;  3KYJ A;  3LS0 A;  4JW1 A;  2KQ9 A;  3OEO A;  3RIP A;  1OW6 A;  3T6G B;  1LE2 A;  4XTK A;  5HV9 A;  2R9R B;  3U9M A;  3T6B A;  3FHD A;  2IOQ A;  3AOU A;  4AL0 A;  1LI7 A;  4JEB A;  4ER9 A;  4Q5S F;  1C17 M;  2PFD A;  4XWJ A;  3CSK A;  3ATP A;  2CW0 F;  3IPM O;  4NCQ A;  1N1C A;  3IQ6 A;  3DJN B;  2NUT B;  3T4R A;  3LNR A;  1G5Z A;  3GWN A;  3EG9 A;  4PJM A;  1I4Z A;  1QPU A;  2EIJ C;  3HNI A;  2NG1 A;  1H7I A;  2J46 A;  4MVM A;  2WVN A;  3RYL A;  3HNJ A;  1XZP A;  1RMV A;  1LS4 A;  2HJM A;  1J8Y F;  4JEA A;  3U8P A;  1OCZ C;  2J9B A;  4HEA J;  4KI2 A;  3U2L A;  1MMN A;  4GQH A;  2XS8 A;  2I8B A;  3NMJ A;  3S28 A;  1IZM A;  3SP1 A;  1CPQ A;  3ZWI A;  4DRI B;  1Z6A A;  2VCB A;  1FMV A;  3DI5 A;  4JKV A;  4ANJ A;  2AVK A;  4G0H A;  4OIQ F;  3RKO F;  4J7T A;  2Y69 C;  1O5H A;  2J9V A;  3I4U A;  3S9O A;  1JPN A;  1V55 C;  4C3D A;  1SMY F;  3B29 A;  2R7S A;  4DRH B;  3QW1 A;  1K40 A;  4J30 B;  3RVZ A;  3KH2 A;  2QE9 A;  2WZG A;  2HUJ A;  1LI5 A;  3C18 A;  4ZLC A;  3FVY A;  4I44 A;  1D1C A;  4IJJ A;  2KK1 A;  1Q0G A;  3NYL A;  1B68 A;  3HLZ A;  3O6X A;  3IHU A;  2FFH A;  4IAQ A;  3X2Q C;  4YJW A;  2RD9 A;  3SNH A;  2A69 F;  3POV A;  2HMZ A;  3AG3 C;  4BJ1 A;  1YZA A;  3UMI A;  1LS1 A;  3C63 A;  3M15 A;  3MBG A;  2J7P D;  2Q9C A;  1T6Q A;  2B0H A;  2OOC A;  3W8I A;  1WGW A;  1Y6D A;  3E9V A;  3H2U A;  4F4B A;  4MND A;  1YYJ A;  4AL1 A;  2EPL X;  1FR0 A;  2L81 A;  2P0N A;  5E3C A;  4LLC A;  2HV6 A;  3TOL A;  2XSE A;  2Y39 A;  3FXH A;  4I1M A;  1E83 A;  5CIV A;  1HE1 A;  4A2N B;  1M2V A;  4CDV A;  4MW8 A;  3U0C A;  3Q7L A;  2CNW D;  1DOV A;  1YA9 A;  1ZZP A;  2OQM A;  4CJG A;  1RJ9 A;  2DYS C;  3LAY A;  1GM5 A;  5KYU A;  1TWH A;  2Y3G A;  2FGY A;  1NBB A;  3FOP A;  1OCO C;  3RH3 A;  4OIN F;  4CIP A;  4CIH A;  3DE8 A;  2HV7 A;  2NPU A;  2XLM A;  1LE4 A;  4PK4 A;  2XLO A;  3K7D A;  3F46 A;  4U5D E;  4DOZ A;  3EFO A;  2KGO A;  2OG2 A;  3I5P A;  3S29 A;  1O87 A;  4KNW A;  1C02 A;  3AG2 C;  4WGY A;  2ZXR A;  2EPM X;  2YHS A;  4PJL A;  3ITF A;  4G7H F;  1ST6 A;  1XZQ A;  1Q0F A;  3NMK A;  4XPY A;  5DQT A;  2A6H F;  3I5Q A;  2PBE A;  2G3K A;  1LVK A;  2Y3D A;  1UFB A;  2R03 A;  2YVK A;  1OCC C;  1QSP A;  1TFK B;  1U0B B;  1OXB A;  1QVX A;  4FX5 A;  3U3B A;  1LM3 B;  4K0D A;  1CPR A;  4LDK A;  4OD4 A;  5KYY B;  3K1I A;  2ZXP A;  4U5E E;  3LJB A;  4YT2 A;  1E2X A;  4YN0 B;  1WAT A;  2H7V C;  2W9Y A;  1Z5Z A;  2HS5 A;  2YEV A;  2O9X A;  2NSF A;  1OR3 A;  2Q9A A;  3MYF A;  3EHN A;  3EGD B;  2BE5 F;  1M57 C;  4H4K C;  5COF A;  2OU6 A;  1ZHW A;  3VF0 A;  3NDB B;  1E84 A;  4E0H A;  3B0P A;  3BEH A;  4GEH A;  1YZC A;  1YYX A;  1G8X A;  3EZH A;  4XLN F;  2C04 A;  2YL1 A;  1H6G A;  2M4E A;  3JYY A;  1VLS A;  4RD9 A;  3JTL O;  3DZA A;  5EGY A;  2HKV A;  2V26 A;  5K0I A;  3V5Z A;  5L0J A;  1ZW2 A;  1AUE A;  3C8G B;  2AWC A;  2KSF A;  4YL3 A;  1E86 A;  1YA7 O;  1M56 C;  4WGZ A;  1JMW A;  1MND A;  3O55 A;  2PF4 E;  2L6G A;  3KMI A;  1D0X A;  2P6V A;  3AG4 C;  3DWW A;  2G62 A;  4XEV A;  3ZDL A;  5KYW B;  5HSW A;  3NRH A;  2A6E F;  2YL0 A;  1EQ1 A;  3SXY A;  4CS8 A;  3AQB A;  3T6J A;  4CJO A;  3UGO A;  3CAX A;  5CI8 A;  1SR2 A;  3DAF A;  1OKK D;  2OEV A;  2LSE A;  3NKD A;  4PR9 A;  3L34 A;  3QVZ A;  4FES A;  4JUR I;  4CBE A;  3N0T A;  3PDM P;  1LKX A;  1OW8 A;  2NUP B;  2J7P A;  2L6F A;  3IQ5 A;  3Q7G A;  2VCC A;  4DRJ B;  1NG1 A;  1ORY A;  2KYH A;  4QI0 A;  2MYS A;  256B A;  3UNG C;  5JLI A;  2J8W A;  1GS9 A;  2Q4F A;  2EIL C;  1E85 A;  3GOR A;  4CDA A;  2ZXW C;  5B3I A;  2IYL D;  2F22 A;  4MVS A;  2KW3 C;  4XPW A;  1OQC A;  3Q6N A;  5JP7 A;  3VRC A;  4N06 A;  5F28 E;  3EGX A;  4JTD B;  3OA1 A;  2EIN C;  3JZ0 A;  3ZSU A;  3TD7 A;  2R7U A;  5KYX A;  4PAC A;  1LPE A;  2CNW A;  2ETS A;  3EHM A;  2KJG A;  3K6B A;  3KL4 A;  4MVZ A;  5T1D B;  4E18 A;  3UR3 C;  3CEX A;  2J9U A;  3S0X A;  4X0R A;  2HSQ A;  3HNK A;  3NG1 A;  1MQV A;  5L0C A;  4LDQ A;  1R4T A;  3DE9 A;  3DKA A;  4CS7 A;  4O79 A;  2XXA B;  2R7X A;  4CS9 A;  1TWA A;  3FOO A;  4J32 B;  2A0B A;  2J9W A;  1D0Z A;  4E17 A;  4AE4 B;  3PHF 2;  1QZX A;  4U5G A;  5DVW A;  4W8P A;  1U6H A;  3ECS A;  4KC9 A;  2FAP B;  2IBF A;  3SXK A;  3K66 A;  1L3P A;  1ZHX A;  2IXO A;  1PV3 A;  4NQF A;  5JS5 A;  1JPJ A;  4MVO A;  4XPX A;  2EPN A;  2VB6 A;  1I4Y A;  3DXJ F;  3Q6M A;  4XEK A;  4JRZ A;  4JCH A;  3IEE A;  2R7R A;  4BPM A;  3N24 A;  2OEX A;  3W4Y A;  2HFI A;  3EPV A;  3O39 A;  4WJ0 A;  2OJE D;  3DM9 B;  4AX2 A;  2AU5 A;  4DVZ A;  1SZI A;  5BUO A;  2P1A A;  4OD5 A;  2LD6 A;  4BJ5 A;  4W8K A;  2OCC C;  5DLJ A;  1WAS A;  2XLV A;  4U5H A;  3QMK A;  1FAP B;  1T6I A;  3N2Z B;  4IGG A;  2H8A A;  2XLW A;  4QDL A;  5EHH A;  3WG7 C;  2IXN A;  4FWV A;  3L8J A;  3KYI A;  4MTF A;  3R7C A;  3U9J A;  2V3C C;  3U2M A;  1NFN A;  1EI7 A;  2Y3B A;  3ABM C;  1RKE A;  5KYN A;  4PJJ A;  4EBK A;  4OIO F;  1V4A A;  1Q0M A;  5JRA A;  3LEO A;  4CS9 C;  3FDQ A;  3G4X A;  3PMR A;  3GM1 A;  3U5S A;  3QW0 A;  5B3S C;  1CGN A;  2Y3H A;  2AP3 A;  2P61 A;  4JTA B;  1C03 A;  2JPU A;  4LDR A;  3GM2 A;  4JVS A;  4K1O A;  2PX0 A;  1NFO A;  3GOD A;  3TK0 A;  1TKN A;  1YJG A;  3R2P A;  4IWB A;  5F5H A;  3LNM B;  5T3W A;  3ABK C;  3W2W A;  4ULW A;  1WN0 A;  5E2Q A;  5F5F A;  4U5F E;  2VH3 A;  3C62 A;  1FMW A;  4IAR A;  4NTF A;  3EG9 B;  4FAP B;  4LER A;  3TUL A;  4U9E A;  1S7Z A;  2GA0 A;  2RSE B;  3FAJ A;  2A1D D;  1JAF A;  1OCR C;  2Q9B A;  3CQZ A;  3MYI A;  5E33 A;  1OKK A;  3NMI A;  1VLT A;  1CGM E;  3ZVR A;  3O10 A;  4RBN A;  5A6A A;  4Z9I A;  3HKK A;  4BJ5 C;  1ZVZ A;  4JTC B;  5A69 A;  4N6H A;  1H9T A;  1YLM A;  2Q7R A;  2QUP A;  3G50 A;  1OW7 A;  2J45 A;  2CGE A;  2OJQ A;  3HTK C;  4XEF A;  5BQH A;  5L0D A;  2BC5 A;  1T5O A;  2M64 A;  3QTH A;  2PP4 A;  4MS2 A;  4MTO A;  2IXM A;  4Z9J A;  4BEJ A;  4A4A A;  1T6U A;  2GAQ A;  3B9Q A;  3ASO C;  4PFP A;  4CSA A;  2ICW G;  3CZ6 A;  2DYR C;  4C7O A;  4ZLD A;  4MW3 A;  2YL3 A;  3JRT A;  3JT1 A;  4G7O F;  1DOW A;  1RXQ A;  2WVQ A;  2ZD9 A;  3MFN A;  1K04 A;  1ORS C;  4EUK B;  3M1C B;  2GDC A;  1ORJ A;  3LES A;  5L0G A;  2XLE A;  4DXW A;  1A7V A;  2Q00 A;  3US6 A;  1TQG A;  1S05 A;  1ZHT A;  3RF3 A;  4MQ9 F;  4O6Y A;  3SXZ A;  4PJN A;  2H7O A;  1YAR O;  3VAY A;  1M2O A;  4E7Z A;  3F47 A;  2NUT A;  1V54 C;  1YDI A;  3SXM A;  4KBL A;  3WAQ A;  5JSL A;  5JUA A;  4CX9 A;  3B0V C;  3W2V A;  2QY9 A;  3LEV A;  2C03 A;  5CI9 A;  4U9D A;  5BQI A;  1Z23 A;  1M2V B;  2L9J A;  4YL1 A;  4EBB A;  2EIK C;  5EK0 A;  1Z7Q c;  3ZTZ A;  1GGQ A;  1RJ9 B;  2HJ3 A;  5KYU B;  2XL4 A;  2YLG A;  3C8G D;  3EJN A;  1GQA A;  3H2V A;  5T3T A;  3V5Y A;  3WHN A;  5BQG A;  3K1I C;  4YT4 A;  3A9C A;  2R7W A;  1NSG B;  2J0X A;  5L0F A;  3ZQV A;  1VK5 A;  4JCZ A;  4OIP F;  1JOG A;  1OXK A;  2R05 A;  3EFO B;  4D4N A;  1HMD A;  1D1A A;  3RQE A;  3TJ6 A;  2MWQ A;  1VMA A;  2G3V A;  4LAC B;  1HW2 A;  4P9T A;  3TJ5 A;  5AGF A;  1ZYR F;  4Q4Z F;  2EPK X;  3ASN C;  4EKW A;  2QNL A;  1HW1 A;  3E70 C;  2GWW A;  4H54 A;  4BJ6 A;  1PD0 A;  1BDJ B;  2Z15 A;  4IRU A;  5DS4 A;  3KPH A;  4DJ9 A;  5GPG B;  4O6M A;  2LQG A;  2P7V A;  3DJU B;  3L1M A;  3LS1 A;  4KNV A;  3QZC A;  3EH1 A;  2E87 A;  3DAG A;  2CDQ A;  2LP4 A;  4XQ1 A;  3RVY A;  3C8Z A;  4C3B A;  1Q0K A;  2QLA A;  4NTB A;  1ZU5 A;  2HZ8 A;  4NC3 A;  4YT5 A;  3SYN A;  4ULV A;  4CS8 C;  4C3E A;  1BZ4 A;  3L0I A;  2YLD A;  3W8H A;  1T9K A;  3RQG A;  3KKB A;  1SYQ A;  4K7B A;  1QLE C;  5JT4 A;  5IY5 C;  2XM0 A;  4R32 A;  4JZA A;  3LUT B;  2VC9 A;  1A0B A;  4NY3 A;  4DBR A;  3JYH A;  1BR2 A;  3B0U X;  2A68 F;  1KTM A;  1EA8 A;  1F1M A;  3T9O A;  1Y4C A;  3SEO A;  3VYW A;  1W2W A;  4JIO A;  3JCU Q;  4RDA A;  1K05 A;  4EBJ A;  1PD1 A;  1FNT c;  3IQC A;  2WL8 A;  1YAU O;  3DM5 A;  3LLK A;  5COG A;  2R7V A;  1WOL A;  2YKZ A;  3UGP A;  1VB5 A;  4BJ6 C;  1APC A;  1R5I D;  1BR4 A;  1UG7 A;  4MVR A;  1KU2 A;  3V7O A;  5L0H A;  3S27 A;  3NYJ A;  3OWT A;  1QQ3 A;  4YL0 A;  1ZW3 A;  2VCA A;  2HSB A;  3ABL C;  3FAP B;  5D92 A;  1O3U A;  1U89 A;  4JJG A;  4I1O B;  1ZHZ A;  2LFF A;  5KYY A;  2ASR A;  1G4W R;  2YQY A;  2YWA A;  3ZC4 A;  4EIY A;  1H9G A;  1JR8 A;  1D0Y A;  2EPO A;  5L3V A;  2NSG A;  3TOM A;  4JC7 A;  2A0U A;  3GEH A;  2YL7 A;  3U8V A;  3GEI A;  3M4B A;  3WOD F;  4B6I A;  4D4X A;  5A6B D;  4U5C E;  1VYK A;  3V5X A;  4ONS A;  4YWQ A;  3EGD A;  1A7E A;  1MMD A;  2YLI A;  4MVU A;  3FMS A;  2LK4 A;  1HMO A;  4NTA A;  3JSE O;  5B1A C;  3ZTM A;  1KNY A;  2IM8 A;  3AQC A;  3EGX B;  3C7J A;  3JRM O;  3NKE A;  4DBQ A;  1MNE A;  3GEE A;  4OIR F;  5KYX B;  1RKC A;  2TMV P;  3AGU A;  4O7G A;  1RCP A;  1EKY A;  3HNL A;  2YZS A;  3M79 A;  1V74 B;  2H7B A;  3B71 A;  3C8G A;  4IB4 A;  3QVY A;  4Z9H A;  5L0I A;  3EQL F;  1VYI A;  1XWJ A;  2D4U A;  3IQT A;  3PCV A;  4YT8 A;  1IW7 F;  1BBH A;  2CYD A;  5KYW A;  5DS5 A;  2HMQ A;  2L7A A;  4AK9 A;  1HY5 A;  4Q7C A;  4M63 A;  2MHR A;  1FFH A;  5AC4 A;  2XL8 A;  1M6T A;  4J7Y A;  2W4B A;  2R7O A;  2B0J A;  2Q3T A;  5L3Q A;  4PFO A;  2XLD A;  3S90 A;  3DMD A;  2EIM C;  1VTM P;  1VOM A;  2WZL A;  3DD7 A;  2R02 A;  4P9F A;  1JRA A;  3AGT A;  2UUI A;  2XRH A;  2XLH A;  1HE9 A;  2NUP A;  3VM6 A;  4HFK B;  2LFD A;  1TWC A;  3BRJ A;  4E0I A;  3S84 A;  4MVQ A;  4BJT A;  1BR1 A;  5AC5 A;  1TWG A;  1ZHY A;  1Z3I X;  2XS1 A;  4GYT A;  1WTY A;  4O6N A;  3SZR A;  3K33 A;  1TFO B;  3ZQY A;  1NLX A;  4DVY P;  2X51 A;  3X1O A;  1NU9 C;  1Z63 A;  4MTG A;  4CDY A;  2IXP A;  4QI2 A;  3K1H A;  2R7Q A;  3RW0 A;  5DQZ A;  2KC3 A;  1AEP A;  3LLI A;  1D1B A;  5A6J A;  5FZT A;  2I15 A;  1I5N A;  1RKE B;  4UDV A;  2WZF A;  2JX0 A;  1MMG A;  5TJ5 E;  3ZIB A;  3GAN A;  5DS6 A;  2R25 A;  4IAO A;  2L6H A;  4WAB A;  2XXA A;  4I3M A;  4XLP F;  3TQO A;  3A11 A;  3JSZ A;  3ZG1 A;  3EH2 A;  4EHP A;  2AWY A;  1TR2 A;  3J06 A;  3AG1 C;  2VAS A;  4AE4 A;  3U3F A;  2QTV A;  2ZXO A;  4E7S A;  1FFT C;  1PCX A;  2LIG A;  1T01 A;  4HFF B;  2PNO A;  4CSA C;  3UMK A;  1J8M F;  1ZU4 A;  5COM A;  2CCY A;  5D91 A;  2DB4 A;  2D5R B;  2PX3 A;  2LCH A;  4HE8 D;  4BEM J;  5A6K A;  1A41 A;  2X0C A;  1WWP A;  5JVE A;  1OR2 A;  2YRF A;  4JE9 A;  3UMH A;  2UUH A;  2R7T A;  1L7C A;  1AVO B;  1NZE A;  1SF8 A;  3HJC A;  3MLG A;  3RFY A;  2J0W A;  2ZPA A;  1Q0D A;  3RQF A;  3L8I A;  3EZI A; 
#chains in the Genus database with same CATH homology
 1YAR O;  3JTL O;  1FNT c;  1YA7 O;  1YAU O;  1AVO B;  3IPM O;  3JSE O;  1Z7Q c;  3JRM O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...