1YA7O

Implications for interactions of proteasome with pan and pa700 from the 1.9 a structure of a proteasome-11s activator complex
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
228
structure length
218
Chain Sequence
b'KRAALIQNLRDSYTETSSFAVIEEWAAGTLQEIEGIAKAAAEAHGVIRNSTYGRAQAEKSPEQLLGVLQRYQDLCHNVYCQAETIRTVIAIRIPEHKEEDNLGVAVQHAVLKIIDELEIKTLGSGEKSGSGGAPTPIGMYALREYLSARSTVEDKLLGGGSQSPSLLLELRQIDADFMLKVELATTHLSTMVRAVINAYLLNWKKLIQPRTGSDHMVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteasome alpha subunit
publication title The 1.9 A structure of a proteasome-11S activator complex and implications for proteasome-PAN/PA700 interactions.
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase/hydrolase activator
total genus 84
structure length 218
sequence length 228
chains with identical sequence P, Q, R, S, T, U
ec nomenclature
pdb deposition date 2004-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF02252 PA28_beta Proteasome activator pa28 beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.180 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Proteasome activator pa28, C-terminal domain 1ya7O01
3IPMO 1YA7O 1Z7Qc 1YARO 1AVOB 3JRMO 1FNTc 1YAUO 3JTLO 3JSEO
chains in the Genus database with same CATH superfamily
4XLPF 2PX3A 2R7WA 3KYIA 3M15A 1FMWA 5E3AA 1OKKA 1ZHWA 1APCA 5KYXA 3O6XA 5L3VA 4NC3A 2WZGA 1OW8A 4WGYA 1TFOB 1H9TA 3MLGA 3U0CA 2C04A 1ORSC 2HJ3A 1L3PA 2IM8A 2PP4A 2XLWA 1NU7D 2R7RA 2MWQA 5D91A 1TWGA 4IAOA 3ZG1A 4YT2A 4XPWA 1M57C 2ZD9A 4X0RA 1MQVA 3DM5A 3HNIA 4KI2A 1FR0A 3B0VC 4UDVA 5GPGB 5K0IA 2C03A 2IXPA 4FX5A 1MMAA 2P61A 2J9UA 1ZHTA 3GM2A 1FFTC 4KNWA 4CJOA 1NG1A 3M4BA 1N1CA 2UUIA 1OW6A 2M4EA 3GEIA 4YJWA 5E3CA 3DKAA 4Q4ZF 4XPXA 1LE2A 3TULA 4I1MA 3NDBB 2DYRC 2RSEB 3KMIA 5COFA 3FOPA 2F22A 3U2LA 5L0JA 4JC7A 3GODA 2YL0A 3F46A 2R7QA 2J0XA 2YL7A 2KK1A 3M4CA 3K1HA 1CGNA 4PJMA 2LFDA 1Z63A 3EGXA 4MS2A 4OINF 2JX0A 3OWTA 3RVYA 1B68A 3W2VA 3C62A 4C7OB 4EBKA 3S28A 4YT8A 2XLOA 3S29A 3JSZA 1YZAA 2ZXRA 3EHNA 3L8JA 2R7OA 3TJ5A 4YWQA 3Q6NA 3ZWIA 1Z6AA 3LNMB 2ETSA 3B29A 3O10A 2CNWD 2XLEA 3TOLA 1Q0MA 4MW8A 2EPLX 2XL4A 2QNLA 1T6UA 3TQOA 3GEHA 2KQ9A 3IEEA 3W8HA 3NKDA 3UMKA 1AVOB 1D1BA 3AQBA 3NYMA 2ZXWC 4RD9A 1T9KA 5CIVA 3UGOA 3QW1A 5T3WA 5A6JA 1JPNA 1OXKA 3A9CA 1LE4A 1E86A 3L1MA 3DXJF 3B0UX 2OOCA 4DBRA 2OG2A 2W4MA 4XEFA 3EH1A 1MNDA 2HSBA 2GAQA 3K7DA 2XXAA 2HUJA 3N0TA 1BR2A 2B0JA 3NMKA 2HFIA 1O5HA 4Z9HA 2XM4A 5B3SC 4P9FA 2XSEA 1TQGA 2IXMA 1A7VA 1XZQA 2NUTB 2XLHA 1RJ9B 3M79A 4K7BA 5FCLA 5DQZA 1LVKA 4EBBA 2CNWA 4MVOA 1M56C 1WASA 4JRZA 4MTGA 4BJ5C 2IYLD 2HV7A 2PFDA 4BJ5A 1JAFA 3G4XA 4PJLA 3RW0A 5A6KA 5T1DB 1ZHZA 2Y3HA 4JZAA 2ZPAA 1FTSA 3AG2C 3B0PA 2WZLA 2LD6A 1HW1A 2XS8A 3EJNA 5E2QA 3GM3A 2R03A 3HJCA 3KPHA 4I1OB 2PNOA 2LK4A 5AC5A 2G3KA 5DS4A 1A7DA 3AG4C 4A2NB 1EQ1A 3B9QA 4AL0A 1JR8A 2Y3GA 4C3BA 3SZRA 3MBGA 4AE4A 1YDIA 3C63A 3EGDB 3QTHA 4J30B 5EK0A 2A0UA 3IPMO 5B1BC 2Q7RA 4YL1A 5L0CA 1K40A 1VLSA 3RFYA 2CCYA 1I4YA 1E2XA 4MVUA 4U5DE 4XEVA 3PCVA 1VMAA 1WTYA 5JP7A 5KYYA 2R7TA 5JRAA 2R05A 5KYWB 1HE9A 3ZQYA 3PMRA 3SXZA 5DLJA 2R7SA 4LLEA 2EPKX 3R2PA 2KNHA 2P1AA 1ZVZA 4BEJA 3LS1A 1EKYA 4AX2A 2Y3BA 1M2OA 4A4AA 1LS4A 4CJGA 2Y3DA 1BR1A 1OW7A 1ZU4A 2Q9BA 1Y4CA 1VK5A 2YQYA 3U3BA 3UR3C 2W9YA 3FAPB 3JZ0A 3ASOC 3K33A 3R7CA 3W8IA 2YZSA 1BZ4A 4OD4A 2NPUA 2QLAA 3GANA 1T01A 3T9OA 4G7ZF 2NUPB 4CIPA 2L9JA 2Q00A 3ZTMA 4ULVA 5F5HA 2HS5A 1A0BA 1UG7A 4N06A 4G78A 3W2WA 5IY5C 4MNDA 1QQ3A 2WVQA 1SZIA 1D0ZA 1ZW3A 2IBFA 2IXOA 4JTAB 1FFHA 2ZXOA 3Q7LA 2XM0A 3VF0A 1DOWA 3EG9B 4O6YA 4EIYA 3IQ5A 3I4UA 1ZHXA 3C8GD 3RH3A 3X1OA 4U9DA 3OA1A 4NCQA 1T6QA 3MYFA 3O39A 5TJ5E 4GEHA 1TWHA 5L0GA 4D4NA 1VTMP 2EILC 1Q0FA 4O79A 5DS5A 2DYSC 4FESA 5KYXB 4XWJA 3K66A 3T6JA 1L7CA 4DVZA 3EZHA 2HKVA 2OU6A 2AU5A 2OJED 2X0CA 3S0XA 3N24A 3JSEO 1MMNA 3RIPA 1QSPA 4IARA 3RQGA 3FOOA 3IQ6A 2EPOA 2VCAA 1KNYA 4WABA 4YK5A 3FMSA 4G7HF 1ZHYA 4LDKA 3DMDA 1KU2A 2X51A 3B71A 1D0YA 5CI8A 1Z23A 1DOVA 2Y39A 3IQTA 3CZ6A 3RQFA 3C8GA 1J8MF 4AL1A 2DGJA 2QTVA 4PACA 1OCRC 5KYUA 4E0HA 4EUKB 2E87A 1SYQA 1GS9A 2J9BA 2YVKA 3POVA 4AK9A 3ECSA 1LKXA 3LNRA 3ZQVA 1OXBA 1TWCA 3V5XA 4JTCB 3KL4A 2HZ8A 1XZPA 4CX9A 2LQGA 3GEEA 1R4TA 3JYYA 1VB5A 2Y69C 3LLIA 2HV6A 4RDAA 1QVXA 1MMGA 5F5FA 4KNVA 1YAUO 2YLDA 1A41A 1C17M 3EGXB 3NYJA 2HMQA 3HNJA 4DRJB 2R9RB 2AWCA 1C03A 5A6AA 3L8IA 2R7XA 2H7OA 3UMHA 4BEMJ 1E84A 1UFBA 1YJGA 2EPNA 4G0HA 4MVRA 4GYTA 3V5ZA 1HY5A 1LM3B 1YARO 4JEAA 2A6EF 1D1AA 4CDYA 1EI7A 1M2VA 2GFHA 5JT4A 4OIQF 2FFHA 1R5ID 4JTDB 3NRHA 3DAGA 3DE9A 5DVWA 4P9TA 3UNGC 1WN0A 3C8ZA 4IB4A 3ZVRA 2JD3A 1WATA 3JCUQ 4C3EA 3ABMC 3HNKA 1ST6A 3TK0A 5EGYA 2P7VA 2HMZA 4MTOA 1EA8A 2XXAB 3DE8A 4O6NA 1G8XA 4CS7A 1H9GA 1MNEA 1I4ZA 4U9EA 3UMIA 1E83A 1YLMA 2VC9A 5E33A 4I3MA 3K1IA 2AWYA 2LSEA 2W45A 4O6MA 4CS8A 3SYNA 4DOZA 3FDQA 2DB4A 3N2ZB 3PDMP 3QMKA 3HKKA 2YWAA 3IQCA 4WJ0A 3U3FA 3VRCA 3U9MA 1NLXA 2OEXA 2J0WA 3SNHA 4PR9A 3OEOA 4JURI 2QY9A 3H2UA 1S7ZA 2RD9A 3CQZA 1AUEA 1V4AA 2EIJC 3ASNC 3K6BA 2LP4A 4MQ9F 4MVMA 2YEVA 2NSFA 4N4WA 4E18A 2R7UA 2BC5A 3X2QC 2J9WA 2MHRA 2D5RB 1RXQA 5AGFA 4OIOF 1OCZC 2A1DD 5L0IA 2XL8A 3ITFA 4OIRF 4QI2A 1Z3IX 1V54C 2VCBA 1K04A 3AG1C 3JRTA 2KC3A 2OKUA 1FAPB 4JE9A 4PFOA 4JKVA 4AE4B 1JRAA 4YL0A 2V3CC 2EIMC 3NMJA 5A6BA 2P6VA 4MVQA 2A0BA 2H7BA 2XLMA 4IRUA 5CI9A 2DI3A 1T6IA 2D4UA 3US6A 5KYYB 4K1OA 4XLNF 2ASRA 1M6TA 1NBBA 1O3UA 3LAYA 4U5EE 4U5HA 3SXKA 1C02A 3TD7A 5BQGA 4W8PA 4J32B 1ZW2A 4HFKB 4RBNA 1FMVA 2VASA 2Q4FA 1YYJA 1OR3A 2FAPB 3LJBA 3WAQA 4G7OF 5L0HA 2WL8A 4OD5A 2QUPA 4R32A 3ZSUA 3ZIBA 2G3VA 1OR2A 4NQFA 4PFPA 1RKEA 3DJNB 3E70C 1QZXA 5F28E 4CS8C 5EHHA 2KSFA 3C7JA 1JOGA 3E9VA 5DQTA 1TWAA 2ICWG 4BJ1A 3LUTB 2VCCA 3H2VA 1JMWA 2LIGA 4LDRA 1SR2A 2WZFA 4Q7CA 5B1AC 3S90A 4N6CA 3LEOA 3FHDA 1Z7Qc 1ORJA 1ORYA 2Q9CA 4BPMA 2KYHA 5HV9A 3QW0A 1GM5A 3DD7A 2NUPA 3L34A 4JIOA 1NFNA 1F1MA 3ZC4A 2W4BA 1G4WR 2WVNA 2Q9AA 1RCPA 3GWNA 1ZZPA 2KW3C 4BJ6C 4DRIB 3UGPA 3W4YA 5JLIA 4N6HA 1NFOA 2PBEA 4E7ZA 1IW7F 3RF3A 3EFOA 4ZLDA 1NSGB 3DZAA 4J7YA 1WGWA 4EBJA 1E85A 3L0IA 2L6GA 2IXNA 3GORA 3K1IC 4PJJA 4XTKA 3VYWA 1QKRA 1FNTc 5KYNA 1Q0DA 2R25A 4JW1A 3AG3C 3S84A 4JCHA 3EPVA 1LPEA 1T5OA 3DM9B 2EIKC 4CSAA 3RKOF 4U5BE 3G50A 3GWLA 2CYDA 1LI5A 5T3TA 4JJGA 4JVSA 4JJFA 4CS9C 3RYLA 2MYSA 3LESA 4KBLA 1HW2A 3FXHA 1D1CA 3ABLC 3C8GB 2AP3A 5KYUB 2LFFA 2HSQA 4I44A 1WOLA 1XWJA 2CW0F 2J46A 1AEPA 1YA7O 3EH2A 4ONSA 1KTMA 2OEVA 1YYXA 3MYIA 4LLCA 4U5FE 2XLVA 5HSWA 2VB6A 3SP1A 2LCHA 3ZDLA 1LS1A 2VH3A 4NTBA 4EKWA 2TMVP 4MTFA 3EQLF 4QI0A 3DAFA 3T4RA 5BQIA 1GGQA 2YRFA 2GA0A 4IJJA 1MMDA 1V55C 2O9XA 4ULWA 3FAJA 4E7SA 3QZCA 3DWWA 4WGZA 1H7IA 3MX3A 1QLEC 4YL3A 1VOMA 3EZIA 2YLGA 3WG7C 4C7OA 3LS0A 1D0XA 4MVSA 4QDLA 4Z9JA 4LDQA 1LI7A 4Z9IA 2Q3TA 1JPJA 4OIPF 2XS1A 4DXWA 2KJGA 1Z5ZA 2KGOA 4F4BA 2WVOA 1U89A 2A68F 4NTFA 4CDAA 4YT4A 4JEBA 3C18A 2PX0A 1M2VB 3S9OA 2YKZA 4FWVA 5B3IA 5DS6A 1U6HA 2FGYA 2L6HA 3LEVA 4BJ6A 5AC4A 4D4XA 3SXYA 5BQHA 3NG1A 4PK4A 1BR4A 4IWBA 3U5SA 1WWPA 3WHNA 4ZLCA 1CGME 1Y6DA 2EPMX 2I15A 2WB7A 2XL6A 3MFNA 3U8VA 1RKCA 1HMDA 1HMOA 2QE9A 3AGUA 3SXMA 2G62A 2A6HF 3CEXA 3AOUA 1OCOC 4ER9A 4PJNA 3NMIA 3TJ6A 1YZCA 5D92A 5A6BD 3RVZA 2J45A 2P0NA 3QVYA 2YLIA 3HLZA 5FZTA 4CIHA 3BEHA 4CDVA 2H8AA 2NUTA 4MVZA 1RJ9A 2NSGA 1HE1A 2YL3A 2A69F 3I5QA 2YHSA 1CGOA 4CBEA 4CS9A 3DI5A 3CSKA 3KKBA 3VAYA 4JCZA 1BDJB 4IGGA 3ABKC 1TKNA 2NG1A 4W8KA 3SEOA 256BA 3U8PA 4E17A 5BUOA 1S05A 2B0HA 2V26A 1YVIA 4DBQA 1PV3A 3V7OA 2I8BA 3PHF2 3NYLA 4E0IA 1U0BB 1BBHA 1ZYRF 2L6FA 5JUAA 4HE8D 3TOMA 4KC9A 1GQAA 2YL1A 4HFFB 1ZU5A 1LIHA 1TR2A 2JPUA 1G5ZA 5COMA 4EWCA 4FAPB 4LERA 3LLKA 3QVZA 4H4KC 4BG0A 4CSAC 3ATPA 4XQ1A 4IAQA 1RMVA 1SF8A 2CDQA 3JRMO 3J06A 3ZTZA 2BL2A 3EGDA 3HNLA 4XEKA 4C3DA 1Q0KA 4GQHA 2AVKA 2PF4E 2J9VA 3HTKC 3KYJA 3NKEA 4L6RA 4DRHB 1VYIA 1OQCA 2IOQA 1Q0GA 1TFKB 3AQCA 3Q6MA 1CPRA 1CPQA 2GDCA 2OJQA 4J7TA 3FVYA 4M63A 1PD0A 3S27A 3T6GB 4HEAJ 1PD1A 2J7PD 1VYKA 4NTAA 1I5NA 2UUHA 4YN0B 1PCXA 3EFOB 3V5YA 3Q7GA 3GM1A 1O87A 3M1CB 3JT1A 1NZEA 1NU9C 3U9JA 5L3QA 4O7GA 1J8YF 2H7VC 3AJMA 1RKEB 2Z15A 2ZXPA 4P6IC 4U5GA 2HJMA 4Q5SF 2R02A 2OCCC 2OQMA 3I5PA 2XLDA 3U2MA 1OKKD 3T6BA 4B6IA 1V74B 2CGEA 3H65A 4LACB 2EINC 3EHMA 3KH2A 3IHUA 5L0DA 2BE5F 2J8WA 2L7AA 1K05A 5JSLA 2L81A 1QPUA 4DVYP 4U5CE 2M64A 4ANJA 3A11A 3JTLO 5KYWA 4BJTA 4XPYA 3RQEA 3DJUB 4DJ9A 2J7PA 3AGTA 4H54A 4YT5A 5L0FA 4MW3A 2XRHA 5A69A 1G4US 1YA9A 2GWWA 3F47A 3O55A 5COGA 3EG9A 1OCCC 3BRJA 1H6GA 1A7EA 3G4ZA 1SMYF 5JVEA 3WODF 3JYHA 1IZMA 3VM6A 4K0DA 1VLTA 5JS5A 4EHPA 4NY3A 1W2WA 2R7VA 3CAXA
chains in the Genus database with same CATH topology
3IPMO 1YA7O 1Z7Qc 1YARO 1AVOB 3JRMO 1FNTc 1YAUO 3JTLO 3JSEO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IPM O;  1YA7 O;  1Z7Q c;  1YAR O;  1AVO B;  3JRM O;  1FNT c;  1YAU O;  3JTL O;  3JSE O; 
#chains in the Genus database with same CATH topology
 4XLP F;  2PX3 A;  2R7W A;  3KYI A;  3M15 A;  1FMW A;  5E3A A;  1OKK A;  1ZHW A;  1APC A;  5KYX A;  3O6X A;  5L3V A;  4NC3 A;  2WZG A;  1OW8 A;  4WGY A;  1TFO B;  1H9T A;  3MLG A;  3U0C A;  2C04 A;  1ORS C;  2HJ3 A;  1L3P A;  2IM8 A;  2PP4 A;  2XLW A;  1NU7 D;  2R7R A;  2MWQ A;  5D91 A;  1TWG A;  4IAO A;  3ZG1 A;  4YT2 A;  4XPW A;  1M57 C;  2ZD9 A;  4X0R A;  1MQV A;  3DM5 A;  3HNI A;  4KI2 A;  1FR0 A;  3B0V C;  4UDV A;  5GPG B;  5K0I A;  2C03 A;  2IXP A;  4FX5 A;  1MMA A;  2P61 A;  2J9U A;  1ZHT A;  3GM2 A;  1FFT C;  4KNW A;  4CJO A;  1NG1 A;  3M4B A;  1N1C A;  2UUI A;  1OW6 A;  2M4E A;  3GEI A;  4YJW A;  5E3C A;  3DKA A;  4Q4Z F;  4XPX A;  1LE2 A;  3TUL A;  4I1M A;  3NDB B;  2DYR C;  2RSE B;  3KMI A;  5COF A;  3FOP A;  2F22 A;  3U2L A;  5L0J A;  4JC7 A;  3GOD A;  2YL0 A;  3F46 A;  2R7Q A;  2J0X A;  2YL7 A;  2KK1 A;  3M4C A;  3K1H A;  1CGN A;  4PJM A;  2LFD A;  1Z63 A;  3EGX A;  4MS2 A;  4OIN F;  2JX0 A;  3OWT A;  3RVY A;  1B68 A;  3W2V A;  3C62 A;  4C7O B;  4EBK A;  3S28 A;  4YT8 A;  2XLO A;  3S29 A;  3JSZ A;  1YZA A;  2ZXR A;  3EHN A;  3L8J A;  2R7O A;  3TJ5 A;  4YWQ A;  3Q6N A;  3ZWI A;  1Z6A A;  3LNM B;  2ETS A;  3B29 A;  3O10 A;  2CNW D;  2XLE A;  3TOL A;  1Q0M A;  4MW8 A;  2EPL X;  2XL4 A;  2QNL A;  1T6U A;  3TQO A;  3GEH A;  2KQ9 A;  3IEE A;  3W8H A;  3NKD A;  3UMK A;  1AVO B;  1D1B A;  3AQB A;  3NYM A;  2ZXW C;  4RD9 A;  1T9K A;  5CIV A;  3UGO A;  3QW1 A;  5T3W A;  5A6J A;  1JPN A;  1OXK A;  3A9C A;  1LE4 A;  1E86 A;  3L1M A;  3DXJ F;  3B0U X;  2OOC A;  4DBR A;  2OG2 A;  2W4M A;  4XEF A;  3EH1 A;  1MND A;  2HSB A;  2GAQ A;  3K7D A;  2XXA A;  2HUJ A;  3N0T A;  1BR2 A;  2B0J A;  3NMK A;  2HFI A;  1O5H A;  4Z9H A;  2XM4 A;  5B3S C;  4P9F A;  2XSE A;  1TQG A;  2IXM A;  1A7V A;  1XZQ A;  2NUT B;  2XLH A;  1RJ9 B;  3M79 A;  4K7B A;  5FCL A;  5DQZ A;  1LVK A;  4EBB A;  2CNW A;  4MVO A;  1M56 C;  1WAS A;  4JRZ A;  4MTG A;  4BJ5 C;  2IYL D;  2HV7 A;  2PFD A;  4BJ5 A;  1JAF A;  3G4X A;  4PJL A;  3RW0 A;  5A6K A;  5T1D B;  1ZHZ A;  2Y3H A;  4JZA A;  2ZPA A;  1FTS A;  3AG2 C;  3B0P A;  2WZL A;  2LD6 A;  1HW1 A;  2XS8 A;  3EJN A;  5E2Q A;  3GM3 A;  2R03 A;  3HJC A;  3KPH A;  4I1O B;  2PNO A;  2LK4 A;  5AC5 A;  2G3K A;  5DS4 A;  1A7D A;  3AG4 C;  4A2N B;  1EQ1 A;  3B9Q A;  4AL0 A;  1JR8 A;  2Y3G A;  4C3B A;  3SZR A;  3MBG A;  4AE4 A;  1YDI A;  3C63 A;  3EGD B;  3QTH A;  4J30 B;  5EK0 A;  2A0U A;  3IPM O;  5B1B C;  2Q7R A;  4YL1 A;  5L0C A;  1K40 A;  1VLS A;  3RFY A;  2CCY A;  1I4Y A;  1E2X A;  4MVU A;  4U5D E;  4XEV A;  3PCV A;  1VMA A;  1WTY A;  5JP7 A;  5KYY A;  2R7T A;  5JRA A;  2R05 A;  5KYW B;  1HE9 A;  3ZQY A;  3PMR A;  3SXZ A;  5DLJ A;  2R7S A;  4LLE A;  2EPK X;  3R2P A;  2KNH A;  2P1A A;  1ZVZ A;  4BEJ A;  3LS1 A;  1EKY A;  4AX2 A;  2Y3B A;  1M2O A;  4A4A A;  1LS4 A;  4CJG A;  2Y3D A;  1BR1 A;  1OW7 A;  1ZU4 A;  2Q9B A;  1Y4C A;  1VK5 A;  2YQY A;  3U3B A;  3UR3 C;  2W9Y A;  3FAP B;  3JZ0 A;  3ASO C;  3K33 A;  3R7C A;  3W8I A;  2YZS A;  1BZ4 A;  4OD4 A;  2NPU A;  2QLA A;  3GAN A;  1T01 A;  3T9O A;  4G7Z F;  2NUP B;  4CIP A;  2L9J A;  2Q00 A;  3ZTM A;  4ULV A;  5F5H A;  2HS5 A;  1A0B A;  1UG7 A;  4N06 A;  4G78 A;  3W2W A;  5IY5 C;  4MND A;  1QQ3 A;  2WVQ A;  1SZI A;  1D0Z A;  1ZW3 A;  2IBF A;  2IXO A;  4JTA B;  1FFH A;  2ZXO A;  3Q7L A;  2XM0 A;  3VF0 A;  1DOW A;  3EG9 B;  4O6Y A;  4EIY A;  3IQ5 A;  3I4U A;  1ZHX A;  3C8G D;  3RH3 A;  3X1O A;  4U9D A;  3OA1 A;  4NCQ A;  1T6Q A;  3MYF A;  3O39 A;  5TJ5 E;  4GEH A;  1TWH A;  5L0G A;  4D4N A;  1VTM P;  2EIL C;  1Q0F A;  4O79 A;  5DS5 A;  2DYS C;  4FES A;  5KYX B;  4XWJ A;  3K66 A;  3T6J A;  1L7C A;  4DVZ A;  3EZH A;  2HKV A;  2OU6 A;  2AU5 A;  2OJE D;  2X0C A;  3S0X A;  3N24 A;  3JSE O;  1MMN A;  3RIP A;  1QSP A;  4IAR A;  3RQG A;  3FOO A;  3IQ6 A;  2EPO A;  2VCA A;  1KNY A;  4WAB A;  4YK5 A;  3FMS A;  4G7H F;  1ZHY A;  4LDK A;  3DMD A;  1KU2 A;  2X51 A;  3B71 A;  1D0Y A;  5CI8 A;  1Z23 A;  1DOV A;  2Y39 A;  3IQT A;  3CZ6 A;  3RQF A;  3C8G A;  1J8M F;  4AL1 A;  2DGJ A;  2QTV A;  4PAC A;  1OCR C;  5KYU A;  4E0H A;  4EUK B;  2E87 A;  1SYQ A;  1GS9 A;  2J9B A;  2YVK A;  3POV A;  4AK9 A;  3ECS A;  1LKX A;  3LNR A;  3ZQV A;  1OXB A;  1TWC A;  3V5X A;  4JTC B;  3KL4 A;  2HZ8 A;  1XZP A;  4CX9 A;  2LQG A;  3GEE A;  1R4T A;  3JYY A;  1VB5 A;  2Y69 C;  3LLI A;  2HV6 A;  4RDA A;  1QVX A;  1MMG A;  5F5F A;  4KNV A;  1YAU O;  2YLD A;  1A41 A;  1C17 M;  3EGX B;  3NYJ A;  2HMQ A;  3HNJ A;  4DRJ B;  2R9R B;  2AWC A;  1C03 A;  5A6A A;  3L8I A;  2R7X A;  2H7O A;  3UMH A;  4BEM J;  1E84 A;  1UFB A;  1YJG A;  2EPN A;  4G0H A;  4MVR A;  4GYT A;  3V5Z A;  1HY5 A;  1LM3 B;  1YAR O;  4JEA A;  2A6E F;  1D1A A;  4CDY A;  1EI7 A;  1M2V A;  2GFH A;  5JT4 A;  4OIQ F;  2FFH A;  1R5I D;  4JTD B;  3NRH A;  3DAG A;  3DE9 A;  5DVW A;  4P9T A;  3UNG C;  1WN0 A;  3C8Z A;  4IB4 A;  3ZVR A;  2JD3 A;  1WAT A;  3JCU Q;  4C3E A;  3ABM C;  3HNK A;  1ST6 A;  3TK0 A;  5EGY A;  2P7V A;  2HMZ A;  4MTO A;  1EA8 A;  2XXA B;  3DE8 A;  4O6N A;  1G8X A;  4CS7 A;  1H9G A;  1MNE A;  1I4Z A;  4U9E A;  3UMI A;  1E83 A;  1YLM A;  2VC9 A;  5E33 A;  4I3M A;  3K1I A;  2AWY A;  2LSE A;  2W45 A;  4O6M A;  4CS8 A;  3SYN A;  4DOZ A;  3FDQ A;  2DB4 A;  3N2Z B;  3PDM P;  3QMK A;  3HKK A;  2YWA A;  3IQC A;  4WJ0 A;  3U3F A;  3VRC A;  3U9M A;  1NLX A;  2OEX A;  2J0W A;  3SNH A;  4PR9 A;  3OEO A;  4JUR I;  2QY9 A;  3H2U A;  1S7Z A;  2RD9 A;  3CQZ A;  1AUE A;  1V4A A;  2EIJ C;  3ASN C;  3K6B A;  2LP4 A;  4MQ9 F;  4MVM A;  2YEV A;  2NSF A;  4N4W A;  4E18 A;  2R7U A;  2BC5 A;  3X2Q C;  2J9W A;  2MHR A;  2D5R B;  1RXQ A;  5AGF A;  4OIO F;  1OCZ C;  2A1D D;  5L0I A;  2XL8 A;  3ITF A;  4OIR F;  4QI2 A;  1Z3I X;  1V54 C;  2VCB A;  1K04 A;  3AG1 C;  3JRT A;  2KC3 A;  2OKU A;  1FAP B;  4JE9 A;  4PFO A;  4JKV A;  4AE4 B;  1JRA A;  4YL0 A;  2V3C C;  2EIM C;  3NMJ A;  5A6B A;  2P6V A;  4MVQ A;  2A0B A;  2H7B A;  2XLM A;  4IRU A;  5CI9 A;  2DI3 A;  1T6I A;  2D4U A;  3US6 A;  5KYY B;  4K1O A;  4XLN F;  2ASR A;  1M6T A;  1NBB A;  1O3U A;  3LAY A;  4U5E E;  4U5H A;  3SXK A;  1C02 A;  3TD7 A;  5BQG A;  4W8P A;  4J32 B;  1ZW2 A;  4HFK B;  4RBN A;  1FMV A;  2VAS A;  2Q4F A;  1YYJ A;  1OR3 A;  2FAP B;  3LJB A;  3WAQ A;  4G7O F;  5L0H A;  2WL8 A;  4OD5 A;  2QUP A;  4R32 A;  3ZSU A;  3ZIB A;  2G3V A;  1OR2 A;  4NQF A;  4PFP A;  1RKE A;  3DJN B;  3E70 C;  1QZX A;  5F28 E;  4CS8 C;  5EHH A;  2KSF A;  3C7J A;  1JOG A;  3E9V A;  5DQT A;  1TWA A;  2ICW G;  4BJ1 A;  3LUT B;  2VCC A;  3H2V A;  1JMW A;  2LIG A;  4LDR A;  1SR2 A;  2WZF A;  4Q7C A;  5B1A C;  3S90 A;  4N6C A;  3LEO A;  3FHD A;  1Z7Q c;  1ORJ A;  1ORY A;  2Q9C A;  4BPM A;  2KYH A;  5HV9 A;  3QW0 A;  1GM5 A;  3DD7 A;  2NUP A;  3L34 A;  4JIO A;  1NFN A;  1F1M A;  3ZC4 A;  2W4B A;  1G4W R;  2WVN A;  2Q9A A;  1RCP A;  3GWN A;  1ZZP A;  2KW3 C;  4BJ6 C;  4DRI B;  3UGP A;  3W4Y A;  5JLI A;  4N6H A;  1NFO A;  2PBE A;  4E7Z A;  1IW7 F;  3RF3 A;  3EFO A;  4ZLD A;  1NSG B;  3DZA A;  4J7Y A;  1WGW A;  4EBJ A;  1E85 A;  3L0I A;  2L6G A;  2IXN A;  3GOR A;  3K1I C;  4PJJ A;  4XTK A;  3VYW A;  1QKR A;  1FNT c;  5KYN A;  1Q0D A;  2R25 A;  4JW1 A;  3AG3 C;  3S84 A;  4JCH A;  3EPV A;  1LPE A;  1T5O A;  3DM9 B;  2EIK C;  4CSA A;  3RKO F;  4U5B E;  3G50 A;  3GWL A;  2CYD A;  1LI5 A;  5T3T A;  4JJG A;  4JVS A;  4JJF A;  4CS9 C;  3RYL A;  2MYS A;  3LES A;  4KBL A;  1HW2 A;  3FXH A;  1D1C A;  3ABL C;  3C8G B;  2AP3 A;  5KYU B;  2LFF A;  2HSQ A;  4I44 A;  1WOL A;  1XWJ A;  2CW0 F;  2J46 A;  1AEP A;  1YA7 O;  3EH2 A;  4ONS A;  1KTM A;  2OEV A;  1YYX A;  3MYI A;  4LLC A;  4U5F E;  2XLV A;  5HSW A;  2VB6 A;  3SP1 A;  2LCH A;  3ZDL A;  1LS1 A;  2VH3 A;  4NTB A;  4EKW A;  2TMV P;  4MTF A;  3EQL F;  4QI0 A;  3DAF A;  3T4R A;  5BQI A;  1GGQ A;  2YRF A;  2GA0 A;  4IJJ A;  1MMD A;  1V55 C;  2O9X A;  4ULW A;  3FAJ A;  4E7S A;  3QZC A;  3DWW A;  4WGZ A;  1H7I A;  3MX3 A;  1QLE C;  4YL3 A;  1VOM A;  3EZI A;  2YLG A;  3WG7 C;  4C7O A;  3LS0 A;  1D0X A;  4MVS A;  4QDL A;  4Z9J A;  4LDQ A;  1LI7 A;  4Z9I A;  2Q3T A;  1JPJ A;  4OIP F;  2XS1 A;  4DXW A;  2KJG A;  1Z5Z A;  2KGO A;  4F4B A;  2WVO A;  1U89 A;  2A68 F;  4NTF A;  4CDA A;  4YT4 A;  4JEB A;  3C18 A;  2PX0 A;  1M2V B;  3S9O A;  2YKZ A;  4FWV A;  5B3I A;  5DS6 A;  1U6H A;  2FGY A;  2L6H A;  3LEV A;  4BJ6 A;  5AC4 A;  4D4X A;  3SXY A;  5BQH A;  3NG1 A;  4PK4 A;  1BR4 A;  4IWB A;  3U5S A;  1WWP A;  3WHN A;  4ZLC A;  1CGM E;  1Y6D A;  2EPM X;  2I15 A;  2WB7 A;  2XL6 A;  3MFN A;  3U8V A;  1RKC A;  1HMD A;  1HMO A;  2QE9 A;  3AGU A;  3SXM A;  2G62 A;  2A6H F;  3CEX A;  3AOU A;  1OCO C;  4ER9 A;  4PJN A;  3NMI A;  3TJ6 A;  1YZC A;  5D92 A;  5A6B D;  3RVZ A;  2J45 A;  2P0N A;  3QVY A;  2YLI A;  3HLZ A;  5FZT A;  4CIH A;  3BEH A;  4CDV A;  2H8A A;  2NUT A;  4MVZ A;  1RJ9 A;  2NSG A;  1HE1 A;  2YL3 A;  2A69 F;  3I5Q A;  2YHS A;  1CGO A;  4CBE A;  4CS9 A;  3DI5 A;  3CSK A;  3KKB A;  3VAY A;  4JCZ A;  1BDJ B;  4IGG A;  3ABK C;  1TKN A;  2NG1 A;  4W8K A;  3SEO A;  256B A;  3U8P A;  4E17 A;  5BUO A;  1S05 A;  2B0H A;  2V26 A;  1YVI A;  4DBQ A;  1PV3 A;  3V7O A;  2I8B A;  3PHF 2;  3NYL A;  4E0I A;  1U0B B;  1BBH A;  1ZYR F;  2L6F A;  5JUA A;  4HE8 D;  3TOM A;  4KC9 A;  1GQA A;  2YL1 A;  4HFF B;  1ZU5 A;  1LIH A;  1TR2 A;  2JPU A;  1G5Z A;  5COM A;  4EWC A;  4FAP B;  4LER A;  3LLK A;  3QVZ A;  4H4K C;  4BG0 A;  4CSA C;  3ATP A;  4XQ1 A;  4IAQ A;  1RMV A;  1SF8 A;  2CDQ A;  3JRM O;  3J06 A;  3ZTZ A;  2BL2 A;  3EGD A;  3HNL A;  4XEK A;  4C3D A;  1Q0K A;  4GQH A;  2AVK A;  2PF4 E;  2J9V A;  3HTK C;  3KYJ A;  3NKE A;  4L6R A;  4DRH B;  1VYI A;  1OQC A;  2IOQ A;  1Q0G A;  1TFK B;  3AQC A;  3Q6M A;  1CPR A;  1CPQ A;  2GDC A;  2OJQ A;  4J7T A;  3FVY A;  4M63 A;  1PD0 A;  3S27 A;  3T6G B;  4HEA J;  1PD1 A;  2J7P D;  1VYK A;  4NTA A;  1I5N A;  2UUH A;  4YN0 B;  1PCX A;  3EFO B;  3V5Y A;  3Q7G A;  3GM1 A;  1O87 A;  3M1C B;  3JT1 A;  1NZE A;  1NU9 C;  3U9J A;  5L3Q A;  4O7G A;  1J8Y F;  2H7V C;  3AJM A;  1RKE B;  2Z15 A;  2ZXP A;  4P6I C;  4U5G A;  2HJM A;  4Q5S F;  2R02 A;  2OCC C;  2OQM A;  3I5P A;  2XLD A;  3U2M A;  1OKK D;  3T6B A;  4B6I A;  1V74 B;  2CGE A;  3H65 A;  4LAC B;  2EIN C;  3EHM A;  3KH2 A;  3IHU A;  5L0D A;  2BE5 F;  2J8W A;  2L7A A;  1K05 A;  5JSL A;  2L81 A;  1QPU A;  4DVY P;  4U5C E;  2M64 A;  4ANJ A;  3A11 A;  3JTL O;  5KYW A;  4BJT A;  4XPY A;  3RQE A;  3DJU B;  4DJ9 A;  2J7P A;  3AGT A;  4H54 A;  4YT5 A;  5L0F A;  4MW3 A;  2XRH A;  5A69 A;  1G4U S;  1YA9 A;  2GWW A;  3F47 A;  3O55 A;  5COG A;  3EG9 A;  1OCC C;  3BRJ A;  1H6G A;  1A7E A;  3G4Z A;  1SMY F;  5JVE A;  3WOD F;  3JYH A;  1IZM A;  3VM6 A;  4K0D A;  1VLT A;  5JS5 A;  4EHP A;  4NY3 A;  1W2W A;  2R7V A;  3CAX A; 
#chains in the Genus database with same CATH homology
 3IPM O;  1YA7 O;  1Z7Q c;  1YAR O;  1AVO B;  3JRM O;  1FNT c;  1YAU O;  3JTL O;  3JSE O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...