3LEVA

Hiv-1 antibody 2f5 in complex with epitope scaffold es2
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
177
structure length
177
Chain Sequence
SDPVRQYLHEIGEVLELDKWAELGAAAKVEEGMEAIKKLSEATGLDQELIREVVRAKILGTAAIQKIPGLKEKPDPKTVEEVDGKLKSLPKELKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRGFAFSTYATWWIRQAINRAIADQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase sigma factor
publication title Elicitation of structure-specific antibodies by epitope scaffolds.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Immune system
total genus 49
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00140 Sigma70_r1_2 Sigma-70 factor, region 1.2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1810 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3levA00
1IW7F 4OIOF 4OIPF 3UGPA 4OIRF 4XLNF 2A6EF 4G7OF 2BE5F 2A69F 3LESA 3EQLF 4KI2A 4OIQF 2CW0F 4Q4ZF 3WODF 4MQ9F 4G7HF 1KU2A 4Q5SF 4G7ZF 2A6HF 3UGOA 2A68F 3DXJF 1ZYRF 1SMYF 3LEVA 4XLPF 4OINF
chains in the Genus database with same CATH superfamily
3NKDA 1IW7F 3QMKA 1R5ID 4CS9C 1Z7Qc 4OIPF 1D1AA 3TOMA 3RVYA 2J45A 4U5GA 1OKKA 3KH2A 4NTBA 4QI2A 1ZZPA 3LNRA 3RW0A 3NYLA 4B6IA 5A6AA 3L1MA 3DJNB 4CX9A 1JR8A 4RDAA 4O7GA 3I4UA 3U0CA 3J06A 3LUTB 4AK9A 4U9EA 1FNTc 1E2XA 1KTMA 5D91A 2Z15A 4KNWA 3MFNA 4ULVA 5JS5A 1K04A 4I3MA 1JMWA 1A0BA 3ATPA 3LLKA 2C04A 3M79A 2ZD9A 1BR4A 4XEVA 2HFIA 3NMKA 4BJ1A 5JT4A 2IOQA 3AG3C 3OA1A 2NUPB 2YHSA 1VYIA 5COFA 1WN0A 1U89A 3DWWA 2P0NA 1YLMA 2ASRA 3HNIA 2UUIA 3K1HA 3M4BA 2Q3TA 3TOLA 1SF8A 1WASA 3GORA 1TWHA 3C7JA 2VCAA 3GWNA 3QVYA 1GQAA 4U5FE 3SNHA 4CBEA 1ZHTA 2VCBA 1Z6AA 5F5HA 3A11A 1M56C 4JEAA 1NSGB 1ZHXA 1MMGA 2QUPA 2NUPA 4DRHB 1VB5A 2BC5A 3GEHA 4IB4A 2NUTA 2H8AA 4CS9A 2XLWA 1L7CA 1E86A 2RSEB 2FAPB 1LPEA 2Y69C 1JOGA 3F46A 3RF3A 2HSBA 2MHRA 1LE2A 4MQ9F 2PX0A 5CI8A 1G8XA 5AC5A 2EPKX 5F5FA 2YL0A 2L6HA 4IRUA 2EIMC 4FX5A 3VRCA 4DRIB 4WGYA 1TKNA 2C03A 5L0HA 1WOLA 3ASNC 5KYYB 5KYNA 3PDMP 4QDLA 1K05A 4YWQA 5TJ5E 2KW3C 3IHUA 1YYXA 2VCCA 2WZLA 4YT5A 4YN0B 1ZHZA 2RD9A 2F22A 3FHDA 1RJ9A 2PFDA 2XRHA 3N2ZB 1ZHYA 1T6QA 3GEEA 4NTFA 4G7OF 3PCVA 1B68A 4CS8A 1CPRA 2ZXOA 3EGDA 4U5CE 5T3TA 2QY9A 1OCZC 3AOUA 1WGWA 4GEHA 4C3BA 2JD3A 2J7PA 3KPHA 5E2QA 1OXKA 2UUHA 3JYYA 4FWVA 4AX2A 1QQ3A 1MNDA 2WVNA 5KYXB 1C03A 4J30B 2R02A 3EJNA 3N24A 2GFHA 1FFHA 3RQFA 4PJLA 4CIPA 2L7AA 1LVKA 3AQCA 1YAUO 1VK5A 2A6HF 2J9UA 3HLZA 3KMIA 5AGFA 3R7CA 1MMNA 5L0JA 2KJGA 2CGEA 3FXHA 2VASA 2R7UA 1NBBA 2VH3A 3LS1A 4L6RA 1ORYA 2Y3BA 3WG7C 3LJBA 4CS8C 1U6HA 2IXNA 1MNEA 5EK0A 3LS0A 2LFFA 1GS9A 2HMZA 3C8GD 2G62A 2GAQA 3M1CB 3EGXA 4ONSA 1ZW2A 4YT8A 2XXAB 1VLTA 3NG1A 2OCCC 1ZHWA 2XLEA 1CGME 1PCXA 3SZRA 3U3FA 3DD7A 2DB4A 3VM6A 4D4NA 5L3VA 3ZC4A 1S7ZA 3C63A 4YL1A 5B3IA 1YZAA 3E70C 3HKKA 2EIJC 2Y3GA 4XTKA 4XWJA 3K6BA 4X0RA 2W4MA 4BJ6C 4HE8D 5A6BA 3X2QC 3DXJF 3EG9B 1V55C 2YLDA 1NG1A 3AQBA 3O6XA 4JE9A 4BPMA 3HTKC 3ZG1A 1EQ1A 1M6TA 3ECSA 1QKRA 4P6IC 2XLOA 3ABKC 2XL4A 4W8KA 4WABA 1QZXA 5JRAA 2Q4FA 3POVA 4IGGA 2YVKA 2R7XA 2R25A 2CYDA 4KC9A 2HS5A 2J9VA 2PBEA 5T1DB 1VLSA 5CIVA 4Q4ZF 5FCLA 4P9FA 5K0IA 1HE1A 3Q6MA 4Z9IA 2LD6A 4JIOA 1SYQA 4MVSA 3HNJA 4DRJB 2R7TA 4K1OA 2O9XA 4ER9A 4G78A 3ZQYA 4BEJA 2KNHA 2EPMX 5A6KA 2OU6A 3EFOA 3DAGA 3QVZA 3LEOA 4OIRF 2Q9BA 1L3PA 3DM5A 1YYJA 4U9DA 2ETSA 2EINC 3S84A 1Y4CA 1EKYA 3NYMA 1I5NA 2G3KA 3CSKA 3IQ6A 4JJFA 1A7DA 2ICWG 4ANJA 3RQEA 3FOPA 2HKVA 2HV7A 4GQHA 5DQZA 1Z63A 2HV6A 3U9JA 4O6MA 1HW2A 3GODA 3JZ0A 2YEVA 2CNWD 4WGZA 1NFNA 3RKOF 1RKEA 4PFPA 3GM3A 5COGA 4R32A 1QVXA 2NG1A 2P6VA 2Q7RA 2EPNA 2AWCA 5BQHA 3AG2C 4A4AA 2NUTB 4PK4A 4XPXA 4XEFA 1C02A 2R7VA 1C17M 4XPWA 3DKAA 4YT4A 3ZQVA 3W2WA 3T6BA 1RXQA 3RIPA 2XLMA 3MYIA 4NCQA 3Q6NA 1OCRC 2M4EA 2R7OA 3C18A 4N06A 2GA0A 4AL0A 2IXOA 2XLHA 4J7TA 3JSZA 4MW3A 3UMKA 2A69F 5L0DA 3O39A 1Z3IX 3B0PA 4BJ5C 3JT1A 1FMWA 4JVSA 1LE4A 2J9WA 2KYHA 2QTVA 3ZIBA 5HSWA 3V5XA 2B0JA 1N1CA 1F1MA 3ZWIA 1RKCA 3MBGA 4IJJA 4JTAB 4G0HA 2XSEA 4IAOA 4PR9A 1RJ9B 2L6GA 3FOOA 3T9OA 1T6IA 1E85A 2V3CC 2A1DD 1TQGA 1ZW3A 4JKVA 3R2PA 4EWCA 5L0CA 4EKWA 5T3WA 1RMVA 1VMAA 3EGDB 5BUOA 1ZYRF 4LLEA 3FDQA 3K33A 3S28A 3DE9A 1I4ZA 4JCZA 2DGJA 2KQ9A 5DS4A 2G3VA 3RVZA 1G4US 5L0IA 1YZCA 1VOMA 1M2VA 1ORJA 2NSGA 1G4WR 2YKZA 3VF0A 4XLNF 3L8IA 1WATA 1HW1A 4Z9HA 1WWPA 3TJ5A 4LDRA 4EBJA 3W8IA 1Z23A 3JTLO 4F4BA 5EHHA 2B0HA 2J0WA 5F28E 3UMHA 1LI7A 1O3UA 4DOZA 4CSAA 3KYIA 1A41A 3L34A 3I5PA 3LESA 4LLCA 4C7OB 2Q9CA 4J7YA 2H7VC 2AVKA 1TFKB 1Q0KA 3U8VA 4C3EA 2WZFA 2QLAA 3AJMA 1NLXA 5DVWA 3TQOA 2Q00A 1AUEA 4HFFB 2DI3A 1FR0A 2CCYA 4G7ZF 4O6YA 2VC9A 3T4RA 3U8PA 1W2WA 2ZXWC 3EGXB 5B3SC 3LEVA 2IBFA 3UR3C 4BJ6A 4ULWA 4AE4A 4BEMJ 2GWWA 4C7OA 3QW1A 4I1MA 2HJMA 5JVEA 5A69A 3ZSUA 1J8YF 1DOVA 4JZAA 2AU5A 4N6CA 4PACA 1YA7O 4DBQA 1ZU5A 3H2VA 3Q7GA 3U5SA 5KYUA 1SR2A 4N4WA 4MVRA 1APCA 1WTYA 4JCHA 3S9OA 4CSAC 1BR2A 2D4UA 4U5HA 3U9MA 1AVOB 2XS8A 3V5YA 4CIHA 2WZGA 3K66A 2MWQA 5COMA 4EBKA 2R9RB 3IPMO 5BQIA 1OKKD 4NTAA 1D1CA 3S90A 3I5QA 3TULA 3ITFA 4G7HF 3AG4C 1M57C 2D5RB 1XWJA 2R7QA 3IQ5A 5HV9A 3FAPB 1GM5A 4Q5SF 4EUKB 3GEIA 1M2OA 1NU9C 2L6FA 3EZIA 1KNYA 1BDJB 4DJ9A 2QE9A 4DBRA 3M4CA 3SXYA 3GM1A 3QZCA 3CZ6A 4FAPB 3RH3A 1Q0DA 3ZDLA 3NMIA 4YL3A 1S05A 2W4BA 3C8ZA 4I44A 1H7IA 3O55A 3UMIA 1R4TA 4U5BE 3C62A 2R7RA 2Y39A 2PX3A 1LIHA 3DAFA 4KNVA 1D0XA 2DYRC 1YDIA 4ZLDA 4M63A 2WL8A 3DE8A 3KL4A 1A7VA 1MMAA 4C3DA 3DI5A 2Y3HA 3WAQA 4OIQF 5DS5A 3EFOB 1MQVA 1ST6A 1PD1A 2J46A 3ABLC 1TWGA 2PF4E 4MVQA 3WHNA 1XZPA 2XM4A 2YL7A 2YLIA 3SXZA 2CDQA 1HE9A 1CPQA 5GPGB 3G4XA 1SMYF 3AGUA 3SP1A 1OCOC 1Q0FA 2DYSC 1A7EA 3H65A 3U2MA 3VYWA 4CDAA 1O87A 3B0UX 1E84A 1OXBA 4H4KC 1G5ZA 2ZXRA 1T6UA 3U2LA 4E0HA 3E9VA 1ORSC 2YLGA 1RKEB 3T6GB 3NYJA 2YRFA 2BL2A 1UG7A 3C8GB 1ZVZA 5BQGA 2FFHA 3DMDA 3JYHA 4KI2A 4KBLA 5E33A 3OEOA 4CJGA 1OCCC 1OR2A 2CW0F 3ZTZA 4BJ5A 3IEEA 4H54A 4MTOA 4N6HA 3WODF 5L0GA 2IXMA 5JUAA 1Q0MA 1V54C 3S29A 1SZIA 2A0BA 3EH1A 1JPJA 2J7PD 2W45A 3TK0A 3S0XA 1Z5ZA 4CDYA 1JAFA 3C8GA 2IM8A 2WVOA 4EIYA 1U0BB 4LDKA 2Q9AA 4I1OB 5FZTA 1XZQA 1NU7D 3JCUQ 4JJGA 1OR3A 1OW7A 1PD0A 1LM3B 3JRMO 2EPLX 1EI7A 2HJ3A 2YL1A 3BRJA 3G50A 4JW1A 3QTHA 3SXMA 2BE5F 1BZ4A 2P1AA 2M64A 2EIKC 4EHPA 1O5HA 2AP3A 3MLGA 1CGNA 4JC7A 1YVIA 2J9BA 1T9KA 4OD5A 5KYXA 1QSPA 4ZLCA 4LACB 3NDBB 3W2VA 2XLVA 1OW6A 3K7DA 4BJTA 2TMVP 2YL3A 1LS4A 1M2VB 5KYWB 1AEPA 256BA 1LKXA 3TD7A 3RFYA 2R05A 3W4YA 3F47A 3SEOA 4K7BA 3CAXA 2XL6A 1T01A 3IQCA 3MX3A 2LCHA 3ASOC 4PJMA 1PV3A 4JTDB 3DM9B 2YQYA 1VTMP 4U5DE 1Q0GA 5A6BD 3HJCA 5KYWA 4NQFA 1YARO 2LFDA 1JRAA 4XEKA 2X0CA 2L81A 4EBBA 1QLEC 5D92A 2NSFA 3X1OA 2H7OA 1TR2A 2PNOA 1HMDA 4AL1A 2LSEA 4BG0A 3SXKA 4JEBA 4AE4B 1H6GA 3GWLA 3S27A 3ABMC 4Z9JA 4O79A 2WVQA 2V26A 3CEXA 3CQZA 3T6JA 1YJGA 3OWTA 4CDVA 1KU2A 2IYLD 1TWCA 5KYUB 3G4ZA 1D0ZA 2I8BA 3V7OA 1H9GA 2HMQA 1BR1A 1LI5A 2PP4A 4MTGA 4NC3A 3ZVRA 5L3QA 4MS2A 4MVUA 2W9YA 1CGOA 1V74B 3LNMB 3SYNA 3A9CA 4CS7A 2HUJA 3BEHA 4IARA 4OD4A 4UDVA 1Y6DA 2JX0A 3K1IA 4HFKB 2OEXA 4CJOA 4E18A 3PHF2 1K40A 4DXWA 4E7ZA 2NPUA 2KSFA 1UFBA 3FMSA 5KYYA 2CNWA 2OJED 1J8MF 4MVMA 2JPUA 1JPNA 2OKUA 1I4YA 2KGOA 3JRTA 3U3BA 3B0VC 1D1BA 2J0XA 3US6A 4MW8A 2Y3DA 1YA9A 2KK1A 3NRHA 4IAQA 5L0FA 1TWAA 3GM2A 1FTSA 5E3AA 1H9TA 5JP7A 2KC3A 2QNLA 4LDQA 3Q7LA 1FAPB 2GDCA 5A6JA 4D4XA 2P7VA 5DS6A 3JSEO 3RQGA 2VB6A 2HSQA 3K1IC 4XPYA 4XQ1A 3HNLA 2LIGA 5AC4A 1GGQA 2EILC 4JURI 4Q7CA 3UGPA 2ZPAA 2P61A 4J32B 1TFOB 2IXPA 2LK4A 3H2UA 4MVOA 4FESA 4YJWA 4MTFA 1IZMA 4U5EE 3EPVA 5DLJA 1FFTC 2AWYA 2OOCA 1RCPA 4RBNA 4WJ0A 3UNGC 4A2NB 5JSLA 4E0IA 5IY5C 3FVYA 3AG1C 3KYJA 1T5OA 3ZTMA 4DVYP 4PFOA 1HMOA 1V4AA 2XS1A 3N0TA 3W8HA 4QI0A 3L0IA 2OQMA 3GANA 3DZAA 1BBHA 3MYFA 2HZ8A 5DQTA 2R7SA 4JRZA 4K0DA 4RD9A 3VAYA 2XXAA 2YWAA 3TJ6A 2A68F 1NFOA 2EPOA 3O10A 3EZHA 2ZXPA 3HNKA 3QW0A 3NKEA 2A0UA 3AGTA 4OINF 4MVZA 1DOWA 1NZEA 1HY5A 2H7BA 2OG2A 2WB7A 4PJNA 4OIOF 1LS1A 4IWBA 2R7WA 3V5ZA 1OW8A 1E83A 2L9JA 2A6EF 2MYSA 1VYKA 5CI9A 2X51A 4LERA 1OQCA 3EG9A 3LLIA 3B71A 1D0YA 4E17A 3EHMA 1EA8A 4HEAJ 2I15A 4O6NA 2R03A 2FGYA 3EQLF 5E3CA 3L8JA 2LP4A 3LAYA 5EGYA 3NMJA 1FMVA 4PJJA 4YL0A 4GYTA 1ZU4A 2YZSA 3EH2A 3RYLA 2OJQA 3IQTA 4YT2A 4DVZA 3B9QA 4MNDA 3B29A 4YK5A 5B1AC 3EHNA 3DJUB 2LQGA 2XL8A 3FAJA 3KKBA 3M15A 4W8PA 5B1BC 2OEVA 3UGOA 3PMRA 2E87A 1QPUA 4JTCB 2XM0A 2J8WA 4NY3A 4E7SA 2XLDA 4P9TA 4XLPF 5JLIA 1MMDA
chains in the Genus database with same CATH topology
3NKDA 1IW7F 3QMKA 4OIPF 1D1AA 2J45A 4U5GA 1OKKA 3KH2A 4QI2A 3LNRA 4B6IA 3NYLA 3DJNB 4RDAA 4O7GA 3I4UA 4AK9A 5D91A 2Z15A 4KNWA 4I3MA 3LLKA 2C04A 1BR4A 4BJ1A 2IOQA 3AG3C 3OA1A 2NUPB 2YHSA 1VYIA 3K1HA 2Q3TA 1SF8A 1TWHA 4U5FE 4CBEA 3SNHA 1ZHTA 1Z6AA 5F5HA 1M56C 1ZHXA 1MMGA 2NUPA 2NUTA 4CS9A 2Y69C 3F46A 4MQ9F 2PX0A 5CI8A 1G8XA 5F5FA 4IRUA 2EIMC 4FX5A 1TKNA 2C03A 5KYYB 3ASNC 5KYNA 4QDLA 4YWQA 2KW3C 4YT5A 2WZLA 4YN0B 1ZHZA 3FHDA 1RJ9A 2PFDA 2XRHA 3N2ZB 1ZHYA 4G7OF 4CS8A 2ZXOA 3EGDA 4U5CE 5T3TA 2QY9A 1OCZC 4C3BA 1WGWA 4GEHA 4CS9C 2JD3A 2J7PA 5E2QA 4AX2A 4FWVA 5KYXB 1MNDA 2WVNA 4J30B 3EJNA 3N24A 2GFHA 1FFHA 4PJLA 1LVKA 3AQCA 3HLZA 1VK5A 2A6HF 2J9UA 3KMIA 1MMNA 2KJGA 2CGEA 2VASA 2R7UA 2VH3A 3LS1A 2Y3BA 3WG7C 3LJBA 4CS8C 2IXNA 1MNEA 3LS0A 2XXAB 2G62A 3M1CB 3EGXA 4YT8A 3NG1A 2OCCC 1ZHWA 1PCXA 3SZRA 3DD7A 5L3VA 3ZC4A 1S7ZA 3E70C 2EIJC 2Y3GA 4XTKA 4XWJA 3K6BA 4X0RA 2W4MA 4BJ6C 4HE8D 3X2QC 3DXJF 3EG9B 1V55C 1NG1A 3AQBA 3O6XA 3HTKC 3ZG1A 3ECSA 4P6IC 3ABKC 2XL4A 4W8KA 1QZXA 3POVA 2R7XA 4KC9A 2J9VA 5T1DB 4Q4ZF 5FCLA 3Q6MA 2R7TA 2O9XA 4BEJA 2KNHA 3EFOA 3DAGA 4OIRF 2Q9BA 3DM5A 2EINC 3NYMA 2G3KA 3CSKA 4JJFA 4ANJA 1Z63A 2HV7A 5DQZA 2HV6A 4O6MA 3GODA 2YEVA 2CNWD 3RKOF 4PFPA 2NG1A 2P6VA 3AG2C 2NUTB 4PK4A 2R7VA 4YT4A 3W2WA 3T6BA 3RIPA 3Q6NA 1OCRC 2M4EA 2R7OA 4N06A 2IXOA 3UMKA 3JSZA 2A69F 3O39A 1Z3IX 3B0PA 4BJ5C 3JT1A 1FMWA 4JVSA 2QTVA 2J9WA 3ZIBA 5HSWA 2B0JA 1N1CA 4IJJA 4G0HA 2XSEA 4IAOA 1RJ9B 2V3CC 2A1DD 4EWCA 5T3WA 1VMAA 3EGDB 5BUOA 1ZYRF 4LLEA 3FDQA 3K33A 3S28A 5DS4A 2DGJA 2KQ9A 2G3VA 1VOMA 1M2VA 4XLNF 5EHHA 4F4BA 3W8IA 1Z23A 2J0WA 3UMHA 4DOZA 4CSAA 3L34A 3LESA 3I5PA 4LLCA 4C7OB 2Q9CA 2H7VC 4C3EA 2WZFA 5DVWA 4HFFB 4G7ZF 4O6YA 3T4RA 1W2WA 2ZXWC 3EGXB 5B3SC 3LEVA 3UR3C 4BJ6A 4ULWA 4AE4A 4C7OA 4I1MA 3ZSUA 1J8YF 4DBQA 4JZAA 1ZU5A 3Q7GA 5KYUA 4JCHA 4CSAC 1BR2A 4U5HA 4CIHA 2WZGA 3K66A 2MWQA 1OKKD 1D1CA 3I5QA 3ITFA 4G7HF 3AG4C 1M57C 2D5RB 2R7QA 4Q5SF 1M2OA 1NU9C 4DBRA 3EZIA 3QZCA 3CZ6A 3RH3A 2W4BA 4I44A 3UMIA 4U5BE 2R7RA 2Y39A 2PX3A 3DAFA 4KNVA 1D0XA 2DYRC 4ZLDA 4M63A 2WL8A 3KL4A 1MMAA 4C3DA 2Y3HA 4OIQF 5DS5A 3EFOB 1ST6A 1PD1A 2J46A 3ABLC 1TWGA 2PF4E 2CDQA 1SMYF 3SP1A 1OCOC 2DYSC 3H65A 3VYWA 1O87A 3B0UX 4H4KC 2ZXRA 3E9VA 3NYJA 2FFHA 3DMDA 3JYHA 4KI2A 4KBLA 5E33A 3OEOA 1OCCC 2CW0F 4BJ5A 3IEEA 3WODF 2IXMA 1V54C 3S29A 1SZIA 3EH1A 1JPJA 2J7PD 2W45A 3S0XA 1Z5ZA 2WVOA 2Q9AA 4I1OB 1NU7D 3JCUQ 4JJGA 1PD0A 4JW1A 2BE5F 2EIKC 1O5HA 3MLGA 4OD5A 5KYXA 4ZLCA 4LACB 3NDBB 3W2VA 3K7DA 4BJTA 5KYWB 1M2VB 1LKXA 3TD7A 3RFYA 3F47A 3SEOA 4K7BA 3MX3A 3ASOC 4PJMA 3DM9B 4U5DE 3HJCA 5KYWA 4EBBA 2L81A 1QLEC 5D92A 3X1OA 2H7OA 1TR2A 2LSEA 4BG0A 4AE4B 3S27A 3ABMC 4O79A 2WVQA 2V26A 3CQZA 3T6JA 3OWTA 1KU2A 2IYLD 1TWCA 5KYUB 1D0ZA 2I8BA 3V7OA 2PP4A 5L3QA 1BR1A 3ZVRA 2W9YA 3SYNA 4CS7A 4OD4A 4HFKB 3PHF2 4E7ZA 5KYYA 2CNWA 1J8MF 1JPNA 2KGOA 3JRTA 3B0VC 1D1BA 2J0XA 2Y3DA 3NRHA 1TWAA 1FTSA 5E3AA 3Q7LA 5DS6A 2P7VA 2VB6A 3K1IC 4JURI 2EILC 4Q7CA 3UGPA 2ZPAA 4J32B 2IXPA 4FESA 4YJWA 1IZMA 4U5EE 3EPVA 5DLJA 1FFTC 4RBNA 4A2NB 4WJ0A 3UNGC 5IY5C 3FVYA 3AG1C 4DVYP 4PFOA 3W8HA 3N0TA 4QI0A 3L0IA 3GANA 3DZAA 5DQTA 2R7SA 4K0DA 4RD9A 3VAYA 2XXAA 2A68F 3EZHA 2ZXPA 3NKEA 4OINF 1NZEA 2OG2A 2H7BA 2WB7A 4PJNA 4OIOF 1LS1A 4IWBA 2R7WA 2L9JA 2A6EF 2MYSA 1VYKA 5CI9A 2X51A 4LERA 3EG9A 3LLIA 1D0YA 3EHMA 4HEAJ 4O6NA 2FGYA 3EQLF 5E3CA 5EGYA 3LAYA 1FMVA 4PJJA 4GYTA 1ZU4A 2YZSA 3EH2A 3RYLA 4YT2A 4DVZA 3B9QA 4MNDA 5B1AC 3EHNA 3DJUB 3FAJA 3KKBA 5B1BC 3UGOA 3PMRA 2E87A 4NY3A 4E7SA 4XLPF 1MMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IW7 F;  4OIO F;  4OIP F;  3UGP A;  4OIR F;  4XLN F;  2A6E F;  4G7O F;  2BE5 F;  2A69 F;  3LES A;  3EQL F;  4KI2 A;  4OIQ F;  2CW0 F;  4Q4Z F;  3WOD F;  4MQ9 F;  4G7H F;  1KU2 A;  4Q5S F;  4G7Z F;  2A6H F;  3UGO A;  2A68 F;  3DXJ F;  1ZYR F;  1SMY F;  3LEV A;  4XLP F;  4OIN F; 
#chains in the Genus database with same CATH topology
 3NKD A;  1IW7 F;  3QMK A;  1R5I D;  4CS9 C;  1Z7Q c;  4OIP F;  1D1A A;  3TOM A;  3RVY A;  2J45 A;  4U5G A;  1OKK A;  3KH2 A;  4NTB A;  4QI2 A;  1ZZP A;  3LNR A;  3RW0 A;  3NYL A;  4B6I A;  5A6A A;  3L1M A;  3DJN B;  4CX9 A;  1JR8 A;  4RDA A;  4O7G A;  3I4U A;  3U0C A;  3J06 A;  3LUT B;  4AK9 A;  4U9E A;  1FNT c;  1E2X A;  1KTM A;  5D91 A;  2Z15 A;  4KNW A;  3MFN A;  4ULV A;  5JS5 A;  1K04 A;  4I3M A;  1JMW A;  1A0B A;  3ATP A;  3LLK A;  2C04 A;  3M79 A;  2ZD9 A;  1BR4 A;  4XEV A;  2HFI A;  3NMK A;  4BJ1 A;  5JT4 A;  2IOQ A;  3AG3 C;  3OA1 A;  2NUP B;  2YHS A;  1VYI A;  5COF A;  1WN0 A;  1U89 A;  3DWW A;  2P0N A;  1YLM A;  2ASR A;  3HNI A;  2UUI A;  3K1H A;  3M4B A;  2Q3T A;  3TOL A;  1SF8 A;  1WAS A;  3GOR A;  1TWH A;  3C7J A;  2VCA A;  3GWN A;  3QVY A;  1GQA A;  4U5F E;  3SNH A;  4CBE A;  1ZHT A;  2VCB A;  1Z6A A;  5F5H A;  3A11 A;  1M56 C;  4JEA A;  1NSG B;  1ZHX A;  1MMG A;  2QUP A;  2NUP A;  4DRH B;  1VB5 A;  2BC5 A;  3GEH A;  4IB4 A;  2NUT A;  2H8A A;  4CS9 A;  2XLW A;  1L7C A;  1E86 A;  2RSE B;  2FAP B;  1LPE A;  2Y69 C;  1JOG A;  3F46 A;  3RF3 A;  2HSB A;  2MHR A;  1LE2 A;  4MQ9 F;  2PX0 A;  5CI8 A;  1G8X A;  5AC5 A;  2EPK X;  5F5F A;  2YL0 A;  2L6H A;  4IRU A;  2EIM C;  4FX5 A;  3VRC A;  4DRI B;  4WGY A;  1TKN A;  2C03 A;  5L0H A;  1WOL A;  3ASN C;  5KYY B;  5KYN A;  3PDM P;  4QDL A;  1K05 A;  4YWQ A;  5TJ5 E;  2KW3 C;  3IHU A;  1YYX A;  2VCC A;  2WZL A;  4YT5 A;  4YN0 B;  1ZHZ A;  2RD9 A;  2F22 A;  3FHD A;  1RJ9 A;  2PFD A;  2XRH A;  3N2Z B;  1ZHY A;  1T6Q A;  3GEE A;  4NTF A;  4G7O F;  3PCV A;  1B68 A;  4CS8 A;  1CPR A;  2ZXO A;  3EGD A;  4U5C E;  5T3T A;  2QY9 A;  1OCZ C;  3AOU A;  1WGW A;  4GEH A;  4C3B A;  2JD3 A;  2J7P A;  3KPH A;  5E2Q A;  1OXK A;  2UUH A;  3JYY A;  4FWV A;  4AX2 A;  1QQ3 A;  1MND A;  2WVN A;  5KYX B;  1C03 A;  4J30 B;  2R02 A;  3EJN A;  3N24 A;  2GFH A;  1FFH A;  3RQF A;  4PJL A;  4CIP A;  2L7A A;  1LVK A;  3AQC A;  1YAU O;  1VK5 A;  2A6H F;  2J9U A;  3HLZ A;  3KMI A;  5AGF A;  3R7C A;  1MMN A;  5L0J A;  2KJG A;  2CGE A;  3FXH A;  2VAS A;  2R7U A;  1NBB A;  2VH3 A;  3LS1 A;  4L6R A;  1ORY A;  2Y3B A;  3WG7 C;  3LJB A;  4CS8 C;  1U6H A;  2IXN A;  1MNE A;  5EK0 A;  3LS0 A;  2LFF A;  1GS9 A;  2HMZ A;  3C8G D;  2G62 A;  2GAQ A;  3M1C B;  3EGX A;  4ONS A;  1ZW2 A;  4YT8 A;  2XXA B;  1VLT A;  3NG1 A;  2OCC C;  1ZHW A;  2XLE A;  1CGM E;  1PCX A;  3SZR A;  3U3F A;  3DD7 A;  2DB4 A;  3VM6 A;  4D4N A;  5L3V A;  3ZC4 A;  1S7Z A;  3C63 A;  4YL1 A;  5B3I A;  1YZA A;  3E70 C;  3HKK A;  2EIJ C;  2Y3G A;  4XTK A;  4XWJ A;  3K6B A;  4X0R A;  2W4M A;  4BJ6 C;  4HE8 D;  5A6B A;  3X2Q C;  3DXJ F;  3EG9 B;  1V55 C;  2YLD A;  1NG1 A;  3AQB A;  3O6X A;  4JE9 A;  4BPM A;  3HTK C;  3ZG1 A;  1EQ1 A;  1M6T A;  3ECS A;  1QKR A;  4P6I C;  2XLO A;  3ABK C;  2XL4 A;  4W8K A;  4WAB A;  1QZX A;  5JRA A;  2Q4F A;  3POV A;  4IGG A;  2YVK A;  2R7X A;  2R25 A;  2CYD A;  4KC9 A;  2HS5 A;  2J9V A;  2PBE A;  5T1D B;  1VLS A;  5CIV A;  4Q4Z F;  5FCL A;  4P9F A;  5K0I A;  1HE1 A;  3Q6M A;  4Z9I A;  2LD6 A;  4JIO A;  1SYQ A;  4MVS A;  3HNJ A;  4DRJ B;  2R7T A;  4K1O A;  2O9X A;  4ER9 A;  4G78 A;  3ZQY A;  4BEJ A;  2KNH A;  2EPM X;  5A6K A;  2OU6 A;  3EFO A;  3DAG A;  3QVZ A;  3LEO A;  4OIR F;  2Q9B A;  1L3P A;  3DM5 A;  1YYJ A;  4U9D A;  2ETS A;  2EIN C;  3S84 A;  1Y4C A;  1EKY A;  3NYM A;  1I5N A;  2G3K A;  3CSK A;  3IQ6 A;  4JJF A;  1A7D A;  2ICW G;  4ANJ A;  3RQE A;  3FOP A;  2HKV A;  2HV7 A;  4GQH A;  5DQZ A;  1Z63 A;  2HV6 A;  3U9J A;  4O6M A;  1HW2 A;  3GOD A;  3JZ0 A;  2YEV A;  2CNW D;  4WGZ A;  1NFN A;  3RKO F;  1RKE A;  4PFP A;  3GM3 A;  5COG A;  4R32 A;  1QVX A;  2NG1 A;  2P6V A;  2Q7R A;  2EPN A;  2AWC A;  5BQH A;  3AG2 C;  4A4A A;  2NUT B;  4PK4 A;  4XPX A;  4XEF A;  1C02 A;  2R7V A;  1C17 M;  4XPW A;  3DKA A;  4YT4 A;  3ZQV A;  3W2W A;  3T6B A;  1RXQ A;  3RIP A;  2XLM A;  3MYI A;  4NCQ A;  3Q6N A;  1OCR C;  2M4E A;  2R7O A;  3C18 A;  4N06 A;  2GA0 A;  4AL0 A;  2IXO A;  2XLH A;  4J7T A;  3JSZ A;  4MW3 A;  3UMK A;  2A69 F;  5L0D A;  3O39 A;  1Z3I X;  3B0P A;  4BJ5 C;  3JT1 A;  1FMW A;  4JVS A;  1LE4 A;  2J9W A;  2KYH A;  2QTV A;  3ZIB A;  5HSW A;  3V5X A;  2B0J A;  1N1C A;  1F1M A;  3ZWI A;  1RKC A;  3MBG A;  4IJJ A;  4JTA B;  4G0H A;  2XSE A;  4IAO A;  4PR9 A;  1RJ9 B;  2L6G A;  3FOO A;  3T9O A;  1T6I A;  1E85 A;  2V3C C;  2A1D D;  1TQG A;  1ZW3 A;  4JKV A;  3R2P A;  4EWC A;  5L0C A;  4EKW A;  5T3W A;  1RMV A;  1VMA A;  3EGD B;  5BUO A;  1ZYR F;  4LLE A;  3FDQ A;  3K33 A;  3S28 A;  3DE9 A;  1I4Z A;  4JCZ A;  2DGJ A;  2KQ9 A;  5DS4 A;  2G3V A;  3RVZ A;  1G4U S;  5L0I A;  1YZC A;  1VOM A;  1M2V A;  1ORJ A;  2NSG A;  1G4W R;  2YKZ A;  3VF0 A;  4XLN F;  3L8I A;  1WAT A;  1HW1 A;  4Z9H A;  1WWP A;  3TJ5 A;  4LDR A;  4EBJ A;  3W8I A;  1Z23 A;  3JTL O;  4F4B A;  5EHH A;  2B0H A;  2J0W A;  5F28 E;  3UMH A;  1LI7 A;  1O3U A;  4DOZ A;  4CSA A;  3KYI A;  1A41 A;  3L34 A;  3I5P A;  3LES A;  4LLC A;  4C7O B;  2Q9C A;  4J7Y A;  2H7V C;  2AVK A;  1TFK B;  1Q0K A;  3U8V A;  4C3E A;  2WZF A;  2QLA A;  3AJM A;  1NLX A;  5DVW A;  3TQO A;  2Q00 A;  1AUE A;  4HFF B;  2DI3 A;  1FR0 A;  2CCY A;  4G7Z F;  4O6Y A;  2VC9 A;  3T4R A;  3U8P A;  1W2W A;  2ZXW C;  3EGX B;  5B3S C;  3LEV A;  2IBF A;  3UR3 C;  4BJ6 A;  4ULW A;  4AE4 A;  4BEM J;  2GWW A;  4C7O A;  3QW1 A;  4I1M A;  2HJM A;  5JVE A;  5A69 A;  3ZSU A;  1J8Y F;  1DOV A;  4JZA A;  2AU5 A;  4N6C A;  4PAC A;  1YA7 O;  4DBQ A;  1ZU5 A;  3H2V A;  3Q7G A;  3U5S A;  5KYU A;  1SR2 A;  4N4W A;  4MVR A;  1APC A;  1WTY A;  4JCH A;  3S9O A;  4CSA C;  1BR2 A;  2D4U A;  4U5H A;  3U9M A;  1AVO B;  2XS8 A;  3V5Y A;  4CIH A;  2WZG A;  3K66 A;  2MWQ A;  5COM A;  4EBK A;  2R9R B;  3IPM O;  5BQI A;  1OKK D;  4NTA A;  1D1C A;  3S90 A;  3I5Q A;  3TUL A;  3ITF A;  4G7H F;  3AG4 C;  1M57 C;  2D5R B;  1XWJ A;  2R7Q A;  3IQ5 A;  5HV9 A;  3FAP B;  1GM5 A;  4Q5S F;  4EUK B;  3GEI A;  1M2O A;  1NU9 C;  2L6F A;  3EZI A;  1KNY A;  1BDJ B;  4DJ9 A;  2QE9 A;  4DBR A;  3M4C A;  3SXY A;  3GM1 A;  3QZC A;  3CZ6 A;  4FAP B;  3RH3 A;  1Q0D A;  3ZDL A;  3NMI A;  4YL3 A;  1S05 A;  2W4B A;  3C8Z A;  4I44 A;  1H7I A;  3O55 A;  3UMI A;  1R4T A;  4U5B E;  3C62 A;  2R7R A;  2Y39 A;  2PX3 A;  1LIH A;  3DAF A;  4KNV A;  1D0X A;  2DYR C;  1YDI A;  4ZLD A;  4M63 A;  2WL8 A;  3DE8 A;  3KL4 A;  1A7V A;  1MMA A;  4C3D A;  3DI5 A;  2Y3H A;  3WAQ A;  4OIQ F;  5DS5 A;  3EFO B;  1MQV A;  1ST6 A;  1PD1 A;  2J46 A;  3ABL C;  1TWG A;  2PF4 E;  4MVQ A;  3WHN A;  1XZP A;  2XM4 A;  2YL7 A;  2YLI A;  3SXZ A;  2CDQ A;  1HE9 A;  1CPQ A;  5GPG B;  3G4X A;  1SMY F;  3AGU A;  3SP1 A;  1OCO C;  1Q0F A;  2DYS C;  1A7E A;  3H65 A;  3U2M A;  3VYW A;  4CDA A;  1O87 A;  3B0U X;  1E84 A;  1OXB A;  4H4K C;  1G5Z A;  2ZXR A;  1T6U A;  3U2L A;  4E0H A;  3E9V A;  1ORS C;  2YLG A;  1RKE B;  3T6G B;  3NYJ A;  2YRF A;  2BL2 A;  1UG7 A;  3C8G B;  1ZVZ A;  5BQG A;  2FFH A;  3DMD A;  3JYH A;  4KI2 A;  4KBL A;  5E33 A;  3OEO A;  4CJG A;  1OCC C;  1OR2 A;  2CW0 F;  3ZTZ A;  4BJ5 A;  3IEE A;  4H54 A;  4MTO A;  4N6H A;  3WOD F;  5L0G A;  2IXM A;  5JUA A;  1Q0M A;  1V54 C;  3S29 A;  1SZI A;  2A0B A;  3EH1 A;  1JPJ A;  2J7P D;  2W45 A;  3TK0 A;  3S0X A;  1Z5Z A;  4CDY A;  1JAF A;  3C8G A;  2IM8 A;  2WVO A;  4EIY A;  1U0B B;  4LDK A;  2Q9A A;  4I1O B;  5FZT A;  1XZQ A;  1NU7 D;  3JCU Q;  4JJG A;  1OR3 A;  1OW7 A;  1PD0 A;  1LM3 B;  3JRM O;  2EPL X;  1EI7 A;  2HJ3 A;  2YL1 A;  3BRJ A;  3G50 A;  4JW1 A;  3QTH A;  3SXM A;  2BE5 F;  1BZ4 A;  2P1A A;  2M64 A;  2EIK C;  4EHP A;  1O5H A;  2AP3 A;  3MLG A;  1CGN A;  4JC7 A;  1YVI A;  2J9B A;  1T9K A;  4OD5 A;  5KYX A;  1QSP A;  4ZLC A;  4LAC B;  3NDB B;  3W2V A;  2XLV A;  1OW6 A;  3K7D A;  4BJT A;  2TMV P;  2YL3 A;  1LS4 A;  1M2V B;  5KYW B;  1AEP A;  256B A;  1LKX A;  3TD7 A;  3RFY A;  2R05 A;  3W4Y A;  3F47 A;  3SEO A;  4K7B A;  3CAX A;  2XL6 A;  1T01 A;  3IQC A;  3MX3 A;  2LCH A;  3ASO C;  4PJM A;  1PV3 A;  4JTD B;  3DM9 B;  2YQY A;  1VTM P;  4U5D E;  1Q0G A;  5A6B D;  3HJC A;  5KYW A;  4NQF A;  1YAR O;  2LFD A;  1JRA A;  4XEK A;  2X0C A;  2L81 A;  4EBB A;  1QLE C;  5D92 A;  2NSF A;  3X1O A;  2H7O A;  1TR2 A;  2PNO A;  1HMD A;  4AL1 A;  2LSE A;  4BG0 A;  3SXK A;  4JEB A;  4AE4 B;  1H6G A;  3GWL A;  3S27 A;  3ABM C;  4Z9J A;  4O79 A;  2WVQ A;  2V26 A;  3CEX A;  3CQZ A;  3T6J A;  1YJG A;  3OWT A;  4CDV A;  1KU2 A;  2IYL D;  1TWC A;  5KYU B;  3G4Z A;  1D0Z A;  2I8B A;  3V7O A;  1H9G A;  2HMQ A;  1BR1 A;  1LI5 A;  2PP4 A;  4MTG A;  4NC3 A;  3ZVR A;  5L3Q A;  4MS2 A;  4MVU A;  2W9Y A;  1CGO A;  1V74 B;  3LNM B;  3SYN A;  3A9C A;  4CS7 A;  2HUJ A;  3BEH A;  4IAR A;  4OD4 A;  4UDV A;  1Y6D A;  2JX0 A;  3K1I A;  4HFK B;  2OEX A;  4CJO A;  4E18 A;  3PHF 2;  1K40 A;  4DXW A;  4E7Z A;  2NPU A;  2KSF A;  1UFB A;  3FMS A;  5KYY A;  2CNW A;  2OJE D;  1J8M F;  4MVM A;  2JPU A;  1JPN A;  2OKU A;  1I4Y A;  2KGO A;  3JRT A;  3U3B A;  3B0V C;  1D1B A;  2J0X A;  3US6 A;  4MW8 A;  2Y3D A;  1YA9 A;  2KK1 A;  3NRH A;  4IAQ A;  5L0F A;  1TWA A;  3GM2 A;  1FTS A;  5E3A A;  1H9T A;  5JP7 A;  2KC3 A;  2QNL A;  4LDQ A;  3Q7L A;  1FAP B;  2GDC A;  5A6J A;  4D4X A;  2P7V A;  5DS6 A;  3JSE O;  3RQG A;  2VB6 A;  2HSQ A;  3K1I C;  4XPY A;  4XQ1 A;  3HNL A;  2LIG A;  5AC4 A;  1GGQ A;  2EIL C;  4JUR I;  4Q7C A;  3UGP A;  2ZPA A;  2P61 A;  4J32 B;  1TFO B;  2IXP A;  2LK4 A;  3H2U A;  4MVO A;  4FES A;  4YJW A;  4MTF A;  1IZM A;  4U5E E;  3EPV A;  5DLJ A;  1FFT C;  2AWY A;  2OOC A;  1RCP A;  4RBN A;  4WJ0 A;  3UNG C;  4A2N B;  5JSL A;  4E0I A;  5IY5 C;  3FVY A;  3AG1 C;  3KYJ A;  1T5O A;  3ZTM A;  4DVY P;  4PFO A;  1HMO A;  1V4A A;  2XS1 A;  3N0T A;  3W8H A;  4QI0 A;  3L0I A;  2OQM A;  3GAN A;  3DZA A;  1BBH A;  3MYF A;  2HZ8 A;  5DQT A;  2R7S A;  4JRZ A;  4K0D A;  4RD9 A;  3VAY A;  2XXA A;  2YWA A;  3TJ6 A;  2A68 F;  1NFO A;  2EPO A;  3O10 A;  3EZH A;  2ZXP A;  3HNK A;  3QW0 A;  3NKE A;  2A0U A;  3AGT A;  4OIN F;  4MVZ A;  1DOW A;  1NZE A;  1HY5 A;  2H7B A;  2OG2 A;  2WB7 A;  4PJN A;  4OIO F;  1LS1 A;  4IWB A;  2R7W A;  3V5Z A;  1OW8 A;  1E83 A;  2L9J A;  2A6E F;  2MYS A;  1VYK A;  5CI9 A;  2X51 A;  4LER A;  1OQC A;  3EG9 A;  3LLI A;  3B71 A;  1D0Y A;  4E17 A;  3EHM A;  1EA8 A;  4HEA J;  2I15 A;  4O6N A;  2R03 A;  2FGY A;  3EQL F;  5E3C A;  3L8J A;  2LP4 A;  3LAY A;  5EGY A;  3NMJ A;  1FMV A;  4PJJ A;  4YL0 A;  4GYT A;  1ZU4 A;  2YZS A;  3EH2 A;  3RYL A;  2OJQ A;  3IQT A;  4YT2 A;  4DVZ A;  3B9Q A;  4MND A;  3B29 A;  4YK5 A;  5B1A C;  3EHN A;  3DJU B;  2LQG A;  2XL8 A;  3FAJ A;  3KKB A;  3M15 A;  4W8P A;  5B1B C;  2OEV A;  3UGO A;  3PMR A;  2E87 A;  1QPU A;  4JTC B;  2XM0 A;  2J8W A;  4NY3 A;  4E7S A;  2XLD A;  4P9T A;  4XLP F;  5JLI A;  1MMD A; 
#chains in the Genus database with same CATH homology
 3NKD A;  1IW7 F;  3QMK A;  4OIP F;  1D1A A;  2J45 A;  4U5G A;  1OKK A;  3KH2 A;  4QI2 A;  3LNR A;  4B6I A;  3NYL A;  3DJN B;  4RDA A;  4O7G A;  3I4U A;  4AK9 A;  5D91 A;  2Z15 A;  4KNW A;  4I3M A;  3LLK A;  2C04 A;  1BR4 A;  4BJ1 A;  2IOQ A;  3AG3 C;  3OA1 A;  2NUP B;  2YHS A;  1VYI A;  3K1H A;  2Q3T A;  1SF8 A;  1TWH A;  4U5F E;  4CBE A;  3SNH A;  1ZHT A;  1Z6A A;  5F5H A;  1M56 C;  1ZHX A;  1MMG A;  2NUP A;  2NUT A;  4CS9 A;  2Y69 C;  3F46 A;  4MQ9 F;  2PX0 A;  5CI8 A;  1G8X A;  5F5F A;  4IRU A;  2EIM C;  4FX5 A;  1TKN A;  2C03 A;  5KYY B;  3ASN C;  5KYN A;  4QDL A;  4YWQ A;  2KW3 C;  4YT5 A;  2WZL A;  4YN0 B;  1ZHZ A;  3FHD A;  1RJ9 A;  2PFD A;  2XRH A;  3N2Z B;  1ZHY A;  4G7O F;  4CS8 A;  2ZXO A;  3EGD A;  4U5C E;  5T3T A;  2QY9 A;  1OCZ C;  4C3B A;  1WGW A;  4GEH A;  4CS9 C;  2JD3 A;  2J7P A;  5E2Q A;  4AX2 A;  4FWV A;  5KYX B;  1MND A;  2WVN A;  4J30 B;  3EJN A;  3N24 A;  2GFH A;  1FFH A;  4PJL A;  1LVK A;  3AQC A;  3HLZ A;  1VK5 A;  2A6H F;  2J9U A;  3KMI A;  1MMN A;  2KJG A;  2CGE A;  2VAS A;  2R7U A;  2VH3 A;  3LS1 A;  2Y3B A;  3WG7 C;  3LJB A;  4CS8 C;  2IXN A;  1MNE A;  3LS0 A;  2XXA B;  2G62 A;  3M1C B;  3EGX A;  4YT8 A;  3NG1 A;  2OCC C;  1ZHW A;  1PCX A;  3SZR A;  3DD7 A;  5L3V A;  3ZC4 A;  1S7Z A;  3E70 C;  2EIJ C;  2Y3G A;  4XTK A;  4XWJ A;  3K6B A;  4X0R A;  2W4M A;  4BJ6 C;  4HE8 D;  3X2Q C;  3DXJ F;  3EG9 B;  1V55 C;  1NG1 A;  3AQB A;  3O6X A;  3HTK C;  3ZG1 A;  3ECS A;  4P6I C;  3ABK C;  2XL4 A;  4W8K A;  1QZX A;  3POV A;  2R7X A;  4KC9 A;  2J9V A;  5T1D B;  4Q4Z F;  5FCL A;  3Q6M A;  2R7T A;  2O9X A;  4BEJ A;  2KNH A;  3EFO A;  3DAG A;  4OIR F;  2Q9B A;  3DM5 A;  2EIN C;  3NYM A;  2G3K A;  3CSK A;  4JJF A;  4ANJ A;  1Z63 A;  2HV7 A;  5DQZ A;  2HV6 A;  4O6M A;  3GOD A;  2YEV A;  2CNW D;  3RKO F;  4PFP A;  2NG1 A;  2P6V A;  3AG2 C;  2NUT B;  4PK4 A;  2R7V A;  4YT4 A;  3W2W A;  3T6B A;  3RIP A;  3Q6N A;  1OCR C;  2M4E A;  2R7O A;  4N06 A;  2IXO A;  3UMK A;  3JSZ A;  2A69 F;  3O39 A;  1Z3I X;  3B0P A;  4BJ5 C;  3JT1 A;  1FMW A;  4JVS A;  2QTV A;  2J9W A;  3ZIB A;  5HSW A;  2B0J A;  1N1C A;  4IJJ A;  4G0H A;  2XSE A;  4IAO A;  1RJ9 B;  2V3C C;  2A1D D;  4EWC A;  5T3W A;  1VMA A;  3EGD B;  5BUO A;  1ZYR F;  4LLE A;  3FDQ A;  3K33 A;  3S28 A;  5DS4 A;  2DGJ A;  2KQ9 A;  2G3V A;  1VOM A;  1M2V A;  4XLN F;  5EHH A;  4F4B A;  3W8I A;  1Z23 A;  2J0W A;  3UMH A;  4DOZ A;  4CSA A;  3L34 A;  3LES A;  3I5P A;  4LLC A;  4C7O B;  2Q9C A;  2H7V C;  4C3E A;  2WZF A;  5DVW A;  4HFF B;  4G7Z F;  4O6Y A;  3T4R A;  1W2W A;  2ZXW C;  3EGX B;  5B3S C;  3LEV A;  3UR3 C;  4BJ6 A;  4ULW A;  4AE4 A;  4C7O A;  4I1M A;  3ZSU A;  1J8Y F;  4DBQ A;  4JZA A;  1ZU5 A;  3Q7G A;  5KYU A;  4JCH A;  4CSA C;  1BR2 A;  4U5H A;  4CIH A;  2WZG A;  3K66 A;  2MWQ A;  1OKK D;  1D1C A;  3I5Q A;  3ITF A;  4G7H F;  3AG4 C;  1M57 C;  2D5R B;  2R7Q A;  4Q5S F;  1M2O A;  1NU9 C;  4DBR A;  3EZI A;  3QZC A;  3CZ6 A;  3RH3 A;  2W4B A;  4I44 A;  3UMI A;  4U5B E;  2R7R A;  2Y39 A;  2PX3 A;  3DAF A;  4KNV A;  1D0X A;  2DYR C;  4ZLD A;  4M63 A;  2WL8 A;  3KL4 A;  1MMA A;  4C3D A;  2Y3H A;  4OIQ F;  5DS5 A;  3EFO B;  1ST6 A;  1PD1 A;  2J46 A;  3ABL C;  1TWG A;  2PF4 E;  2CDQ A;  1SMY F;  3SP1 A;  1OCO C;  2DYS C;  3H65 A;  3VYW A;  1O87 A;  3B0U X;  4H4K C;  2ZXR A;  3E9V A;  3NYJ A;  2FFH A;  3DMD A;  3JYH A;  4KI2 A;  4KBL A;  5E33 A;  3OEO A;  1OCC C;  2CW0 F;  4BJ5 A;  3IEE A;  3WOD F;  2IXM A;  1V54 C;  3S29 A;  1SZI A;  3EH1 A;  1JPJ A;  2J7P D;  2W45 A;  3S0X A;  1Z5Z A;  2WVO A;  2Q9A A;  4I1O B;  1NU7 D;  3JCU Q;  4JJG A;  1PD0 A;  4JW1 A;  2BE5 F;  2EIK C;  1O5H A;  3MLG A;  4OD5 A;  5KYX A;  4ZLC A;  4LAC B;  3NDB B;  3W2V A;  3K7D A;  4BJT A;  5KYW B;  1M2V B;  1LKX A;  3TD7 A;  3RFY A;  3F47 A;  3SEO A;  4K7B A;  3MX3 A;  3ASO C;  4PJM A;  3DM9 B;  4U5D E;  3HJC A;  5KYW A;  4EBB A;  2L81 A;  1QLE C;  5D92 A;  3X1O A;  2H7O A;  1TR2 A;  2LSE A;  4BG0 A;  4AE4 B;  3S27 A;  3ABM C;  4O79 A;  2WVQ A;  2V26 A;  3CQZ A;  3T6J A;  3OWT A;  1KU2 A;  2IYL D;  1TWC A;  5KYU B;  1D0Z A;  2I8B A;  3V7O A;  2PP4 A;  5L3Q A;  1BR1 A;  3ZVR A;  2W9Y A;  3SYN A;  4CS7 A;  4OD4 A;  4HFK B;  3PHF 2;  4E7Z A;  5KYY A;  2CNW A;  1J8M F;  1JPN A;  2KGO A;  3JRT A;  3B0V C;  1D1B A;  2J0X A;  2Y3D A;  3NRH A;  1TWA A;  1FTS A;  5E3A A;  3Q7L A;  5DS6 A;  2P7V A;  2VB6 A;  3K1I C;  4JUR I;  2EIL C;  4Q7C A;  3UGP A;  2ZPA A;  4J32 B;  2IXP A;  4FES A;  4YJW A;  1IZM A;  4U5E E;  3EPV A;  5DLJ A;  1FFT C;  4RBN A;  4A2N B;  4WJ0 A;  3UNG C;  5IY5 C;  3FVY A;  3AG1 C;  4DVY P;  4PFO A;  3W8H A;  3N0T A;  4QI0 A;  3L0I A;  3GAN A;  3DZA A;  5DQT A;  2R7S A;  4K0D A;  4RD9 A;  3VAY A;  2XXA A;  2A68 F;  3EZH A;  2ZXP A;  3NKE A;  4OIN F;  1NZE A;  2OG2 A;  2H7B A;  2WB7 A;  4PJN A;  4OIO F;  1LS1 A;  4IWB A;  2R7W A;  2L9J A;  2A6E F;  2MYS A;  1VYK A;  5CI9 A;  2X51 A;  4LER A;  3EG9 A;  3LLI A;  1D0Y A;  3EHM A;  4HEA J;  4O6N A;  2FGY A;  3EQL F;  5E3C A;  5EGY A;  3LAY A;  1FMV A;  4PJJ A;  4GYT A;  1ZU4 A;  2YZS A;  3EH2 A;  3RYL A;  4YT2 A;  4DVZ A;  3B9Q A;  4MND A;  5B1A C;  3EHN A;  3DJU B;  3FAJ A;  3KKB A;  5B1B C;  3UGO A;  3PMR A;  2E87 A;  4NY3 A;  4E7S A;  4XLP F;  1MMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...