3LEVA

Hiv-1 antibody 2f5 in complex with epitope scaffold es2
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
177
structure length
177
Chain Sequence
SDPVRQYLHEIGEVLELDKWAELGAAAKVEEGMEAIKKLSEATGLDQELIREVVRAKILGTAAIQKIPGLKEKPDPKTVEEVDGKLKSLPKELKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRGFAFSTYATWWIRQAINRAIADQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords RNA polymerase sigma factor
publication title Elicitation of structure-specific antibodies by epitope scaffolds.
pubmed doi rcsb
source organism Thermus aquaticus
total genus 49
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00140 Sigma70_r1_2 Sigma-70 factor, region 1.2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1810 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3levA00
2A6HF 4OIPF 4OINF 4XLNF 3WODF 2A69F 4OIRF 1SMYF 1ZYRF 1KU2A 4OIQF 4OIOF 1IW7F 2BE5F 3EQLF 2CW0F 2A68F 4XLPF 4G7OF 3DXJF 3LEVA 4Q5SF 4KI2A 2A6EF 4G7HF 4G7ZF 3UGPA 4MQ9F 3UGOA 4Q4ZF 3LESA
chains in the Genus database with same CATH superfamily
2HKVA 2B0JA 4NY3A 5KYWB 4Z9IA 4JTAB 4CJGA 1A7VA 3WHNA 3ASOC 1MMAA 4JURI 1ORJA 2B0HA 2W45A 1Z63A 4CS9C 1OKKA 2GA0A 5A6KA 2OOCA 3ITFA 4O6YA 1D1BA 1IW7F 2AU5A 4PR9A 3KYJA 2YZSA 2G62A 4IJJA 1LIHA 1N1CA 2L6FA 2YL1A 2HV6A 4BEJA 5E3AA 3SEOA 2KW3C 5L0IA 2KJGA 1OR2A 1LS1A 4BJ1A 1MMDA 1OXBA 2NSFA 2EIJC 3JYHA 1ZHXA 2ETSA 4EKWA 5CIVA 4K7BA 4EUKB 1HY5A 4CSAC 1TWCA 1WGWA 1ZW3A 3LESA 1YA9A 1YYXA 4U5DE 1OCZC 2YL7A 3DMDA 2L6GA 3K1IA 3GM1A 4H4KC 4MVZA 1YVIA 1VMAA 1Z3IX 3OWTA 3LAYA 3HNKA 3TOMA 3VRCA 3X1OA 3ZDLA 4BJ6C 1TR2A 2L6HA 3FVYA 4OIRF 1SMYF 4JEBA 4AE4B 4YWQA 3NMJA 3QW1A 3SXZA 2R7TA 3LLIA 2NUPB 2FGYA 4HFFB 4JJGA 3B0VC 4MVRA 1VLSA 2LCHA 5L0JA 4CIPA 2C04A 1RMVA 4Q5SF 2QLAA 3H2VA 3QW0A 3B71A 1NFOA 1YARO 2YEVA 4MTOA 2CDQA 4IGGA 1HMOA 4YT5A 1FAPB 4JVSA 4MVUA 4ULVA 2J0XA 5DS6A 1G8XA 3SXKA 1T6UA 4O7GA 4C3DA 2VASA 2CNWD 1C02A 1NFNA 1MMNA 1RJ9B 2NSGA 3NKDA 3RIPA 4CS9A 4ZLDA 1PV3A 2OCCC 2RSEB 1OKKD 2IXOA 4HEAJ 5T3WA 3WODF 3DKAA 2XS8A 4CDVA 1APCA 1ZYRF 1ZHWA 3QVZA 1YYJA 2BE5F 2J9WA 5BUOA 4AE4A 2Y3DA 4IWBA 4MS2A 4PJMA 4YJWA 5A6AA 2NUPA 2KGOA 2EPNA 1JRAA 4KI2A 4XEVA 2Z15A 1HE1A 4CS8A 5CI8A 4JW1A 3B0UX 1YLMA 3LUTB 2HJ3A 3ZQYA 1T6QA 1SZIA 2OEVA 2W9YA 1XWJA 2D4UA 1R5ID 3JCUQ 4GQHA 5T3TA 3W2WA 5B3IA 1E85A 5B3SC 3LS0A 2OJED 2G3KA 4FWVA 4BJ6A 2PP4A 3EFOA 5E3CA 3UR3C 1OW7A 3AGTA 4HFKB 3IHUA 2NPUA 4CDAA 2Q00A 2ZXOA 2EPMX 3L34A 4B6IA 1D1AA 2I15A 2LSEA 2YKZA 2LP4A 2XLWA 3JTLO 5DVWA 3SNHA 4DRHB 5A6JA 2R03A 1FFHA 1O87A 4RD9A 5JP7A 1BBHA 2NUTA 2KNHA 1GS9A 3MYIA 4E7SA 4NCQA 1LKXA 4I44A 3C7JA 2DYRC 1JR8A 4PFPA 1Z7Qc 1TQGA 2P6VA 4A4AA 5A6BD 4XPXA 5JRAA 4FX5A 1B68A 3SXMA 3T6BA 3AJMA 2XXAA 4EIYA 3DE9A 3Q7GA 3CZ6A 1RKCA 5L0DA 1TWAA 1V54C 3KKBA 3UNGC 5KYXB 5T1DB 5DS5A 4BJTA 3ABLC 4I3MA 2EPOA 3ABKC 3SXYA 2R7OA 3S9OA 2KSFA 2BC5A 1TFOB 2R7UA 1VTMP 1I4ZA 2QY9A 4JTCB 3IQTA 1D1CA 4U5CE 1ZU5A 3CQZA 4NTFA 3WG7C 5JVEA 3RQGA 4MVOA 1BDJB 5HV9A 2FAPB 2J0WA 4U9DA 1Z23A 3V7OA 1H7IA 1CGME 2XL8A 1QVXA 3FHDA 3NYMA 3ZTZA 2NG1A 1OCOC 2WL8A 1QKRA 3GM2A 3S84A 1DOVA 4CS7A 1HW1A 3ASNC 1EKYA 2XLMA 3BRJA 3EPVA 4U5HA 4QI0A 2DGJA 1NSGB 4MW3A 4OD4A 2YHSA 3UGPA 3Q6MA 1PD1A 3IPMO 3DAFA 4EWCA 2LFFA 2XLHA 3VAYA 3CSKA 2P0NA 4EBBA 5L3VA 3RFYA 2Q9CA 3U8PA 3K6BA 3POVA 1G5ZA 5KYXA 4J7TA 3DI5A 1QLEC 2CNWA 3HLZA 2KYHA 3PMRA 2IM8A 1Y4CA 4Z9HA 1HE9A 2Y39A 3C8GD 2LQGA 5DQTA 3NYLA 4EBKA 3JYYA 2XLEA 3N2ZB 1M2OA 3R2PA 4WABA 5EK0A 2PBEA 5F5HA 4E17A 2EPKX 2KC3A 3US6A 3NG1A 3H65A 4I1OB 3U3BA 2QTVA 3J06A 1OXKA 1E2XA 2R7VA 3FOPA 2VCCA 3DWWA 2M4EA 1TWGA 2VCBA 3GEHA 3M1CB 2XLDA 3GODA 3SP1A 1ORSC 2WB7A 5F28E 1NBBA 1CPRA 1VB5A 4IARA 4JCHA 2HMZA 2R02A 4Q4ZF 2R7XA 2ZPAA 2J9VA 3Q7LA 1T01A 1UG7A 2YLGA 3LS1A 1D0YA 3GWLA 4JTDB 3TK0A 2O9XA 4JC7A 4MW8A 3RH3A 1D0XA 1K40A 1VYIA 2AWCA 4LLCA 2ASRA 4MNDA 2R7SA 1WN0A 2PFDA 3UMHA 2D5RB 3RF3A 3ZSUA 3CAXA 4OIOF 2OU6A 1SF8A 5BQHA 5BQIA 5GPGB 4L6RA 4J30B 3KYIA 2WZFA 3TD7A 4Q7CA 1S05A 1WOLA 3GORA 2YL0A 1LE4A 1TKNA 4E18A 1Q0FA 4QDLA 1SYQA 1YZAA 2A6EF 2G3VA 2VB6A 4XWJA 3K66A 4G7ZF 4N6HA 4JE9A 4U5GA 1VK5A 4U5EE 4CJOA 4LDQA 4PJNA 1BZ4A 5A6BA 3EFOB 2R25A 3BEHA 3HKKA 3QTHA 4O6MA 4AK9A 1VOMA 1T9KA 3AG3C 3A11A 1O5HA 3L0IA 3LJBA 4PJJA 3RQEA 1F1MA 3ZVRA 2R7QA 3W8IA 1KNYA 3O10A 2X51A 1FMWA 1SR2A 2HUJA 4NC3A 5CI9A 4D4XA 4KNWA 5FCLA 1AEPA 1LS4A 1XZQA 2IXNA 2HV7A 3N0TA 4R32A 1U6HA 2H7BA 3C8GB 3EG9A 5B1BC 1EQ1A 1L3PA 2NUTB 4W8KA 4XPYA 4XEFA 3AG4C 1KTMA 3VF0A 4LERA 1K05A 3C62A 1Y6DA 2BL2A 3ZC4A 4WJ0A 3LEVA 1ZHZA 4X0RA 4JCZA 2VCAA 2ZXWC 3JSZA 2HS5A 4JEAA 1YZCA 2IBFA 5L0HA 4CSAA 4JIOA 3AQCA 5JLIA 2XXAB 1QPUA 2J7PD 4I1MA 2A1DD 5COGA 1ZU4A 3X2QC 3LEOA 2OQMA 3M15A 3EGXA 4ER9A 1OW8A 3QVYA 1R4TA 1BR4A 3ABMC 2YL3A 1QSPA 2XSEA 2ZXRA 3NRHA 5DLJA 2GAQA 4DOZA 3T6JA 2PX0A 1H9GA 1Q0GA 1A7EA 1CGOA 1T5OA 1Z6AA 4K1OA 4M63A 2C03A 2P7VA 1OCRC 4XLNF 2Q7RA 1CGNA 3W4YA 1U89A 4P9TA 3T4RA 1W2WA 2LFDA 4RDAA 3EJNA 2GWWA 2WVOA 1QZXA 2PNOA 1C03A 3C8GA 3EQLF 1ZVZA 1H6GA 3V5ZA 2WVNA 3IQ6A 4P6IC 2AWYA 1J8YF 1G4WR 4BPMA 1MMGA 4D4NA 1NU7D 3C8ZA 2V3CC 3MBGA 2RD9A 5IY5C 1FNTc 3U9MA 3MLGA 2H7VC 1JPNA 5E33A 1GQAA 1DOWA 3KMIA 1FMVA 2R9RB 3NMIA 4U5BE 4QI2A 1M57C 3TJ5A 4YK5A 2CGEA 4YL3A 4G7OF 3OA1A 2DYSC 2VC9A 4U5FE 2QE9A 3Q6NA 4OIPF 1JPJA 3R7CA 2OKUA 5B1AC 3TULA 4YN0B 3W2VA 3L8JA 2ZD9A 3ZTMA 1QQ3A 2V26A 2JPUA 1NU9C 4GYTA 2YLIA 3LLKA 1ST6A 2KQ9A 3M79A 3G50A 2EIMC 3O6XA 2YRFA 1YDIA 2LD6A 3JRTA 3O55A 1G4US 1GGQA 1Q0MA 4ZLCA 4CBEA 4NTBA 3T9OA 3W8HA 4G7HF 1V4AA 2J46A 3GWNA 3F47A 4BG0A 3I4UA 1EA8A 2Y3GA 3A9CA 3E70C 3U2LA 5DS4A 4YL1A 1MQVA 4LDRA 1Q0KA 4EHPA 1YAUO 4C3BA 4PACA 1D0ZA 1ZZPA 3N24A 4XPWA 3JSEO 2LIGA 1J8MF 3KPHA 2J8WA 2JD3A 1JMWA 2M64A 4KC9A 4YL0A 5AC5A 4CX9A 5FZTA 2X0CA 2UUIA 3EHNA 2HJMA 3NKEA 4BEMJ 5KYYB 1LM3B 3S27A 4LDKA 3ZIBA 1FR0A 3NDBB 4G78A 4G0HA 2A68F 2R7RA 1A7DA 2QUPA 1ZW2A 3LNRA 3KL4A 4DXWA 5D92A 1OR3A 3G4ZA 3TJ6A 2H8AA 4O79A 1U0BB 4HE8D 4JKVA 5BQGA 4AL1A 1YJGA 3U9JA 4K0DA 1I5NA 3T6GB 5EHHA 1AUEA 2MHRA 2MWQA 3DJUB 4C7OA 4JJFA 2PF4E 3DZAA 2J7PA 1YA7O 4CDYA 1PD0A 1WASA 3RVYA 3FAPB 3HNLA 2XL4A 5L3QA 2XM4A 1FTSA 2IOQA 3EG9B 3RVZA 4FAPB 2A69F 2L9JA 1PCXA 4N06A 1IZMA 1KU2A 2CYDA 2JX0A 5E2QA 2IXMA 2WZLA 3FAJA 3I5QA 2GDCA 2XM0A 1ORYA 3QMKA 4LLEA 1RKEB 3RW0A 3UMIA 3IQCA 5KYYA 1L7CA 3V5YA 5F5FA 3FOOA 5JT4A 2HMQA 1O3UA 5TJ5E 3MYFA 5L0GA 4A2NB 1LE2A 4AX2A 1A0BA 3ZQVA 5L0CA 4YT4A 3GANA 5D91A 5JS5A 2J9BA 5K0IA 1E84A 4PFOA 1BR1A 3EGXB 2VH3A 4CS8C 1M2VB 4YT8A 3U0CA 3GEEA 3VM6A 5AC4A 1K04A 3ZWIA 1TWHA 2WVQA 1WTYA 5KYNA 3PHF2 3B29A 3MFNA 4FESA 4DVZA 5KYWA 1HMDA 3GEIA 256BA 4J7YA 1E86A 2DI3A 2EINC 3MX3A 1AVOB 2HSQA 2L81A 4MTGA 2KK1A 3C18A 4E0HA 4GEHA 4LACB 3HJCA 4PJLA 3U5SA 3NMKA 2GFHA 3K7DA 4E0IA 3TOLA 4JZAA 1ZHYA 2OJQA 1XZPA 1OQCA 1NZEA 2Q3TA 2XS1A 3C63A 3KH2A 3AOUA 4KNVA 4P9FA 1V74B 3H2UA 4WGZA 4DJ9A 2R05A 3EZHA 1WATA 2XLVA 2YLDA 1RKEA 2FFHA 4UDVA 3I5PA 4W8PA 3EHMA 2XLOA 1OCCC 2IXPA 3UGOA 4EBJA 1EI7A 1VLTA 2P61A 3IQ5A 2DB4A 1M2VA 2EPLX 3FXHA 1BR2A 3EH2A 4OINF 5L0FA 4ONSA 1HW2A 1H9TA 4N6CA 3PCVA 2Y3BA 3U2MA 2W4MA 2XL6A 4F4BA 4DRJB 1JAFA 5EGYA 2Y69C 3GM3A 3JRMO 4OIQF 2A0BA 3EGDB 3V5XA 2F22A 3AQBA 2CCYA 2Q9BA 2WZGA 3CEXA 4N4WA 3K1HA 4MVQA 1NLXA 2MYSA 3WAQA 1GM5A 4XTKA 4YT2A 1T6IA 3DXJF 2YWAA 4XLPF 3EH1A 4IB4A 3JZ0A 3L1MA 3JT1A 1LPEA 2E87A 2UUHA 3AG2C 3G4XA 3U3FA 3TQOA 5A69A 1MNEA 2Y3HA 2QNLA 4OD5A 2A0UA 3VYWA 4ANJA 4MQ9F 3ATPA 3O39A 5JUAA 1A41A 4PK4A 1ZHTA 4BJ5C 1Q0DA 1RXQA 1RCPA 1FFTC 3FMSA 5AGFA 3FDQA 3DM9B 4AL0A 2H7OA 4DVYP 1OW6A 1RJ9A 3DE8A 4DRIB 2HZ8A 3DJNB 2J45A 4E7ZA 1C17M 2XRHA 4ULWA 4U9EA 4DBRA 3EZIA 4IAQA 4KBLA 4DBQA 1M6TA 3ZG1A 2OEXA 2OG2A 4H54A 2CW0F 3EGDA 3S0XA 4IRUA 5DQZA 3PDMP 1MNDA 1S7ZA 3HNJA 3SYNA 2Q9AA 4MVMA 1LI5A 1I4YA 3B0PA 5COMA 2Q4FA 3RYLA 4C7OB 1VYKA 3M4BA 5HSWA 2ICWG 2HSBA 3ECSA 2ZXPA 5KYUA 4Z9JA 4NQFA 3E9VA 4J32B 4MVSA 1Z5ZA 4WGYA 2A6HF 4JRZA 3LNMB 4CIHA 3NYJA 1CPQA 3DM5A 2AVKA 4C3EA 4O6NA 4NTAA 2I8BA 1TFKB 4XEKA 3U8VA 2PX3A 2J9UA 3F46A 1NG1A 2L7AA 2IYLD 2YVKA 1V55C 3K1IC 3SZRA 3HNIA 5JSLA 3S90A 1WWPA 2AP3A 3HTKC 2TMVP 3L8IA 2EIKC 3AGUA 3OEOA 2YQYA 1UFBA 4RBNA 2EILC 3S28A 1LI7A 2HFIA 3S29A 1JOGA 3IEEA 2R7WA 1M56C 3DD7A 4MTFA 3AG1C 3DAGA 2LK4A 4XQ1A 4BJ5A 3M4CA 5KYUB 2P1AA 1E83A 5COFA 3RKOF 3UMKA 1LVKA 3QZCA 2W4BA 3B9QA 3K33A 4IAOA 3RQFA
chains in the Genus database with same CATH topology
2B0JA 4NY3A 5KYWB 3ASOC 1MMAA 4JURI 2W45A 1Z63A 4CS9C 1OKKA 3ITFA 4O6YA 1D1BA 1IW7F 2YZSA 2G62A 4IJJA 1N1CA 4BEJA 2HV6A 5E3AA 3SEOA 2KW3C 2KJGA 1LS1A 4BJ1A 1MMDA 2EIJC 3JYHA 1ZHXA 4K7BA 4CSAC 1TWCA 1WGWA 3LESA 1OCZC 3DMDA 4H4KC 3OWTA 1VMAA 1Z3IX 3LAYA 3X1OA 4BJ6C 1TR2A 3FVYA 4OIRF 1SMYF 4AE4B 4YWQA 2R7TA 3LLIA 2NUPB 2FGYA 4HFFB 4JJGA 3B0VC 4Q5SF 2C04A 2YEVA 2CDQA 4YT5A 4JVSA 2J0XA 5DS6A 1G8XA 4O7GA 2VASA 2CNWD 1RJ9B 3NKDA 1MMNA 4CS9A 3RIPA 4ZLDA 2OCCC 1OKKD 2IXOA 4HEAJ 5T3WA 3WODF 1ZYRF 1ZHWA 2BE5F 2J9WA 5BUOA 4AE4A 2Y3DA 4IWBA 4PJMA 4YJWA 2NUPA 2KGOA 4KI2A 2Z15A 4CS8A 5CI8A 4JW1A 3B0UX 4B6IA 5KYUB 1SZIA 2W9YA 3JCUQ 5T3TA 3W2WA 5B3SC 3LS0A 4FWVA 2G3KA 4BJ6A 2PP4A 3EFOA 5E3CA 3UR3C 4HFKB 2ZXOA 3L34A 1D1AA 2LSEA 5DVWA 3SNHA 1FFHA 1O87A 4RD9A 2NUTA 2KNHA 4E7SA 1LKXA 4I44A 2DYRC 4PFPA 2P6VA 4FX5A 3T6BA 2XXAA 3Q7GA 3CZ6A 3KKBA 1TWAA 1V54C 3UNGC 5KYXB 5T1DB 5DS5A 4BJTA 3ABLC 4I3MA 3ABKC 2R7OA 2R7UA 2QY9A 4U5CE 1D1CA 1ZU5A 3CQZA 3WG7C 2J0WA 1Z23A 3V7OA 3NYMA 3FHDA 2NG1A 1OCOC 2WL8A 4CS7A 3ASNC 4U5HA 3EPVA 4QI0A 2DGJA 4OD4A 2YHSA 3UGPA 3Q6MA 1PD1A 3DAFA 4EWCA 3VAYA 3CSKA 4EBBA 5L3VA 3RFYA 2Q9CA 3POVA 3K6BA 5KYXA 1QLEC 2CNWA 3HLZA 3PMRA 2Y39A 5DQTA 3NYLA 3N2ZB 1M2OA 5F5HA 3NG1A 3H65A 4I1OB 2QTVA 2R7VA 2M4EA 1TWGA 3M1CB 3GODA 3SP1A 2WB7A 4JCHA 4Q4ZF 2R7XA 2ZPAA 2J9VA 3Q7LA 3LS1A 1D0YA 2O9XA 3RH3A 1D0XA 1VYIA 4MNDA 4LLCA 2R7SA 2PFDA 3UMHA 2D5RB 3ZSUA 4OIOF 1SF8A 4J30B 2WZFA 3TD7A 4Q7CA 1TKNA 4QDLA 2VB6A 2A6EF 2G3VA 4G7ZF 3K66A 4U5GA 1VK5A 4U5EE 4PJNA 3EFOB 4O6MA 4AK9A 1VOMA 3AG3C 3L0IA 3LJBA 1O5HA 4PJJA 3ZVRA 2R7QA 3W8IA 2X51A 1FMWA 5CI9A 5FCLA 4KNWA 2IXNA 2HV7A 3N0TA 5B1BC 2H7BA 3EG9A 2NUTB 4W8KA 3AG4C 4LERA 2R7RA 3ZC4A 4WJ0A 3LEVA 1ZHZA 4X0RA 2ZXWC 3JSZA 2XXAB 4CSAA 3AQCA 2J7PD 4I1MA 2A1DD 1ZU4A 3X2QC 3EGXA 1BR4A 3ABMC 2XSEA 2ZXRA 3NRHA 5DLJA 4DOZA 3T6JA 2PX0A 4XLNF 1Z6AA 4M63A 2C03A 2P7VA 1OCRC 3T4RA 1W2WA 4RDAA 3EJNA 2WVOA 1QZXA 3EQLF 2WVNA 4P6IC 1J8YF 1MMGA 1NU7D 2V3CC 5IY5C 3MLGA 2H7VC 1JPNA 5E33A 3KMIA 1FMVA 4QI2A 4U5BE 1M57C 2CGEA 4G7OF 3OA1A 2DYSC 4U5FE 3Q6NA 4OIPF 1JPJA 5B1AC 4YN0B 3W2VA 2V26A 1NU9C 4GYTA 3LLKA 1ST6A 2KQ9A 2EIMC 3O6XA 3JRTA 4ZLCA 4CBEA 3W8HA 4G7HF 2J46A 3F47A 4BG0A 3I4UA 2Y3GA 5DS4A 3E70C 4C3BA 1D0ZA 3N24A 1J8MF 2JD3A 4KC9A 3EHNA 3NKEA 5KYYB 3S27A 3ZIBA 3NDBB 4G0HA 2A68F 3LNRA 3KL4A 5D92A 4O79A 4HE8D 4K0DA 5EHHA 2MWQA 3DJUB 4C7OA 4JJFA 2PF4E 3DZAA 2J7PA 1PD0A 2XL4A 5L3QA 1FTSA 2IOQA 3EG9B 2A69F 2L9JA 1PCXA 4N06A 1IZMA 1KU2A 5E2QA 2IXMA 2WZLA 3FAJA 3I5QA 3QMKA 4LLEA 3UMIA 5KYYA 5F5FA 4A2NB 4AX2A 4YT4A 3GANA 5D91A 4PFOA 1BR1A 3EGXB 2VH3A 4CS8C 1M2VB 4YT8A 1TWHA 2WVQA 5KYNA 3PHF2 4FESA 4DVZA 5KYWA 2EINC 3MX3A 2L81A 4GEHA 4LACB 3HJCA 4PJLA 2GFHA 3K7DA 4JZAA 1ZHYA 3KH2A 4U5DE 2Q3TA 1NZEA 4XWJA 4C3DA 4KNVA 3EZHA 2FFHA 3I5PA 3EHMA 1OCCC 2IXPA 3UGOA 1M2VA 1BR2A 3EH2A 4OINF 2Y3BA 2W4MA 4F4BA 5EGYA 2Y69C 4OIQF 3EGDB 3AQBA 2WZGA 2Q9BA 3K1HA 2MYSA 4XTKA 4YT2A 4XLPF 3DXJF 3EH1A 3JT1A 3AG2C 2E87A 1MNEA 2Y3HA 4OD5A 3VYWA 4ANJA 4MQ9F 3O39A 4PK4A 1ZHTA 4BJ5C 1FFTC 3FDQA 3DM9B 4DVYP 2H7OA 1RJ9A 3DJNB 2J45A 4E7ZA 4ULWA 2XRHA 4DBRA 3EZIA 4DBQA 4KBLA 3ZG1A 2OG2A 2CW0F 3EGDA 3S0XA 4IRUA 5DQZA 1MNDA 1S7ZA 3SYNA 2Q9AA 3B0PA 3RYLA 4C7OB 1VYKA 5HSWA 3ECSA 2ZXPA 5KYUA 3E9VA 4J32B 1Z5ZA 2A6HF 4CIHA 3NYJA 3DM5A 4C3EA 4O6NA 2I8BA 2PX3A 3K1IC 2J9UA 1NG1A 3F46A 2IYLD 1V55C 3SZRA 3HTKC 2EIKC 3OEOA 4RBNA 2EILC 3S28A 3S29A 3IEEA 2R7WA 1M56C 3DD7A 3AG1C 3DAGA 4BJ5A 3RKOF 3UMKA 1LVKA 3QZCA 2W4BA 3B9QA 3K33A 4IAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A6H F;  4OIP F;  4OIN F;  4XLN F;  3WOD F;  2A69 F;  4OIR F;  1SMY F;  1ZYR F;  1KU2 A;  4OIQ F;  4OIO F;  1IW7 F;  2BE5 F;  3EQL F;  2CW0 F;  2A68 F;  4XLP F;  4G7O F;  3DXJ F;  3LEV A;  4Q5S F;  4KI2 A;  2A6E F;  4G7H F;  4G7Z F;  3UGP A;  4MQ9 F;  3UGO A;  4Q4Z F;  3LES A; 
#chains in the Genus database with same CATH topology
 2HKV A;  2B0J A;  4NY3 A;  5KYW B;  4Z9I A;  4JTA B;  4CJG A;  1A7V A;  3WHN A;  3ASO C;  1MMA A;  4JUR I;  1ORJ A;  2B0H A;  2W45 A;  1Z63 A;  4CS9 C;  1OKK A;  2GA0 A;  5A6K A;  2OOC A;  3ITF A;  4O6Y A;  1D1B A;  1IW7 F;  2AU5 A;  4PR9 A;  3KYJ A;  2YZS A;  2G62 A;  4IJJ A;  1LIH A;  1N1C A;  2L6F A;  2YL1 A;  2HV6 A;  4BEJ A;  5E3A A;  3SEO A;  2KW3 C;  5L0I A;  2KJG A;  1OR2 A;  1LS1 A;  4BJ1 A;  1MMD A;  1OXB A;  2NSF A;  2EIJ C;  3JYH A;  1ZHX A;  2ETS A;  4EKW A;  5CIV A;  4K7B A;  4EUK B;  1HY5 A;  4CSA C;  1TWC A;  1WGW A;  1ZW3 A;  3LES A;  1YA9 A;  1YYX A;  4U5D E;  1OCZ C;  2YL7 A;  3DMD A;  2L6G A;  3K1I A;  3GM1 A;  4H4K C;  4MVZ A;  1YVI A;  1VMA A;  1Z3I X;  3OWT A;  3LAY A;  3HNK A;  3TOM A;  3VRC A;  3X1O A;  3ZDL A;  4BJ6 C;  1TR2 A;  2L6H A;  3FVY A;  4OIR F;  1SMY F;  4JEB A;  4AE4 B;  4YWQ A;  3NMJ A;  3QW1 A;  3SXZ A;  2R7T A;  3LLI A;  2NUP B;  2FGY A;  4HFF B;  4JJG A;  3B0V C;  4MVR A;  1VLS A;  2LCH A;  5L0J A;  4CIP A;  2C04 A;  1RMV A;  4Q5S F;  2QLA A;  3H2V A;  3QW0 A;  3B71 A;  1NFO A;  1YAR O;  2YEV A;  4MTO A;  2CDQ A;  4IGG A;  1HMO A;  4YT5 A;  1FAP B;  4JVS A;  4MVU A;  4ULV A;  2J0X A;  5DS6 A;  1G8X A;  3SXK A;  1T6U A;  4O7G A;  4C3D A;  2VAS A;  2CNW D;  1C02 A;  1NFN A;  1MMN A;  1RJ9 B;  2NSG A;  3NKD A;  3RIP A;  4CS9 A;  4ZLD A;  1PV3 A;  2OCC C;  2RSE B;  1OKK D;  2IXO A;  4HEA J;  5T3W A;  3WOD F;  3DKA A;  2XS8 A;  4CDV A;  1APC A;  1ZYR F;  1ZHW A;  3QVZ A;  1YYJ A;  2BE5 F;  2J9W A;  5BUO A;  4AE4 A;  2Y3D A;  4IWB A;  4MS2 A;  4PJM A;  4YJW A;  5A6A A;  2NUP A;  2KGO A;  2EPN A;  1JRA A;  4KI2 A;  4XEV A;  2Z15 A;  1HE1 A;  4CS8 A;  5CI8 A;  4JW1 A;  3B0U X;  1YLM A;  3LUT B;  2HJ3 A;  3ZQY A;  1T6Q A;  1SZI A;  2OEV A;  2W9Y A;  1XWJ A;  2D4U A;  1R5I D;  3JCU Q;  4GQH A;  5T3T A;  3W2W A;  5B3I A;  1E85 A;  5B3S C;  3LS0 A;  2OJE D;  2G3K A;  4FWV A;  4BJ6 A;  2PP4 A;  3EFO A;  5E3C A;  3UR3 C;  1OW7 A;  3AGT A;  4HFK B;  3IHU A;  2NPU A;  4CDA A;  2Q00 A;  2ZXO A;  2EPM X;  3L34 A;  4B6I A;  1D1A A;  2I15 A;  2LSE A;  2YKZ A;  2LP4 A;  2XLW A;  3JTL O;  5DVW A;  3SNH A;  4DRH B;  5A6J A;  2R03 A;  1FFH A;  1O87 A;  4RD9 A;  5JP7 A;  1BBH A;  2NUT A;  2KNH A;  1GS9 A;  3MYI A;  4E7S A;  4NCQ A;  1LKX A;  4I44 A;  3C7J A;  2DYR C;  1JR8 A;  4PFP A;  1Z7Q c;  1TQG A;  2P6V A;  4A4A A;  5A6B D;  4XPX A;  5JRA A;  4FX5 A;  1B68 A;  3SXM A;  3T6B A;  3AJM A;  2XXA A;  4EIY A;  3DE9 A;  3Q7G A;  3CZ6 A;  1RKC A;  5L0D A;  1TWA A;  1V54 C;  3KKB A;  3UNG C;  5KYX B;  5T1D B;  5DS5 A;  4BJT A;  3ABL C;  4I3M A;  2EPO A;  3ABK C;  3SXY A;  2R7O A;  3S9O A;  2KSF A;  2BC5 A;  1TFO B;  2R7U A;  1VTM P;  1I4Z A;  2QY9 A;  4JTC B;  3IQT A;  1D1C A;  4U5C E;  1ZU5 A;  3CQZ A;  4NTF A;  3WG7 C;  5JVE A;  3RQG A;  4MVO A;  1BDJ B;  5HV9 A;  2FAP B;  2J0W A;  4U9D A;  1Z23 A;  3V7O A;  1H7I A;  1CGM E;  2XL8 A;  1QVX A;  3FHD A;  3NYM A;  3ZTZ A;  2NG1 A;  1OCO C;  2WL8 A;  1QKR A;  3GM2 A;  3S84 A;  1DOV A;  4CS7 A;  1HW1 A;  3ASN C;  1EKY A;  2XLM A;  3BRJ A;  3EPV A;  4U5H A;  4QI0 A;  2DGJ A;  1NSG B;  4MW3 A;  4OD4 A;  2YHS A;  3UGP A;  3Q6M A;  1PD1 A;  3IPM O;  3DAF A;  4EWC A;  2LFF A;  2XLH A;  3VAY A;  3CSK A;  2P0N A;  4EBB A;  5L3V A;  3RFY A;  2Q9C A;  3U8P A;  3K6B A;  3POV A;  1G5Z A;  5KYX A;  4J7T A;  3DI5 A;  1QLE C;  2CNW A;  3HLZ A;  2KYH A;  3PMR A;  2IM8 A;  1Y4C A;  4Z9H A;  1HE9 A;  2Y39 A;  3C8G D;  2LQG A;  5DQT A;  3NYL A;  4EBK A;  3JYY A;  2XLE A;  3N2Z B;  1M2O A;  3R2P A;  4WAB A;  5EK0 A;  2PBE A;  5F5H A;  4E17 A;  2EPK X;  2KC3 A;  3US6 A;  3NG1 A;  3H65 A;  4I1O B;  3U3B A;  2QTV A;  3J06 A;  1OXK A;  1E2X A;  2R7V A;  3FOP A;  2VCC A;  3DWW A;  2M4E A;  1TWG A;  2VCB A;  3GEH A;  3M1C B;  2XLD A;  3GOD A;  3SP1 A;  1ORS C;  2WB7 A;  5F28 E;  1NBB A;  1CPR A;  1VB5 A;  4IAR A;  4JCH A;  2HMZ A;  2R02 A;  4Q4Z F;  2R7X A;  2ZPA A;  2J9V A;  3Q7L A;  1T01 A;  1UG7 A;  2YLG A;  3LS1 A;  1D0Y A;  3GWL A;  4JTD B;  3TK0 A;  2O9X A;  4JC7 A;  4MW8 A;  3RH3 A;  1D0X A;  1K40 A;  1VYI A;  2AWC A;  4LLC A;  2ASR A;  4MND A;  2R7S A;  1WN0 A;  2PFD A;  3UMH A;  2D5R B;  3RF3 A;  3ZSU A;  3CAX A;  4OIO F;  2OU6 A;  1SF8 A;  5BQH A;  5BQI A;  5GPG B;  4L6R A;  4J30 B;  3KYI A;  2WZF A;  3TD7 A;  4Q7C A;  1S05 A;  1WOL A;  3GOR A;  2YL0 A;  1LE4 A;  1TKN A;  4E18 A;  1Q0F A;  4QDL A;  1SYQ A;  1YZA A;  2A6E F;  2G3V A;  2VB6 A;  4XWJ A;  3K66 A;  4G7Z F;  4N6H A;  4JE9 A;  4U5G A;  1VK5 A;  4U5E E;  4CJO A;  4LDQ A;  4PJN A;  1BZ4 A;  5A6B A;  3EFO B;  2R25 A;  3BEH A;  3HKK A;  3QTH A;  4O6M A;  4AK9 A;  1VOM A;  1T9K A;  3AG3 C;  3A11 A;  1O5H A;  3L0I A;  3LJB A;  4PJJ A;  3RQE A;  1F1M A;  3ZVR A;  2R7Q A;  3W8I A;  1KNY A;  3O10 A;  2X51 A;  1FMW A;  1SR2 A;  2HUJ A;  4NC3 A;  5CI9 A;  4D4X A;  4KNW A;  5FCL A;  1AEP A;  1LS4 A;  1XZQ A;  2IXN A;  2HV7 A;  3N0T A;  4R32 A;  1U6H A;  2H7B A;  3C8G B;  3EG9 A;  5B1B C;  1EQ1 A;  1L3P A;  2NUT B;  4W8K A;  4XPY A;  4XEF A;  3AG4 C;  1KTM A;  3VF0 A;  4LER A;  1K05 A;  3C62 A;  1Y6D A;  2BL2 A;  3ZC4 A;  4WJ0 A;  3LEV A;  1ZHZ A;  4X0R A;  4JCZ A;  2VCA A;  2ZXW C;  3JSZ A;  2HS5 A;  4JEA A;  1YZC A;  2IBF A;  5L0H A;  4CSA A;  4JIO A;  3AQC A;  5JLI A;  2XXA B;  1QPU A;  2J7P D;  4I1M A;  2A1D D;  5COG A;  1ZU4 A;  3X2Q C;  3LEO A;  2OQM A;  3M15 A;  3EGX A;  4ER9 A;  1OW8 A;  3QVY A;  1R4T A;  1BR4 A;  3ABM C;  2YL3 A;  1QSP A;  2XSE A;  2ZXR A;  3NRH A;  5DLJ A;  2GAQ A;  4DOZ A;  3T6J A;  2PX0 A;  1H9G A;  1Q0G A;  1A7E A;  1CGO A;  1T5O A;  1Z6A A;  4K1O A;  4M63 A;  2C03 A;  2P7V A;  1OCR C;  4XLN F;  2Q7R A;  1CGN A;  3W4Y A;  1U89 A;  4P9T A;  3T4R A;  1W2W A;  2LFD A;  4RDA A;  3EJN A;  2GWW A;  2WVO A;  1QZX A;  2PNO A;  1C03 A;  3C8G A;  3EQL F;  1ZVZ A;  1H6G A;  3V5Z A;  2WVN A;  3IQ6 A;  4P6I C;  2AWY A;  1J8Y F;  1G4W R;  4BPM A;  1MMG A;  4D4N A;  1NU7 D;  3C8Z A;  2V3C C;  3MBG A;  2RD9 A;  5IY5 C;  1FNT c;  3U9M A;  3MLG A;  2H7V C;  1JPN A;  5E33 A;  1GQA A;  1DOW A;  3KMI A;  1FMV A;  2R9R B;  3NMI A;  4U5B E;  4QI2 A;  1M57 C;  3TJ5 A;  4YK5 A;  2CGE A;  4YL3 A;  4G7O F;  3OA1 A;  2DYS C;  2VC9 A;  4U5F E;  2QE9 A;  3Q6N A;  4OIP F;  1JPJ A;  3R7C A;  2OKU A;  5B1A C;  3TUL A;  4YN0 B;  3W2V A;  3L8J A;  2ZD9 A;  3ZTM A;  1QQ3 A;  2V26 A;  2JPU A;  1NU9 C;  4GYT A;  2YLI A;  3LLK A;  1ST6 A;  2KQ9 A;  3M79 A;  3G50 A;  2EIM C;  3O6X A;  2YRF A;  1YDI A;  2LD6 A;  3JRT A;  3O55 A;  1G4U S;  1GGQ A;  1Q0M A;  4ZLC A;  4CBE A;  4NTB A;  3T9O A;  3W8H A;  4G7H F;  1V4A A;  2J46 A;  3GWN A;  3F47 A;  4BG0 A;  3I4U A;  1EA8 A;  2Y3G A;  3A9C A;  3E70 C;  3U2L A;  5DS4 A;  4YL1 A;  1MQV A;  4LDR A;  1Q0K A;  4EHP A;  1YAU O;  4C3B A;  4PAC A;  1D0Z A;  1ZZP A;  3N24 A;  4XPW A;  3JSE O;  2LIG A;  1J8M F;  3KPH A;  2J8W A;  2JD3 A;  1JMW A;  2M64 A;  4KC9 A;  4YL0 A;  5AC5 A;  4CX9 A;  5FZT A;  2X0C A;  2UUI A;  3EHN A;  2HJM A;  3NKE A;  4BEM J;  5KYY B;  1LM3 B;  3S27 A;  4LDK A;  3ZIB A;  1FR0 A;  3NDB B;  4G78 A;  4G0H A;  2A68 F;  2R7R A;  1A7D A;  2QUP A;  1ZW2 A;  3LNR A;  3KL4 A;  4DXW A;  5D92 A;  1OR3 A;  3G4Z A;  3TJ6 A;  2H8A A;  4O79 A;  1U0B B;  4HE8 D;  4JKV A;  5BQG A;  4AL1 A;  1YJG A;  3U9J A;  4K0D A;  1I5N A;  3T6G B;  5EHH A;  1AUE A;  2MHR A;  2MWQ A;  3DJU B;  4C7O A;  4JJF A;  2PF4 E;  3DZA A;  2J7P A;  1YA7 O;  4CDY A;  1PD0 A;  1WAS A;  3RVY A;  3FAP B;  3HNL A;  2XL4 A;  5L3Q A;  2XM4 A;  1FTS A;  2IOQ A;  3EG9 B;  3RVZ A;  4FAP B;  2A69 F;  2L9J A;  1PCX A;  4N06 A;  1IZM A;  1KU2 A;  2CYD A;  2JX0 A;  5E2Q A;  2IXM A;  2WZL A;  3FAJ A;  3I5Q A;  2GDC A;  2XM0 A;  1ORY A;  3QMK A;  4LLE A;  1RKE B;  3RW0 A;  3UMI A;  3IQC A;  5KYY A;  1L7C A;  3V5Y A;  5F5F A;  3FOO A;  5JT4 A;  2HMQ A;  1O3U A;  5TJ5 E;  3MYF A;  5L0G A;  4A2N B;  1LE2 A;  4AX2 A;  1A0B A;  3ZQV A;  5L0C A;  4YT4 A;  3GAN A;  5D91 A;  5JS5 A;  2J9B A;  5K0I A;  1E84 A;  4PFO A;  1BR1 A;  3EGX B;  2VH3 A;  4CS8 C;  1M2V B;  4YT8 A;  3U0C A;  3GEE A;  3VM6 A;  5AC4 A;  1K04 A;  3ZWI A;  1TWH A;  2WVQ A;  1WTY A;  5KYN A;  3PHF 2;  3B29 A;  3MFN A;  4FES A;  4DVZ A;  5KYW A;  1HMD A;  3GEI A;  256B A;  4J7Y A;  1E86 A;  2DI3 A;  2EIN C;  3MX3 A;  1AVO B;  2HSQ A;  2L81 A;  4MTG A;  2KK1 A;  3C18 A;  4E0H A;  4GEH A;  4LAC B;  3HJC A;  4PJL A;  3U5S A;  3NMK A;  2GFH A;  3K7D A;  4E0I A;  3TOL A;  4JZA A;  1ZHY A;  2OJQ A;  1XZP A;  1OQC A;  1NZE A;  2Q3T A;  2XS1 A;  3C63 A;  3KH2 A;  3AOU A;  4KNV A;  4P9F A;  1V74 B;  3H2U A;  4WGZ A;  4DJ9 A;  2R05 A;  3EZH A;  1WAT A;  2XLV A;  2YLD A;  1RKE A;  2FFH A;  4UDV A;  3I5P A;  4W8P A;  3EHM A;  2XLO A;  1OCC C;  2IXP A;  3UGO A;  4EBJ A;  1EI7 A;  1VLT A;  2P61 A;  3IQ5 A;  2DB4 A;  1M2V A;  2EPL X;  3FXH A;  1BR2 A;  3EH2 A;  4OIN F;  5L0F A;  4ONS A;  1HW2 A;  1H9T A;  4N6C A;  3PCV A;  2Y3B A;  3U2M A;  2W4M A;  2XL6 A;  4F4B A;  4DRJ B;  1JAF A;  5EGY A;  2Y69 C;  3GM3 A;  3JRM O;  4OIQ F;  2A0B A;  3EGD B;  3V5X A;  2F22 A;  3AQB A;  2CCY A;  2Q9B A;  2WZG A;  3CEX A;  4N4W A;  3K1H A;  4MVQ A;  1NLX A;  2MYS A;  3WAQ A;  1GM5 A;  4XTK A;  4YT2 A;  1T6I A;  3DXJ F;  2YWA A;  4XLP F;  3EH1 A;  4IB4 A;  3JZ0 A;  3L1M A;  3JT1 A;  1LPE A;  2E87 A;  2UUH A;  3AG2 C;  3G4X A;  3U3F A;  3TQO A;  5A69 A;  1MNE A;  2Y3H A;  2QNL A;  4OD5 A;  2A0U A;  3VYW A;  4ANJ A;  4MQ9 F;  3ATP A;  3O39 A;  5JUA A;  1A41 A;  4PK4 A;  1ZHT A;  4BJ5 C;  1Q0D A;  1RXQ A;  1RCP A;  1FFT C;  3FMS A;  5AGF A;  3FDQ A;  3DM9 B;  4AL0 A;  2H7O A;  4DVY P;  1OW6 A;  1RJ9 A;  3DE8 A;  4DRI B;  2HZ8 A;  3DJN B;  2J45 A;  4E7Z A;  1C17 M;  2XRH A;  4ULW A;  4U9E A;  4DBR A;  3EZI A;  4IAQ A;  4KBL A;  4DBQ A;  1M6T A;  3ZG1 A;  2OEX A;  2OG2 A;  4H54 A;  2CW0 F;  3EGD A;  3S0X A;  4IRU A;  5DQZ A;  3PDM P;  1MND A;  1S7Z A;  3HNJ A;  3SYN A;  2Q9A A;  4MVM A;  1LI5 A;  1I4Y A;  3B0P A;  5COM A;  2Q4F A;  3RYL A;  4C7O B;  1VYK A;  3M4B A;  5HSW A;  2ICW G;  2HSB A;  3ECS A;  2ZXP A;  5KYU A;  4Z9J A;  4NQF A;  3E9V A;  4J32 B;  4MVS A;  1Z5Z A;  4WGY A;  2A6H F;  4JRZ A;  3LNM B;  4CIH A;  3NYJ A;  1CPQ A;  3DM5 A;  2AVK A;  4C3E A;  4O6N A;  4NTA A;  2I8B A;  1TFK B;  4XEK A;  3U8V A;  2PX3 A;  2J9U A;  3F46 A;  1NG1 A;  2L7A A;  2IYL D;  2YVK A;  1V55 C;  3K1I C;  3SZR A;  3HNI A;  5JSL A;  3S90 A;  1WWP A;  2AP3 A;  3HTK C;  2TMV P;  3L8I A;  2EIK C;  3AGU A;  3OEO A;  2YQY A;  1UFB A;  4RBN A;  2EIL C;  3S28 A;  1LI7 A;  2HFI A;  3S29 A;  1JOG A;  3IEE A;  2R7W A;  1M56 C;  3DD7 A;  4MTF A;  3AG1 C;  3DAG A;  2LK4 A;  4XQ1 A;  4BJ5 A;  3M4C A;  5KYU B;  2P1A A;  1E83 A;  5COF A;  3RKO F;  3UMK A;  1LVK A;  3QZC A;  2W4B A;  3B9Q A;  3K33 A;  4IAO A;  3RQF A; 
#chains in the Genus database with same CATH homology
 2B0J A;  4NY3 A;  5KYW B;  3ASO C;  1MMA A;  4JUR I;  2W45 A;  1Z63 A;  4CS9 C;  1OKK A;  3ITF A;  4O6Y A;  1D1B A;  1IW7 F;  2YZS A;  2G62 A;  4IJJ A;  1N1C A;  4BEJ A;  2HV6 A;  5E3A A;  3SEO A;  2KW3 C;  2KJG A;  1LS1 A;  4BJ1 A;  1MMD A;  2EIJ C;  3JYH A;  1ZHX A;  4K7B A;  4CSA C;  1TWC A;  1WGW A;  3LES A;  1OCZ C;  3DMD A;  4H4K C;  3OWT A;  1VMA A;  1Z3I X;  3LAY A;  3X1O A;  4BJ6 C;  1TR2 A;  3FVY A;  4OIR F;  1SMY F;  4AE4 B;  4YWQ A;  2R7T A;  3LLI A;  2NUP B;  2FGY A;  4HFF B;  4JJG A;  3B0V C;  4Q5S F;  2C04 A;  2YEV A;  2CDQ A;  4YT5 A;  4JVS A;  2J0X A;  5DS6 A;  1G8X A;  4O7G A;  2VAS A;  2CNW D;  1RJ9 B;  3NKD A;  1MMN A;  4CS9 A;  3RIP A;  4ZLD A;  2OCC C;  1OKK D;  2IXO A;  4HEA J;  5T3W A;  3WOD F;  1ZYR F;  1ZHW A;  2BE5 F;  2J9W A;  5BUO A;  4AE4 A;  2Y3D A;  4IWB A;  4PJM A;  4YJW A;  2NUP A;  2KGO A;  4KI2 A;  2Z15 A;  4CS8 A;  5CI8 A;  4JW1 A;  3B0U X;  4B6I A;  5KYU B;  1SZI A;  2W9Y A;  3JCU Q;  5T3T A;  3W2W A;  5B3S C;  3LS0 A;  4FWV A;  2G3K A;  4BJ6 A;  2PP4 A;  3EFO A;  5E3C A;  3UR3 C;  4HFK B;  2ZXO A;  3L34 A;  1D1A A;  2LSE A;  5DVW A;  3SNH A;  1FFH A;  1O87 A;  4RD9 A;  2NUT A;  2KNH A;  4E7S A;  1LKX A;  4I44 A;  2DYR C;  4PFP A;  2P6V A;  4FX5 A;  3T6B A;  2XXA A;  3Q7G A;  3CZ6 A;  3KKB A;  1TWA A;  1V54 C;  3UNG C;  5KYX B;  5T1D B;  5DS5 A;  4BJT A;  3ABL C;  4I3M A;  3ABK C;  2R7O A;  2R7U A;  2QY9 A;  4U5C E;  1D1C A;  1ZU5 A;  3CQZ A;  3WG7 C;  2J0W A;  1Z23 A;  3V7O A;  3NYM A;  3FHD A;  2NG1 A;  1OCO C;  2WL8 A;  4CS7 A;  3ASN C;  4U5H A;  3EPV A;  4QI0 A;  2DGJ A;  4OD4 A;  2YHS A;  3UGP A;  3Q6M A;  1PD1 A;  3DAF A;  4EWC A;  3VAY A;  3CSK A;  4EBB A;  5L3V A;  3RFY A;  2Q9C A;  3POV A;  3K6B A;  5KYX A;  1QLE C;  2CNW A;  3HLZ A;  3PMR A;  2Y39 A;  5DQT A;  3NYL A;  3N2Z B;  1M2O A;  5F5H A;  3NG1 A;  3H65 A;  4I1O B;  2QTV A;  2R7V A;  2M4E A;  1TWG A;  3M1C B;  3GOD A;  3SP1 A;  2WB7 A;  4JCH A;  4Q4Z F;  2R7X A;  2ZPA A;  2J9V A;  3Q7L A;  3LS1 A;  1D0Y A;  2O9X A;  3RH3 A;  1D0X A;  1VYI A;  4MND A;  4LLC A;  2R7S A;  2PFD A;  3UMH A;  2D5R B;  3ZSU A;  4OIO F;  1SF8 A;  4J30 B;  2WZF A;  3TD7 A;  4Q7C A;  1TKN A;  4QDL A;  2VB6 A;  2A6E F;  2G3V A;  4G7Z F;  3K66 A;  4U5G A;  1VK5 A;  4U5E E;  4PJN A;  3EFO B;  4O6M A;  4AK9 A;  1VOM A;  3AG3 C;  3L0I A;  3LJB A;  1O5H A;  4PJJ A;  3ZVR A;  2R7Q A;  3W8I A;  2X51 A;  1FMW A;  5CI9 A;  5FCL A;  4KNW A;  2IXN A;  2HV7 A;  3N0T A;  5B1B C;  2H7B A;  3EG9 A;  2NUT B;  4W8K A;  3AG4 C;  4LER A;  2R7R A;  3ZC4 A;  4WJ0 A;  3LEV A;  1ZHZ A;  4X0R A;  2ZXW C;  3JSZ A;  2XXA B;  4CSA A;  3AQC A;  2J7P D;  4I1M A;  2A1D D;  1ZU4 A;  3X2Q C;  3EGX A;  1BR4 A;  3ABM C;  2XSE A;  2ZXR A;  3NRH A;  5DLJ A;  4DOZ A;  3T6J A;  2PX0 A;  4XLN F;  1Z6A A;  4M63 A;  2C03 A;  2P7V A;  1OCR C;  3T4R A;  1W2W A;  4RDA A;  3EJN A;  2WVO A;  1QZX A;  3EQL F;  2WVN A;  4P6I C;  1J8Y F;  1MMG A;  1NU7 D;  2V3C C;  5IY5 C;  3MLG A;  2H7V C;  1JPN A;  5E33 A;  3KMI A;  1FMV A;  4QI2 A;  4U5B E;  1M57 C;  2CGE A;  4G7O F;  3OA1 A;  2DYS C;  4U5F E;  3Q6N A;  4OIP F;  1JPJ A;  5B1A C;  4YN0 B;  3W2V A;  2V26 A;  1NU9 C;  4GYT A;  3LLK A;  1ST6 A;  2KQ9 A;  2EIM C;  3O6X A;  3JRT A;  4ZLC A;  4CBE A;  3W8H A;  4G7H F;  2J46 A;  3F47 A;  4BG0 A;  3I4U A;  2Y3G A;  5DS4 A;  3E70 C;  4C3B A;  1D0Z A;  3N24 A;  1J8M F;  2JD3 A;  4KC9 A;  3EHN A;  3NKE A;  5KYY B;  3S27 A;  3ZIB A;  3NDB B;  4G0H A;  2A68 F;  3LNR A;  3KL4 A;  5D92 A;  4O79 A;  4HE8 D;  4K0D A;  5EHH A;  2MWQ A;  3DJU B;  4C7O A;  4JJF A;  2PF4 E;  3DZA A;  2J7P A;  1PD0 A;  2XL4 A;  5L3Q A;  1FTS A;  2IOQ A;  3EG9 B;  2A69 F;  2L9J A;  1PCX A;  4N06 A;  1IZM A;  1KU2 A;  5E2Q A;  2IXM A;  2WZL A;  3FAJ A;  3I5Q A;  3QMK A;  4LLE A;  3UMI A;  5KYY A;  5F5F A;  4A2N B;  4AX2 A;  4YT4 A;  3GAN A;  5D91 A;  4PFO A;  1BR1 A;  3EGX B;  2VH3 A;  4CS8 C;  1M2V B;  4YT8 A;  1TWH A;  2WVQ A;  5KYN A;  3PHF 2;  4FES A;  4DVZ A;  5KYW A;  2EIN C;  3MX3 A;  2L81 A;  4GEH A;  4LAC B;  3HJC A;  4PJL A;  2GFH A;  3K7D A;  4JZA A;  1ZHY A;  3KH2 A;  4U5D E;  2Q3T A;  1NZE A;  4XWJ A;  4C3D A;  4KNV A;  3EZH A;  2FFH A;  3I5P A;  3EHM A;  1OCC C;  2IXP A;  3UGO A;  1M2V A;  1BR2 A;  3EH2 A;  4OIN F;  2Y3B A;  2W4M A;  4F4B A;  5EGY A;  2Y69 C;  4OIQ F;  3EGD B;  3AQB A;  2WZG A;  2Q9B A;  3K1H A;  2MYS A;  4XTK A;  4YT2 A;  4XLP F;  3DXJ F;  3EH1 A;  3JT1 A;  3AG2 C;  2E87 A;  1MNE A;  2Y3H A;  4OD5 A;  3VYW A;  4ANJ A;  4MQ9 F;  3O39 A;  4PK4 A;  1ZHT A;  4BJ5 C;  1FFT C;  3FDQ A;  3DM9 B;  4DVY P;  2H7O A;  1RJ9 A;  3DJN B;  2J45 A;  4E7Z A;  4ULW A;  2XRH A;  4DBR A;  3EZI A;  4DBQ A;  4KBL A;  3ZG1 A;  2OG2 A;  2CW0 F;  3EGD A;  3S0X A;  4IRU A;  5DQZ A;  1MND A;  1S7Z A;  3SYN A;  2Q9A A;  3B0P A;  3RYL A;  4C7O B;  1VYK A;  5HSW A;  3ECS A;  2ZXP A;  5KYU A;  3E9V A;  4J32 B;  1Z5Z A;  2A6H F;  4CIH A;  3NYJ A;  3DM5 A;  4C3E A;  4O6N A;  2I8B A;  2PX3 A;  3K1I C;  2J9U A;  1NG1 A;  3F46 A;  2IYL D;  1V55 C;  3SZR A;  3HTK C;  2EIK C;  3OEO A;  4RBN A;  2EIL C;  3S28 A;  3S29 A;  3IEE A;  2R7W A;  1M56 C;  3DD7 A;  3AG1 C;  3DAG A;  4BJ5 A;  3RKO F;  3UMK A;  1LVK A;  3QZC A;  2W4B A;  3B9Q A;  3K33 A;  4IAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...