3LEVA

Hiv-1 antibody 2f5 in complex with epitope scaffold es2
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
177
structure length
177
Chain Sequence
SDPVRQYLHEIGEVLELDKWAELGAAAKVEEGMEAIKKLSEATGLDQELIREVVRAKILGTAAIQKIPGLKEKPDPKTVEEVDGKLKSLPKELKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRGFAFSTYATWWIRQAINRAIADQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase sigma factor
publication title Elicitation of structure-specific antibodies by epitope scaffolds.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Immune system
total genus 49
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00140 Sigma70_r1_2 Sigma-70 factor, region 1.2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1810 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3levA00
2BE5F 4G7OF 4XLNF 2A6HF 3UGOA 3LEVA 4OIQF 3EQLF 2A6EF 3LESA 3DXJF 4OIPF 4MQ9F 2A68F 4OINF 4OIOF 4G7HF 1IW7F 2CW0F 2A69F 4OIRF 4KI2A 3UGPA 4Q4ZF 4Q5SF 1SMYF 1ZYRF 3WODF 4G7ZF 1KU2A 4XLPF
chains in the Genus database with same CATH superfamily
1A7EA 3WAQA 3EH2A 4EHPA 5B3SC 2L6GA 2HV7A 3RFYA 4IJJA 2J45A 4MVMA 1NFOA 2IYLD 3JSEO 1DOVA 2J9UA 1QSPA 3WG7C 1CGOA 2J9VA 1MQVA 4MQ9F 2MHRA 1HE9A 3HLZA 2VASA 4YK5A 3S27A 3KYIA 1HE1A 1BR1A 4IRUA 3LNMB 1V4AA 1G4US 2P1AA 1E2XA 2XLHA 3LS0A 1H9TA 3K7DA 2Q7RA 2QLAA 1EA8A 4HEAJ 4LLCA 2KNHA 4PJJA 4EKWA 1JPNA 2G3VA 3JYYA 4IGGA 4NTAA 3U2LA 4XEFA 4LLEA 1DOWA 4F4BA 2DB4A 2ZD9A 4W8KA 4Z9JA 1TR2A 1TFKB 4OIRF 3C8GD 2Y3DA 2YKZA 2XLVA 4NTFA 2OJED 4AL1A 1NG1A 1QVXA 3DD7A 1SF8A 2AVKA 2EINC 2P7VA 4MTFA 2QY9A 2D4UA 1HY5A 4BJTA 2IXMA 3IQ5A 5KYYB 2Y69C 2R02A 3EGDB 4FWVA 1FNTc 3U3BA 1D1CA 3T9OA 2Q9AA 2KSFA 2YL1A 4UDVA 3DKAA 1MMNA 4U5BE 5E3AA 3IHUA 4NY3A 1EKYA 2M4EA 3S9OA 2NSFA 4DJ9A 1FR0A 1A7DA 1PV3A 2F22A 1SZIA 2XXAB 3QVZA 2NUPB 3SNHA 4BJ6A 3ZDLA 2WVNA 2A69F 3C8GA 1Y6DA 3JTLO 2CCYA 2OU6A 2YL3A 3MYFA 4N6HA 5JT4A 2YLDA 3AG3C 3L8JA 4JZAA 3EHNA 3ZWIA 4Q4ZF 4Q5SF 3L34A 3NMIA 2PBEA 1OXKA 2WVOA 1ZYRF 3RF3A 4DXWA 1TFOB 4K7BA 4E0HA 1LI5A 3K1HA 4XPWA 4YT2A 2NUTA 4IARA 2HSBA 3I4UA 2WZFA 1Z7Qc 3VRCA 4BJ6C 1ZU5A 5L0DA 3E9VA 4JIOA 3EQLF 1J8MF 2IXPA 3US6A 1D1AA 3IQ6A 1TQGA 1UFBA 1E84A 1T9KA 4HFKB 2YLIA 1OR2A 3SYNA 4CSAA 2H8AA 2W4BA 4EWCA 5K0IA 3JT1A 5CI8A 2QNLA 1G5ZA 3AG1C 2CNWD 3SP1A 4BPMA 4KI2A 3EH1A 2EPNA 1SMYF 1YA9A 2ZXWC 5T3TA 1E85A 1ZW3A 2Z15A 4NCQA 3OA1A 3C18A 1PCXA 5JSLA 2OJQA 2A0UA 3B0PA 3EGXA 3FOPA 5COMA 4CJOA 4PFPA 4Q7CA 1YDIA 2A6HF 2L9JA 3LUTB 1JRAA 3JSZA 5CI9A 1O5HA 1R4TA 1XWJA 2G62A 1JPJA 2UUIA 2VH3A 4JC7A 1MNDA 2Y3HA 3IPMO 1D0XA 4N4WA 1FTSA 4XQ1A 4DBQA 3VM6A 3B0VC 1JR8A 1K04A 1OW7A 1YJGA 2GFHA 2P61A 4AL0A 1CPRA 4BJ5A 1RJ9B 4X0RA 5A6AA 2PF4E 1OCCC 2L6HA 3AOUA 4N06A 4G7OF 2CNWA 4XEVA 3UMKA 2PP4A 1YA7O 3H2VA 2LSEA 4GEHA 1PD0A 3UGPA 1Q0FA 3ASNC 3KMIA 4PK4A 3QMKA 2H7VC 3KH2A 2LFDA 4WGYA 3U3FA 3WHNA 4XLPF 4DVZA 1M56C 1I4ZA 3B71A 2GA0A 4XWJA 4RDAA 2Q4FA 3GWNA 5FZTA 3LAYA 4BEMJ 2A6EF 3LESA 3DXJF 2GDCA 3ZTMA 5IY5C 2GAQA 2FAPB 4B6IA 2A68F 1NU7D 5F5HA 2L81A 3NYLA 5CIVA 5L0GA 1RKEA 2PNOA 2AWYA 2EILC 2ZXRA 3BEHA 4RBNA 5AC5A 4YT8A 2YRFA 1MMDA 4WABA 3OEOA 2ASRA 2I15A 3K66A 3MX3A 3B9QA 4HE8D 3ZIBA 5DLJA 3HNKA 4EUKB 2C04A 1ORYA 3EJNA 1RMVA 1LM3B 3W2VA 3KKBA 3H65A 1LIHA 1ZHZA 3QTHA 4HFFB 4I3MA 2IXNA 3AQBA 4J7TA 3R7CA 3T4RA 4OD4A 4P9FA 4WGZA 2HJ3A 2L7AA 5KYWB 1Q0MA 4Z9IA 4I1OB 1RKCA 1I4YA 2DI3A 4QDLA 2D5RB 4FX5A 5DQTA 4CDVA 3MYIA 2EIMC 2QE9A 4JJFA 3U9MA 3A11A 4DRJB 4PJMA 5L0IA 4G0HA 2YVKA 2GWWA 4PACA 3U9JA 3TULA 2A1DD 1EI7A 1C03A 1R5ID 4NC3A 3GODA 3LEOA 4EBKA 2H7BA 3DZAA 1KTMA 1IZMA 2YLGA 1SR2A 4JURI 4N6CA 2DYSC 3QVYA 2M64A 2KW3C 4O6MA 4OIOF 3VYWA 3PMRA 3U0CA 3EZIA 1YARO 2YL0A 3S84A 3EGDA 1VOMA 2CGEA 4YT4A 2H7OA 3EG9A 3SZRA 4AE4A 4ULWA 4NTBA 1TKNA 3C63A 4EBBA 3N2ZB 3M4BA 3Q7GA 1MMGA 1YYJA 2EPMX 5COGA 1BBHA 4BEJA 2HFIA 3V5YA 1U89A 1BR4A 3EFOB 2VCAA 2ZPAA 3ABMC 3JYHA 3N24A 4XLNF 3UGOA 1YVIA 3DE8A 5L3QA 3T6GB 2EIJC 4ANJA 3QW0A 4MNDA 2R7UA 3C62A 3ATPA 1N1CA 2EIKC 3HNIA 3GORA 3LS1A 1WGWA 1QLEC 4DVYP 2W9YA 3TJ5A 4K0DA 5E3CA 1OXBA 4ULVA 4ER9A 2VCBA 2NSGA 5BUOA 5GPGB 3V5ZA 3RQFA 1VYIA 3K33A 1OW8A 2LFFA 2WL8A 3GANA 2R7RA 2XL6A 3RVZA 3O6XA 4ZLDA 4E0IA 5JUAA 2HUJA 5B3IA 2J9BA 4XPXA 3G4ZA 4D4XA 2Q9BA 4I44A 1UG7A 3LEVA 5JRAA 5F5FA 2IXOA 3GEHA 1CGNA 5T1DB 5L0CA 3TD7A 3EHMA 3F46A 2L6FA 2W45A 3FDQA 1NSGB 3EZHA 4RD9A 5KYUA 4J30B 4O6NA 2UUHA 3U8PA 4KC9A 3OWTA 2NPUA 3KL4A 1VTMP 5A69A 1OW6A 1G8XA 4XPYA 4MTOA 2YHSA 4PR9A 3ZC4A 3K6BA 3ABKC 3MBGA 3B0UX 2R7SA 1WN0A 3FAJA 3U8VA 1AEPA 3GEEA 3AQCA 2XLWA 3GM2A 5JP7A 4JJGA 4C3EA 1QKRA 4PFOA 3UMHA 1D0YA 3UNGC 4CX9A 3GEIA 4O6YA 4JCZA 2P6VA 3KPHA 5DS4A 3JRTA 2XL8A 2DGJA 3C8GB 3ITFA 1YZCA 4KBLA 1HMDA 4CSAC 5DVWA 4DRHB 3AG2C 1Q0GA 2HJMA 4EIYA 4OD5A 5DS5A 3HTKC 3UR3C 4A4AA 1BDJB 1WWPA 4MVQA 3V7OA 1E83A 1OQCA 1LPEA 1L3PA 2YWAA 2MYSA 1G4WR 4E7ZA 3BRJA 1LS1A 1QZXA 4U9DA 2NUTB 2J7PD 1QQ3A 1H9GA 1ORSC 3L8IA 2OCCC 1O87A 4LERA 2JPUA 2J46A 5KYXB 4IWBA 1FFHA 1HW2A 3DWWA 4GYTA 4CIHA 3S0XA 1XZQA 3S90A 3AJMA 4BJ5C 2A0BA 1SYQA 2XL4A 3E70C 3MFNA 4R32A 4E18A 2TMVP 1M2OA 2W4MA 4PJNA 3K1IA 1H7IA 3X2QC 3G50A 4LDKA 1NLXA 4FAPB 1Z63A 1NFNA 4LDQA 3B29A 4J7YA 3DAFA 5L3VA 4OIQF 4CDYA 1M57C 3L1MA 2XS8A 2VCCA 4U9EA 4C3BA 3W2WA 4L6RA 2AU5A 2Q3TA 1U0BB 2HSQA 1WASA 2EPKX 2R05A 2JD3A 2G3KA 2J7PA 1T6IA 3EGXB 1ZZPA 3NYJA 5FCLA 3HNJA 2E87A 3NYMA 2V3CC 4YT5A 4G7HF 2HMZA 1T6UA 2OOCA 1M2VA 3CEXA 1W2WA 5B1AC 4MS2A 4LDRA 2HS5A 4JTAB 3DAGA 3DJUB 4YWQA 1GQAA 2KQ9A 4H54A 1VK5A 4U5GA 4MW8A 1FMVA 2MWQA 2VB6A 3PDMP 1ZHYA 3NRHA 5HSWA 3S29A 2Q00A 3ZG1A 3RQGA 2BE5F 2B0HA 2EPLX 5BQHA 1NZEA 5AGFA 3U2MA 2R7XA 3NMKA 4CBEA 5JLIA 1ZHTA 5E2QA 2C03A 3SXMA 3C7JA 2O9XA 3PCVA 3JZ0A 5TJ5E 5A6JA 1Z5ZA 3LLIA 4CS9A 1U6HA 1YZAA 2J0WA 2YL7A 3S28A 4DRIB 5BQIA 3O10A 4CS8A 5AC4A 2B0JA 1IW7F 1ZVZA 3SXKA 5BQGA 1ST6A 4CS7A 3IQCA 5L0JA 3IEEA 2OKUA 3X1OA 5KYYA 2R7TA 3RYLA 1OKKD 2ICWG 2PX0A 5COFA 3ZVRA 2LCHA 3VAYA 4CS9C 2XSEA 4BG0A 1RKEB 1V54C 1QPUA 1FMWA 2OQMA 3HKKA 2QUPA 4IAQA 4MVSA 4P9TA 4PJLA 3Q7LA 3PHF2 3T6JA 4ONSA 2DYRC 4CS8C 1A7VA 1L7CA 1PD1A 4JVSA 4O7GA 4E7SA 3TJ6A 3O55A 1ZU4A 3JRMO 2J0XA 1VB5A 3M79A 4FESA 3FHDA 4JCHA 2XXAA 3GWLA 2XRHA 3V5XA 2ETSA 2NUPA 1JOGA 3LLKA 1CGME 3RVYA 3SXZA 1FFTC 2HMQA 1OCRC 1WOLA 2ZXPA 3IQTA 3GM3A 3KYJA 3M15A 4WJ0A 2YEVA 4C7OB 2R03A 4MTGA 2IBFA 2WZGA 4KNWA 2PFDA 1T01A 5EK0A 1AUEA 256BA 4IB4A 4U5DE 1OKKA 1T6QA 1TWGA 1VLSA 3M4CA 1OCZC 4P6IC 1D1BA 1H6GA 2LIGA 1JMWA 3ASOC 1FAPB 4XTKA 3POVA 1LE2A 3Q6MA 1LS4A 3T6BA 4LACB 4JE9A 1T5OA 2FGYA 1GM5A 1Q0KA 2R7WA 2X51A 4W8PA 2XLDA 4JKVA 5D91A 3UMIA 4CDAA 1HW1A 4EBJA 5DS6A 4D4NA 4CIPA 4O79A 2OEVA 3EG9B 5HV9A 1V74B 3HJCA 4U5EE 4AE4B 4C7OA 2R7OA 1S7ZA 3H2UA 1OR3A 4OIPF 3G4XA 2X0CA 2R7QA 3J06A 1WTYA 1Z6AA 1TWAA 2Y3GA 5L0FA 2HZ8A 4MVOA 3RW0A 3W4YA 4OINF 1LE4A 2WZLA 3CQZA 1XZPA 2WB7A 2R9RB 3CZ6A 3ZQVA 4MW3A 3FAPB 1APCA 1D0ZA 1GS9A 2CDQA 1CPQA 4JRZA 4Z9HA 3DI5A 2BL2A 3DMDA 3ECSA 1BR2A 3ZTZA 2P0NA 1Q0DA 1F1MA 2AWCA 2NG1A 2J8WA 1RJ9A 3LNRA 3TOMA 3ZQYA 1J8YF 4YL3A 4JEAA 1K05A 3TK0A 5KYXA 3DM9B 3O39A 2R25A 1Y4CA 1VMAA 1ZHWA 1NU9C 3CSKA 4KNVA 4U5HA 2BC5A 5E33A 4MVZA 3AG4C 4U5FE 2CYDA 4YJWA 3U5SA 4AX2A 1JAFA 1RCPA 1NBBA 1VYKA 2QTVA 3W8IA 1TWHA 4YL0A 3HNLA 4JEBA 3RIPA 3DJNB 3I5QA 2XM4A 3M1CB 5KYUB 4J32B 2OG2A 1KNYA 2RD9A 3W8HA 4DBRA 1Z3IX 2HKVA 3C8ZA 5EHHA 1I5NA 3R2PA 3SEOA 3TOLA 3F47A 3WODF 4G7ZF 1A41A 3RQEA 5EGYA 1WATA 3AGUA 4YN0B 1Z23A 1BZ4A 3NG1A 4QI2A 5A6BD 1RXQA 1ORJA 1HMOA 2IM8A 2KJGA 2Y39A 3FXHA 1VLTA 3NMJA 3I5PA 4G78A 4ZLCA 2YQYA 2ZXOA 4I1MA 2OEXA 4E17A 2XM0A 4A2NB 1YLMA 3LJBA 4DOZA 2EPOA 2IOQA 4U5CE 4MVRA 3EPVA 2AP3A 5F28E 2KGOA 3TQOA 5DQZA 3QZCA 2XLEA 3N0TA 5KYNA 3K1IC 1LKXA 4K1OA 1GGQA 5KYWA 1OCOC 2RSEB 2LK4A 3RH3A 3VF0A 1V55C 2JX0A 3ABLC 2YZSA 3FVYA 2I8BA 2WVQA 3JCUQ 4XEKA 3A9CA 1ZHXA 2LP4A 4H4KC 4MVUA 5T3WA 3NDBB 5A6KA 3RKOF 4AK9A 1LI7A 2XLMA 3MLGA 3DE9A 1M6TA 4JTDB 1EQ1A 1AVOB 1KU2A 5A6BA 1S05A 2FFHA 2XLOA 5JS5A 3L0IA 3NKEA 1MMAA 3FOOA 1LVKA 1O3UA 3NKDA 4NQFA 5B1BC 2LD6A 4CJGA 1ZW2A 2HV6A 3DM5A 3SXYA 4JW1A 2KYHA 4BJ1A 1B68A 3GM1A 1TWCA 2KK1A 5D92A 4C3DA 4GQHA 4M63A 5JVEA 1K40A 2R7VA 2CW0F 4YL1A 4IAOA 1C17M 2PX3A 2Y3BA 2XS1A 4QI0A 2KC3A 3CAXA 1YYXA 3EFOA 2Q9CA 3QW1A 4JTCB 3FMSA 2LQGA 2J9WA 2VC9A 1E86A 5L0HA 1A0BA 1YAUO 3AGTA 2V26A 3ZSUA 1M2VB 1C02A 3Q6NA 1MNEA
chains in the Genus database with same CATH topology
3EH2A 5B3SC 2HV7A 3RFYA 4IJJA 2J45A 2IYLD 2J9UA 3WG7C 4CBEA 2J9VA 3S27A 4MQ9F 3HLZA 2VASA 4IRUA 1BR1A 3LS0A 3K7DA 4HEAJ 4LLCA 2KNHA 4PJJA 1JPNA 2G3VA 4LLEA 4F4BA 4W8KA 4OIRF 1TR2A 2Y3DA 1NG1A 3DD7A 1SF8A 2EINC 2P7VA 2QY9A 4BJTA 2IXMA 5KYYB 2Y69C 3EGDB 4FWVA 1D1CA 2Q9AA 1MMNA 4U5BE 5E3AA 4NY3A 2M4EA 1SZIA 2XXAB 2NUPB 3SNHA 4BJ6A 2WVNA 2A69F 3AG3C 4JZAA 3EHNA 4Q4ZF 4Q5SF 3L34A 2WVOA 1ZYRF 4K7BA 3K1HA 4YT2A 2NUTA 3I4UA 2WZFA 4BJ6C 1ZU5A 3E9VA 3EQLF 1J8MF 2IXPA 1D1AA 4HFKB 3SYNA 4CSAA 2W4BA 4EWCA 3JT1A 5CI8A 3AG1C 2CNWD 3SP1A 4KI2A 3EH1A 1SMYF 2ZXWC 5T3TA 2Z15A 3OA1A 1PCXA 3B0PA 3EGXA 4PFPA 4Q7CA 2A6HF 2L9JA 3JSZA 5CI9A 1O5HA 2G62A 1JPJA 2VH3A 3POVA 1MNDA 2Y3HA 4DBQA 1D0XA 3B0VC 1FTSA 4BJ5A 2GFHA 1RJ9B 4X0RA 2PF4E 1OCCC 4N06A 2CNWA 3UMKA 2PP4A 2LSEA 4GEHA 1PD0A 3UGPA 3KMIA 3ASNC 4PK4A 3QMKA 2H7VC 3KH2A 4XLPF 4DVZA 1M56C 4XWJA 4RDAA 3LAYA 2A6EF 3LESA 3DXJF 5IY5C 4B6IA 2A68F 1NU7D 5F5HA 2L81A 3NYLA 2EILC 2ZXRA 4RBNA 4YT8A 1MMDA 3OEOA 4HE8D 3K66A 3MX3A 3B9QA 3ZIBA 5DLJA 2C04A 3EJNA 3W2VA 3KKBA 3H65A 1ZHZA 4HFFB 4I3MA 2IXNA 3AQBA 3T4RA 4OD4A 4C7OA 5KYWB 4I1OB 4QDLA 2D5RB 4FX5A 5DQTA 2EIMC 4JJFA 4PJMA 4G0HA 2A1DD 3GODA 2H7BA 3DZAA 1IZMA 4JURI 2DYSC 2KW3C 4O6MA 4OIOF 3VYWA 3PMRA 3EZIA 3EGDA 1VOMA 2CGEA 4YT4A 2H7OA 3EG9A 3SZRA 4AE4A 4ULWA 1TKNA 4EBBA 3N2ZB 3Q7GA 1MMGA 4BEJA 1BR4A 3EFOB 3JYHA 2ZPAA 3ABMC 3N24A 4XLNF 3UGOA 5L3QA 2EIJC 4ANJA 4MNDA 2R7UA 1N1CA 3LS1A 2EIKC 1WGWA 1QLEC 4DVYP 2W9YA 4K0DA 5E3CA 5BUOA 1VYIA 3K33A 2WL8A 3GANA 2R7RA 3O6XA 4ZLDA 2Q9BA 4I44A 3LEVA 5F5FA 2IXOA 5T1DB 3TD7A 3EHMA 3F46A 2W45A 3FDQA 3EZHA 4RD9A 5KYUA 4J30B 4O6NA 4KC9A 3OWTA 3KL4A 1G8XA 2YHSA 3ZC4A 3K6BA 3ABKC 3B0UX 2R7SA 3FAJA 3AQCA 4JJGA 4C3EA 4PFOA 3UMHA 1D0YA 3UNGC 4O6YA 5DS4A 2P6VA 3JRTA 3ITFA 2DGJA 4KBLA 4CSAC 5DVWA 3AG2C 4OD5A 5DS5A 3HTKC 3UR3C 3V7OA 2MYSA 4E7ZA 1LS1A 1QZXA 2NUTB 2J7PD 2OCCC 1O87A 4LERA 5KYXB 2J46A 4IWBA 1FFHA 4GYTA 4CIHA 3S0XA 4BJ5C 3E70C 2XL4A 1M2OA 2W4MA 4PJNA 3X2QC 1Z63A 4G7OF 5L3VA 3DAFA 4OIQF 1M57C 4C3BA 3W2WA 2Q3TA 2JD3A 2G3KA 2J7PA 3EGXB 3NYJA 5FCLA 2E87A 3NYMA 2V3CC 4YT5A 4G7HF 1M2VA 1W2WA 5B1AC 3DAGA 3DJUB 4YWQA 2KQ9A 1VK5A 4U5GA 1FMVA 2MWQA 2VB6A 1ZHYA 3NRHA 5HSWA 3S29A 3ZG1A 2BE5F 1NZEA 2R7XA 1ZHTA 5E2QA 2C03A 2O9XA 1Z5ZA 3LLIA 4CS9A 3S28A 2J0WA 4CS8A 2B0JA 1IW7F 1ST6A 4CS7A 3IEEA 3X1OA 5KYYA 2R7TA 3RYLA 1OKKD 2PX0A 3ZVRA 3VAYA 4CS9C 2XSEA 4BG0A 1V54C 1FMWA 3PHF2 4PJLA 3Q7LA 3T6JA 4CS8C 2DYRC 4E7SA 1PD1A 4JVSA 4O7GA 1ZU4A 2J0XA 4FESA 3FHDA 4JCHA 2XXAA 2XRHA 2NUPA 3LLKA 1FFTC 1OCRC 2ZXPA 4C7OB 4WJ0A 2YEVA 2WZGA 4KNWA 2PFDA 4U5DE 1OKKA 1TWGA 4P6IC 1OCZC 1D1BA 3ASOC 4XTKA 3Q6MA 3T6BA 4LACB 2FGYA 2R7WA 2X51A 5D91A 3UMIA 5DS6A 4O79A 3EG9B 3HJCA 4U5EE 4AE4B 2R7OA 1S7ZA 4OIPF 2R7QA 1Z6AA 1TWAA 2Y3GA 4OINF 2WZLA 3CQZA 2WB7A 3CZ6A 1D0ZA 2CDQA 3DMDA 3ECSA 1BR2A 2NG1A 1RJ9A 3LNRA 1J8YF 5KYXA 3DM9B 3O39A 1VMAA 1ZHWA 1NU9C 3CSKA 4KNVA 4U5HA 5E33A 3AG4C 4U5FE 4YJWA 4AX2A 1VYKA 2QTVA 3W8IA 1TWHA 3RIPA 3DJNB 3I5QA 3M1CB 5KYUB 4J32B 2OG2A 3W8HA 4DBRA 1Z3IX 5EHHA 3SEOA 3WODF 3F47A 4G7ZF 5EGYA 4YN0B 1Z23A 3NG1A 4QI2A 2KJGA 2Y39A 3I5PA 4ZLCA 2ZXOA 4I1MA 4A2NB 3LJBA 4DOZA 2IOQA 4U5CE 5DQZA 3EPVA 2KGOA 3QZCA 3N0TA 5KYNA 3K1IC 1LKXA 5KYWA 1OCOC 3RH3A 1V55C 3ABLC 2YZSA 3FVYA 2I8BA 2WVQA 3JCUQ 3NDBB 1ZHXA 4H4KC 5T3WA 3RKOF 4AK9A 3MLGA 1KU2A 2FFHA 3L0IA 3NKEA 1MMAA 1LVKA 3NKDA 5B1BC 2HV6A 3DM5A 4JW1A 4BJ1A 1TWCA 5D92A 4C3DA 4M63A 2R7VA 2CW0F 4IAOA 2PX3A 2Y3BA 4QI0A 3EFOA 2Q9CA 2J9WA 2V26A 3ZSUA 1M2VB 3Q6NA 1MNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BE5 F;  4G7O F;  4XLN F;  2A6H F;  3UGO A;  3LEV A;  4OIQ F;  3EQL F;  2A6E F;  3LES A;  3DXJ F;  4OIP F;  4MQ9 F;  2A68 F;  4OIN F;  4OIO F;  4G7H F;  1IW7 F;  2CW0 F;  2A69 F;  4OIR F;  4KI2 A;  3UGP A;  4Q4Z F;  4Q5S F;  1SMY F;  1ZYR F;  3WOD F;  4G7Z F;  1KU2 A;  4XLP F; 
#chains in the Genus database with same CATH topology
 1A7E A;  3WAQ A;  3EH2 A;  4EHP A;  5B3S C;  2L6G A;  2HV7 A;  3RFY A;  4IJJ A;  2J45 A;  4MVM A;  1NFO A;  2IYL D;  3JSE O;  1DOV A;  2J9U A;  1QSP A;  3WG7 C;  1CGO A;  2J9V A;  1MQV A;  4MQ9 F;  2MHR A;  1HE9 A;  3HLZ A;  2VAS A;  4YK5 A;  3S27 A;  3KYI A;  1HE1 A;  1BR1 A;  4IRU A;  3LNM B;  1V4A A;  1G4U S;  2P1A A;  1E2X A;  2XLH A;  3LS0 A;  1H9T A;  3K7D A;  2Q7R A;  2QLA A;  1EA8 A;  4HEA J;  4LLC A;  2KNH A;  4PJJ A;  4EKW A;  1JPN A;  2G3V A;  3JYY A;  4IGG A;  4NTA A;  3U2L A;  4XEF A;  4LLE A;  1DOW A;  4F4B A;  2DB4 A;  2ZD9 A;  4W8K A;  4Z9J A;  1TR2 A;  1TFK B;  4OIR F;  3C8G D;  2Y3D A;  2YKZ A;  2XLV A;  4NTF A;  2OJE D;  4AL1 A;  1NG1 A;  1QVX A;  3DD7 A;  1SF8 A;  2AVK A;  2EIN C;  2P7V A;  4MTF A;  2QY9 A;  2D4U A;  1HY5 A;  4BJT A;  2IXM A;  3IQ5 A;  5KYY B;  2Y69 C;  2R02 A;  3EGD B;  4FWV A;  1FNT c;  3U3B A;  1D1C A;  3T9O A;  2Q9A A;  2KSF A;  2YL1 A;  4UDV A;  3DKA A;  1MMN A;  4U5B E;  5E3A A;  3IHU A;  4NY3 A;  1EKY A;  2M4E A;  3S9O A;  2NSF A;  4DJ9 A;  1FR0 A;  1A7D A;  1PV3 A;  2F22 A;  1SZI A;  2XXA B;  3QVZ A;  2NUP B;  3SNH A;  4BJ6 A;  3ZDL A;  2WVN A;  2A69 F;  3C8G A;  1Y6D A;  3JTL O;  2CCY A;  2OU6 A;  2YL3 A;  3MYF A;  4N6H A;  5JT4 A;  2YLD A;  3AG3 C;  3L8J A;  4JZA A;  3EHN A;  3ZWI A;  4Q4Z F;  4Q5S F;  3L34 A;  3NMI A;  2PBE A;  1OXK A;  2WVO A;  1ZYR F;  3RF3 A;  4DXW A;  1TFO B;  4K7B A;  4E0H A;  1LI5 A;  3K1H A;  4XPW A;  4YT2 A;  2NUT A;  4IAR A;  2HSB A;  3I4U A;  2WZF A;  1Z7Q c;  3VRC A;  4BJ6 C;  1ZU5 A;  5L0D A;  3E9V A;  4JIO A;  3EQL F;  1J8M F;  2IXP A;  3US6 A;  1D1A A;  3IQ6 A;  1TQG A;  1UFB A;  1E84 A;  1T9K A;  4HFK B;  2YLI A;  1OR2 A;  3SYN A;  4CSA A;  2H8A A;  2W4B A;  4EWC A;  5K0I A;  3JT1 A;  5CI8 A;  2QNL A;  1G5Z A;  3AG1 C;  2CNW D;  3SP1 A;  4BPM A;  4KI2 A;  3EH1 A;  2EPN A;  1SMY F;  1YA9 A;  2ZXW C;  5T3T A;  1E85 A;  1ZW3 A;  2Z15 A;  4NCQ A;  3OA1 A;  3C18 A;  1PCX A;  5JSL A;  2OJQ A;  2A0U A;  3B0P A;  3EGX A;  3FOP A;  5COM A;  4CJO A;  4PFP A;  4Q7C A;  1YDI A;  2A6H F;  2L9J A;  3LUT B;  1JRA A;  3JSZ A;  5CI9 A;  1O5H A;  1R4T A;  1XWJ A;  2G62 A;  1JPJ A;  2UUI A;  2VH3 A;  4JC7 A;  1MND A;  2Y3H A;  3IPM O;  1D0X A;  4N4W A;  1FTS A;  4XQ1 A;  4DBQ A;  3VM6 A;  3B0V C;  1JR8 A;  1K04 A;  1OW7 A;  1YJG A;  2GFH A;  2P61 A;  4AL0 A;  1CPR A;  4BJ5 A;  1RJ9 B;  4X0R A;  5A6A A;  2PF4 E;  1OCC C;  2L6H A;  3AOU A;  4N06 A;  4G7O F;  2CNW A;  4XEV A;  3UMK A;  2PP4 A;  1YA7 O;  3H2V A;  2LSE A;  4GEH A;  1PD0 A;  3UGP A;  1Q0F A;  3ASN C;  3KMI A;  4PK4 A;  3QMK A;  2H7V C;  3KH2 A;  2LFD A;  4WGY A;  3U3F A;  3WHN A;  4XLP F;  4DVZ A;  1M56 C;  1I4Z A;  3B71 A;  2GA0 A;  4XWJ A;  4RDA A;  2Q4F A;  3GWN A;  5FZT A;  3LAY A;  4BEM J;  2A6E F;  3LES A;  3DXJ F;  2GDC A;  3ZTM A;  5IY5 C;  2GAQ A;  2FAP B;  4B6I A;  2A68 F;  1NU7 D;  5F5H A;  2L81 A;  3NYL A;  5CIV A;  5L0G A;  1RKE A;  2PNO A;  2AWY A;  2EIL C;  2ZXR A;  3BEH A;  4RBN A;  5AC5 A;  4YT8 A;  2YRF A;  1MMD A;  4WAB A;  3OEO A;  2ASR A;  2I15 A;  3K66 A;  3MX3 A;  3B9Q A;  4HE8 D;  3ZIB A;  5DLJ A;  3HNK A;  4EUK B;  2C04 A;  1ORY A;  3EJN A;  1RMV A;  1LM3 B;  3W2V A;  3KKB A;  3H65 A;  1LIH A;  1ZHZ A;  3QTH A;  4HFF B;  4I3M A;  2IXN A;  3AQB A;  4J7T A;  3R7C A;  3T4R A;  4OD4 A;  4P9F A;  4WGZ A;  2HJ3 A;  2L7A A;  5KYW B;  1Q0M A;  4Z9I A;  4I1O B;  1RKC A;  1I4Y A;  2DI3 A;  4QDL A;  2D5R B;  4FX5 A;  5DQT A;  4CDV A;  3MYI A;  2EIM C;  2QE9 A;  4JJF A;  3U9M A;  3A11 A;  4DRJ B;  4PJM A;  5L0I A;  4G0H A;  2YVK A;  2GWW A;  4PAC A;  3U9J A;  3TUL A;  2A1D D;  1EI7 A;  1C03 A;  1R5I D;  4NC3 A;  3GOD A;  3LEO A;  4EBK A;  2H7B A;  3DZA A;  1KTM A;  1IZM A;  2YLG A;  1SR2 A;  4JUR I;  4N6C A;  2DYS C;  3QVY A;  2M64 A;  2KW3 C;  4O6M A;  4OIO F;  3VYW A;  3PMR A;  3U0C A;  3EZI A;  1YAR O;  2YL0 A;  3S84 A;  3EGD A;  1VOM A;  2CGE A;  4YT4 A;  2H7O A;  3EG9 A;  3SZR A;  4AE4 A;  4ULW A;  4NTB A;  1TKN A;  3C63 A;  4EBB A;  3N2Z B;  3M4B A;  3Q7G A;  1MMG A;  1YYJ A;  2EPM X;  5COG A;  1BBH A;  4BEJ A;  2HFI A;  3V5Y A;  1U89 A;  1BR4 A;  3EFO B;  2VCA A;  2ZPA A;  3ABM C;  3JYH A;  3N24 A;  4XLN F;  3UGO A;  1YVI A;  3DE8 A;  5L3Q A;  3T6G B;  2EIJ C;  4ANJ A;  3QW0 A;  4MND A;  2R7U A;  3C62 A;  3ATP A;  1N1C A;  2EIK C;  3HNI A;  3GOR A;  3LS1 A;  1WGW A;  1QLE C;  4DVY P;  2W9Y A;  3TJ5 A;  4K0D A;  5E3C A;  1OXB A;  4ULV A;  4ER9 A;  2VCB A;  2NSG A;  5BUO A;  5GPG B;  3V5Z A;  3RQF A;  1VYI A;  3K33 A;  1OW8 A;  2LFF A;  2WL8 A;  3GAN A;  2R7R A;  2XL6 A;  3RVZ A;  3O6X A;  4ZLD A;  4E0I A;  5JUA A;  2HUJ A;  5B3I A;  2J9B A;  4XPX A;  3G4Z A;  4D4X A;  2Q9B A;  4I44 A;  1UG7 A;  3LEV A;  5JRA A;  5F5F A;  2IXO A;  3GEH A;  1CGN A;  5T1D B;  5L0C A;  3TD7 A;  3EHM A;  3F46 A;  2L6F A;  2W45 A;  3FDQ A;  1NSG B;  3EZH A;  4RD9 A;  5KYU A;  4J30 B;  4O6N A;  2UUH A;  3U8P A;  4KC9 A;  3OWT A;  2NPU A;  3KL4 A;  1VTM P;  5A69 A;  1OW6 A;  1G8X A;  4XPY A;  4MTO A;  2YHS A;  4PR9 A;  3ZC4 A;  3K6B A;  3ABK C;  3MBG A;  3B0U X;  2R7S A;  1WN0 A;  3FAJ A;  3U8V A;  1AEP A;  3GEE A;  3AQC A;  2XLW A;  3GM2 A;  5JP7 A;  4JJG A;  4C3E A;  1QKR A;  4PFO A;  3UMH A;  1D0Y A;  3UNG C;  4CX9 A;  3GEI A;  4O6Y A;  4JCZ A;  2P6V A;  3KPH A;  5DS4 A;  3JRT A;  2XL8 A;  2DGJ A;  3C8G B;  3ITF A;  1YZC A;  4KBL A;  1HMD A;  4CSA C;  5DVW A;  4DRH B;  3AG2 C;  1Q0G A;  2HJM A;  4EIY A;  4OD5 A;  5DS5 A;  3HTK C;  3UR3 C;  4A4A A;  1BDJ B;  1WWP A;  4MVQ A;  3V7O A;  1E83 A;  1OQC A;  1LPE A;  1L3P A;  2YWA A;  2MYS A;  1G4W R;  4E7Z A;  3BRJ A;  1LS1 A;  1QZX A;  4U9D A;  2NUT B;  2J7P D;  1QQ3 A;  1H9G A;  1ORS C;  3L8I A;  2OCC C;  1O87 A;  4LER A;  2JPU A;  2J46 A;  5KYX B;  4IWB A;  1FFH A;  1HW2 A;  3DWW A;  4GYT A;  4CIH A;  3S0X A;  1XZQ A;  3S90 A;  3AJM A;  4BJ5 C;  2A0B A;  1SYQ A;  2XL4 A;  3E70 C;  3MFN A;  4R32 A;  4E18 A;  2TMV P;  1M2O A;  2W4M A;  4PJN A;  3K1I A;  1H7I A;  3X2Q C;  3G50 A;  4LDK A;  1NLX A;  4FAP B;  1Z63 A;  1NFN A;  4LDQ A;  3B29 A;  4J7Y A;  3DAF A;  5L3V A;  4OIQ F;  4CDY A;  1M57 C;  3L1M A;  2XS8 A;  2VCC A;  4U9E A;  4C3B A;  3W2W A;  4L6R A;  2AU5 A;  2Q3T A;  1U0B B;  2HSQ A;  1WAS A;  2EPK X;  2R05 A;  2JD3 A;  2G3K A;  2J7P A;  1T6I A;  3EGX B;  1ZZP A;  3NYJ A;  5FCL A;  3HNJ A;  2E87 A;  3NYM A;  2V3C C;  4YT5 A;  4G7H F;  2HMZ A;  1T6U A;  2OOC A;  1M2V A;  3CEX A;  1W2W A;  5B1A C;  4MS2 A;  4LDR A;  2HS5 A;  4JTA B;  3DAG A;  3DJU B;  4YWQ A;  1GQA A;  2KQ9 A;  4H54 A;  1VK5 A;  4U5G A;  4MW8 A;  1FMV A;  2MWQ A;  2VB6 A;  3PDM P;  1ZHY A;  3NRH A;  5HSW A;  3S29 A;  2Q00 A;  3ZG1 A;  3RQG A;  2BE5 F;  2B0H A;  2EPL X;  5BQH A;  1NZE A;  5AGF A;  3U2M A;  2R7X A;  3NMK A;  4CBE A;  5JLI A;  1ZHT A;  5E2Q A;  2C03 A;  3SXM A;  3C7J A;  2O9X A;  3PCV A;  3JZ0 A;  5TJ5 E;  5A6J A;  1Z5Z A;  3LLI A;  4CS9 A;  1U6H A;  1YZA A;  2J0W A;  2YL7 A;  3S28 A;  4DRI B;  5BQI A;  3O10 A;  4CS8 A;  5AC4 A;  2B0J A;  1IW7 F;  1ZVZ A;  3SXK A;  5BQG A;  1ST6 A;  4CS7 A;  3IQC A;  5L0J A;  3IEE A;  2OKU A;  3X1O A;  5KYY A;  2R7T A;  3RYL A;  1OKK D;  2ICW G;  2PX0 A;  5COF A;  3ZVR A;  2LCH A;  3VAY A;  4CS9 C;  2XSE A;  4BG0 A;  1RKE B;  1V54 C;  1QPU A;  1FMW A;  2OQM A;  3HKK A;  2QUP A;  4IAQ A;  4MVS A;  4P9T A;  4PJL A;  3Q7L A;  3PHF 2;  3T6J A;  4ONS A;  2DYR C;  4CS8 C;  1A7V A;  1L7C A;  1PD1 A;  4JVS A;  4O7G A;  4E7S A;  3TJ6 A;  3O55 A;  1ZU4 A;  3JRM O;  2J0X A;  1VB5 A;  3M79 A;  4FES A;  3FHD A;  4JCH A;  2XXA A;  3GWL A;  2XRH A;  3V5X A;  2ETS A;  2NUP A;  1JOG A;  3LLK A;  1CGM E;  3RVY A;  3SXZ A;  1FFT C;  2HMQ A;  1OCR C;  1WOL A;  2ZXP A;  3IQT A;  3GM3 A;  3KYJ A;  3M15 A;  4WJ0 A;  2YEV A;  4C7O B;  2R03 A;  4MTG A;  2IBF A;  2WZG A;  4KNW A;  2PFD A;  1T01 A;  5EK0 A;  1AUE A;  256B A;  4IB4 A;  4U5D E;  1OKK A;  1T6Q A;  1TWG A;  1VLS A;  3M4C A;  1OCZ C;  4P6I C;  1D1B A;  1H6G A;  2LIG A;  1JMW A;  3ASO C;  1FAP B;  4XTK A;  3POV A;  1LE2 A;  3Q6M A;  1LS4 A;  3T6B A;  4LAC B;  4JE9 A;  1T5O A;  2FGY A;  1GM5 A;  1Q0K A;  2R7W A;  2X51 A;  4W8P A;  2XLD A;  4JKV A;  5D91 A;  3UMI A;  4CDA A;  1HW1 A;  4EBJ A;  5DS6 A;  4D4N A;  4CIP A;  4O79 A;  2OEV A;  3EG9 B;  5HV9 A;  1V74 B;  3HJC A;  4U5E E;  4AE4 B;  4C7O A;  2R7O A;  1S7Z A;  3H2U A;  1OR3 A;  4OIP F;  3G4X A;  2X0C A;  2R7Q A;  3J06 A;  1WTY A;  1Z6A A;  1TWA A;  2Y3G A;  5L0F A;  2HZ8 A;  4MVO A;  3RW0 A;  3W4Y A;  4OIN F;  1LE4 A;  2WZL A;  3CQZ A;  1XZP A;  2WB7 A;  2R9R B;  3CZ6 A;  3ZQV A;  4MW3 A;  3FAP B;  1APC A;  1D0Z A;  1GS9 A;  2CDQ A;  1CPQ A;  4JRZ A;  4Z9H A;  3DI5 A;  2BL2 A;  3DMD A;  3ECS A;  1BR2 A;  3ZTZ A;  2P0N A;  1Q0D A;  1F1M A;  2AWC A;  2NG1 A;  2J8W A;  1RJ9 A;  3LNR A;  3TOM A;  3ZQY A;  1J8Y F;  4YL3 A;  4JEA A;  1K05 A;  3TK0 A;  5KYX A;  3DM9 B;  3O39 A;  2R25 A;  1Y4C A;  1VMA A;  1ZHW A;  1NU9 C;  3CSK A;  4KNV A;  4U5H A;  2BC5 A;  5E33 A;  4MVZ A;  3AG4 C;  4U5F E;  2CYD A;  4YJW A;  3U5S A;  4AX2 A;  1JAF A;  1RCP A;  1NBB A;  1VYK A;  2QTV A;  3W8I A;  1TWH A;  4YL0 A;  3HNL A;  4JEB A;  3RIP A;  3DJN B;  3I5Q A;  2XM4 A;  3M1C B;  5KYU B;  4J32 B;  2OG2 A;  1KNY A;  2RD9 A;  3W8H A;  4DBR A;  1Z3I X;  2HKV A;  3C8Z A;  5EHH A;  1I5N A;  3R2P A;  3SEO A;  3TOL A;  3F47 A;  3WOD F;  4G7Z F;  1A41 A;  3RQE A;  5EGY A;  1WAT A;  3AGU A;  4YN0 B;  1Z23 A;  1BZ4 A;  3NG1 A;  4QI2 A;  5A6B D;  1RXQ A;  1ORJ A;  1HMO A;  2IM8 A;  2KJG A;  2Y39 A;  3FXH A;  1VLT A;  3NMJ A;  3I5P A;  4G78 A;  4ZLC A;  2YQY A;  2ZXO A;  4I1M A;  2OEX A;  4E17 A;  2XM0 A;  4A2N B;  1YLM A;  3LJB A;  4DOZ A;  2EPO A;  2IOQ A;  4U5C E;  4MVR A;  3EPV A;  2AP3 A;  5F28 E;  2KGO A;  3TQO A;  5DQZ A;  3QZC A;  2XLE A;  3N0T A;  5KYN A;  3K1I C;  1LKX A;  4K1O A;  1GGQ A;  5KYW A;  1OCO C;  2RSE B;  2LK4 A;  3RH3 A;  3VF0 A;  1V55 C;  2JX0 A;  3ABL C;  2YZS A;  3FVY A;  2I8B A;  2WVQ A;  3JCU Q;  4XEK A;  3A9C A;  1ZHX A;  2LP4 A;  4H4K C;  4MVU A;  5T3W A;  3NDB B;  5A6K A;  3RKO F;  4AK9 A;  1LI7 A;  2XLM A;  3MLG A;  3DE9 A;  1M6T A;  4JTD B;  1EQ1 A;  1AVO B;  1KU2 A;  5A6B A;  1S05 A;  2FFH A;  2XLO A;  5JS5 A;  3L0I A;  3NKE A;  1MMA A;  3FOO A;  1LVK A;  1O3U A;  3NKD A;  4NQF A;  5B1B C;  2LD6 A;  4CJG A;  1ZW2 A;  2HV6 A;  3DM5 A;  3SXY A;  4JW1 A;  2KYH A;  4BJ1 A;  1B68 A;  3GM1 A;  1TWC A;  2KK1 A;  5D92 A;  4C3D A;  4GQH A;  4M63 A;  5JVE A;  1K40 A;  2R7V A;  2CW0 F;  4YL1 A;  4IAO A;  1C17 M;  2PX3 A;  2Y3B A;  2XS1 A;  4QI0 A;  2KC3 A;  3CAX A;  1YYX A;  3EFO A;  2Q9C A;  3QW1 A;  4JTC B;  3FMS A;  2LQG A;  2J9W A;  2VC9 A;  1E86 A;  5L0H A;  1A0B A;  1YAU O;  3AGT A;  2V26 A;  3ZSU A;  1M2V B;  1C02 A;  3Q6N A;  1MNE A; 
#chains in the Genus database with same CATH homology
 3EH2 A;  5B3S C;  2HV7 A;  3RFY A;  4IJJ A;  2J45 A;  2IYL D;  2J9U A;  3WG7 C;  4CBE A;  2J9V A;  3S27 A;  4MQ9 F;  3HLZ A;  2VAS A;  4IRU A;  1BR1 A;  3LS0 A;  3K7D A;  4HEA J;  4LLC A;  2KNH A;  4PJJ A;  1JPN A;  2G3V A;  4LLE A;  4F4B A;  4W8K A;  4OIR F;  1TR2 A;  2Y3D A;  1NG1 A;  3DD7 A;  1SF8 A;  2EIN C;  2P7V A;  2QY9 A;  4BJT A;  2IXM A;  5KYY B;  2Y69 C;  3EGD B;  4FWV A;  1D1C A;  2Q9A A;  1MMN A;  4U5B E;  5E3A A;  4NY3 A;  2M4E A;  1SZI A;  2XXA B;  2NUP B;  3SNH A;  4BJ6 A;  2WVN A;  2A69 F;  3AG3 C;  4JZA A;  3EHN A;  4Q4Z F;  4Q5S F;  3L34 A;  2WVO A;  1ZYR F;  4K7B A;  3K1H A;  4YT2 A;  2NUT A;  3I4U A;  2WZF A;  4BJ6 C;  1ZU5 A;  3E9V A;  3EQL F;  1J8M F;  2IXP A;  1D1A A;  4HFK B;  3SYN A;  4CSA A;  2W4B A;  4EWC A;  3JT1 A;  5CI8 A;  3AG1 C;  2CNW D;  3SP1 A;  4KI2 A;  3EH1 A;  1SMY F;  2ZXW C;  5T3T A;  2Z15 A;  3OA1 A;  1PCX A;  3B0P A;  3EGX A;  4PFP A;  4Q7C A;  2A6H F;  2L9J A;  3JSZ A;  5CI9 A;  1O5H A;  2G62 A;  1JPJ A;  2VH3 A;  3POV A;  1MND A;  2Y3H A;  4DBQ A;  1D0X A;  3B0V C;  1FTS A;  4BJ5 A;  2GFH A;  1RJ9 B;  4X0R A;  2PF4 E;  1OCC C;  4N06 A;  2CNW A;  3UMK A;  2PP4 A;  2LSE A;  4GEH A;  1PD0 A;  3UGP A;  3KMI A;  3ASN C;  4PK4 A;  3QMK A;  2H7V C;  3KH2 A;  4XLP F;  4DVZ A;  1M56 C;  4XWJ A;  4RDA A;  3LAY A;  2A6E F;  3LES A;  3DXJ F;  5IY5 C;  4B6I A;  2A68 F;  1NU7 D;  5F5H A;  2L81 A;  3NYL A;  2EIL C;  2ZXR A;  4RBN A;  4YT8 A;  1MMD A;  3OEO A;  4HE8 D;  3K66 A;  3MX3 A;  3B9Q A;  3ZIB A;  5DLJ A;  2C04 A;  3EJN A;  3W2V A;  3KKB A;  3H65 A;  1ZHZ A;  4HFF B;  4I3M A;  2IXN A;  3AQB A;  3T4R A;  4OD4 A;  4C7O A;  5KYW B;  4I1O B;  4QDL A;  2D5R B;  4FX5 A;  5DQT A;  2EIM C;  4JJF A;  4PJM A;  4G0H A;  2A1D D;  3GOD A;  2H7B A;  3DZA A;  1IZM A;  4JUR I;  2DYS C;  2KW3 C;  4O6M A;  4OIO F;  3VYW A;  3PMR A;  3EZI A;  3EGD A;  1VOM A;  2CGE A;  4YT4 A;  2H7O A;  3EG9 A;  3SZR A;  4AE4 A;  4ULW A;  1TKN A;  4EBB A;  3N2Z B;  3Q7G A;  1MMG A;  4BEJ A;  1BR4 A;  3EFO B;  3JYH A;  2ZPA A;  3ABM C;  3N24 A;  4XLN F;  3UGO A;  5L3Q A;  2EIJ C;  4ANJ A;  4MND A;  2R7U A;  1N1C A;  3LS1 A;  2EIK C;  1WGW A;  1QLE C;  4DVY P;  2W9Y A;  4K0D A;  5E3C A;  5BUO A;  1VYI A;  3K33 A;  2WL8 A;  3GAN A;  2R7R A;  3O6X A;  4ZLD A;  2Q9B A;  4I44 A;  3LEV A;  5F5F A;  2IXO A;  5T1D B;  3TD7 A;  3EHM A;  3F46 A;  2W45 A;  3FDQ A;  3EZH A;  4RD9 A;  5KYU A;  4J30 B;  4O6N A;  4KC9 A;  3OWT A;  3KL4 A;  1G8X A;  2YHS A;  3ZC4 A;  3K6B A;  3ABK C;  3B0U X;  2R7S A;  3FAJ A;  3AQC A;  4JJG A;  4C3E A;  4PFO A;  3UMH A;  1D0Y A;  3UNG C;  4O6Y A;  5DS4 A;  2P6V A;  3JRT A;  3ITF A;  2DGJ A;  4KBL A;  4CSA C;  5DVW A;  3AG2 C;  4OD5 A;  5DS5 A;  3HTK C;  3UR3 C;  3V7O A;  2MYS A;  4E7Z A;  1LS1 A;  1QZX A;  2NUT B;  2J7P D;  2OCC C;  1O87 A;  4LER A;  5KYX B;  2J46 A;  4IWB A;  1FFH A;  4GYT A;  4CIH A;  3S0X A;  4BJ5 C;  3E70 C;  2XL4 A;  1M2O A;  2W4M A;  4PJN A;  3X2Q C;  1Z63 A;  4G7O F;  5L3V A;  3DAF A;  4OIQ F;  1M57 C;  4C3B A;  3W2W A;  2Q3T A;  2JD3 A;  2G3K A;  2J7P A;  3EGX B;  3NYJ A;  5FCL A;  2E87 A;  3NYM A;  2V3C C;  4YT5 A;  4G7H F;  1M2V A;  1W2W A;  5B1A C;  3DAG A;  3DJU B;  4YWQ A;  2KQ9 A;  1VK5 A;  4U5G A;  1FMV A;  2MWQ A;  2VB6 A;  1ZHY A;  3NRH A;  5HSW A;  3S29 A;  3ZG1 A;  2BE5 F;  1NZE A;  2R7X A;  1ZHT A;  5E2Q A;  2C03 A;  2O9X A;  1Z5Z A;  3LLI A;  4CS9 A;  3S28 A;  2J0W A;  4CS8 A;  2B0J A;  1IW7 F;  1ST6 A;  4CS7 A;  3IEE A;  3X1O A;  5KYY A;  2R7T A;  3RYL A;  1OKK D;  2PX0 A;  3ZVR A;  3VAY A;  4CS9 C;  2XSE A;  4BG0 A;  1V54 C;  1FMW A;  3PHF 2;  4PJL A;  3Q7L A;  3T6J A;  4CS8 C;  2DYR C;  4E7S A;  1PD1 A;  4JVS A;  4O7G A;  1ZU4 A;  2J0X A;  4FES A;  3FHD A;  4JCH A;  2XXA A;  2XRH A;  2NUP A;  3LLK A;  1FFT C;  1OCR C;  2ZXP A;  4C7O B;  4WJ0 A;  2YEV A;  2WZG A;  4KNW A;  2PFD A;  4U5D E;  1OKK A;  1TWG A;  4P6I C;  1OCZ C;  1D1B A;  3ASO C;  4XTK A;  3Q6M A;  3T6B A;  4LAC B;  2FGY A;  2R7W A;  2X51 A;  5D91 A;  3UMI A;  5DS6 A;  4O79 A;  3EG9 B;  3HJC A;  4U5E E;  4AE4 B;  2R7O A;  1S7Z A;  4OIP F;  2R7Q A;  1Z6A A;  1TWA A;  2Y3G A;  4OIN F;  2WZL A;  3CQZ A;  2WB7 A;  3CZ6 A;  1D0Z A;  2CDQ A;  3DMD A;  3ECS A;  1BR2 A;  2NG1 A;  1RJ9 A;  3LNR A;  1J8Y F;  5KYX A;  3DM9 B;  3O39 A;  1VMA A;  1ZHW A;  1NU9 C;  3CSK A;  4KNV A;  4U5H A;  5E33 A;  3AG4 C;  4U5F E;  4YJW A;  4AX2 A;  1VYK A;  2QTV A;  3W8I A;  1TWH A;  3RIP A;  3DJN B;  3I5Q A;  3M1C B;  5KYU B;  4J32 B;  2OG2 A;  3W8H A;  4DBR A;  1Z3I X;  5EHH A;  3SEO A;  3WOD F;  3F47 A;  4G7Z F;  5EGY A;  4YN0 B;  1Z23 A;  3NG1 A;  4QI2 A;  2KJG A;  2Y39 A;  3I5P A;  4ZLC A;  2ZXO A;  4I1M A;  4A2N B;  3LJB A;  4DOZ A;  2IOQ A;  4U5C E;  5DQZ A;  3EPV A;  2KGO A;  3QZC A;  3N0T A;  5KYN A;  3K1I C;  1LKX A;  5KYW A;  1OCO C;  3RH3 A;  1V55 C;  3ABL C;  2YZS A;  3FVY A;  2I8B A;  2WVQ A;  3JCU Q;  3NDB B;  1ZHX A;  4H4K C;  5T3W A;  3RKO F;  4AK9 A;  3MLG A;  1KU2 A;  2FFH A;  3L0I A;  3NKE A;  1MMA A;  1LVK A;  3NKD A;  5B1B C;  2HV6 A;  3DM5 A;  4JW1 A;  4BJ1 A;  1TWC A;  5D92 A;  4C3D A;  4M63 A;  2R7V A;  2CW0 F;  4IAO A;  2PX3 A;  2Y3B A;  4QI0 A;  3EFO A;  2Q9C A;  2J9W A;  2V26 A;  3ZSU A;  1M2V B;  3Q6N A;  1MNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...