2CCYA

Structure of ferricytochrome c(prime) from rhodospirillum molischianum at 1.67 angstroms resolution
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
127
structure length
127
Chain Sequence
QSKPEDLLKLRQGLMQTLKSQWVPIAGFAAGKADLPADAAQRAENMAMVAKLAPIGWAKGTEALPNGETKPEAFGSKSAEFLEGWKALATESTKLAAAAKAGPDALKAQAAATGKVCKACHEEFKQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of ferricytochrome c' from Rhodospirillum molischianum at 1.67 A resolution.
pubmed doi rcsb
source organism Phaeospirillum molischianum
molecule tags Electron transport (heme protein)
molecule keywords CYTOCHROME C
total genus 48
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 1985-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2ccyA00
1S05A 3HNJA 2YLGA 4CDYA 2XLOA 2YL7A 1E84A 5JP7A 3TOLA 3IQ6A 3DE9A 4WGYA 4CJGA 3QW0A 2XL6A 3M15A 5B3IA 1A7VA 4L6RA 3IQ5A 3ZQYA 2XLEA 1MQVA 1E85A 2XM4A 3NMJA 4CDVA 5JUAA 4WGZA 1YYJA 1NBBA 3HNLA 1EKYA 3FOPA 4NC3A 1GQAA 3QVYA 1CPQA 3DE8A 1CGOA 4CJOA 3ZTZA 4JKVA 2YL3A 3FOOA 4IB4A 5JS5A 3QW1A 1QPUA 1QQ3A 2YKZA 3NMIA 2J8WA 1APCA 1LM3B 3HNKA 4EIYA 2XLVA 3ZTMA 2YLDA 4JEAA 1CPRA 4ULVA 3NMKA 4CX9A 2YL0A 5JRAA 1YZAA 2XLMA 3TOMA 4N6HA 3M4BA 2QLAA 1BBHA 4N4WA 3M4CA 3ZWIA 4JE9A 2XL8A 4D4NA 1YYXA 4JEBA 3C63A 1M6TA 5AGFA 3L1MA 4U9DA 5JT4A 3ZQVA 2XM0A 1CGNA 4CIPA 3QVZA 2BC5A 4U9EA 3VRCA 256BA 2CCYA 5JSLA 3U8PA 3C62A 4CDAA 4IAQA 1YZCA 1E83A 2J9BA 4D4XA 2XLWA 3M79A 1RCPA 5JLIA 1E86A 2XLDA 4ER9A 5JVEA 2YLIA 2XLHA 4IARA 2YL1A 3HNIA 1JAFA
chains in the Genus database with same CATH superfamily
5CIVA 3JYHA 1LPEA 2YEVA 4IAOA 4G78A 4JJGA 2P0NA 1XZPA 1Q0FA 3POVA 1ZU4A 2Q3TA 1LS4A 2IM8A 4WJ0A 1AUEA 1Y4CA 2KC3A 2NG1A 3FMSA 3MX3A 4IWBA 3IQ6A 3V5XA 3U9JA 2YHSA 1U89A 5DS5A 2CW0F 3QW0A 4LACB 2TMVP 1LE4A 4JCZA 3C7JA 5DQTA 1Q0GA 1A7VA 1DOWA 1BR4A 2L6FA 3LJBA 3V7OA 2QNLA 3ZC4A 1C17M 4EKWA 4BJ6C 5JVEA 1ZHTA 1OXKA 5KYWA 5HSWA 1OKKD 5L0GA 1K40A 4G0HA 4BJTA 4CS8C 1ZHXA 4Z9JA 3TD7A 2XSEA 3IHUA 3JZ0A 3DJUB 3EFOB 3GEHA 3NMJA 1Z3IX 2W4MA 2W4BA 1YYJA 4WGZA 3X2QC 1U0BB 3JTLO 3EFOA 3LEOA 5BUOA 1YLMA 2R05A 3ASOC 1V54C 3FOPA 4XEFA 2MHRA 4NQFA 1CPQA 2HJMA 2Z15A 1KNYA 2HV7A 1TR2A 2OU6A 3DM9B 3U3BA 3C8GB 4CS7A 4JKVA 3EHMA 1HW1A 3NYLA 4JW1A 5A6BA 2WZGA 4B6IA 1JPJA 3LESA 5DS4A 5JS5A 1QPUA 4PFOA 3DI5A 2J9VA 3WG7C 2Q9CA 3UR3C 1KU2A 2LP4A 2HSBA 5KYXA 2J8WA 1APCA 2LFFA 1ST6A 4ZLDA 1LM3B 2DYSC 2J46A 3IQTA 3K1HA 3RIPA 1VTMP 2A6EF 1TFKB 4JEAA 4JZAA 4LDKA 1I4ZA 3CQZA 1CPRA 1T6IA 3Q6NA 3OWTA 2VH3A 4K1OA 1G4US 3SEOA 5DQZA 2A68F 2Q7RA 3C8GD 3FAJA 1R5ID 5AC4A 4N06A 4U5HA 3ITFA 2G3KA 4U5BE 1KTMA 1A7EA 1M57C 4C3EA 1VLTA 2PF4E 3GM1A 4UDVA 1ORYA 1D1BA 3EJNA 2JPUA 2GWWA 5TJ5E 2F22A 3UMKA 2CDQA 2KGOA 2LIGA 2OJED 4AE4A 3RQGA 3DD7A 4PACA 5B3SC 3R2PA 2WVOA 2CNWA 1RJ9A 3FVYA 3KKBA 2A1DD 3KYIA 1IW7F 2DB4A 5E2QA 4BJ5A 1OCRC 1SR2A 4XPXA 3AGTA 3RQFA 3U2LA 5AGFA 2HV6A 2PNOA 4PJNA 4ANJA 1Y6DA 4AL1A 4DRJB 5IY5C 1NFNA 3L1MA 2ICWG 2EPLX 1Z6AA 5F5FA 1XZQA 2D4UA 1OKKA 4FWVA 3V5ZA 1ZHWA 2ETSA 4G7ZF 4MVSA 1VLSA 1K04A 2LCHA 1OW8A 2YQYA 3NDBB 3RVZA 3ZIBA 2OG2A 2ZXOA 3LEVA 3HTKC 2OCCC 1LE2A 3ABLC 4AL0A 3L8IA 4MVOA 1YAUO 2OEXA 1QZXA 2P7VA 4CDAA 2NSFA 4IAQA 5HV9A 2NUTA 3SXKA 5A6BD 1E83A 1L7CA 1UG7A 2L7AA 4XWJA 3FDQA 1ZW2A 3EQLF 2X0CA 3U0CA 4AK9A 2XLDA 4IJJA 1TKNA 4YJWA 1RKEA 1PD1A 5EHHA 1NG1A 4O6NA 5DVWA 4QI2A 3L8JA 2V26A 1ZHZA 2JD3A 3H2VA 3Q7GA 2VCAA 1ZU5A 2LFDA 4IRUA 3BRJA 3S29A 2IXOA 2UUIA 5A6KA 3N24A 2W9YA 2YLGA 4O7GA 2P61A 2EIMC 4JCHA 3ATPA 2XLOA 5KYYB 3KMIA 1V4AA 5JP7A 4K0DA 1MMNA 2EIKC 3DE9A 3RFYA 3IPMO 1ZVZA 2L6HA 3WAQA 4CS9A 3S84A 3GEEA 1HW2A 2XL6A 5L3QA 2HMQA 3CZ6A 3IQCA 4P9FA 3W4YA 4E0IA 4FAPB 1NU9C 2LK4A 3JT1A 4H4KC 3KL4A 5E33A 2Y39A 3NG1A 4L6RA 4JTAB 2RD9A 3ZQYA 2CNWD 3JRMO 2XLEA 1OR3A 1MQVA 3GM3A 4MVZA 5E3AA 4OINF 5L0FA 3T6GB 1O3UA 1XWJA 1E85A 2FFHA 4ONSA 1EQ1A 1JMWA 3H2UA 4W8KA 5CI9A 3O39A 4MTOA 1LI7A 3HNLA 4RD9A 4F4BA 3EZHA 3E70C 4NC3A 1GQAA 2YZSA 3KPHA 2Q00A 5COMA 1LS1A 4DRIB 4CS9C 1AVOB 1CGOA 1GGQA 3DE8A 5DLJA 4MW3A 1HE1A 2YVKA 1UFBA 3FOOA 4PJJA 2IXNA 1Z7Qc 4E7ZA 1C02A 5A69A 4NTFA 1QQ3A 4OIPF 4M63A 2LSEA 3NMIA 2A69F 1QKRA 5AC5A 3DM5A 1A41A 4BPMA 2VB6A 3K1IC 1Q0DA 1Z63A 2AP3A 3KYJA 1ORSC 1O87A 2XLVA 2KQ9A 2YLDA 4WABA 4OIRF 3DKAA 3ZTMA 5KYWB 4DXWA 1ZHYA 4OIQF 4ULVA 4BEMJ 3FAPB 3NMKA 2HUJA 4CX9A 2OQMA 2Y3HA 4XLNF 2YL0A 2R7UA 4HE8D 2XLMA 3AGUA 4U5EE 4ULWA 2R7RA 3Q7LA 2J7PD 1VYKA 1YDIA 2BL2A 1RKEB 1JPNA 3I5PA 2EIJC 4U5CE 2AU5A 4KNVA 1NFOA 4AX2A 2PFDA 2GFHA 3K7DA 4HFFB 3EG9A 3W2WA 1BDJB 2PBEA 3M1CB 2LQGA 3M4CA 1ZZPA 2XL8A 2RSEB 3X1OA 3K66A 2I8BA 2KNHA 2WL8A 4D4NA 3HKKA 4HEAJ 1M6TA 1D1CA 2EINC 3LNRA 3AQCA 1H7IA 3Q6MA 1IZMA 2Y3DA 4I1OB 3ZG1A 4E18A 4DVYP 1QSPA 2R7OA 2ZXRA 2C03A 3ZVRA 3B0PA 4J30B 4LDQA 5A6AA 1GM5A 4PR9A 3TQOA 3JSEO 1TFOB 2EPKX 2XM0A 3SXYA 1N1CA 4U5DE 3WODF 4DBQA 2IBFA 3RW0A 2J9UA 4ZLCA 2BC5A 2E87A 4U9EA 3A9CA 2H7OA 3RF3A 3VRCA 3UMIA 3NYJA 2PX3A 2CCYA 3GEIA 3U8PA 3ABKC 1G4WR 4FX5A 4JRZA 2NPUA 3E9VA 2Q4FA 2HJ3A 4W8PA 2J9BA 2IYLD 3RVYA 4XLPF 5JLIA 4CSAA 2J7PA 3C8ZA 3I4UA 3MYFA 5COGA 1MNEA 3VM6A 4CBEA 4ER9A 3HJCA 4KNWA 1M56C 4NCQA 4LERA 4NTAA 1WN0A 1Z5ZA 2XS8A 3AQBA 1G5ZA 2XLHA 4IARA 3S27A 3J06A 2Y69C 5F5HA 2YL1A 3AG3C 1H6GA 4PFPA 5FZTA 2WVNA 1I5NA 5GPGB 1OXBA 1EA8A 1JAFA 2VC9A 3S9OA 1S05A 3HNJA 3LAYA 2EPMX 3W2VA 2M4EA 4C7OA 4FESA 3DXJF 2FGYA 2MWQA 3K6BA 4CDYA 3DAFA 5FCLA 1HY5A 1WOLA 2NUPB 4MS2A 4YT5A 1E84A 3SZRA 2BE5F 2FAPB 3MYIA 3ECSA 4EUKB 2L81A 2YRFA 3CEXA 4OIOF 1WASA 2OJQA 3EZIA 1E2XA 2AVKA 4X0RA 3M15A 2EPNA 4I1MA 1V74B 3C8GA 3EGXB 3GANA 3U2MA 1OCOC 4RBNA 4MW8A 2R7QA 4DVZA 1Z23A 1T6UA 4BJ1A 1VK5A 2XM4A 3TJ6A 2AWYA 4PK4A 4CS8A 1I4YA 3LNMB 1JR8A 2R7VA 4CDVA 4R32A 4J32B 3T9OA 5JUAA 1TWGA 4XTKA 4JJFA 1EKYA 3TJ5A 3MLGA 4YN0B 3BEHA 3I5QA 5E3CA 2EPOA 2DYRC 3QVYA 2B0HA 4Z9IA 3G4ZA 1YA9A 3N2ZB 3ZTZA 4BJ5C 1NU7D 2XS1A 4XEVA 2WZFA 3GODA 3T6JA 5KYUA 3B29A 1QLEC 3VYWA 3QW1A 1FTSA 4NY3A 1SZIA 3B0VC 3EHNA 4JC7A 3AOUA 3AG4C 3FHDA 4PJMA 3UNGC 3CAXA 3NKDA 2IOQA 2R03A 2ZPAA 1LVKA 1YJGA 1FAPB 2WZLA 3HNKA 4EIYA 2V3CC 3B0UX 3AJMA 2A0BA 1MMAA 1NLXA 1BR1A 4E17A 4Q4ZF 3PDMP 1D0ZA 5D91A 3R7CA 3EGDB 1YA7O 3ABMC 3EPVA 2O9XA 5JRAA 1YZAA 1BZ4A 3U9MA 2WB7A 4N6HA 4RDAA 3U3FA 4DJ9A 2HMZA 3KH2A 3FXHA 4E0HA 4JURI 5COFA 2J0XA 1MMGA 2QLAA 2IXPA 3U8VA 1BBHA 3QMKA 4Z9HA 3SNHA 3V5YA 4QDLA 5A6JA 4JE9A 1VOMA 3VAYA 4JEBA 3AG1C 3T4RA 2EILC 3ASNC 3K33A 1FR0A 2OEVA 1GS9A 2M64A 5DS6A 5T3WA 5L0HA 1C03A 4YT4A 1F1MA 4U9DA 1Q0MA 2OOCA 1OCCC 5JT4A 2D5RB 3QZCA 1LIHA 2IXMA 3ZQVA 1B68A 2HZ8A 2KW3C 3EGDA 2G3VA 2H8AA 4CIPA 4YT8A 2QUPA 2QE9A 2VCCA 2Y3GA 3QVZA 5L0IA 3S90A 4MTFA 5B1AC 2HS5A 1O5HA 2L9JA 4O79A 1FFTC 5JSLA 3S0XA 3O10A 5L3VA 2VASA 2KJGA 4YL3A 1LKXA 3GORA 4C3DA 1T9KA 2C04A 5K0IA 3DJNB 3EH2A 1MNDA 1RKCA 1YZCA 4U5FE 5BQIA 1NSGB 1G8XA 4MVMA 2XLWA 1M2VB 1FMVA 2Q9BA 4KI2A 5D92A 1OR2A 4EHPA 3EG9B 1E86A 1OW6A 3JSZA 4MVQA 3SXMA 1D0XA 1HMOA 1AEPA 2YLIA 2R7XA 3RKOF 3G50A 1TWAA 3GM2A 3PHF2 2HSQA 3EH1A 3HNIA 4OD5A 2CGEA 2LD6A 2CYDA 4EBJA 4J7TA 3NRHA 4O6YA 1L3PA 1DOVA 4J7YA 2ZD9A 4LDRA 5T1DB 4P9TA 4DBRA 4AE4B 2GAQA 1VMAA 2QTVA 2YL7A 1WTYA 3LS1A 4GEHA 1HMDA 3RYLA 5KYNA 3US6A 1T5OA 3TOLA 1CGME 3DWWA 4G7OF 3SYNA 1H9GA 2PP4A 1PCXA 3EGXA 3L0IA 4WGYA 4XQ1A 4CJGA 2R7WA 1WWPA 2WVQA 2DGJA 2KSFA 2J0WA 1A7DA 1J8YF 3RQEA 3UGOA 2PX0A 3N0TA 5B3IA 2KYHA 4KBLA 1YARO 2R02A 3A11A 3F47A 3W8HA 3IQ5A 2GA0A 3AG2C 1M2OA 1ZW3A 3LS0A 4MVUA 2R7TA 2R7SA 1SYQA 3RH3A 4K7BA 1M2VA 1W2WA 2L6GA 2OKUA 4MQ9F 1HE9A 5KYXB 3SXZA 1H9TA 4DRHB 1RXQA 4C7OB 1NBBA 1D1AA 2JX0A 2ASRA 4LLEA 5CI8A 5F28E 5BQGA 3TK0A 1FNTc 1TWCA 4G7HF 5KYUB 1WGWA 4PJLA 2G62A 3W8IA 3UMHA 4CJOA 4E7SA 2XXAB 1MMDA 4NTBA 4JTDB 2YL3A 1K05A 2VCBA 4IB4A 4MTGA 2Q9AA 1JRAA 5L0JA 3JRTA 3DAGA 4XPYA 3QTHA 1FFHA 2P6VA 3OA1A 2YKZA 1ZYRF 2HKVA 2KK1A 2HFIA 4GQHA 4XPWA 2J9WA 2YWAA 3WHNA 5L0CA 1ORJA 2R9RB 1PD0A 5EGYA 1RJ9B 1V55C 4QI0A 5EK0A 3ZDLA 5B1BC 4I3MA 1NZEA 4CSAC 4YL1A 2QY9A 3IEEA 2R25A 3MFNA 3U5SA 3G4XA 2X51A 1A0BA 3TOMA 3B9QA 4MNDA 3UGPA 4LLCA 1FMWA 2Y3BA 4A2NB 3LLIA 4MVRA 3C18A 4Q7CA 3VF0A 4EBBA 2NUPA 2XRHA 1T01A 3GWLA 2B0JA 3M4BA 4HFKB 1Q0KA 4CIHA 3JCUQ 1S7ZA 4OD4A 4A4AA 3MBGA 3OEOA 1SMYF 4Q5SF 1EI7A 1T6QA 4N4WA 4H54A 4EWCA 3CSKA 3NKEA 3ZWIA 4DOZA 1YYXA 2AWCA 2MYSA 4GYTA 3H65A 3C63A 4O6MA 3TULA 3F46A 3S28A 1QVXA 3T6BA 1D0YA 1LI5A 4JIOA 5L0DA 3LUTB 3L34A 4IGGA 3NYMA 3DMDA 1WATA 1CGNA 1TQGA 2ZXWC 2ZXPA 3B71A 1OW7A 1VB5A 3DZAA 4P6IC 2H7VC 3HLZA 2J45A 4U5GA 1OCZC 4JTCB 4YK5A 4BG0A 4BJ6A 5BQHA 256BA 4JVSA 3GWNA 1BR2A 3JYYA 1TWHA 4I44A 5KYYA 4BEJA 2P1AA 2A6HF 3C62A 1YVIA 4C3BA 4XEKA 1U6HA 2XL4A 4YWQA 3O55A 2A0UA 2DI3A 1PV3A 4YL0A 2GDCA 3O6XA 4D4XA 4YT2A 3LLKA 3M79A 2I15A 2UUHA 3PCVA 1RCPA 1R4TA 5T3TA 1JOGA 1SF8A 3PMRA 2NSGA 2XXAA 1RMVA 4EBKA 1OQCA 1J8MF 3SP1A 4KC9A 2H7BA 1VYIA 2W45A 3K1IA 3ZSUA 2NUTB 4N6CA
chains in the Genus database with same CATH topology
1S05A 3HNJA 2YLGA 4CDYA 2XLOA 2YL7A 1E84A 5JP7A 3TOLA 3IQ6A 3DE9A 4WGYA 4CJGA 3QW0A 2XL6A 3M15A 5B3IA 1A7VA 4L6RA 3IQ5A 3ZQYA 2XLEA 1MQVA 1E85A 2XM4A 3NMJA 4CDVA 5JUAA 4WGZA 1YYJA 1NBBA 3HNLA 1EKYA 3FOPA 4NC3A 1GQAA 3QVYA 1CPQA 3DE8A 1CGOA 4CJOA 3ZTZA 4JKVA 2YL3A 3FOOA 4IB4A 5JS5A 3QW1A 1QPUA 1QQ3A 2YKZA 3NMIA 2J8WA 1APCA 1LM3B 3HNKA 4EIYA 2XLVA 3ZTMA 2YLDA 4JEAA 1CPRA 4ULVA 3NMKA 4CX9A 2YL0A 5JRAA 1YZAA 2XLMA 3TOMA 4N6HA 3M4BA 2QLAA 1BBHA 4N4WA 3M4CA 3ZWIA 4JE9A 2XL8A 4D4NA 1YYXA 4JEBA 3C63A 1M6TA 5AGFA 3L1MA 4U9DA 5JT4A 3ZQVA 2XM0A 1CGNA 4CIPA 3QVZA 2BC5A 4U9EA 3VRCA 256BA 2CCYA 5JSLA 3U8PA 3C62A 4CDAA 4IAQA 1YZCA 1E83A 2J9BA 4D4XA 2XLWA 3M79A 1RCPA 5JLIA 1E86A 2XLDA 4ER9A 5JVEA 2YLIA 2XLHA 4IARA 2YL1A 3HNIA 1JAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S05 A;  3HNJ A;  2YLG A;  4CDY A;  2XLO A;  2YL7 A;  1E84 A;  5JP7 A;  3TOL A;  3IQ6 A;  3DE9 A;  4WGY A;  4CJG A;  3QW0 A;  2XL6 A;  3M15 A;  5B3I A;  1A7V A;  4L6R A;  3IQ5 A;  3ZQY A;  2XLE A;  1MQV A;  1E85 A;  2XM4 A;  3NMJ A;  4CDV A;  5JUA A;  4WGZ A;  1YYJ A;  1NBB A;  3HNL A;  1EKY A;  3FOP A;  4NC3 A;  1GQA A;  3QVY A;  1CPQ A;  3DE8 A;  1CGO A;  4CJO A;  3ZTZ A;  4JKV A;  2YL3 A;  3FOO A;  4IB4 A;  5JS5 A;  3QW1 A;  1QPU A;  1QQ3 A;  2YKZ A;  3NMI A;  2J8W A;  1APC A;  1LM3 B;  3HNK A;  4EIY A;  2XLV A;  3ZTM A;  2YLD A;  4JEA A;  1CPR A;  4ULV A;  3NMK A;  4CX9 A;  2YL0 A;  5JRA A;  1YZA A;  2XLM A;  3TOM A;  4N6H A;  3M4B A;  2QLA A;  1BBH A;  4N4W A;  3M4C A;  3ZWI A;  4JE9 A;  2XL8 A;  4D4N A;  1YYX A;  4JEB A;  3C63 A;  1M6T A;  5AGF A;  3L1M A;  4U9D A;  5JT4 A;  3ZQV A;  2XM0 A;  1CGN A;  4CIP A;  3QVZ A;  2BC5 A;  4U9E A;  3VRC A;  256B A;  2CCY A;  5JSL A;  3U8P A;  3C62 A;  4CDA A;  4IAQ A;  1YZC A;  1E83 A;  2J9B A;  4D4X A;  2XLW A;  3M79 A;  1RCP A;  5JLI A;  1E86 A;  2XLD A;  4ER9 A;  5JVE A;  2YLI A;  2XLH A;  4IAR A;  2YL1 A;  3HNI A;  1JAF A; 
#chains in the Genus database with same CATH topology
 5CIV A;  3JYH A;  1LPE A;  2YEV A;  4IAO A;  4G78 A;  4JJG A;  2P0N A;  1XZP A;  1Q0F A;  3POV A;  1ZU4 A;  2Q3T A;  1LS4 A;  2IM8 A;  4WJ0 A;  1AUE A;  1Y4C A;  2KC3 A;  2NG1 A;  3FMS A;  3MX3 A;  4IWB A;  3IQ6 A;  3V5X A;  3U9J A;  2YHS A;  1U89 A;  5DS5 A;  2CW0 F;  3QW0 A;  4LAC B;  2TMV P;  1LE4 A;  4JCZ A;  3C7J A;  5DQT A;  1Q0G A;  1A7V A;  1DOW A;  1BR4 A;  2L6F A;  3LJB A;  3V7O A;  2QNL A;  3ZC4 A;  1C17 M;  4EKW A;  4BJ6 C;  5JVE A;  1ZHT A;  1OXK A;  5KYW A;  5HSW A;  1OKK D;  5L0G A;  1K40 A;  4G0H A;  4BJT A;  4CS8 C;  1ZHX A;  4Z9J A;  3TD7 A;  2XSE A;  3IHU A;  3JZ0 A;  3DJU B;  3EFO B;  3GEH A;  3NMJ A;  1Z3I X;  2W4M A;  2W4B A;  1YYJ A;  4WGZ A;  3X2Q C;  1U0B B;  3JTL O;  3EFO A;  3LEO A;  5BUO A;  1YLM A;  2R05 A;  3ASO C;  1V54 C;  3FOP A;  4XEF A;  2MHR A;  4NQF A;  1CPQ A;  2HJM A;  2Z15 A;  1KNY A;  2HV7 A;  1TR2 A;  2OU6 A;  3DM9 B;  3U3B A;  3C8G B;  4CS7 A;  4JKV A;  3EHM A;  1HW1 A;  3NYL A;  4JW1 A;  5A6B A;  2WZG A;  4B6I A;  1JPJ A;  3LES A;  5DS4 A;  5JS5 A;  1QPU A;  4PFO A;  3DI5 A;  2J9V A;  3WG7 C;  2Q9C A;  3UR3 C;  1KU2 A;  2LP4 A;  2HSB A;  5KYX A;  2J8W A;  1APC A;  2LFF A;  1ST6 A;  4ZLD A;  1LM3 B;  2DYS C;  2J46 A;  3IQT A;  3K1H A;  3RIP A;  1VTM P;  2A6E F;  1TFK B;  4JEA A;  4JZA A;  4LDK A;  1I4Z A;  3CQZ A;  1CPR A;  1T6I A;  3Q6N A;  3OWT A;  2VH3 A;  4K1O A;  1G4U S;  3SEO A;  5DQZ A;  2A68 F;  2Q7R A;  3C8G D;  3FAJ A;  1R5I D;  5AC4 A;  4N06 A;  4U5H A;  3ITF A;  2G3K A;  4U5B E;  1KTM A;  1A7E A;  1M57 C;  4C3E A;  1VLT A;  2PF4 E;  3GM1 A;  4UDV A;  1ORY A;  1D1B A;  3EJN A;  2JPU A;  2GWW A;  5TJ5 E;  2F22 A;  3UMK A;  2CDQ A;  2KGO A;  2LIG A;  2OJE D;  4AE4 A;  3RQG A;  3DD7 A;  4PAC A;  5B3S C;  3R2P A;  2WVO A;  2CNW A;  1RJ9 A;  3FVY A;  3KKB A;  2A1D D;  3KYI A;  1IW7 F;  2DB4 A;  5E2Q A;  4BJ5 A;  1OCR C;  1SR2 A;  4XPX A;  3AGT A;  3RQF A;  3U2L A;  5AGF A;  2HV6 A;  2PNO A;  4PJN A;  4ANJ A;  1Y6D A;  4AL1 A;  4DRJ B;  5IY5 C;  1NFN A;  3L1M A;  2ICW G;  2EPL X;  1Z6A A;  5F5F A;  1XZQ A;  2D4U A;  1OKK A;  4FWV A;  3V5Z A;  1ZHW A;  2ETS A;  4G7Z F;  4MVS A;  1VLS A;  1K04 A;  2LCH A;  1OW8 A;  2YQY A;  3NDB B;  3RVZ A;  3ZIB A;  2OG2 A;  2ZXO A;  3LEV A;  3HTK C;  2OCC C;  1LE2 A;  3ABL C;  4AL0 A;  3L8I A;  4MVO A;  1YAU O;  2OEX A;  1QZX A;  2P7V A;  4CDA A;  2NSF A;  4IAQ A;  5HV9 A;  2NUT A;  3SXK A;  5A6B D;  1E83 A;  1L7C A;  1UG7 A;  2L7A A;  4XWJ A;  3FDQ A;  1ZW2 A;  3EQL F;  2X0C A;  3U0C A;  4AK9 A;  2XLD A;  4IJJ A;  1TKN A;  4YJW A;  1RKE A;  1PD1 A;  5EHH A;  1NG1 A;  4O6N A;  5DVW A;  4QI2 A;  3L8J A;  2V26 A;  1ZHZ A;  2JD3 A;  3H2V A;  3Q7G A;  2VCA A;  1ZU5 A;  2LFD A;  4IRU A;  3BRJ A;  3S29 A;  2IXO A;  2UUI A;  5A6K A;  3N24 A;  2W9Y A;  2YLG A;  4O7G A;  2P61 A;  2EIM C;  4JCH A;  3ATP A;  2XLO A;  5KYY B;  3KMI A;  1V4A A;  5JP7 A;  4K0D A;  1MMN A;  2EIK C;  3DE9 A;  3RFY A;  3IPM O;  1ZVZ A;  2L6H A;  3WAQ A;  4CS9 A;  3S84 A;  3GEE A;  1HW2 A;  2XL6 A;  5L3Q A;  2HMQ A;  3CZ6 A;  3IQC A;  4P9F A;  3W4Y A;  4E0I A;  4FAP B;  1NU9 C;  2LK4 A;  3JT1 A;  4H4K C;  3KL4 A;  5E33 A;  2Y39 A;  3NG1 A;  4L6R A;  4JTA B;  2RD9 A;  3ZQY A;  2CNW D;  3JRM O;  2XLE A;  1OR3 A;  1MQV A;  3GM3 A;  4MVZ A;  5E3A A;  4OIN F;  5L0F A;  3T6G B;  1O3U A;  1XWJ A;  1E85 A;  2FFH A;  4ONS A;  1EQ1 A;  1JMW A;  3H2U A;  4W8K A;  5CI9 A;  3O39 A;  4MTO A;  1LI7 A;  3HNL A;  4RD9 A;  4F4B A;  3EZH A;  3E70 C;  4NC3 A;  1GQA A;  2YZS A;  3KPH A;  2Q00 A;  5COM A;  1LS1 A;  4DRI B;  4CS9 C;  1AVO B;  1CGO A;  1GGQ A;  3DE8 A;  5DLJ A;  4MW3 A;  1HE1 A;  2YVK A;  1UFB A;  3FOO A;  4PJJ A;  2IXN A;  1Z7Q c;  4E7Z A;  1C02 A;  5A69 A;  4NTF A;  1QQ3 A;  4OIP F;  4M63 A;  2LSE A;  3NMI A;  2A69 F;  1QKR A;  5AC5 A;  3DM5 A;  1A41 A;  4BPM A;  2VB6 A;  3K1I C;  1Q0D A;  1Z63 A;  2AP3 A;  3KYJ A;  1ORS C;  1O87 A;  2XLV A;  2KQ9 A;  2YLD A;  4WAB A;  4OIR F;  3DKA A;  3ZTM A;  5KYW B;  4DXW A;  1ZHY A;  4OIQ F;  4ULV A;  4BEM J;  3FAP B;  3NMK A;  2HUJ A;  4CX9 A;  2OQM A;  2Y3H A;  4XLN F;  2YL0 A;  2R7U A;  4HE8 D;  2XLM A;  3AGU A;  4U5E E;  4ULW A;  2R7R A;  3Q7L A;  2J7P D;  1VYK A;  1YDI A;  2BL2 A;  1RKE B;  1JPN A;  3I5P A;  2EIJ C;  4U5C E;  2AU5 A;  4KNV A;  1NFO A;  4AX2 A;  2PFD A;  2GFH A;  3K7D A;  4HFF B;  3EG9 A;  3W2W A;  1BDJ B;  2PBE A;  3M1C B;  2LQG A;  3M4C A;  1ZZP A;  2XL8 A;  2RSE B;  3X1O A;  3K66 A;  2I8B A;  2KNH A;  2WL8 A;  4D4N A;  3HKK A;  4HEA J;  1M6T A;  1D1C A;  2EIN C;  3LNR A;  3AQC A;  1H7I A;  3Q6M A;  1IZM A;  2Y3D A;  4I1O B;  3ZG1 A;  4E18 A;  4DVY P;  1QSP A;  2R7O A;  2ZXR A;  2C03 A;  3ZVR A;  3B0P A;  4J30 B;  4LDQ A;  5A6A A;  1GM5 A;  4PR9 A;  3TQO A;  3JSE O;  1TFO B;  2EPK X;  2XM0 A;  3SXY A;  1N1C A;  4U5D E;  3WOD F;  4DBQ A;  2IBF A;  3RW0 A;  2J9U A;  4ZLC A;  2BC5 A;  2E87 A;  4U9E A;  3A9C A;  2H7O A;  3RF3 A;  3VRC A;  3UMI A;  3NYJ A;  2PX3 A;  2CCY A;  3GEI A;  3U8P A;  3ABK C;  1G4W R;  4FX5 A;  4JRZ A;  2NPU A;  3E9V A;  2Q4F A;  2HJ3 A;  4W8P A;  2J9B A;  2IYL D;  3RVY A;  4XLP F;  5JLI A;  4CSA A;  2J7P A;  3C8Z A;  3I4U A;  3MYF A;  5COG A;  1MNE A;  3VM6 A;  4CBE A;  4ER9 A;  3HJC A;  4KNW A;  1M56 C;  4NCQ A;  4LER A;  4NTA A;  1WN0 A;  1Z5Z A;  2XS8 A;  3AQB A;  1G5Z A;  2XLH A;  4IAR A;  3S27 A;  3J06 A;  2Y69 C;  5F5H A;  2YL1 A;  3AG3 C;  1H6G A;  4PFP A;  5FZT A;  2WVN A;  1I5N A;  5GPG B;  1OXB A;  1EA8 A;  1JAF A;  2VC9 A;  3S9O A;  1S05 A;  3HNJ A;  3LAY A;  2EPM X;  3W2V A;  2M4E A;  4C7O A;  4FES A;  3DXJ F;  2FGY A;  2MWQ A;  3K6B A;  4CDY A;  3DAF A;  5FCL A;  1HY5 A;  1WOL A;  2NUP B;  4MS2 A;  4YT5 A;  1E84 A;  3SZR A;  2BE5 F;  2FAP B;  3MYI A;  3ECS A;  4EUK B;  2L81 A;  2YRF A;  3CEX A;  4OIO F;  1WAS A;  2OJQ A;  3EZI A;  1E2X A;  2AVK A;  4X0R A;  3M15 A;  2EPN A;  4I1M A;  1V74 B;  3C8G A;  3EGX B;  3GAN A;  3U2M A;  1OCO C;  4RBN A;  4MW8 A;  2R7Q A;  4DVZ A;  1Z23 A;  1T6U A;  4BJ1 A;  1VK5 A;  2XM4 A;  3TJ6 A;  2AWY A;  4PK4 A;  4CS8 A;  1I4Y A;  3LNM B;  1JR8 A;  2R7V A;  4CDV A;  4R32 A;  4J32 B;  3T9O A;  5JUA A;  1TWG A;  4XTK A;  4JJF A;  1EKY A;  3TJ5 A;  3MLG A;  4YN0 B;  3BEH A;  3I5Q A;  5E3C A;  2EPO A;  2DYR C;  3QVY A;  2B0H A;  4Z9I A;  3G4Z A;  1YA9 A;  3N2Z B;  3ZTZ A;  4BJ5 C;  1NU7 D;  2XS1 A;  4XEV A;  2WZF A;  3GOD A;  3T6J A;  5KYU A;  3B29 A;  1QLE C;  3VYW A;  3QW1 A;  1FTS A;  4NY3 A;  1SZI A;  3B0V C;  3EHN A;  4JC7 A;  3AOU A;  3AG4 C;  3FHD A;  4PJM A;  3UNG C;  3CAX A;  3NKD A;  2IOQ A;  2R03 A;  2ZPA A;  1LVK A;  1YJG A;  1FAP B;  2WZL A;  3HNK A;  4EIY A;  2V3C C;  3B0U X;  3AJM A;  2A0B A;  1MMA A;  1NLX A;  1BR1 A;  4E17 A;  4Q4Z F;  3PDM P;  1D0Z A;  5D91 A;  3R7C A;  3EGD B;  1YA7 O;  3ABM C;  3EPV A;  2O9X A;  5JRA A;  1YZA A;  1BZ4 A;  3U9M A;  2WB7 A;  4N6H A;  4RDA A;  3U3F A;  4DJ9 A;  2HMZ A;  3KH2 A;  3FXH A;  4E0H A;  4JUR I;  5COF A;  2J0X A;  1MMG A;  2QLA A;  2IXP A;  3U8V A;  1BBH A;  3QMK A;  4Z9H A;  3SNH A;  3V5Y A;  4QDL A;  5A6J A;  4JE9 A;  1VOM A;  3VAY A;  4JEB A;  3AG1 C;  3T4R A;  2EIL C;  3ASN C;  3K33 A;  1FR0 A;  2OEV A;  1GS9 A;  2M64 A;  5DS6 A;  5T3W A;  5L0H A;  1C03 A;  4YT4 A;  1F1M A;  4U9D A;  1Q0M A;  2OOC A;  1OCC C;  5JT4 A;  2D5R B;  3QZC A;  1LIH A;  2IXM A;  3ZQV A;  1B68 A;  2HZ8 A;  2KW3 C;  3EGD A;  2G3V A;  2H8A A;  4CIP A;  4YT8 A;  2QUP A;  2QE9 A;  2VCC A;  2Y3G A;  3QVZ A;  5L0I A;  3S90 A;  4MTF A;  5B1A C;  2HS5 A;  1O5H A;  2L9J A;  4O79 A;  1FFT C;  5JSL A;  3S0X A;  3O10 A;  5L3V A;  2VAS A;  2KJG A;  4YL3 A;  1LKX A;  3GOR A;  4C3D A;  1T9K A;  2C04 A;  5K0I A;  3DJN B;  3EH2 A;  1MND A;  1RKC A;  1YZC A;  4U5F E;  5BQI A;  1NSG B;  1G8X A;  4MVM A;  2XLW A;  1M2V B;  1FMV A;  2Q9B A;  4KI2 A;  5D92 A;  1OR2 A;  4EHP A;  3EG9 B;  1E86 A;  1OW6 A;  3JSZ A;  4MVQ A;  3SXM A;  1D0X A;  1HMO A;  1AEP A;  2YLI A;  2R7X A;  3RKO F;  3G50 A;  1TWA A;  3GM2 A;  3PHF 2;  2HSQ A;  3EH1 A;  3HNI A;  4OD5 A;  2CGE A;  2LD6 A;  2CYD A;  4EBJ A;  4J7T A;  3NRH A;  4O6Y A;  1L3P A;  1DOV A;  4J7Y A;  2ZD9 A;  4LDR A;  5T1D B;  4P9T A;  4DBR A;  4AE4 B;  2GAQ A;  1VMA A;  2QTV A;  2YL7 A;  1WTY A;  3LS1 A;  4GEH A;  1HMD A;  3RYL A;  5KYN A;  3US6 A;  1T5O A;  3TOL A;  1CGM E;  3DWW A;  4G7O F;  3SYN A;  1H9G A;  2PP4 A;  1PCX A;  3EGX A;  3L0I A;  4WGY A;  4XQ1 A;  4CJG A;  2R7W A;  1WWP A;  2WVQ A;  2DGJ A;  2KSF A;  2J0W A;  1A7D A;  1J8Y F;  3RQE A;  3UGO A;  2PX0 A;  3N0T A;  5B3I A;  2KYH A;  4KBL A;  1YAR O;  2R02 A;  3A11 A;  3F47 A;  3W8H A;  3IQ5 A;  2GA0 A;  3AG2 C;  1M2O A;  1ZW3 A;  3LS0 A;  4MVU A;  2R7T A;  2R7S A;  1SYQ A;  3RH3 A;  4K7B A;  1M2V A;  1W2W A;  2L6G A;  2OKU A;  4MQ9 F;  1HE9 A;  5KYX B;  3SXZ A;  1H9T A;  4DRH B;  1RXQ A;  4C7O B;  1NBB A;  1D1A A;  2JX0 A;  2ASR A;  4LLE A;  5CI8 A;  5F28 E;  5BQG A;  3TK0 A;  1FNT c;  1TWC A;  4G7H F;  5KYU B;  1WGW A;  4PJL A;  2G62 A;  3W8I A;  3UMH A;  4CJO A;  4E7S A;  2XXA B;  1MMD A;  4NTB A;  4JTD B;  2YL3 A;  1K05 A;  2VCB A;  4IB4 A;  4MTG A;  2Q9A A;  1JRA A;  5L0J A;  3JRT A;  3DAG A;  4XPY A;  3QTH A;  1FFH A;  2P6V A;  3OA1 A;  2YKZ A;  1ZYR F;  2HKV A;  2KK1 A;  2HFI A;  4GQH A;  4XPW A;  2J9W A;  2YWA A;  3WHN A;  5L0C A;  1ORJ A;  2R9R B;  1PD0 A;  5EGY A;  1RJ9 B;  1V55 C;  4QI0 A;  5EK0 A;  3ZDL A;  5B1B C;  4I3M A;  1NZE A;  4CSA C;  4YL1 A;  2QY9 A;  3IEE A;  2R25 A;  3MFN A;  3U5S A;  3G4X A;  2X51 A;  1A0B A;  3TOM A;  3B9Q A;  4MND A;  3UGP A;  4LLC A;  1FMW A;  2Y3B A;  4A2N B;  3LLI A;  4MVR A;  3C18 A;  4Q7C A;  3VF0 A;  4EBB A;  2NUP A;  2XRH A;  1T01 A;  3GWL A;  2B0J A;  3M4B A;  4HFK B;  1Q0K A;  4CIH A;  3JCU Q;  1S7Z A;  4OD4 A;  4A4A A;  3MBG A;  3OEO A;  1SMY F;  4Q5S F;  1EI7 A;  1T6Q A;  4N4W A;  4H54 A;  4EWC A;  3CSK A;  3NKE A;  3ZWI A;  4DOZ A;  1YYX A;  2AWC A;  2MYS A;  4GYT A;  3H65 A;  3C63 A;  4O6M A;  3TUL A;  3F46 A;  3S28 A;  1QVX A;  3T6B A;  1D0Y A;  1LI5 A;  4JIO A;  5L0D A;  3LUT B;  3L34 A;  4IGG A;  3NYM A;  3DMD A;  1WAT A;  1CGN A;  1TQG A;  2ZXW C;  2ZXP A;  3B71 A;  1OW7 A;  1VB5 A;  3DZA A;  4P6I C;  2H7V C;  3HLZ A;  2J45 A;  4U5G A;  1OCZ C;  4JTC B;  4YK5 A;  4BG0 A;  4BJ6 A;  5BQH A;  256B A;  4JVS A;  3GWN A;  1BR2 A;  3JYY A;  1TWH A;  4I44 A;  5KYY A;  4BEJ A;  2P1A A;  2A6H F;  3C62 A;  1YVI A;  4C3B A;  4XEK A;  1U6H A;  2XL4 A;  4YWQ A;  3O55 A;  2A0U A;  2DI3 A;  1PV3 A;  4YL0 A;  2GDC A;  3O6X A;  4D4X A;  4YT2 A;  3LLK A;  3M79 A;  2I15 A;  2UUH A;  3PCV A;  1RCP A;  1R4T A;  5T3T A;  1JOG A;  1SF8 A;  3PMR A;  2NSG A;  2XXA A;  1RMV A;  4EBK A;  1OQC A;  1J8M F;  3SP1 A;  4KC9 A;  2H7B A;  1VYI A;  2W45 A;  3K1I A;  3ZSU A;  2NUT B;  4N6C A; 
#chains in the Genus database with same CATH homology
 1S05 A;  3HNJ A;  2YLG A;  4CDY A;  2XLO A;  2YL7 A;  1E84 A;  5JP7 A;  3TOL A;  3IQ6 A;  3DE9 A;  4WGY A;  4CJG A;  3QW0 A;  2XL6 A;  3M15 A;  5B3I A;  1A7V A;  4L6R A;  3IQ5 A;  3ZQY A;  2XLE A;  1MQV A;  1E85 A;  2XM4 A;  3NMJ A;  4CDV A;  5JUA A;  4WGZ A;  1YYJ A;  1NBB A;  3HNL A;  1EKY A;  3FOP A;  4NC3 A;  1GQA A;  3QVY A;  1CPQ A;  3DE8 A;  1CGO A;  4CJO A;  3ZTZ A;  4JKV A;  2YL3 A;  3FOO A;  4IB4 A;  5JS5 A;  3QW1 A;  1QPU A;  1QQ3 A;  2YKZ A;  3NMI A;  2J8W A;  1APC A;  1LM3 B;  3HNK A;  4EIY A;  2XLV A;  3ZTM A;  2YLD A;  4JEA A;  1CPR A;  4ULV A;  3NMK A;  4CX9 A;  2YL0 A;  5JRA A;  1YZA A;  2XLM A;  3TOM A;  4N6H A;  3M4B A;  2QLA A;  1BBH A;  4N4W A;  3M4C A;  3ZWI A;  4JE9 A;  2XL8 A;  4D4N A;  1YYX A;  4JEB A;  3C63 A;  1M6T A;  5AGF A;  3L1M A;  4U9D A;  5JT4 A;  3ZQV A;  2XM0 A;  1CGN A;  4CIP A;  3QVZ A;  2BC5 A;  4U9E A;  3VRC A;  256B A;  2CCY A;  5JSL A;  3U8P A;  3C62 A;  4CDA A;  4IAQ A;  1YZC A;  1E83 A;  2J9B A;  4D4X A;  2XLW A;  3M79 A;  1RCP A;  5JLI A;  1E86 A;  2XLD A;  4ER9 A;  5JVE A;  2YLI A;  2XLH A;  4IAR A;  2YL1 A;  3HNI A;  1JAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...