2CCYA

Structure of ferricytochrome c(prime) from rhodospirillum molischianum at 1.67 angstroms resolution
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
127
structure length
127
Chain Sequence
QSKPEDLLKLRQGLMQTLKSQWVPIAGFAAGKADLPADAAQRAENMAMVAKLAPIGWAKGTEALPNGETKPEAFGSKSAEFLEGWKALATESTKLAAAAKAGPDALKAQAAATGKVCKACHEEFKQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of ferricytochrome c' from Rhodospirillum molischianum at 1.67 A resolution.
pubmed doi rcsb
source organism Phaeospirillum molischianum
molecule tags Electron transport (heme protein)
molecule keywords CYTOCHROME C
total genus 48
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 1985-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2ccyA00
2YLDA 5B3IA 3TOMA 3HNKA 1QQ3A 3M15A 4ULVA 1CGOA 4EIYA 1E85A 3ZTZA 2J8WA 3M79A 2J9BA 3M4CA 2YL1A 4JEBA 4N4WA 5JS5A 256BA 3HNJA 4JKVA 4U9DA 1M6TA 2XLEA 1CPRA 2YLIA 4IARA 1CGNA 1GQAA 3DE8A 4D4NA 3FOPA 2YKZA 4WGZA 3HNLA 2XLDA 3NMKA 5JT4A 4WGYA 2CCYA 5JSLA 4CJGA 1NBBA 2YL3A 4CJOA 5AGFA 4L6RA 1CPQA 1YYXA 2QLAA 4CDVA 2XLHA 1APCA 5JRAA 1EKYA 1BBHA 1MQVA 2XM4A 3ZQVA 2XL8A 3ZTMA 3QVZA 3C63A 3ZWIA 1JAFA 3QVYA 4IAQA 4D4XA 4N6HA 1YZCA 2YL0A 4IB4A 4U9EA 2XLOA 5JP7A 3VRCA 4CX9A 3TOLA 1RCPA 1YZAA 3FOOA 3L1MA 3M4BA 1E86A 2YL7A 4CDAA 3DE9A 5JUAA 4CIPA 2BC5A 3QW1A 3ZQYA 1E83A 2XLMA 1A7VA 2XLVA 4JE9A 2YLGA 1E84A 1YYJA 4JEAA 5JLIA 3NMIA 3HNIA 4ER9A 2XLWA 2XL6A 3U8PA 3C62A 3QW0A 3IQ5A 4CDYA 5JVEA 1QPUA 4NC3A 1LM3B 2XM0A 3IQ6A 1S05A 3NMJA
chains in the Genus database with same CATH superfamily
3W2WA 1G4WR 1Q0FA 3A9CA 2F22A 2OOCA 3HTKC 3RQGA 1TWCA 1JOGA 4Z9IA 3T4RA 3M15A 1U0BB 2J0WA 3T9OA 5DS5A 4IJJA 2KC3A 3EGDB 4XTKA 2EPLX 3S90A 3C7JA 4EIYA 3ZTZA 3E9VA 4OD4A 2HS5A 1HMOA 1T01A 1Q0MA 3FAPB 3OEOA 3ZVRA 4AL1A 4A4AA 3ABMC 2OJQA 3M4CA 1ZYRF 1CGME 2XRHA 1S7ZA 2QNLA 2JD3A 4MVMA 3HNJA 3NYLA 4M63A 4N4WA 3L8IA 4DVYP 4NTFA 4LDKA 2DYRC 3LEVA 3UMKA 2TMVP 1FR0A 2XLEA 2IOQA 2YLIA 5AC5A 3EH2A 1RJ9A 4J30B 3RVYA 3U3BA 1M2OA 1NZEA 2KW3C 4BJ1A 1WN0A 4NY3A 1NU9C 2L9JA 3EQLF 2A0BA 3JRTA 3DE8A 2HMZA 3EFOB 4JRZA 1SR2A 2B0JA 2YKZA 3F47A 3I5PA 5KYYA 4YT4A 3MLGA 3LUTB 3O10A 4XPYA 3GEHA 4XWJA 4YL3A 2KNHA 1G5ZA 1WATA 3DJUB 4I44A 2X0CA 2BL2A 3F46A 1RXQA 5B1AC 2R25A 2L6HA 2PNOA 2H7BA 4OINF 4EBBA 1O87A 1GS9A 1ZHZA 4CJOA 5AGFA 3NYMA 4L6RA 4EKWA 4JJGA 4O6MA 3LNRA 2AWYA 4PK4A 4RDAA 1YYXA 2PFDA 2ETSA 4BJ6C 2J0XA 2GFHA 2H7VC 2Q9AA 1OQCA 1OKKD 4JTAB 2RSEB 1BBHA 2GDCA 3GWLA 4AE4A 2HV6A 3HJCA 2LFDA 1EI7A 4H54A 5FCLA 2PF4E 1NLXA 2DB4A 2DGJA 1A7EA 1LI7A 2J46A 3IEEA 4YN0B 3EG9A 2W4MA 4YWQA 1RKEA 1AEPA 3LLIA 1QSPA 3H2VA 2IXNA 3ZWIA 1JAFA 3G50A 3K1HA 4K7BA 4YK5A 5COMA 3WG7C 1ORJA 3WAQA 1TWAA 3EZHA 3JSZA 2OU6A 2J7PA 2VC9A 3EGDA 5L0FA 4MVOA 4IB4A 3JRMO 2XLOA 3VRCA 2P1AA 4MW8A 3JSEO 4XPXA 5D92A 1C02A 4HFKB 2A1DD 1C17M 1H6GA 2A6HF 4CS8C 3EFOA 2HKVA 2WVQA 3KPHA 3AG1C 4X0RA 5DQZA 5E3AA 1RCPA 2R9RB 3L1MA 4C3EA 4JTCB 3ABKC 1PV3A 3Q6MA 2ZPAA 3DE9A 4Z9HA 1H9TA 1VTMP 5F5FA 4CIPA 2BC5A 4G78A 3EH1A 2A6EF 3SXKA 1ZW2A 3V5ZA 4J32B 1VB5A 1E83A 4JJFA 2CGEA 2W9YA 2QE9A 1SF8A 2W4BA 3SNHA 2XLVA 3K33A 4JE9A 2YLGA 4XQ1A 4G7OF 2P6VA 1YYJA 1L7CA 3Q6NA 4O7GA 3QMKA 3EJNA 3RF3A 2V3CC 3FVYA 1KNYA 3BEHA 3KYIA 4PJMA 3VAYA 2LIGA 2KK1A 3FXHA 3K7DA 2LQGA 4ANJA 4ER9A 1N1CA 4OIQF 5FZTA 4FAPB 1OCOC 4JURI 4MW3A 3IPMO 4B6IA 5A6JA 1TQGA 4GEHA 4J7YA 4OIPF 4LLCA 1HE9A 3RKOF 4EBKA 3S29A 3C8GD 5KYUB 2OQMA 5KYXB 4C7OB 2Q00A 3KYJA 3W4YA 2WB7A 5A6KA 2Q3TA 3IQCA 3NMJA 2Q4FA 1EQ1A 3U2MA 2D5RB 2R7WA 2I8BA 1ZU4A 1V74B 4W8PA 3SXMA 4BJTA 2DYSC 3AGTA 3L8JA 1RMVA 1LKXA 3HNKA 4KNWA 1TWGA 2CNWA 2NUPA 5T3WA 1D1AA 2HJ3A 1JR8A 3GODA 3US6A 4OIOF 1LE2A 4XLNF 3U5SA 3S27A 2LK4A 2YZSA 3FMSA 4DOZA 3PCVA 3AJMA 4OD5A 4CSAC 4PACA 4KI2A 2J8WA 3N2ZB 2ZXRA 4JC7A 2J9BA 3RQFA 3TD7A 2GWWA 4LACB 256BA 1ZW3A 3CQZA 2YEVA 4GQHA 1MNDA 1V55C 1Z6AA 3GM1A 2Q7RA 1K05A 3NKEA 2A68F 2AP3A 3O6XA 3H65A 4K0DA 1M6TA 3T6GB 5L0JA 2HV7A 2M4EA 3GM2A 1CPRA 3JT1A 4YL0A 3RYLA 1T9KA 2P0NA 2B0HA 1FNTc 4BJ6A 2IXMA 3NKDA 5T3TA 1OXBA 3V5YA 2CW0F 3C8GB 5E33A 1O3UA 3RIPA 5DLJA 2GA0A 1A7DA 3EZIA 4YT2A 5TJ5E 4Z9JA 3UMHA 1BR4A 1ORYA 1FFHA 1ZHXA 3G4XA 1RKEB 1HY5A 1O5HA 2FFHA 1R5ID 5EK0A 1CPQA 4XPWA 4AK9A 3U9MA 2XS1A 4CDVA 4MTGA 4E17A 1SZIA 5JRAA 1OCCC 3TQOA 4LLEA 4AE4B 1KTMA 1WOLA 4CBEA 1HMDA 4QI0A 4CS8A 2ICWG 3LNMB 3MFNA 4MVUA 5L0HA 3IHUA 1UG7A 4DBRA 2PX3A 4PFPA 3FAJA 1L3PA 2R7OA 3JTLO 4CS9A 5F5HA 2AWCA 3CZ6A 3QVYA 4IAQA 3TK0A 4MVZA 1YZCA 1BDJB 2WL8A 4U5DE 1MMDA 1XZQA 3EGXB 2ASRA 3L34A 4P6IC 3U9JA 4E0IA 3DXJF 1JPNA 1MMAA 2LCHA 3I4UA 3LAYA 4KBLA 3SP1A 4PJJA 1E86A 3KMIA 3AQCA 1TWHA 5KYWB 4JCHA 4G7HF 5BQGA 2R7SA 5D91A 2NUTA 1HW1A 3SXYA 1MMNA 2XL4A 1ZHWA 2WVOA 3LESA 4NCQA 4QDLA 3FOOA 1Z5ZA 3LJBA 1NFNA 3JZ0A 3M4BA 3GANA 5DVWA 3WODF 5L0IA 5EHHA 3FDQA 2R7QA 3V5XA 2J9UA 3S84A 2J45A 5A6BD 4JTDB 5KYNA 3R7CA 1D1CA 3DAFA 2IXOA 3ECSA 2OCCC 3ZQYA 4H4KC 4LDQA 2J9WA 2AU5A 3VM6A 1WASA 3K66A 3UR3C 2LD6A 3G4ZA 3Q7LA 2G3VA 2G62A 1VYIA 3WHNA 1E2XA 2D4UA 4NTAA 1DOVA 5JLIA 3NMIA 4C3BA 3FHDA 2XL6A 3C8ZA 1ZHYA 5KYYB 1TFOB 1OCRC 3L0IA 1VK5A 4MQ9F 3S0XA 5IY5C 1U6HA 3DAGA 3ABLC 4DRJB 4IWBA 2OG2A 1G8XA 2MWQA 2MYSA 4U5EE 4K1OA 4D4NA 1IZMA 2YLDA 1VLTA 5B3IA 3AQBA 4PR9A 2PBEA 3RQEA 2EINC 3AG3C 2YWAA 3ZSUA 2WZGA 2OEVA 3U8VA 3MBGA 1E85A 2Y3BA 4Q4ZF 2Y3DA 3NG1A 4U5FE 1MMGA 3M79A 2YL1A 1OW7A 3AGUA 5BUOA 3POVA 5JS5A 2R7XA 2EIJC 4GYTA 3GORA 4U9DA 4BJ5C 1HW2A 1FAPB 2R7TA 2NG1A 2VB6A 3OWTA 5EGYA 2HUJA 1OXKA 2A0UA 3H2UA 4ULWA 1WWPA 2ZXPA 3LS1A 5L3VA 4BJ5A 1TKNA 3KKBA 2IBFA 3JYHA 3B29A 3C18A 1GQAA 2H8AA 2Y39A 3KH2A 3O55A 4O6NA 2NUTB 2L7AA 4W8KA 2Y3HA 3CSKA 3SYNA 2Q9BA 3FOPA 3KL4A 3E70C 5B1BC 1Z3IX 4KNVA 1ZZPA 3T6JA 3NMKA 1KU2A 1UFBA 4MTOA 3ZG1A 1OR2A 4HFFB 5A69A 4WGYA 2EIMC 4J7TA 4RBNA 5L0DA 1C03A 4JW1A 4RD9A 5AC4A 2ZXWC 5A6AA 3K6BA 4OIRF 1LS1A 1NBBA 3NRHA 2YL3A 2P7VA 3QZCA 3I5QA 2VCCA 3ITFA 4MVRA 1ST6A 3PHF2 1YA7O 3EHMA 2NUPB 5CI8A 2QLAA 3ZDLA 2ZD9A 1SYQA 5T1DB 1APCA 1D1BA 1GM5A 1EKYA 2QUPA 2CDQA 2R05A 2HMQA 4N6CA 1ZHTA 4N06A 5BQHA 3LLKA 2L6GA 3AG2C 5L0CA 3J06A 3DZAA 2XL8A 2VCAA 3ZTMA 3UGOA 2CYDA 4BEMJ 3RVZA 4R32A 3C63A 5COGA 5A6BA 3ATPA 1IW7F 4PFOA 1I4ZA 4XEVA 1M2VA 3O39A 1WTYA 2X51A 2ZXOA 3EGXA 4MVQA 4BG0A 1NU7D 1T5OA 1D0XA 3ASNC 1LI5A 1T6IA 2KGOA 2YRFA 3B9QA 4A2NB 3NYJA 3S28A 4LDRA 4U9EA 1RKCA 1VYKA 4JZAA 2WVNA 4CX9A 3A11A 3IQTA 1FMVA 2PP4A 4DVZA 4ZLDA 1Q0KA 2VCBA 3B0VC 2YHSA 2OJED 2W45A 1AVOB 5L3QA 3DM5A 4CDAA 5JUAA 3RFYA 1OKKA 3GEEA 3QTHA 4F4BA 4I3MA 1TR2A 1OCZC 1ORSC 2NSFA 1D0ZA 3K1IA 3Q7GA 4YT5A 4DRHB 1HE1A 3N24A 1K40A 3OA1A 2XLMA 1A7VA 3K1IC 2UUHA 4U5CE 5HSWA 3AG4C 2XSEA 4MTFA 2E87A 1W2WA 2JX0A 4IGGA 3S9OA 3T6BA 2EPMX 3ZC4A 2R7UA 1K04A 3HNIA 2Z15A 2YQYA 4O6YA 4I1OB 4AX2A 4JVSA 3UMIA 4E7SA 1JRAA 1YVIA 2KJGA 2J7PD 2IM8A 1J8MF 3N0TA 3U8PA 2XXAA 1A0BA 2O9XA 3C62A 3QW0A 4HEAJ 1XWJA 4YL1A 3IQ5A 4CDYA 3TULA 2WZLA 1QPUA 4C7OA 4NC3A 4C3DA 5KYXA 5KYUA 1LM3B 1Z7Qc 2YVKA 2XM0A 3IQ6A 1S05A 3DWWA 4ONSA 1XZPA 5BQIA 4U5GA 1FTSA 1VMAA 1Y4CA 3TOMA 2WZFA 1QQ3A 1T6UA 1JPJA 4XEFA 3AOUA 1PD0A 4PJNA 4CSAA 5HV9A 3HKKA 4ULVA 4QI2A 1ZU5A 4BPMA 1F1MA 2EILC 1CGOA 1YAUO 4MS2A 3UNGC 2P61A 4U5BE 5E3CA 1YARO 2RD9A 1QLEC 2QY9A 4G0HA 4JEBA 5GPGB 3VYWA 2M64A 1DOWA 2R02A 4JKVA 1QVXA 4WABA 3RW0A 5DQTA 1FMWA 1LS4A 3B71A 3V7OA 1J8YF 2L81A 2LFFA 2R03A 1RJ9B 1CGNA 4IARA 2IYLD 3RH3A 1OW6A 1M56C 2V26A 2HJMA 3ASOC 1H9GA 3C8GA 2KQ9A 2J9VA 2HSBA 4KC9A 3GWNA 3HNLA 4WGZA 2HFIA 2XLDA 5KYWA 2FGYA 4EBJA 1OR3A 1R4TA 4MNDA 4PJLA 3W2VA 5JT4A 2NSGA 3JCUQ 3DD7A 4MVSA 2CCYA 2H7OA 4O79A 4DXWA 2CNWD 5L0GA 1I4YA 5JSLA 3W8IA 4U5HA 2KYHA 4CJGA 5DS6A 1LPEA 4E0HA 2AVKA 2A69F 1YJGA 1QZXA 2HSQA 3SEOA 4Q7CA 1FFTC 1T6QA 4FWVA 3U3FA 3M1CB 1I5NA 2GAQA 3JYYA 3PMRA 4P9FA 3U2LA 1LVKA 2BE5F 1Z23A 2XLHA 3DI5A 3NDBB 3HLZA 4EWCA 5K0IA 1MQVA 2G3KA 2XM4A 2PX0A 2MHRA 2QTVA 4I1MA 2EPNA 4NQFA 3X2QC 3ZQVA 3EHNA 3TJ6A 1G4US 2Y69C 1U89A 5DS4A 1NG1A 1PCXA 3DJNB 3QVZA 4JCZA 5CI9A 3EG9B 1ZVZA 2R7RA 2R7VA 1V54C 1Q0GA 1LE4A 1YA9A 3SXZA 4XLPF 1VLSA 4D4XA 3DMDA 4N6HA 1YDIA 4AL0A 1BR1A 2YL0A 3W8HA 5E2QA 4ZLCA 4LERA 2I15A 1B68A 1Y6DA 4HE8D 3MYFA 3ZIBA 3CAXA 3DM9B 4E18A 4G7ZF 1AUEA 3LS0A 2KSFA 4FESA 5JP7A 1M57C 2VASA 4DRIB 1Z63A 1V4AA 1VOMA 4IAOA 1H7IA 3TOLA 3UGPA 1JMWA 1YZAA 4CS7A 2YL7A 4UDVA 4EHPA 2C04A 2XXAB 3B0PA 1YLMA 5CIVA 4CS9C 4FX5A 2LP4A 2OKUA 3GEIA 3QW1A 3VF0A 3B0UX 3GM3A 3MYIA 2FAPB 5B3SC 2EPKX 3TJ5A 4CIHA 2VH3A 1EA8A 4P9TA 1D0YA 4E7ZA 2OEXA 1E84A 2JPUA 2LSEA 4Q5SF 2HZ8A 4XEKA 4EUKB 2Q9CA 1WGWA 1LIHA 1MNEA 3DKAA 3LEOA 5F28E 3X1OA 4JEAA 1A41A 1NFOA 5COFA 1BR2A 4BEJA 2DI3A 2EPOA 1OW8A 1PD1A 2IXPA 2NPUA 2XLWA 1QKRA 2EIKC 3BRJA 2C03A 4NTBA 2XS8A 4WJ0A 3SZRA 4JIOA 1M2VB 3CEXA 1BZ4A 1NSGB 4DJ9A 1TFKB 3MX3A 4DBQA 3R2PA 4YJWA 5JVEA 3PDMP 2L6FA 4IRUA 1GGQA 4YT8A 2UUIA 1SMYF 1Q0DA 3U0CA 3EPVA 2Y3GA
chains in the Genus database with same CATH topology
2YLDA 5B3IA 3TOMA 3HNKA 1QQ3A 3M15A 4ULVA 1CGOA 4EIYA 1E85A 3ZTZA 2J8WA 3M79A 2J9BA 3M4CA 2YL1A 4JEBA 4N4WA 5JS5A 256BA 3HNJA 4JKVA 4U9DA 1M6TA 2XLEA 1CPRA 2YLIA 4IARA 1CGNA 1GQAA 3DE8A 4D4NA 3FOPA 2YKZA 4WGZA 3HNLA 2XLDA 3NMKA 5JT4A 4WGYA 2CCYA 5JSLA 4CJGA 1NBBA 2YL3A 4CJOA 5AGFA 4L6RA 1CPQA 1YYXA 2QLAA 4CDVA 2XLHA 1APCA 5JRAA 1EKYA 1BBHA 1MQVA 2XM4A 3ZQVA 2XL8A 3ZTMA 3QVZA 3C63A 3ZWIA 1JAFA 3QVYA 4IAQA 4D4XA 4N6HA 1YZCA 2YL0A 4IB4A 4U9EA 2XLOA 5JP7A 3VRCA 4CX9A 3TOLA 1RCPA 1YZAA 3FOOA 3L1MA 3M4BA 1E86A 2YL7A 4CDAA 3DE9A 5JUAA 4CIPA 2BC5A 3QW1A 3ZQYA 1E83A 2XLMA 1A7VA 2XLVA 4JE9A 2YLGA 1E84A 1YYJA 4JEAA 5JLIA 3NMIA 3HNIA 4ER9A 2XLWA 2XL6A 3U8PA 3C62A 3QW0A 3IQ5A 4CDYA 5JVEA 1QPUA 4NC3A 1LM3B 2XM0A 3IQ6A 1S05A 3NMJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YLD A;  5B3I A;  3TOM A;  3HNK A;  1QQ3 A;  3M15 A;  4ULV A;  1CGO A;  4EIY A;  1E85 A;  3ZTZ A;  2J8W A;  3M79 A;  2J9B A;  3M4C A;  2YL1 A;  4JEB A;  4N4W A;  5JS5 A;  256B A;  3HNJ A;  4JKV A;  4U9D A;  1M6T A;  2XLE A;  1CPR A;  2YLI A;  4IAR A;  1CGN A;  1GQA A;  3DE8 A;  4D4N A;  3FOP A;  2YKZ A;  4WGZ A;  3HNL A;  2XLD A;  3NMK A;  5JT4 A;  4WGY A;  2CCY A;  5JSL A;  4CJG A;  1NBB A;  2YL3 A;  4CJO A;  5AGF A;  4L6R A;  1CPQ A;  1YYX A;  2QLA A;  4CDV A;  2XLH A;  1APC A;  5JRA A;  1EKY A;  1BBH A;  1MQV A;  2XM4 A;  3ZQV A;  2XL8 A;  3ZTM A;  3QVZ A;  3C63 A;  3ZWI A;  1JAF A;  3QVY A;  4IAQ A;  4D4X A;  4N6H A;  1YZC A;  2YL0 A;  4IB4 A;  4U9E A;  2XLO A;  5JP7 A;  3VRC A;  4CX9 A;  3TOL A;  1RCP A;  1YZA A;  3FOO A;  3L1M A;  3M4B A;  1E86 A;  2YL7 A;  4CDA A;  3DE9 A;  5JUA A;  4CIP A;  2BC5 A;  3QW1 A;  3ZQY A;  1E83 A;  2XLM A;  1A7V A;  2XLV A;  4JE9 A;  2YLG A;  1E84 A;  1YYJ A;  4JEA A;  5JLI A;  3NMI A;  3HNI A;  4ER9 A;  2XLW A;  2XL6 A;  3U8P A;  3C62 A;  3QW0 A;  3IQ5 A;  4CDY A;  5JVE A;  1QPU A;  4NC3 A;  1LM3 B;  2XM0 A;  3IQ6 A;  1S05 A;  3NMJ A; 
#chains in the Genus database with same CATH topology
 3W2W A;  1G4W R;  1Q0F A;  3A9C A;  2F22 A;  2OOC A;  3HTK C;  3RQG A;  1TWC A;  1JOG A;  4Z9I A;  3T4R A;  3M15 A;  1U0B B;  2J0W A;  3T9O A;  5DS5 A;  4IJJ A;  2KC3 A;  3EGD B;  4XTK A;  2EPL X;  3S90 A;  3C7J A;  4EIY A;  3ZTZ A;  3E9V A;  4OD4 A;  2HS5 A;  1HMO A;  1T01 A;  1Q0M A;  3FAP B;  3OEO A;  3ZVR A;  4AL1 A;  4A4A A;  3ABM C;  2OJQ A;  3M4C A;  1ZYR F;  1CGM E;  2XRH A;  1S7Z A;  2QNL A;  2JD3 A;  4MVM A;  3HNJ A;  3NYL A;  4M63 A;  4N4W A;  3L8I A;  4DVY P;  4NTF A;  4LDK A;  2DYR C;  3LEV A;  3UMK A;  2TMV P;  1FR0 A;  2XLE A;  2IOQ A;  2YLI A;  5AC5 A;  3EH2 A;  1RJ9 A;  4J30 B;  3RVY A;  3U3B A;  1M2O A;  1NZE A;  2KW3 C;  4BJ1 A;  1WN0 A;  4NY3 A;  1NU9 C;  2L9J A;  3EQL F;  2A0B A;  3JRT A;  3DE8 A;  2HMZ A;  3EFO B;  4JRZ A;  1SR2 A;  2B0J A;  2YKZ A;  3F47 A;  3I5P A;  5KYY A;  4YT4 A;  3MLG A;  3LUT B;  3O10 A;  4XPY A;  3GEH A;  4XWJ A;  4YL3 A;  2KNH A;  1G5Z A;  1WAT A;  3DJU B;  4I44 A;  2X0C A;  2BL2 A;  3F46 A;  1RXQ A;  5B1A C;  2R25 A;  2L6H A;  2PNO A;  2H7B A;  4OIN F;  4EBB A;  1O87 A;  1GS9 A;  1ZHZ A;  4CJO A;  5AGF A;  3NYM A;  4L6R A;  4EKW A;  4JJG A;  4O6M A;  3LNR A;  2AWY A;  4PK4 A;  4RDA A;  1YYX A;  2PFD A;  2ETS A;  4BJ6 C;  2J0X A;  2GFH A;  2H7V C;  2Q9A A;  1OQC A;  1OKK D;  4JTA B;  2RSE B;  1BBH A;  2GDC A;  3GWL A;  4AE4 A;  2HV6 A;  3HJC A;  2LFD A;  1EI7 A;  4H54 A;  5FCL A;  2PF4 E;  1NLX A;  2DB4 A;  2DGJ A;  1A7E A;  1LI7 A;  2J46 A;  3IEE A;  4YN0 B;  3EG9 A;  2W4M A;  4YWQ A;  1RKE A;  1AEP A;  3LLI A;  1QSP A;  3H2V A;  2IXN A;  3ZWI A;  1JAF A;  3G50 A;  3K1H A;  4K7B A;  4YK5 A;  5COM A;  3WG7 C;  1ORJ A;  3WAQ A;  1TWA A;  3EZH A;  3JSZ A;  2OU6 A;  2J7P A;  2VC9 A;  3EGD A;  5L0F A;  4MVO A;  4IB4 A;  3JRM O;  2XLO A;  3VRC A;  2P1A A;  4MW8 A;  3JSE O;  4XPX A;  5D92 A;  1C02 A;  4HFK B;  2A1D D;  1C17 M;  1H6G A;  2A6H F;  4CS8 C;  3EFO A;  2HKV A;  2WVQ A;  3KPH A;  3AG1 C;  4X0R A;  5DQZ A;  5E3A A;  1RCP A;  2R9R B;  3L1M A;  4C3E A;  4JTC B;  3ABK C;  1PV3 A;  3Q6M A;  2ZPA A;  3DE9 A;  4Z9H A;  1H9T A;  1VTM P;  5F5F A;  4CIP A;  2BC5 A;  4G78 A;  3EH1 A;  2A6E F;  3SXK A;  1ZW2 A;  3V5Z A;  4J32 B;  1VB5 A;  1E83 A;  4JJF A;  2CGE A;  2W9Y A;  2QE9 A;  1SF8 A;  2W4B A;  3SNH A;  2XLV A;  3K33 A;  4JE9 A;  2YLG A;  4XQ1 A;  4G7O F;  2P6V A;  1YYJ A;  1L7C A;  3Q6N A;  4O7G A;  3QMK A;  3EJN A;  3RF3 A;  2V3C C;  3FVY A;  1KNY A;  3BEH A;  3KYI A;  4PJM A;  3VAY A;  2LIG A;  2KK1 A;  3FXH A;  3K7D A;  2LQG A;  4ANJ A;  4ER9 A;  1N1C A;  4OIQ F;  5FZT A;  4FAP B;  1OCO C;  4JUR I;  4MW3 A;  3IPM O;  4B6I A;  5A6J A;  1TQG A;  4GEH A;  4J7Y A;  4OIP F;  4LLC A;  1HE9 A;  3RKO F;  4EBK A;  3S29 A;  3C8G D;  5KYU B;  2OQM A;  5KYX B;  4C7O B;  2Q00 A;  3KYJ A;  3W4Y A;  2WB7 A;  5A6K A;  2Q3T A;  3IQC A;  3NMJ A;  2Q4F A;  1EQ1 A;  3U2M A;  2D5R B;  2R7W A;  2I8B A;  1ZU4 A;  1V74 B;  4W8P A;  3SXM A;  4BJT A;  2DYS C;  3AGT A;  3L8J A;  1RMV A;  1LKX A;  3HNK A;  4KNW A;  1TWG A;  2CNW A;  2NUP A;  5T3W A;  1D1A A;  2HJ3 A;  1JR8 A;  3GOD A;  3US6 A;  4OIO F;  1LE2 A;  4XLN F;  3U5S A;  3S27 A;  2LK4 A;  2YZS A;  3FMS A;  4DOZ A;  3PCV A;  3AJM A;  4OD5 A;  4CSA C;  4PAC A;  4KI2 A;  2J8W A;  3N2Z B;  2ZXR A;  4JC7 A;  2J9B A;  3RQF A;  3TD7 A;  2GWW A;  4LAC B;  256B A;  1ZW3 A;  3CQZ A;  2YEV A;  4GQH A;  1MND A;  1V55 C;  1Z6A A;  3GM1 A;  2Q7R A;  1K05 A;  3NKE A;  2A68 F;  2AP3 A;  3O6X A;  3H65 A;  4K0D A;  1M6T A;  3T6G B;  5L0J A;  2HV7 A;  2M4E A;  3GM2 A;  1CPR A;  3JT1 A;  4YL0 A;  3RYL A;  1T9K A;  2P0N A;  2B0H A;  1FNT c;  4BJ6 A;  2IXM A;  3NKD A;  5T3T A;  1OXB A;  3V5Y A;  2CW0 F;  3C8G B;  5E33 A;  1O3U A;  3RIP A;  5DLJ A;  2GA0 A;  1A7D A;  3EZI A;  4YT2 A;  5TJ5 E;  4Z9J A;  3UMH A;  1BR4 A;  1ORY A;  1FFH A;  1ZHX A;  3G4X A;  1RKE B;  1HY5 A;  1O5H A;  2FFH A;  1R5I D;  5EK0 A;  1CPQ A;  4XPW A;  4AK9 A;  3U9M A;  2XS1 A;  4CDV A;  4MTG A;  4E17 A;  1SZI A;  5JRA A;  1OCC C;  3TQO A;  4LLE A;  4AE4 B;  1KTM A;  1WOL A;  4CBE A;  1HMD A;  4QI0 A;  4CS8 A;  2ICW G;  3LNM B;  3MFN A;  4MVU A;  5L0H A;  3IHU A;  1UG7 A;  4DBR A;  2PX3 A;  4PFP A;  3FAJ A;  1L3P A;  2R7O A;  3JTL O;  4CS9 A;  5F5H A;  2AWC A;  3CZ6 A;  3QVY A;  4IAQ A;  3TK0 A;  4MVZ A;  1YZC A;  1BDJ B;  2WL8 A;  4U5D E;  1MMD A;  1XZQ A;  3EGX B;  2ASR A;  3L34 A;  4P6I C;  3U9J A;  4E0I A;  3DXJ F;  1JPN A;  1MMA A;  2LCH A;  3I4U A;  3LAY A;  4KBL A;  3SP1 A;  4PJJ A;  1E86 A;  3KMI A;  3AQC A;  1TWH A;  5KYW B;  4JCH A;  4G7H F;  5BQG A;  2R7S A;  5D91 A;  2NUT A;  1HW1 A;  3SXY A;  1MMN A;  2XL4 A;  1ZHW A;  2WVO A;  3LES A;  4NCQ A;  4QDL A;  3FOO A;  1Z5Z A;  3LJB A;  1NFN A;  3JZ0 A;  3M4B A;  3GAN A;  5DVW A;  3WOD F;  5L0I A;  5EHH A;  3FDQ A;  2R7Q A;  3V5X A;  2J9U A;  3S84 A;  2J45 A;  5A6B D;  4JTD B;  5KYN A;  3R7C A;  1D1C A;  3DAF A;  2IXO A;  3ECS A;  2OCC C;  3ZQY A;  4H4K C;  4LDQ A;  2J9W A;  2AU5 A;  3VM6 A;  1WAS A;  3K66 A;  3UR3 C;  2LD6 A;  3G4Z A;  3Q7L A;  2G3V A;  2G62 A;  1VYI A;  3WHN A;  1E2X A;  2D4U A;  4NTA A;  1DOV A;  5JLI A;  3NMI A;  4C3B A;  3FHD A;  2XL6 A;  3C8Z A;  1ZHY A;  5KYY B;  1TFO B;  1OCR C;  3L0I A;  1VK5 A;  4MQ9 F;  3S0X A;  5IY5 C;  1U6H A;  3DAG A;  3ABL C;  4DRJ B;  4IWB A;  2OG2 A;  1G8X A;  2MWQ A;  2MYS A;  4U5E E;  4K1O A;  4D4N A;  1IZM A;  2YLD A;  1VLT A;  5B3I A;  3AQB A;  4PR9 A;  2PBE A;  3RQE A;  2EIN C;  3AG3 C;  2YWA A;  3ZSU A;  2WZG A;  2OEV A;  3U8V A;  3MBG A;  1E85 A;  2Y3B A;  4Q4Z F;  2Y3D A;  3NG1 A;  4U5F E;  1MMG A;  3M79 A;  2YL1 A;  1OW7 A;  3AGU A;  5BUO A;  3POV A;  5JS5 A;  2R7X A;  2EIJ C;  4GYT A;  3GOR A;  4U9D A;  4BJ5 C;  1HW2 A;  1FAP B;  2R7T A;  2NG1 A;  2VB6 A;  3OWT A;  5EGY A;  2HUJ A;  1OXK A;  2A0U A;  3H2U A;  4ULW A;  1WWP A;  2ZXP A;  3LS1 A;  5L3V A;  4BJ5 A;  1TKN A;  3KKB A;  2IBF A;  3JYH A;  3B29 A;  3C18 A;  1GQA A;  2H8A A;  2Y39 A;  3KH2 A;  3O55 A;  4O6N A;  2NUT B;  2L7A A;  4W8K A;  2Y3H A;  3CSK A;  3SYN A;  2Q9B A;  3FOP A;  3KL4 A;  3E70 C;  5B1B C;  1Z3I X;  4KNV A;  1ZZP A;  3T6J A;  3NMK A;  1KU2 A;  1UFB A;  4MTO A;  3ZG1 A;  1OR2 A;  4HFF B;  5A69 A;  4WGY A;  2EIM C;  4J7T A;  4RBN A;  5L0D A;  1C03 A;  4JW1 A;  4RD9 A;  5AC4 A;  2ZXW C;  5A6A A;  3K6B A;  4OIR F;  1LS1 A;  1NBB A;  3NRH A;  2YL3 A;  2P7V A;  3QZC A;  3I5Q A;  2VCC A;  3ITF A;  4MVR A;  1ST6 A;  3PHF 2;  1YA7 O;  3EHM A;  2NUP B;  5CI8 A;  2QLA A;  3ZDL A;  2ZD9 A;  1SYQ A;  5T1D B;  1APC A;  1D1B A;  1GM5 A;  1EKY A;  2QUP A;  2CDQ A;  2R05 A;  2HMQ A;  4N6C A;  1ZHT A;  4N06 A;  5BQH A;  3LLK A;  2L6G A;  3AG2 C;  5L0C A;  3J06 A;  3DZA A;  2XL8 A;  2VCA A;  3ZTM A;  3UGO A;  2CYD A;  4BEM J;  3RVZ A;  4R32 A;  3C63 A;  5COG A;  5A6B A;  3ATP A;  1IW7 F;  4PFO A;  1I4Z A;  4XEV A;  1M2V A;  3O39 A;  1WTY A;  2X51 A;  2ZXO A;  3EGX A;  4MVQ A;  4BG0 A;  1NU7 D;  1T5O A;  1D0X A;  3ASN C;  1LI5 A;  1T6I A;  2KGO A;  2YRF A;  3B9Q A;  4A2N B;  3NYJ A;  3S28 A;  4LDR A;  4U9E A;  1RKC A;  1VYK A;  4JZA A;  2WVN A;  4CX9 A;  3A11 A;  3IQT A;  1FMV A;  2PP4 A;  4DVZ A;  4ZLD A;  1Q0K A;  2VCB A;  3B0V C;  2YHS A;  2OJE D;  2W45 A;  1AVO B;  5L3Q A;  3DM5 A;  4CDA A;  5JUA A;  3RFY A;  1OKK A;  3GEE A;  3QTH A;  4F4B A;  4I3M A;  1TR2 A;  1OCZ C;  1ORS C;  2NSF A;  1D0Z A;  3K1I A;  3Q7G A;  4YT5 A;  4DRH B;  1HE1 A;  3N24 A;  1K40 A;  3OA1 A;  2XLM A;  1A7V A;  3K1I C;  2UUH A;  4U5C E;  5HSW A;  3AG4 C;  2XSE A;  4MTF A;  2E87 A;  1W2W A;  2JX0 A;  4IGG A;  3S9O A;  3T6B A;  2EPM X;  3ZC4 A;  2R7U A;  1K04 A;  3HNI A;  2Z15 A;  2YQY A;  4O6Y A;  4I1O B;  4AX2 A;  4JVS A;  3UMI A;  4E7S A;  1JRA A;  1YVI A;  2KJG A;  2J7P D;  2IM8 A;  1J8M F;  3N0T A;  3U8P A;  2XXA A;  1A0B A;  2O9X A;  3C62 A;  3QW0 A;  4HEA J;  1XWJ A;  4YL1 A;  3IQ5 A;  4CDY A;  3TUL A;  2WZL A;  1QPU A;  4C7O A;  4NC3 A;  4C3D A;  5KYX A;  5KYU A;  1LM3 B;  1Z7Q c;  2YVK A;  2XM0 A;  3IQ6 A;  1S05 A;  3DWW A;  4ONS A;  1XZP A;  5BQI A;  4U5G A;  1FTS A;  1VMA A;  1Y4C A;  3TOM A;  2WZF A;  1QQ3 A;  1T6U A;  1JPJ A;  4XEF A;  3AOU A;  1PD0 A;  4PJN A;  4CSA A;  5HV9 A;  3HKK A;  4ULV A;  4QI2 A;  1ZU5 A;  4BPM A;  1F1M A;  2EIL C;  1CGO A;  1YAU O;  4MS2 A;  3UNG C;  2P61 A;  4U5B E;  5E3C A;  1YAR O;  2RD9 A;  1QLE C;  2QY9 A;  4G0H A;  4JEB A;  5GPG B;  3VYW A;  2M64 A;  1DOW A;  2R02 A;  4JKV A;  1QVX A;  4WAB A;  3RW0 A;  5DQT A;  1FMW A;  1LS4 A;  3B71 A;  3V7O A;  1J8Y F;  2L81 A;  2LFF A;  2R03 A;  1RJ9 B;  1CGN A;  4IAR A;  2IYL D;  3RH3 A;  1OW6 A;  1M56 C;  2V26 A;  2HJM A;  3ASO C;  1H9G A;  3C8G A;  2KQ9 A;  2J9V A;  2HSB A;  4KC9 A;  3GWN A;  3HNL A;  4WGZ A;  2HFI A;  2XLD A;  5KYW A;  2FGY A;  4EBJ A;  1OR3 A;  1R4T A;  4MND A;  4PJL A;  3W2V A;  5JT4 A;  2NSG A;  3JCU Q;  3DD7 A;  4MVS A;  2CCY A;  2H7O A;  4O79 A;  4DXW A;  2CNW D;  5L0G A;  1I4Y A;  5JSL A;  3W8I A;  4U5H A;  2KYH A;  4CJG A;  5DS6 A;  1LPE A;  4E0H A;  2AVK A;  2A69 F;  1YJG A;  1QZX A;  2HSQ A;  3SEO A;  4Q7C A;  1FFT C;  1T6Q A;  4FWV A;  3U3F A;  3M1C B;  1I5N A;  2GAQ A;  3JYY A;  3PMR A;  4P9F A;  3U2L A;  1LVK A;  2BE5 F;  1Z23 A;  2XLH A;  3DI5 A;  3NDB B;  3HLZ A;  4EWC A;  5K0I A;  1MQV A;  2G3K A;  2XM4 A;  2PX0 A;  2MHR A;  2QTV A;  4I1M A;  2EPN A;  4NQF A;  3X2Q C;  3ZQV A;  3EHN A;  3TJ6 A;  1G4U S;  2Y69 C;  1U89 A;  5DS4 A;  1NG1 A;  1PCX A;  3DJN B;  3QVZ A;  4JCZ A;  5CI9 A;  3EG9 B;  1ZVZ A;  2R7R A;  2R7V A;  1V54 C;  1Q0G A;  1LE4 A;  1YA9 A;  3SXZ A;  4XLP F;  1VLS A;  4D4X A;  3DMD A;  4N6H A;  1YDI A;  4AL0 A;  1BR1 A;  2YL0 A;  3W8H A;  5E2Q A;  4ZLC A;  4LER A;  2I15 A;  1B68 A;  1Y6D A;  4HE8 D;  3MYF A;  3ZIB A;  3CAX A;  3DM9 B;  4E18 A;  4G7Z F;  1AUE A;  3LS0 A;  2KSF A;  4FES A;  5JP7 A;  1M57 C;  2VAS A;  4DRI B;  1Z63 A;  1V4A A;  1VOM A;  4IAO A;  1H7I A;  3TOL A;  3UGP A;  1JMW A;  1YZA A;  4CS7 A;  2YL7 A;  4UDV A;  4EHP A;  2C04 A;  2XXA B;  3B0P A;  1YLM A;  5CIV A;  4CS9 C;  4FX5 A;  2LP4 A;  2OKU A;  3GEI A;  3QW1 A;  3VF0 A;  3B0U X;  3GM3 A;  3MYI A;  2FAP B;  5B3S C;  2EPK X;  3TJ5 A;  4CIH A;  2VH3 A;  1EA8 A;  4P9T A;  1D0Y A;  4E7Z A;  2OEX A;  1E84 A;  2JPU A;  2LSE A;  4Q5S F;  2HZ8 A;  4XEK A;  4EUK B;  2Q9C A;  1WGW A;  1LIH A;  1MNE A;  3DKA A;  3LEO A;  5F28 E;  3X1O A;  4JEA A;  1A41 A;  1NFO A;  5COF A;  1BR2 A;  4BEJ A;  2DI3 A;  2EPO A;  1OW8 A;  1PD1 A;  2IXP A;  2NPU A;  2XLW A;  1QKR A;  2EIK C;  3BRJ A;  2C03 A;  4NTB A;  2XS8 A;  4WJ0 A;  3SZR A;  4JIO A;  1M2V B;  3CEX A;  1BZ4 A;  1NSG B;  4DJ9 A;  1TFK B;  3MX3 A;  4DBQ A;  3R2P A;  4YJW A;  5JVE A;  3PDM P;  2L6F A;  4IRU A;  1GGQ A;  4YT8 A;  2UUI A;  1SMY F;  1Q0D A;  3U0C A;  3EPV A;  2Y3G A; 
#chains in the Genus database with same CATH homology
 2YLD A;  5B3I A;  3TOM A;  3HNK A;  1QQ3 A;  3M15 A;  4ULV A;  1CGO A;  4EIY A;  1E85 A;  3ZTZ A;  2J8W A;  3M79 A;  2J9B A;  3M4C A;  2YL1 A;  4JEB A;  4N4W A;  5JS5 A;  256B A;  3HNJ A;  4JKV A;  4U9D A;  1M6T A;  2XLE A;  1CPR A;  2YLI A;  4IAR A;  1CGN A;  1GQA A;  3DE8 A;  4D4N A;  3FOP A;  2YKZ A;  4WGZ A;  3HNL A;  2XLD A;  3NMK A;  5JT4 A;  4WGY A;  2CCY A;  5JSL A;  4CJG A;  1NBB A;  2YL3 A;  4CJO A;  5AGF A;  4L6R A;  1CPQ A;  1YYX A;  2QLA A;  4CDV A;  2XLH A;  1APC A;  5JRA A;  1EKY A;  1BBH A;  1MQV A;  2XM4 A;  3ZQV A;  2XL8 A;  3ZTM A;  3QVZ A;  3C63 A;  3ZWI A;  1JAF A;  3QVY A;  4IAQ A;  4D4X A;  4N6H A;  1YZC A;  2YL0 A;  4IB4 A;  4U9E A;  2XLO A;  5JP7 A;  3VRC A;  4CX9 A;  3TOL A;  1RCP A;  1YZA A;  3FOO A;  3L1M A;  3M4B A;  1E86 A;  2YL7 A;  4CDA A;  3DE9 A;  5JUA A;  4CIP A;  2BC5 A;  3QW1 A;  3ZQY A;  1E83 A;  2XLM A;  1A7V A;  2XLV A;  4JE9 A;  2YLG A;  1E84 A;  1YYJ A;  4JEA A;  5JLI A;  3NMI A;  3HNI A;  4ER9 A;  2XLW A;  2XL6 A;  3U8P A;  3C62 A;  3QW0 A;  3IQ5 A;  4CDY A;  5JVE A;  1QPU A;  4NC3 A;  1LM3 B;  2XM0 A;  3IQ6 A;  1S05 A;  3NMJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...