2CCYA

Structure of ferricytochrome c(prime) from rhodospirillum molischianum at 1.67 angstroms resolution
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
127
structure length
127
Chain Sequence
QSKPEDLLKLRQGLMQTLKSQWVPIAGFAAGKADLPADAAQRAENMAMVAKLAPIGWAKGTEALPNGETKPEAFGSKSAEFLEGWKALATESTKLAAAAKAGPDALKAQAAATGKVCKACHEEFKQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C
publication title Structure of ferricytochrome c' from Rhodospirillum molischianum at 1.67 A resolution.
pubmed doi rcsb
source organism Phaeospirillum molischianum
molecule tags Electron transport (heme protein)
total genus 48
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 1985-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2ccyA00
3M79A 1GQAA 2J9BA 3M4BA 3FOPA 4JE9A 1QQ3A 4NC3A 4CDVA 2YLDA 3ZTZA 1M6TA 4IB4A 1JAFA 3DE9A 2XLEA 3NMIA 1APCA 1CPRA 2XM4A 4U9DA 4JEAA 2YL1A 1QPUA 3M4CA 1CPQA 2XLOA 2XLHA 3M15A 4N6HA 2YL7A 5JT4A 1BBHA 4WGYA 4D4XA 3IQ6A 4IAQA 1A7VA 1RCPA 3QVYA 3C63A 3QW1A 2XLVA 3ZTMA 1NBBA 4L6RA 4ULVA 3QVZA 1YYXA 3HNJA 3TOLA 2XL6A 3C62A 3U8PA 3NMJA 2XLMA 2XM0A 4IARA 4EIYA 1YZCA 2YL0A 2YLIA 2YKZA 5JRAA 2XL8A 5B3IA 1E83A 2XLWA 1E84A 1E86A 1CGOA 3QW0A 3ZQVA 4CJOA 4CX9A 4CJGA 2BC5A 5JSLA 3HNLA 2QLAA 1E85A 1MQVA 3TOMA 5JS5A 3VRCA 1YZAA 2YLGA 2XLDA 2CCYA 256BA 1CGNA 2YL3A 4CDAA 5JUAA 4ER9A 2J8WA 4CIPA 1YYJA 3HNKA 1LM3B 1S05A 3DE8A 4CDYA 5JP7A 3HNIA 3L1MA 3IQ5A 3NMKA 4JKVA 5AGFA 3FOOA 3ZWIA 1EKYA 4D4NA 5JLIA 5JVEA 4N4WA 4WGZA 4U9EA 3ZQYA 4JEBA
chains in the Genus database with same CATH superfamily
4YL1A 2KQ9A 3SXZA 1D0XA 3ATPA 1YA9A 3S0XA 1GQAA 1R4TA 3N0TA 1UFBA 3LLKA 3SXMA 3T6BA 2W4MA 4NQFA 2R7OA 3MLGA 1L7CA 3FOPA 3JRMO 1LI7A 1QZXA 1QQ3A 2DYSC 1I4YA 3ITFA 1T6QA 4I44A 4O79A 1A41A 2LK4A 2HJMA 3GANA 1NZEA 4LDRA 3ZTZA 1Z63A 5E33A 3PMRA 3JTLO 5TJ5E 1RMVA 5CI8A 3TJ6A 4C7OB 2XLEA 2OJED 3MX3A 1ORJA 3U9MA 3TULA 1APCA 4XEKA 3ZDLA 1M56C 4EBJA 3ZIBA 2OCCC 3S84A 4U9DA 4OINF 3AQCA 3EFOA 2Q9AA 2CW0F 1A7EA 1W2WA 3X2QC 3F46A 2R7XA 1Q0GA 3EGXB 2XLOA 1BR2A 2XS1A 4JTAB 4G0HA 1D0ZA 5CIVA 4B6IA 3G50A 1PCXA 2LIGA 1S7ZA 2IBFA 1TWCA 2L81A 3ABKC 3Q6MA 2YL7A 4KBLA 4N6HA 4C3EA 2Q4FA 4WGYA 4YJWA 2HMQA 1TWGA 1OXBA 3V7OA 2L7AA 2A69F 2YEVA 1OCZC 1ZHXA 3MYIA 4NCQA 4C3DA 4U5DE 2ETSA 2NG1A 3S90A 1RXQA 3KMIA 4ZLDA 2JX0A 2IXPA 2XLVA 4BJ6A 1EQ1A 4QI0A 3GM2A 2B0HA 3RKOF 1WOLA 4JURI 4BJTA 2LP4A 1XWJA 2PBEA 1WWPA 3DM5A 3DMDA 1Q0MA 4I3MA 2EPKX 2HKVA 3QVZA 4LLEA 1V55C 3TJ5A 3VM6A 3S28A 4F4BA 5FCLA 2ZPAA 1YJGA 2QNLA 4CSAC 3C62A 2R03A 2Z15A 3NMJA 3EHMA 2XLMA 4IARA 2DGJA 2OJQA 1ZW2A 5E2QA 2L6FA 1Q0FA 2QTVA 3AGUA 5DS5A 3TK0A 2HZ8A 1HE9A 4EBBA 3DJNB 3AJMA 1BDJB 1SYQA 3SZRA 3ZVRA 1B68A 1M2VA 2HMZA 5B3SC 2D4UA 2IXMA 1GGQA 1J8MF 3EHNA 4MVSA 3TD7A 3C18A 3JRTA 2P6VA 2GAQA 2XXAB 2R25A 2XLWA 1T01A 3WAQA 4PK4A 3NKDA 3OA1A 3ABMC 2Y3DA 3QW0A 4LDQA 4R32A 4XEFA 3S9OA 5K0IA 5L0HA 1H6GA 2J46A 3A11A 4CX9A 3F47A 4K0DA 2BC5A 4JRZA 3HNLA 3JCUQ 1MNEA 2BE5F 3B29A 3PCVA 1OKKA 2CNWD 2P0NA 2YZSA 2J7PA 3IEEA 3TOMA 3UNGC 5A6KA 5AC4A 2YLGA 1I5NA 2Y3BA 3JZ0A 3GEIA 4Z9HA 5L0IA 1IZMA 4C7OA 1NG1A 2VCBA 1HE1A 1N1CA 2QUPA 1Q0DA 4IJJA 1G4WR 4JJGA 2H7BA 2XL4A 4ER9A 4CIPA 4QDLA 2X51A 2ZXPA 5E3AA 3C7JA 2LSEA 3LEVA 5COGA 3LJBA 3UGPA 2J9WA 1FNTc 5EHHA 5FZTA 3L0IA 1S05A 2PFDA 3DE8A 2KJGA 2IYLD 4HE8D 2UUIA 4UDVA 5DQTA 3JSZA 2NUTB 1UG7A 1M57C 2OEVA 1MMAA 3NMKA 1OR2A 2AWCA 2B0JA 4DBRA 4JKVA 3K33A 4JTDB 5AGFA 1G5ZA 3FOOA 4RDAA 1WASA 2LCHA 1WATA 2I15A 2FAPB 3MFNA 1K40A 4O6YA 2OG2A 4N6CA 4W8PA 4CS8C 3RVYA 2E87A 1OQCA 3M79A 3RH3A 2C04A 3FAPB 1QVXA 4HFKB 4AL0A 3L8IA 2OU6A 5A6AA 1TFOB 4FX5A 3CSKA 1C02A 4G7HF 1LPEA 4J7YA 1NU9C 5BUOA 3J06A 4LACB 4MVZA 1Z5ZA 1K05A 3SYNA 3ZC4A 4IB4A 4BJ5A 3HLZA 4MW3A 3DE9A 1VYIA 2XSEA 2VCAA 1Y4CA 2PX3A 3AG1C 4XTKA 3RF3A 1SR2A 3C8GD 1C17M 2KW3C 4CIHA 1CPRA 1BZ4A 4U5HA 1ZU4A 1ST6A 2EIKC 3EPVA 4CBEA 4E0HA 4XPXA 2P7VA 1QPUA 2J9VA 4PJJA 1JRAA 3AG3C 1H9TA 4XLNF 3O6XA 4CS9C 4ONSA 1TR2A 3H65A 3UMKA 5A6JA 3GEEA 2HSBA 4JW1A 5JT4A 1NLXA 4QI2A 3K1HA 3SXKA 4D4XA 1D1BA 1Z3IX 3VYWA 4IAQA 2KSFA 5B1BC 1YAUO 4JCZA 2ICWG 4HFFB 1RCPA 1AVOB 2YVKA 2Q9BA 4EBKA 1T6IA 1JPJA 1PV3A 3O55A 3LNRA 5CI9A 5E3CA 1LS1A 2M4EA 2WB7A 4OIRF 3RQEA 1LVKA 1M2OA 4AL1A 3PDMP 2OKUA 3LAYA 3VF0A 2IM8A 3KPHA 5A69A 3U0CA 4AK9A 1YYXA 3KYJA 4LDKA 4RD9A 4BPMA 4IWBA 4KC9A 5COMA 1R5ID 2NUTA 2HJ3A 3W8HA 2PP4A 4O7GA 2PF4E 4DOZA 4XQ1A 3SNHA 2WVNA 4JCHA 1FFTC 2Y3HA 3M1CB 2P61A 3US6A 4DVZA 1VOMA 4KNVA 4BG0A 5GPGB 4GYTA 2W4BA 3NDBB 3IQTA 4U5CE 4J32B 2YKZA 5JRAA 2EILC 3N2ZB 2A1DD 2KK1A 2W9YA 3AOUA 2VB6A 4CS7A 2R7VA 2CYDA 4YWQA 2HFIA 1E83A 2QE9A 1E86A 3CQZA 2VH3A 1V4AA 3QMKA 4U5EE 3RIPA 3R2PA 2ZD9A 4JJFA 2HSQA 1D1AA 4BEJA 5JS5A 1VK5A 1YZAA 2Q9CA 2XS8A 5KYYB 5DS6A 3BRJA 3CAXA 5L3VA 2VCCA 2XLDA 3K7DA 1VMAA 1MMDA 3Q6NA 2JD3A 3DXJF 4CSAA 1VYKA 1I4ZA 2OEXA 3IHUA 4DXWA 4MNDA 4X0RA 2J8WA 2EIJC 1FMWA 5KYXB 3C8GB 4IGGA 2H7VC 1SF8A 4EUKB 2L6HA 1LM3B 2AVKA 2R9RB 4PR9A 4MVQA 4CDYA 2MWQA 2ZXOA 4KI2A 3ASNC 2Q7RA 1ZHYA 3FHDA 4YT8A 3I5PA 3UR3C 2ZXRA 3MYFA 1OCRC 4ZLCA 3G4ZA 4DBQA 2M64A 1E2XA 1VLSA 1QLEC 2RD9A 4U9EA 1LS4A 1A0BA 3E70C 4MTOA 1H7IA 3ZWIA 2G3VA 5JLIA 3DAFA 1EI7A 2AWYA 1VTMP 1VLTA 2J0XA 4FAPB 1NFNA 4M63A 3CZ6A 5L0FA 4E17A 4ULWA 3CEXA 4E18A 2OQMA 1V74B 2WZFA 4PJMA 5L3QA 2J9BA 4LLCA 3M4BA 1AEPA 2J0WA 1YARO 2FGYA 4JE9A 4K7BA 5A6BA 4NC3A 5DLJA 5IY5C 4PJNA 4CDVA 1ORYA 1TQGA 2EIMC 2UUHA 3DI5A 3EGXA 3X1OA 2GA0A 1M6TA 1T5OA 1V54C 1G4US 2WVQA 1GS9A 2R02A 2LFDA 2R7SA 2EPNA 3MBGA 3O39A 1RKCA 4IAOA 5KYUB 3OEOA 2XM4A 4C3BA 3E9VA 2WZLA 2QY9A 1ZZPA 1OKKD 1LKXA 4K1OA 4FWVA 2J7PD 2VC9A 1LI5A 1LIHA 2R7QA 2YL1A 4NTBA 3GORA 3U9JA 4DRIB 4CS8A 3EGDB 2A0BA 3V5XA 2Y39A 4I1MA 3NYJA 2WZGA 4YT4A 4H4KC 5F5FA 1BBHA 2NSFA 4N06A 2C03A 2DYRC 3JT1A 4BEMJ 3IQ6A 4J7TA 3UGOA 3KL4A 5D91A 4A4AA 2F22A 3EZHA 2MHRA 3C63A 4I1OB 1A7DA 3QW1A 4W8KA 3T4RA 3ZTMA 5KYXA 4P9TA 2A6HF 1O87A 4MS2A 1JPNA 3C8ZA 1NBBA 1XZPA 2GDCA 3ABLC 1TWAA 2KNHA 4OIPF 1JMWA 3UMHA 4DRHB 1XZQA 2XL6A 3U8PA 4AX2A 2XXAA 1U0BB 1T6UA 2W45A 2GFHA 2XM0A 5KYWB 1PD1A 1D0YA 1OW6A 1NFOA 1OCCC 3K66A 1CGME 4MVMA 2EPLX 2EPOA 4EIYA 1FMVA 1YZCA 4PACA 2YL0A 2JPUA 3S27A 3LS0A 3Q7GA 2BL2A 5EGYA 3AGTA 4PFPA 4CS9A 3FAJA 2Y69C 4XLPF 3AG2C 3PHF2 1Q0KA 2L9JA 2J9UA 3K1IC 4U5GA 1U6HA 5B3IA 2R7TA 1MNDA 2LFFA 3H2UA 4EHPA 2O9XA 3K6BA 1HW1A 1MMGA 3U3BA 4CJGA 1HY5A 4CJOA 5BQHA 5L0CA 4MVUA 2XRHA 2LQGA 3AQBA 5JSLA 3U2MA 5COFA 1MQVA 4BJ1A 5L0DA 3RQFA 4A2NB 4XEVA 4JTCB 2VASA 2CCYA 3FVYA 2YRFA 3LLIA 5HSWA 1OR3A 4CDAA 2OOCA 3Q7LA 5KYUA 4Q4ZF 1EA8A 1RKEB 1TFKB 4OD4A 3DD7A 1SMYF 2IOQA 2P1AA 2R05A 3O10A 3HTKC 4O6NA 3HNKA 3WG7C 4YL0A 2HS5A 4EKWA 1KTMA 3ECSA 3UMIA 2R7UA 5JP7A 1LE2A 3HNIA 3EGDA 3IQ5A 1MMNA 3RFYA 4E7ZA 1ZHZA 3QZCA 3GEHA 1VB5A 5DVWA 1QKRA 3EG9B 3I4UA 4Z9JA 3RQGA 3SXYA 3KKBA 2I8BA 2EINC 3N24A 3GM3A 2R7WA 3LEOA 1BR4A 5D92A 3T6JA 3ASOC 2YWAA 3EQLF 5AC5A 5JVEA 4MVRA 4P9FA 4MQ9F 1DOWA 4XWJA 5L0JA 1T9KA 3BEHA 3NYMA 3W4YA 4WJ0A 1Z6AA 3S29A 3NYLA 3IPMO 4JC7A 4XPYA 2WL8A 3GM1A 4GQHA 4H54A 3JSEO 1H9GA 3AG4C 5KYWA 2YHSA 3HJCA 2FFHA 3I5QA 1ZYRF 3RYLA 1RJ9B 2DB4A 4OD5A 4BJ6C 2YLDA 3IQCA 3ZG1A 1LE4A 2AP3A 1NSGB 1SZIA 4YT2A 1JAFA 3VAYA 2PX0A 4DVYP 1L3PA 2CDQA 1WGWA 2D5RB 3NMIA 3RW0A 2H7OA 3W2VA 2A0UA 2CNWA 1BR1A 1YLMA 2CGEA 2IXNA 1Z23A 4O6MA 1FR0A 4J30B 4AE4B 1YDIA 3T6GB 4E7SA 4JEAA 4YN0B 1TWHA 3M4CA 3U5SA 2Q00A 1CPQA 1OXKA 2G62A 2DI3A 4OIOF 3T9OA 2XLHA 3JYHA 1ZU5A 3NG1A 1O3UA 1D1CA 3EH1A 4LERA 2KYHA 1HW2A 3GODA 3M15A 4G78A 4DRJB 5DS4A 4IRUA 2Q3TA 4MTGA 2IXOA 2A68F 2MYSA 3EH2A 1A7VA 3B71A 4U5FE 1GM5A 4OIQF 2NUPB 2WVOA 1ZVZA 3QVYA 5KYNA 1RKEA 3B0UX 1C03A 2L6GA 4RBNA 3R7CA 1YA7O 1F1MA 1ORSC 3W8IA 4JIOA 4L6RA 1YVIA 4ULVA 1K04A 3DJUB 3EZIA 4MW8A 3V5YA 1WTYA 3FMSA 3WHNA 3HNJA 1Y6DA 2V3CC 3TOLA 4Q5SF 3LNMB 4G7ZF 3POVA 3EG9A 4P6IC 2ASRA 1ZHTA 2TMVP 3H2VA 3DWWA 3B0VC 3SP1A 4ANJA 3HKKA 1PD0A 2KC3A 3DAGA 3EJNA 3GWLA 1OCOC 1J8YF 3NKEA 4GEHA 4XPWA 2A6EF 3DKAA 4YT5A 2EPMX 3B0PA 2H8AA 1TKNA 1FFHA 3DZAA 2X0CA 2YLIA 5KYYA 1NU7D 1IW7F 3WODF 1KU2A 2XL8A 4YK5A 3W2WA 4Z9IA 5A6BD 1KNYA 1ZW3A 3L8JA 3A9CA 4FESA 1E84A 3DM9B 1CGOA 1QSPA 3EFOB 3KYIA 3RVZA 3ZQVA 3NRHA 3C8GA 1OW7A 1Z7Qc 4PFOA 3B9QA 3FDQA 2GWWA 1E85A 2QLAA 1OW8A 1HMOA 1RJ9A 2J45A 3FXHA 3G4XA 3OWTA 4NTFA 5EK0A 5T3TA 5F5HA 3VRCA 5T3WA 5DQZA 2ZXWC 1JOGA 5L0GA 1DOVA 3LUTB 4PJLA 4KNWA 256BA 5B1AC 1CGNA 2Y3GA 1O5HA 1JR8A 4JZAA 2NSGA 2YL3A 3L34A 1U89A 2YQYA 5JUAA 1YYJA 4MTFA 4AE4A 3SEOA 5BQIA 4U5BE 3U2LA 1AUEA 4EWCA 1FAPB 3U8VA 3GWNA 4BJ5C 5F28E 5HV9A 4Q7CA 2PNOA 4DJ9A 3L1MA 2NPUA 1FTSA 2RSEB 3LESA 4G7OF 3JYYA 3QTHA 2V26A 3K1IA 4NTAA 2HUJA 2AU5A 2G3KA 2HV7A 2R7RA 3LS1A 3TQOA 2KGOA 5T1DB 1ZHWA 3ZSUA 2HV6A 2NUPA 1EKYA 4YL3A 4D4NA 4MVOA 1M2VB 3V5ZA 3U3FA 4N4WA 4HEAJ 5BQGA 2LD6A 4WABA 4WGZA 4JVSA 1WN0A 4NY3A 1HMDA 1G8XA 3KH2A 3ZQYA 4E0IA 4JEBA
chains in the Genus database with same CATH topology
3M79A 1GQAA 2J9BA 3M4BA 3FOPA 4JE9A 1QQ3A 4NC3A 4CDVA 2YLDA 3ZTZA 1M6TA 4IB4A 1JAFA 3DE9A 2XLEA 3NMIA 1APCA 1CPRA 2XM4A 4U9DA 4JEAA 2YL1A 1QPUA 3M4CA 1CPQA 2XLOA 2XLHA 3M15A 4N6HA 2YL7A 5JT4A 1BBHA 4WGYA 4D4XA 3IQ6A 4IAQA 1A7VA 1RCPA 3QVYA 3C63A 3QW1A 2XLVA 3ZTMA 1NBBA 4L6RA 4ULVA 3QVZA 1YYXA 3HNJA 3TOLA 2XL6A 3C62A 3U8PA 3NMJA 2XLMA 2XM0A 4IARA 4EIYA 1YZCA 2YL0A 2YLIA 2YKZA 5JRAA 2XL8A 5B3IA 1E83A 2XLWA 1E84A 1E86A 1CGOA 3QW0A 3ZQVA 4CJOA 4CX9A 4CJGA 2BC5A 5JSLA 3HNLA 2QLAA 1E85A 1MQVA 3TOMA 5JS5A 3VRCA 1YZAA 2YLGA 2XLDA 2CCYA 256BA 1CGNA 2YL3A 4CDAA 5JUAA 4ER9A 2J8WA 4CIPA 1YYJA 3HNKA 1LM3B 1S05A 3DE8A 4CDYA 5JP7A 3HNIA 3L1MA 3IQ5A 3NMKA 4JKVA 5AGFA 3FOOA 3ZWIA 1EKYA 4D4NA 5JLIA 5JVEA 4N4WA 4WGZA 4U9EA 3ZQYA 4JEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M79 A;  1GQA A;  2J9B A;  3M4B A;  3FOP A;  4JE9 A;  1QQ3 A;  4NC3 A;  4CDV A;  2YLD A;  3ZTZ A;  1M6T A;  4IB4 A;  1JAF A;  3DE9 A;  2XLE A;  3NMI A;  1APC A;  1CPR A;  2XM4 A;  4U9D A;  4JEA A;  2YL1 A;  1QPU A;  3M4C A;  1CPQ A;  2XLO A;  2XLH A;  3M15 A;  4N6H A;  2YL7 A;  5JT4 A;  1BBH A;  4WGY A;  4D4X A;  3IQ6 A;  4IAQ A;  1A7V A;  1RCP A;  3QVY A;  3C63 A;  3QW1 A;  2XLV A;  3ZTM A;  1NBB A;  4L6R A;  4ULV A;  3QVZ A;  1YYX A;  3HNJ A;  3TOL A;  2XL6 A;  3C62 A;  3U8P A;  3NMJ A;  2XLM A;  2XM0 A;  4IAR A;  4EIY A;  1YZC A;  2YL0 A;  2YLI A;  2YKZ A;  5JRA A;  2XL8 A;  5B3I A;  1E83 A;  2XLW A;  1E84 A;  1E86 A;  1CGO A;  3QW0 A;  3ZQV A;  4CJO A;  4CX9 A;  4CJG A;  2BC5 A;  5JSL A;  3HNL A;  2QLA A;  1E85 A;  1MQV A;  3TOM A;  5JS5 A;  3VRC A;  1YZA A;  2YLG A;  2XLD A;  2CCY A;  256B A;  1CGN A;  2YL3 A;  4CDA A;  5JUA A;  4ER9 A;  2J8W A;  4CIP A;  1YYJ A;  3HNK A;  1LM3 B;  1S05 A;  3DE8 A;  4CDY A;  5JP7 A;  3HNI A;  3L1M A;  3IQ5 A;  3NMK A;  4JKV A;  5AGF A;  3FOO A;  3ZWI A;  1EKY A;  4D4N A;  5JLI A;  5JVE A;  4N4W A;  4WGZ A;  4U9E A;  3ZQY A;  4JEB A; 
#chains in the Genus database with same CATH topology
 4YL1 A;  2KQ9 A;  3SXZ A;  1D0X A;  3ATP A;  1YA9 A;  3S0X A;  1GQA A;  1R4T A;  3N0T A;  1UFB A;  3LLK A;  3SXM A;  3T6B A;  2W4M A;  4NQF A;  2R7O A;  3MLG A;  1L7C A;  3FOP A;  3JRM O;  1LI7 A;  1QZX A;  1QQ3 A;  2DYS C;  1I4Y A;  3ITF A;  1T6Q A;  4I44 A;  4O79 A;  1A41 A;  2LK4 A;  2HJM A;  3GAN A;  1NZE A;  4LDR A;  3ZTZ A;  1Z63 A;  5E33 A;  3PMR A;  3JTL O;  5TJ5 E;  1RMV A;  5CI8 A;  3TJ6 A;  4C7O B;  2XLE A;  2OJE D;  3MX3 A;  1ORJ A;  3U9M A;  3TUL A;  1APC A;  4XEK A;  3ZDL A;  1M56 C;  4EBJ A;  3ZIB A;  2OCC C;  3S84 A;  4U9D A;  4OIN F;  3AQC A;  3EFO A;  2Q9A A;  2CW0 F;  1A7E A;  1W2W A;  3X2Q C;  3F46 A;  2R7X A;  1Q0G A;  3EGX B;  2XLO A;  1BR2 A;  2XS1 A;  4JTA B;  4G0H A;  1D0Z A;  5CIV A;  4B6I A;  3G50 A;  1PCX A;  2LIG A;  1S7Z A;  2IBF A;  1TWC A;  2L81 A;  3ABK C;  3Q6M A;  2YL7 A;  4KBL A;  4N6H A;  4C3E A;  2Q4F A;  4WGY A;  4YJW A;  2HMQ A;  1TWG A;  1OXB A;  3V7O A;  2L7A A;  2A69 F;  2YEV A;  1OCZ C;  1ZHX A;  3MYI A;  4NCQ A;  4C3D A;  4U5D E;  2ETS A;  2NG1 A;  3S90 A;  1RXQ A;  3KMI A;  4ZLD A;  2JX0 A;  2IXP A;  2XLV A;  4BJ6 A;  1EQ1 A;  4QI0 A;  3GM2 A;  2B0H A;  3RKO F;  1WOL A;  4JUR I;  4BJT A;  2LP4 A;  1XWJ A;  2PBE A;  1WWP A;  3DM5 A;  3DMD A;  1Q0M A;  4I3M A;  2EPK X;  2HKV A;  3QVZ A;  4LLE A;  1V55 C;  3TJ5 A;  3VM6 A;  3S28 A;  4F4B A;  5FCL A;  2ZPA A;  1YJG A;  2QNL A;  4CSA C;  3C62 A;  2R03 A;  2Z15 A;  3NMJ A;  3EHM A;  2XLM A;  4IAR A;  2DGJ A;  2OJQ A;  1ZW2 A;  5E2Q A;  2L6F A;  1Q0F A;  2QTV A;  3AGU A;  5DS5 A;  3TK0 A;  2HZ8 A;  1HE9 A;  4EBB A;  3DJN B;  3AJM A;  1BDJ B;  1SYQ A;  3SZR A;  3ZVR A;  1B68 A;  1M2V A;  2HMZ A;  5B3S C;  2D4U A;  2IXM A;  1GGQ A;  1J8M F;  3EHN A;  4MVS A;  3TD7 A;  3C18 A;  3JRT A;  2P6V A;  2GAQ A;  2XXA B;  2R25 A;  2XLW A;  1T01 A;  3WAQ A;  4PK4 A;  3NKD A;  3OA1 A;  3ABM C;  2Y3D A;  3QW0 A;  4LDQ A;  4R32 A;  4XEF A;  3S9O A;  5K0I A;  5L0H A;  1H6G A;  2J46 A;  3A11 A;  4CX9 A;  3F47 A;  4K0D A;  2BC5 A;  4JRZ A;  3HNL A;  3JCU Q;  1MNE A;  2BE5 F;  3B29 A;  3PCV A;  1OKK A;  2CNW D;  2P0N A;  2YZS A;  2J7P A;  3IEE A;  3TOM A;  3UNG C;  5A6K A;  5AC4 A;  2YLG A;  1I5N A;  2Y3B A;  3JZ0 A;  3GEI A;  4Z9H A;  5L0I A;  1IZM A;  4C7O A;  1NG1 A;  2VCB A;  1HE1 A;  1N1C A;  2QUP A;  1Q0D A;  4IJJ A;  1G4W R;  4JJG A;  2H7B A;  2XL4 A;  4ER9 A;  4CIP A;  4QDL A;  2X51 A;  2ZXP A;  5E3A A;  3C7J A;  2LSE A;  3LEV A;  5COG A;  3LJB A;  3UGP A;  2J9W A;  1FNT c;  5EHH A;  5FZT A;  3L0I A;  1S05 A;  2PFD A;  3DE8 A;  2KJG A;  2IYL D;  4HE8 D;  2UUI A;  4UDV A;  5DQT A;  3JSZ A;  2NUT B;  1UG7 A;  1M57 C;  2OEV A;  1MMA A;  3NMK A;  1OR2 A;  2AWC A;  2B0J A;  4DBR A;  4JKV A;  3K33 A;  4JTD B;  5AGF A;  1G5Z A;  3FOO A;  4RDA A;  1WAS A;  2LCH A;  1WAT A;  2I15 A;  2FAP B;  3MFN A;  1K40 A;  4O6Y A;  2OG2 A;  4N6C A;  4W8P A;  4CS8 C;  3RVY A;  2E87 A;  1OQC A;  3M79 A;  3RH3 A;  2C04 A;  3FAP B;  1QVX A;  4HFK B;  4AL0 A;  3L8I A;  2OU6 A;  5A6A A;  1TFO B;  4FX5 A;  3CSK A;  1C02 A;  4G7H F;  1LPE A;  4J7Y A;  1NU9 C;  5BUO A;  3J06 A;  4LAC B;  4MVZ A;  1Z5Z A;  1K05 A;  3SYN A;  3ZC4 A;  4IB4 A;  4BJ5 A;  3HLZ A;  4MW3 A;  3DE9 A;  1VYI A;  2XSE A;  2VCA A;  1Y4C A;  2PX3 A;  3AG1 C;  4XTK A;  3RF3 A;  1SR2 A;  3C8G D;  1C17 M;  2KW3 C;  4CIH A;  1CPR A;  1BZ4 A;  4U5H A;  1ZU4 A;  1ST6 A;  2EIK C;  3EPV A;  4CBE A;  4E0H A;  4XPX A;  2P7V A;  1QPU A;  2J9V A;  4PJJ A;  1JRA A;  3AG3 C;  1H9T A;  4XLN F;  3O6X A;  4CS9 C;  4ONS A;  1TR2 A;  3H65 A;  3UMK A;  5A6J A;  3GEE A;  2HSB A;  4JW1 A;  5JT4 A;  1NLX A;  4QI2 A;  3K1H A;  3SXK A;  4D4X A;  1D1B A;  1Z3I X;  3VYW A;  4IAQ A;  2KSF A;  5B1B C;  1YAU O;  4JCZ A;  2ICW G;  4HFF B;  1RCP A;  1AVO B;  2YVK A;  2Q9B A;  4EBK A;  1T6I A;  1JPJ A;  1PV3 A;  3O55 A;  3LNR A;  5CI9 A;  5E3C A;  1LS1 A;  2M4E A;  2WB7 A;  4OIR F;  3RQE A;  1LVK A;  1M2O A;  4AL1 A;  3PDM P;  2OKU A;  3LAY A;  3VF0 A;  2IM8 A;  3KPH A;  5A69 A;  3U0C A;  4AK9 A;  1YYX A;  3KYJ A;  4LDK A;  4RD9 A;  4BPM A;  4IWB A;  4KC9 A;  5COM A;  1R5I D;  2NUT A;  2HJ3 A;  3W8H A;  2PP4 A;  4O7G A;  2PF4 E;  4DOZ A;  4XQ1 A;  3SNH A;  2WVN A;  4JCH A;  1FFT C;  2Y3H A;  3M1C B;  2P61 A;  3US6 A;  4DVZ A;  1VOM A;  4KNV A;  4BG0 A;  5GPG B;  4GYT A;  2W4B A;  3NDB B;  3IQT A;  4U5C E;  4J32 B;  2YKZ A;  5JRA A;  2EIL C;  3N2Z B;  2A1D D;  2KK1 A;  2W9Y A;  3AOU A;  2VB6 A;  4CS7 A;  2R7V A;  2CYD A;  4YWQ A;  2HFI A;  1E83 A;  2QE9 A;  1E86 A;  3CQZ A;  2VH3 A;  1V4A A;  3QMK A;  4U5E E;  3RIP A;  3R2P A;  2ZD9 A;  4JJF A;  2HSQ A;  1D1A A;  4BEJ A;  5JS5 A;  1VK5 A;  1YZA A;  2Q9C A;  2XS8 A;  5KYY B;  5DS6 A;  3BRJ A;  3CAX A;  5L3V A;  2VCC A;  2XLD A;  3K7D A;  1VMA A;  1MMD A;  3Q6N A;  2JD3 A;  3DXJ F;  4CSA A;  1VYK A;  1I4Z A;  2OEX A;  3IHU A;  4DXW A;  4MND A;  4X0R A;  2J8W A;  2EIJ C;  1FMW A;  5KYX B;  3C8G B;  4IGG A;  2H7V C;  1SF8 A;  4EUK B;  2L6H A;  1LM3 B;  2AVK A;  2R9R B;  4PR9 A;  4MVQ A;  4CDY A;  2MWQ A;  2ZXO A;  4KI2 A;  3ASN C;  2Q7R A;  1ZHY A;  3FHD A;  4YT8 A;  3I5P A;  3UR3 C;  2ZXR A;  3MYF A;  1OCR C;  4ZLC A;  3G4Z A;  4DBQ A;  2M64 A;  1E2X A;  1VLS A;  1QLE C;  2RD9 A;  4U9E A;  1LS4 A;  1A0B A;  3E70 C;  4MTO A;  1H7I A;  3ZWI A;  2G3V A;  5JLI A;  3DAF A;  1EI7 A;  2AWY A;  1VTM P;  1VLT A;  2J0X A;  4FAP B;  1NFN A;  4M63 A;  3CZ6 A;  5L0F A;  4E17 A;  4ULW A;  3CEX A;  4E18 A;  2OQM A;  1V74 B;  2WZF A;  4PJM A;  5L3Q A;  2J9B A;  4LLC A;  3M4B A;  1AEP A;  2J0W A;  1YAR O;  2FGY A;  4JE9 A;  4K7B A;  5A6B A;  4NC3 A;  5DLJ A;  5IY5 C;  4PJN A;  4CDV A;  1ORY A;  1TQG A;  2EIM C;  2UUH A;  3DI5 A;  3EGX A;  3X1O A;  2GA0 A;  1M6T A;  1T5O A;  1V54 C;  1G4U S;  2WVQ A;  1GS9 A;  2R02 A;  2LFD A;  2R7S A;  2EPN A;  3MBG A;  3O39 A;  1RKC A;  4IAO A;  5KYU B;  3OEO A;  2XM4 A;  4C3B A;  3E9V A;  2WZL A;  2QY9 A;  1ZZP A;  1OKK D;  1LKX A;  4K1O A;  4FWV A;  2J7P D;  2VC9 A;  1LI5 A;  1LIH A;  2R7Q A;  2YL1 A;  4NTB A;  3GOR A;  3U9J A;  4DRI B;  4CS8 A;  3EGD B;  2A0B A;  3V5X A;  2Y39 A;  4I1M A;  3NYJ A;  2WZG A;  4YT4 A;  4H4K C;  5F5F A;  1BBH A;  2NSF A;  4N06 A;  2C03 A;  2DYR C;  3JT1 A;  4BEM J;  3IQ6 A;  4J7T A;  3UGO A;  3KL4 A;  5D91 A;  4A4A A;  2F22 A;  3EZH A;  2MHR A;  3C63 A;  4I1O B;  1A7D A;  3QW1 A;  4W8K A;  3T4R A;  3ZTM A;  5KYX A;  4P9T A;  2A6H F;  1O87 A;  4MS2 A;  1JPN A;  3C8Z A;  1NBB A;  1XZP A;  2GDC A;  3ABL C;  1TWA A;  2KNH A;  4OIP F;  1JMW A;  3UMH A;  4DRH B;  1XZQ A;  2XL6 A;  3U8P A;  4AX2 A;  2XXA A;  1U0B B;  1T6U A;  2W45 A;  2GFH A;  2XM0 A;  5KYW B;  1PD1 A;  1D0Y A;  1OW6 A;  1NFO A;  1OCC C;  3K66 A;  1CGM E;  4MVM A;  2EPL X;  2EPO A;  4EIY A;  1FMV A;  1YZC A;  4PAC A;  2YL0 A;  2JPU A;  3S27 A;  3LS0 A;  3Q7G A;  2BL2 A;  5EGY A;  3AGT A;  4PFP A;  4CS9 A;  3FAJ A;  2Y69 C;  4XLP F;  3AG2 C;  3PHF 2;  1Q0K A;  2L9J A;  2J9U A;  3K1I C;  4U5G A;  1U6H A;  5B3I A;  2R7T A;  1MND A;  2LFF A;  3H2U A;  4EHP A;  2O9X A;  3K6B A;  1HW1 A;  1MMG A;  3U3B A;  4CJG A;  1HY5 A;  4CJO A;  5BQH A;  5L0C A;  4MVU A;  2XRH A;  2LQG A;  3AQB A;  5JSL A;  3U2M A;  5COF A;  1MQV A;  4BJ1 A;  5L0D A;  3RQF A;  4A2N B;  4XEV A;  4JTC B;  2VAS A;  2CCY A;  3FVY A;  2YRF A;  3LLI A;  5HSW A;  1OR3 A;  4CDA A;  2OOC A;  3Q7L A;  5KYU A;  4Q4Z F;  1EA8 A;  1RKE B;  1TFK B;  4OD4 A;  3DD7 A;  1SMY F;  2IOQ A;  2P1A A;  2R05 A;  3O10 A;  3HTK C;  4O6N A;  3HNK A;  3WG7 C;  4YL0 A;  2HS5 A;  4EKW A;  1KTM A;  3ECS A;  3UMI A;  2R7U A;  5JP7 A;  1LE2 A;  3HNI A;  3EGD A;  3IQ5 A;  1MMN A;  3RFY A;  4E7Z A;  1ZHZ A;  3QZC A;  3GEH A;  1VB5 A;  5DVW A;  1QKR A;  3EG9 B;  3I4U A;  4Z9J A;  3RQG A;  3SXY A;  3KKB A;  2I8B A;  2EIN C;  3N24 A;  3GM3 A;  2R7W A;  3LEO A;  1BR4 A;  5D92 A;  3T6J A;  3ASO C;  2YWA A;  3EQL F;  5AC5 A;  5JVE A;  4MVR A;  4P9F A;  4MQ9 F;  1DOW A;  4XWJ A;  5L0J A;  1T9K A;  3BEH A;  3NYM A;  3W4Y A;  4WJ0 A;  1Z6A A;  3S29 A;  3NYL A;  3IPM O;  4JC7 A;  4XPY A;  2WL8 A;  3GM1 A;  4GQH A;  4H54 A;  3JSE O;  1H9G A;  3AG4 C;  5KYW A;  2YHS A;  3HJC A;  2FFH A;  3I5Q A;  1ZYR F;  3RYL A;  1RJ9 B;  2DB4 A;  4OD5 A;  4BJ6 C;  2YLD A;  3IQC A;  3ZG1 A;  1LE4 A;  2AP3 A;  1NSG B;  1SZI A;  4YT2 A;  1JAF A;  3VAY A;  2PX0 A;  4DVY P;  1L3P A;  2CDQ A;  1WGW A;  2D5R B;  3NMI A;  3RW0 A;  2H7O A;  3W2V A;  2A0U A;  2CNW A;  1BR1 A;  1YLM A;  2CGE A;  2IXN A;  1Z23 A;  4O6M A;  1FR0 A;  4J30 B;  4AE4 B;  1YDI A;  3T6G B;  4E7S A;  4JEA A;  4YN0 B;  1TWH A;  3M4C A;  3U5S A;  2Q00 A;  1CPQ A;  1OXK A;  2G62 A;  2DI3 A;  4OIO F;  3T9O A;  2XLH A;  3JYH A;  1ZU5 A;  3NG1 A;  1O3U A;  1D1C A;  3EH1 A;  4LER A;  2KYH A;  1HW2 A;  3GOD A;  3M15 A;  4G78 A;  4DRJ B;  5DS4 A;  4IRU A;  2Q3T A;  4MTG A;  2IXO A;  2A68 F;  2MYS A;  3EH2 A;  1A7V A;  3B71 A;  4U5F E;  1GM5 A;  4OIQ F;  2NUP B;  2WVO A;  1ZVZ A;  3QVY A;  5KYN A;  1RKE A;  3B0U X;  1C03 A;  2L6G A;  4RBN A;  3R7C A;  1YA7 O;  1F1M A;  1ORS C;  3W8I A;  4JIO A;  4L6R A;  1YVI A;  4ULV A;  1K04 A;  3DJU B;  3EZI A;  4MW8 A;  3V5Y A;  1WTY A;  3FMS A;  3WHN A;  3HNJ A;  1Y6D A;  2V3C C;  3TOL A;  4Q5S F;  3LNM B;  4G7Z F;  3POV A;  3EG9 A;  4P6I C;  2ASR A;  1ZHT A;  2TMV P;  3H2V A;  3DWW A;  3B0V C;  3SP1 A;  4ANJ A;  3HKK A;  1PD0 A;  2KC3 A;  3DAG A;  3EJN A;  3GWL A;  1OCO C;  1J8Y F;  3NKE A;  4GEH A;  4XPW A;  2A6E F;  3DKA A;  4YT5 A;  2EPM X;  3B0P A;  2H8A A;  1TKN A;  1FFH A;  3DZA A;  2X0C A;  2YLI A;  5KYY A;  1NU7 D;  1IW7 F;  3WOD F;  1KU2 A;  2XL8 A;  4YK5 A;  3W2W A;  4Z9I A;  5A6B D;  1KNY A;  1ZW3 A;  3L8J A;  3A9C A;  4FES A;  1E84 A;  3DM9 B;  1CGO A;  1QSP A;  3EFO B;  3KYI A;  3RVZ A;  3ZQV A;  3NRH A;  3C8G A;  1OW7 A;  1Z7Q c;  4PFO A;  3B9Q A;  3FDQ A;  2GWW A;  1E85 A;  2QLA A;  1OW8 A;  1HMO A;  1RJ9 A;  2J45 A;  3FXH A;  3G4X A;  3OWT A;  4NTF A;  5EK0 A;  5T3T A;  5F5H A;  3VRC A;  5T3W A;  5DQZ A;  2ZXW C;  1JOG A;  5L0G A;  1DOV A;  3LUT B;  4PJL A;  4KNW A;  256B A;  5B1A C;  1CGN A;  2Y3G A;  1O5H A;  1JR8 A;  4JZA A;  2NSG A;  2YL3 A;  3L34 A;  1U89 A;  2YQY A;  5JUA A;  1YYJ A;  4MTF A;  4AE4 A;  3SEO A;  5BQI A;  4U5B E;  3U2L A;  1AUE A;  4EWC A;  1FAP B;  3U8V A;  3GWN A;  4BJ5 C;  5F28 E;  5HV9 A;  4Q7C A;  2PNO A;  4DJ9 A;  3L1M A;  2NPU A;  1FTS A;  2RSE B;  3LES A;  4G7O F;  3JYY A;  3QTH A;  2V26 A;  3K1I A;  4NTA A;  2HUJ A;  2AU5 A;  2G3K A;  2HV7 A;  2R7R A;  3LS1 A;  3TQO A;  2KGO A;  5T1D B;  1ZHW A;  3ZSU A;  2HV6 A;  2NUP A;  1EKY A;  4YL3 A;  4D4N A;  4MVO A;  1M2V B;  3V5Z A;  3U3F A;  4N4W A;  4HEA J;  5BQG A;  2LD6 A;  4WAB A;  4WGZ A;  4JVS A;  1WN0 A;  4NY3 A;  1HMD A;  1G8X A;  3KH2 A;  3ZQY A;  4E0I A;  4JEB A; 
#chains in the Genus database with same CATH homology
 3M79 A;  1GQA A;  2J9B A;  3M4B A;  3FOP A;  4JE9 A;  1QQ3 A;  4NC3 A;  4CDV A;  2YLD A;  3ZTZ A;  1M6T A;  4IB4 A;  1JAF A;  3DE9 A;  2XLE A;  3NMI A;  1APC A;  1CPR A;  2XM4 A;  4U9D A;  4JEA A;  2YL1 A;  1QPU A;  3M4C A;  1CPQ A;  2XLO A;  2XLH A;  3M15 A;  4N6H A;  2YL7 A;  5JT4 A;  1BBH A;  4WGY A;  4D4X A;  3IQ6 A;  4IAQ A;  1A7V A;  1RCP A;  3QVY A;  3C63 A;  3QW1 A;  2XLV A;  3ZTM A;  1NBB A;  4L6R A;  4ULV A;  3QVZ A;  1YYX A;  3HNJ A;  3TOL A;  2XL6 A;  3C62 A;  3U8P A;  3NMJ A;  2XLM A;  2XM0 A;  4IAR A;  4EIY A;  1YZC A;  2YL0 A;  2YLI A;  2YKZ A;  5JRA A;  2XL8 A;  5B3I A;  1E83 A;  2XLW A;  1E84 A;  1E86 A;  1CGO A;  3QW0 A;  3ZQV A;  4CJO A;  4CX9 A;  4CJG A;  2BC5 A;  5JSL A;  3HNL A;  2QLA A;  1E85 A;  1MQV A;  3TOM A;  5JS5 A;  3VRC A;  1YZA A;  2YLG A;  2XLD A;  2CCY A;  256B A;  1CGN A;  2YL3 A;  4CDA A;  5JUA A;  4ER9 A;  2J8W A;  4CIP A;  1YYJ A;  3HNK A;  1LM3 B;  1S05 A;  3DE8 A;  4CDY A;  5JP7 A;  3HNI A;  3L1M A;  3IQ5 A;  3NMK A;  4JKV A;  5AGF A;  3FOO A;  3ZWI A;  1EKY A;  4D4N A;  5JLI A;  5JVE A;  4N4W A;  4WGZ A;  4U9E A;  3ZQY A;  4JEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...