2CCYA

Structure of ferricytochrome c(prime) from rhodospirillum molischianum at 1.67 angstroms resolution
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
127
structure length
127
Chain Sequence
b'QSKPEDLLKLRQGLMQTLKSQWVPIAGFAAGKADLPADAAQRAENMAMVAKLAPIGWAKGTEALPNGETKPEAFGSKSAEFLEGWKALATESTKLAAAAKAGPDALKAQAAATGKVCKACHEEFKQD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C
molecule tags Electron transport (heme protein)
source organism Phaeospirillum molischianum
publication title Structure of ferricytochrome c' from Rhodospirillum molischianum at 1.67 A resolution.
pubmed doi rcsb
total genus 48
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 1985-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2ccyA00
5JRAA 5JLIA 3FOOA 1RCPA 4CDAA 3QW1A 1CPQA 2XLHA 2YL3A 5JVEA 2YLDA 4D4NA 1JAFA 3NMJA 3HNKA 4L6RA 4CX9A 3HNJA 5JUAA 2J8WA 2XM0A 2XLDA 3HNIA 3QVYA 3VRCA 3TOMA 1CGOA 3ZTMA 2YLGA 1APCA 4CJGA 2XL8A 2YLIA 3DE9A 4EIYA 5JT4A 256BA 5AGFA 1QQ3A 1E85A 3NMIA 3FOPA 1GQAA 1MQVA 3IQ5A 5JSLA 1LM3B 1A7VA 4N6HA 4WGYA 4D4XA 2XLVA 4CIPA 3QW0A 3ZQVA 4U9DA 2YL1A 1E84A 4IB4A 1BBHA 1NBBA 2XLOA 1CGNA 2XLEA 3C62A 5JS5A 5B3IA 3ZQYA 3M4BA 1E83A 1E86A 3L1MA 4IARA 3M4CA 2XLMA 4U9EA 2BC5A 4JEBA 1YZCA 1EKYA 1S05A 3TOLA 2QLAA 4WGZA 2YL7A 3ZTZA 4IAQA 4ULVA 4JEAA 3NMKA 4JE9A 2YL0A 2J9BA 4ER9A 3HNLA 4JKVA 2XM4A 2YKZA 4CDYA 2CCYA 3DE8A 3IQ6A 2XL6A 1QPUA 1YYXA 3C63A 4NC3A 3M79A 4N4WA 3M15A 3U8PA 5JP7A 4CDVA 3QVZA 4CJOA 3ZWIA 1YZAA 1M6TA 2XLWA 1CPRA 1YYJA
chains in the Genus database with same CATH superfamily
2NPUA 3K7DA 2G3KA 5JRAA 1RMVA 1VLTA 3ABMC 3C8GD 2R7RA 2X51A 4U5HA 3C8GB 1D1AA 2YL3A 2OOCA 2A6EF 2DI3A 1WOLA 3C8ZA 1Q0MA 4NTFA 4Z9IA 5AC5A 4KBLA 2XXAA 1AEPA 3RFYA 3L34A 4D4NA 4U5CE 2BL2A 3NMJA 2GA0A 5T3TA 1V54C 3LAYA 1Z7Qc 4E18A 3GEIA 2OEVA 4K1OA 2J8WA 4O6YA 1Z6AA 2XLDA 4MVRA 2WVQA 3WODF 4CSAA 3HNIA 1BZ4A 2HFIA 2LD6A 3VRCA 4MQ9F 2XS8A 3K1IC 1T6UA 2YLGA 2W9YA 1A7EA 2Q4FA 3RIPA 1GM5A 1V4AA 3EHMA 3GORA 1VOMA 4NY3A 3HJCA 4JVSA 256BA 3KMIA 5KYUA 1R5ID 4EKWA 4MVMA 5CI9A 4OD5A 1RJ9B 3EZIA 4G7OF 1WATA 1T01A 3C8GA 3SYNA 3IQ5A 3LUTB 1O3UA 2OQMA 4LDRA 1LM3B 3DMDA 5HSWA 2Y3DA 2Q00A 3T4RA 4CS9A 4N6HA 3B9QA 2ZXWC 3F46A 2GFHA 3MFNA 3Q6MA 4D4XA 3NKDA 4CIHA 1JPNA 1OR2A 2IXOA 2J9UA 2R7VA 5FCLA 5COGA 1NG1A 1OW7A 1YLMA 3AGUA 3FMSA 3K33A 3KH2A 3N2ZB 4KNWA 3ATPA 2PNOA 3ZQVA 3FVYA 2EPKX 1TQGA 2OCCC 3U2MA 3N0TA 1RKCA 4IB4A 4I1OB 1M2VA 2M64A 2XLOA 4XWJA 5CI8A 1VLSA 1M2VB 1ZU5A 2HV7A 1FNTc 3S9OA 5B3IA 2C04A 4ULWA 2WZLA 3M4BA 4U5EE 2AWCA 4U5BE 3TQOA 5D91A 3EG9A 2VB6A 1DOWA 4U5FE 3V7OA 2EINC 1D0XA 4PFOA 1NLXA 2C03A 2P61A 3BRJA 3T6BA 4U9EA 3SZRA 5A6JA 2BC5A 2YQYA 3O39A 3RKOF 3RVZA 1KTMA 2EPLX 2B0JA 3FHDA 3HTKC 3HKKA 3JYHA 2J0WA 3KYJA 2MHRA 2OU6A 3I5PA 1A0BA 1RJ9A 2XRHA 2ZXPA 2LFDA 3MYIA 1ZYRF 3JSZA 4EBJA 3I4UA 4ONSA 1ZU4A 4AE4A 2YL7A 2J9VA 4GEHA 1TWHA 4ZLCA 2NUPB 3LESA 2EIJC 5L3QA 3ECSA 1YARO 4JE9A 2YL0A 1M56C 2J0XA 4GQHA 4XPYA 5A6BA 1OQCA 4E7SA 3L0IA 1LE2A 3NDBB 2D4UA 2XM4A 3S28A 5A6AA 3DXJF 4CS9C 3H65A 2DGJA 2LFFA 4MVUA 5L0DA 3AOUA 3HLZA 1TR2A 1OR3A 1G8XA 3IPMO 1VYIA 1JR8A 5KYNA 3SXYA 3A11A 2ETSA 2KGOA 4FX5A 2F22A 4FAPB 4N4WA 3VM6A 3ABKC 4DJ9A 2RSEB 4JTDB 4XEVA 4DRIB 5KYXA 3I5QA 2GWWA 3CAXA 3ITFA 3SNHA 4CDVA 2X0CA 2A1DD 3LLIA 3LS0A 4X0RA 3ASNC 1HMDA 1HW2A 3S27A 4DBRA 2L6HA 5DS4A 2XLWA 3MLGA 1JMWA 1JRAA 2R7UA 1TFKB 5JLIA 4A2NB 3KL4A 1OCZC 5A6BD 3LLKA 1G4WR 2P6VA 4DVZA 3QW1A 3ZG1A 2A0BA 2YZSA 4LDKA 1Z23A 3S29A 4PJJA 4JRZA 2O9XA 3L8IA 4LLEA 4EBKA 1OXBA 3QZCA 1I5NA 3RF3A 4C7OA 2HSBA 4CX9A 3HNJA 2PX3A 2ICWG 1HE1A 1OCCC 2HSQA 3DM9B 5JUAA 4LDQA 3FDQA 1MNDA 1SMYF 4RBNA 2UUHA 4P9FA 3QVYA 4IJJA 1LVKA 1CGOA 2ZD9A 3UMIA 3ZTMA 4O79A 4HE8D 2Q3TA 4W8PA 5FZTA 2NUTA 1APCA 2PFDA 2R7SA 3DE9A 3WHNA 2HJ3A 5JT4A 1H9GA 4MW3A 4G7ZF 2AVKA 3W4YA 3W2VA 1K04A 1QQ3A 4MW8A 4JCHA 4CS8A 3S84A 2LK4A 3EFOB 1Q0GA 3U5SA 3KKBA 4XLPF 1HMOA 5HV9A 3NMIA 4FESA 4IGGA 3AGTA 4NCQA 3X2QC 3CQZA 4K7BA 2CYDA 1QZXA 3B0VC 3JCUQ 4XQ1A 2P7VA 2R25A 4HFFB 4N06A 3US6A 4YWQA 2AU5A 2P0NA 3R2PA 5A69A 2YVKA 2XLVA 2PP4A 1QSPA 1LS4A 2LCHA 1IZMA 5L0CA 2L81A 4JC7A 5L3VA 1Q0KA 3ABLC 4LACB 1FFTC 4OIPF 2H7BA 2OJQA 1M2OA 4PFPA 4QI0A 1S7ZA 3H2VA 4YJWA 1RKEA 4C7OB 4JJFA 3GM3A 2J46A 1GS9A 5F5FA 2R7WA 3G4ZA 4K0DA 4E0IA 3FAJA 4WJ0A 4C3EA 5JS5A 1ZHWA 3MX3A 1MNEA 4N6CA 4PJLA 3QTHA 1ZZPA 1LE4A 2WB7A 3L1MA 2KYHA 1QVXA 5KYXB 1EQ1A 2OEXA 1KNYA 1ST6A 1RXQA 1R4TA 1WASA 2I15A 2R05A 3IQCA 1ZW2A 2HKVA 4PR9A 4HFKB 3W8HA 3V5YA 4JEBA 1T9KA 2TMVP 4CSAC 2Y3BA 2NSFA 2QE9A 3U2LA 4Z9JA 3WAQA 1YAUO 1EKYA 4R32A 2VASA 4NQFA 4DRJB 1OKKD 4PK4A 3U8VA 5KYYA 3VAYA 2CDQA 4DVYP 2WVOA 1J8MF 5T3WA 3ZTZA 4UDVA 4YL0A 1FTSA 4CBEA 4XPWA 4BEJA 4IAQA 2A0UA 3JTLO 2DYSC 3TD7A 3UGOA 2LP4A 3PCVA 2CGEA 2LSEA 4H4KC 2J9BA 5F5HA 3UGPA 3HNLA 4ZLDA 2AP3A 3EH2A 1I4ZA 2JPUA 1XZQA 4BJ5C 2YKZA 3W2WA 4BG0A 4G78A 4CDYA 2IXPA 3EPVA 2CCYA 4MVQA 4AE4B 3N24A 4AL1A 3EGDA 2W4BA 4OIOF 3CZ6A 3E70C 3EJNA 2CNWD 1C03A 5BQHA 1PD0A 2J7PD 1YJGA 5DS6A 1QPUA 2R7OA 1CGME 1YYXA 5EGYA 2KK1A 3QMKA 1A7DA 3M15A 3POVA 3ZC4A 1UG7A 4Q5SF 2A69F 1BR1A 2YEVA 2ASRA 4MTGA 4QDLA 3RQGA 2BE5F 2L9JA 3MYFA 3QVZA 4MTOA 3RYLA 4J7YA 4CJOA 2NUTB 3TJ6A 1LS1A 1K05A 3SP1A 2G62A 2IYLD 3RQFA 1T6QA 4J32B 2NG1A 1CPRA 5IY5C 1MMDA 3RW0A 2EPNA 3UMHA 4B6IA 3ZVRA 1Z3IX 3FOOA 4QI2A 3ZIBA 1RCPA 3GM1A 3LS1A 5B1AC 4CDAA 3X1OA 1CPQA 3B71A 1B68A 3GM2A 1KU2A 4YT5A 1T6IA 5JVEA 3NYMA 3ASOC 2HMZA 2YLDA 2ZXRA 4LLCA 5D92A 1JAFA 3G4XA 1V74B 2JX0A 4I3MA 2Y3HA 2KW3C 4F4BA 2QUPA 3SEOA 4E7ZA 3PHF2 2OJED 4KNVA 5E3AA 2R03A 4IAOA 2XM0A 1VTMP 1HE9A 2ZPAA 1H7IA 2R7TA 3MBGA 3PMRA 4I44A 2QY9A 2Y39A 3IEEA 1TKNA 4Z9HA 5TJ5E 1LPEA 4JW1A 5KYUB 2HJMA 1AUEA 4O7GA 3NG1A 4CJGA 1K40A 4MS2A 2QNLA 1OKKA 2DB4A 3DD7A 3O10A 4P6IC 2YWAA 5AGFA 3LNMB 1E85A 1PCXA 2HZ8A 4JCZA 2KJGA 2YHSA 3FOPA 1GQAA 2UUIA 4Q7CA 1TWCA 4BJ1A 5BUOA 1NZEA 3NYJA 4CS7A 3S0XA 3DJNB 3SXKA 3F47A 1MMNA 3UNGC 3OWTA 1U0BB 1NU9C 2EIKC 3M1CB 1OW8A 2FGYA 2OKUA 1YVIA 2Q9CA 1WGWA 5L0IA 3UR3C 1Z63A 1FMVA 1L3PA 2PX0A 4DRHB 4C3DA 4XPXA 2VH3A 3G50A 3VF0A 4U9DA 1NU7D 2EILC 3UMKA 1E84A 1BBHA 1NBBA 2PBEA 4U5DE 1CGNA 3RQEA 1ZHXA 1LKXA 1QKRA 1E2XA 1RKEB 4OINF 5COMA 3H2UA 1AVOB 3DWWA 1XZPA 4DBQA 3L8JA 1C17M 3ZQYA 5E2QA 2RD9A 2R9RB 1E83A 1E86A 5E33A 3JRMO 4BPMA 4IARA 1IW7F 2XSEA 3EQLF 2XLMA 4G7HF 1VK5A 2Y69C 5T1DB 3CSKA 1SYQA 1OCRC 1YZCA 3U9MA 1WWPA 1ZHYA 2VCCA 4YN0B 1EA8A 1TWAA 2W4MA 3B29A 5DS5A 4AL0A 1A41A 2FFHA 4E0HA 1OXKA 1SR2A 3DAFA 4WGZA 4EUKB 1OW6A 3LJBA 3GEHA 3EZHA 5L0GA 4JJGA 1O5HA 3S90A 4M63A 4ULVA 4O6NA 4MVZA 2R7QA 2KNHA 2NUPA 4DOZA 1ZW3A 1BR4A 1TFOB 1Z5ZA 4OIQF 3RVYA 2IM8A 4JKVA 2CNWA 1Q0FA 3FAPB 4YL1A 4YK5A 2G3VA 3T6JA 4XLNF 3IHUA 4P9TA 1ZHTA 2XXAB 3GWNA 3T6GB 4BJTA 2JD3A 1XWJA 2L6GA 1WTYA 2VC9A 4EHPA 3E9VA 3GEEA 2VCAA 2Q9AA 1F1MA 2CW0F 1FAPB 1W2WA 1L7CA 5F28E 3LEVA 4AX2A 1NFNA 2AWYA 3OA1A 3C63A 4KI2A 1G4US 3M79A 4FWVA 1M57C 3U8PA 5JP7A 4WABA 1T5OA 4JZAA 2Q7RA 3TK0A 1N1CA 3K66A 2I8BA 4MNDA 3AQCA 3U3BA 1BDJB 4MVSA 4NTAA 3ZWIA 4J7TA 5CIVA 1YZAA 2IXMA 2Q9BA 3O6XA 1Y6DA 3GANA 3JT1A 5DVWA 2L7AA 2H8AA 1YYJA 1VYKA 3AG1C 4PJNA 3EFOA 5KYYB 3U3FA 2P1AA 3EGXA 2KSFA 1DOVA 2R02A 1VB5A 2V3CC 5L0HA 2XLHA 5L0FA 1C02A 4BJ5A 4JIOA 1D0YA 1PV3A 1I4YA 3WG7C 3NYLA 3TJ5A 2Z15A 2H7OA 3R7CA 1OCOC 3HNKA 5KYWB 3DI5A 1YA9A 4L6RA 4PACA 5KYWA 4XEKA 3LNRA 1SZIA 3B0UX 1H6GA 3DJUB 3U0CA 2YRFA 1TWGA 1JPJA 2EPOA 1YDIA 2Y3GA 3EGDB 3TOMA 4KC9A 2XL4A 3FXHA 4U5GA 1ORSC 2XL8A 2YLIA 4PJMA 4C3BA 4JTAB 4EIYA 3TULA 1O87A 3T9OA 2GAQA 1V55C 4O6MA 1D1CA 3V5XA 2E87A 5DQZA 4JTCB 2J9WA 3BEHA 4IWBA 1MMAA 3K6BA 2QTVA 4RDAA 1MQVA 1U89A 5E3CA 3JYYA 5JSLA 5BQGA 3SXMA 3V5ZA 5B3SC 3C18A 3LEOA 1A7VA 3PDMP 2MYSA 4EWCA 4WGYA 4GYTA 3K1IA 2WZFA 4CIPA 3QW0A 2A6HF 2IXNA 1UFBA 1SF8A 2L6FA 4MVOA 1J8YF 4Q4ZF 3EG9B 5BQIA 5EHHA 3J06A 1ORYA 3NRHA 2W45A 2YL1A 4YT2A 3GWLA 4OIRF 1FR0A 2A68F 2HS5A 2GDCA 4W8KA 5COFA 2EIMC 2H7VC 3CEXA 1QLEC 2OG2A 4I1MA 2XLEA 3C62A 1YA7O 3AG4C 3DZAA 1ORJA 1VMAA 1EI7A 1U6HA 2M4EA 3AJMA 3Q6NA 5AC4A 1BR2A 1FFHA 2IBFA 2LIGA 5EK0A 4EBBA 3KYIA 2MWQA 1ZVZA 3M4CA 4LERA 4OD4A 3SXZA 1NFOA 3U9JA 4CS8C 4YT8A 3AG3C 4XEFA 3EH1A 1WN0A 3EHNA 1LIHA 4XTKA 2V26A 4HEAJ 1NSGB 4H54A 5DLJA 1HW1A 3Q7LA 4J30B 2KC3A 4YL3A 4JURI 4E17A 5A6KA 1S05A 3TOLA 4BJ6C 1Q0DA 2IOQA 2QLAA 2PF4E 2J45A 1D1BA 3AQBA 2D5RB 3KPHA 2FAPB 3JSEO 1JOGA 4JEAA 3NMKA 2XS1A 3AG2C 3GODA 2WVNA 4ER9A 2EPMX 1G5ZA 2LQGA 3B0PA 3EGXB 3ZDLA 3Q7GA 1ZHZA 3OEOA 3A9CA 3DE8A 3IQ6A 5DQTA 1D0ZA 1GGQA 2DYRC 3K1HA 4BEMJ 3DKAA 4DXWA 5GPGB 2XL6A 1FMWA 1PD1A 2WZGA 4IRUA 4NTBA 3RH3A 2WL8A 3C7JA 3JRTA 4RD9A 2HV6A 2HUJA 2NSGA 3JZ0A 1LI5A 4MTFA 4NC3A 3DAGA 3W8IA 4A4AA 2KQ9A 5K0IA 2B0HA 4YT4A 3IQTA 3O55A 2R7XA 3VYWA 2ZXOA 5B1BC 1LI7A 4G0HA 5L0JA 1HY5A 4BJ6A 2VCBA 3DM5A 4ANJA 2HMQA 3ZSUA 1Y4CA 1M6TA 4AK9A 1H9TA 1MMGA 3NKEA 2J7PA
chains in the Genus database with same CATH topology
5JRAA 5JLIA 3FOOA 1RCPA 4CDAA 3QW1A 1CPQA 2XLHA 2YL3A 5JVEA 2YLDA 4D4NA 1JAFA 3NMJA 3HNKA 4L6RA 4CX9A 3HNJA 5JUAA 2J8WA 2XM0A 2XLDA 3HNIA 3QVYA 3VRCA 3TOMA 1CGOA 3ZTMA 2YLGA 1APCA 4CJGA 2XL8A 2YLIA 3DE9A 4EIYA 5JT4A 256BA 5AGFA 1QQ3A 1E85A 3NMIA 3FOPA 1GQAA 1MQVA 3IQ5A 5JSLA 1LM3B 1A7VA 4N6HA 4WGYA 4D4XA 2XLVA 4CIPA 3QW0A 3ZQVA 4U9DA 2YL1A 1E84A 4IB4A 1BBHA 1NBBA 2XLOA 1CGNA 2XLEA 3C62A 5JS5A 5B3IA 3ZQYA 3M4BA 1E83A 1E86A 3L1MA 4IARA 3M4CA 2XLMA 4U9EA 2BC5A 4JEBA 1YZCA 1EKYA 1S05A 3TOLA 2QLAA 4WGZA 2YL7A 3ZTZA 4IAQA 4ULVA 4JEAA 3NMKA 4JE9A 2YL0A 2J9BA 4ER9A 3HNLA 4JKVA 2XM4A 2YKZA 4CDYA 2CCYA 3DE8A 3IQ6A 2XL6A 1QPUA 1YYXA 3C63A 4NC3A 3M79A 4N4WA 3M15A 3U8PA 5JP7A 4CDVA 3QVZA 4CJOA 3ZWIA 1YZAA 1M6TA 2XLWA 1CPRA 1YYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JRA A;  5JLI A;  3FOO A;  1RCP A;  4CDA A;  3QW1 A;  1CPQ A;  2XLH A;  2YL3 A;  5JVE A;  2YLD A;  4D4N A;  1JAF A;  3NMJ A;  3HNK A;  4L6R A;  4CX9 A;  3HNJ A;  5JUA A;  2J8W A;  2XM0 A;  2XLD A;  3HNI A;  3QVY A;  3VRC A;  3TOM A;  1CGO A;  3ZTM A;  2YLG A;  1APC A;  4CJG A;  2XL8 A;  2YLI A;  3DE9 A;  4EIY A;  5JT4 A;  256B A;  5AGF A;  1QQ3 A;  1E85 A;  3NMI A;  3FOP A;  1GQA A;  1MQV A;  3IQ5 A;  5JSL A;  1LM3 B;  1A7V A;  4N6H A;  4WGY A;  4D4X A;  2XLV A;  4CIP A;  3QW0 A;  3ZQV A;  4U9D A;  2YL1 A;  1E84 A;  4IB4 A;  1BBH A;  1NBB A;  2XLO A;  1CGN A;  2XLE A;  3C62 A;  5JS5 A;  5B3I A;  3ZQY A;  3M4B A;  1E83 A;  1E86 A;  3L1M A;  4IAR A;  3M4C A;  2XLM A;  4U9E A;  2BC5 A;  4JEB A;  1YZC A;  1EKY A;  1S05 A;  3TOL A;  2QLA A;  4WGZ A;  2YL7 A;  3ZTZ A;  4IAQ A;  4ULV A;  4JEA A;  3NMK A;  4JE9 A;  2YL0 A;  2J9B A;  4ER9 A;  3HNL A;  4JKV A;  2XM4 A;  2YKZ A;  4CDY A;  2CCY A;  3DE8 A;  3IQ6 A;  2XL6 A;  1QPU A;  1YYX A;  3C63 A;  4NC3 A;  3M79 A;  4N4W A;  3M15 A;  3U8P A;  5JP7 A;  4CDV A;  3QVZ A;  4CJO A;  3ZWI A;  1YZA A;  1M6T A;  2XLW A;  1CPR A;  1YYJ A; 
#chains in the Genus database with same CATH topology
 2NPU A;  3K7D A;  2G3K A;  5JRA A;  1RMV A;  1VLT A;  3ABM C;  3C8G D;  2R7R A;  2X51 A;  4U5H A;  3C8G B;  1D1A A;  2YL3 A;  2OOC A;  2A6E F;  2DI3 A;  1WOL A;  3C8Z A;  1Q0M A;  4NTF A;  4Z9I A;  5AC5 A;  4KBL A;  2XXA A;  1AEP A;  3RFY A;  3L34 A;  4D4N A;  4U5C E;  2BL2 A;  3NMJ A;  2GA0 A;  5T3T A;  1V54 C;  3LAY A;  1Z7Q c;  4E18 A;  3GEI A;  2OEV A;  4K1O A;  2J8W A;  4O6Y A;  1Z6A A;  2XLD A;  4MVR A;  2WVQ A;  3WOD F;  4CSA A;  3HNI A;  1BZ4 A;  2HFI A;  2LD6 A;  3VRC A;  4MQ9 F;  2XS8 A;  3K1I C;  1T6U A;  2YLG A;  2W9Y A;  1A7E A;  2Q4F A;  3RIP A;  1GM5 A;  1V4A A;  3EHM A;  3GOR A;  1VOM A;  4NY3 A;  3HJC A;  4JVS A;  256B A;  3KMI A;  5KYU A;  1R5I D;  4EKW A;  4MVM A;  5CI9 A;  4OD5 A;  1RJ9 B;  3EZI A;  4G7O F;  1WAT A;  1T01 A;  3C8G A;  3SYN A;  3IQ5 A;  3LUT B;  1O3U A;  2OQM A;  4LDR A;  1LM3 B;  3DMD A;  5HSW A;  2Y3D A;  2Q00 A;  3T4R A;  4CS9 A;  4N6H A;  3B9Q A;  2ZXW C;  3F46 A;  2GFH A;  3MFN A;  3Q6M A;  4D4X A;  3NKD A;  4CIH A;  1JPN A;  1OR2 A;  2IXO A;  2J9U A;  2R7V A;  5FCL A;  5COG A;  1NG1 A;  1OW7 A;  1YLM A;  3AGU A;  3FMS A;  3K33 A;  3KH2 A;  3N2Z B;  4KNW A;  3ATP A;  2PNO A;  3ZQV A;  3FVY A;  2EPK X;  1TQG A;  2OCC C;  3U2M A;  3N0T A;  1RKC A;  4IB4 A;  4I1O B;  1M2V A;  2M64 A;  2XLO A;  4XWJ A;  5CI8 A;  1VLS A;  1M2V B;  1ZU5 A;  2HV7 A;  1FNT c;  3S9O A;  5B3I A;  2C04 A;  4ULW A;  2WZL A;  3M4B A;  4U5E E;  2AWC A;  4U5B E;  3TQO A;  5D91 A;  3EG9 A;  2VB6 A;  1DOW A;  4U5F E;  3V7O A;  2EIN C;  1D0X A;  4PFO A;  1NLX A;  2C03 A;  2P61 A;  3BRJ A;  3T6B A;  4U9E A;  3SZR A;  5A6J A;  2BC5 A;  2YQY A;  3O39 A;  3RKO F;  3RVZ A;  1KTM A;  2EPL X;  2B0J A;  3FHD A;  3HTK C;  3HKK A;  3JYH A;  2J0W A;  3KYJ A;  2MHR A;  2OU6 A;  3I5P A;  1A0B A;  1RJ9 A;  2XRH A;  2ZXP A;  2LFD A;  3MYI A;  1ZYR F;  3JSZ A;  4EBJ A;  3I4U A;  4ONS A;  1ZU4 A;  4AE4 A;  2YL7 A;  2J9V A;  4GEH A;  1TWH A;  4ZLC A;  2NUP B;  3LES A;  2EIJ C;  5L3Q A;  3ECS A;  1YAR O;  4JE9 A;  2YL0 A;  1M56 C;  2J0X A;  4GQH A;  4XPY A;  5A6B A;  1OQC A;  4E7S A;  3L0I A;  1LE2 A;  3NDB B;  2D4U A;  2XM4 A;  3S28 A;  5A6A A;  3DXJ F;  4CS9 C;  3H65 A;  2DGJ A;  2LFF A;  4MVU A;  5L0D A;  3AOU A;  3HLZ A;  1TR2 A;  1OR3 A;  1G8X A;  3IPM O;  1VYI A;  1JR8 A;  5KYN A;  3SXY A;  3A11 A;  2ETS A;  2KGO A;  4FX5 A;  2F22 A;  4FAP B;  4N4W A;  3VM6 A;  3ABK C;  4DJ9 A;  2RSE B;  4JTD B;  4XEV A;  4DRI B;  5KYX A;  3I5Q A;  2GWW A;  3CAX A;  3ITF A;  3SNH A;  4CDV A;  2X0C A;  2A1D D;  3LLI A;  3LS0 A;  4X0R A;  3ASN C;  1HMD A;  1HW2 A;  3S27 A;  4DBR A;  2L6H A;  5DS4 A;  2XLW A;  3MLG A;  1JMW A;  1JRA A;  2R7U A;  1TFK B;  5JLI A;  4A2N B;  3KL4 A;  1OCZ C;  5A6B D;  3LLK A;  1G4W R;  2P6V A;  4DVZ A;  3QW1 A;  3ZG1 A;  2A0B A;  2YZS A;  4LDK A;  1Z23 A;  3S29 A;  4PJJ A;  4JRZ A;  2O9X A;  3L8I A;  4LLE A;  4EBK A;  1OXB A;  3QZC A;  1I5N A;  3RF3 A;  4C7O A;  2HSB A;  4CX9 A;  3HNJ A;  2PX3 A;  2ICW G;  1HE1 A;  1OCC C;  2HSQ A;  3DM9 B;  5JUA A;  4LDQ A;  3FDQ A;  1MND A;  1SMY F;  4RBN A;  2UUH A;  4P9F A;  3QVY A;  4IJJ A;  1LVK A;  1CGO A;  2ZD9 A;  3UMI A;  3ZTM A;  4O79 A;  4HE8 D;  2Q3T A;  4W8P A;  5FZT A;  2NUT A;  1APC A;  2PFD A;  2R7S A;  3DE9 A;  3WHN A;  2HJ3 A;  5JT4 A;  1H9G A;  4MW3 A;  4G7Z F;  2AVK A;  3W4Y A;  3W2V A;  1K04 A;  1QQ3 A;  4MW8 A;  4JCH A;  4CS8 A;  3S84 A;  2LK4 A;  3EFO B;  1Q0G A;  3U5S A;  3KKB A;  4XLP F;  1HMO A;  5HV9 A;  3NMI A;  4FES A;  4IGG A;  3AGT A;  4NCQ A;  3X2Q C;  3CQZ A;  4K7B A;  2CYD A;  1QZX A;  3B0V C;  3JCU Q;  4XQ1 A;  2P7V A;  2R25 A;  4HFF B;  4N06 A;  3US6 A;  4YWQ A;  2AU5 A;  2P0N A;  3R2P A;  5A69 A;  2YVK A;  2XLV A;  2PP4 A;  1QSP A;  1LS4 A;  2LCH A;  1IZM A;  5L0C A;  2L81 A;  4JC7 A;  5L3V A;  1Q0K A;  3ABL C;  4LAC B;  1FFT C;  4OIP F;  2H7B A;  2OJQ A;  1M2O A;  4PFP A;  4QI0 A;  1S7Z A;  3H2V A;  4YJW A;  1RKE A;  4C7O B;  4JJF A;  3GM3 A;  2J46 A;  1GS9 A;  5F5F A;  2R7W A;  3G4Z A;  4K0D A;  4E0I A;  3FAJ A;  4WJ0 A;  4C3E A;  5JS5 A;  1ZHW A;  3MX3 A;  1MNE A;  4N6C A;  4PJL A;  3QTH A;  1ZZP A;  1LE4 A;  2WB7 A;  3L1M A;  2KYH A;  1QVX A;  5KYX B;  1EQ1 A;  2OEX A;  1KNY A;  1ST6 A;  1RXQ A;  1R4T A;  1WAS A;  2I15 A;  2R05 A;  3IQC A;  1ZW2 A;  2HKV A;  4PR9 A;  4HFK B;  3W8H A;  3V5Y A;  4JEB A;  1T9K A;  2TMV P;  4CSA C;  2Y3B A;  2NSF A;  2QE9 A;  3U2L A;  4Z9J A;  3WAQ A;  1YAU O;  1EKY A;  4R32 A;  2VAS A;  4NQF A;  4DRJ B;  1OKK D;  4PK4 A;  3U8V A;  5KYY A;  3VAY A;  2CDQ A;  4DVY P;  2WVO A;  1J8M F;  5T3W A;  3ZTZ A;  4UDV A;  4YL0 A;  1FTS A;  4CBE A;  4XPW A;  4BEJ A;  4IAQ A;  2A0U A;  3JTL O;  2DYS C;  3TD7 A;  3UGO A;  2LP4 A;  3PCV A;  2CGE A;  2LSE A;  4H4K C;  2J9B A;  5F5H A;  3UGP A;  3HNL A;  4ZLD A;  2AP3 A;  3EH2 A;  1I4Z A;  2JPU A;  1XZQ A;  4BJ5 C;  2YKZ A;  3W2W A;  4BG0 A;  4G78 A;  4CDY A;  2IXP A;  3EPV A;  2CCY A;  4MVQ A;  4AE4 B;  3N24 A;  4AL1 A;  3EGD A;  2W4B A;  4OIO F;  3CZ6 A;  3E70 C;  3EJN A;  2CNW D;  1C03 A;  5BQH A;  1PD0 A;  2J7P D;  1YJG A;  5DS6 A;  1QPU A;  2R7O A;  1CGM E;  1YYX A;  5EGY A;  2KK1 A;  3QMK A;  1A7D A;  3M15 A;  3POV A;  3ZC4 A;  1UG7 A;  4Q5S F;  2A69 F;  1BR1 A;  2YEV A;  2ASR A;  4MTG A;  4QDL A;  3RQG A;  2BE5 F;  2L9J A;  3MYF A;  3QVZ A;  4MTO A;  3RYL A;  4J7Y A;  4CJO A;  2NUT B;  3TJ6 A;  1LS1 A;  1K05 A;  3SP1 A;  2G62 A;  2IYL D;  3RQF A;  1T6Q A;  4J32 B;  2NG1 A;  1CPR A;  5IY5 C;  1MMD A;  3RW0 A;  2EPN A;  3UMH A;  4B6I A;  3ZVR A;  1Z3I X;  3FOO A;  4QI2 A;  3ZIB A;  1RCP A;  3GM1 A;  3LS1 A;  5B1A C;  4CDA A;  3X1O A;  1CPQ A;  3B71 A;  1B68 A;  3GM2 A;  1KU2 A;  4YT5 A;  1T6I A;  5JVE A;  3NYM A;  3ASO C;  2HMZ A;  2YLD A;  2ZXR A;  4LLC A;  5D92 A;  1JAF A;  3G4X A;  1V74 B;  2JX0 A;  4I3M A;  2Y3H A;  2KW3 C;  4F4B A;  2QUP A;  3SEO A;  4E7Z A;  3PHF 2;  2OJE D;  4KNV A;  5E3A A;  2R03 A;  4IAO A;  2XM0 A;  1VTM P;  1HE9 A;  2ZPA A;  1H7I A;  2R7T A;  3MBG A;  3PMR A;  4I44 A;  2QY9 A;  2Y39 A;  3IEE A;  1TKN A;  4Z9H A;  5TJ5 E;  1LPE A;  4JW1 A;  5KYU B;  2HJM A;  1AUE A;  4O7G A;  3NG1 A;  4CJG A;  1K40 A;  4MS2 A;  2QNL A;  1OKK A;  2DB4 A;  3DD7 A;  3O10 A;  4P6I C;  2YWA A;  5AGF A;  3LNM B;  1E85 A;  1PCX A;  2HZ8 A;  4JCZ A;  2KJG A;  2YHS A;  3FOP A;  1GQA A;  2UUI A;  4Q7C A;  1TWC A;  4BJ1 A;  5BUO A;  1NZE A;  3NYJ A;  4CS7 A;  3S0X A;  3DJN B;  3SXK A;  3F47 A;  1MMN A;  3UNG C;  3OWT A;  1U0B B;  1NU9 C;  2EIK C;  3M1C B;  1OW8 A;  2FGY A;  2OKU A;  1YVI A;  2Q9C A;  1WGW A;  5L0I A;  3UR3 C;  1Z63 A;  1FMV A;  1L3P A;  2PX0 A;  4DRH B;  4C3D A;  4XPX A;  2VH3 A;  3G50 A;  3VF0 A;  4U9D A;  1NU7 D;  2EIL C;  3UMK A;  1E84 A;  1BBH A;  1NBB A;  2PBE A;  4U5D E;  1CGN A;  3RQE A;  1ZHX A;  1LKX A;  1QKR A;  1E2X A;  1RKE B;  4OIN F;  5COM A;  3H2U A;  1AVO B;  3DWW A;  1XZP A;  4DBQ A;  3L8J A;  1C17 M;  3ZQY A;  5E2Q A;  2RD9 A;  2R9R B;  1E83 A;  1E86 A;  5E33 A;  3JRM O;  4BPM A;  4IAR A;  1IW7 F;  2XSE A;  3EQL F;  2XLM A;  4G7H F;  1VK5 A;  2Y69 C;  5T1D B;  3CSK A;  1SYQ A;  1OCR C;  1YZC A;  3U9M A;  1WWP A;  1ZHY A;  2VCC A;  4YN0 B;  1EA8 A;  1TWA A;  2W4M A;  3B29 A;  5DS5 A;  4AL0 A;  1A41 A;  2FFH A;  4E0H A;  1OXK A;  1SR2 A;  3DAF A;  4WGZ A;  4EUK B;  1OW6 A;  3LJB A;  3GEH A;  3EZH A;  5L0G A;  4JJG A;  1O5H A;  3S90 A;  4M63 A;  4ULV A;  4O6N A;  4MVZ A;  2R7Q A;  2KNH A;  2NUP A;  4DOZ A;  1ZW3 A;  1BR4 A;  1TFO B;  1Z5Z A;  4OIQ F;  3RVY A;  2IM8 A;  4JKV A;  2CNW A;  1Q0F A;  3FAP B;  4YL1 A;  4YK5 A;  2G3V A;  3T6J A;  4XLN F;  3IHU A;  4P9T A;  1ZHT A;  2XXA B;  3GWN A;  3T6G B;  4BJT A;  2JD3 A;  1XWJ A;  2L6G A;  1WTY A;  2VC9 A;  4EHP A;  3E9V A;  3GEE A;  2VCA A;  2Q9A A;  1F1M A;  2CW0 F;  1FAP B;  1W2W A;  1L7C A;  5F28 E;  3LEV A;  4AX2 A;  1NFN A;  2AWY A;  3OA1 A;  3C63 A;  4KI2 A;  1G4U S;  3M79 A;  4FWV A;  1M57 C;  3U8P A;  5JP7 A;  4WAB A;  1T5O A;  4JZA A;  2Q7R A;  3TK0 A;  1N1C A;  3K66 A;  2I8B A;  4MND A;  3AQC A;  3U3B A;  1BDJ B;  4MVS A;  4NTA A;  3ZWI A;  4J7T A;  5CIV A;  1YZA A;  2IXM A;  2Q9B A;  3O6X A;  1Y6D A;  3GAN A;  3JT1 A;  5DVW A;  2L7A A;  2H8A A;  1YYJ A;  1VYK A;  3AG1 C;  4PJN A;  3EFO A;  5KYY B;  3U3F A;  2P1A A;  3EGX A;  2KSF A;  1DOV A;  2R02 A;  1VB5 A;  2V3C C;  5L0H A;  2XLH A;  5L0F A;  1C02 A;  4BJ5 A;  4JIO A;  1D0Y A;  1PV3 A;  1I4Y A;  3WG7 C;  3NYL A;  3TJ5 A;  2Z15 A;  2H7O A;  3R7C A;  1OCO C;  3HNK A;  5KYW B;  3DI5 A;  1YA9 A;  4L6R A;  4PAC A;  5KYW A;  4XEK A;  3LNR A;  1SZI A;  3B0U X;  1H6G A;  3DJU B;  3U0C A;  2YRF A;  1TWG A;  1JPJ A;  2EPO A;  1YDI A;  2Y3G A;  3EGD B;  3TOM A;  4KC9 A;  2XL4 A;  3FXH A;  4U5G A;  1ORS C;  2XL8 A;  2YLI A;  4PJM A;  4C3B A;  4JTA B;  4EIY A;  3TUL A;  1O87 A;  3T9O A;  2GAQ A;  1V55 C;  4O6M A;  1D1C A;  3V5X A;  2E87 A;  5DQZ A;  4JTC B;  2J9W A;  3BEH A;  4IWB A;  1MMA A;  3K6B A;  2QTV A;  4RDA A;  1MQV A;  1U89 A;  5E3C A;  3JYY A;  5JSL A;  5BQG A;  3SXM A;  3V5Z A;  5B3S C;  3C18 A;  3LEO A;  1A7V A;  3PDM P;  2MYS A;  4EWC A;  4WGY A;  4GYT A;  3K1I A;  2WZF A;  4CIP A;  3QW0 A;  2A6H F;  2IXN A;  1UFB A;  1SF8 A;  2L6F A;  4MVO A;  1J8Y F;  4Q4Z F;  3EG9 B;  5BQI A;  5EHH A;  3J06 A;  1ORY A;  3NRH A;  2W45 A;  2YL1 A;  4YT2 A;  3GWL A;  4OIR F;  1FR0 A;  2A68 F;  2HS5 A;  2GDC A;  4W8K A;  5COF A;  2EIM C;  2H7V C;  3CEX A;  1QLE C;  2OG2 A;  4I1M A;  2XLE A;  3C62 A;  1YA7 O;  3AG4 C;  3DZA A;  1ORJ A;  1VMA A;  1EI7 A;  1U6H A;  2M4E A;  3AJM A;  3Q6N A;  5AC4 A;  1BR2 A;  1FFH A;  2IBF A;  2LIG A;  5EK0 A;  4EBB A;  3KYI A;  2MWQ A;  1ZVZ A;  3M4C A;  4LER A;  4OD4 A;  3SXZ A;  1NFO A;  3U9J A;  4CS8 C;  4YT8 A;  3AG3 C;  4XEF A;  3EH1 A;  1WN0 A;  3EHN A;  1LIH A;  4XTK A;  2V26 A;  4HEA J;  1NSG B;  4H54 A;  5DLJ A;  1HW1 A;  3Q7L A;  4J30 B;  2KC3 A;  4YL3 A;  4JUR I;  4E17 A;  5A6K A;  1S05 A;  3TOL A;  4BJ6 C;  1Q0D A;  2IOQ A;  2QLA A;  2PF4 E;  2J45 A;  1D1B A;  3AQB A;  2D5R B;  3KPH A;  2FAP B;  3JSE O;  1JOG A;  4JEA A;  3NMK A;  2XS1 A;  3AG2 C;  3GOD A;  2WVN A;  4ER9 A;  2EPM X;  1G5Z A;  2LQG A;  3B0P A;  3EGX B;  3ZDL A;  3Q7G A;  1ZHZ A;  3OEO A;  3A9C A;  3DE8 A;  3IQ6 A;  5DQT A;  1D0Z A;  1GGQ A;  2DYR C;  3K1H A;  4BEM J;  3DKA A;  4DXW A;  5GPG B;  2XL6 A;  1FMW A;  1PD1 A;  2WZG A;  4IRU A;  4NTB A;  3RH3 A;  2WL8 A;  3C7J A;  3JRT A;  4RD9 A;  2HV6 A;  2HUJ A;  2NSG A;  3JZ0 A;  1LI5 A;  4MTF A;  4NC3 A;  3DAG A;  3W8I A;  4A4A A;  2KQ9 A;  5K0I A;  2B0H A;  4YT4 A;  3IQT A;  3O55 A;  2R7X A;  3VYW A;  2ZXO A;  5B1B C;  1LI7 A;  4G0H A;  5L0J A;  1HY5 A;  4BJ6 A;  2VCB A;  3DM5 A;  4ANJ A;  2HMQ A;  3ZSU A;  1Y4C A;  1M6T A;  4AK9 A;  1H9T A;  1MMG A;  3NKE A;  2J7P A; 
#chains in the Genus database with same CATH homology
 5JRA A;  5JLI A;  3FOO A;  1RCP A;  4CDA A;  3QW1 A;  1CPQ A;  2XLH A;  2YL3 A;  5JVE A;  2YLD A;  4D4N A;  1JAF A;  3NMJ A;  3HNK A;  4L6R A;  4CX9 A;  3HNJ A;  5JUA A;  2J8W A;  2XM0 A;  2XLD A;  3HNI A;  3QVY A;  3VRC A;  3TOM A;  1CGO A;  3ZTM A;  2YLG A;  1APC A;  4CJG A;  2XL8 A;  2YLI A;  3DE9 A;  4EIY A;  5JT4 A;  256B A;  5AGF A;  1QQ3 A;  1E85 A;  3NMI A;  3FOP A;  1GQA A;  1MQV A;  3IQ5 A;  5JSL A;  1LM3 B;  1A7V A;  4N6H A;  4WGY A;  4D4X A;  2XLV A;  4CIP A;  3QW0 A;  3ZQV A;  4U9D A;  2YL1 A;  1E84 A;  4IB4 A;  1BBH A;  1NBB A;  2XLO A;  1CGN A;  2XLE A;  3C62 A;  5JS5 A;  5B3I A;  3ZQY A;  3M4B A;  1E83 A;  1E86 A;  3L1M A;  4IAR A;  3M4C A;  2XLM A;  4U9E A;  2BC5 A;  4JEB A;  1YZC A;  1EKY A;  1S05 A;  3TOL A;  2QLA A;  4WGZ A;  2YL7 A;  3ZTZ A;  4IAQ A;  4ULV A;  4JEA A;  3NMK A;  4JE9 A;  2YL0 A;  2J9B A;  4ER9 A;  3HNL A;  4JKV A;  2XM4 A;  2YKZ A;  4CDY A;  2CCY A;  3DE8 A;  3IQ6 A;  2XL6 A;  1QPU A;  1YYX A;  3C63 A;  4NC3 A;  3M79 A;  4N4W A;  3M15 A;  3U8P A;  5JP7 A;  4CDV A;  3QVZ A;  4CJO A;  3ZWI A;  1YZA A;  1M6T A;  2XLW A;  1CPR A;  1YYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...