2CCYA

Structure of ferricytochrome c(prime) from rhodospirillum molischianum at 1.67 angstroms resolution
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
127
structure length
127
Chain Sequence
QSKPEDLLKLRQGLMQTLKSQWVPIAGFAAGKADLPADAAQRAENMAMVAKLAPIGWAKGTEALPNGETKPEAFGSKSAEFLEGWKALATESTKLAAAAKAGPDALKAQAAATGKVCKACHEEFKQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport (heme protein)
molecule keywords CYTOCHROME C
publication title Structure of ferricytochrome c' from Rhodospirillum molischianum at 1.67 A resolution.
pubmed doi rcsb
source organism Phaeospirillum molischianum
total genus 48
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 1985-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2ccyA00
3IQ6A 4CJGA 5JRAA 2XLWA 3M4BA 1CGNA 2YLDA 3M79A 1GQAA 1E83A 4EIYA 3C62A 3L1MA 4IARA 2CCYA 5JT4A 4WGZA 4N6HA 5JP7A 2YLGA 1LM3B 1YZCA 5AGFA 1NBBA 3ZWIA 1YYJA 2YLIA 1M6TA 3QVYA 2XM0A 3HNIA 1EKYA 2XLOA 4NC3A 4JKVA 2YL0A 3DE8A 4L6RA 1QPUA 1MQVA 2XL6A 3FOPA 3IQ5A 3TOLA 4IAQA 1S05A 3HNKA 1QQ3A 3ZQYA 2YKZA 1E85A 4ER9A 1CPRA 3DE9A 3ZQVA 2J8WA 4JEAA 1YYXA 4IB4A 1CPQA 3FOOA 2J9BA 4JE9A 3NMIA 1JAFA 2XLMA 3ZTZA 5JUAA 5JLIA 3U8PA 2XLDA 256BA 3M15A 4ULVA 4D4XA 3ZTMA 1APCA 4JEBA 1CGOA 5JS5A 1YZAA 2XL8A 3VRCA 4WGYA 2XLHA 1A7VA 3HNLA 1RCPA 1BBHA 3HNJA 5JVEA 2XM4A 3C63A 4U9EA 4CDYA 3NMJA 4CDVA 1E84A 5B3IA 4CX9A 2XLEA 5JSLA 2QLAA 2YL1A 4CDAA 4CJOA 2BC5A 2YL7A 2XLVA 2YL3A 3M4CA 3TOMA 4CIPA 1E86A 4N4WA 4U9DA 3QW0A 3QVZA 3QW1A 3NMKA 4D4NA
chains in the Genus database with same CATH superfamily
4QDLA 5IY5C 1LVKA 3TJ6A 4CJGA 1F1MA 3S27A 1ZW2A 3GANA 3O39A 4W8PA 4XWJA 5BQGA 3WODF 1FFHA 5B1BC 3NYJA 4PFOA 3RH3A 1LI5A 1WTYA 1B68A 1TQGA 3S84A 2IXMA 1HW2A 1D0XA 1FFTC 4GYTA 5HV9A 3N2ZB 4FAPB 1OR3A 1Y4CA 4EIYA 1JPNA 3C62A 3KH2A 3GM1A 4Z9IA 3W2VA 4WGZA 4N6HA 5KYYA 2LP4A 2ZXOA 4DRIB 2JX0A 5DS6A 3IQCA 3JYYA 4MVQA 4CS8C 4PJJA 4I1MA 4K1OA 1U6HA 1LM3B 2WL8A 1QKRA 4G78A 3SXKA 2R25A 3ZWIA 5DS4A 2YLIA 4R32A 2AP3A 1ORSC 2HKVA 2XM0A 3AG4C 3EHNA 1SYQA 2L6FA 3FAPB 3OWTA 4PJLA 4XEVA 2X0CA 1Z7Qc 2B0JA 2R7UA 4FWVA 4JVSA 3SXZA 3DMDA 1VK5A 2Q9BA 4N06A 4Z9JA 2BL2A 2H7BA 1UFBA 3K6BA 1XZQA 4RDAA 3HKKA 3ZIBA 2XL6A 3ZC4A 2KYHA 2V3CC 1Q0MA 3OEOA 4OIRF 2PF4E 2Q00A 3FXHA 2QNLA 1SF8A 3JYHA 4KBLA 3ZQYA 2FAPB 2YKZA 1ZHXA 1D1BA 1E85A 2G3VA 4GEHA 2GFHA 2PP4A 5F5HA 1M2OA 2Z15A 4PR9A 1BR4A 3Q6NA 1YYXA 2KK1A 1WATA 3ABLC 3DXJF 3NKDA 2CW0F 4X0RA 2OG2A 1CPQA 1SZIA 3FOOA 1HE9A 3UMHA 3SP1A 2V26A 4DXWA 3TULA 2D4UA 2KNHA 2YVKA 3EH1A 1OCRC 3VF0A 5T3TA 3H2VA 1LS1A 2OEVA 3QTHA 4GQHA 4U5BE 5JUAA 3DAFA 3U8PA 2CNWA 3HLZA 3K1IC 4MTFA 3T6GB 4LDRA 4JCZA 1YLMA 3CAXA 5D91A 2NUTA 3JRTA 3KMIA 3LS0A 2MWQA 2XS8A 1JR8A 4J30B 2EILC 1D1AA 2ZD9A 2R7QA 2EPOA 4E7SA 4CS9C 4DVZA 2J0XA 2VCCA 3NYMA 5F28E 4AE4A 4KI2A 1RKEA 1MNEA 3JZ0A 2R7RA 3T6BA 1ZHWA 4DRJB 1EQ1A 3CZ6A 5A69A 1TKNA 1HMOA 1VB5A 2J45A 1E2XA 3C8GD 3UR3C 1G5ZA 3W8HA 3W2WA 4OIPF 3K1IA 3E70C 3EGXA 1RCPA 3L0IA 3POVA 1BBHA 1D1CA 1ZVZA 2G3KA 2IBFA 3AGUA 3LUTB 4O6YA 1K04A 2W4MA 3T9OA 1Q0FA 2ZXRA 4U9EA 1OKKD 3VAYA 4CDYA 4C7OA 4F4BA 1JPJA 4IRUA 3UGOA 1VMAA 1PD0A 1KNYA 1HE1A 1O5HA 1NSGB 2VCAA 2C03A 2L7AA 5CI9A 1E84A 1GM5A 4CX9A 4CSAC 3MYIA 3LESA 4BEJA 1TWAA 1ZU5A 2GWWA 4EBJA 1O3UA 2DB4A 4DBRA 2YL1A 5L0GA 1QLEC 4CJOA 2YL7A 3RQFA 2YL3A 1PD1A 1M2VB 4JTCB 3SNHA 2LD6A 2OEXA 1E86A 1JRAA 3B71A 3A11A 4XQ1A 1BR2A 3LNRA 1V54C 3QVZA 3EGDA 2ZXPA 4D4NA 3US6A 4I44A 3V5YA 4H4KC 3JRMO 5COFA 4CSAA 4U5FE 4ANJA 1XZPA 3K7DA 2IXPA 2Y3GA 3RF3A 1WN0A 5JRAA 5KYWB 1N1CA 1MMAA 2WVNA 3J06A 3B0PA 4BEMJ 2LFFA 3M79A 1FTSA 2R7TA 4MVOA 5BUOA 5K0IA 1LE2A 1OXKA 1T6IA 4A2NB 4AX2A 3ABMC 3EQLF 5EK0A 5A6AA 3DJNB 2YLGA 2Y39A 3O6XA 4J32B 1G4WR 1KTMA 2L6GA 1YZCA 5AGFA 1YA7O 3S9OA 1NFOA 1YYJA 3QVYA 2J7PA 4MNDA 2UUHA 4HE8D 2VASA 4JC7A 5KYXA 2QUPA 4K7BA 1V55C 1QZXA 1LKXA 1A41A 3Q7GA 4NC3A 1VYIA 2EIMC 1MMGA 2NUPA 2YL0A 4Q5SF 2HS5A 4W8KA 3RYLA 1DOWA 3H65A 1PCXA 3EFOB 3GWNA 4EWCA 5A6BA 3IQ5A 2ZXWC 3RQGA 3U8VA 3SXYA 1U89A 1YARO 4E0HA 1T01A 3EG9A 3AGTA 1G8XA 5BQHA 3V5XA 4E7ZA 3FHDA 4RD9A 2MYSA 3O55A 1ZU4A 2XXAA 3C18A 3K66A 4ER9A 4QI0A 1CPRA 4MTOA 2NPUA 3ASNC 4O7GA 2F22A 3ZG1A 4IB4A 1YAUO 3MYFA 2J9BA 3DWWA 3OA1A 4MS2A 2XRHA 3GEEA 5E33A 2EIJC 3ABKC 3C8GB 4JE9A 4BG0A 2BE5F 4KNWA 3U0CA 3W8IA 4Q4ZF 3EHMA 1NFNA 3KKBA 4LLCA 3MBGA 2LQGA 5DVWA 4AL1A 2XS1A 3DKAA 4CS8A 5KYUB 3IHUA 2HZ8A 2G62A 3GORA 3LEVA 4OD5A 4NCQA 2XLDA 2XSEA 2YEVA 4MVUA 2KW3C 3ASOC 2PBEA 1APCA 1IW7F 2WZLA 2KC3A 4LERA 2CNWD 1CGOA 2AWCA 3SEOA 3W4YA 2YWAA 1YZAA 1Z63A 3DI5A 4E17A 3LNMB 3BEHA 1G4US 3C7JA 4XLPF 1OR2A 5FZTA 4DOZA 1OCCC 2DYRC 4MW8A 2LK4A 2I15A 2UUIA 4NTBA 3RQEA 4C3DA 3B0UX 3IQTA 5JVEA 4BJTA 4AL0A 1PV3A 4MW3A 5T3WA 1IZMA 2ASRA 1VOMA 2C04A 1RJ9A 4CIHA 3K1HA 3UNGC 3B29A 1RKCA 4C3EA 4C3BA 4DRHB 4EUKB 2WVQA 1OW7A 2Y3DA 2ZPAA 3AG1C 3ATPA 1RXQA 3L8IA 4XTKA 3NYLA 4U5HA 5E3CA 5B3IA 4JZAA 4XPWA 3RKOF 3O10A 3TQOA 1V4AA 4MVSA 5DQZA 5B3SC 4OIQF 4CDAA 4QI2A 2BC5A 3U5SA 4ZLCA 3X2QC 1NG1A 2XLVA 2A6EF 2DI3A 4MTGA 3TOMA 2R05A 4CIPA 4U9DA 1T6QA 4E18A 1D0YA 1NLXA 2MHRA 3FAJA 3DM9B 2NSFA 3GWLA 1FMWA 3QW1A 2H7VC 2KGOA 2LCHA 5DLJA 4XEKA 1ZHTA 1H6GA 5KYYB 3EZIA 4EHPA 1NZEA 1XWJA 2OKUA 3RW0A 2IYLD 5D92A 1D0ZA 3DD7A 1O87A 1H7IA 3A9CA 2LIGA 4JW1A 1JOGA 2KSFA 2XLWA 3M4BA 3MLGA 1CGNA 2YLDA 2Q9AA 3FDQA 2IM8A 5CIVA 1ST6A 4CS9A 1VTMP 3NG1A 2DGJA 5B1AC 3AJMA 4MVZA 1YVIA 4LDKA 2EIKC 2H7OA 3L1MA 2CCYA 4BJ1A 1OCOC 1VLTA 3ZDLA 2YRFA 3EH2A 4PK4A 4XLNF 2Q3TA 4G7OF 4U5CE 4YN0B 5COMA 2M64A 1M56C 2OCCC 1QSPA 2M4EA 2TMVP 3I5PA 3S90A 3PMRA 1OQCA 2A68F 4HFKB 2CYDA 2ICWG 2J9VA 3EFOA 3AQBA 1QVXA 4HFFB 4ONSA 1KU2A 2FFHA 3T6JA 4BJ6C 2I8BA 3X1OA 3JT1A 1AVOB 4KC9A 2GA0A 2RD9A 3AG2C 2A0UA 2J7PD 2HV6A 1Q0DA 4JKVA 4I3MA 1CGME 3DE8A 4DBQA 3F47A 4YJWA 2EPNA 2WVOA 2L9JA 1FNTc 2WZFA 1ZHYA 1QPUA 4MQ9F 3TOLA 4IAQA 3H2UA 2A0BA 4K0DA 1HY5A 4A4AA 3IPMO 2PNOA 1RMVA 5A6BD 2YQYA 3GM2A 5L0DA 2L81A 1ORYA 4WABA 4BJ6A 5COGA 2IXNA 2HUJA 2Q9CA 2YHSA 5L0FA 4U5DE 2J9UA 3HTKC 3TK0A 2OJQA 3JSEO 2YZSA 5KYNA 1V74B 4IWBA 2O9XA 3G4XA 3UMKA 1VLSA 2NUTB 3RFYA 3SXMA 4J7YA 2QE9A 3B9QA 4O79A 5KYUA 1WASA 3DJUB 3KPHA 4LACB 4AE4B 1YJGA 4BJ5C 4XPXA 1RKEB 1MMDA 4U5GA 3R7CA 3NMIA 1JAFA 3U3BA 3G50A 4NTAA 2HSBA 1T6UA 2R03A 3EGXB 5JLIA 3BRJA 3EPVA 2NSGA 3LJBA 3M15A 256BA 1A0BA 3LEOA 3FVYA 4D4XA 2Q4FA 2IOQA 4C7OB 2D5RB 2CDQA 1TFOB 3L34A 3Q6MA 5F5FA 1OCZC 3C8ZA 4G0HA 5JS5A 4OINF 3WAQA 3PHF2 1LI7A 1W2WA 2X51A 4YWQA 2XL4A 2VH3A 3ZVRA 2LSEA 2XL8A 4XEFA 3RVZA 2J9WA 1L7CA 2A69F 4CS7A 3UGPA 5AC5A 3KL4A 3SYNA 3U2LA 2JPUA 3QMKA 4YL0A 1T5OA 1A7VA 3JTLO 2EPMX 4JIOA 3U9MA 2IXOA 2HSQA 2QTVA 3HNJA 1K05A 4JCHA 1NU9C 3GEHA 3EGDB 3PDMP 4CDVA 4P6IC 4J7TA 1TFKB 4CBEA 2KQ9A 4MVMA 1AEPA 1NU7D 2W4BA 1S7ZA 2WZGA 1SMYF 1BR1A 2DYSC 3LS1A 4JTAB 4B6IA 4YT8A 1GGQA 4YK5A 1YDIA 1A7DA 5BQIA 2Y3HA 4PFPA 3U9JA 2QLAA 5T1DB 2A1DD 3M1CB 3E9VA 4OIOF 3LAYA 4ZLDA 3FMSA 1VYKA 3KYIA 2CGEA 4N4WA 4YT5A 3NDBB 3I5QA 3QW0A 5EHHA 3U2MA 3Q7LA 3NMKA 5E3AA 4WJ0A 3IQ6A 1TWGA 3JCUQ 2PX3A 4NTFA 4NQFA 1R4TA 3R2PA 2HJ3A 3PCVA 4RBNA 2VB6A 5KYXB 4ULWA 2R7SA 1U0BB 5L0HA 1K40A 2R7VA 1GQAA 1M2VA 4E0IA 1Z6AA 4JRZA 1E83A 2NUPB 1HMDA 4KNVA 2R7WA 3IEEA 3KYJA 1TWHA 4IARA 2H8AA 3GEIA 1ZW3A 1YA9A 4LLEA 5JT4A 3HJCA 2J0WA 3V7OA 5JP7A 1FMVA 4IJJA 2A6HF 4EBBA 1I4ZA 2P0NA 1T9KA 5AC4A 3AQCA 4FX5A 4LDQA 1L3PA 5GPGB 3EG9B 4YT2A 1EI7A 1NBBA 5KYWA 1M6TA 4JTDB 4PJMA 1Z3IX 2J46A 1M57C 1OW6A 4P9TA 4YL3A 4XPYA 5A6JA 3CSKA 1ZHZA 3HNIA 1EKYA 2VC9A 4FESA 4PACA 3V5ZA 4G7HF 2XLOA 2XXAB 2OQMA 2NG1A 3QZCA 2HJMA 1Z23A 2P6VA 2GDCA 1FAPB 2EPKX 2OOCA 1ZYRF 1WOLA 2HV7A 2FGYA 2LFDA 2OJED 2P1AA 2W9YA 4L6RA 5FCLA 1MQVA 2L6HA 3FOPA 4JJGA 4BPMA 4YL1A 1BDJB 4JURI 3N0TA 1EA8A 1C02A 4P9FA 1S05A 3CQZA 3SZRA 2PFDA 3WHNA 3HNKA 1ZZPA 2KJGA 2HMZA 4I1OB 1FR0A 3MX3A 3ZSUA 3UMIA 1QQ3A 1UG7A 1C17M 2Y3BA 3JSZA 1I4YA 5L0IA 3CEXA 1A7EA 2AWYA 3S28A 3ZQVA 2E87A 3DE9A 4Z9HA 1LS4A 2J8WA 4EBKA 5A6KA 2ETSA 4JEAA 4G7ZF 1TWCA 3VM6A 5L3VA 4U5EE 1LE4A 1LPEA 3K33A 1TR2A 5DS5A 2JD3A 2VCBA 4MVRA 1OW8A 3DAGA 2R9RB 1R5ID 1SR2A 3LLKA 5TJ5E 3B0VC 3N24A 2W45A 3VYWA 1WGWA 3RVYA 4PJNA 5L3QA 2XLMA 2GAQA 3ZTZA 2R02A 4AK9A 1LIHA 4ULVA 2OU6A 1C03A 2AU5A 4O6MA 3MFNA 3ZTMA 2Y69C 1RJ9B 2HFIA 4JEBA 2RSEB 3F46A 2EPLX 3U3FA 3ECSA 4YT4A 5L0CA 3C8GA 4H54A 1WWPA 4IAOA 4M63A 1JMWA 4O6NA 5E2QA 2Q7RA 1DOVA 3TJ5A 1Y6DA 3VRCA 3GODA 4EKWA 1OXBA 4N6CA 4WGYA 2XLHA 4DJ9A 5HSWA 1J8MF 2B0HA 1OKKA 3HNLA 4UDVA 1I5NA 4JJFA 1Q0KA 4OD4A 2XM4A 2WB7A 3C63A 4DVYP 3NMJA 5CI8A 3LLIA 3WG7C 1H9TA 3EZHA 3EJNA 2EINC 2XLEA 5EGYA 2R7OA 3TD7A 1MMNA 1Q0GA 3NRHA 4NY3A 4HEAJ 5JSLA 3AG3C 1GS9A 5DQTA 1H9GA 2AVKA 3DM5A 1Z5ZA 3M4CA 4IGGA 3ITFA 1J8YF 1ORJA 2P61A 3GM3A 2P7VA 3T4RA 4BJ5A 3RIPA 3I4UA 3NKEA 1BZ4A 1AUEA 1HW1A 2HMQA 3S0XA 3S29A 4Q7CA 3L8JA 5L0JA 1MNDA 3G4ZA 2PX0A 3AOUA 2R7XA 3DZAA 2QY9A
chains in the Genus database with same CATH topology
3IQ6A 4CJGA 5JRAA 2XLWA 3M4BA 1CGNA 2YLDA 3M79A 1GQAA 1E83A 4EIYA 3C62A 3L1MA 4IARA 2CCYA 5JT4A 4WGZA 4N6HA 5JP7A 2YLGA 1LM3B 1YZCA 5AGFA 1NBBA 3ZWIA 1YYJA 2YLIA 1M6TA 3QVYA 2XM0A 3HNIA 1EKYA 2XLOA 4NC3A 4JKVA 2YL0A 3DE8A 4L6RA 1QPUA 1MQVA 2XL6A 3FOPA 3IQ5A 3TOLA 4IAQA 1S05A 3HNKA 1QQ3A 3ZQYA 2YKZA 1E85A 4ER9A 1CPRA 3DE9A 3ZQVA 2J8WA 4JEAA 1YYXA 4IB4A 1CPQA 3FOOA 2J9BA 4JE9A 3NMIA 1JAFA 2XLMA 3ZTZA 5JUAA 5JLIA 3U8PA 2XLDA 256BA 3M15A 4ULVA 4D4XA 3ZTMA 1APCA 4JEBA 1CGOA 5JS5A 1YZAA 2XL8A 3VRCA 4WGYA 2XLHA 1A7VA 3HNLA 1RCPA 1BBHA 3HNJA 5JVEA 2XM4A 3C63A 4U9EA 4CDYA 3NMJA 4CDVA 1E84A 5B3IA 4CX9A 2XLEA 5JSLA 2QLAA 2YL1A 4CDAA 4CJOA 2BC5A 2YL7A 2XLVA 2YL3A 3M4CA 3TOMA 4CIPA 1E86A 4N4WA 4U9DA 3QW0A 3QVZA 3QW1A 3NMKA 4D4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IQ6 A;  4CJG A;  5JRA A;  2XLW A;  3M4B A;  1CGN A;  2YLD A;  3M79 A;  1GQA A;  1E83 A;  4EIY A;  3C62 A;  3L1M A;  4IAR A;  2CCY A;  5JT4 A;  4WGZ A;  4N6H A;  5JP7 A;  2YLG A;  1LM3 B;  1YZC A;  5AGF A;  1NBB A;  3ZWI A;  1YYJ A;  2YLI A;  1M6T A;  3QVY A;  2XM0 A;  3HNI A;  1EKY A;  2XLO A;  4NC3 A;  4JKV A;  2YL0 A;  3DE8 A;  4L6R A;  1QPU A;  1MQV A;  2XL6 A;  3FOP A;  3IQ5 A;  3TOL A;  4IAQ A;  1S05 A;  3HNK A;  1QQ3 A;  3ZQY A;  2YKZ A;  1E85 A;  4ER9 A;  1CPR A;  3DE9 A;  3ZQV A;  2J8W A;  4JEA A;  1YYX A;  4IB4 A;  1CPQ A;  3FOO A;  2J9B A;  4JE9 A;  3NMI A;  1JAF A;  2XLM A;  3ZTZ A;  5JUA A;  5JLI A;  3U8P A;  2XLD A;  256B A;  3M15 A;  4ULV A;  4D4X A;  3ZTM A;  1APC A;  4JEB A;  1CGO A;  5JS5 A;  1YZA A;  2XL8 A;  3VRC A;  4WGY A;  2XLH A;  1A7V A;  3HNL A;  1RCP A;  1BBH A;  3HNJ A;  5JVE A;  2XM4 A;  3C63 A;  4U9E A;  4CDY A;  3NMJ A;  4CDV A;  1E84 A;  5B3I A;  4CX9 A;  2XLE A;  5JSL A;  2QLA A;  2YL1 A;  4CDA A;  4CJO A;  2BC5 A;  2YL7 A;  2XLV A;  2YL3 A;  3M4C A;  3TOM A;  4CIP A;  1E86 A;  4N4W A;  4U9D A;  3QW0 A;  3QVZ A;  3QW1 A;  3NMK A;  4D4N A; 
#chains in the Genus database with same CATH topology
 4QDL A;  5IY5 C;  1LVK A;  3TJ6 A;  4CJG A;  1F1M A;  3S27 A;  1ZW2 A;  3GAN A;  3O39 A;  4W8P A;  4XWJ A;  5BQG A;  3WOD F;  1FFH A;  5B1B C;  3NYJ A;  4PFO A;  3RH3 A;  1LI5 A;  1WTY A;  1B68 A;  1TQG A;  3S84 A;  2IXM A;  1HW2 A;  1D0X A;  1FFT C;  4GYT A;  5HV9 A;  3N2Z B;  4FAP B;  1OR3 A;  1Y4C A;  4EIY A;  1JPN A;  3C62 A;  3KH2 A;  3GM1 A;  4Z9I A;  3W2V A;  4WGZ A;  4N6H A;  5KYY A;  2LP4 A;  2ZXO A;  4DRI B;  2JX0 A;  5DS6 A;  3IQC A;  3JYY A;  4MVQ A;  4CS8 C;  4PJJ A;  4I1M A;  4K1O A;  1U6H A;  1LM3 B;  2WL8 A;  1QKR A;  4G78 A;  3SXK A;  2R25 A;  3ZWI A;  5DS4 A;  2YLI A;  4R32 A;  2AP3 A;  1ORS C;  2HKV A;  2XM0 A;  3AG4 C;  3EHN A;  1SYQ A;  2L6F A;  3FAP B;  3OWT A;  4PJL A;  4XEV A;  2X0C A;  1Z7Q c;  2B0J A;  2R7U A;  4FWV A;  4JVS A;  3SXZ A;  3DMD A;  1VK5 A;  2Q9B A;  4N06 A;  4Z9J A;  2BL2 A;  2H7B A;  1UFB A;  3K6B A;  1XZQ A;  4RDA A;  3HKK A;  3ZIB A;  2XL6 A;  3ZC4 A;  2KYH A;  2V3C C;  1Q0M A;  3OEO A;  4OIR F;  2PF4 E;  2Q00 A;  3FXH A;  2QNL A;  1SF8 A;  3JYH A;  4KBL A;  3ZQY A;  2FAP B;  2YKZ A;  1ZHX A;  1D1B A;  1E85 A;  2G3V A;  4GEH A;  2GFH A;  2PP4 A;  5F5H A;  1M2O A;  2Z15 A;  4PR9 A;  1BR4 A;  3Q6N A;  1YYX A;  2KK1 A;  1WAT A;  3ABL C;  3DXJ F;  3NKD A;  2CW0 F;  4X0R A;  2OG2 A;  1CPQ A;  1SZI A;  3FOO A;  1HE9 A;  3UMH A;  3SP1 A;  2V26 A;  4DXW A;  3TUL A;  2D4U A;  2KNH A;  2YVK A;  3EH1 A;  1OCR C;  3VF0 A;  5T3T A;  3H2V A;  1LS1 A;  2OEV A;  3QTH A;  4GQH A;  4U5B E;  5JUA A;  3DAF A;  3U8P A;  2CNW A;  3HLZ A;  3K1I C;  4MTF A;  3T6G B;  4LDR A;  4JCZ A;  1YLM A;  3CAX A;  5D91 A;  2NUT A;  3JRT A;  3KMI A;  3LS0 A;  2MWQ A;  2XS8 A;  1JR8 A;  4J30 B;  2EIL C;  1D1A A;  2ZD9 A;  2R7Q A;  2EPO A;  4E7S A;  4CS9 C;  4DVZ A;  2J0X A;  2VCC A;  3NYM A;  5F28 E;  4AE4 A;  4KI2 A;  1RKE A;  1MNE A;  3JZ0 A;  2R7R A;  3T6B A;  1ZHW A;  4DRJ B;  1EQ1 A;  3CZ6 A;  5A69 A;  1TKN A;  1HMO A;  1VB5 A;  2J45 A;  1E2X A;  3C8G D;  3UR3 C;  1G5Z A;  3W8H A;  3W2W A;  4OIP F;  3K1I A;  3E70 C;  3EGX A;  1RCP A;  3L0I A;  3POV A;  1BBH A;  1D1C A;  1ZVZ A;  2G3K A;  2IBF A;  3AGU A;  3LUT B;  4O6Y A;  1K04 A;  2W4M A;  3T9O A;  1Q0F A;  2ZXR A;  4U9E A;  1OKK D;  3VAY A;  4CDY A;  4C7O A;  4F4B A;  1JPJ A;  4IRU A;  3UGO A;  1VMA A;  1PD0 A;  1KNY A;  1HE1 A;  1O5H A;  1NSG B;  2VCA A;  2C03 A;  2L7A A;  5CI9 A;  1E84 A;  1GM5 A;  4CX9 A;  4CSA C;  3MYI A;  3LES A;  4BEJ A;  1TWA A;  1ZU5 A;  2GWW A;  4EBJ A;  1O3U A;  2DB4 A;  4DBR A;  2YL1 A;  5L0G A;  1QLE C;  4CJO A;  2YL7 A;  3RQF A;  2YL3 A;  1PD1 A;  1M2V B;  4JTC B;  3SNH A;  2LD6 A;  2OEX A;  1E86 A;  1JRA A;  3B71 A;  3A11 A;  4XQ1 A;  1BR2 A;  3LNR A;  1V54 C;  3QVZ A;  3EGD A;  2ZXP A;  4D4N A;  3US6 A;  4I44 A;  3V5Y A;  4H4K C;  3JRM O;  5COF A;  4CSA A;  4U5F E;  4ANJ A;  1XZP A;  3K7D A;  2IXP A;  2Y3G A;  3RF3 A;  1WN0 A;  5JRA A;  5KYW B;  1N1C A;  1MMA A;  2WVN A;  3J06 A;  3B0P A;  4BEM J;  2LFF A;  3M79 A;  1FTS A;  2R7T A;  4MVO A;  5BUO A;  5K0I A;  1LE2 A;  1OXK A;  1T6I A;  4A2N B;  4AX2 A;  3ABM C;  3EQL F;  5EK0 A;  5A6A A;  3DJN B;  2YLG A;  2Y39 A;  3O6X A;  4J32 B;  1G4W R;  1KTM A;  2L6G A;  1YZC A;  5AGF A;  1YA7 O;  3S9O A;  1NFO A;  1YYJ A;  3QVY A;  2J7P A;  4MND A;  2UUH A;  4HE8 D;  2VAS A;  4JC7 A;  5KYX A;  2QUP A;  4K7B A;  1V55 C;  1QZX A;  1LKX A;  1A41 A;  3Q7G A;  4NC3 A;  1VYI A;  2EIM C;  1MMG A;  2NUP A;  2YL0 A;  4Q5S F;  2HS5 A;  4W8K A;  3RYL A;  1DOW A;  3H65 A;  1PCX A;  3EFO B;  3GWN A;  4EWC A;  5A6B A;  3IQ5 A;  2ZXW C;  3RQG A;  3U8V A;  3SXY A;  1U89 A;  1YAR O;  4E0H A;  1T01 A;  3EG9 A;  3AGT A;  1G8X A;  5BQH A;  3V5X A;  4E7Z A;  3FHD A;  4RD9 A;  2MYS A;  3O55 A;  1ZU4 A;  2XXA A;  3C18 A;  3K66 A;  4ER9 A;  4QI0 A;  1CPR A;  4MTO A;  2NPU A;  3ASN C;  4O7G A;  2F22 A;  3ZG1 A;  4IB4 A;  1YAU O;  3MYF A;  2J9B A;  3DWW A;  3OA1 A;  4MS2 A;  2XRH A;  3GEE A;  5E33 A;  2EIJ C;  3ABK C;  3C8G B;  4JE9 A;  4BG0 A;  2BE5 F;  4KNW A;  3U0C A;  3W8I A;  4Q4Z F;  3EHM A;  1NFN A;  3KKB A;  4LLC A;  3MBG A;  2LQG A;  5DVW A;  4AL1 A;  2XS1 A;  3DKA A;  4CS8 A;  5KYU B;  3IHU A;  2HZ8 A;  2G62 A;  3GOR A;  3LEV A;  4OD5 A;  4NCQ A;  2XLD A;  2XSE A;  2YEV A;  4MVU A;  2KW3 C;  3ASO C;  2PBE A;  1APC A;  1IW7 F;  2WZL A;  2KC3 A;  4LER A;  2CNW D;  1CGO A;  2AWC A;  3SEO A;  3W4Y A;  2YWA A;  1YZA A;  1Z63 A;  3DI5 A;  4E17 A;  3LNM B;  3BEH A;  1G4U S;  3C7J A;  4XLP F;  1OR2 A;  5FZT A;  4DOZ A;  1OCC C;  2DYR C;  4MW8 A;  2LK4 A;  2I15 A;  2UUI A;  4NTB A;  3RQE A;  4C3D A;  3B0U X;  3IQT A;  5JVE A;  4BJT A;  4AL0 A;  1PV3 A;  4MW3 A;  5T3W A;  1IZM A;  2ASR A;  1VOM A;  2C04 A;  1RJ9 A;  4CIH A;  3K1H A;  3UNG C;  3B29 A;  1RKC A;  4C3E A;  4C3B A;  4DRH B;  4EUK B;  2WVQ A;  1OW7 A;  2Y3D A;  2ZPA A;  3AG1 C;  3ATP A;  1RXQ A;  3L8I A;  4XTK A;  3NYL A;  4U5H A;  5E3C A;  5B3I A;  4JZA A;  4XPW A;  3RKO F;  3O10 A;  3TQO A;  1V4A A;  4MVS A;  5DQZ A;  5B3S C;  4OIQ F;  4CDA A;  4QI2 A;  2BC5 A;  3U5S A;  4ZLC A;  3X2Q C;  1NG1 A;  2XLV A;  2A6E F;  2DI3 A;  4MTG A;  3TOM A;  2R05 A;  4CIP A;  4U9D A;  1T6Q A;  4E18 A;  1D0Y A;  1NLX A;  2MHR A;  3FAJ A;  3DM9 B;  2NSF A;  3GWL A;  1FMW A;  3QW1 A;  2H7V C;  2KGO A;  2LCH A;  5DLJ A;  4XEK A;  1ZHT A;  1H6G A;  5KYY B;  3EZI A;  4EHP A;  1NZE A;  1XWJ A;  2OKU A;  3RW0 A;  2IYL D;  5D92 A;  1D0Z A;  3DD7 A;  1O87 A;  1H7I A;  3A9C A;  2LIG A;  4JW1 A;  1JOG A;  2KSF A;  2XLW A;  3M4B A;  3MLG A;  1CGN A;  2YLD A;  2Q9A A;  3FDQ A;  2IM8 A;  5CIV A;  1ST6 A;  4CS9 A;  1VTM P;  3NG1 A;  2DGJ A;  5B1A C;  3AJM A;  4MVZ A;  1YVI A;  4LDK A;  2EIK C;  2H7O A;  3L1M A;  2CCY A;  4BJ1 A;  1OCO C;  1VLT A;  3ZDL A;  2YRF A;  3EH2 A;  4PK4 A;  4XLN F;  2Q3T A;  4G7O F;  4U5C E;  4YN0 B;  5COM A;  2M64 A;  1M56 C;  2OCC C;  1QSP A;  2M4E A;  2TMV P;  3I5P A;  3S90 A;  3PMR A;  1OQC A;  2A68 F;  4HFK B;  2CYD A;  2ICW G;  2J9V A;  3EFO A;  3AQB A;  1QVX A;  4HFF B;  4ONS A;  1KU2 A;  2FFH A;  3T6J A;  4BJ6 C;  2I8B A;  3X1O A;  3JT1 A;  1AVO B;  4KC9 A;  2GA0 A;  2RD9 A;  3AG2 C;  2A0U A;  2J7P D;  2HV6 A;  1Q0D A;  4JKV A;  4I3M A;  1CGM E;  3DE8 A;  4DBQ A;  3F47 A;  4YJW A;  2EPN A;  2WVO A;  2L9J A;  1FNT c;  2WZF A;  1ZHY A;  1QPU A;  4MQ9 F;  3TOL A;  4IAQ A;  3H2U A;  2A0B A;  4K0D A;  1HY5 A;  4A4A A;  3IPM O;  2PNO A;  1RMV A;  5A6B D;  2YQY A;  3GM2 A;  5L0D A;  2L81 A;  1ORY A;  4WAB A;  4BJ6 A;  5COG A;  2IXN A;  2HUJ A;  2Q9C A;  2YHS A;  5L0F A;  4U5D E;  2J9U A;  3HTK C;  3TK0 A;  2OJQ A;  3JSE O;  2YZS A;  5KYN A;  1V74 B;  4IWB A;  2O9X A;  3G4X A;  3UMK A;  1VLS A;  2NUT B;  3RFY A;  3SXM A;  4J7Y A;  2QE9 A;  3B9Q A;  4O79 A;  5KYU A;  1WAS A;  3DJU B;  3KPH A;  4LAC B;  4AE4 B;  1YJG A;  4BJ5 C;  4XPX A;  1RKE B;  1MMD A;  4U5G A;  3R7C A;  3NMI A;  1JAF A;  3U3B A;  3G50 A;  4NTA A;  2HSB A;  1T6U A;  2R03 A;  3EGX B;  5JLI A;  3BRJ A;  3EPV A;  2NSG A;  3LJB A;  3M15 A;  256B A;  1A0B A;  3LEO A;  3FVY A;  4D4X A;  2Q4F A;  2IOQ A;  4C7O B;  2D5R B;  2CDQ A;  1TFO B;  3L34 A;  3Q6M A;  5F5F A;  1OCZ C;  3C8Z A;  4G0H A;  5JS5 A;  4OIN F;  3WAQ A;  3PHF 2;  1LI7 A;  1W2W A;  2X51 A;  4YWQ A;  2XL4 A;  2VH3 A;  3ZVR A;  2LSE A;  2XL8 A;  4XEF A;  3RVZ A;  2J9W A;  1L7C A;  2A69 F;  4CS7 A;  3UGP A;  5AC5 A;  3KL4 A;  3SYN A;  3U2L A;  2JPU A;  3QMK A;  4YL0 A;  1T5O A;  1A7V A;  3JTL O;  2EPM X;  4JIO A;  3U9M A;  2IXO A;  2HSQ A;  2QTV A;  3HNJ A;  1K05 A;  4JCH A;  1NU9 C;  3GEH A;  3EGD B;  3PDM P;  4CDV A;  4P6I C;  4J7T A;  1TFK B;  4CBE A;  2KQ9 A;  4MVM A;  1AEP A;  1NU7 D;  2W4B A;  1S7Z A;  2WZG A;  1SMY F;  1BR1 A;  2DYS C;  3LS1 A;  4JTA B;  4B6I A;  4YT8 A;  1GGQ A;  4YK5 A;  1YDI A;  1A7D A;  5BQI A;  2Y3H A;  4PFP A;  3U9J A;  2QLA A;  5T1D B;  2A1D D;  3M1C B;  3E9V A;  4OIO F;  3LAY A;  4ZLD A;  3FMS A;  1VYK A;  3KYI A;  2CGE A;  4N4W A;  4YT5 A;  3NDB B;  3I5Q A;  3QW0 A;  5EHH A;  3U2M A;  3Q7L A;  3NMK A;  5E3A A;  4WJ0 A;  3IQ6 A;  1TWG A;  3JCU Q;  2PX3 A;  4NTF A;  4NQF A;  1R4T A;  3R2P A;  2HJ3 A;  3PCV A;  4RBN A;  2VB6 A;  5KYX B;  4ULW A;  2R7S A;  1U0B B;  5L0H A;  1K40 A;  2R7V A;  1GQA A;  1M2V A;  4E0I A;  1Z6A A;  4JRZ A;  1E83 A;  2NUP B;  1HMD A;  4KNV A;  2R7W A;  3IEE A;  3KYJ A;  1TWH A;  4IAR A;  2H8A A;  3GEI A;  1ZW3 A;  1YA9 A;  4LLE A;  5JT4 A;  3HJC A;  2J0W A;  3V7O A;  5JP7 A;  1FMV A;  4IJJ A;  2A6H F;  4EBB A;  1I4Z A;  2P0N A;  1T9K A;  5AC4 A;  3AQC A;  4FX5 A;  4LDQ A;  1L3P A;  5GPG B;  3EG9 B;  4YT2 A;  1EI7 A;  1NBB A;  5KYW A;  1M6T A;  4JTD B;  4PJM A;  1Z3I X;  2J46 A;  1M57 C;  1OW6 A;  4P9T A;  4YL3 A;  4XPY A;  5A6J A;  3CSK A;  1ZHZ A;  3HNI A;  1EKY A;  2VC9 A;  4FES A;  4PAC A;  3V5Z A;  4G7H F;  2XLO A;  2XXA B;  2OQM A;  2NG1 A;  3QZC A;  2HJM A;  1Z23 A;  2P6V A;  2GDC A;  1FAP B;  2EPK X;  2OOC A;  1ZYR F;  1WOL A;  2HV7 A;  2FGY A;  2LFD A;  2OJE D;  2P1A A;  2W9Y A;  4L6R A;  5FCL A;  1MQV A;  2L6H A;  3FOP A;  4JJG A;  4BPM A;  4YL1 A;  1BDJ B;  4JUR I;  3N0T A;  1EA8 A;  1C02 A;  4P9F A;  1S05 A;  3CQZ A;  3SZR A;  2PFD A;  3WHN A;  3HNK A;  1ZZP A;  2KJG A;  2HMZ A;  4I1O B;  1FR0 A;  3MX3 A;  3ZSU A;  3UMI A;  1QQ3 A;  1UG7 A;  1C17 M;  2Y3B A;  3JSZ A;  1I4Y A;  5L0I A;  3CEX A;  1A7E A;  2AWY A;  3S28 A;  3ZQV A;  2E87 A;  3DE9 A;  4Z9H A;  1LS4 A;  2J8W A;  4EBK A;  5A6K A;  2ETS A;  4JEA A;  4G7Z F;  1TWC A;  3VM6 A;  5L3V A;  4U5E E;  1LE4 A;  1LPE A;  3K33 A;  1TR2 A;  5DS5 A;  2JD3 A;  2VCB A;  4MVR A;  1OW8 A;  3DAG A;  2R9R B;  1R5I D;  1SR2 A;  3LLK A;  5TJ5 E;  3B0V C;  3N24 A;  2W45 A;  3VYW A;  1WGW A;  3RVY A;  4PJN A;  5L3Q A;  2XLM A;  2GAQ A;  3ZTZ A;  2R02 A;  4AK9 A;  1LIH A;  4ULV A;  2OU6 A;  1C03 A;  2AU5 A;  4O6M A;  3MFN A;  3ZTM A;  2Y69 C;  1RJ9 B;  2HFI A;  4JEB A;  2RSE B;  3F46 A;  2EPL X;  3U3F A;  3ECS A;  4YT4 A;  5L0C A;  3C8G A;  4H54 A;  1WWP A;  4IAO A;  4M63 A;  1JMW A;  4O6N A;  5E2Q A;  2Q7R A;  1DOV A;  3TJ5 A;  1Y6D A;  3VRC A;  3GOD A;  4EKW A;  1OXB A;  4N6C A;  4WGY A;  2XLH A;  4DJ9 A;  5HSW A;  1J8M F;  2B0H A;  1OKK A;  3HNL A;  4UDV A;  1I5N A;  4JJF A;  1Q0K A;  4OD4 A;  2XM4 A;  2WB7 A;  3C63 A;  4DVY P;  3NMJ A;  5CI8 A;  3LLI A;  3WG7 C;  1H9T A;  3EZH A;  3EJN A;  2EIN C;  2XLE A;  5EGY A;  2R7O A;  3TD7 A;  1MMN A;  1Q0G A;  3NRH A;  4NY3 A;  4HEA J;  5JSL A;  3AG3 C;  1GS9 A;  5DQT A;  1H9G A;  2AVK A;  3DM5 A;  1Z5Z A;  3M4C A;  4IGG A;  3ITF A;  1J8Y F;  1ORJ A;  2P61 A;  3GM3 A;  2P7V A;  3T4R A;  4BJ5 A;  3RIP A;  3I4U A;  3NKE A;  1BZ4 A;  1AUE A;  1HW1 A;  2HMQ A;  3S0X A;  3S29 A;  4Q7C A;  3L8J A;  5L0J A;  1MND A;  3G4Z A;  2PX0 A;  3AOU A;  2R7X A;  3DZA A;  2QY9 A; 
#chains in the Genus database with same CATH homology
 3IQ6 A;  4CJG A;  5JRA A;  2XLW A;  3M4B A;  1CGN A;  2YLD A;  3M79 A;  1GQA A;  1E83 A;  4EIY A;  3C62 A;  3L1M A;  4IAR A;  2CCY A;  5JT4 A;  4WGZ A;  4N6H A;  5JP7 A;  2YLG A;  1LM3 B;  1YZC A;  5AGF A;  1NBB A;  3ZWI A;  1YYJ A;  2YLI A;  1M6T A;  3QVY A;  2XM0 A;  3HNI A;  1EKY A;  2XLO A;  4NC3 A;  4JKV A;  2YL0 A;  3DE8 A;  4L6R A;  1QPU A;  1MQV A;  2XL6 A;  3FOP A;  3IQ5 A;  3TOL A;  4IAQ A;  1S05 A;  3HNK A;  1QQ3 A;  3ZQY A;  2YKZ A;  1E85 A;  4ER9 A;  1CPR A;  3DE9 A;  3ZQV A;  2J8W A;  4JEA A;  1YYX A;  4IB4 A;  1CPQ A;  3FOO A;  2J9B A;  4JE9 A;  3NMI A;  1JAF A;  2XLM A;  3ZTZ A;  5JUA A;  5JLI A;  3U8P A;  2XLD A;  256B A;  3M15 A;  4ULV A;  4D4X A;  3ZTM A;  1APC A;  4JEB A;  1CGO A;  5JS5 A;  1YZA A;  2XL8 A;  3VRC A;  4WGY A;  2XLH A;  1A7V A;  3HNL A;  1RCP A;  1BBH A;  3HNJ A;  5JVE A;  2XM4 A;  3C63 A;  4U9E A;  4CDY A;  3NMJ A;  4CDV A;  1E84 A;  5B3I A;  4CX9 A;  2XLE A;  5JSL A;  2QLA A;  2YL1 A;  4CDA A;  4CJO A;  2BC5 A;  2YL7 A;  2XLV A;  2YL3 A;  3M4C A;  3TOM A;  4CIP A;  1E86 A;  4N4W A;  4U9D A;  3QW0 A;  3QVZ A;  3QW1 A;  3NMK A;  4D4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...