3QVYA

Crystal structure of the zn-ridc1 complex stabilized by bmoe crosslinks
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHDALHLANECKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome cb562
publication title Templated construction of a zn-selective protein dimerization motif.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 42
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3qvyA00
1S05A 4WGZA 3ZTMA 1NBBA 5JT4A 256BA 1MQVA 4JEBA 4EIYA 2YLDA 4CJGA 4ER9A 4JEAA 2YL7A 4U9EA 5JVEA 1GQAA 3HNIA 3ZTZA 5JUAA 3M4BA 3QVZA 4JKVA 2XLHA 3DE8A 3IQ5A 4L6RA 2XLVA 4IARA 2YL1A 2J9BA 4WGYA 2CCYA 3QW1A 4IB4A 5JP7A 2XM4A 1BBHA 3NMJA 4ULVA 1LM3B 2XLMA 3TOMA 2YLIA 3QVYA 2XM0A 4D4XA 1YZAA 5JSLA 4JE9A 3QW0A 3FOPA 1YYJA 2QLAA 1A7VA 4CX9A 2XL8A 1E84A 3NMKA 3M79A 4CDYA 1QPUA 5B3IA 1APCA 4N4WA 3M15A 3DE9A 3HNJA 5JRAA 1CGOA 4U9DA 4CJOA 2BC5A 1YZCA 5AGFA 2YL3A 4D4NA 3ZQVA 2XLDA 3C63A 2XLOA 4N6HA 1E85A 4CIPA 4NC3A 1JAFA 2XLEA 1RCPA 1CGNA 1CPQA 4CDVA 1E83A 2XLWA 1E86A 3ZQYA 2J8WA 3U8PA 3HNKA 2YL0A 3C62A 4CDAA 1QQ3A 4IAQA 3TOLA 3ZWIA 1EKYA 2YKZA 3IQ6A 3HNLA 1YYXA 3VRCA 3L1MA 2XL6A 5JS5A 1M6TA 3FOOA 2YLGA 3NMIA 5JLIA 1CPRA 3M4CA
chains in the Genus database with same CATH superfamily
1WN0A 3EHNA 4IJJA 2X51A 4PK4A 1S05A 2G62A 4OIQF 1G8XA 1XWJA 4YT2A 2R9RB 4BJ6C 3EH2A 3IQTA 3NYLA 5JT4A 2Q00A 1QLEC 3F47A 1KNYA 1VTMP 2R7RA 4KNWA 4EIYA 5KYYA 2UUIA 2W4BA 2WZGA 2MWQA 4AX2A 1LKXA 2WB7A 4U9EA 1T6IA 2VC9A 1XZQA 2ZD9A 3GM1A 2R05A 2QNLA 3FAJA 5JUAA 4KC9A 3W4YA 1ZW3A 3U9MA 3QVZA 3LESA 4JKVA 4YL1A 2XLHA 4JZAA 1NFNA 2HJMA 2WVQA 2HS5A 1H6GA 2H7BA 3DE8A 3IQ5A 4E17A 3UMHA 4PACA 1TWHA 3GODA 1T01A 5COGA 2XXAB 3SXYA 4NTFA 1HMOA 3IPMO 2DI3A 3I4UA 2Y3BA 3ZC4A 4DVZA 4O79A 1JMWA 2EPMX 1ZHZA 4JCHA 3TK0A 1MMNA 4MW3A 1D0YA 3SZRA 2XS8A 5F5HA 5AC5A 5JP7A 3EPVA 5CIVA 2GFHA 3GANA 4I1OB 1FMWA 3KYIA 4CS8C 1BBHA 4EHPA 1R5ID 4EBJA 5KYWA 3SNHA 3JSEO 2IXMA 1SYQA 1NFOA 2AWCA 3LLIA 3J06A 3A11A 3N2ZB 2R7OA 4PR9A 3T6GB 3V5ZA 3GM3A 1NSGB 1JOGA 3NYJA 1YZAA 1A0BA 4MVRA 4MQ9F 2L6GA 2W9YA 4CIHA 2Y39A 4JE9A 3N24A 1GS9A 3DI5A 3JTLO 3Q6NA 1I5NA 3DAFA 3QW0A 4DRHB 3AOUA 5A6KA 2NUPB 3EGXB 1YYJA 3JZ0A 4YT4A 4YWQA 3IQCA 5L3QA 2OKUA 3UMIA 1E84A 4CDYA 2YHSA 1APCA 4O6MA 4E7ZA 3FHDA 2IOQA 4N4WA 3CZ6A 2OEVA 4EKWA 4JC7A 1GM5A 3DE9A 1SMYF 4NQFA 1MMGA 3TQOA 2LFFA 4K1OA 2QY9A 2A0BA 4AK9A 5KYYB 2L6FA 2XS1A 1JR8A 3JYHA 2HSQA 1SR2A 2Q9AA 2PP4A 3AJMA 3MYFA 3I5QA 1H9GA 4KBLA 3EFOA 4U5DE 3TJ6A 3X2QC 5DS6A 2NSGA 3DZAA 3W2WA 1JPNA 1PV3A 4BEMJ 1WOLA 4F4BA 2JD3A 3FVYA 4CS9A 4EBBA 2IXOA 1C02A 4DOZA 3C63A 2P6VA 2XLOA 5BUOA 1BR2A 1UFBA 2R7QA 1M56C 1LPEA 3KMIA 3NRHA 4AL1A 4CS7A 4GQHA 2XLEA 3DWWA 4MVSA 3W8HA 2CDQA 1Q0DA 3LEVA 4J32B 5L0FA 2XLWA 4G7ZF 4CSAA 3K66A 1FFHA 3HNKA 1ZU4A 1ORJA 3EQLF 4M63A 2LQGA 2B0HA 3DJUB 3EHMA 1G4WR 5L0CA 3ZDLA 3RFYA 1SF8A 4C3EA 1GGQA 1KU2A 1VLSA 3SYNA 1QQ3A 1NU9C 2L9JA 4LACB 3R2PA 3UNGC 2KSFA 4Z9IA 3TOLA 3US6A 1K05A 2QE9A 1WATA 1YAUO 2ZPAA 3DMDA 3V7OA 3CEXA 5L3VA 2VB6A 4UDVA 1OW6A 1C17M 4MVZA 3HJCA 3L1MA 2V3CC 4GYTA 2GWWA 4RBNA 3WG7C 1G4US 4MTGA 2ETSA 1OCZC 3FOOA 4U5GA 2NUTB 4P9FA 1ZHYA 1HY5A 2G3KA 4JVSA 5T1DB 4MVQA 2Q9BA 3RF3A 4YT5A 2XRHA 2XXAA 2Q3TA 4EWCA 2EIKC 3PMRA 2X0CA 3V5YA 4WGZA 1A7EA 3POVA 5BQGA 4LDQA 3H65A 3IEEA 1NBBA 4CBEA 3WODF 2YQYA 1VYKA 5B1AC 5A6BD 4EUKB 256BA 4XTKA 5CI9A 1U89A 4FESA 4BEJA 3AG1C 4CJGA 2E87A 1DOVA 2OCCC 3A9CA 4JEAA 4XPWA 5KYXA 4KI2A 4AE4A 3EZHA 2Q4FA 3HNIA 3RVYA 1HE9A 3M4BA 4YJWA 2WVNA 4HFFB 1Z23A 4XPXA 2Y69C 3RYLA 5E3CA 3ATPA 4JW1A 4P9TA 1F1MA 4IARA 1VMAA 4BJ5C 2VCBA 1LE2A 2YL1A 4GEHA 1TKNA 2NUPA 1IZMA 2PNOA 3EGXA 5A6JA 2DYSC 4P6IC 4J7YA 4XLPF 2L6HA 3T4RA 1Z5ZA 1AEPA 3NG1A 2CCYA 3HTKC 1L7CA 1S7ZA 3B71A 4IB4A 3W2VA 1T6UA 1LIHA 3ABMC 4JIOA 5DS5A 1O87A 2XM4A 5B1BC 2EINC 5A6BA 1LM3B 3E70C 3DM9B 2XLMA 1TWGA 2YLIA 3MBGA 3RIPA 3QVYA 5B3SC 3S0XA 3AGTA 1Z6AA 2J7PD 2XM0A 4JURI 1Y6DA 2J9VA 5BQHA 4ULWA 1OR3A 1RKEA 2KGOA 3DM5A 1N1CA 5E33A 3O10A 2HJ3A 3B9QA 5KYUB 3TULA 3FOPA 2A0UA 3LLKA 1G5ZA 2ZXPA 1RJ9A 4YN0B 4LDKA 2R7UA 3X1OA 2Q7RA 3NMKA 1ZYRF 4G78A 2ZXWC 3KKBA 5KYNA 3JRMO 2PX3A 2ZXRA 1U0BB 2CGEA 5T3TA 2KC3A 3GEEA 4O6NA 3CAXA 4JCZA 1FAPB 2AWYA 2C03A 5KYXB 1J8MF 1TFOB 1AVOB 3C18A 4C3DA 1EA8A 4AE4B 2J7PA 2VCAA 3K1HA 4U9DA 4Z9JA 4YK5A 3L34A 2UUHA 3ABLC 3F46A 3U8VA 1MNDA 4HE8D 5IY5C 2BC5A 1YZCA 4IRUA 1B68A 1L3PA 4HFKB 2YL3A 4NY3A 5AGFA 4XLNF 1Z7Qc 4OD4A 5DQTA 1ZU5A 3S27A 4N06A 2WZFA 1T5OA 2A6EF 2KW3C 4JJFA 1A7DA 4N6HA 1E85A 2Y3HA 1DOWA 3W8IA 1LS1A 4ZLDA 1RCPA 5FCLA 1CPQA 2NUTA 1Q0KA 1TQGA 5L0GA 3HLZA 2LSEA 3QTHA 3O6XA 3ABKC 5HSWA 3G50A 5DLJA 4JTAB 4DVYP 2PF4E 4Z9HA 1BZ4A 3VYWA 2J9WA 3ZWIA 2JX0A 2OU6A 1C03A 5COFA 3RVZA 1TWCA 1M2OA 2OJED 2YKZA 1RKEB 2BL2A 3B0PA 3DKAA 1ZHTA 1RMVA 1D1AA 2VASA 4K7BA 1ST6A 2OG2A 3DAGA 2A68F 1M57C 2LFDA 2H7VC 2AU5A 3PCVA 3VRCA 3B0UX 2AVKA 3NKDA 1SZIA 2OJQA 1RJ9B 1Q0FA 3T6BA 2P7VA 5JLIA 3KL4A 1QKRA 1V74B 4G7HF 1MNEA 2G3VA 1OW8A 2PFDA 1V54C 2NSFA 3M4CA 4DXWA 1QSPA 2BE5F 3EH1A 1I4ZA 5DS4A 3RKOF 2J0XA 2W4MA 3V5XA 4MVUA 1LI5A 3K1IA 3B29A 4YL3A 1FMVA 1YA9A 2HUJA 4ONSA 2QTVA 3ECSA 4PJJA 3AG3C 4Q7CA 4YL0A 2GA0A 1WASA 3OEOA 3AQCA 2ICWG 4PFOA 4LLEA 1MQVA 4JEBA 2YLDA 4ER9A 2P1AA 2R7XA 2KK1A 1Z3IX 4JTCB 4LLCA 3K33A 1WGWA 2R03A 1NZEA 3KYJA 4XQ1A 2D4UA 4ZLCA 2CYDA 5JVEA 1GQAA 2XSEA 3ZTZA 1YVIA 1OW7A 1OKKD 2KNHA 3DJNB 3C8ZA 1EI7A 2R7VA 2EIMC 2TMVP 5KYUA 2D5RB 4CS9C 1H9TA 1OXKA 2LD6A 2P61A 2XLVA 2HV6A 4LDRA 4MVOA 2J45A 1JRAA 3KPHA 4CX9A 4DJ9A 3S29A 2KYHA 4H4KC 2J9BA 1OCRC 4XEVA 3FXHA 5L0DA 2R02A 1ZW2A 4I1MA 3QW1A 3HKKA 3UMKA 4CSAC 1LI7A 3T9OA 1BR1A 4MTFA 3ZSUA 4E0HA 4Q4ZF 2ASRA 2A6HF 3NMJA 4X0RA 3TOMA 2IYLD 3U9JA 1Y4CA 3PHF2 5A6AA 4D4XA 2YZSA 5EK0A 2B0JA 5JSLA 3B0VC 2EILC 3JSZA 1OKKA 3S84A 2Z15A 3NYMA 4W8PA 4EBKA 2QLAA 5L0HA 1D0XA 3EZIA 5EHHA 3AQBA 2XL8A 4IGGA 3JT1A 3G4XA 5GPGB 3ZVRA 2YRFA 3RQEA 1BDJB 3SEOA 3DD7A 4BJ6A 1NG1A 1QPUA 4A2NB 4OIPF 1R4TA 1OCOC 2DB4A 3OWTA 4G0HA 1VLTA 4QDLA 5FZTA 4C3BA 4DRIB 4QI2A 3SXKA 3SP1A 3M15A 4O6YA 1RXQA 2W45A 1E2XA 4W8KA 2XL4A 1A41A 1T6QA 2IBFA 1JPJA 1AUEA 1IW7F 1W2WA 2GAQA 2J46A 3I5PA 3LJBA 3VF0A 4PJLA 4E0IA 2FFHA 2HKVA 3T6JA 3LUTB 1CGOA 3O55A 2R7WA 2IM8A 2MYSA 3EGDB 4XEFA 2AP3A 3C7JA 5HV9A 4CJOA 2QUPA 4PFPA 1YA7O 2VCCA 3WHNA 1ZZPA 4IAOA 1OQCA 4I44A 1YJGA 2R25A 1D1CA 1HW1A 5D91A 4U5BE 1OXBA 3FDQA 4OIOF 2PX0A 4U5EE 1JAFA 3AGUA 5D92A 1ZHXA 1CGNA 2OOCA 3MFNA 3SXMA 1VOMA 3OA1A 1E86A 1Z63A 3DXJF 2EPLX 4CS8A 4BPMA 2J8WA 4OIRF 3U8PA 5TJ5E 4C7OB 2YL0A 3CSKA 2OEXA 4JTDB 2RSEB 1WWPA 3MX3A 4FAPB 4IWBA 2EIJC 2DYRC 4YT8A 3RQGA 4OD5A 2VH3A 4CDAA 1D0ZA 1PD1A 2DGJA 2WL8A 2Q9CA 1MMAA 1TFKB 4MVMA 1Q0GA 4DBQA 3UR3C 4K0DA 3RQFA 3IQ6A 2H8AA 5DVWA 3RW0A 2IXPA 1YYXA 2O9XA 4JRZA 2LP4A 3LNMB 2XL6A 3AG2C 3JYYA 2P0NA 4NTBA 3H2VA 3LS0A 3R7CA 2WVOA 3NMIA 4XEKA 4MW8A 4A4AA 1H7IA 1TR2A 3C8GB 4U5FE 2C04A 3U3FA 3TD7A 1BR4A 3GORA 4Q5SF 2H7OA 1I4YA 3BRJA 1M2VB 1LE4A 3KH2A 3ZIBA 3IHUA 4J30B 3LNRA 4FWVA 1K04A 3ZTMA 2LCHA 2WZLA 4DBRA 1QZXA 4H54A 3LEOA 5CI8A 2L81A 3UGOA 4MTOA 4O7GA 4G7OF 4AL0A 2YL7A 3AG4C 2Y3GA 1YDIA 3UGPA 2NPUA 4PJMA 3VAYA 1J8YF 5DQZA 5K0IA 4LERA 3PDMP 5F5FA 4L6RA 1FNTc 1K40A 1YLMA 2YWAA 4XWJA 1FFTC 2V26A 2J0WA 3S90A 1LVKA 1LS4A 3EJNA 3L0IA 4WGYA 1U6HA 2J9UA 3GEHA 2ZXOA 2EPOA 4WABA 2I15A 2F22A 3O39A 1V55C 3ASOC 4BJTA 2EPKX 4MS2A 3U2MA 5L0IA 2HSBA 3NDBB 3GWNA 4JJGA 4DRJB 1CGME 1HW2A 3U5SA 2HFIA 4ULVA 3VM6A 3WAQA 5AC4A 2A1DD 5E3AA 1VB5A 1ZVZA 1MMDA 2KQ9A 1O5HA 3JCUQ 3NKEA 1FTSA 3TJ5A 1KTMA 2YVKA 3EGDA 3QZCA 1TWAA 4E18A 4MNDA 4XPYA 1EQ1A 1NU7D 1OR2A 5L0JA 3EG9A 2FGYA 3BEHA 4RD9A 4WJ0A 4N6CA 5T3WA 3SXZA 1VK5A 3S28A 1ORSC 2A69F 1A7VA 3E9VA 4R32A 5EGYA 3S9OA 3C8GD 2CW0F 2M4EA 3M79A 5E2QA 2JPUA 5B3IA 5A69A 1ORYA 2HMZA 2PBEA 5KYWB 2I8BA 1PD0A 3U0CA 4C7OA 1UG7A 2HV7A 4BJ1A 4U5HA 2CNWD 3HNJA 3K1IC 3GM2A 2LIGA 3RH3A 1T9KA 5JRAA 3CQZA 4I3MA 5F28E 1FR0A 4FX5A 3Q7LA 1Q0MA 1HE1A 3ASNC 3G4ZA 3ITFA 4BJ5A 4D4NA 3ZQVA 4QI0A 1PCXA 2XLDA 5COMA 3H2UA 1XZPA 3GEIA 3LAYA 4B6IA 3MLGA 4CIPA 4NC3A 1D1BA 2MHRA 4OINF 2R7SA 4CDVA 3GWLA 1E83A 2LK4A 3FAPB 1WTYA 3C8GA 3MYIA 2R7TA 3K7DA 3ZQYA 3L8IA 2Y3DA 4HEAJ 4J7TA 3U3BA 3U2LA 3QMKA 4BG0A 1NLXA 4RDAA 1VYIA 2HZ8A 4U5CE 3C62A 2M64A 1M2VA 4KNVA 2RD9A 5BQIA 2YEVA 3L8JA 2CNWA 2OQMA 3M1CB 2FAPB 4IAQA 3EFOB 1EKYA 2HMQA 2IXNA 1RKCA 1QVXA 3HNLA 3ZG1A 4E7SA 2NG1A 1V4AA 3Q7GA 4NCQA 4NTAA 3EG9B 3FMSA 2KJGA 1OCCC 5JS5A 1M6TA 3LS1A 2YLGA 1O3UA 2EPNA 3JRTA 1HMDA 3Q6MA 4PJNA 2L7AA 1YARO 4ANJA 1ZHWA 1CPRA 3K6BA 3N0TA 2GDCA
chains in the Genus database with same CATH topology
1S05A 4WGZA 3ZTMA 1NBBA 5JT4A 256BA 1MQVA 4JEBA 4EIYA 2YLDA 4CJGA 4ER9A 4JEAA 2YL7A 4U9EA 5JVEA 1GQAA 3HNIA 3ZTZA 5JUAA 3M4BA 3QVZA 4JKVA 2XLHA 3DE8A 3IQ5A 4L6RA 2XLVA 4IARA 2YL1A 2J9BA 4WGYA 2CCYA 3QW1A 4IB4A 5JP7A 2XM4A 1BBHA 3NMJA 4ULVA 1LM3B 2XLMA 3TOMA 2YLIA 3QVYA 2XM0A 4D4XA 1YZAA 5JSLA 4JE9A 3QW0A 3FOPA 1YYJA 2QLAA 1A7VA 4CX9A 2XL8A 1E84A 3NMKA 3M79A 4CDYA 1QPUA 5B3IA 1APCA 4N4WA 3M15A 3DE9A 3HNJA 5JRAA 1CGOA 4U9DA 4CJOA 2BC5A 1YZCA 5AGFA 2YL3A 4D4NA 3ZQVA 2XLDA 3C63A 2XLOA 4N6HA 1E85A 4CIPA 4NC3A 1JAFA 2XLEA 1RCPA 1CGNA 1CPQA 4CDVA 1E83A 2XLWA 1E86A 3ZQYA 2J8WA 3U8PA 3HNKA 2YL0A 3C62A 4CDAA 1QQ3A 4IAQA 3TOLA 3ZWIA 1EKYA 2YKZA 3IQ6A 3HNLA 1YYXA 3VRCA 3L1MA 2XL6A 5JS5A 1M6TA 3FOOA 2YLGA 3NMIA 5JLIA 1CPRA 3M4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S05 A;  4WGZ A;  3ZTM A;  1NBB A;  5JT4 A;  256B A;  1MQV A;  4JEB A;  4EIY A;  2YLD A;  4CJG A;  4ER9 A;  4JEA A;  2YL7 A;  4U9E A;  5JVE A;  1GQA A;  3HNI A;  3ZTZ A;  5JUA A;  3M4B A;  3QVZ A;  4JKV A;  2XLH A;  3DE8 A;  3IQ5 A;  4L6R A;  2XLV A;  4IAR A;  2YL1 A;  2J9B A;  4WGY A;  2CCY A;  3QW1 A;  4IB4 A;  5JP7 A;  2XM4 A;  1BBH A;  3NMJ A;  4ULV A;  1LM3 B;  2XLM A;  3TOM A;  2YLI A;  3QVY A;  2XM0 A;  4D4X A;  1YZA A;  5JSL A;  4JE9 A;  3QW0 A;  3FOP A;  1YYJ A;  2QLA A;  1A7V A;  4CX9 A;  2XL8 A;  1E84 A;  3NMK A;  3M79 A;  4CDY A;  1QPU A;  5B3I A;  1APC A;  4N4W A;  3M15 A;  3DE9 A;  3HNJ A;  5JRA A;  1CGO A;  4U9D A;  4CJO A;  2BC5 A;  1YZC A;  5AGF A;  2YL3 A;  4D4N A;  3ZQV A;  2XLD A;  3C63 A;  2XLO A;  4N6H A;  1E85 A;  4CIP A;  4NC3 A;  1JAF A;  2XLE A;  1RCP A;  1CGN A;  1CPQ A;  4CDV A;  1E83 A;  2XLW A;  1E86 A;  3ZQY A;  2J8W A;  3U8P A;  3HNK A;  2YL0 A;  3C62 A;  4CDA A;  1QQ3 A;  4IAQ A;  3TOL A;  3ZWI A;  1EKY A;  2YKZ A;  3IQ6 A;  3HNL A;  1YYX A;  3VRC A;  3L1M A;  2XL6 A;  5JS5 A;  1M6T A;  3FOO A;  2YLG A;  3NMI A;  5JLI A;  1CPR A;  3M4C A; 
#chains in the Genus database with same CATH topology
 1WN0 A;  3EHN A;  4IJJ A;  2X51 A;  4PK4 A;  1S05 A;  2G62 A;  4OIQ F;  1G8X A;  1XWJ A;  4YT2 A;  2R9R B;  4BJ6 C;  3EH2 A;  3IQT A;  3NYL A;  5JT4 A;  2Q00 A;  1QLE C;  3F47 A;  1KNY A;  1VTM P;  2R7R A;  4KNW A;  4EIY A;  5KYY A;  2UUI A;  2W4B A;  2WZG A;  2MWQ A;  4AX2 A;  1LKX A;  2WB7 A;  4U9E A;  1T6I A;  2VC9 A;  1XZQ A;  2ZD9 A;  3GM1 A;  2R05 A;  2QNL A;  3FAJ A;  5JUA A;  4KC9 A;  3W4Y A;  1ZW3 A;  3U9M A;  3QVZ A;  3LES A;  4JKV A;  4YL1 A;  2XLH A;  4JZA A;  1NFN A;  2HJM A;  2WVQ A;  2HS5 A;  1H6G A;  2H7B A;  3DE8 A;  3IQ5 A;  4E17 A;  3UMH A;  4PAC A;  1TWH A;  3GOD A;  1T01 A;  5COG A;  2XXA B;  3SXY A;  4NTF A;  1HMO A;  3IPM O;  2DI3 A;  3I4U A;  2Y3B A;  3ZC4 A;  4DVZ A;  4O79 A;  1JMW A;  2EPM X;  1ZHZ A;  4JCH A;  3TK0 A;  1MMN A;  4MW3 A;  1D0Y A;  3SZR A;  2XS8 A;  5F5H A;  5AC5 A;  5JP7 A;  3EPV A;  5CIV A;  2GFH A;  3GAN A;  4I1O B;  1FMW A;  3KYI A;  4CS8 C;  1BBH A;  4EHP A;  1R5I D;  4EBJ A;  5KYW A;  3SNH A;  3JSE O;  2IXM A;  1SYQ A;  1NFO A;  2AWC A;  3LLI A;  3J06 A;  3A11 A;  3N2Z B;  2R7O A;  4PR9 A;  3T6G B;  3V5Z A;  3GM3 A;  1NSG B;  1JOG A;  3NYJ A;  1YZA A;  1A0B A;  4MVR A;  4MQ9 F;  2L6G A;  2W9Y A;  4CIH A;  2Y39 A;  4JE9 A;  3N24 A;  1GS9 A;  3DI5 A;  3JTL O;  3Q6N A;  1I5N A;  3DAF A;  3QW0 A;  4DRH B;  3AOU A;  5A6K A;  2NUP B;  3EGX B;  1YYJ A;  3JZ0 A;  4YT4 A;  4YWQ A;  3IQC A;  5L3Q A;  2OKU A;  3UMI A;  1E84 A;  4CDY A;  2YHS A;  1APC A;  4O6M A;  4E7Z A;  3FHD A;  2IOQ A;  4N4W A;  3CZ6 A;  2OEV A;  4EKW A;  4JC7 A;  1GM5 A;  3DE9 A;  1SMY F;  4NQF A;  1MMG A;  3TQO A;  2LFF A;  4K1O A;  2QY9 A;  2A0B A;  4AK9 A;  5KYY B;  2L6F A;  2XS1 A;  1JR8 A;  3JYH A;  2HSQ A;  1SR2 A;  2Q9A A;  2PP4 A;  3AJM A;  3MYF A;  3I5Q A;  1H9G A;  4KBL A;  3EFO A;  4U5D E;  3TJ6 A;  3X2Q C;  5DS6 A;  2NSG A;  3DZA A;  3W2W A;  1JPN A;  1PV3 A;  4BEM J;  1WOL A;  4F4B A;  2JD3 A;  3FVY A;  4CS9 A;  4EBB A;  2IXO A;  1C02 A;  4DOZ A;  3C63 A;  2P6V A;  2XLO A;  5BUO A;  1BR2 A;  1UFB A;  2R7Q A;  1M56 C;  1LPE A;  3KMI A;  3NRH A;  4AL1 A;  4CS7 A;  4GQH A;  2XLE A;  3DWW A;  4MVS A;  3W8H A;  2CDQ A;  1Q0D A;  3LEV A;  4J32 B;  5L0F A;  2XLW A;  4G7Z F;  4CSA A;  3K66 A;  1FFH A;  3HNK A;  1ZU4 A;  1ORJ A;  3EQL F;  4M63 A;  2LQG A;  2B0H A;  3DJU B;  3EHM A;  1G4W R;  5L0C A;  3ZDL A;  3RFY A;  1SF8 A;  4C3E A;  1GGQ A;  1KU2 A;  1VLS A;  3SYN A;  1QQ3 A;  1NU9 C;  2L9J A;  4LAC B;  3R2P A;  3UNG C;  2KSF A;  4Z9I A;  3TOL A;  3US6 A;  1K05 A;  2QE9 A;  1WAT A;  1YAU O;  2ZPA A;  3DMD A;  3V7O A;  3CEX A;  5L3V A;  2VB6 A;  4UDV A;  1OW6 A;  1C17 M;  4MVZ A;  3HJC A;  3L1M A;  2V3C C;  4GYT A;  2GWW A;  4RBN A;  3WG7 C;  1G4U S;  4MTG A;  2ETS A;  1OCZ C;  3FOO A;  4U5G A;  2NUT B;  4P9F A;  1ZHY A;  1HY5 A;  2G3K A;  4JVS A;  5T1D B;  4MVQ A;  2Q9B A;  3RF3 A;  4YT5 A;  2XRH A;  2XXA A;  2Q3T A;  4EWC A;  2EIK C;  3PMR A;  2X0C A;  3V5Y A;  4WGZ A;  1A7E A;  3POV A;  5BQG A;  4LDQ A;  3H65 A;  3IEE A;  1NBB A;  4CBE A;  3WOD F;  2YQY A;  1VYK A;  5B1A C;  5A6B D;  4EUK B;  256B A;  4XTK A;  5CI9 A;  1U89 A;  4FES A;  4BEJ A;  3AG1 C;  4CJG A;  2E87 A;  1DOV A;  2OCC C;  3A9C A;  4JEA A;  4XPW A;  5KYX A;  4KI2 A;  4AE4 A;  3EZH A;  2Q4F A;  3HNI A;  3RVY A;  1HE9 A;  3M4B A;  4YJW A;  2WVN A;  4HFF B;  1Z23 A;  4XPX A;  2Y69 C;  3RYL A;  5E3C A;  3ATP A;  4JW1 A;  4P9T A;  1F1M A;  4IAR A;  1VMA A;  4BJ5 C;  2VCB A;  1LE2 A;  2YL1 A;  4GEH A;  1TKN A;  2NUP A;  1IZM A;  2PNO A;  3EGX A;  5A6J A;  2DYS C;  4P6I C;  4J7Y A;  4XLP F;  2L6H A;  3T4R A;  1Z5Z A;  1AEP A;  3NG1 A;  2CCY A;  3HTK C;  1L7C A;  1S7Z A;  3B71 A;  4IB4 A;  3W2V A;  1T6U A;  1LIH A;  3ABM C;  4JIO A;  5DS5 A;  1O87 A;  2XM4 A;  5B1B C;  2EIN C;  5A6B A;  1LM3 B;  3E70 C;  3DM9 B;  2XLM A;  1TWG A;  2YLI A;  3MBG A;  3RIP A;  3QVY A;  5B3S C;  3S0X A;  3AGT A;  1Z6A A;  2J7P D;  2XM0 A;  4JUR I;  1Y6D A;  2J9V A;  5BQH A;  4ULW A;  1OR3 A;  1RKE A;  2KGO A;  3DM5 A;  1N1C A;  5E33 A;  3O10 A;  2HJ3 A;  3B9Q A;  5KYU B;  3TUL A;  3FOP A;  2A0U A;  3LLK A;  1G5Z A;  2ZXP A;  1RJ9 A;  4YN0 B;  4LDK A;  2R7U A;  3X1O A;  2Q7R A;  3NMK A;  1ZYR F;  4G78 A;  2ZXW C;  3KKB A;  5KYN A;  3JRM O;  2PX3 A;  2ZXR A;  1U0B B;  2CGE A;  5T3T A;  2KC3 A;  3GEE A;  4O6N A;  3CAX A;  4JCZ A;  1FAP B;  2AWY A;  2C03 A;  5KYX B;  1J8M F;  1TFO B;  1AVO B;  3C18 A;  4C3D A;  1EA8 A;  4AE4 B;  2J7P A;  2VCA A;  3K1H A;  4U9D A;  4Z9J A;  4YK5 A;  3L34 A;  2UUH A;  3ABL C;  3F46 A;  3U8V A;  1MND A;  4HE8 D;  5IY5 C;  2BC5 A;  1YZC A;  4IRU A;  1B68 A;  1L3P A;  4HFK B;  2YL3 A;  4NY3 A;  5AGF A;  4XLN F;  1Z7Q c;  4OD4 A;  5DQT A;  1ZU5 A;  3S27 A;  4N06 A;  2WZF A;  1T5O A;  2A6E F;  2KW3 C;  4JJF A;  1A7D A;  4N6H A;  1E85 A;  2Y3H A;  1DOW A;  3W8I A;  1LS1 A;  4ZLD A;  1RCP A;  5FCL A;  1CPQ A;  2NUT A;  1Q0K A;  1TQG A;  5L0G A;  3HLZ A;  2LSE A;  3QTH A;  3O6X A;  3ABK C;  5HSW A;  3G50 A;  5DLJ A;  4JTA B;  4DVY P;  2PF4 E;  4Z9H A;  1BZ4 A;  3VYW A;  2J9W A;  3ZWI A;  2JX0 A;  2OU6 A;  1C03 A;  5COF A;  3RVZ A;  1TWC A;  1M2O A;  2OJE D;  2YKZ A;  1RKE B;  2BL2 A;  3B0P A;  3DKA A;  1ZHT A;  1RMV A;  1D1A A;  2VAS A;  4K7B A;  1ST6 A;  2OG2 A;  3DAG A;  2A68 F;  1M57 C;  2LFD A;  2H7V C;  2AU5 A;  3PCV A;  3VRC A;  3B0U X;  2AVK A;  3NKD A;  1SZI A;  2OJQ A;  1RJ9 B;  1Q0F A;  3T6B A;  2P7V A;  5JLI A;  3KL4 A;  1QKR A;  1V74 B;  4G7H F;  1MNE A;  2G3V A;  1OW8 A;  2PFD A;  1V54 C;  2NSF A;  3M4C A;  4DXW A;  1QSP A;  2BE5 F;  3EH1 A;  1I4Z A;  5DS4 A;  3RKO F;  2J0X A;  2W4M A;  3V5X A;  4MVU A;  1LI5 A;  3K1I A;  3B29 A;  4YL3 A;  1FMV A;  1YA9 A;  2HUJ A;  4ONS A;  2QTV A;  3ECS A;  4PJJ A;  3AG3 C;  4Q7C A;  4YL0 A;  2GA0 A;  1WAS A;  3OEO A;  3AQC A;  2ICW G;  4PFO A;  4LLE A;  1MQV A;  4JEB A;  2YLD A;  4ER9 A;  2P1A A;  2R7X A;  2KK1 A;  1Z3I X;  4JTC B;  4LLC A;  3K33 A;  1WGW A;  2R03 A;  1NZE A;  3KYJ A;  4XQ1 A;  2D4U A;  4ZLC A;  2CYD A;  5JVE A;  1GQA A;  2XSE A;  3ZTZ A;  1YVI A;  1OW7 A;  1OKK D;  2KNH A;  3DJN B;  3C8Z A;  1EI7 A;  2R7V A;  2EIM C;  2TMV P;  5KYU A;  2D5R B;  4CS9 C;  1H9T A;  1OXK A;  2LD6 A;  2P61 A;  2XLV A;  2HV6 A;  4LDR A;  4MVO A;  2J45 A;  1JRA A;  3KPH A;  4CX9 A;  4DJ9 A;  3S29 A;  2KYH A;  4H4K C;  2J9B A;  1OCR C;  4XEV A;  3FXH A;  5L0D A;  2R02 A;  1ZW2 A;  4I1M A;  3QW1 A;  3HKK A;  3UMK A;  4CSA C;  1LI7 A;  3T9O A;  1BR1 A;  4MTF A;  3ZSU A;  4E0H A;  4Q4Z F;  2ASR A;  2A6H F;  3NMJ A;  4X0R A;  3TOM A;  2IYL D;  3U9J A;  1Y4C A;  3PHF 2;  5A6A A;  4D4X A;  2YZS A;  5EK0 A;  2B0J A;  5JSL A;  3B0V C;  2EIL C;  3JSZ A;  1OKK A;  3S84 A;  2Z15 A;  3NYM A;  4W8P A;  4EBK A;  2QLA A;  5L0H A;  1D0X A;  3EZI A;  5EHH A;  3AQB A;  2XL8 A;  4IGG A;  3JT1 A;  3G4X A;  5GPG B;  3ZVR A;  2YRF A;  3RQE A;  1BDJ B;  3SEO A;  3DD7 A;  4BJ6 A;  1NG1 A;  1QPU A;  4A2N B;  4OIP F;  1R4T A;  1OCO C;  2DB4 A;  3OWT A;  4G0H A;  1VLT A;  4QDL A;  5FZT A;  4C3B A;  4DRI B;  4QI2 A;  3SXK A;  3SP1 A;  3M15 A;  4O6Y A;  1RXQ A;  2W45 A;  1E2X A;  4W8K A;  2XL4 A;  1A41 A;  1T6Q A;  2IBF A;  1JPJ A;  1AUE A;  1IW7 F;  1W2W A;  2GAQ A;  2J46 A;  3I5P A;  3LJB A;  3VF0 A;  4PJL A;  4E0I A;  2FFH A;  2HKV A;  3T6J A;  3LUT B;  1CGO A;  3O55 A;  2R7W A;  2IM8 A;  2MYS A;  3EGD B;  4XEF A;  2AP3 A;  3C7J A;  5HV9 A;  4CJO A;  2QUP A;  4PFP A;  1YA7 O;  2VCC A;  3WHN A;  1ZZP A;  4IAO A;  1OQC A;  4I44 A;  1YJG A;  2R25 A;  1D1C A;  1HW1 A;  5D91 A;  4U5B E;  1OXB A;  3FDQ A;  4OIO F;  2PX0 A;  4U5E E;  1JAF A;  3AGU A;  5D92 A;  1ZHX A;  1CGN A;  2OOC A;  3MFN A;  3SXM A;  1VOM A;  3OA1 A;  1E86 A;  1Z63 A;  3DXJ F;  2EPL X;  4CS8 A;  4BPM A;  2J8W A;  4OIR F;  3U8P A;  5TJ5 E;  4C7O B;  2YL0 A;  3CSK A;  2OEX A;  4JTD B;  2RSE B;  1WWP A;  3MX3 A;  4FAP B;  4IWB A;  2EIJ C;  2DYR C;  4YT8 A;  3RQG A;  4OD5 A;  2VH3 A;  4CDA A;  1D0Z A;  1PD1 A;  2DGJ A;  2WL8 A;  2Q9C A;  1MMA A;  1TFK B;  4MVM A;  1Q0G A;  4DBQ A;  3UR3 C;  4K0D A;  3RQF A;  3IQ6 A;  2H8A A;  5DVW A;  3RW0 A;  2IXP A;  1YYX A;  2O9X A;  4JRZ A;  2LP4 A;  3LNM B;  2XL6 A;  3AG2 C;  3JYY A;  2P0N A;  4NTB A;  3H2V A;  3LS0 A;  3R7C A;  2WVO A;  3NMI A;  4XEK A;  4MW8 A;  4A4A A;  1H7I A;  1TR2 A;  3C8G B;  4U5F E;  2C04 A;  3U3F A;  3TD7 A;  1BR4 A;  3GOR A;  4Q5S F;  2H7O A;  1I4Y A;  3BRJ A;  1M2V B;  1LE4 A;  3KH2 A;  3ZIB A;  3IHU A;  4J30 B;  3LNR A;  4FWV A;  1K04 A;  3ZTM A;  2LCH A;  2WZL A;  4DBR A;  1QZX A;  4H54 A;  3LEO A;  5CI8 A;  2L81 A;  3UGO A;  4MTO A;  4O7G A;  4G7O F;  4AL0 A;  2YL7 A;  3AG4 C;  2Y3G A;  1YDI A;  3UGP A;  2NPU A;  4PJM A;  3VAY A;  1J8Y F;  5DQZ A;  5K0I A;  4LER A;  3PDM P;  5F5F A;  4L6R A;  1FNT c;  1K40 A;  1YLM A;  2YWA A;  4XWJ A;  1FFT C;  2V26 A;  2J0W A;  3S90 A;  1LVK A;  1LS4 A;  3EJN A;  3L0I A;  4WGY A;  1U6H A;  2J9U A;  3GEH A;  2ZXO A;  2EPO A;  4WAB A;  2I15 A;  2F22 A;  3O39 A;  1V55 C;  3ASO C;  4BJT A;  2EPK X;  4MS2 A;  3U2M A;  5L0I A;  2HSB A;  3NDB B;  3GWN A;  4JJG A;  4DRJ B;  1CGM E;  1HW2 A;  3U5S A;  2HFI A;  4ULV A;  3VM6 A;  3WAQ A;  5AC4 A;  2A1D D;  5E3A A;  1VB5 A;  1ZVZ A;  1MMD A;  2KQ9 A;  1O5H A;  3JCU Q;  3NKE A;  1FTS A;  3TJ5 A;  1KTM A;  2YVK A;  3EGD A;  3QZC A;  1TWA A;  4E18 A;  4MND A;  4XPY A;  1EQ1 A;  1NU7 D;  1OR2 A;  5L0J A;  3EG9 A;  2FGY A;  3BEH A;  4RD9 A;  4WJ0 A;  4N6C A;  5T3W A;  3SXZ A;  1VK5 A;  3S28 A;  1ORS C;  2A69 F;  1A7V A;  3E9V A;  4R32 A;  5EGY A;  3S9O A;  3C8G D;  2CW0 F;  2M4E A;  3M79 A;  5E2Q A;  2JPU A;  5B3I A;  5A69 A;  1ORY A;  2HMZ A;  2PBE A;  5KYW B;  2I8B A;  1PD0 A;  3U0C A;  4C7O A;  1UG7 A;  2HV7 A;  4BJ1 A;  4U5H A;  2CNW D;  3HNJ A;  3K1I C;  3GM2 A;  2LIG A;  3RH3 A;  1T9K A;  5JRA A;  3CQZ A;  4I3M A;  5F28 E;  1FR0 A;  4FX5 A;  3Q7L A;  1Q0M A;  1HE1 A;  3ASN C;  3G4Z A;  3ITF A;  4BJ5 A;  4D4N A;  3ZQV A;  4QI0 A;  1PCX A;  2XLD A;  5COM A;  3H2U A;  1XZP A;  3GEI A;  3LAY A;  4B6I A;  3MLG A;  4CIP A;  4NC3 A;  1D1B A;  2MHR A;  4OIN F;  2R7S A;  4CDV A;  3GWL A;  1E83 A;  2LK4 A;  3FAP B;  1WTY A;  3C8G A;  3MYI A;  2R7T A;  3K7D A;  3ZQY A;  3L8I A;  2Y3D A;  4HEA J;  4J7T A;  3U3B A;  3U2L A;  3QMK A;  4BG0 A;  1NLX A;  4RDA A;  1VYI A;  2HZ8 A;  4U5C E;  3C62 A;  2M64 A;  1M2V A;  4KNV A;  2RD9 A;  5BQI A;  2YEV A;  3L8J A;  2CNW A;  2OQM A;  3M1C B;  2FAP B;  4IAQ A;  3EFO B;  1EKY A;  2HMQ A;  2IXN A;  1RKC A;  1QVX A;  3HNL A;  3ZG1 A;  4E7S A;  2NG1 A;  1V4A A;  3Q7G A;  4NCQ A;  4NTA A;  3EG9 B;  3FMS A;  2KJG A;  1OCC C;  5JS5 A;  1M6T A;  3LS1 A;  2YLG A;  1O3U A;  2EPN A;  3JRT A;  1HMD A;  3Q6M A;  4PJN A;  2L7A A;  1YAR O;  4ANJ A;  1ZHW A;  1CPR A;  3K6B A;  3N0T A;  2GDC A; 
#chains in the Genus database with same CATH homology
 1S05 A;  4WGZ A;  3ZTM A;  1NBB A;  5JT4 A;  256B A;  1MQV A;  4JEB A;  4EIY A;  2YLD A;  4CJG A;  4ER9 A;  4JEA A;  2YL7 A;  4U9E A;  5JVE A;  1GQA A;  3HNI A;  3ZTZ A;  5JUA A;  3M4B A;  3QVZ A;  4JKV A;  2XLH A;  3DE8 A;  3IQ5 A;  4L6R A;  2XLV A;  4IAR A;  2YL1 A;  2J9B A;  4WGY A;  2CCY A;  3QW1 A;  4IB4 A;  5JP7 A;  2XM4 A;  1BBH A;  3NMJ A;  4ULV A;  1LM3 B;  2XLM A;  3TOM A;  2YLI A;  3QVY A;  2XM0 A;  4D4X A;  1YZA A;  5JSL A;  4JE9 A;  3QW0 A;  3FOP A;  1YYJ A;  2QLA A;  1A7V A;  4CX9 A;  2XL8 A;  1E84 A;  3NMK A;  3M79 A;  4CDY A;  1QPU A;  5B3I A;  1APC A;  4N4W A;  3M15 A;  3DE9 A;  3HNJ A;  5JRA A;  1CGO A;  4U9D A;  4CJO A;  2BC5 A;  1YZC A;  5AGF A;  2YL3 A;  4D4N A;  3ZQV A;  2XLD A;  3C63 A;  2XLO A;  4N6H A;  1E85 A;  4CIP A;  4NC3 A;  1JAF A;  2XLE A;  1RCP A;  1CGN A;  1CPQ A;  4CDV A;  1E83 A;  2XLW A;  1E86 A;  3ZQY A;  2J8W A;  3U8P A;  3HNK A;  2YL0 A;  3C62 A;  4CDA A;  1QQ3 A;  4IAQ A;  3TOL A;  3ZWI A;  1EKY A;  2YKZ A;  3IQ6 A;  3HNL A;  1YYX A;  3VRC A;  3L1M A;  2XL6 A;  5JS5 A;  1M6T A;  3FOO A;  2YLG A;  3NMI A;  5JLI A;  1CPR A;  3M4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...