3QVYA

Crystal structure of the zn-ridc1 complex stabilized by bmoe crosslinks
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHDALHLANECKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome cb562
publication title Templated construction of a zn-selective protein dimerization motif.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 42
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3qvyA00
3DE9A 1E83A 5JLIA 3HNKA 1CPQA 2XL6A 2XM0A 4CDAA 1APCA 2YLDA 3ZTZA 2XLWA 3QW0A 3FOPA 3NMKA 1YYXA 2XLOA 3IQ6A 1MQVA 4CX9A 3L1MA 5JS5A 3QVZA 3QVYA 4JE9A 4U9DA 3VRCA 4D4NA 3TOMA 4CIPA 2J9BA 3U8PA 1NBBA 4CJOA 3HNIA 3NMJA 3ZQYA 1YZAA 2XLDA 1S05A 5AGFA 3M4BA 4WGZA 1LM3B 1BBHA 4ULVA 5JVEA 1A7VA 4CDVA 1E84A 2XLHA 1QQ3A 2CCYA 256BA 1GQAA 3ZQVA 3ZTMA 4CDYA 3M79A 4IB4A 2YL1A 1CPRA 1RCPA 2BC5A 5B3IA 4ER9A 4WGYA 2XM4A 2XLMA 1QPUA 3DE8A 2XLVA 5JSLA 3NMIA 5JRAA 3HNLA 4CJGA 2XLEA 3M4CA 4NC3A 4N4WA 1JAFA 5JT4A 2YL3A 1EKYA 4JKVA 3FOOA 3HNJA 4D4XA 5JP7A 2QLAA 3C62A 5JUAA 4JEAA 2YL0A 1YYJA 3TOLA 2YKZA 2YL7A 3ZWIA 1CGNA 2XL8A 4U9EA 4JEBA 3C63A 1E86A 2J8WA 3IQ5A 3QW1A 1E85A 4EIYA 4L6RA 4IARA 4IAQA 3M15A 2YLGA 1YZCA 1M6TA 1CGOA 4N6HA 2YLIA
chains in the Genus database with same CATH superfamily
3DE9A 4U5GA 1E83A 5KYUB 3HNKA 2L6HA 2H7BA 4IAOA 1JPNA 1SMYF 1U0BB 1VLTA 2XM0A 3NKDA 2PBEA 3SYNA 4AL0A 4MTGA 2R02A 1OKKD 1ORJA 3EHMA 5B1AC 3H2UA 2QNLA 3ZDLA 3DD7A 3EG9B 3QMKA 2NUTA 3SEOA 3AQCA 4P6IC 3ABLC 3ZTZA 1QSPA 1QLEC 2WZLA 3LEVA 4IJJA 1ZHXA 3RKOF 3TK0A 3WG7C 1RKCA 2KQ9A 1F1MA 1YA9A 1BR4A 4PFOA 1M2VA 5D92A 1OKKA 2A0BA 1D0XA 1MQVA 4OINF 2G62A 2J45A 3C8GB 4LLCA 4DVYP 3QVZA 3LAYA 2Q00A 1Q0MA 5T3TA 4AE4B 4AL1A 2G3VA 4GQHA 4O6MA 1MMNA 4E0IA 2ZXWC 4CS9A 3VRCA 1H7IA 2DB4A 4FX5A 4EWCA 4CIPA 4ULWA 4RD9A 3AG1C 1YDIA 2QE9A 2IXMA 2YEVA 5KYUA 2FAPB 2GA0A 2ZXRA 4CJOA 2I15A 3HNIA 3NMJA 4EBKA 1E2XA 2GDCA 1RKEB 3ZG1A 1ST6A 4ZLCA 4XPWA 2Y39A 3DJNB 4O6YA 5DS6A 5KYYB 4OD4A 3NYLA 3EG9A 1D1CA 2HV6A 1LM3B 2L6GA 4G7ZF 2HV7A 4FESA 4LERA 2DYRC 3B71A 1VYIA 3BRJA 2R05A 3LS0A 5E33A 4Z9JA 1A7VA 3JSEO 1G8XA 1Y6DA 2XXAB 2XLHA 3C18A 2WL8A 1W2WA 3NYMA 2W4BA 3QZCA 1FFTC 1LE2A 3ZTMA 2YL1A 5DLJA 5L0DA 3WAQA 4YN0B 1CPRA 1H9TA 2HMQA 1D0YA 3VAYA 1RCPA 1HE9A 2OG2A 3LEOA 4N06A 3EZHA 3MFNA 4NY3A 4AE4A 3W8IA 4EHPA 1GS9A 3U2LA 1I4YA 3K66A 4HFKB 3N24A 3PMRA 1VTMP 3AGTA 2R7SA 5EGYA 1TWAA 2OJQA 1QPUA 3A9CA 3EQLF 2VCCA 2XLVA 5COMA 3PCVA 4YJWA 2GAQA 3L0IA 3JRMO 2OJED 4MVSA 1FNTc 3U2MA 4CSAC 3A11A 2R03A 4N6CA 4CJGA 2AVKA 4O79A 2XLEA 3NDBB 1A41A 3RQFA 3TQOA 5AC5A 3AGUA 2B0JA 1OCZC 1TWHA 5A69A 1OW6A 1Z63A 1JAFA 4K0DA 2EIKC 1ZYRF 3RW0A 2YL3A 4Q7CA 1OCCC 3O55A 2Q9AA 3G4ZA 3C7JA 4HE8D 4WABA 4DOZA 5L0IA 4O7GA 2LSEA 4H54A 2PX0A 5JP7A 3EGDB 2CYDA 3WODF 2OU6A 2NSFA 3ABMC 5HSWA 3ZC4A 5B3SC 3FXHA 1QKRA 3B9QA 2P0NA 1OW8A 2YKZA 3IQCA 4E17A 4CIHA 3GWLA 1TWCA 3K33A 4W8PA 3T9OA 1NZEA 3OWTA 3Q7GA 2NUPB 2CDQA 4U9EA 1FFHA 2YZSA 3JRTA 1VK5A 4DRHB 3C63A 5L0GA 2H8AA 5COFA 3IQ5A 3QW1A 3T4RA 3ITFA 4IGGA 4MVZA 3RQEA 1ZU5A 1TFOB 1BDJB 3M15A 5L0JA 4UDVA 3US6A 3DMDA 2MHRA 1QZXA 1M57C 4N6HA 3GEEA 2R25A 4JTAB 1AEPA 3DWWA 2H7VC 5JLIA 2XSEA 3EGDA 2P1AA 4HEAJ 2L7AA 1FAPB 2WVNA 3K1HA 3DXJF 5T1DB 4J30B 2WVOA 3KMIA 2YLDA 1WATA 3UMHA 1YJGA 2CNWD 1M2OA 2HZ8A 2M4EA 3DAFA 1OW7A 1AVOB 4PACA 1IZMA 1D1BA 1LE4A 3EH1A 2VASA 5HV9A 1Z3IX 2XLWA 3UGPA 3ATPA 4BJ5C 2W4MA 2C04A 5B1BC 4E18A 2NUPA 3NMKA 2XLOA 3AG4C 4J7YA 4F4BA 1MNDA 4BJTA 5JS5A 3K1IC 2V26A 3TJ6A 4W8KA 3ZSUA 4CS8A 3OEOA 1Q0FA 4JURI 1SYQA 2O9XA 5L3QA 1NLXA 1H9GA 2JD3A 3CZ6A 1O5HA 3TOMA 2E87A 1C03A 1JRAA 1OQCA 2NPUA 4RBNA 2Y3HA 1J8YF 2R7QA 3KKBA 4PFPA 1NBBA 2X0CA 4G7OF 3ZQYA 2EPOA 1YZAA 2A0UA 3GWNA 4LDQA 5F28E 5BQGA 5F5HA 2PFDA 2XLDA 1O3UA 4U5HA 1WTYA 5AGFA 3M4BA 1V55C 4YT2A 4WGZA 1WOLA 3ASOC 4I3MA 3NRHA 4M63A 4DXWA 4EKWA 2AU5A 2Y3DA 5JVEA 1HW1A 2AWCA 3BEHA 3IPMO 4CDVA 1TKNA 2EILC 4OIOF 3L34A 1ZVZA 4CDYA 5BQHA 1L3PA 2EIJC 4BEJA 5L3VA 3J06A 4ZLDA 1NFNA 2F22A 4XEFA 5FZTA 4XLNF 3S90A 4CS7A 4C7OA 2EPKX 2HFIA 3X2QC 1MMDA 2J0WA 4E7ZA 3UNGC 4YT4A 1PD0A 1ZW2A 2BC5A 2LFDA 1ORYA 4AX2A 4ER9A 3SXZA 1SR2A 4JVSA 3JZ0A 4A2NB 2R7OA 2GWWA 4DBRA 5JSLA 3X1OA 2YVKA 3SXMA 4B6IA 3NMIA 2ASRA 4XWJA 2BL2A 3UGOA 1Z7Qc 1IW7F 1M56C 3SP1A 3K7DA 1YA7O 2XS1A 2VCBA 4HFFB 3Q6MA 2IBFA 3KL4A 4JJGA 4JTCB 1LVKA 3C8ZA 4CS9C 3Q7LA 4KNWA 4U5FE 3PHF2 1ZHTA 4C3BA 5JT4A 2LCHA 2ZXPA 4BG0A 3HNJA 4D4XA 2Y3BA 3RQGA 2KSFA 2H7OA 2YWAA 4OIQF 2QLAA 3AG3C 2Q9CA 4KC9A 1JOGA 4YL1A 3R7CA 2EPNA 3EZIA 1XZQA 1Q0GA 2J9WA 3C62A 3JT1A 3RIPA 2YL0A 3G4XA 1H6GA 2IXOA 3KYJA 1A0BA 3ZIBA 3KH2A 1U6HA 4R32A 4BEMJ 4MW3A 2NSGA 2HJ3A 1JMWA 1KTMA 1G4WR 4FAPB 1K40A 1WASA 4YWQA 2XL8A 4PJNA 3SXKA 1EQ1A 2LQGA 3L8IA 4O6NA 1TR2A 4G0HA 2QY9A 1EI7A 3SXYA 1PD1A 1VB5A 3ZVRA 2YRFA 3AJMA 1OXKA 4LDKA 1ZZPA 1V74B 4L6RA 1GGQA 4C3DA 2TMVP 2KNHA 4XPYA 2YLGA 2VC9A 3MYFA 5FCLA 3VYWA 2VCAA 1M6TA 2D5RB 3GEHA 4JZAA 2YLIA 4U5EE 1WN0A 1RJ9B 1R5ID 5AC4A 2VB6A 2ZXOA 2UUHA 2R7UA 2J0XA 2XL6A 5L0FA 3W4YA 3S84A 3W2WA 3B0PA 1NG1A 1GM5A 2L6FA 3DM9B 3S29A 1Z6AA 3S28A 3AQBA 1WWPA 2LIGA 3K6BA 2J46A 4PJMA 3I5PA 2LD6A 2HMZA 4RDAA 3WHNA 2AWYA 1T01A 3FOPA 2D4UA 4NCQA 1V54C 2IM8A 3RVYA 1Z5ZA 3B29A 3IQ6A 4MTOA 2PNOA 3MX3A 3O6XA 1UFBA 3CAXA 5CI9A 5EHHA 1V4AA 3GANA 2KK1A 3QVYA 2L9JA 3DJUB 4JE9A 2WZFA 3GORA 3IEEA 4U9DA 2LK4A 5DVWA 2Q7RA 5DQZA 2R7VA 2P6VA 5D91A 2J9UA 2WVQA 3N0TA 2OQMA 2G3KA 2EPLX 5CI8A 4A4AA 1T5OA 4MS2A 4QI2A 1YVIA 1NFOA 2P61A 1RJ9A 3L8JA 2J9BA 1JPJA 3PDMP 1BR2A 1RMVA 3U8PA 3S0XA 2WB7A 3KYIA 3SZRA 1K05A 1G4US 3F46A 5E3AA 4U5CE 2JPUA 3U5SA 3FAPB 3EJNA 4NTAA 2IXPA 3AOUA 2A6EF 3MLGA 3MYIA 1J8MF 1D0ZA 2V3CC 4I1MA 4QDLA 1LPEA 3IHUA 1DOWA 2XL4A 1BBHA 2NG1A 3HJCA 3V5XA 3W2VA 2Z15A 4BJ6A 2LFFA 2Q9BA 2DYSC 2FFHA 2HKVA 1VYKA 4K7BA 3ZQVA 1QQ3A 2CCYA 3ABKC 1FMVA 2CNWA 1HMOA 2KW3C 3M79A 4IB4A 4FWVA 4JC7A 1OXBA 1LS1A 1R4TA 4C7OB 3DZAA 3FDQA 2C03A 4YL0A 2PP4A 1VLSA 4YT5A 2OEXA 2VH3A 4NTFA 2IXNA 4JCHA 5B3IA 3JSZA 2XM4A 2XLMA 4BPMA 2EINC 2Y69C 1BR1A 1PV3A 1T9KA 2W9YA 1OCRC 4JCZA 1T6QA 2OCCC 4LACB 4QI0A 4Q4ZF 3CQZA 5T3WA 5IY5C 1EA8A 2R7WA 3CEXA 2J7PD 5TJ5E 5DQTA 4N4WA 4CS8C 2R7XA 2M64A 4I1OB 4XTKA 5KYWB 3MBGA 4E0HA 4MNDA 3TD7A 2YQYA 5BQIA 1ZHZA 3FHDA 1WGWA 3U3FA 5KYXA 1LIHA 3H65A 3DI5A 3LUTB 4JKVA 4MTFA 4OD5A 3RVZA 3EPVA 2ETSA 3TJ5A 1VOMA 1NSGB 1O87A 1LS4A 3LESA 2JX0A 4XLPF 2J7PA 5E3CA 3RH3A 4XEKA 1ORSC 4CBEA 3U8VA 2XS8A 1MMGA 2FGYA 1A7EA 1G5ZA 1VMAA 4PJJA 2QTVA 4IRUA 1YYJA 3Q6NA 5CIVA 5F5FA 4BJ1A 2BE5F 3NYJA 2GFHA 3JTLO 1Q0DA 4G7HF 3DM5A 3ZWIA 1CGNA 3IQTA 2A69F 3O39A 1FTSA 4MQ9F 4U5BE 4LLEA 1YARO 2QUPA 1K04A 2A1DD 2HUJA 1HY5A 1Y4CA 1E86A 2J8WA 3FAJA 5A6KA 1ZHYA 4WJ0A 1BZ4A 1E85A 1U89A 4EIYA 5KYWA 4IARA 3CSKA 1T6IA 4EBBA 3T6BA 5E2QA 2OEVA 2HSBA 3V7OA 3LS1A 1Q0KA 2R7RA 2R7TA 4J7TA 2EPMX 2KGOA 4MVQA 1CPQA 4JRZA 1LI7A 1OR2A 5K0IA 3JCUQ 2KC3A 3NKEA 2HJMA 2ZD9A 3U9JA 3KPHA 2RD9A 4MW8A 3B0VC 4KBLA 1APCA 4CDAA 1CGME 2XRHA 2L81A 4XEVA 2R9RB 3HKKA 4DRIB 3C8GD 2I8BA 5COGA 3QW0A 1MMAA 3GM1A 3M1CB 1XZPA 4JIOA 1YYXA 3T6JA 3O10A 3QTHA 5L0HA 4CX9A 1QVXA 1DOVA 4E7SA 3FMSA 4MVUA 3RF3A 3L1MA 4CSAA 3C8GA 4MVRA 3UMIA 1TFKB 1SF8A 3TULA 4G78A 3H2VA 3LNRA 1YAUO 2MYSA 4D4NA 4EUKB 3B0UX 4EBJA 1ZHWA 1OR3A 4MVOA 1I5NA 3RYLA 3HLZA 2KJGA 1YLMA 3UR3C 4JJFA 3ECSA 4AK9A 1TQGA 2KYHA 4XPXA 3EFOB 5L0CA 3FVYA 2CGEA 1RKEA 1S05A 3I5QA 1SZIA 2Y3GA 3DKAA 5KYYA 3VF0A 1N1CA 1NU7D 1Z23A 2CW0F 2B0HA 2HSQA 2LP4A 1LKXA 2PX3A 2DI3A 2X51A 3LLIA 4ULVA 1HMDA 2OKUA 3GM3A 5KYNA 4KNVA 4YT8A 2EIMC 3EH2A 5A6BD 1E84A 1AUEA 1GQAA 1HE1A 1PCXA 256BA 2ICWG 3LJBA 4K1OA 4JW1A 3RFYA 5BUOA 4Z9IA 2XXAA 5A6JA 1FR0A 3LLKA 3EHNA 1JR8A 1NU9C 4OIRF 3S27A 2AP3A 3EGXB 4PK4A 4WGYA 2Q4FA 2P7VA 3SNHA 3VM6A 4Q5SF 4OIPF 5A6BA 3R2PA 2MWQA 2OOCA 2YHSA 3DE8A 3OA1A 4YL3A 3GODA 3S9OA 4I44A 5DS5A 4J32B 5EK0A 4DJ9A 5JRAA 1HW2A 3HNLA 1ZW3A 3JYYA 1T6UA 3AG2C 4GYTA 4GEHA 4ANJA 2WZGA 3GEIA 3E9VA 4IWBA 4PR9A 3UMKA 3EFOA 3POVA 3M4CA 4NC3A 4JTDB 2UUIA 5A6AA 1LI5A 1I4ZA 3LNMB 4YK5A 4Z9HA 3ASNC 4DVZA 5KYXB 1ZU4A 3I4UA 3DAGA 1B68A 3NG1A 4U5DE 1EKYA 1XWJA 1OCOC 1C02A 2PF4E 4LDRA 3FOOA 3U3BA 3V5YA 3N2ZB 5GPGB 1UG7A 4BJ5A 1D1AA 3GM2A 2IOQA 4KI2A 4P9FA 4H4KC 3U9MA 3W8HA 4P9TA 3E70C 2A68F 5JUAA 4JEAA 3K1IA 4NTBA 3TOLA 4DRJB 3EGXA 2NUTB 1MNEA 1KNYA 2IYLD 4BJ6C 4DBQA 2YL7A 3JYHA 2W45A 2DGJA 1L7CA 1M2VB 3F47A 1S7ZA 2HS5A 3T6GB 2J9VA 4MVMA 2A6HF 4JEBA 4XQ1A 2Q3TA 3G50A 3U0CA 1RXQA 4C3EA 1FMWA 1A7DA 4PJLA 1KU2A 4IAQA 4ONSA 3V5ZA 5DS4A 1TWGA 2ZPAA 1C17M 1YZCA 2RSEB 3HTKC 4X0RA 1CGOA 4NQFA
chains in the Genus database with same CATH topology
3DE9A 1E83A 5JLIA 3HNKA 1CPQA 2XL6A 2XM0A 4CDAA 1APCA 2YLDA 3ZTZA 2XLWA 3QW0A 3FOPA 3NMKA 1YYXA 2XLOA 3IQ6A 1MQVA 4CX9A 3L1MA 5JS5A 3QVZA 3QVYA 4JE9A 4U9DA 3VRCA 4D4NA 3TOMA 4CIPA 2J9BA 3U8PA 1NBBA 4CJOA 3HNIA 3NMJA 3ZQYA 1YZAA 2XLDA 1S05A 5AGFA 3M4BA 4WGZA 1LM3B 1BBHA 4ULVA 5JVEA 1A7VA 4CDVA 1E84A 2XLHA 1QQ3A 2CCYA 256BA 1GQAA 3ZQVA 3ZTMA 4CDYA 3M79A 4IB4A 2YL1A 1CPRA 1RCPA 2BC5A 5B3IA 4ER9A 4WGYA 2XM4A 2XLMA 1QPUA 3DE8A 2XLVA 5JSLA 3NMIA 5JRAA 3HNLA 4CJGA 2XLEA 3M4CA 4NC3A 4N4WA 1JAFA 5JT4A 2YL3A 1EKYA 4JKVA 3FOOA 3HNJA 4D4XA 5JP7A 2QLAA 3C62A 5JUAA 4JEAA 2YL0A 1YYJA 3TOLA 2YKZA 2YL7A 3ZWIA 1CGNA 2XL8A 4U9EA 4JEBA 3C63A 1E86A 2J8WA 3IQ5A 3QW1A 1E85A 4EIYA 4L6RA 4IARA 4IAQA 3M15A 2YLGA 1YZCA 1M6TA 1CGOA 4N6HA 2YLIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DE9 A;  1E83 A;  5JLI A;  3HNK A;  1CPQ A;  2XL6 A;  2XM0 A;  4CDA A;  1APC A;  2YLD A;  3ZTZ A;  2XLW A;  3QW0 A;  3FOP A;  3NMK A;  1YYX A;  2XLO A;  3IQ6 A;  1MQV A;  4CX9 A;  3L1M A;  5JS5 A;  3QVZ A;  3QVY A;  4JE9 A;  4U9D A;  3VRC A;  4D4N A;  3TOM A;  4CIP A;  2J9B A;  3U8P A;  1NBB A;  4CJO A;  3HNI A;  3NMJ A;  3ZQY A;  1YZA A;  2XLD A;  1S05 A;  5AGF A;  3M4B A;  4WGZ A;  1LM3 B;  1BBH A;  4ULV A;  5JVE A;  1A7V A;  4CDV A;  1E84 A;  2XLH A;  1QQ3 A;  2CCY A;  256B A;  1GQA A;  3ZQV A;  3ZTM A;  4CDY A;  3M79 A;  4IB4 A;  2YL1 A;  1CPR A;  1RCP A;  2BC5 A;  5B3I A;  4ER9 A;  4WGY A;  2XM4 A;  2XLM A;  1QPU A;  3DE8 A;  2XLV A;  5JSL A;  3NMI A;  5JRA A;  3HNL A;  4CJG A;  2XLE A;  3M4C A;  4NC3 A;  4N4W A;  1JAF A;  5JT4 A;  2YL3 A;  1EKY A;  4JKV A;  3FOO A;  3HNJ A;  4D4X A;  5JP7 A;  2QLA A;  3C62 A;  5JUA A;  4JEA A;  2YL0 A;  1YYJ A;  3TOL A;  2YKZ A;  2YL7 A;  3ZWI A;  1CGN A;  2XL8 A;  4U9E A;  4JEB A;  3C63 A;  1E86 A;  2J8W A;  3IQ5 A;  3QW1 A;  1E85 A;  4EIY A;  4L6R A;  4IAR A;  4IAQ A;  3M15 A;  2YLG A;  1YZC A;  1M6T A;  1CGO A;  4N6H A;  2YLI A; 
#chains in the Genus database with same CATH topology
 3DE9 A;  4U5G A;  1E83 A;  5KYU B;  3HNK A;  2L6H A;  2H7B A;  4IAO A;  1JPN A;  1SMY F;  1U0B B;  1VLT A;  2XM0 A;  3NKD A;  2PBE A;  3SYN A;  4AL0 A;  4MTG A;  2R02 A;  1OKK D;  1ORJ A;  3EHM A;  5B1A C;  3H2U A;  2QNL A;  3ZDL A;  3DD7 A;  3EG9 B;  3QMK A;  2NUT A;  3SEO A;  3AQC A;  4P6I C;  3ABL C;  3ZTZ A;  1QSP A;  1QLE C;  2WZL A;  3LEV A;  4IJJ A;  1ZHX A;  3RKO F;  3TK0 A;  3WG7 C;  1RKC A;  2KQ9 A;  1F1M A;  1YA9 A;  1BR4 A;  4PFO A;  1M2V A;  5D92 A;  1OKK A;  2A0B A;  1D0X A;  1MQV A;  4OIN F;  2G62 A;  2J45 A;  3C8G B;  4LLC A;  4DVY P;  3QVZ A;  3LAY A;  2Q00 A;  1Q0M A;  5T3T A;  4AE4 B;  4AL1 A;  2G3V A;  4GQH A;  4O6M A;  1MMN A;  4E0I A;  2ZXW C;  4CS9 A;  3VRC A;  1H7I A;  2DB4 A;  4FX5 A;  4EWC A;  4CIP A;  4ULW A;  4RD9 A;  3AG1 C;  1YDI A;  2QE9 A;  2IXM A;  2YEV A;  5KYU A;  2FAP B;  2GA0 A;  2ZXR A;  4CJO A;  2I15 A;  3HNI A;  3NMJ A;  4EBK A;  1E2X A;  2GDC A;  1RKE B;  3ZG1 A;  1ST6 A;  4ZLC A;  4XPW A;  2Y39 A;  3DJN B;  4O6Y A;  5DS6 A;  5KYY B;  4OD4 A;  3NYL A;  3EG9 A;  1D1C A;  2HV6 A;  1LM3 B;  2L6G A;  4G7Z F;  2HV7 A;  4FES A;  4LER A;  2DYR C;  3B71 A;  1VYI A;  3BRJ A;  2R05 A;  3LS0 A;  5E33 A;  4Z9J A;  1A7V A;  3JSE O;  1G8X A;  1Y6D A;  2XXA B;  2XLH A;  3C18 A;  2WL8 A;  1W2W A;  3NYM A;  2W4B A;  3QZC A;  1FFT C;  1LE2 A;  3ZTM A;  2YL1 A;  5DLJ A;  5L0D A;  3WAQ A;  4YN0 B;  1CPR A;  1H9T A;  2HMQ A;  1D0Y A;  3VAY A;  1RCP A;  1HE9 A;  2OG2 A;  3LEO A;  4N06 A;  3EZH A;  3MFN A;  4NY3 A;  4AE4 A;  3W8I A;  4EHP A;  1GS9 A;  3U2L A;  1I4Y A;  3K66 A;  4HFK B;  3N24 A;  3PMR A;  1VTM P;  3AGT A;  2R7S A;  5EGY A;  1TWA A;  2OJQ A;  1QPU A;  3A9C A;  3EQL F;  2VCC A;  2XLV A;  5COM A;  3PCV A;  4YJW A;  2GAQ A;  3L0I A;  3JRM O;  2OJE D;  4MVS A;  1FNT c;  3U2M A;  4CSA C;  3A11 A;  2R03 A;  4N6C A;  4CJG A;  2AVK A;  4O79 A;  2XLE A;  3NDB B;  1A41 A;  3RQF A;  3TQO A;  5AC5 A;  3AGU A;  2B0J A;  1OCZ C;  1TWH A;  5A69 A;  1OW6 A;  1Z63 A;  1JAF A;  4K0D A;  2EIK C;  1ZYR F;  3RW0 A;  2YL3 A;  4Q7C A;  1OCC C;  3O55 A;  2Q9A A;  3G4Z A;  3C7J A;  4HE8 D;  4WAB A;  4DOZ A;  5L0I A;  4O7G A;  2LSE A;  4H54 A;  2PX0 A;  5JP7 A;  3EGD B;  2CYD A;  3WOD F;  2OU6 A;  2NSF A;  3ABM C;  5HSW A;  3ZC4 A;  5B3S C;  3FXH A;  1QKR A;  3B9Q A;  2P0N A;  1OW8 A;  2YKZ A;  3IQC A;  4E17 A;  4CIH A;  3GWL A;  1TWC A;  3K33 A;  4W8P A;  3T9O A;  1NZE A;  3OWT A;  3Q7G A;  2NUP B;  2CDQ A;  4U9E A;  1FFH A;  2YZS A;  3JRT A;  1VK5 A;  4DRH B;  3C63 A;  5L0G A;  2H8A A;  5COF A;  3IQ5 A;  3QW1 A;  3T4R A;  3ITF A;  4IGG A;  4MVZ A;  3RQE A;  1ZU5 A;  1TFO B;  1BDJ B;  3M15 A;  5L0J A;  4UDV A;  3US6 A;  3DMD A;  2MHR A;  1QZX A;  1M57 C;  4N6H A;  3GEE A;  2R25 A;  4JTA B;  1AEP A;  3DWW A;  2H7V C;  5JLI A;  2XSE A;  3EGD A;  2P1A A;  4HEA J;  2L7A A;  1FAP B;  2WVN A;  3K1H A;  3DXJ F;  5T1D B;  4J30 B;  2WVO A;  3KMI A;  2YLD A;  1WAT A;  3UMH A;  1YJG A;  2CNW D;  1M2O A;  2HZ8 A;  2M4E A;  3DAF A;  1OW7 A;  1AVO B;  4PAC A;  1IZM A;  1D1B A;  1LE4 A;  3EH1 A;  2VAS A;  5HV9 A;  1Z3I X;  2XLW A;  3UGP A;  3ATP A;  4BJ5 C;  2W4M A;  2C04 A;  5B1B C;  4E18 A;  2NUP A;  3NMK A;  2XLO A;  3AG4 C;  4J7Y A;  4F4B A;  1MND A;  4BJT A;  5JS5 A;  3K1I C;  2V26 A;  3TJ6 A;  4W8K A;  3ZSU A;  4CS8 A;  3OEO A;  1Q0F A;  4JUR I;  1SYQ A;  2O9X A;  5L3Q A;  1NLX A;  1H9G A;  2JD3 A;  3CZ6 A;  1O5H A;  3TOM A;  2E87 A;  1C03 A;  1JRA A;  1OQC A;  2NPU A;  4RBN A;  2Y3H A;  1J8Y F;  2R7Q A;  3KKB A;  4PFP A;  1NBB A;  2X0C A;  4G7O F;  3ZQY A;  2EPO A;  1YZA A;  2A0U A;  3GWN A;  4LDQ A;  5F28 E;  5BQG A;  5F5H A;  2PFD A;  2XLD A;  1O3U A;  4U5H A;  1WTY A;  5AGF A;  3M4B A;  1V55 C;  4YT2 A;  4WGZ A;  1WOL A;  3ASO C;  4I3M A;  3NRH A;  4M63 A;  4DXW A;  4EKW A;  2AU5 A;  2Y3D A;  5JVE A;  1HW1 A;  2AWC A;  3BEH A;  3IPM O;  4CDV A;  1TKN A;  2EIL C;  4OIO F;  3L34 A;  1ZVZ A;  4CDY A;  5BQH A;  1L3P A;  2EIJ C;  4BEJ A;  5L3V A;  3J06 A;  4ZLD A;  1NFN A;  2F22 A;  4XEF A;  5FZT A;  4XLN F;  3S90 A;  4CS7 A;  4C7O A;  2EPK X;  2HFI A;  3X2Q C;  1MMD A;  2J0W A;  4E7Z A;  3UNG C;  4YT4 A;  1PD0 A;  1ZW2 A;  2BC5 A;  2LFD A;  1ORY A;  4AX2 A;  4ER9 A;  3SXZ A;  1SR2 A;  4JVS A;  3JZ0 A;  4A2N B;  2R7O A;  2GWW A;  4DBR A;  5JSL A;  3X1O A;  2YVK A;  3SXM A;  4B6I A;  3NMI A;  2ASR A;  4XWJ A;  2BL2 A;  3UGO A;  1Z7Q c;  1IW7 F;  1M56 C;  3SP1 A;  3K7D A;  1YA7 O;  2XS1 A;  2VCB A;  4HFF B;  3Q6M A;  2IBF A;  3KL4 A;  4JJG A;  4JTC B;  1LVK A;  3C8Z A;  4CS9 C;  3Q7L A;  4KNW A;  4U5F E;  3PHF 2;  1ZHT A;  4C3B A;  5JT4 A;  2LCH A;  2ZXP A;  4BG0 A;  3HNJ A;  4D4X A;  2Y3B A;  3RQG A;  2KSF A;  2H7O A;  2YWA A;  4OIQ F;  2QLA A;  3AG3 C;  2Q9C A;  4KC9 A;  1JOG A;  4YL1 A;  3R7C A;  2EPN A;  3EZI A;  1XZQ A;  1Q0G A;  2J9W A;  3C62 A;  3JT1 A;  3RIP A;  2YL0 A;  3G4X A;  1H6G A;  2IXO A;  3KYJ A;  1A0B A;  3ZIB A;  3KH2 A;  1U6H A;  4R32 A;  4BEM J;  4MW3 A;  2NSG A;  2HJ3 A;  1JMW A;  1KTM A;  1G4W R;  4FAP B;  1K40 A;  1WAS A;  4YWQ A;  2XL8 A;  4PJN A;  3SXK A;  1EQ1 A;  2LQG A;  3L8I A;  4O6N A;  1TR2 A;  4G0H A;  2QY9 A;  1EI7 A;  3SXY A;  1PD1 A;  1VB5 A;  3ZVR A;  2YRF A;  3AJM A;  1OXK A;  4LDK A;  1ZZP A;  1V74 B;  4L6R A;  1GGQ A;  4C3D A;  2TMV P;  2KNH A;  4XPY A;  2YLG A;  2VC9 A;  3MYF A;  5FCL A;  3VYW A;  2VCA A;  1M6T A;  2D5R B;  3GEH A;  4JZA A;  2YLI A;  4U5E E;  1WN0 A;  1RJ9 B;  1R5I D;  5AC4 A;  2VB6 A;  2ZXO A;  2UUH A;  2R7U A;  2J0X A;  2XL6 A;  5L0F A;  3W4Y A;  3S84 A;  3W2W A;  3B0P A;  1NG1 A;  1GM5 A;  2L6F A;  3DM9 B;  3S29 A;  1Z6A A;  3S28 A;  3AQB A;  1WWP A;  2LIG A;  3K6B A;  2J46 A;  4PJM A;  3I5P A;  2LD6 A;  2HMZ A;  4RDA A;  3WHN A;  2AWY A;  1T01 A;  3FOP A;  2D4U A;  4NCQ A;  1V54 C;  2IM8 A;  3RVY A;  1Z5Z A;  3B29 A;  3IQ6 A;  4MTO A;  2PNO A;  3MX3 A;  3O6X A;  1UFB A;  3CAX A;  5CI9 A;  5EHH A;  1V4A A;  3GAN A;  2KK1 A;  3QVY A;  2L9J A;  3DJU B;  4JE9 A;  2WZF A;  3GOR A;  3IEE A;  4U9D A;  2LK4 A;  5DVW A;  2Q7R A;  5DQZ A;  2R7V A;  2P6V A;  5D91 A;  2J9U A;  2WVQ A;  3N0T A;  2OQM A;  2G3K A;  2EPL X;  5CI8 A;  4A4A A;  1T5O A;  4MS2 A;  4QI2 A;  1YVI A;  1NFO A;  2P61 A;  1RJ9 A;  3L8J A;  2J9B A;  1JPJ A;  3PDM P;  1BR2 A;  1RMV A;  3U8P A;  3S0X A;  2WB7 A;  3KYI A;  3SZR A;  1K05 A;  1G4U S;  3F46 A;  5E3A A;  4U5C E;  2JPU A;  3U5S A;  3FAP B;  3EJN A;  4NTA A;  2IXP A;  3AOU A;  2A6E F;  3MLG A;  3MYI A;  1J8M F;  1D0Z A;  2V3C C;  4I1M A;  4QDL A;  1LPE A;  3IHU A;  1DOW A;  2XL4 A;  1BBH A;  2NG1 A;  3HJC A;  3V5X A;  3W2V A;  2Z15 A;  4BJ6 A;  2LFF A;  2Q9B A;  2DYS C;  2FFH A;  2HKV A;  1VYK A;  4K7B A;  3ZQV A;  1QQ3 A;  2CCY A;  3ABK C;  1FMV A;  2CNW A;  1HMO A;  2KW3 C;  3M79 A;  4IB4 A;  4FWV A;  4JC7 A;  1OXB A;  1LS1 A;  1R4T A;  4C7O B;  3DZA A;  3FDQ A;  2C03 A;  4YL0 A;  2PP4 A;  1VLS A;  4YT5 A;  2OEX A;  2VH3 A;  4NTF A;  2IXN A;  4JCH A;  5B3I A;  3JSZ A;  2XM4 A;  2XLM A;  4BPM A;  2EIN C;  2Y69 C;  1BR1 A;  1PV3 A;  1T9K A;  2W9Y A;  1OCR C;  4JCZ A;  1T6Q A;  2OCC C;  4LAC B;  4QI0 A;  4Q4Z F;  3CQZ A;  5T3W A;  5IY5 C;  1EA8 A;  2R7W A;  3CEX A;  2J7P D;  5TJ5 E;  5DQT A;  4N4W A;  4CS8 C;  2R7X A;  2M64 A;  4I1O B;  4XTK A;  5KYW B;  3MBG A;  4E0H A;  4MND A;  3TD7 A;  2YQY A;  5BQI A;  1ZHZ A;  3FHD A;  1WGW A;  3U3F A;  5KYX A;  1LIH A;  3H65 A;  3DI5 A;  3LUT B;  4JKV A;  4MTF A;  4OD5 A;  3RVZ A;  3EPV A;  2ETS A;  3TJ5 A;  1VOM A;  1NSG B;  1O87 A;  1LS4 A;  3LES A;  2JX0 A;  4XLP F;  2J7P A;  5E3C A;  3RH3 A;  4XEK A;  1ORS C;  4CBE A;  3U8V A;  2XS8 A;  1MMG A;  2FGY A;  1A7E A;  1G5Z A;  1VMA A;  4PJJ A;  2QTV A;  4IRU A;  1YYJ A;  3Q6N A;  5CIV A;  5F5F A;  4BJ1 A;  2BE5 F;  3NYJ A;  2GFH A;  3JTL O;  1Q0D A;  4G7H F;  3DM5 A;  3ZWI A;  1CGN A;  3IQT A;  2A69 F;  3O39 A;  1FTS A;  4MQ9 F;  4U5B E;  4LLE A;  1YAR O;  2QUP A;  1K04 A;  2A1D D;  2HUJ A;  1HY5 A;  1Y4C A;  1E86 A;  2J8W A;  3FAJ A;  5A6K A;  1ZHY A;  4WJ0 A;  1BZ4 A;  1E85 A;  1U89 A;  4EIY A;  5KYW A;  4IAR A;  3CSK A;  1T6I A;  4EBB A;  3T6B A;  5E2Q A;  2OEV A;  2HSB A;  3V7O A;  3LS1 A;  1Q0K A;  2R7R A;  2R7T A;  4J7T A;  2EPM X;  2KGO A;  4MVQ A;  1CPQ A;  4JRZ A;  1LI7 A;  1OR2 A;  5K0I A;  3JCU Q;  2KC3 A;  3NKE A;  2HJM A;  2ZD9 A;  3U9J A;  3KPH A;  2RD9 A;  4MW8 A;  3B0V C;  4KBL A;  1APC A;  4CDA A;  1CGM E;  2XRH A;  2L81 A;  4XEV A;  2R9R B;  3HKK A;  4DRI B;  3C8G D;  2I8B A;  5COG A;  3QW0 A;  1MMA A;  3GM1 A;  3M1C B;  1XZP A;  4JIO A;  1YYX A;  3T6J A;  3O10 A;  3QTH A;  5L0H A;  4CX9 A;  1QVX A;  1DOV A;  4E7S A;  3FMS A;  4MVU A;  3RF3 A;  3L1M A;  4CSA A;  3C8G A;  4MVR A;  3UMI A;  1TFK B;  1SF8 A;  3TUL A;  4G78 A;  3H2V A;  3LNR A;  1YAU O;  2MYS A;  4D4N A;  4EUK B;  3B0U X;  4EBJ A;  1ZHW A;  1OR3 A;  4MVO A;  1I5N A;  3RYL A;  3HLZ A;  2KJG A;  1YLM A;  3UR3 C;  4JJF A;  3ECS A;  4AK9 A;  1TQG A;  2KYH A;  4XPX A;  3EFO B;  5L0C A;  3FVY A;  2CGE A;  1RKE A;  1S05 A;  3I5Q A;  1SZI A;  2Y3G A;  3DKA A;  5KYY A;  3VF0 A;  1N1C A;  1NU7 D;  1Z23 A;  2CW0 F;  2B0H A;  2HSQ A;  2LP4 A;  1LKX A;  2PX3 A;  2DI3 A;  2X51 A;  3LLI A;  4ULV A;  1HMD A;  2OKU A;  3GM3 A;  5KYN A;  4KNV A;  4YT8 A;  2EIM C;  3EH2 A;  5A6B D;  1E84 A;  1AUE A;  1GQA A;  1HE1 A;  1PCX A;  256B A;  2ICW G;  3LJB A;  4K1O A;  4JW1 A;  3RFY A;  5BUO A;  4Z9I A;  2XXA A;  5A6J A;  1FR0 A;  3LLK A;  3EHN A;  1JR8 A;  1NU9 C;  4OIR F;  3S27 A;  2AP3 A;  3EGX B;  4PK4 A;  4WGY A;  2Q4F A;  2P7V A;  3SNH A;  3VM6 A;  4Q5S F;  4OIP F;  5A6B A;  3R2P A;  2MWQ A;  2OOC A;  2YHS A;  3DE8 A;  3OA1 A;  4YL3 A;  3GOD A;  3S9O A;  4I44 A;  5DS5 A;  4J32 B;  5EK0 A;  4DJ9 A;  5JRA A;  1HW2 A;  3HNL A;  1ZW3 A;  3JYY A;  1T6U A;  3AG2 C;  4GYT A;  4GEH A;  4ANJ A;  2WZG A;  3GEI A;  3E9V A;  4IWB A;  4PR9 A;  3UMK A;  3EFO A;  3POV A;  3M4C A;  4NC3 A;  4JTD B;  2UUI A;  5A6A A;  1LI5 A;  1I4Z A;  3LNM B;  4YK5 A;  4Z9H A;  3ASN C;  4DVZ A;  5KYX B;  1ZU4 A;  3I4U A;  3DAG A;  1B68 A;  3NG1 A;  4U5D E;  1EKY A;  1XWJ A;  1OCO C;  1C02 A;  2PF4 E;  4LDR A;  3FOO A;  3U3B A;  3V5Y A;  3N2Z B;  5GPG B;  1UG7 A;  4BJ5 A;  1D1A A;  3GM2 A;  2IOQ A;  4KI2 A;  4P9F A;  4H4K C;  3U9M A;  3W8H A;  4P9T A;  3E70 C;  2A68 F;  5JUA A;  4JEA A;  3K1I A;  4NTB A;  3TOL A;  4DRJ B;  3EGX A;  2NUT B;  1MNE A;  1KNY A;  2IYL D;  4BJ6 C;  4DBQ A;  2YL7 A;  3JYH A;  2W45 A;  2DGJ A;  1L7C A;  1M2V B;  3F47 A;  1S7Z A;  2HS5 A;  3T6G B;  2J9V A;  4MVM A;  2A6H F;  4JEB A;  4XQ1 A;  2Q3T A;  3G50 A;  3U0C A;  1RXQ A;  4C3E A;  1FMW A;  1A7D A;  4PJL A;  1KU2 A;  4IAQ A;  4ONS A;  3V5Z A;  5DS4 A;  1TWG A;  2ZPA A;  1C17 M;  1YZC A;  2RSE B;  3HTK C;  4X0R A;  1CGO A;  4NQF A; 
#chains in the Genus database with same CATH homology
 3DE9 A;  1E83 A;  5JLI A;  3HNK A;  1CPQ A;  2XL6 A;  2XM0 A;  4CDA A;  1APC A;  2YLD A;  3ZTZ A;  2XLW A;  3QW0 A;  3FOP A;  3NMK A;  1YYX A;  2XLO A;  3IQ6 A;  1MQV A;  4CX9 A;  3L1M A;  5JS5 A;  3QVZ A;  3QVY A;  4JE9 A;  4U9D A;  3VRC A;  4D4N A;  3TOM A;  4CIP A;  2J9B A;  3U8P A;  1NBB A;  4CJO A;  3HNI A;  3NMJ A;  3ZQY A;  1YZA A;  2XLD A;  1S05 A;  5AGF A;  3M4B A;  4WGZ A;  1LM3 B;  1BBH A;  4ULV A;  5JVE A;  1A7V A;  4CDV A;  1E84 A;  2XLH A;  1QQ3 A;  2CCY A;  256B A;  1GQA A;  3ZQV A;  3ZTM A;  4CDY A;  3M79 A;  4IB4 A;  2YL1 A;  1CPR A;  1RCP A;  2BC5 A;  5B3I A;  4ER9 A;  4WGY A;  2XM4 A;  2XLM A;  1QPU A;  3DE8 A;  2XLV A;  5JSL A;  3NMI A;  5JRA A;  3HNL A;  4CJG A;  2XLE A;  3M4C A;  4NC3 A;  4N4W A;  1JAF A;  5JT4 A;  2YL3 A;  1EKY A;  4JKV A;  3FOO A;  3HNJ A;  4D4X A;  5JP7 A;  2QLA A;  3C62 A;  5JUA A;  4JEA A;  2YL0 A;  1YYJ A;  3TOL A;  2YKZ A;  2YL7 A;  3ZWI A;  1CGN A;  2XL8 A;  4U9E A;  4JEB A;  3C63 A;  1E86 A;  2J8W A;  3IQ5 A;  3QW1 A;  1E85 A;  4EIY A;  4L6R A;  4IAR A;  4IAQ A;  3M15 A;  2YLG A;  1YZC A;  1M6T A;  1CGO A;  4N6H A;  2YLI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...