3QVYA

Crystal structure of the zn-ridc1 complex stabilized by bmoe crosslinks
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHDALHLANECKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Templated construction of a zn-selective protein dimerization motif.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords Cytochrome cb562
total genus 42
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3qvyA00
4IARA 1YZCA 5JP7A 1CPRA 3C63A 1CGOA 4D4NA 1M6TA 3ZQVA 2XLMA 4L6RA 3M4CA 4WGYA 3QVYA 3HNJA 3IQ6A 3HNKA 2J8WA 3NMJA 3M15A 2YL0A 2YL7A 2XLVA 1APCA 3M4BA 2YKZA 3IQ5A 1S05A 2YL1A 4U9EA 1A7VA 3ZWIA 1NBBA 3NMIA 1QPUA 2XLWA 2XL8A 4WGZA 3DE8A 2XLOA 3L1MA 4JEBA 2YL3A 4IAQA 1YYXA 2XLDA 4JEAA 4D4XA 4CDVA 1YYJA 2J9BA 2BC5A 3HNLA 4IB4A 4JKVA 4U9DA 2YLDA 4CJOA 2CCYA 2XM4A 2YLGA 5JLIA 3DE9A 3HNIA 1E85A 4EIYA 5JT4A 3ZTZA 3C62A 1YZAA 2XM0A 1QQ3A 1LM3B 4CJGA 1CPQA 5JVEA 5JRAA 5JSLA 3NMKA 3TOMA 4CDAA 5AGFA 4CDYA 4ER9A 1JAFA 3ZQYA 4ULVA 4NC3A 1GQAA 1CGNA 3VRCA 4CX9A 1BBHA 2QLAA 3FOPA 2XLEA 2YLIA 256BA 2XLHA 3TOLA 1E84A 4CIPA 5JUAA 1MQVA 1RCPA 5JS5A 3U8PA 1E83A 3ZTMA 5B3IA 1EKYA 4N4WA 3QW0A 1E86A 3FOOA 3QVZA 3QW1A 4N6HA 2XL6A 3M79A 4JE9A
chains in the Genus database with same CATH superfamily
1BR2A 1Q0DA 2WVQA 4N6CA 1YZCA 1I4ZA 5JP7A 2WZFA 3JT1A 4D4NA 2R7VA 3IQTA 1OR3A 2XLMA 5COGA 1YAUO 4NTAA 3M4CA 3V7OA 1VOMA 1WWPA 3IQ6A 3HNKA 4WABA 1D1CA 2ETSA 3WG7C 1FAPB 1MMAA 1O5HA 3M1CB 5T3WA 3B9QA 3NDBB 5KYNA 2J0WA 3GORA 1QZXA 3N24A 1APCA 3EZHA 2EINC 4EBBA 5L0HA 2HUJA 1LI7A 2L6FA 5B1AC 1K05A 1L7CA 3DM9B 1PD1A 2DYRC 1WN0A 1FMWA 4KC9A 2KGOA 2E87A 5JRAA 1E83A 3AG3C 1QSPA 2J7PD 1NG1A 3K7DA 3NMIA 4H54A 4A2NB 4C3DA 4FAPB 5E3CA 3G50A 1NSGB 2J45A 4HFKB 3VF0A 1A41A 5A6AA 1VTMP 4U5DE 3JRTA 1FNTc 3LS0A 5AC4A 1JR8A 1YVIA 4MS2A 1OCZC 1UFBA 5CI8A 4U5CE 2OCCC 3EG9B 1TKNA 3POVA 5DS6A 1LPEA 1SYQA 1VMAA 3EZIA 2R03A 3K66A 4BJ5C 4D4XA 4CDVA 2HFIA 5D92A 1WATA 3DKAA 1YYJA 4JTDB 3T6GB 2CYDA 2J9BA 2KK1A 4E0IA 2HMQA 3VAYA 2GFHA 1C02A 3RFYA 2J9UA 1LVKA 3EG9A 1TWGA 4JW1A 3S9OA 3S29A 2GA0A 3RW0A 3JSEO 1NU7D 2YLDA 1ZU4A 2W9YA 2Z15A 4MW3A 3TQOA 5F28E 5L0GA 2GDCA 2F22A 3HKKA 4XEVA 3MFNA 2D5RB 3RVYA 3EFOA 2ASRA 3DXJF 3I5QA 3DD7A 4HEAJ 4I44A 2HJ3A 3E70C 3CQZA 4IGGA 5JLIA 4G7HF 2ZXWC 1Q0MA 3DJUB 4I1MA 2DYSC 4LERA 2HS5A 4XPYA 5JT4A 2YRFA 3H2UA 3LLKA 3ZTZA 3O10A 2AU5A 1LS4A 1YA9A 3PMRA 4BJ5A 3ASNC 2Y39A 2G62A 2B0JA 3FVYA 5EGYA 1CPQA 5BQIA 2FGYA 3CZ6A 5KYYA 1HW1A 3L8IA 3E9VA 3U9MA 3NMKA 1Q0GA 1ZW3A 2WZLA 5A6JA 4U5HA 4YN0B 4YT4A 1ZW2A 4H4KC 4RBNA 1VYIA 2R7SA 3LNRA 3ABMC 2J7PA 1GM5A 1OCCC 3G4ZA 4DRHB 2PBEA 1TWAA 4IRUA 2H7BA 3I5PA 2A1DD 2FAPB 1CGME 4OIOF 1XZPA 1FFTC 3FAPB 3GODA 5DQZA 2XLEA 1M2VB 3T4RA 3Q6NA 4E7SA 5CIVA 2UUHA 1E84A 2R7UA 4C3EA 2QNLA 1H9GA 5JUAA 1T6UA 2EIKC 2LIGA 4JJFA 1T9KA 5JS5A 5F5HA 2IBFA 2P0NA 4I3MA 4PK4A 1K40A 1Z23A 5COFA 1RJ9B 3T6JA 2OU6A 4ZLCA 5B3IA 3NKEA 2CW0F 4DJ9A 1EKYA 2OQMA 2LP4A 3AOUA 3EGDA 3KPHA 4DRIB 4XWJA 5L0IA 3UMHA 4E18A 1EA8A 4BJ1A 2CNWA 2WZGA 4X0RA 3RH3A 4A4AA 5E2QA 3U0CA 4XLPF 1M2VA 1SR2A 5A6KA 2GWWA 1TWHA 3C8GD 3IQCA 2KYHA 3NYMA 4P9TA 3NYLA 4MVMA 3WAQA 3HJCA 2JX0A 5EHHA 1M6TA 2CNWD 5BQHA 3OEOA 4YWQA 5B3SC 2WL8A 4G7OF 3LS1A 1YARO 2M64A 3U3FA 5AC5A 2NSFA 3LEVA 3OA1A 3LESA 4WGYA 2LFFA 1OXBA 4K0DA 1R4TA 1VLTA 3HLZA 1LIHA 2QUPA 5DLJA 3SXZA 3AQCA 2OEVA 4MTOA 1Z63A 3S0XA 3EPVA 1YA7O 3RKOF 2J8WA 3MLGA 1BR1A 1S7ZA 2L7AA 2PF4E 3B0PA 3FXHA 2I8BA 2XLVA 4KNWA 3MYFA 2EIJC 1O3UA 3DAGA 1MMNA 2YKZA 5DS5A 1O87A 2L6HA 2YL1A 4PJJA 2L81A 4CS7A 3EGXA 4Z9JA 3V5ZA 2DB4A 1QLEC 3KMIA 4YL0A 1A7VA 2DI3A 3ZDLA 3NKDA 1RKEB 5KYWB 1QPUA 4O6YA 3F46A 2R05A 4W8PA 1BR4A 2IYLD 3O6XA 2WVOA 3DI5A 3I4UA 4K1OA 2XLOA 4JEBA 3AG1C 3K6BA 3B71A 3T9OA 1OQCA 4MVRA 1K04A 4IAQA 4WJ0A 1A0BA 3DM5A 4O7GA 3SXMA 4OIQF 1VLSA 3GEEA 3R7CA 5A6BD 5DVWA 2OJQA 1ORSC 4N06A 3HNLA 3GANA 2HJMA 2EILC 4PACA 1EI7A 1T6IA 3L34A 4YT2A 2VCCA 1RMVA 3DMDA 2R7XA 2HZ8A 2Y3GA 3S27A 1MNEA 3RYLA 2HV7A 4OIPF 1OKKA 1VYKA 2IXPA 3C8ZA 1WTYA 4CJOA 5T1DB 2XM4A 4RD9A 4MQ9F 4AL1A 1YLMA 2ZD9A 3SYNA 1OR2A 1JPJA 2PNOA 4U5EE 4RDAA 3W2WA 3DE9A 1AUEA 3HNIA 4EIYA 3SXYA 3ATPA 5TJ5E 5KYXB 4IJJA 3FDQA 3C62A 3ZSUA 2XM0A 3CEXA 2VC9A 1D0ZA 3CAXA 3QTHA 5KYUA 3CSKA 3ZIBA 2LFDA 2HSQA 4I1OB 4PJMA 2XL4A 3LLIA 3IEEA 2H7VC 1ZHXA 3O55A 2IM8A 3OWTA 3ABKC 1LE4A 1AVOB 1Q0KA 3ITFA 3LEOA 4JC7A 4PJLA 3ZG1A 4CDAA 4DBQA 3TULA 1ZVZA 1QKRA 1GQAA 4MVOA 1CGNA 1BDJB 4LDKA 4CX9A 2Y69C 3S90A 2A0BA 4JCZA 3EH1A 4NTFA 1VK5A 4DOZA 4QI2A 2R7TA 2RD9A 4BJ6C 5L0CA 1MNDA 1NFNA 5B1BC 2YLIA 1ZYRF 4NCQA 3C8GB 4MNDA 4EKWA 2PP4A 1XZQA 1TR2A 2W4BA 1FR0A 1MQVA 1RCPA 4ONSA 4CSAA 4E17A 4U5FE 2XS8A 1HE9A 3ZTMA 1G4WR 2H7OA 1ZZPA 3JYHA 4OIRF 4HFFB 2A6HF 4OD4A 2Q4FA 1Z5ZA 4U5GA 2C03A 2EPOA 3RQEA 2UUIA 2DGJA 2JPUA 3QW0A 2QY9A 2XS1A 4CS9A 2L6GA 4AK9A 5L3QA 1GGQA 3K1IA 1Z6AA 3AG2C 1J8YF 1H9TA 1OKKD 2LCHA 1JRAA 4IARA 4JRZA 4FWVA 5D91A 3PDMP 2EPLX 3AGTA 1CPRA 1Y6DA 3C63A 2PX0A 4JCHA 4O6NA 4O6MA 5COMA 4UDVA 3JCUQ 2IXMA 3S84A 3LJBA 4BEMJ 3EGDB 3RVZA 2B0HA 1V74B 2J9VA 2KSFA 4L6RA 3U9JA 2AP3A 3MBGA 3QVYA 4BPMA 5HV9A 5FCLA 5FZTA 4O79A 1U0BB 1LKXA 2A69F 1L3PA 3A9CA 4K7BA 2BE5F 2CDQA 5L3VA 3SP1A 3X1OA 2C04A 1DOVA 3RQGA 4AE4A 5DQTA 2IXOA 4ULWA 1Z3IX 1FMVA 4CIHA 2NPUA 2VCBA 3DAFA 2OKUA 3NRHA 4Q5SF 1S05A 2Q9AA 1GS9A 3GEIA 1G4US 5KYYB 4NY3A 1PV3A 4YK5A 2P7VA 1IW7F 1D1BA 4U9EA 3UR3C 1M56C 1SMYF 3MYIA 3NG1A 1ZHZA 4JTAB 3RF3A 3U2MA 4DVYP 2XL8A 2YEVA 3ASOC 4W8KA 4C7OA 2R7QA 4ZLDA 1SF8A 3PHF2 4G0HA 4G7ZF 4NTBA 2D4UA 3L1MA 2PX3A 2XXAA 3K1IC 2KC3A 4EBKA 3C8GA 4JEAA 4YT8A 1OXKA 3NYJA 4JIOA 1LI5A 2GAQA 3V5XA 3VM6A 3AG4C 3SXKA 3C18A 1TQGA 4BJTA 2Q9CA 4IB4A 2OG2A 1V4AA 3FMSA 3IPMO 3FHDA 4U9DA 4XPWA 2J46A 1M57C 1D0XA 2R02A 2H8AA 2CCYA 3GWNA 1R5ID 3LUTB 4PR9A 2VH3A 4J7TA 2ZPAA 4R32A 4XLNF 5F5FA 2ICWG 1SZIA 3JTLO 4J32B 4JURI 3SNHA 1YJGA 3UGPA 2YQYA 2MYSA 3B0VC 5A69A 1V55C 3JYYA 5KYUB 3QZCA 1Z7Qc 3V5YA 3K33A 3ABLC 2W4MA 2PFDA 2A68F 2YWAA 1BZ4A 1NLXA 1RKCA 5L0JA 4LDRA 1ORYA 4GYTA 1LM3B 2YZSA 2YVKA 2Y3DA 3L8JA 1J8MF 1WASA 1WOLA 2J9WA 2NG1A 3AGUA 3AQBA 3TK0A 4AX2A 4DRJB 4JVSA 5JSLA 1TWCA 4ER9A 1HW2A 4CDYA 3RQFA 4BEJA 4ULVA 2Y3HA 3B29A 2Y3BA 1D1AA 1BBHA 4KBLA 4NQFA 1KU2A 1M2OA 2QLAA 3N0TA 3WODF 5L0FA 5HSWA 2NUPA 2QTVA 3GM3A 5E33A 2A6EF 1MMDA 256BA 1HY5A 2XLHA 3AJMA 3GM1A 1ORJA 4XPXA 4Q4ZF 2CGEA 1G8XA 4JZAA 1LE2A 4CIPA 3O39A 2EPKX 2NSGA 1B68A 2RSEB 3KYJA 1HMOA 1QVXA 4LACB 1WGWA 3KYIA 3U8PA 1JPNA 4PFPA 2LQGA 2XRHA 4JTCB 4AE4B 5A6BA 3ECSA 2WB7A 2KQ9A 2R25A 2ZXOA 3X2QC 1D0YA 5KYXA 1E86A 2LSEA 4F4BA 4EUKB 4N6HA 1PD0A 1ST6A 5BUOA 3FAJA 2W45A 3JRMO 3UNGC 1PCXA 2YL0A 3M79A 3Q7GA 4JE9A 2XSEA 4E0HA 2KNHA 1TFOB 3US6A 2HKVA 1HMDA 1CGOA 5IY5C 3KH2A 4P9FA 3ZQVA 3A11A 3UGOA 4CS8A 2V3CC 2TMVP 2KJGA 4OINF 3TJ5A 3N2ZB 2JD3A 3EQLF 3HNJA 2G3VA 3R2PA 4PFOA 2LD6A 2L9JA 3EHMA 4CS9C 1EQ1A 2A0UA 2OEXA 2MHRA 2O9XA 4XEFA 4C7OB 3NMJA 3ZC4A 1U89A 3M15A 3T6BA 1A7DA 3W4YA 3W8IA 2YL7A 3W8HA 1FTSA 4LLEA 5T3TA 3BEHA 3GM2A 3M4BA 4MVUA 1RKEA 5KYWA 1C03A 2VB6A 4XEKA 1W2WA 4DXWA 1C17M 5K0IA 1NU9C 3IQ5A 1I4YA 4HE8D 4J7YA 4MVZA 2KW3C 2WVNA 4CS8C 4M63A 4BJ6A 2NUPB 2VASA 3U3BA 1H7IA 3Q7LA 3ZWIA 1NBBA 2VCAA 4FESA 4QDLA 3SEOA 4E7ZA 2XLWA 1JMWA 1Q0FA 2J0XA 4WGZA 3DE8A 1OW6A 1ZHTA 3VYWA 2EPMX 2G3KA 2IXNA 3H2VA 4U5BE 3W2VA 5GPGB 4C3BA 2OOCA 4J30B 3TD7A 2YL3A 3G4XA 1JOGA 3EHNA 1YYXA 2XLDA 1IZMA 4Z9IA 1KTMA 1Y4CA 1ZHYA 4B6IA 3DJNB 3GWLA 4MVSA 3UMKA 4MTGA 2MWQA 2AWCA 4IWBA 3ZVRA 1LS1A 3C7JA 2BC5A 2AWYA 2HSBA 2FFHA 4JJGA 2XXAB 4YL3A 4Q7CA 1T5OA 3TJ6A 3KKBA 3LAYA 5E3AA 3IHUA 3U8VA 4EHPA 4JKVA 4LDQA 3U5SA 1KNYA 4BG0A 2NUTA 1VB5A 4GQHA 4XQ1A 5EK0A 1NZEA 1UG7A 1OW8A 4QI0A 3DWWA 2QE9A 4MTFA 2I15A 2P6VA 1ZHWA 2YLGA 3EGXB 1TFKB 4XTKA 3F47A 3WHNA 3KL4A 3EH2A 4CBEA 4P6IC 4DVZA 3B0UX 1RJ9A 1T6QA 3JSZA 3GEHA 4G78A 1E85A 4EBJA 2M4EA 2Q00A 4DBRA 2BL2A 2HMZA 3H65A 2EIMC 4AL0A 2ZXPA 1YZAA 4Z9HA 1DOWA 2Q3TA 1MMGA 3MX3A 3RIPA 1QQ3A 2OJED 4IAOA 4CJGA 4CSAC 1N1CA 1OCRC 1E2XA 5JVEA 4YL1A 3EFOB 1OW7A 1RXQA 3JZ0A 3TOMA 1V54C 3U2LA 3DZAA 5AGFA 5DS4A 4GEHA 1JAFA 3L0IA 4EWCA 3ZQYA 4NC3A 2R7WA 3J06A 3BRJA 2Q7RA 1OCOC 4ANJA 2R7RA 2IOQA 2R7OA 3VRCA 1FFHA 2NUTB 3FOPA 1YDIA 1U6HA 1F1MA 3PCVA 1H6GA 2AVKA 1NFOA 2LK4A 3TOLA 2V26A 1I5NA 3QMKA 4KI2A 2X0CA 3K1HA 2YHSA 4OD5A 3S28A 4YJWA 5CI9A 3Q6MA 4MW8A 1A7EA 1HE1A 2X51A 5BQGA 4FX5A 2R9RB 3LNMB 1XWJA 4N4WA 2Q9BA 4PJNA 2ZXRA 4YT5A 1ZU5A 4KNVA 1G5ZA 2P1AA 3FOOA 3QVZA 3QW1A 4LLCA 4MVQA 3SZRA 1T01A 5L0DA 2P61A 2EPNA 1AEPA 3UMIA 3EJNA 3HTKC 2XL6A 2HV6A
chains in the Genus database with same CATH topology
4IARA 1YZCA 5JP7A 1CPRA 3C63A 1CGOA 4D4NA 1M6TA 3ZQVA 2XLMA 4L6RA 3M4CA 4WGYA 3QVYA 3HNJA 3IQ6A 3HNKA 2J8WA 3NMJA 3M15A 2YL0A 2YL7A 2XLVA 1APCA 3M4BA 2YKZA 3IQ5A 1S05A 2YL1A 4U9EA 1A7VA 3ZWIA 1NBBA 3NMIA 1QPUA 2XLWA 2XL8A 4WGZA 3DE8A 2XLOA 3L1MA 4JEBA 2YL3A 4IAQA 1YYXA 2XLDA 4JEAA 4D4XA 4CDVA 1YYJA 2J9BA 2BC5A 3HNLA 4IB4A 4JKVA 4U9DA 2YLDA 4CJOA 2CCYA 2XM4A 2YLGA 5JLIA 3DE9A 3HNIA 1E85A 4EIYA 5JT4A 3ZTZA 3C62A 1YZAA 2XM0A 1QQ3A 1LM3B 4CJGA 1CPQA 5JVEA 5JRAA 5JSLA 3NMKA 3TOMA 4CDAA 5AGFA 4CDYA 4ER9A 1JAFA 3ZQYA 4ULVA 4NC3A 1GQAA 1CGNA 3VRCA 4CX9A 1BBHA 2QLAA 3FOPA 2XLEA 2YLIA 256BA 2XLHA 3TOLA 1E84A 4CIPA 5JUAA 1MQVA 1RCPA 5JS5A 3U8PA 1E83A 3ZTMA 5B3IA 1EKYA 4N4WA 3QW0A 1E86A 3FOOA 3QVZA 3QW1A 4N6HA 2XL6A 3M79A 4JE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IAR A;  1YZC A;  5JP7 A;  1CPR A;  3C63 A;  1CGO A;  4D4N A;  1M6T A;  3ZQV A;  2XLM A;  4L6R A;  3M4C A;  4WGY A;  3QVY A;  3HNJ A;  3IQ6 A;  3HNK A;  2J8W A;  3NMJ A;  3M15 A;  2YL0 A;  2YL7 A;  2XLV A;  1APC A;  3M4B A;  2YKZ A;  3IQ5 A;  1S05 A;  2YL1 A;  4U9E A;  1A7V A;  3ZWI A;  1NBB A;  3NMI A;  1QPU A;  2XLW A;  2XL8 A;  4WGZ A;  3DE8 A;  2XLO A;  3L1M A;  4JEB A;  2YL3 A;  4IAQ A;  1YYX A;  2XLD A;  4JEA A;  4D4X A;  4CDV A;  1YYJ A;  2J9B A;  2BC5 A;  3HNL A;  4IB4 A;  4JKV A;  4U9D A;  2YLD A;  4CJO A;  2CCY A;  2XM4 A;  2YLG A;  5JLI A;  3DE9 A;  3HNI A;  1E85 A;  4EIY A;  5JT4 A;  3ZTZ A;  3C62 A;  1YZA A;  2XM0 A;  1QQ3 A;  1LM3 B;  4CJG A;  1CPQ A;  5JVE A;  5JRA A;  5JSL A;  3NMK A;  3TOM A;  4CDA A;  5AGF A;  4CDY A;  4ER9 A;  1JAF A;  3ZQY A;  4ULV A;  4NC3 A;  1GQA A;  1CGN A;  3VRC A;  4CX9 A;  1BBH A;  2QLA A;  3FOP A;  2XLE A;  2YLI A;  256B A;  2XLH A;  3TOL A;  1E84 A;  4CIP A;  5JUA A;  1MQV A;  1RCP A;  5JS5 A;  3U8P A;  1E83 A;  3ZTM A;  5B3I A;  1EKY A;  4N4W A;  3QW0 A;  1E86 A;  3FOO A;  3QVZ A;  3QW1 A;  4N6H A;  2XL6 A;  3M79 A;  4JE9 A; 
#chains in the Genus database with same CATH topology
 1BR2 A;  1Q0D A;  2WVQ A;  4N6C A;  1YZC A;  1I4Z A;  5JP7 A;  2WZF A;  3JT1 A;  4D4N A;  2R7V A;  3IQT A;  1OR3 A;  2XLM A;  5COG A;  1YAU O;  4NTA A;  3M4C A;  3V7O A;  1VOM A;  1WWP A;  3IQ6 A;  3HNK A;  4WAB A;  1D1C A;  2ETS A;  3WG7 C;  1FAP B;  1MMA A;  1O5H A;  3M1C B;  5T3W A;  3B9Q A;  3NDB B;  5KYN A;  2J0W A;  3GOR A;  1QZX A;  3N24 A;  1APC A;  3EZH A;  2EIN C;  4EBB A;  5L0H A;  2HUJ A;  1LI7 A;  2L6F A;  5B1A C;  1K05 A;  1L7C A;  3DM9 B;  1PD1 A;  2DYR C;  1WN0 A;  1FMW A;  4KC9 A;  2KGO A;  2E87 A;  5JRA A;  1E83 A;  3AG3 C;  1QSP A;  2J7P D;  1NG1 A;  3K7D A;  3NMI A;  4H54 A;  4A2N B;  4C3D A;  4FAP B;  5E3C A;  3G50 A;  1NSG B;  2J45 A;  4HFK B;  3VF0 A;  1A41 A;  5A6A A;  1VTM P;  4U5D E;  3JRT A;  1FNT c;  3LS0 A;  5AC4 A;  1JR8 A;  1YVI A;  4MS2 A;  1OCZ C;  1UFB A;  5CI8 A;  4U5C E;  2OCC C;  3EG9 B;  1TKN A;  3POV A;  5DS6 A;  1LPE A;  1SYQ A;  1VMA A;  3EZI A;  2R03 A;  3K66 A;  4BJ5 C;  4D4X A;  4CDV A;  2HFI A;  5D92 A;  1WAT A;  3DKA A;  1YYJ A;  4JTD B;  3T6G B;  2CYD A;  2J9B A;  2KK1 A;  4E0I A;  2HMQ A;  3VAY A;  2GFH A;  1C02 A;  3RFY A;  2J9U A;  1LVK A;  3EG9 A;  1TWG A;  4JW1 A;  3S9O A;  3S29 A;  2GA0 A;  3RW0 A;  3JSE O;  1NU7 D;  2YLD A;  1ZU4 A;  2W9Y A;  2Z15 A;  4MW3 A;  3TQO A;  5F28 E;  5L0G A;  2GDC A;  2F22 A;  3HKK A;  4XEV A;  3MFN A;  2D5R B;  3RVY A;  3EFO A;  2ASR A;  3DXJ F;  3I5Q A;  3DD7 A;  4HEA J;  4I44 A;  2HJ3 A;  3E70 C;  3CQZ A;  4IGG A;  5JLI A;  4G7H F;  2ZXW C;  1Q0M A;  3DJU B;  4I1M A;  2DYS C;  4LER A;  2HS5 A;  4XPY A;  5JT4 A;  2YRF A;  3H2U A;  3LLK A;  3ZTZ A;  3O10 A;  2AU5 A;  1LS4 A;  1YA9 A;  3PMR A;  4BJ5 A;  3ASN C;  2Y39 A;  2G62 A;  2B0J A;  3FVY A;  5EGY A;  1CPQ A;  5BQI A;  2FGY A;  3CZ6 A;  5KYY A;  1HW1 A;  3L8I A;  3E9V A;  3U9M A;  3NMK A;  1Q0G A;  1ZW3 A;  2WZL A;  5A6J A;  4U5H A;  4YN0 B;  4YT4 A;  1ZW2 A;  4H4K C;  4RBN A;  1VYI A;  2R7S A;  3LNR A;  3ABM C;  2J7P A;  1GM5 A;  1OCC C;  3G4Z A;  4DRH B;  2PBE A;  1TWA A;  4IRU A;  2H7B A;  3I5P A;  2A1D D;  2FAP B;  1CGM E;  4OIO F;  1XZP A;  1FFT C;  3FAP B;  3GOD A;  5DQZ A;  2XLE A;  1M2V B;  3T4R A;  3Q6N A;  4E7S A;  5CIV A;  2UUH A;  1E84 A;  2R7U A;  4C3E A;  2QNL A;  1H9G A;  5JUA A;  1T6U A;  2EIK C;  2LIG A;  4JJF A;  1T9K A;  5JS5 A;  5F5H A;  2IBF A;  2P0N A;  4I3M A;  4PK4 A;  1K40 A;  1Z23 A;  5COF A;  1RJ9 B;  3T6J A;  2OU6 A;  4ZLC A;  5B3I A;  3NKE A;  2CW0 F;  4DJ9 A;  1EKY A;  2OQM A;  2LP4 A;  3AOU A;  3EGD A;  3KPH A;  4DRI B;  4XWJ A;  5L0I A;  3UMH A;  4E18 A;  1EA8 A;  4BJ1 A;  2CNW A;  2WZG A;  4X0R A;  3RH3 A;  4A4A A;  5E2Q A;  3U0C A;  4XLP F;  1M2V A;  1SR2 A;  5A6K A;  2GWW A;  1TWH A;  3C8G D;  3IQC A;  2KYH A;  3NYM A;  4P9T A;  3NYL A;  4MVM A;  3WAQ A;  3HJC A;  2JX0 A;  5EHH A;  1M6T A;  2CNW D;  5BQH A;  3OEO A;  4YWQ A;  5B3S C;  2WL8 A;  4G7O F;  3LS1 A;  1YAR O;  2M64 A;  3U3F A;  5AC5 A;  2NSF A;  3LEV A;  3OA1 A;  3LES A;  4WGY A;  2LFF A;  1OXB A;  4K0D A;  1R4T A;  1VLT A;  3HLZ A;  1LIH A;  2QUP A;  5DLJ A;  3SXZ A;  3AQC A;  2OEV A;  4MTO A;  1Z63 A;  3S0X A;  3EPV A;  1YA7 O;  3RKO F;  2J8W A;  3MLG A;  1BR1 A;  1S7Z A;  2L7A A;  2PF4 E;  3B0P A;  3FXH A;  2I8B A;  2XLV A;  4KNW A;  3MYF A;  2EIJ C;  1O3U A;  3DAG A;  1MMN A;  2YKZ A;  5DS5 A;  1O87 A;  2L6H A;  2YL1 A;  4PJJ A;  2L81 A;  4CS7 A;  3EGX A;  4Z9J A;  3V5Z A;  2DB4 A;  1QLE C;  3KMI A;  4YL0 A;  1A7V A;  2DI3 A;  3ZDL A;  3NKD A;  1RKE B;  5KYW B;  1QPU A;  4O6Y A;  3F46 A;  2R05 A;  4W8P A;  1BR4 A;  2IYL D;  3O6X A;  2WVO A;  3DI5 A;  3I4U A;  4K1O A;  2XLO A;  4JEB A;  3AG1 C;  3K6B A;  3B71 A;  3T9O A;  1OQC A;  4MVR A;  1K04 A;  4IAQ A;  4WJ0 A;  1A0B A;  3DM5 A;  4O7G A;  3SXM A;  4OIQ F;  1VLS A;  3GEE A;  3R7C A;  5A6B D;  5DVW A;  2OJQ A;  1ORS C;  4N06 A;  3HNL A;  3GAN A;  2HJM A;  2EIL C;  4PAC A;  1EI7 A;  1T6I A;  3L34 A;  4YT2 A;  2VCC A;  1RMV A;  3DMD A;  2R7X A;  2HZ8 A;  2Y3G A;  3S27 A;  1MNE A;  3RYL A;  2HV7 A;  4OIP F;  1OKK A;  1VYK A;  2IXP A;  3C8Z A;  1WTY A;  4CJO A;  5T1D B;  2XM4 A;  4RD9 A;  4MQ9 F;  4AL1 A;  1YLM A;  2ZD9 A;  3SYN A;  1OR2 A;  1JPJ A;  2PNO A;  4U5E E;  4RDA A;  3W2W A;  3DE9 A;  1AUE A;  3HNI A;  4EIY A;  3SXY A;  3ATP A;  5TJ5 E;  5KYX B;  4IJJ A;  3FDQ A;  3C62 A;  3ZSU A;  2XM0 A;  3CEX A;  2VC9 A;  1D0Z A;  3CAX A;  3QTH A;  5KYU A;  3CSK A;  3ZIB A;  2LFD A;  2HSQ A;  4I1O B;  4PJM A;  2XL4 A;  3LLI A;  3IEE A;  2H7V C;  1ZHX A;  3O55 A;  2IM8 A;  3OWT A;  3ABK C;  1LE4 A;  1AVO B;  1Q0K A;  3ITF A;  3LEO A;  4JC7 A;  4PJL A;  3ZG1 A;  4CDA A;  4DBQ A;  3TUL A;  1ZVZ A;  1QKR A;  1GQA A;  4MVO A;  1CGN A;  1BDJ B;  4LDK A;  4CX9 A;  2Y69 C;  3S90 A;  2A0B A;  4JCZ A;  3EH1 A;  4NTF A;  1VK5 A;  4DOZ A;  4QI2 A;  2R7T A;  2RD9 A;  4BJ6 C;  5L0C A;  1MND A;  1NFN A;  5B1B C;  2YLI A;  1ZYR F;  4NCQ A;  3C8G B;  4MND A;  4EKW A;  2PP4 A;  1XZQ A;  1TR2 A;  2W4B A;  1FR0 A;  1MQV A;  1RCP A;  4ONS A;  4CSA A;  4E17 A;  4U5F E;  2XS8 A;  1HE9 A;  3ZTM A;  1G4W R;  2H7O A;  1ZZP A;  3JYH A;  4OIR F;  4HFF B;  2A6H F;  4OD4 A;  2Q4F A;  1Z5Z A;  4U5G A;  2C03 A;  2EPO A;  3RQE A;  2UUI A;  2DGJ A;  2JPU A;  3QW0 A;  2QY9 A;  2XS1 A;  4CS9 A;  2L6G A;  4AK9 A;  5L3Q A;  1GGQ A;  3K1I A;  1Z6A A;  3AG2 C;  1J8Y F;  1H9T A;  1OKK D;  2LCH A;  1JRA A;  4IAR A;  4JRZ A;  4FWV A;  5D91 A;  3PDM P;  2EPL X;  3AGT A;  1CPR A;  1Y6D A;  3C63 A;  2PX0 A;  4JCH A;  4O6N A;  4O6M A;  5COM A;  4UDV A;  3JCU Q;  2IXM A;  3S84 A;  3LJB A;  4BEM J;  3EGD B;  3RVZ A;  2B0H A;  1V74 B;  2J9V A;  2KSF A;  4L6R A;  3U9J A;  2AP3 A;  3MBG A;  3QVY A;  4BPM A;  5HV9 A;  5FCL A;  5FZT A;  4O79 A;  1U0B B;  1LKX A;  2A69 F;  1L3P A;  3A9C A;  4K7B A;  2BE5 F;  2CDQ A;  5L3V A;  3SP1 A;  3X1O A;  2C04 A;  1DOV A;  3RQG A;  4AE4 A;  5DQT A;  2IXO A;  4ULW A;  1Z3I X;  1FMV A;  4CIH A;  2NPU A;  2VCB A;  3DAF A;  2OKU A;  3NRH A;  4Q5S F;  1S05 A;  2Q9A A;  1GS9 A;  3GEI A;  1G4U S;  5KYY B;  4NY3 A;  1PV3 A;  4YK5 A;  2P7V A;  1IW7 F;  1D1B A;  4U9E A;  3UR3 C;  1M56 C;  1SMY F;  3MYI A;  3NG1 A;  1ZHZ A;  4JTA B;  3RF3 A;  3U2M A;  4DVY P;  2XL8 A;  2YEV A;  3ASO C;  4W8K A;  4C7O A;  2R7Q A;  4ZLD A;  1SF8 A;  3PHF 2;  4G0H A;  4G7Z F;  4NTB A;  2D4U A;  3L1M A;  2PX3 A;  2XXA A;  3K1I C;  2KC3 A;  4EBK A;  3C8G A;  4JEA A;  4YT8 A;  1OXK A;  3NYJ A;  4JIO A;  1LI5 A;  2GAQ A;  3V5X A;  3VM6 A;  3AG4 C;  3SXK A;  3C18 A;  1TQG A;  4BJT A;  2Q9C A;  4IB4 A;  2OG2 A;  1V4A A;  3FMS A;  3IPM O;  3FHD A;  4U9D A;  4XPW A;  2J46 A;  1M57 C;  1D0X A;  2R02 A;  2H8A A;  2CCY A;  3GWN A;  1R5I D;  3LUT B;  4PR9 A;  2VH3 A;  4J7T A;  2ZPA A;  4R32 A;  4XLN F;  5F5F A;  2ICW G;  1SZI A;  3JTL O;  4J32 B;  4JUR I;  3SNH A;  1YJG A;  3UGP A;  2YQY A;  2MYS A;  3B0V C;  5A69 A;  1V55 C;  3JYY A;  5KYU B;  3QZC A;  1Z7Q c;  3V5Y A;  3K33 A;  3ABL C;  2W4M A;  2PFD A;  2A68 F;  2YWA A;  1BZ4 A;  1NLX A;  1RKC A;  5L0J A;  4LDR A;  1ORY A;  4GYT A;  1LM3 B;  2YZS A;  2YVK A;  2Y3D A;  3L8J A;  1J8M F;  1WAS A;  1WOL A;  2J9W A;  2NG1 A;  3AGU A;  3AQB A;  3TK0 A;  4AX2 A;  4DRJ B;  4JVS A;  5JSL A;  1TWC A;  4ER9 A;  1HW2 A;  4CDY A;  3RQF A;  4BEJ A;  4ULV A;  2Y3H A;  3B29 A;  2Y3B A;  1D1A A;  1BBH A;  4KBL A;  4NQF A;  1KU2 A;  1M2O A;  2QLA A;  3N0T A;  3WOD F;  5L0F A;  5HSW A;  2NUP A;  2QTV A;  3GM3 A;  5E33 A;  2A6E F;  1MMD A;  256B A;  1HY5 A;  2XLH A;  3AJM A;  3GM1 A;  1ORJ A;  4XPX A;  4Q4Z F;  2CGE A;  1G8X A;  4JZA A;  1LE2 A;  4CIP A;  3O39 A;  2EPK X;  2NSG A;  1B68 A;  2RSE B;  3KYJ A;  1HMO A;  1QVX A;  4LAC B;  1WGW A;  3KYI A;  3U8P A;  1JPN A;  4PFP A;  2LQG A;  2XRH A;  4JTC B;  4AE4 B;  5A6B A;  3ECS A;  2WB7 A;  2KQ9 A;  2R25 A;  2ZXO A;  3X2Q C;  1D0Y A;  5KYX A;  1E86 A;  2LSE A;  4F4B A;  4EUK B;  4N6H A;  1PD0 A;  1ST6 A;  5BUO A;  3FAJ A;  2W45 A;  3JRM O;  3UNG C;  1PCX A;  2YL0 A;  3M79 A;  3Q7G A;  4JE9 A;  2XSE A;  4E0H A;  2KNH A;  1TFO B;  3US6 A;  2HKV A;  1HMD A;  1CGO A;  5IY5 C;  3KH2 A;  4P9F A;  3ZQV A;  3A11 A;  3UGO A;  4CS8 A;  2V3C C;  2TMV P;  2KJG A;  4OIN F;  3TJ5 A;  3N2Z B;  2JD3 A;  3EQL F;  3HNJ A;  2G3V A;  3R2P A;  4PFO A;  2LD6 A;  2L9J A;  3EHM A;  4CS9 C;  1EQ1 A;  2A0U A;  2OEX A;  2MHR A;  2O9X A;  4XEF A;  4C7O B;  3NMJ A;  3ZC4 A;  1U89 A;  3M15 A;  3T6B A;  1A7D A;  3W4Y A;  3W8I A;  2YL7 A;  3W8H A;  1FTS A;  4LLE A;  5T3T A;  3BEH A;  3GM2 A;  3M4B A;  4MVU A;  1RKE A;  5KYW A;  1C03 A;  2VB6 A;  4XEK A;  1W2W A;  4DXW A;  1C17 M;  5K0I A;  1NU9 C;  3IQ5 A;  1I4Y A;  4HE8 D;  4J7Y A;  4MVZ A;  2KW3 C;  2WVN A;  4CS8 C;  4M63 A;  4BJ6 A;  2NUP B;  2VAS A;  3U3B A;  1H7I A;  3Q7L A;  3ZWI A;  1NBB A;  2VCA A;  4FES A;  4QDL A;  3SEO A;  4E7Z A;  2XLW A;  1JMW A;  1Q0F A;  2J0X A;  4WGZ A;  3DE8 A;  1OW6 A;  1ZHT A;  3VYW A;  2EPM X;  2G3K A;  2IXN A;  3H2V A;  4U5B E;  3W2V A;  5GPG B;  4C3B A;  2OOC A;  4J30 B;  3TD7 A;  2YL3 A;  3G4X A;  1JOG A;  3EHN A;  1YYX A;  2XLD A;  1IZM A;  4Z9I A;  1KTM A;  1Y4C A;  1ZHY A;  4B6I A;  3DJN B;  3GWL A;  4MVS A;  3UMK A;  4MTG A;  2MWQ A;  2AWC A;  4IWB A;  3ZVR A;  1LS1 A;  3C7J A;  2BC5 A;  2AWY A;  2HSB A;  2FFH A;  4JJG A;  2XXA B;  4YL3 A;  4Q7C A;  1T5O A;  3TJ6 A;  3KKB A;  3LAY A;  5E3A A;  3IHU A;  3U8V A;  4EHP A;  4JKV A;  4LDQ A;  3U5S A;  1KNY A;  4BG0 A;  2NUT A;  1VB5 A;  4GQH A;  4XQ1 A;  5EK0 A;  1NZE A;  1UG7 A;  1OW8 A;  4QI0 A;  3DWW A;  2QE9 A;  4MTF A;  2I15 A;  2P6V A;  1ZHW A;  2YLG A;  3EGX B;  1TFK B;  4XTK A;  3F47 A;  3WHN A;  3KL4 A;  3EH2 A;  4CBE A;  4P6I C;  4DVZ A;  3B0U X;  1RJ9 A;  1T6Q A;  3JSZ A;  3GEH A;  4G78 A;  1E85 A;  4EBJ A;  2M4E A;  2Q00 A;  4DBR A;  2BL2 A;  2HMZ A;  3H65 A;  2EIM C;  4AL0 A;  2ZXP A;  1YZA A;  4Z9H A;  1DOW A;  2Q3T A;  1MMG A;  3MX3 A;  3RIP A;  1QQ3 A;  2OJE D;  4IAO A;  4CJG A;  4CSA C;  1N1C A;  1OCR C;  1E2X A;  5JVE A;  4YL1 A;  3EFO B;  1OW7 A;  1RXQ A;  3JZ0 A;  3TOM A;  1V54 C;  3U2L A;  3DZA A;  5AGF A;  5DS4 A;  4GEH A;  1JAF A;  3L0I A;  4EWC A;  3ZQY A;  4NC3 A;  2R7W A;  3J06 A;  3BRJ A;  2Q7R A;  1OCO C;  4ANJ A;  2R7R A;  2IOQ A;  2R7O A;  3VRC A;  1FFH A;  2NUT B;  3FOP A;  1YDI A;  1U6H A;  1F1M A;  3PCV A;  1H6G A;  2AVK A;  1NFO A;  2LK4 A;  3TOL A;  2V26 A;  1I5N A;  3QMK A;  4KI2 A;  2X0C A;  3K1H A;  2YHS A;  4OD5 A;  3S28 A;  4YJW A;  5CI9 A;  3Q6M A;  4MW8 A;  1A7E A;  1HE1 A;  2X51 A;  5BQG A;  4FX5 A;  2R9R B;  3LNM B;  1XWJ A;  4N4W A;  2Q9B A;  4PJN A;  2ZXR A;  4YT5 A;  1ZU5 A;  4KNV A;  1G5Z A;  2P1A A;  3FOO A;  3QVZ A;  3QW1 A;  4LLC A;  4MVQ A;  3SZR A;  1T01 A;  5L0D A;  2P61 A;  2EPN A;  1AEP A;  3UMI A;  3EJN A;  3HTK C;  2XL6 A;  2HV6 A; 
#chains in the Genus database with same CATH homology
 4IAR A;  1YZC A;  5JP7 A;  1CPR A;  3C63 A;  1CGO A;  4D4N A;  1M6T A;  3ZQV A;  2XLM A;  4L6R A;  3M4C A;  4WGY A;  3QVY A;  3HNJ A;  3IQ6 A;  3HNK A;  2J8W A;  3NMJ A;  3M15 A;  2YL0 A;  2YL7 A;  2XLV A;  1APC A;  3M4B A;  2YKZ A;  3IQ5 A;  1S05 A;  2YL1 A;  4U9E A;  1A7V A;  3ZWI A;  1NBB A;  3NMI A;  1QPU A;  2XLW A;  2XL8 A;  4WGZ A;  3DE8 A;  2XLO A;  3L1M A;  4JEB A;  2YL3 A;  4IAQ A;  1YYX A;  2XLD A;  4JEA A;  4D4X A;  4CDV A;  1YYJ A;  2J9B A;  2BC5 A;  3HNL A;  4IB4 A;  4JKV A;  4U9D A;  2YLD A;  4CJO A;  2CCY A;  2XM4 A;  2YLG A;  5JLI A;  3DE9 A;  3HNI A;  1E85 A;  4EIY A;  5JT4 A;  3ZTZ A;  3C62 A;  1YZA A;  2XM0 A;  1QQ3 A;  1LM3 B;  4CJG A;  1CPQ A;  5JVE A;  5JRA A;  5JSL A;  3NMK A;  3TOM A;  4CDA A;  5AGF A;  4CDY A;  4ER9 A;  1JAF A;  3ZQY A;  4ULV A;  4NC3 A;  1GQA A;  1CGN A;  3VRC A;  4CX9 A;  1BBH A;  2QLA A;  3FOP A;  2XLE A;  2YLI A;  256B A;  2XLH A;  3TOL A;  1E84 A;  4CIP A;  5JUA A;  1MQV A;  1RCP A;  5JS5 A;  3U8P A;  1E83 A;  3ZTM A;  5B3I A;  1EKY A;  4N4W A;  3QW0 A;  1E86 A;  3FOO A;  3QVZ A;  3QW1 A;  4N6H A;  2XL6 A;  3M79 A;  4JE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...