3QVYA

Crystal structure of the zn-ridc1 complex stabilized by bmoe crosslinks
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHDALHLANECKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome cb562
publication title Templated construction of a zn-selective protein dimerization motif.
pubmed doi rcsb
source organism Escherichia coli
total genus 42
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3qvyA00
4N4WA 1S05A 1CGOA 1EKYA 1JAFA 4CDVA 2J8WA 3M4CA 4CDYA 1LM3B 3DE9A 1A7VA 1YZAA 3QW0A 3M15A 2YL3A 3FOPA 2QLAA 4N6HA 4CJOA 4JKVA 2J9BA 3ZTMA 5JS5A 2YLDA 1E84A 3ZQVA 3HNLA 3C63A 2XLMA 2YKZA 3L1MA 2YL1A 1CPQA 5JSLA 5JRAA 3HNKA 3C62A 4IAQA 2XM4A 5AGFA 1M6TA 1CGNA 3ZTZA 1APCA 3HNIA 3M79A 5B3IA 1RCPA 3QVYA 4CX9A 4CJGA 4CDAA 1YYXA 3TOLA 2YL0A 4ER9A 1E83A 3TOMA 4EIYA 1YYJA 1E85A 1MQVA 1NBBA 4WGYA 4JEAA 4WGZA 2XLWA 1GQAA 2XLHA 3FOOA 1BBHA 4ULVA 4D4XA 2YL7A 3HNJA 1QPUA 3DE8A 256BA 2XL6A 1E86A 3U8PA 4CIPA 3ZWIA 4U9DA 3QVZA 4L6RA 3IQ5A 3M4BA 5JUAA 2XM0A 1YZCA 2CCYA 2XLOA 4JEBA 4D4NA 3IQ6A 2YLIA 4U9EA 5JLIA 2XL8A 1QQ3A 3VRCA 2XLDA 4JE9A 5JP7A 5JVEA 4IARA 3QW1A 1CPRA 3NMJA 2XLEA 3NMIA 2BC5A 2YLGA 3ZQYA 4NC3A 5JT4A 2XLVA 4IB4A 3NMKA
chains in the Genus database with same CATH superfamily
4MVRA 3T6BA 4G7OF 1E2XA 2JX0A 2DGJA 3ASNC 1KTMA 3ZIBA 1TKNA 1XZQA 4GYTA 2UUIA 1QVXA 3IQCA 2B0HA 2VC9A 2R9RB 2KW3C 1N1CA 4MVUA 3T4RA 2HSQA 3EH1A 2V26A 2H7BA 4PK4A 3QW0A 1C17M 1H9GA 2EPLX 2AVKA 4YJWA 2VH3A 1G8XA 4OD4A 2OJED 1Q0KA 2ZXPA 3DM5A 4A2NB 1NSGB 2QLAA 2Y3BA 1XZPA 3BRJA 4B6IA 4A4AA 4CJOA 4C3DA 3ZTMA 2WB7A 1Y6DA 4IJJA 3SP1A 2YLDA 3I5QA 1RJ9B 4MW8A 3C63A 2EIMC 3MFNA 3DKAA 4N6CA 4JIOA 5L0DA 3LNMB 2YZSA 2CDQA 3IPMO 3N24A 1RXQA 1IZMA 1SMYF 3H65A 1H7IA 1CPQA 2NG1A 4O7GA 4EUKB 5L0FA 2Q9BA 2XM4A 4YT4A 3RVZA 1O87A 3ITFA 3W8IA 5L3QA 3N0TA 1WATA 1NFOA 3LUTB 4NY3A 2IOQA 4Q4ZF 1LPEA 2QNLA 1G4US 4WABA 1K04A 2QY9A 1T6IA 2XS8A 5F28E 1LS4A 2KNHA 3AGUA 1RCPA 2WVOA 3JYHA 4MVZA 3S27A 4JTCB 4JCHA 2NUTA 4N06A 4CDAA 4CS7A 2J46A 3U3BA 3G4ZA 2R7SA 3RQGA 1V4AA 1OXKA 1ZW3A 2GWWA 1MNEA 2YL0A 3JYYA 4XPYA 2Q7RA 4ER9A 3U9JA 1VYIA 3SXZA 1T5OA 1TWHA 2LK4A 4EBJA 4E18A 2I8BA 1YYJA 3ABMC 1MMNA 3M1CB 1ZHTA 3HTKC 1VMAA 4BEMJ 4AK9A 1HE9A 2F22A 3LESA 1JPJA 3U8VA 1OQCA 1VK5A 3W2VA 1ST6A 2HKVA 2CW0F 1TWCA 3AQCA 3FOOA 4D4XA 1T01A 4LACB 2GDCA 2AP3A 4XEVA 2KYHA 2HFIA 1ORSC 2P1AA 2Q4FA 5D91A 2J9WA 1Q0FA 3DE8A 4I1OB 2Q00A 4W8KA 5DVWA 3UGOA 3AQBA 2LFDA 2P0NA 2XL6A 2OG2A 3LLKA 3Q7GA 4H4KC 5FCLA 5F5FA 2HJ3A 3ZWIA 1TFOB 1HE1A 3NG1A 2Z15A 2PFDA 4L6RA 4U5FE 3GEHA 2RD9A 4U9DA 1PD1A 2Q9CA 5JUAA 4AE4B 2XXAA 2W45A 3PHF2 2L7AA 3Q6NA 1RJ9A 4GEHA 3QZCA 4LLCA 1KNYA 3HLZA 2J0XA 1ZYRF 2YLIA 4MQ9F 3UNGC 5KYWB 5L0JA 3X2QC 3VRCA 3UMHA 3MLGA 1J8YF 4U5DE 1QSPA 2ETSA 2OU6A 3K1IC 4NTAA 4E17A 3QW1A 3SXYA 3R2PA 3GM3A 3DM9B 3IQTA 3KMIA 4O6MA 3V5ZA 3NKDA 2R05A 3W8HA 3JRMO 3AG1C 4JVSA 3GEEA 3RVYA 5EGYA 4NC3A 1XWJA 5COMA 2HMZA 2I15A 5A6BA 1ZW2A 5KYUB 4I1MA 5A6JA 4HE8D 4J7TA 3RW0A 1A41A 3FAPB 1F1MA 1VLSA 2H8AA 1WGWA 4MTOA 3OWTA 4E7ZA 3SXMA 4CDVA 2A6EF 3CZ6A 1VOMA 3IHUA 3U3FA 3M4CA 5IY5C 2AWYA 1QZXA 3DD7A 2EPKX 4I44A 4LDQA 4R32A 2L81A 1A7VA 1YZAA 4PJNA 3EGDA 1O3UA 3Q7LA 3T9OA 3S90A 3UGPA 4O6YA 3C8GA 1G5ZA 3EG9B 2PP4A 1JR8A 2BL2A 1V54C 2HMQA 4JTAB 2TMVP 2ZXRA 4OIQF 2L6HA 4MVOA 2P61A 4P9TA 4AL1A 4NQFA 3G4XA 4JKVA 1YARO 3MYFA 2XS1A 5DLJA 3FVYA 2C03A 4DVZA 3EZIA 5JS5A 5CI9A 3RH3A 4JTDB 2EIJC 1G4WR 1A7EA 1MMDA 4BPMA 3HNLA 4MTGA 3NKEA 1OW7A 5AC4A 2R7TA 2JD3A 3GORA 2JPUA 1I5NA 2XLMA 4M63A 4AE4A 4LERA 2YL1A 2W9YA 3LS0A 4J7YA 1Z6AA 3L8IA 3S0XA 1YJGA 1VB5A 1D0ZA 5JRAA 3DMDA 1PD0A 3HNKA 4DBRA 2NPUA 2YHSA 2Y69C 3OA1A 4BJ6A 5KYWA 2A6HF 2E87A 3DWWA 5KYXB 3K66A 5GPGB 1Z23A 4YL1A 1FMVA 3QMKA 4AX2A 4GQHA 5DQTA 1HY5A 4OIPF 1APCA 1Z5ZA 2J7PD 3A11A 3DAGA 4IWBA 3EHMA 3O6XA 4C7OB 3VAYA 5DS4A 3QVYA 2OJQA 2OEXA 3RQFA 3AG2C 4CJGA 1B68A 4XLPF 1OCOC 2AU5A 3LJBA 3Q6MA 1WWPA 1YYXA 4NTBA 3TOLA 1CGME 3DAFA 3C7JA 1W2WA 1NLXA 2XSEA 1EI7A 3TOMA 3TULA 2EPMX 1OKKA 1H6GA 3BEHA 3EFOA 4Q7CA 1LVKA 2VASA 4E0HA 2VCCA 4OINF 1Q0GA 3GWNA 3UMKA 1NBBA 2M64A 3NYMA 1U89A 4JEAA 4WGYA 3SEOA 1Z63A 2XLHA 2QTVA 2R7WA 4Z9IA 4ULVA 4XPXA 4PR9A 5T1DB 3B71A 4XTKA 3O55A 4HFFB 4XQ1A 4EBBA 4ANJA 1D0YA 1TR2A 3ATPA 3H2UA 1QPUA 2KGOA 3GM1A 3LS1A 4MTFA 3S29A 4JCZA 2OOCA 3FXHA 3U2LA 1AVOB 3GWLA 3ASOC 2Y3DA 2A0BA 5TJ5E 1L3PA 3EG9A 5DS5A 2DYSC 3U8PA 2M4EA 3AJMA 3LEOA 3QVZA 5L0GA 3WODF 3L8JA 3EGXA 4JW1A 4RBNA 3CSKA 2PF4E 2YQYA 4BEJA 3B0VC 4KI2A 2A1DD 2NUPB 2Q3TA 1LE4A 1PCXA 3U2MA 2CCYA 2ZPAA 3IQ6A 2VCAA 3MYIA 2MYSA 3T6JA 4DRJB 1LKXA 5KYNA 1FR0A 4O6NA 1HW2A 1M56C 1WOLA 2KJGA 3E70C 1ZVZA 3L0IA 1H9TA 1OCCC 2LIGA 1YLMA 5HSWA 4MNDA 2Q9AA 3NRHA 4IARA 2LSEA 5JVEA 5KYXA 2YEVA 2W4BA 1SF8A 1Q0MA 1Y4CA 2V3CC 3EPVA 4DVYP 2P6VA 3AGTA 4YL0A 4ZLCA 1T6UA 1WTYA 2HV6A 5L0HA 3RF3A 1TQGA 1OXBA 2J45A 4C7OA 4EWCA 3LEVA 1PV3A 2QUPA 4IRUA 5JT4A 4G0HA 4IB4A 1V55C 4CBEA 3UMIA 1S05A 1RKEB 2P7VA 3TQOA 3B9QA 2LQGA 2R7OA 1EKYA 4J30B 3A9CA 4CS8C 3GEIA 4CSAA 3PCVA 1BZ4A 2WZFA 2IXNA 4XPWA 1ZU5A 2J8WA 3F47A 2MHRA 2H7OA 3I5PA 1DOVA 1RMVA 3W4YA 3SNHA 4JJGA 1VLTA 1BR1A 2R7UA 1LM3B 2EIKC 2FFHA 2HUJA 4P6IC 4U5HA 4BJ5A 5A69A 5CIVA 3MX3A 4QDLA 3AG4C 3S9OA 1NFNA 2OCCC 3SYNA 2YL3A 3K33A 3FOPA 1JRAA 3MBGA 3NYJA 2Y3HA 1JPNA 2CNWA 1ZHZA 2J9BA 1HMOA 1OR2A 4XEKA 5COFA 4PJJA 2KSFA 1E84A 3FMSA 4MVQA 5E3AA 2Y39A 3H2VA 1WASA 2ASRA 2KK1A 4BJ6C 2R7RA 2IBFA 3V5YA 3ZSUA 2PBEA 2CYDA 2NUPA 2Y3GA 5A6KA 1TFKB 1D1BA 4C3BA 3JRTA 4YWQA 2L6GA 4G78A 1ZHYA 2DYRC 5AGFA 1UG7A 2R7VA 1RKCA 2IM8A 1DOWA 2D4UA 5B3SC 4CS8A 3W2WA 1QKRA 1U6HA 3HNIA 4YN0B 4RDAA 1OW8A 3M79A 5B3IA 1M2OA 3RIPA 5T3WA 4CX9A 4Q5SF 4PJLA 3DXJF 4K1OA 1C02A 1ORYA 2EINC 3JTLO 3HJCA 4J32B 3WAQA 4DRHB 4U5EE 3E9VA 4JJFA 1E83A 1FFHA 4BJ1A 4DRIB 3VF0A 2X0CA 1D1CA 3T6GB 2GA0A 3TD7A 1ORJA 2KC3A 5BUOA 3OEOA 1RKEA 3KYIA 1Z3IX 1WN0A 4YT2A 4WGZA 5L3VA 3EZHA 4PFPA 1GQAA 3L34A 1NU7D 3CAXA 4CS9C 1BBHA 3KYJA 5B1AC 4F4BA 1J8MF 2IXPA 3K6BA 3DJUB 3N2ZB 2PX3A 4U5CE 1SYQA 2VB6A 1ZU4A 2NUTB 3V5XA 4BG0A 3HKKA 4XWJA 3JCUQ 2IXOA 4HFKB 4G7HF 3KH2A 4NCQA 2EPOA 3EH2A 4JC7A 2KQ9A 1BDJB 4FESA 2G62A 1A7DA 5COGA 4OD5A 4LDKA 3M4BA 3CQZA 2L6FA 4QI0A 2LP4A 4OIOF 4MW3A 1OCZC 5BQHA 1A0BA 1D1AA 1YZCA 1R5ID 5CI8A 4JEBA 5F5HA 3S84A 3B29A 2O9XA 3US6A 1NU9C 3AG3C 3G50A 4FX5A 5KYUA 3VYWA 5A6BD 4U9EA 1MMAA 1TWGA 1ZZPA 3ZVRA 4MS2A 2HZ8A 1U0BB 1KU2A 1QQ3A 2XLDA 4MVSA 3TK0A 4XLNF 3IEEA 1ZHXA 3QTHA 3GANA 4JE9A 4U5GA 4X0RA 2J9UA 5JP7A 4CIHA 3NDBB 4YK5A 3FAJA 5L0CA 1CPRA 2IXMA 3U9MA 4EBKA 3FHDA 3LNRA 3KPHA 3K7DA 3WG7C 1GM5A 3NMIA 3ZDLA 2BC5A 4CS9A 2WVQA 5DQZA 4XEFA 3C8GD 2YRFA 4EHPA 3O10A 3RFYA 3V7OA 4E0IA 3X1OA 2X51A 4CSAC 3ZQYA 2XXAB 1OW6A 2GAQA 1LI7A 3RYLA 2PNOA 2XLVA 3ZC4A 1YA9A 4P9FA 3JT1A 2B0JA 3NMKA 3B0PA 3U0CA 1SR2A 4N4WA 2HV7A 4YT8A 1OCRC 1CGOA 2WL8A 2FGYA 3UR3C 4BJ5C 1Q0DA 3PMRA 4JURI 4ZLDA 2OQMA 4DBQA 3EQLF 5KYYB 1JAFA 4AL0A 3SXKA 4DXWA 3WHNA 4CDYA 5L0IA 1EQ1A 3K1HA 2R02A 5HV9A 2RSEB 3DE9A 3B0UX 1BR2A 3EJNA 5D92A 1BR4A 2DI3A 4W8PA 2G3VA 3M15A 1MNDA 3DJNB 1FAPB 4PJMA 1TWAA 2G3KA 4RD9A 1QLEC 5FZTA 2R7XA 2IYLD 2BE5F 4LDRA 4N6HA 1S7ZA 4QI2A 1JOGA 4FWVA 1HMDA 2ZXOA 3ABKC 3RKOF 4K7BA 2VCBA 4KC9A 4H54A 3FDQA 3SZRA 2D5RB 5E2QA 2H7VC 1FNTc 1I4ZA 3ZQVA 2LD6A 2LFFA 4IGGA 2YKZA 3L1MA 3C8ZA 1FMWA 4PFOA 1K40A 1OKKD 1M2VB 4WJ0A 5JSLA 3EGDB 2J9VA 1ZHWA 3C62A 4IAQA 2UUHA 1R4TA 3TJ6A 3C8GB 2NSFA 2A68F 1M57C 1Z7Qc 3J06A 3O39A 1M6TA 1CGNA 3ZTZA 5E33A 4I3MA 4BJTA 3LLIA 1LIHA 4EKWA 2CGEA 4ONSA 4E7SA 2WZLA 4FAPB 1L7CA 3ECSA 1MMGA 1YAUO 3GM2A 1HW1A 4JRZA 3AOUA 1YDIA 5E3CA 5K0IA 3JSZA 1GS9A 4EIYA 1EA8A 3I4UA 3LAYA 1FFTC 1LE2A 4G7ZF 3JSEO 3JZ0A 1YVIA 1YA7O 2A0UA 4K0DA 4LLEA 4PACA 1E85A 3R7CA 1MQVA 2XL4A 4OIRF 4ULWA 4DJ9A 5AC5A 2XLWA 2EILC 2NSGA 4NTFA 5T3TA 3GODA 5KYYA 1O5HA 2J7PA 1NZEA 4O79A 1LI5A 2QE9A 5A6AA 3EHNA 1AEPA 2W4MA 3KL4A 2YL7A 1V74B 1NG1A 4HEAJ 2ZD9A 2HSBA 3HNJA 1JMWA 2C04A 3NYLA 2PX0A 3PDMP 1UFBA 3ABLC 1LS1A 1IW7F 2R25A 4KNWA 4JZAA 256BA 3VM6A 3CEXA 3ZG1A 5DS6A 2WZGA 3KKBA 1E86A 2L9JA 4IAOA 4CIPA 3EFOB 5EHHA 3TJ5A 4C3EA 4YL3A 2XM0A 3U5SA 5BQIA 3DI5A 1I4YA 1GGQA 2HJMA 2XLOA 2YWAA 2ICWG 4D4NA 4KBLA 2J0WA 3RQEA 1C03A 3S28A 5B1BC 5JLIA 2XL8A 2XRHA 2ZXWC 1D0XA 1AUEA 2YVKA 4KNVA 3DZAA 4Z9HA 1M2VA 5EK0A 4Z9JA 1T6QA 2DB4A 2R03A 3C18A 4YT5A 2GFHA 2MWQA 3F46A 2FAPB 4DOZA 2HS5A 3NMJA 1SZIA 2A69F 2LCHA 2XLEA 4UDVA 1VTMP 1VYKA 1K05A 2R7QA 3EGXB 2WVNA 4MVMA 3POVA 2OEVA 1T9KA 3K1IA 5BQGA 4U5BE 2YLGA 1OR3A 2AWCA 2EPNA 2OKUA 1FTSA 3IQ5A 2CNWD
chains in the Genus database with same CATH topology
4N4WA 1S05A 1CGOA 1EKYA 1JAFA 4CDVA 2J8WA 3M4CA 4CDYA 1LM3B 3DE9A 1A7VA 1YZAA 3QW0A 3M15A 2YL3A 3FOPA 2QLAA 4N6HA 4CJOA 4JKVA 2J9BA 3ZTMA 5JS5A 2YLDA 1E84A 3ZQVA 3HNLA 3C63A 2XLMA 2YKZA 3L1MA 2YL1A 1CPQA 5JSLA 5JRAA 3HNKA 3C62A 4IAQA 2XM4A 5AGFA 1M6TA 1CGNA 3ZTZA 1APCA 3HNIA 3M79A 5B3IA 1RCPA 3QVYA 4CX9A 4CJGA 4CDAA 1YYXA 3TOLA 2YL0A 4ER9A 1E83A 3TOMA 4EIYA 1YYJA 1E85A 1MQVA 1NBBA 4WGYA 4JEAA 4WGZA 2XLWA 1GQAA 2XLHA 3FOOA 1BBHA 4ULVA 4D4XA 2YL7A 3HNJA 1QPUA 3DE8A 256BA 2XL6A 1E86A 3U8PA 4CIPA 3ZWIA 4U9DA 3QVZA 4L6RA 3IQ5A 3M4BA 5JUAA 2XM0A 1YZCA 2CCYA 2XLOA 4JEBA 4D4NA 3IQ6A 2YLIA 4U9EA 5JLIA 2XL8A 1QQ3A 3VRCA 2XLDA 4JE9A 5JP7A 5JVEA 4IARA 3QW1A 1CPRA 3NMJA 2XLEA 3NMIA 2BC5A 2YLGA 3ZQYA 4NC3A 5JT4A 2XLVA 4IB4A 3NMKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N4W A;  1S05 A;  1CGO A;  1EKY A;  1JAF A;  4CDV A;  2J8W A;  3M4C A;  4CDY A;  1LM3 B;  3DE9 A;  1A7V A;  1YZA A;  3QW0 A;  3M15 A;  2YL3 A;  3FOP A;  2QLA A;  4N6H A;  4CJO A;  4JKV A;  2J9B A;  3ZTM A;  5JS5 A;  2YLD A;  1E84 A;  3ZQV A;  3HNL A;  3C63 A;  2XLM A;  2YKZ A;  3L1M A;  2YL1 A;  1CPQ A;  5JSL A;  5JRA A;  3HNK A;  3C62 A;  4IAQ A;  2XM4 A;  5AGF A;  1M6T A;  1CGN A;  3ZTZ A;  1APC A;  3HNI A;  3M79 A;  5B3I A;  1RCP A;  3QVY A;  4CX9 A;  4CJG A;  4CDA A;  1YYX A;  3TOL A;  2YL0 A;  4ER9 A;  1E83 A;  3TOM A;  4EIY A;  1YYJ A;  1E85 A;  1MQV A;  1NBB A;  4WGY A;  4JEA A;  4WGZ A;  2XLW A;  1GQA A;  2XLH A;  3FOO A;  1BBH A;  4ULV A;  4D4X A;  2YL7 A;  3HNJ A;  1QPU A;  3DE8 A;  256B A;  2XL6 A;  1E86 A;  3U8P A;  4CIP A;  3ZWI A;  4U9D A;  3QVZ A;  4L6R A;  3IQ5 A;  3M4B A;  5JUA A;  2XM0 A;  1YZC A;  2CCY A;  2XLO A;  4JEB A;  4D4N A;  3IQ6 A;  2YLI A;  4U9E A;  5JLI A;  2XL8 A;  1QQ3 A;  3VRC A;  2XLD A;  4JE9 A;  5JP7 A;  5JVE A;  4IAR A;  3QW1 A;  1CPR A;  3NMJ A;  2XLE A;  3NMI A;  2BC5 A;  2YLG A;  3ZQY A;  4NC3 A;  5JT4 A;  2XLV A;  4IB4 A;  3NMK A; 
#chains in the Genus database with same CATH topology
 4MVR A;  3T6B A;  4G7O F;  1E2X A;  2JX0 A;  2DGJ A;  3ASN C;  1KTM A;  3ZIB A;  1TKN A;  1XZQ A;  4GYT A;  2UUI A;  1QVX A;  3IQC A;  2B0H A;  2VC9 A;  2R9R B;  2KW3 C;  1N1C A;  4MVU A;  3T4R A;  2HSQ A;  3EH1 A;  2V26 A;  2H7B A;  4PK4 A;  3QW0 A;  1C17 M;  1H9G A;  2EPL X;  2AVK A;  4YJW A;  2VH3 A;  1G8X A;  4OD4 A;  2OJE D;  1Q0K A;  2ZXP A;  3DM5 A;  4A2N B;  1NSG B;  2QLA A;  2Y3B A;  1XZP A;  3BRJ A;  4B6I A;  4A4A A;  4CJO A;  4C3D A;  3ZTM A;  2WB7 A;  1Y6D A;  4IJJ A;  3SP1 A;  2YLD A;  3I5Q A;  1RJ9 B;  4MW8 A;  3C63 A;  2EIM C;  3MFN A;  3DKA A;  4N6C A;  4JIO A;  5L0D A;  3LNM B;  2YZS A;  2CDQ A;  3IPM O;  3N24 A;  1RXQ A;  1IZM A;  1SMY F;  3H65 A;  1H7I A;  1CPQ A;  2NG1 A;  4O7G A;  4EUK B;  5L0F A;  2Q9B A;  2XM4 A;  4YT4 A;  3RVZ A;  1O87 A;  3ITF A;  3W8I A;  5L3Q A;  3N0T A;  1WAT A;  1NFO A;  3LUT B;  4NY3 A;  2IOQ A;  4Q4Z F;  1LPE A;  2QNL A;  1G4U S;  4WAB A;  1K04 A;  2QY9 A;  1T6I A;  2XS8 A;  5F28 E;  1LS4 A;  2KNH A;  3AGU A;  1RCP A;  2WVO A;  3JYH A;  4MVZ A;  3S27 A;  4JTC B;  4JCH A;  2NUT A;  4N06 A;  4CDA A;  4CS7 A;  2J46 A;  3U3B A;  3G4Z A;  2R7S A;  3RQG A;  1V4A A;  1OXK A;  1ZW3 A;  2GWW A;  1MNE A;  2YL0 A;  3JYY A;  4XPY A;  2Q7R A;  4ER9 A;  3U9J A;  1VYI A;  3SXZ A;  1T5O A;  1TWH A;  2LK4 A;  4EBJ A;  4E18 A;  2I8B A;  1YYJ A;  3ABM C;  1MMN A;  3M1C B;  1ZHT A;  3HTK C;  1VMA A;  4BEM J;  4AK9 A;  1HE9 A;  2F22 A;  3LES A;  1JPJ A;  3U8V A;  1OQC A;  1VK5 A;  3W2V A;  1ST6 A;  2HKV A;  2CW0 F;  1TWC A;  3AQC A;  3FOO A;  4D4X A;  1T01 A;  4LAC B;  2GDC A;  2AP3 A;  4XEV A;  2KYH A;  2HFI A;  1ORS C;  2P1A A;  2Q4F A;  5D91 A;  2J9W A;  1Q0F A;  3DE8 A;  4I1O B;  2Q00 A;  4W8K A;  5DVW A;  3UGO A;  3AQB A;  2LFD A;  2P0N A;  2XL6 A;  2OG2 A;  3LLK A;  3Q7G A;  4H4K C;  5FCL A;  5F5F A;  2HJ3 A;  3ZWI A;  1TFO B;  1HE1 A;  3NG1 A;  2Z15 A;  2PFD A;  4L6R A;  4U5F E;  3GEH A;  2RD9 A;  4U9D A;  1PD1 A;  2Q9C A;  5JUA A;  4AE4 B;  2XXA A;  2W45 A;  3PHF 2;  2L7A A;  3Q6N A;  1RJ9 A;  4GEH A;  3QZC A;  4LLC A;  1KNY A;  3HLZ A;  2J0X A;  1ZYR F;  2YLI A;  4MQ9 F;  3UNG C;  5KYW B;  5L0J A;  3X2Q C;  3VRC A;  3UMH A;  3MLG A;  1J8Y F;  4U5D E;  1QSP A;  2ETS A;  2OU6 A;  3K1I C;  4NTA A;  4E17 A;  3QW1 A;  3SXY A;  3R2P A;  3GM3 A;  3DM9 B;  3IQT A;  3KMI A;  4O6M A;  3V5Z A;  3NKD A;  2R05 A;  3W8H A;  3JRM O;  3AG1 C;  4JVS A;  3GEE A;  3RVY A;  5EGY A;  4NC3 A;  1XWJ A;  5COM A;  2HMZ A;  2I15 A;  5A6B A;  1ZW2 A;  5KYU B;  4I1M A;  5A6J A;  4HE8 D;  4J7T A;  3RW0 A;  1A41 A;  3FAP B;  1F1M A;  1VLS A;  2H8A A;  1WGW A;  4MTO A;  3OWT A;  4E7Z A;  3SXM A;  4CDV A;  2A6E F;  3CZ6 A;  1VOM A;  3IHU A;  3U3F A;  3M4C A;  5IY5 C;  2AWY A;  1QZX A;  3DD7 A;  2EPK X;  4I44 A;  4LDQ A;  4R32 A;  2L81 A;  1A7V A;  1YZA A;  4PJN A;  3EGD A;  1O3U A;  3Q7L A;  3T9O A;  3S90 A;  3UGP A;  4O6Y A;  3C8G A;  1G5Z A;  3EG9 B;  2PP4 A;  1JR8 A;  2BL2 A;  1V54 C;  2HMQ A;  4JTA B;  2TMV P;  2ZXR A;  4OIQ F;  2L6H A;  4MVO A;  2P61 A;  4P9T A;  4AL1 A;  4NQF A;  3G4X A;  4JKV A;  1YAR O;  3MYF A;  2XS1 A;  5DLJ A;  3FVY A;  2C03 A;  4DVZ A;  3EZI A;  5JS5 A;  5CI9 A;  3RH3 A;  4JTD B;  2EIJ C;  1G4W R;  1A7E A;  1MMD A;  4BPM A;  3HNL A;  4MTG A;  3NKE A;  1OW7 A;  5AC4 A;  2R7T A;  2JD3 A;  3GOR A;  2JPU A;  1I5N A;  2XLM A;  4M63 A;  4AE4 A;  4LER A;  2YL1 A;  2W9Y A;  3LS0 A;  4J7Y A;  1Z6A A;  3L8I A;  3S0X A;  1YJG A;  1VB5 A;  1D0Z A;  5JRA A;  3DMD A;  1PD0 A;  3HNK A;  4DBR A;  2NPU A;  2YHS A;  2Y69 C;  3OA1 A;  4BJ6 A;  5KYW A;  2A6H F;  2E87 A;  3DWW A;  5KYX B;  3K66 A;  5GPG B;  1Z23 A;  4YL1 A;  1FMV A;  3QMK A;  4AX2 A;  4GQH A;  5DQT A;  1HY5 A;  4OIP F;  1APC A;  1Z5Z A;  2J7P D;  3A11 A;  3DAG A;  4IWB A;  3EHM A;  3O6X A;  4C7O B;  3VAY A;  5DS4 A;  3QVY A;  2OJQ A;  2OEX A;  3RQF A;  3AG2 C;  4CJG A;  1B68 A;  4XLP F;  1OCO C;  2AU5 A;  3LJB A;  3Q6M A;  1WWP A;  1YYX A;  4NTB A;  3TOL A;  1CGM E;  3DAF A;  3C7J A;  1W2W A;  1NLX A;  2XSE A;  1EI7 A;  3TOM A;  3TUL A;  2EPM X;  1OKK A;  1H6G A;  3BEH A;  3EFO A;  4Q7C A;  1LVK A;  2VAS A;  4E0H A;  2VCC A;  4OIN F;  1Q0G A;  3GWN A;  3UMK A;  1NBB A;  2M64 A;  3NYM A;  1U89 A;  4JEA A;  4WGY A;  3SEO A;  1Z63 A;  2XLH A;  2QTV A;  2R7W A;  4Z9I A;  4ULV A;  4XPX A;  4PR9 A;  5T1D B;  3B71 A;  4XTK A;  3O55 A;  4HFF B;  4XQ1 A;  4EBB A;  4ANJ A;  1D0Y A;  1TR2 A;  3ATP A;  3H2U A;  1QPU A;  2KGO A;  3GM1 A;  3LS1 A;  4MTF A;  3S29 A;  4JCZ A;  2OOC A;  3FXH A;  3U2L A;  1AVO B;  3GWL A;  3ASO C;  2Y3D A;  2A0B A;  5TJ5 E;  1L3P A;  3EG9 A;  5DS5 A;  2DYS C;  3U8P A;  2M4E A;  3AJM A;  3LEO A;  3QVZ A;  5L0G A;  3WOD F;  3L8J A;  3EGX A;  4JW1 A;  4RBN A;  3CSK A;  2PF4 E;  2YQY A;  4BEJ A;  3B0V C;  4KI2 A;  2A1D D;  2NUP B;  2Q3T A;  1LE4 A;  1PCX A;  3U2M A;  2CCY A;  2ZPA A;  3IQ6 A;  2VCA A;  3MYI A;  2MYS A;  3T6J A;  4DRJ B;  1LKX A;  5KYN A;  1FR0 A;  4O6N A;  1HW2 A;  1M56 C;  1WOL A;  2KJG A;  3E70 C;  1ZVZ A;  3L0I A;  1H9T A;  1OCC C;  2LIG A;  1YLM A;  5HSW A;  4MND A;  2Q9A A;  3NRH A;  4IAR A;  2LSE A;  5JVE A;  5KYX A;  2YEV A;  2W4B A;  1SF8 A;  1Q0M A;  1Y4C A;  2V3C C;  3EPV A;  4DVY P;  2P6V A;  3AGT A;  4YL0 A;  4ZLC A;  1T6U A;  1WTY A;  2HV6 A;  5L0H A;  3RF3 A;  1TQG A;  1OXB A;  2J45 A;  4C7O A;  4EWC A;  3LEV A;  1PV3 A;  2QUP A;  4IRU A;  5JT4 A;  4G0H A;  4IB4 A;  1V55 C;  4CBE A;  3UMI A;  1S05 A;  1RKE B;  2P7V A;  3TQO A;  3B9Q A;  2LQG A;  2R7O A;  1EKY A;  4J30 B;  3A9C A;  4CS8 C;  3GEI A;  4CSA A;  3PCV A;  1BZ4 A;  2WZF A;  2IXN A;  4XPW A;  1ZU5 A;  2J8W A;  3F47 A;  2MHR A;  2H7O A;  3I5P A;  1DOV A;  1RMV A;  3W4Y A;  3SNH A;  4JJG A;  1VLT A;  1BR1 A;  2R7U A;  1LM3 B;  2EIK C;  2FFH A;  2HUJ A;  4P6I C;  4U5H A;  4BJ5 A;  5A69 A;  5CIV A;  3MX3 A;  4QDL A;  3AG4 C;  3S9O A;  1NFN A;  2OCC C;  3SYN A;  2YL3 A;  3K33 A;  3FOP A;  1JRA A;  3MBG A;  3NYJ A;  2Y3H A;  1JPN A;  2CNW A;  1ZHZ A;  2J9B A;  1HMO A;  1OR2 A;  4XEK A;  5COF A;  4PJJ A;  2KSF A;  1E84 A;  3FMS A;  4MVQ A;  5E3A A;  2Y39 A;  3H2V A;  1WAS A;  2ASR A;  2KK1 A;  4BJ6 C;  2R7R A;  2IBF A;  3V5Y A;  3ZSU A;  2PBE A;  2CYD A;  2NUP A;  2Y3G A;  5A6K A;  1TFK B;  1D1B A;  4C3B A;  3JRT A;  4YWQ A;  2L6G A;  4G78 A;  1ZHY A;  2DYR C;  5AGF A;  1UG7 A;  2R7V A;  1RKC A;  2IM8 A;  1DOW A;  2D4U A;  5B3S C;  4CS8 A;  3W2W A;  1QKR A;  1U6H A;  3HNI A;  4YN0 B;  4RDA A;  1OW8 A;  3M79 A;  5B3I A;  1M2O A;  3RIP A;  5T3W A;  4CX9 A;  4Q5S F;  4PJL A;  3DXJ F;  4K1O A;  1C02 A;  1ORY A;  2EIN C;  3JTL O;  3HJC A;  4J32 B;  3WAQ A;  4DRH B;  4U5E E;  3E9V A;  4JJF A;  1E83 A;  1FFH A;  4BJ1 A;  4DRI B;  3VF0 A;  2X0C A;  1D1C A;  3T6G B;  2GA0 A;  3TD7 A;  1ORJ A;  2KC3 A;  5BUO A;  3OEO A;  1RKE A;  3KYI A;  1Z3I X;  1WN0 A;  4YT2 A;  4WGZ A;  5L3V A;  3EZH A;  4PFP A;  1GQA A;  3L34 A;  1NU7 D;  3CAX A;  4CS9 C;  1BBH A;  3KYJ A;  5B1A C;  4F4B A;  1J8M F;  2IXP A;  3K6B A;  3DJU B;  3N2Z B;  2PX3 A;  4U5C E;  1SYQ A;  2VB6 A;  1ZU4 A;  2NUT B;  3V5X A;  4BG0 A;  3HKK A;  4XWJ A;  3JCU Q;  2IXO A;  4HFK B;  4G7H F;  3KH2 A;  4NCQ A;  2EPO A;  3EH2 A;  4JC7 A;  2KQ9 A;  1BDJ B;  4FES A;  2G62 A;  1A7D A;  5COG A;  4OD5 A;  4LDK A;  3M4B A;  3CQZ A;  2L6F A;  4QI0 A;  2LP4 A;  4OIO F;  4MW3 A;  1OCZ C;  5BQH A;  1A0B A;  1D1A A;  1YZC A;  1R5I D;  5CI8 A;  4JEB A;  5F5H A;  3S84 A;  3B29 A;  2O9X A;  3US6 A;  1NU9 C;  3AG3 C;  3G50 A;  4FX5 A;  5KYU A;  3VYW A;  5A6B D;  4U9E A;  1MMA A;  1TWG A;  1ZZP A;  3ZVR A;  4MS2 A;  2HZ8 A;  1U0B B;  1KU2 A;  1QQ3 A;  2XLD A;  4MVS A;  3TK0 A;  4XLN F;  3IEE A;  1ZHX A;  3QTH A;  3GAN A;  4JE9 A;  4U5G A;  4X0R A;  2J9U A;  5JP7 A;  4CIH A;  3NDB B;  4YK5 A;  3FAJ A;  5L0C A;  1CPR A;  2IXM A;  3U9M A;  4EBK A;  3FHD A;  3LNR A;  3KPH A;  3K7D A;  3WG7 C;  1GM5 A;  3NMI A;  3ZDL A;  2BC5 A;  4CS9 A;  2WVQ A;  5DQZ A;  4XEF A;  3C8G D;  2YRF A;  4EHP A;  3O10 A;  3RFY A;  3V7O A;  4E0I A;  3X1O A;  2X51 A;  4CSA C;  3ZQY A;  2XXA B;  1OW6 A;  2GAQ A;  1LI7 A;  3RYL A;  2PNO A;  2XLV A;  3ZC4 A;  1YA9 A;  4P9F A;  3JT1 A;  2B0J A;  3NMK A;  3B0P A;  3U0C A;  1SR2 A;  4N4W A;  2HV7 A;  4YT8 A;  1OCR C;  1CGO A;  2WL8 A;  2FGY A;  3UR3 C;  4BJ5 C;  1Q0D A;  3PMR A;  4JUR I;  4ZLD A;  2OQM A;  4DBQ A;  3EQL F;  5KYY B;  1JAF A;  4AL0 A;  3SXK A;  4DXW A;  3WHN A;  4CDY A;  5L0I A;  1EQ1 A;  3K1H A;  2R02 A;  5HV9 A;  2RSE B;  3DE9 A;  3B0U X;  1BR2 A;  3EJN A;  5D92 A;  1BR4 A;  2DI3 A;  4W8P A;  2G3V A;  3M15 A;  1MND A;  3DJN B;  1FAP B;  4PJM A;  1TWA A;  2G3K A;  4RD9 A;  1QLE C;  5FZT A;  2R7X A;  2IYL D;  2BE5 F;  4LDR A;  4N6H A;  1S7Z A;  4QI2 A;  1JOG A;  4FWV A;  1HMD A;  2ZXO A;  3ABK C;  3RKO F;  4K7B A;  2VCB A;  4KC9 A;  4H54 A;  3FDQ A;  3SZR A;  2D5R B;  5E2Q A;  2H7V C;  1FNT c;  1I4Z A;  3ZQV A;  2LD6 A;  2LFF A;  4IGG A;  2YKZ A;  3L1M A;  3C8Z A;  1FMW A;  4PFO A;  1K40 A;  1OKK D;  1M2V B;  4WJ0 A;  5JSL A;  3EGD B;  2J9V A;  1ZHW A;  3C62 A;  4IAQ A;  2UUH A;  1R4T A;  3TJ6 A;  3C8G B;  2NSF A;  2A68 F;  1M57 C;  1Z7Q c;  3J06 A;  3O39 A;  1M6T A;  1CGN A;  3ZTZ A;  5E33 A;  4I3M A;  4BJT A;  3LLI A;  1LIH A;  4EKW A;  2CGE A;  4ONS A;  4E7S A;  2WZL A;  4FAP B;  1L7C A;  3ECS A;  1MMG A;  1YAU O;  3GM2 A;  1HW1 A;  4JRZ A;  3AOU A;  1YDI A;  5E3C A;  5K0I A;  3JSZ A;  1GS9 A;  4EIY A;  1EA8 A;  3I4U A;  3LAY A;  1FFT C;  1LE2 A;  4G7Z F;  3JSE O;  3JZ0 A;  1YVI A;  1YA7 O;  2A0U A;  4K0D A;  4LLE A;  4PAC A;  1E85 A;  3R7C A;  1MQV A;  2XL4 A;  4OIR F;  4ULW A;  4DJ9 A;  5AC5 A;  2XLW A;  2EIL C;  2NSG A;  4NTF A;  5T3T A;  3GOD A;  5KYY A;  1O5H A;  2J7P A;  1NZE A;  4O79 A;  1LI5 A;  2QE9 A;  5A6A A;  3EHN A;  1AEP A;  2W4M A;  3KL4 A;  2YL7 A;  1V74 B;  1NG1 A;  4HEA J;  2ZD9 A;  2HSB A;  3HNJ A;  1JMW A;  2C04 A;  3NYL A;  2PX0 A;  3PDM P;  1UFB A;  3ABL C;  1LS1 A;  1IW7 F;  2R25 A;  4KNW A;  4JZA A;  256B A;  3VM6 A;  3CEX A;  3ZG1 A;  5DS6 A;  2WZG A;  3KKB A;  1E86 A;  2L9J A;  4IAO A;  4CIP A;  3EFO B;  5EHH A;  3TJ5 A;  4C3E A;  4YL3 A;  2XM0 A;  3U5S A;  5BQI A;  3DI5 A;  1I4Y A;  1GGQ A;  2HJM A;  2XLO A;  2YWA A;  2ICW G;  4D4N A;  4KBL A;  2J0W A;  3RQE A;  1C03 A;  3S28 A;  5B1B C;  5JLI A;  2XL8 A;  2XRH A;  2ZXW C;  1D0X A;  1AUE A;  2YVK A;  4KNV A;  3DZA A;  4Z9H A;  1M2V A;  5EK0 A;  4Z9J A;  1T6Q A;  2DB4 A;  2R03 A;  3C18 A;  4YT5 A;  2GFH A;  2MWQ A;  3F46 A;  2FAP B;  4DOZ A;  2HS5 A;  3NMJ A;  1SZI A;  2A69 F;  2LCH A;  2XLE A;  4UDV A;  1VTM P;  1VYK A;  1K05 A;  2R7Q A;  3EGX B;  2WVN A;  4MVM A;  3POV A;  2OEV A;  1T9K A;  3K1I A;  5BQG A;  4U5B E;  2YLG A;  1OR3 A;  2AWC A;  2EPN A;  2OKU A;  1FTS A;  3IQ5 A;  2CNW D; 
#chains in the Genus database with same CATH homology
 4N4W A;  1S05 A;  1CGO A;  1EKY A;  1JAF A;  4CDV A;  2J8W A;  3M4C A;  4CDY A;  1LM3 B;  3DE9 A;  1A7V A;  1YZA A;  3QW0 A;  3M15 A;  2YL3 A;  3FOP A;  2QLA A;  4N6H A;  4CJO A;  4JKV A;  2J9B A;  3ZTM A;  5JS5 A;  2YLD A;  1E84 A;  3ZQV A;  3HNL A;  3C63 A;  2XLM A;  2YKZ A;  3L1M A;  2YL1 A;  1CPQ A;  5JSL A;  5JRA A;  3HNK A;  3C62 A;  4IAQ A;  2XM4 A;  5AGF A;  1M6T A;  1CGN A;  3ZTZ A;  1APC A;  3HNI A;  3M79 A;  5B3I A;  1RCP A;  3QVY A;  4CX9 A;  4CJG A;  4CDA A;  1YYX A;  3TOL A;  2YL0 A;  4ER9 A;  1E83 A;  3TOM A;  4EIY A;  1YYJ A;  1E85 A;  1MQV A;  1NBB A;  4WGY A;  4JEA A;  4WGZ A;  2XLW A;  1GQA A;  2XLH A;  3FOO A;  1BBH A;  4ULV A;  4D4X A;  2YL7 A;  3HNJ A;  1QPU A;  3DE8 A;  256B A;  2XL6 A;  1E86 A;  3U8P A;  4CIP A;  3ZWI A;  4U9D A;  3QVZ A;  4L6R A;  3IQ5 A;  3M4B A;  5JUA A;  2XM0 A;  1YZC A;  2CCY A;  2XLO A;  4JEB A;  4D4N A;  3IQ6 A;  2YLI A;  4U9E A;  5JLI A;  2XL8 A;  1QQ3 A;  3VRC A;  2XLD A;  4JE9 A;  5JP7 A;  5JVE A;  4IAR A;  3QW1 A;  1CPR A;  3NMJ A;  2XLE A;  3NMI A;  2BC5 A;  2YLG A;  3ZQY A;  4NC3 A;  5JT4 A;  2XLV A;  4IB4 A;  3NMK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...