3QVYA

Crystal structure of the zn-ridc1 complex stabilized by bmoe crosslinks
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHDALHLANECKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Templated construction of a zn-selective protein dimerization motif.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords Cytochrome cb562
total genus 42
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3qvyA00
3M15A 1YZAA 3TOMA 4CDAA 2J9BA 256BA 2XLOA 2CCYA 4CX9A 3DE8A 4IB4A 3NMJA 2YL3A 3NMIA 1E84A 1S05A 1E86A 1EKYA 3NMKA 4N4WA 1CPRA 2YLGA 2XLMA 4N6HA 3HNJA 3M4BA 2QLAA 4JKVA 3HNKA 4JEAA 5JLIA 2XLEA 3ZTMA 1CPQA 4D4XA 3IQ5A 3QW0A 3QVYA 4JEBA 4NC3A 1CGNA 2XLWA 3C62A 3L1MA 5JUAA 1LM3B 3HNLA 2YL0A 2YL7A 3FOOA 1APCA 1E83A 5JP7A 2BC5A 4ULVA 3ZQVA 1M6TA 4CDYA 1MQVA 2YLDA 5JRAA 1YYJA 2XM4A 1A7VA 4WGZA 4CIPA 4JE9A 4CJGA 1BBHA 1GQAA 4D4NA 3C63A 4EIYA 2YL1A 3M4CA 3HNIA 1RCPA 3ZWIA 1E85A 4CJOA 1YZCA 2YKZA 2XM0A 2XLHA 3U8PA 1JAFA 3QVZA 3ZQYA 5JT4A 5JSLA 2XLVA 4L6RA 3M79A 2XL6A 3TOLA 3VRCA 5JVEA 4IARA 5AGFA 4ER9A 4U9DA 2YLIA 4WGYA 1YYXA 3QW1A 1QPUA 4IAQA 3IQ6A 3ZTZA 3FOPA 4CDVA 4U9EA 5JS5A 2XL8A 1NBBA 5B3IA 1CGOA 2XLDA 1QQ3A 3DE9A 2J8WA
chains in the Genus database with same CATH superfamily
3FAJA 4Q5SF 3JZ0A 2G3VA 1WTYA 5DVWA 5E2QA 3OA1A 1VOMA 3IHUA 4XQ1A 5L0JA 2XXAB 4HEAJ 1Z7Qc 5B3SC 1PV3A 3BRJA 3UGOA 4JVSA 1YLMA 3L0IA 2WB7A 2O9XA 3T6GB 4FAPB 2CCYA 1ZZPA 4C7OB 4WJ0A 5F5HA 4XEKA 1O3UA 2R7VA 2R7OA 1G4WR 4JC7A 4IGGA 3NMIA 3ZVRA 5E33A 1E84A 1MMDA 5KYYA 5L0DA 1S05A 1G5ZA 1O5HA 3SEOA 1E86A 2ZXPA 5COMA 3I5PA 3SXZA 2YLGA 4JJGA 3ZC4A 4XEVA 4Q7CA 3E70C 2KYHA 1WOLA 3ZG1A 2WZFA 2W4MA 4EBBA 4HE8D 1AUEA 4DBRA 4U5EE 3EFOB 4MVMA 3RVZA 5A6JA 2NSFA 3B9QA 2XS8A 4MNDA 1J8MF 3M4BA 3S0XA 4UDVA 1HMDA 1NFOA 2R02A 2PX3A 2X51A 2EINC 4PFPA 3S27A 2IXMA 2J45A 4O6MA 5JLIA 4DVZA 1TR2A 3FXHA 2A69F 4I1OB 5AC5A 2HFIA 4EHPA 3QW0A 5FZTA 5T3WA 2XXAA 2EPOA 1RKEB 2LFDA 4NY3A 1RKEA 1EI7A 3AJMA 1U89A 3DJNB 3ITFA 4RDAA 1FAPB 2MWQA 3SXMA 2P7VA 3RIPA 2OJQA 5DS6A 2GAQA 2YL0A 3HNLA 5BQGA 3FOOA 1LS1A 4JTCB 3B0PA 4YL3A 3LEOA 4P9TA 1NG1A 4P9FA 2RD9A 3MLGA 3LAYA 4ULVA 1M2OA 2Y3HA 3N2ZB 3JSZA 2KC3A 4MQ9F 3UR3C 3W4YA 2Y3DA 2RSEB 3PHF2 2H7VC 2R7RA 4LLEA 1UFBA 1C02A 1SZIA 3EZHA 2YLDA 4U5GA 4YT2A 1ST6A 4YJWA 5JRAA 2QY9A 4LERA 2ICWG 1YYJA 4K0DA 2XS1A 4C3EA 4E7SA 4O7GA 4AX2A 3JYHA 2YQYA 4CJGA 1BBHA 1V54C 1VB5A 1MMNA 2H7BA 2L6FA 4G0HA 1GQAA 3Q6MA 1RJ9A 4D4NA 2KW3C 4MTGA 3W8HA 2MHRA 4JW1A 2HJMA 3LJBA 2Y3BA 3GM1A 3HNIA 2I8BA 4P6IC 1TWHA 1ZU4A 3VF0A 1MMAA 3AG4C 1RCPA 4M63A 3QTHA 4NQFA 4DVYP 2V3CC 1RMVA 1YZCA 3U8PA 2FFHA 4EUKB 4OIOF 5BQIA 1M2VA 3HJCA 3K1IC 1VK5A 1D1BA 2BL2A 4O79A 4I3MA 3M79A 4U5FE 2R7UA 1NFNA 3U3FA 4IARA 4DXWA 4W8KA 3R7CA 5L3QA 3S90A 2EILC 2A6EF 2OCCC 4NTBA 4OINF 5L0HA 1WWPA 3AG1C 1LE2A 3DD7A 3QW1A 4I44A 2OG2A 2J0XA 2ZXOA 4OIRF 1LIHA 1LVKA 2DB4A 5A6BD 2EPNA 3FOPA 4CDVA 5L0CA 3TD7A 3ABMC 2I15A 3AGUA 5A6KA 2KK1A 5KYWB 1VTMP 3KYIA 5KYWA 3EH2A 2VH3A 1QQ3A 2XLDA 3LNRA 1LE4A 1L3PA 4PACA 4F4BA 1XWJA 2LK4A 4ONSA 2X0CA 3RVYA 3U3BA 5K0IA 2J9VA 1Z63A 1Y6DA 2PNOA 2Z15A 3M15A 1M56C 1YZAA 1FTSA 3C18A 4CDAA 3K33A 4J7TA 2HS5A 2J9BA 3EG9B 1FR0A 1ZHWA 1R4TA 2M4EA 1ZVZA 2P1AA 2QTVA 2Q9BA 1JR8A 4LDRA 1QKRA 4LDKA 3TQOA 3ASOC 5EK0A 5CIVA 3C8ZA 3A9CA 3ABKC 2VC9A 4CS8C 5T3TA 3DMDA 3SXYA 4E17A 2HV6A 3GANA 2J7PA 3NG1A 3HKKA 1LI7A 2HSBA 1EKYA 5IY5C 3NMKA 4K7BA 4N4WA 4J30B 2A0UA 2CW0F 3U5SA 3K1IA 5GPGB 2GFHA 4JZAA 2BE5F 3DKAA 1T5OA 3EPVA 4BJ5C 2HMQA 3HNJA 3Q7LA 3U8VA 1XZQA 1TWCA 2QLAA 3DM5A 4IJJA 4N6CA 3UNGC 1OKKD 4U5DE 2AWCA 2D4UA 1UG7A 1YDIA 4G7ZF 2P0NA 5E3AA 2XLEA 1OCCC 3U2MA 2G3KA 3Q6NA 4OD5A 1CPQA 1WASA 3F46A 2EPLX 3IQ5A 3LLIA 4YL0A 2JPUA 3QVYA 3RQGA 3MYIA 4A4AA 3FVYA 4NC3A 4DRHB 4OIQF 5BUOA 2LD6A 1EA8A 2W4BA 1QZXA 2YRFA 1TQGA 3WG7C 4EBKA 2YL7A 1GS9A 2J9WA 5JP7A 1WN0A 1ZHXA 2KJGA 1B68A 2L6GA 3PMRA 3VM6A 1H7IA 1ZHYA 1Z6AA 2J7PD 3ASNC 4MVOA 4YL1A 2OKUA 5T1DB 3TULA 1OKKA 3AQBA 2L9JA 2CDQA 1HE1A 3DAFA 3DWWA 3LNMB 4BEJA 3POVA 1LKXA 3SNHA 4CDYA 2KSFA 2V26A 3U9MA 4E0HA 3MBGA 4A2NB 5CI9A 4H4KC 1Q0DA 1RJ9B 4DOZA 3IPMO 4CIPA 1MNEA 4JE9A 3I5QA 4BJ5A 1H9GA 3S84A 2R7TA 3LS0A 2D5RB 5A69A 3C8GA 1CGME 1OCRC 2AWYA 3U2LA 1U6HA 2JD3A 1G4US 1WATA 1XZPA 2UUIA 1C03A 2ASRA 2HJ3A 2YL1A 4FESA 4GQHA 4PFOA 5F28E 4YT4A 2Q7RA 2J9UA 3J06A 2IM8A 3G4XA 2R25A 3G4ZA 4FX5A 3AOUA 4CJOA 2FAPB 2XM0A 1Q0FA 1JPNA 4XPWA 3IQCA 2Q3TA 3KPHA 3O55A 1JAFA 2CYDA 2NUPB 1K04A 2NSGA 4IWBA 4L6RA 3LS1A 3US6A 4AE4B 5L0IA 5JVEA 3EJNA 4ER9A 2FGYA 1TFOB 1W2WA 2WVOA 3S9OA 2IXOA 3U9JA 1ZHTA 1LI5A 3MX3A 4LLCA 1NU7D 2AVKA 3FHDA 4NTAA 3N0TA 4Z9IA 4DJ9A 3L34A 3TJ6A 1ORSC 4IAQA 3IQ6A 5KYUA 1U0BB 4XWJA 1LS4A 2EPKX 2GA0A 1MMGA 4MVQA 4U9EA 4YWQA 1G8XA 2UUHA 1LPEA 4JIOA 2ZPAA 3GEHA 4RD9A 2IXPA 3JT1A 5HSWA 1NBBA 4H54A 4Q4ZF 3B0VC 3W2VA 3C8GD 1OW6A 3T6BA 3WAQA 1OW8A 1A7DA 4Z9HA 1HW2A 3B0UX 1FMVA 3NYMA 2J8WA 2B0JA 1Q0GA 2HMZA 3U0CA 2TMVP 2XL4A 2IYLD 2A0BA 3DJUB 3V7OA 3H65A 3TOMA 2MYSA 3FDQA 1JMWA 4E0IA 3EH1A 5E3CA 2WZGA 3K6BA 1A7EA 2XLOA 1AEPA 3M1CB 4CSAA 4O6YA 2EPMX 4CX9A 2HZ8A 1Q0MA 3RQFA 3JSEO 4OD4A 4EKWA 2IBFA 2DI3A 2YL3A 5L3VA 1D0XA 3JRTA 1QLEC 4JTDB 4PJMA 2Y69C 1DOWA 2H8AA 1PD1A 1H6GA 4RBNA 2IXNA 2Y3GA 2A6HF 1TFKB 4KNVA 5D92A 2XLMA 5BQHA 5DS4A 3Q7GA 1ZHZA 4N6HA 4QDLA 2QUPA 3GORA 2Y39A 3A11A 5B1BC 1IZMA 1HY5A 4MVSA 4BJ6C 4J7YA 2WVNA 5KYUB 1GGQA 3HNKA 3O39A 1FFTC 4G7HF 3C8GB 4BG0A 5AC4A 3EGXA 3ZTMA 3W8IA 4U5CE 4MVRA 1ZU5A 3EG9A 1QSPA 2F22A 1YA9A 4GEHA 4BPMA 1T6IA 2G62A 1L7CA 1V55C 1Z23A 2KNHA 2LIGA 3EGDA 3L1MA 4JEBA 3GEEA 4JRZA 3E9VA 4W8PA 1AVOB 2LFFA 3H2UA 4YT5A 5B1AC 4AE4A 2KQ9A 1PCXA 4E7ZA 5DLJA 1APCA 1E83A 4ANJA 1TWGA 2ZXRA 4IRUA 2EIKC 2VB6A 2YHSA 3G50A 3UGPA 3I4UA 4MS2A 3T4RA 2IOQA 1M6TA 4FWVA 1IW7F 4MTOA 2A1DD 1D1AA 4J32B 2OEXA 3OEOA 2WL8A 3ECSA 5COFA 1D0YA 4HFKB 2PF4E 3PCVA 5KYYB 4ZLCA 1FNTc 1R5ID 2R7WA 2R7SA 4JURI 4WGZA 3EGDB 2E87A 2R9RB 3R2PA 3EGXB 5A6AA 2LQGA 1Q0KA 2R7QA 2VCBA 1ORYA 1T9KA 5F5FA 1DOVA 3M4CA 4PJJA 2HUJA 2PBEA 2XRHA 4MTFA 4O6NA 4BJTA 1KTMA 4Z9JA 1C17M 3UMHA 3KYJA 1F1MA 3NKEA 5KYNA 2DYSC 4NCQA 1T6UA 3B71A 2W45A 3FAPB 1YJGA 3QZCA 1VYIA 4WABA 4CBEA 4G7OF 3RH3A 1O87A 4MVZA 1V74B 3JYYA 2XLVA 1HE9A 1ZW2A 3CSKA 3GWNA 4GYTA 4U5HA 2J0WA 4OIPF 4XTKA 2CNWA 4U9DA 1ZW3A 3SYNA 3WODF 4C7OA 4WGYA 4X0RA 2AU5A 4NTFA 3KH2A 1BDJB 1NU9C 2Q00A 3DI5A 3EZIA 1QPUA 3RFYA 5CI8A 1VLTA 4G78A 3ATPA 1OR3A 3K1HA 3JTLO 1M2VB 1JRAA 3WHNA 3ZTZA 1NLXA 4DBQA 2L6HA 1H9TA 2OU6A 2OOCA 3UMIA 3RKOF 3TK0A 4KBLA 3MFNA 3FMSA 4K1OA 4XPXA 3SZRA 2GWWA 2OJED 2VCCA 1JPJA 5B3IA 1OQCA 4XLNF 4ZLDA 3RYLA 2DGJA 3GM2A 3ZDLA 1K05A 1YA7O 3JCUQ 2A68F 1VYKA 3MYFA 3AGTA 2ETSA 3NKDA 1KNYA 1Y4CA 3S28A 1YARO 4U5BE 4BEMJ 3SP1A 1HMOA 3LUTB 1BR1A 1OXKA 5A6BA 2C04A 1EQ1A 3AG3C 1VLSA 256BA 2EIJC 2PFDA 3T9OA 2M64A 2JX0A 3DE8A 3DXJF 3GEIA 4IAOA 4IB4A 3V5XA 4PR9A 2NUTB 4MW8A 2R03A 4LDQA 3NMJA 1OW7A 3DAGA 4BJ6A 4XLPF 2QE9A 2P6VA 2YZSA 4KI2A 3OWTA 1NSGB 1CPRA 3O10A 1JOGA 1T6QA 2VCAA 3ZIBA 2Q4FA 3F47A 2L81A 3HTKC 2W9YA 5EHHA 4E18A 4C3DA 1MNDA 3EHMA 3GM3A 4QI2A 1A0BA 2HSQA 2LP4A 3AQCA 3PDMP 1TKNA 3TJ5A 3KMIA 4JCZA 4MVUA 1GM5A 3V5YA 3CZ6A 1D0ZA 4JKVA 3VAYA 1Z5ZA 1SMYF 4JEAA 2KGOA 3NDBB 2R05A 3LEVA 4D4XA 1FFHA 2P61A 5D91A 4R32A 2NG1A 3VYWA 3K7DA 3CAXA 1CGNA 2XLWA 3C62A 1E2XA 5L0GA 4HFFB 3RQEA 5JUAA 1A41A 1I4YA 3IEEA 2LSEA 3EHNA 1LM3B 4MW3A 4DRIB 4XEFA 1J8YF 3W2WA 2WVQA 2BC5A 5DQTA 1BR2A 1BZ4A 4QI0A 5DS5A 3L8IA 4AL0A 2YVKA 4PJLA 4CS7A 1D1CA 4JJFA 1I5NA 2AP3A 4JTAB 3B29A 3ZQVA 4B6IA 2H7OA 3NRHA 2CGEA 1BR4A 2PP4A 4JCHA 4ULWA 4CSAC 2ZD9A 4EWCA 1MQVA 1Z3IX 3CEXA 3UMKA 4CS8A 1RKCA 1TWAA 2C03A 2Q9AA 2XSEA 1NZEA 2J46A 1OXBA 2XM4A 3BEHA 1A7VA 2OEVA 3JRMO 3DZAA 3KL4A 3QMKA 4I1MA 3X2QC 1RXQA 3S29A 3ZSUA 4C3BA 1K40A 2PX0A 3HLZA 4PJNA 3C63A 1SF8A 3H2VA 4DRJB 1SR2A 4PK4A 1OCOC 4EIYA 3RF3A 2YWAA 1T01A 4KC9A 1N1CA 2NPUA 3V5ZA 4N06A 5DQZA 3ZWIA 1FMWA 1M57C 4EBJA 1PD0A 4CIHA 1WGWA 2YKZA 3ABLC 3EQLF 2XLHA 1E85A 1VMAA 3NYJA 1YAUO 3L8JA 1SYQA 5TJ5E 4AL1A 3ZQYA 3QVZA 2HV7A 2HKVA 5JT4A 3LLKA 2EIMC 5HV9A 2Q9CA 3K66A 2CNWD 5JSLA 1HW1A 2QNLA 2XL6A 1ZYRF 4YN0B 3GODA 3TOLA 3VRCA 2YEVA 3AG2C 4KNWA 2NUTA 5AGFA 5EGYA 2R7XA 5KYXB 4YK5A 5KYXA 3NYLA 4CS9C 3RW0A 2YLIA 4BJ1A 3SXKA 4YT8A 1I4ZA 5FCLA 3GWLA 1YYXA 1QVXA 2LCHA 1OCZC 1V4AA 1YVIA 3N24A 3T6JA 2ZXWC 3C7JA 2B0HA 1ORJA 5L0FA 2OQMA 4CS9A 5JS5A 1S7ZA 3EFOA 1KU2A 3LESA 3O6XA 4LACB 2XL8A 5COGA 3DM9B 2NUPA 1OR2A 3IQTA 4XPYA 3KKBA 2GDCA 3X1OA 4AK9A 1CGOA 2WZLA 3CQZA 2VASA 2L7AA 2DYRC 3DE9A
chains in the Genus database with same CATH topology
3M15A 1YZAA 3TOMA 4CDAA 2J9BA 256BA 2XLOA 2CCYA 4CX9A 3DE8A 4IB4A 3NMJA 2YL3A 3NMIA 1E84A 1S05A 1E86A 1EKYA 3NMKA 4N4WA 1CPRA 2YLGA 2XLMA 4N6HA 3HNJA 3M4BA 2QLAA 4JKVA 3HNKA 4JEAA 5JLIA 2XLEA 3ZTMA 1CPQA 4D4XA 3IQ5A 3QW0A 3QVYA 4JEBA 4NC3A 1CGNA 2XLWA 3C62A 3L1MA 5JUAA 1LM3B 3HNLA 2YL0A 2YL7A 3FOOA 1APCA 1E83A 5JP7A 2BC5A 4ULVA 3ZQVA 1M6TA 4CDYA 1MQVA 2YLDA 5JRAA 1YYJA 2XM4A 1A7VA 4WGZA 4CIPA 4JE9A 4CJGA 1BBHA 1GQAA 4D4NA 3C63A 4EIYA 2YL1A 3M4CA 3HNIA 1RCPA 3ZWIA 1E85A 4CJOA 1YZCA 2YKZA 2XM0A 2XLHA 3U8PA 1JAFA 3QVZA 3ZQYA 5JT4A 5JSLA 2XLVA 4L6RA 3M79A 2XL6A 3TOLA 3VRCA 5JVEA 4IARA 5AGFA 4ER9A 4U9DA 2YLIA 4WGYA 1YYXA 3QW1A 1QPUA 4IAQA 3IQ6A 3ZTZA 3FOPA 4CDVA 4U9EA 5JS5A 2XL8A 1NBBA 5B3IA 1CGOA 2XLDA 1QQ3A 3DE9A 2J8WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M15 A;  1YZA A;  3TOM A;  4CDA A;  2J9B A;  256B A;  2XLO A;  2CCY A;  4CX9 A;  3DE8 A;  4IB4 A;  3NMJ A;  2YL3 A;  3NMI A;  1E84 A;  1S05 A;  1E86 A;  1EKY A;  3NMK A;  4N4W A;  1CPR A;  2YLG A;  2XLM A;  4N6H A;  3HNJ A;  3M4B A;  2QLA A;  4JKV A;  3HNK A;  4JEA A;  5JLI A;  2XLE A;  3ZTM A;  1CPQ A;  4D4X A;  3IQ5 A;  3QW0 A;  3QVY A;  4JEB A;  4NC3 A;  1CGN A;  2XLW A;  3C62 A;  3L1M A;  5JUA A;  1LM3 B;  3HNL A;  2YL0 A;  2YL7 A;  3FOO A;  1APC A;  1E83 A;  5JP7 A;  2BC5 A;  4ULV A;  3ZQV A;  1M6T A;  4CDY A;  1MQV A;  2YLD A;  5JRA A;  1YYJ A;  2XM4 A;  1A7V A;  4WGZ A;  4CIP A;  4JE9 A;  4CJG A;  1BBH A;  1GQA A;  4D4N A;  3C63 A;  4EIY A;  2YL1 A;  3M4C A;  3HNI A;  1RCP A;  3ZWI A;  1E85 A;  4CJO A;  1YZC A;  2YKZ A;  2XM0 A;  2XLH A;  3U8P A;  1JAF A;  3QVZ A;  3ZQY A;  5JT4 A;  5JSL A;  2XLV A;  4L6R A;  3M79 A;  2XL6 A;  3TOL A;  3VRC A;  5JVE A;  4IAR A;  5AGF A;  4ER9 A;  4U9D A;  2YLI A;  4WGY A;  1YYX A;  3QW1 A;  1QPU A;  4IAQ A;  3IQ6 A;  3ZTZ A;  3FOP A;  4CDV A;  4U9E A;  5JS5 A;  2XL8 A;  1NBB A;  5B3I A;  1CGO A;  2XLD A;  1QQ3 A;  3DE9 A;  2J8W A; 
#chains in the Genus database with same CATH topology
 3FAJ A;  4Q5S F;  3JZ0 A;  2G3V A;  1WTY A;  5DVW A;  5E2Q A;  3OA1 A;  1VOM A;  3IHU A;  4XQ1 A;  5L0J A;  2XXA B;  4HEA J;  1Z7Q c;  5B3S C;  1PV3 A;  3BRJ A;  3UGO A;  4JVS A;  1YLM A;  3L0I A;  2WB7 A;  2O9X A;  3T6G B;  4FAP B;  2CCY A;  1ZZP A;  4C7O B;  4WJ0 A;  5F5H A;  4XEK A;  1O3U A;  2R7V A;  2R7O A;  1G4W R;  4JC7 A;  4IGG A;  3NMI A;  3ZVR A;  5E33 A;  1E84 A;  1MMD A;  5KYY A;  5L0D A;  1S05 A;  1G5Z A;  1O5H A;  3SEO A;  1E86 A;  2ZXP A;  5COM A;  3I5P A;  3SXZ A;  2YLG A;  4JJG A;  3ZC4 A;  4XEV A;  4Q7C A;  3E70 C;  2KYH A;  1WOL A;  3ZG1 A;  2WZF A;  2W4M A;  4EBB A;  4HE8 D;  1AUE A;  4DBR A;  4U5E E;  3EFO B;  4MVM A;  3RVZ A;  5A6J A;  2NSF A;  3B9Q A;  2XS8 A;  4MND A;  1J8M F;  3M4B A;  3S0X A;  4UDV A;  1HMD A;  1NFO A;  2R02 A;  2PX3 A;  2X51 A;  2EIN C;  4PFP A;  3S27 A;  2IXM A;  2J45 A;  4O6M A;  5JLI A;  4DVZ A;  1TR2 A;  3FXH A;  2A69 F;  4I1O B;  5AC5 A;  2HFI A;  4EHP A;  3QW0 A;  5FZT A;  5T3W A;  2XXA A;  2EPO A;  1RKE B;  2LFD A;  4NY3 A;  1RKE A;  1EI7 A;  3AJM A;  1U89 A;  3DJN B;  3ITF A;  4RDA A;  1FAP B;  2MWQ A;  3SXM A;  2P7V A;  3RIP A;  2OJQ A;  5DS6 A;  2GAQ A;  2YL0 A;  3HNL A;  5BQG A;  3FOO A;  1LS1 A;  4JTC B;  3B0P A;  4YL3 A;  3LEO A;  4P9T A;  1NG1 A;  4P9F A;  2RD9 A;  3MLG A;  3LAY A;  4ULV A;  1M2O A;  2Y3H A;  3N2Z B;  3JSZ A;  2KC3 A;  4MQ9 F;  3UR3 C;  3W4Y A;  2Y3D A;  2RSE B;  3PHF 2;  2H7V C;  2R7R A;  4LLE A;  1UFB A;  1C02 A;  1SZI A;  3EZH A;  2YLD A;  4U5G A;  4YT2 A;  1ST6 A;  4YJW A;  5JRA A;  2QY9 A;  4LER A;  2ICW G;  1YYJ A;  4K0D A;  2XS1 A;  4C3E A;  4E7S A;  4O7G A;  4AX2 A;  3JYH A;  2YQY A;  4CJG A;  1BBH A;  1V54 C;  1VB5 A;  1MMN A;  2H7B A;  2L6F A;  4G0H A;  1GQA A;  3Q6M A;  1RJ9 A;  4D4N A;  2KW3 C;  4MTG A;  3W8H A;  2MHR A;  4JW1 A;  2HJM A;  3LJB A;  2Y3B A;  3GM1 A;  3HNI A;  2I8B A;  4P6I C;  1TWH A;  1ZU4 A;  3VF0 A;  1MMA A;  3AG4 C;  1RCP A;  4M63 A;  3QTH A;  4NQF A;  4DVY P;  2V3C C;  1RMV A;  1YZC A;  3U8P A;  2FFH A;  4EUK B;  4OIO F;  5BQI A;  1M2V A;  3HJC A;  3K1I C;  1VK5 A;  1D1B A;  2BL2 A;  4O79 A;  4I3M A;  3M79 A;  4U5F E;  2R7U A;  1NFN A;  3U3F A;  4IAR A;  4DXW A;  4W8K A;  3R7C A;  5L3Q A;  3S90 A;  2EIL C;  2A6E F;  2OCC C;  4NTB A;  4OIN F;  5L0H A;  1WWP A;  3AG1 C;  1LE2 A;  3DD7 A;  3QW1 A;  4I44 A;  2OG2 A;  2J0X A;  2ZXO A;  4OIR F;  1LIH A;  1LVK A;  2DB4 A;  5A6B D;  2EPN A;  3FOP A;  4CDV A;  5L0C A;  3TD7 A;  3ABM C;  2I15 A;  3AGU A;  5A6K A;  2KK1 A;  5KYW B;  1VTM P;  3KYI A;  5KYW A;  3EH2 A;  2VH3 A;  1QQ3 A;  2XLD A;  3LNR A;  1LE4 A;  1L3P A;  4PAC A;  4F4B A;  1XWJ A;  2LK4 A;  4ONS A;  2X0C A;  3RVY A;  3U3B A;  5K0I A;  2J9V A;  1Z63 A;  1Y6D A;  2PNO A;  2Z15 A;  3M15 A;  1M56 C;  1YZA A;  1FTS A;  3C18 A;  4CDA A;  3K33 A;  4J7T A;  2HS5 A;  2J9B A;  3EG9 B;  1FR0 A;  1ZHW A;  1R4T A;  2M4E A;  1ZVZ A;  2P1A A;  2QTV A;  2Q9B A;  1JR8 A;  4LDR A;  1QKR A;  4LDK A;  3TQO A;  3ASO C;  5EK0 A;  5CIV A;  3C8Z A;  3A9C A;  3ABK C;  2VC9 A;  4CS8 C;  5T3T A;  3DMD A;  3SXY A;  4E17 A;  2HV6 A;  3GAN A;  2J7P A;  3NG1 A;  3HKK A;  1LI7 A;  2HSB A;  1EKY A;  5IY5 C;  3NMK A;  4K7B A;  4N4W A;  4J30 B;  2A0U A;  2CW0 F;  3U5S A;  3K1I A;  5GPG B;  2GFH A;  4JZA A;  2BE5 F;  3DKA A;  1T5O A;  3EPV A;  4BJ5 C;  2HMQ A;  3HNJ A;  3Q7L A;  3U8V A;  1XZQ A;  1TWC A;  2QLA A;  3DM5 A;  4IJJ A;  4N6C A;  3UNG C;  1OKK D;  4U5D E;  2AWC A;  2D4U A;  1UG7 A;  1YDI A;  4G7Z F;  2P0N A;  5E3A A;  2XLE A;  1OCC C;  3U2M A;  2G3K A;  3Q6N A;  4OD5 A;  1CPQ A;  1WAS A;  3F46 A;  2EPL X;  3IQ5 A;  3LLI A;  4YL0 A;  2JPU A;  3QVY A;  3RQG A;  3MYI A;  4A4A A;  3FVY A;  4NC3 A;  4DRH B;  4OIQ F;  5BUO A;  2LD6 A;  1EA8 A;  2W4B A;  1QZX A;  2YRF A;  1TQG A;  3WG7 C;  4EBK A;  2YL7 A;  1GS9 A;  2J9W A;  5JP7 A;  1WN0 A;  1ZHX A;  2KJG A;  1B68 A;  2L6G A;  3PMR A;  3VM6 A;  1H7I A;  1ZHY A;  1Z6A A;  2J7P D;  3ASN C;  4MVO A;  4YL1 A;  2OKU A;  5T1D B;  3TUL A;  1OKK A;  3AQB A;  2L9J A;  2CDQ A;  1HE1 A;  3DAF A;  3DWW A;  3LNM B;  4BEJ A;  3POV A;  1LKX A;  3SNH A;  4CDY A;  2KSF A;  2V26 A;  3U9M A;  4E0H A;  3MBG A;  4A2N B;  5CI9 A;  4H4K C;  1Q0D A;  1RJ9 B;  4DOZ A;  3IPM O;  4CIP A;  1MNE A;  4JE9 A;  3I5Q A;  4BJ5 A;  1H9G A;  3S84 A;  2R7T A;  3LS0 A;  2D5R B;  5A69 A;  3C8G A;  1CGM E;  1OCR C;  2AWY A;  3U2L A;  1U6H A;  2JD3 A;  1G4U S;  1WAT A;  1XZP A;  2UUI A;  1C03 A;  2ASR A;  2HJ3 A;  2YL1 A;  4FES A;  4GQH A;  4PFO A;  5F28 E;  4YT4 A;  2Q7R A;  2J9U A;  3J06 A;  2IM8 A;  3G4X A;  2R25 A;  3G4Z A;  4FX5 A;  3AOU A;  4CJO A;  2FAP B;  2XM0 A;  1Q0F A;  1JPN A;  4XPW A;  3IQC A;  2Q3T A;  3KPH A;  3O55 A;  1JAF A;  2CYD A;  2NUP B;  1K04 A;  2NSG A;  4IWB A;  4L6R A;  3LS1 A;  3US6 A;  4AE4 B;  5L0I A;  5JVE A;  3EJN A;  4ER9 A;  2FGY A;  1TFO B;  1W2W A;  2WVO A;  3S9O A;  2IXO A;  3U9J A;  1ZHT A;  1LI5 A;  3MX3 A;  4LLC A;  1NU7 D;  2AVK A;  3FHD A;  4NTA A;  3N0T A;  4Z9I A;  4DJ9 A;  3L34 A;  3TJ6 A;  1ORS C;  4IAQ A;  3IQ6 A;  5KYU A;  1U0B B;  4XWJ A;  1LS4 A;  2EPK X;  2GA0 A;  1MMG A;  4MVQ A;  4U9E A;  4YWQ A;  1G8X A;  2UUH A;  1LPE A;  4JIO A;  2ZPA A;  3GEH A;  4RD9 A;  2IXP A;  3JT1 A;  5HSW A;  1NBB A;  4H54 A;  4Q4Z F;  3B0V C;  3W2V A;  3C8G D;  1OW6 A;  3T6B A;  3WAQ A;  1OW8 A;  1A7D A;  4Z9H A;  1HW2 A;  3B0U X;  1FMV A;  3NYM A;  2J8W A;  2B0J A;  1Q0G A;  2HMZ A;  3U0C A;  2TMV P;  2XL4 A;  2IYL D;  2A0B A;  3DJU B;  3V7O A;  3H65 A;  3TOM A;  2MYS A;  3FDQ A;  1JMW A;  4E0I A;  3EH1 A;  5E3C A;  2WZG A;  3K6B A;  1A7E A;  2XLO A;  1AEP A;  3M1C B;  4CSA A;  4O6Y A;  2EPM X;  4CX9 A;  2HZ8 A;  1Q0M A;  3RQF A;  3JSE O;  4OD4 A;  4EKW A;  2IBF A;  2DI3 A;  2YL3 A;  5L3V A;  1D0X A;  3JRT A;  1QLE C;  4JTD B;  4PJM A;  2Y69 C;  1DOW A;  2H8A A;  1PD1 A;  1H6G A;  4RBN A;  2IXN A;  2Y3G A;  2A6H F;  1TFK B;  4KNV A;  5D92 A;  2XLM A;  5BQH A;  5DS4 A;  3Q7G A;  1ZHZ A;  4N6H A;  4QDL A;  2QUP A;  3GOR A;  2Y39 A;  3A11 A;  5B1B C;  1IZM A;  1HY5 A;  4MVS A;  4BJ6 C;  4J7Y A;  2WVN A;  5KYU B;  1GGQ A;  3HNK A;  3O39 A;  1FFT C;  4G7H F;  3C8G B;  4BG0 A;  5AC4 A;  3EGX A;  3ZTM A;  3W8I A;  4U5C E;  4MVR A;  1ZU5 A;  3EG9 A;  1QSP A;  2F22 A;  1YA9 A;  4GEH A;  4BPM A;  1T6I A;  2G62 A;  1L7C A;  1V55 C;  1Z23 A;  2KNH A;  2LIG A;  3EGD A;  3L1M A;  4JEB A;  3GEE A;  4JRZ A;  3E9V A;  4W8P A;  1AVO B;  2LFF A;  3H2U A;  4YT5 A;  5B1A C;  4AE4 A;  2KQ9 A;  1PCX A;  4E7Z A;  5DLJ A;  1APC A;  1E83 A;  4ANJ A;  1TWG A;  2ZXR A;  4IRU A;  2EIK C;  2VB6 A;  2YHS A;  3G50 A;  3UGP A;  3I4U A;  4MS2 A;  3T4R A;  2IOQ A;  1M6T A;  4FWV A;  1IW7 F;  4MTO A;  2A1D D;  1D1A A;  4J32 B;  2OEX A;  3OEO A;  2WL8 A;  3ECS A;  5COF A;  1D0Y A;  4HFK B;  2PF4 E;  3PCV A;  5KYY B;  4ZLC A;  1FNT c;  1R5I D;  2R7W A;  2R7S A;  4JUR I;  4WGZ A;  3EGD B;  2E87 A;  2R9R B;  3R2P A;  3EGX B;  5A6A A;  2LQG A;  1Q0K A;  2R7Q A;  2VCB A;  1ORY A;  1T9K A;  5F5F A;  1DOV A;  3M4C A;  4PJJ A;  2HUJ A;  2PBE A;  2XRH A;  4MTF A;  4O6N A;  4BJT A;  1KTM A;  4Z9J A;  1C17 M;  3UMH A;  3KYJ A;  1F1M A;  3NKE A;  5KYN A;  2DYS C;  4NCQ A;  1T6U A;  3B71 A;  2W45 A;  3FAP B;  1YJG A;  3QZC A;  1VYI A;  4WAB A;  4CBE A;  4G7O F;  3RH3 A;  1O87 A;  4MVZ A;  1V74 B;  3JYY A;  2XLV A;  1HE9 A;  1ZW2 A;  3CSK A;  3GWN A;  4GYT A;  4U5H A;  2J0W A;  4OIP F;  4XTK A;  2CNW A;  4U9D A;  1ZW3 A;  3SYN A;  3WOD F;  4C7O A;  4WGY A;  4X0R A;  2AU5 A;  4NTF A;  3KH2 A;  1BDJ B;  1NU9 C;  2Q00 A;  3DI5 A;  3EZI A;  1QPU A;  3RFY A;  5CI8 A;  1VLT A;  4G78 A;  3ATP A;  1OR3 A;  3K1H A;  3JTL O;  1M2V B;  1JRA A;  3WHN A;  3ZTZ A;  1NLX A;  4DBQ A;  2L6H A;  1H9T A;  2OU6 A;  2OOC A;  3UMI A;  3RKO F;  3TK0 A;  4KBL A;  3MFN A;  3FMS A;  4K1O A;  4XPX A;  3SZR A;  2GWW A;  2OJE D;  2VCC A;  1JPJ A;  5B3I A;  1OQC A;  4XLN F;  4ZLD A;  3RYL A;  2DGJ A;  3GM2 A;  3ZDL A;  1K05 A;  1YA7 O;  3JCU Q;  2A68 F;  1VYK A;  3MYF A;  3AGT A;  2ETS A;  3NKD A;  1KNY A;  1Y4C A;  3S28 A;  1YAR O;  4U5B E;  4BEM J;  3SP1 A;  1HMO A;  3LUT B;  1BR1 A;  1OXK A;  5A6B A;  2C04 A;  1EQ1 A;  3AG3 C;  1VLS A;  256B A;  2EIJ C;  2PFD A;  3T9O A;  2M64 A;  2JX0 A;  3DE8 A;  3DXJ F;  3GEI A;  4IAO A;  4IB4 A;  3V5X A;  4PR9 A;  2NUT B;  4MW8 A;  2R03 A;  4LDQ A;  3NMJ A;  1OW7 A;  3DAG A;  4BJ6 A;  4XLP F;  2QE9 A;  2P6V A;  2YZS A;  4KI2 A;  3OWT A;  1NSG B;  1CPR A;  3O10 A;  1JOG A;  1T6Q A;  2VCA A;  3ZIB A;  2Q4F A;  3F47 A;  2L81 A;  3HTK C;  2W9Y A;  5EHH A;  4E18 A;  4C3D A;  1MND A;  3EHM A;  3GM3 A;  4QI2 A;  1A0B A;  2HSQ A;  2LP4 A;  3AQC A;  3PDM P;  1TKN A;  3TJ5 A;  3KMI A;  4JCZ A;  4MVU A;  1GM5 A;  3V5Y A;  3CZ6 A;  1D0Z A;  4JKV A;  3VAY A;  1Z5Z A;  1SMY F;  4JEA A;  2KGO A;  3NDB B;  2R05 A;  3LEV A;  4D4X A;  1FFH A;  2P61 A;  5D91 A;  4R32 A;  2NG1 A;  3VYW A;  3K7D A;  3CAX A;  1CGN A;  2XLW A;  3C62 A;  1E2X A;  5L0G A;  4HFF B;  3RQE A;  5JUA A;  1A41 A;  1I4Y A;  3IEE A;  2LSE A;  3EHN A;  1LM3 B;  4MW3 A;  4DRI B;  4XEF A;  1J8Y F;  3W2W A;  2WVQ A;  2BC5 A;  5DQT A;  1BR2 A;  1BZ4 A;  4QI0 A;  5DS5 A;  3L8I A;  4AL0 A;  2YVK A;  4PJL A;  4CS7 A;  1D1C A;  4JJF A;  1I5N A;  2AP3 A;  4JTA B;  3B29 A;  3ZQV A;  4B6I A;  2H7O A;  3NRH A;  2CGE A;  1BR4 A;  2PP4 A;  4JCH A;  4ULW A;  4CSA C;  2ZD9 A;  4EWC A;  1MQV A;  1Z3I X;  3CEX A;  3UMK A;  4CS8 A;  1RKC A;  1TWA A;  2C03 A;  2Q9A A;  2XSE A;  1NZE A;  2J46 A;  1OXB A;  2XM4 A;  3BEH A;  1A7V A;  2OEV A;  3JRM O;  3DZA A;  3KL4 A;  3QMK A;  4I1M A;  3X2Q C;  1RXQ A;  3S29 A;  3ZSU A;  4C3B A;  1K40 A;  2PX0 A;  3HLZ A;  4PJN A;  3C63 A;  1SF8 A;  3H2V A;  4DRJ B;  1SR2 A;  4PK4 A;  1OCO C;  4EIY A;  3RF3 A;  2YWA A;  1T01 A;  4KC9 A;  1N1C A;  2NPU A;  3V5Z A;  4N06 A;  5DQZ A;  3ZWI A;  1FMW A;  1M57 C;  4EBJ A;  1PD0 A;  4CIH A;  1WGW A;  2YKZ A;  3ABL C;  3EQL F;  2XLH A;  1E85 A;  1VMA A;  3NYJ A;  1YAU O;  3L8J A;  1SYQ A;  5TJ5 E;  4AL1 A;  3ZQY A;  3QVZ A;  2HV7 A;  2HKV A;  5JT4 A;  3LLK A;  2EIM C;  5HV9 A;  2Q9C A;  3K66 A;  2CNW D;  5JSL A;  1HW1 A;  2QNL A;  2XL6 A;  1ZYR F;  4YN0 B;  3GOD A;  3TOL A;  3VRC A;  2YEV A;  3AG2 C;  4KNW A;  2NUT A;  5AGF A;  5EGY A;  2R7X A;  5KYX B;  4YK5 A;  5KYX A;  3NYL A;  4CS9 C;  3RW0 A;  2YLI A;  4BJ1 A;  3SXK A;  4YT8 A;  1I4Z A;  5FCL A;  3GWL A;  1YYX A;  1QVX A;  2LCH A;  1OCZ C;  1V4A A;  1YVI A;  3N24 A;  3T6J A;  2ZXW C;  3C7J A;  2B0H A;  1ORJ A;  5L0F A;  2OQM A;  4CS9 A;  5JS5 A;  1S7Z A;  3EFO A;  1KU2 A;  3LES A;  3O6X A;  4LAC B;  2XL8 A;  5COG A;  3DM9 B;  2NUP A;  1OR2 A;  3IQT A;  4XPY A;  3KKB A;  2GDC A;  3X1O A;  4AK9 A;  1CGO A;  2WZL A;  3CQZ A;  2VAS A;  2L7A A;  2DYR C;  3DE9 A; 
#chains in the Genus database with same CATH homology
 3M15 A;  1YZA A;  3TOM A;  4CDA A;  2J9B A;  256B A;  2XLO A;  2CCY A;  4CX9 A;  3DE8 A;  4IB4 A;  3NMJ A;  2YL3 A;  3NMI A;  1E84 A;  1S05 A;  1E86 A;  1EKY A;  3NMK A;  4N4W A;  1CPR A;  2YLG A;  2XLM A;  4N6H A;  3HNJ A;  3M4B A;  2QLA A;  4JKV A;  3HNK A;  4JEA A;  5JLI A;  2XLE A;  3ZTM A;  1CPQ A;  4D4X A;  3IQ5 A;  3QW0 A;  3QVY A;  4JEB A;  4NC3 A;  1CGN A;  2XLW A;  3C62 A;  3L1M A;  5JUA A;  1LM3 B;  3HNL A;  2YL0 A;  2YL7 A;  3FOO A;  1APC A;  1E83 A;  5JP7 A;  2BC5 A;  4ULV A;  3ZQV A;  1M6T A;  4CDY A;  1MQV A;  2YLD A;  5JRA A;  1YYJ A;  2XM4 A;  1A7V A;  4WGZ A;  4CIP A;  4JE9 A;  4CJG A;  1BBH A;  1GQA A;  4D4N A;  3C63 A;  4EIY A;  2YL1 A;  3M4C A;  3HNI A;  1RCP A;  3ZWI A;  1E85 A;  4CJO A;  1YZC A;  2YKZ A;  2XM0 A;  2XLH A;  3U8P A;  1JAF A;  3QVZ A;  3ZQY A;  5JT4 A;  5JSL A;  2XLV A;  4L6R A;  3M79 A;  2XL6 A;  3TOL A;  3VRC A;  5JVE A;  4IAR A;  5AGF A;  4ER9 A;  4U9D A;  2YLI A;  4WGY A;  1YYX A;  3QW1 A;  1QPU A;  4IAQ A;  3IQ6 A;  3ZTZ A;  3FOP A;  4CDV A;  4U9E A;  5JS5 A;  2XL8 A;  1NBB A;  5B3I A;  1CGO A;  2XLD A;  1QQ3 A;  3DE9 A;  2J8W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...