1QPUA

Solution structure of oxidized escherichia coli cytochrome b562
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of oxidized Escherichia coli cytochrome b562.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
molecule keywords CYTOCHROME B562
total genus 38
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1999-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1qpuA00
4CDAA 4N6HA 2XL8A 3DE9A 4D4NA 2CCYA 3QW0A 1CGOA 2XLHA 1CPQA 3HNIA 5B3IA 4CJOA 2XM0A 3ZQVA 4L6RA 4CIPA 2QLAA 5JLIA 3U8PA 4ULVA 1EKYA 3HNLA 2XLOA 4JEBA 5JRAA 3M15A 1M6TA 5JP7A 1NBBA 3HNJA 3L1MA 4CX9A 2YLDA 3ZTMA 3M4CA 4JKVA 4IAQA 1QPUA 2XM4A 4CJGA 1E84A 4JE9A 1CPRA 5JS5A 3TOMA 5AGFA 1QQ3A 1YZCA 2BC5A 2XLMA 1JAFA 2XLDA 3NMKA 3IQ6A 3QVYA 3ZQYA 2YL7A 2XL6A 2YLIA 2XLWA 1E85A 4ER9A 1GQAA 1LM3B 3C62A 3QW1A 5JT4A 1E86A 3FOPA 3M4BA 4JEAA 3DE8A 4IB4A 1CGNA 2YL3A 5JUAA 1YYXA 3NMIA 2XLEA 4EIYA 3ZWIA 4U9EA 2J9BA 3M79A 4WGYA 2YLGA 1E83A 4CDYA 5JSLA 4D4XA 2YL0A 1S05A 3QVZA 4WGZA 1BBHA 256BA 1MQVA 2XLVA 3VRCA 2J8WA 3ZTZA 4IARA 1A7VA 4N4WA 1APCA 3C63A 1YYJA 3HNKA 2YKZA 4U9DA 1YZAA 5JVEA 3NMJA 1RCPA 2YL1A 3FOOA 3IQ5A 3TOLA 4NC3A 4CDVA
chains in the Genus database with same CATH superfamily
2XL4A 4LLEA 3CSKA 1XZPA 2O9XA 3OA1A 3PMRA 1MMAA 3U5SA 4CS9C 1C02A 4GQHA 1G5ZA 3SXMA 5AC5A 1DOVA 1BR2A 2XXAA 3C8ZA 1I4ZA 1RJ9B 2DYSC 1T01A 1NZEA 4I3MA 5L0FA 2Q9BA 2YRFA 1NU7D 3H2UA 3T6GB 3JCUQ 1JRAA 3LS1A 2D4UA 4MS2A 1AEPA 2YEVA 2NUTA 3S0XA 4C7OB 1EQ1A 4U5HA 3RVZA 1OQCA 2QTVA 3U2LA 5JLIA 4X0RA 3IEEA 1XWJA 2IXPA 2R9RB 5E33A 5KYYA 4J32B 3ZSUA 2HZ8A 2DI3A 1M2VA 2R7RA 3GM3A 5HV9A 2OEVA 1M6TA 4J7YA 3UGOA 3K7DA 2AWCA 4JRZA 1NBBA 3L1MA 4CX9A 2KNHA 2NSFA 3LJBA 3SXKA 3HLZA 3SP1A 1ZW3A 3FAJA 5KYYB 2FAPB 4Z9JA 2OCCC 3Q7LA 4CBEA 1HE1A 3GM1A 3LNRA 4U5EE 4AE4A 4CSAC 3DJUB 1OCCC 2HMZA 3RQFA 1QPUA 4JW1A 3U9JA 5HSWA 1ORYA 1E84A 3SZRA 5B1BC 1NSGB 3GWLA 5JS5A 3TOMA 2EPMX 2BC5A 3AQBA 1FR0A 4DRHB 1U0BB 1ZU5A 4EBJA 2CDQA 3C8GA 4LLCA 1Z5ZA 1G8XA 2LP4A 3H2VA 3QVYA 1OCRC 2GDCA 4XPXA 3ZIBA 1U6HA 5F5HA 2CYDA 2KC3A 2YL7A 3EJNA 2W4BA 3EGDA 2XL6A 1G4US 3WAQA 4MTFA 2XLWA 1LS1A 2EIKC 3JYHA 4XEVA 2LCHA 3TQOA 1IZMA 4Q4ZF 4MQ9F 5B1AC 3DKAA 2E87A 2Y69C 3FOPA 3GM2A 4U5CE 4J30B 3DE8A 1Z6AA 1CGNA 1QZXA 1QSPA 2NPUA 3AOUA 3V5YA 5L0DA 3B0UX 2IBFA 2EPNA 3NMIA 5L0HA 4WABA 1TWAA 4DRIB 3PCVA 4EIYA 4WJ0A 3ZWIA 3IHUA 4BJ1A 1Z63A 4O6YA 4WGYA 1Y6DA 1V74B 1PCXA 3VAYA 3FMSA 4EUKB 5A6BA 4OIQF 1OR3A 2GFHA 2QUPA 4I1OB 1MNEA 5T3WA 1ST6A 2A69F 5A69A 3BRJA 2ASRA 4U5BE 1Z7Qc 4E0IA 1EI7A 1LKXA 3OWTA 1H6GA 2A6HF 4BEMJ 2PFDA 2QNLA 4D4XA 4AL1A 2WB7A 4CS8A 4QI2A 3QVZA 2P0NA 4LACB 2DYRC 2XS8A 1CGME 5KYXB 4J7TA 4E7ZA 3A11A 2HFIA 5COGA 3ZTZA 3ATPA 1WATA 3KPHA 1C03A 4IARA 1ZHWA 3MLGA 4MTOA 2BL2A 2OU6A 4N4WA 2DGJA 2OQMA 3C63A 1YARO 1UFBA 5L0GA 3G4ZA 5BQIA 3HNKA 5L3VA 1E2XA 3VF0A 3IQCA 2CGEA 4YN0B 5A6JA 3LAYA 1H7IA 5JVEA 3NMJA 4DXWA 3L8IA 4FAPB 4IJJA 1H9TA 4K7BA 1LE4A 3CAXA 5CIVA 3K33A 1A0BA 2G3VA 3IQ5A 4G7HF 2CNWD 4JIOA 4NC3A 3U0CA 1O5HA 2XS1A 2AP3A 2OOCA 1ZVZA 4IAOA 3DE9A 3ITFA 2HMQA 2EIJC 3TJ6A 3ECSA 3NG1A 1PV3A 2VCCA 1LI5A 3AG2C 2HKVA 2Q9AA 4U5FE 3EZHA 4Q5SF 3NYMA 1CPQA 3Q6MA 5B3IA 2J9WA 4XLNF 3L0IA 4IWBA 1M2OA 3ASNC 1WGWA 1TQGA 1Z23A 2R7OA 4XTKA 3ZQVA 4L6RA 4YL0A 4JCHA 2HJ3A 3U8PA 1BZ4A 2A6EF 4JJGA 4ULVA 5KYWA 1OW7A 3AJMA 3WHNA 3HNLA 2KW3C 2Y3GA 1EKYA 2XLOA 5JRAA 2F22A 5EHHA 4DOZA 4JCZA 3LLIA 1NFNA 1MMNA 1Q0GA 3I4UA 1YDIA 3W8HA 1RJ9A 2C03A 5T1DB 1N1CA 1WASA 2NUPA 4OIOF 5DLJA 1I5NA 3EG9A 4OD4A 3S90A 3ASOC 2R7SA 3SYNA 2I15A 4JKVA 4XQ1A 4BG0A 4ZLCA 3PHF2 3U9MA 1TWHA 2W9YA 3UR3C 3KL4A 1KU2A 4EBKA 2YVKA 1RMVA 3EGXB 2D5RB 3AQCA 4MVZA 3FXHA 1CPRA 5B3SC 3T9OA 1MMDA 2C04A 2GA0A 4W8PA 5AGFA 3S84A 2R7TA 4YT2A 3RKOF 2KSFA 5T3TA 4JJFA 3Q6NA 3EH2A 3DM5A 1QVXA 4DVZA 3MYIA 2LIGA 1MNDA 4MVOA 3UGPA 2R7VA 1VLSA 3QZCA 3NYLA 4JTAB 4OD5A 4W8KA 4YT8A 2J0XA 3U8VA 2OEXA 1QKRA 4LDKA 3LEOA 3R2PA 4ER9A 1LM3B 1M56C 1T6QA 4F4BA 1ZHTA 3CQZA 1BDJB 4RBNA 1VOMA 4Q7CA 5JT4A 3DZAA 4BJ6C 4CIHA 2V3CC 2R02A 1D0YA 1B68A 2KQ9A 4E18A 4JEAA 2IOQA 2YL3A 3N0TA 4YK5A 3U2MA 5F28E 2LFFA 3NKEA 1WWPA 1YYXA 4MNDA 5JUAA 1F1MA 4MVMA 2OJQA 2XLEA 4NTBA 3C7JA 3RF3A 4XWJA 3T6BA 2WZGA 3EQLF 3U3FA 4HEAJ 2J9BA 3M79A 1S7ZA 3DI5A 1C17M 1EA8A 2PX3A 3FAPB 1V4AA 2YLGA 1OCOC 4XLPF 5EGYA 2KGOA 3NYJA 1ZYRF 4P9TA 4E17A 1JOGA 4I1MA 1PD1A 5DVWA 3V5ZA 5A6AA 3KYIA 2IM8A 1L3PA 2PF4E 3AGTA 4WGZA 2NG1A 4AL0A 1H9GA 2WVNA 3UMHA 4LDRA 3RW0A 1JPJA 3ZDLA 2Z15A 4O6NA 3AGUA 4MVSA 3X1OA 5CI9A 1Q0DA 3U3BA 2MHRA 5IY5C 2J9VA 2P6VA 3TK0A 3LESA 3LNMB 4MW3A 1UG7A 2IXOA 2A0BA 1U89A 1L7CA 1YYJA 2JX0A 2NUTB 3I5QA 3TULA 1WOLA 1VK5A 2W4MA 2YQYA 1YZAA 2KYHA 1Z3IX 3EHMA 4CS9A 1RCPA 2YL1A 3JZ0A 4NQFA 4NTAA 4K0DA 3ZC4A 3J06A 1ZU4A 3FOOA 2P61A 1YA9A 2KK1A 2NUPB 3KH2A 4MVQA 4CDVA 2OJED 3SXZA 2CW0F 2ZXOA 4CDAA 3PDMP 2XL8A 3C18A 2Y3BA 4NTFA 4G7ZF 2YHSA 3F47A 4N06A 3CZ6A 3I5PA 2IXNA 4I44A 1YA7O 3S28A 1CGOA 2BE5F 4OIRF 5TJ5E 4DJ9A 1OW6A 2VB6A 3HNIA 4DBQA 3KKBA 1SR2A 2H7VC 1T9KA 3GEHA 3KMIA 4YT4A 4YL3A 1ZW2A 2XM0A 4XPYA 1A7EA 3V7OA 1TR2A 3UMIA 2A68F 4CIPA 2PP4A 2QLAA 1FAPB 2EPKX 2P1AA 1T6UA 1A7DA 2FGYA 1OR2A 1M57C 1BR4A 1K05A 3AG1C 3DXJF 3G4XA 4O6MA 3O10A 4QDLA 4UDVA 5KYNA 4JEBA 2V26A 1V54C 2HV6A 2VCAA 3FHDA 3S9OA 1YAUO 4PK4A 2H7OA 4XEKA 5L0JA 3B0VC 3WODF 3E9VA 3HNJA 4AX2A 4YL1A 1TWGA 1YVIA 1AVOB 2X51A 2XRHA 3GANA 2EPLX 4JTCB 4IAQA 3US6A 1FNTc 4C3EA 4DBRA 2MYSA 2VH3A 2R7UA 4BJ5A 2EINC 1ORSC 3JYYA 3LEVA 4HFKB 4IRUA 3JTLO 1D1AA 4CJGA 1Q0MA 2J0WA 4JE9A 4QI0A 2B0HA 1R4TA 1RKEB 1YZCA 4BPMA 1ZHYA 2CNWA 2IYLD 2QE9A 2RSEB 2XLDA 3GEIA 2YZSA 3NMKA 3QMKA 4KBLA 3W4YA 2HSBA 2R7XA 2GWWA 2JD3A 5A6BD 3ZQYA 1TKNA 2ZPAA 2L9JA 3K6BA 2EPOA 1BR1A 4LERA 4YWQA 2PNOA 2GAQA 1D1BA 3B0PA 3B29A 4G0HA 5AC4A 1GQAA 4BJTA 4C3BA 5KYXA 3N2ZB 3E70C 3C62A 3DAFA 2JPUA 4Z9IA 2M64A 2HSQA 4JVSA 4DRJB 1T5OA 2NSGA 2H7BA 1R5ID 1SZIA 1WN0A 1VB5A 1FMWA 3EZIA 2Y3DA 1PD0A 3M4BA 4PJMA 1IW7F 2HS5A 3DD7A 3SXYA 4E7SA 1FMVA 1YLMA 1LIHA 2P7VA 1OCZC 1O87A 1JPNA 2KJGA 5DS5A 4KI2A 2RD9A 1Y4CA 2X0CA 3JRTA 3TD7A 3EH1A 4U5DE 3DAGA 2Q4FA 4A4AA 2G3KA 3HJCA 5BQGA 2L6FA 1V55C 3G50A 4CSAA 2Y3HA 2LD6A 3NRHA 5FCLA 2R7WA 1LS4A 3DJNB 5L3QA 1TFOB 2FFHA 2R7QA 3EG9B 2ETSA 3O55A 4ZLDA 4H4KC 1ZHXA 5DS6A 3SNHA 2PX0A 4PJJA 3K1IA 3EFOB 3UMKA 1LVKA 2L6GA 3POVA 3BEHA 1Q0FA 3F46A 3GEEA 2YWAA 5F5FA 1NU9C 4EKWA 3RYLA 256BA 3RFYA 3HTKC 1AUEA 3C8GB 1QLEC 4MW8A 1DOWA 3VRCA 4BEJA 4PR9A 2J8WA 1T6IA 4U5GA 2XSEA 4PJLA 4IGGA 1A7VA 3JT1A 4PACA 3QTHA 1HW1A 3W2WA 3CEXA 1K04A 2EILC 4JTDB 3UNGC 2LK4A 1HMDA 5KYWB 1YJGA 2Q7RA 1OKKD 1D0XA 2LFDA 2YKZA 3L34A 4U9DA 5BQHA 4ONSA 3ZG1A 2UUHA 3EHNA 2W45A 3GORA 4EWCA 4MVRA 1FFTC 2A1DD 3ABKC 4ULWA 1VTMP 4N6CA 3TOLA 3LUTB 3OEOA 3Q7GA 4P6IC 3ZVRA 5D91A 3LLKA 3RQEA 3AG3C 4N6HA 4YJWA 5BUOA 2QY9A 1HMOA 1FFHA 5L0CA 1OXKA 5DQZA 1I4YA 1OKKA 4KNVA 4A2NB 4D4NA 3FDQA 1J8MF 2CCYA 3QW0A 5D92A 2MWQA 2J7PA 2XLHA 4Z9HA 2AU5A 1ZZPA 2WZFA 3O39A 2L7AA 4NCQA 2ICWG 4CJOA 4G78A 2Q9CA 4C7OA 4M63A 1OXBA 3GODA 4OINF 1NG1A 3X2QC 1ZHZA 2VCBA 2TMVP 2ZXPA 1HY5A 2AWYA 3IPMO 2OKUA 2OG2A 3MBGA 3JSZA 4JC7A 5E3CA 4B6IA 4PFOA 3B71A 5DQTA 3SEOA 5E3AA 1HE9A 3W8IA 4K1OA 4YT5A 4EBBA 3AG4C 4KC9A 1WTYA 3M15A 1K40A 1NLXA 3EGDB 3B9QA 4PJNA 4XEFA 1RKEA 5JP7A 4AE4B 3ABMC 3N24A 3VM6A 3K1HA 2YLDA 4HE8D 3ZTMA 4PFPA 3M4CA 1RKCA 3K1IC 4LDQA 3RVYA 1J8YF 2WZLA 4JZAA 1HW2A 2J7PD 5FZTA 1D1CA 5A6KA 1LE2A 2WVQA 1XZQA 4XPWA 2HJMA 2XM4A 1NFOA 4BJ5C 3IQTA 4MTGA 3LS0A 4CS8C 2EIMC 4P9FA 1QQ3A 5COFA 1JR8A 2XLMA 2J46A 1ORJA 3C8GD 4RD9A 1JAFA 4JURI 3DMDA 1FTSA 1M2VB 3H65A 3T6JA 3IQ6A 3HKKA 3EPVA 2R05A 4GEHA 2B0JA 2UUIA 5K0IA 4KNWA 3WG7C 4BJ6A 1D0ZA 2R25A 3KYJA 4G7OF 3V5XA 2LQGA 2YLIA 3FVYA 2ZXRA 1E85A 2A0UA 3RIPA 3O6XA 1RXQA 2IXMA 3R7CA 1LI7A 3QW1A 2Y39A 3JRMO 2L6HA 4EHPA 1E86A 1KTMA 3TJ5A 2PBEA 1GGQA 1TWCA 5DS4A 2H8AA 4O7GA 4H54A 1TFKB 4IB4A 2XXAB 1O3UA 5GPGB 3T4RA 2WL8A 5KYUB 1VMAA 1W2WA 2AVKA 2J45A 1A41A 1SMYF 3M1CB 3S27A 4U9EA 4R32A 2J9UA 1VLTA 1KNYA 3EFOA 3NKDA 1OW8A 2ZD9A 1LPEA 2WVOA 4E0HA 2I8BA 4FWVA 5COMA 1E83A 4OIPF 5KYUA 4ANJA 1JMWA 1SF8A 4FX5A 3RH3A 4CDYA 2LSEA 3S29A 2VC9A 4DVYP 2VASA 5JSLA 1VYIA 1GM5A 3NDBB 2DB4A 2YL0A 1S05A 3MX3A 3DM9B 4GYTA 1BBHA 5E2QA 1G4WR 4HFFB 5L0IA 1MQVA 2R03A 2XLVA 3MYFA 4C3DA 4CS7A 5EK0A 1GS9A 3GWNA 3MFNA 2Q00A 3JSEO 1APCA 3RQGA 3EGXA 4MVUA 1SYQA 3A9CA 3K66A 3VYWA 2HUJA 2Q3TA 3DWWA 2G62A 3L8JA 4RDAA 2M4EA 3ABLC 4O79A 2HV7A 5CI8A 4AK9A 4NY3A 2ZXWC 1MMGA 1Q0KA 4FESA 2L81A 3W2VA 1VYKA
chains in the Genus database with same CATH topology
4CDAA 4N6HA 2XL8A 3DE9A 4D4NA 2CCYA 3QW0A 1CGOA 2XLHA 1CPQA 3HNIA 5B3IA 4CJOA 2XM0A 3ZQVA 4L6RA 4CIPA 2QLAA 5JLIA 3U8PA 4ULVA 1EKYA 3HNLA 2XLOA 4JEBA 5JRAA 3M15A 1M6TA 5JP7A 1NBBA 3HNJA 3L1MA 4CX9A 2YLDA 3ZTMA 3M4CA 4JKVA 4IAQA 1QPUA 2XM4A 4CJGA 1E84A 4JE9A 1CPRA 5JS5A 3TOMA 5AGFA 1QQ3A 1YZCA 2BC5A 2XLMA 1JAFA 2XLDA 3NMKA 3IQ6A 3QVYA 3ZQYA 2YL7A 2XL6A 2YLIA 2XLWA 1E85A 4ER9A 1GQAA 1LM3B 3C62A 3QW1A 5JT4A 1E86A 3FOPA 3M4BA 4JEAA 3DE8A 4IB4A 1CGNA 2YL3A 5JUAA 1YYXA 3NMIA 2XLEA 4EIYA 3ZWIA 4U9EA 2J9BA 3M79A 4WGYA 2YLGA 1E83A 4CDYA 5JSLA 4D4XA 2YL0A 1S05A 3QVZA 4WGZA 1BBHA 256BA 1MQVA 2XLVA 3VRCA 2J8WA 3ZTZA 4IARA 1A7VA 4N4WA 1APCA 3C63A 1YYJA 3HNKA 2YKZA 4U9DA 1YZAA 5JVEA 3NMJA 1RCPA 2YL1A 3FOOA 3IQ5A 3TOLA 4NC3A 4CDVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CDA A;  4N6H A;  2XL8 A;  3DE9 A;  4D4N A;  2CCY A;  3QW0 A;  1CGO A;  2XLH A;  1CPQ A;  3HNI A;  5B3I A;  4CJO A;  2XM0 A;  3ZQV A;  4L6R A;  4CIP A;  2QLA A;  5JLI A;  3U8P A;  4ULV A;  1EKY A;  3HNL A;  2XLO A;  4JEB A;  5JRA A;  3M15 A;  1M6T A;  5JP7 A;  1NBB A;  3HNJ A;  3L1M A;  4CX9 A;  2YLD A;  3ZTM A;  3M4C A;  4JKV A;  4IAQ A;  1QPU A;  2XM4 A;  4CJG A;  1E84 A;  4JE9 A;  1CPR A;  5JS5 A;  3TOM A;  5AGF A;  1QQ3 A;  1YZC A;  2BC5 A;  2XLM A;  1JAF A;  2XLD A;  3NMK A;  3IQ6 A;  3QVY A;  3ZQY A;  2YL7 A;  2XL6 A;  2YLI A;  2XLW A;  1E85 A;  4ER9 A;  1GQA A;  1LM3 B;  3C62 A;  3QW1 A;  5JT4 A;  1E86 A;  3FOP A;  3M4B A;  4JEA A;  3DE8 A;  4IB4 A;  1CGN A;  2YL3 A;  5JUA A;  1YYX A;  3NMI A;  2XLE A;  4EIY A;  3ZWI A;  4U9E A;  2J9B A;  3M79 A;  4WGY A;  2YLG A;  1E83 A;  4CDY A;  5JSL A;  4D4X A;  2YL0 A;  1S05 A;  3QVZ A;  4WGZ A;  1BBH A;  256B A;  1MQV A;  2XLV A;  3VRC A;  2J8W A;  3ZTZ A;  4IAR A;  1A7V A;  4N4W A;  1APC A;  3C63 A;  1YYJ A;  3HNK A;  2YKZ A;  4U9D A;  1YZA A;  5JVE A;  3NMJ A;  1RCP A;  2YL1 A;  3FOO A;  3IQ5 A;  3TOL A;  4NC3 A;  4CDV A; 
#chains in the Genus database with same CATH topology
 2XL4 A;  4LLE A;  3CSK A;  1XZP A;  2O9X A;  3OA1 A;  3PMR A;  1MMA A;  3U5S A;  4CS9 C;  1C02 A;  4GQH A;  1G5Z A;  3SXM A;  5AC5 A;  1DOV A;  1BR2 A;  2XXA A;  3C8Z A;  1I4Z A;  1RJ9 B;  2DYS C;  1T01 A;  1NZE A;  4I3M A;  5L0F A;  2Q9B A;  2YRF A;  1NU7 D;  3H2U A;  3T6G B;  3JCU Q;  1JRA A;  3LS1 A;  2D4U A;  4MS2 A;  1AEP A;  2YEV A;  2NUT A;  3S0X A;  4C7O B;  1EQ1 A;  4U5H A;  3RVZ A;  1OQC A;  2QTV A;  3U2L A;  5JLI A;  4X0R A;  3IEE A;  1XWJ A;  2IXP A;  2R9R B;  5E33 A;  5KYY A;  4J32 B;  3ZSU A;  2HZ8 A;  2DI3 A;  1M2V A;  2R7R A;  3GM3 A;  5HV9 A;  2OEV A;  1M6T A;  4J7Y A;  3UGO A;  3K7D A;  2AWC A;  4JRZ A;  1NBB A;  3L1M A;  4CX9 A;  2KNH A;  2NSF A;  3LJB A;  3SXK A;  3HLZ A;  3SP1 A;  1ZW3 A;  3FAJ A;  5KYY B;  2FAP B;  4Z9J A;  2OCC C;  3Q7L A;  4CBE A;  1HE1 A;  3GM1 A;  3LNR A;  4U5E E;  4AE4 A;  4CSA C;  3DJU B;  1OCC C;  2HMZ A;  3RQF A;  1QPU A;  4JW1 A;  3U9J A;  5HSW A;  1ORY A;  1E84 A;  3SZR A;  5B1B C;  1NSG B;  3GWL A;  5JS5 A;  3TOM A;  2EPM X;  2BC5 A;  3AQB A;  1FR0 A;  4DRH B;  1U0B B;  1ZU5 A;  4EBJ A;  2CDQ A;  3C8G A;  4LLC A;  1Z5Z A;  1G8X A;  2LP4 A;  3H2V A;  3QVY A;  1OCR C;  2GDC A;  4XPX A;  3ZIB A;  1U6H A;  5F5H A;  2CYD A;  2KC3 A;  2YL7 A;  3EJN A;  2W4B A;  3EGD A;  2XL6 A;  1G4U S;  3WAQ A;  4MTF A;  2XLW A;  1LS1 A;  2EIK C;  3JYH A;  4XEV A;  2LCH A;  3TQO A;  1IZM A;  4Q4Z F;  4MQ9 F;  5B1A C;  3DKA A;  2E87 A;  2Y69 C;  3FOP A;  3GM2 A;  4U5C E;  4J30 B;  3DE8 A;  1Z6A A;  1CGN A;  1QZX A;  1QSP A;  2NPU A;  3AOU A;  3V5Y A;  5L0D A;  3B0U X;  2IBF A;  2EPN A;  3NMI A;  5L0H A;  4WAB A;  1TWA A;  4DRI B;  3PCV A;  4EIY A;  4WJ0 A;  3ZWI A;  3IHU A;  4BJ1 A;  1Z63 A;  4O6Y A;  4WGY A;  1Y6D A;  1V74 B;  1PCX A;  3VAY A;  3FMS A;  4EUK B;  5A6B A;  4OIQ F;  1OR3 A;  2GFH A;  2QUP A;  4I1O B;  1MNE A;  5T3W A;  1ST6 A;  2A69 F;  5A69 A;  3BRJ A;  2ASR A;  4U5B E;  1Z7Q c;  4E0I A;  1EI7 A;  1LKX A;  3OWT A;  1H6G A;  2A6H F;  4BEM J;  2PFD A;  2QNL A;  4D4X A;  4AL1 A;  2WB7 A;  4CS8 A;  4QI2 A;  3QVZ A;  2P0N A;  4LAC B;  2DYR C;  2XS8 A;  1CGM E;  5KYX B;  4J7T A;  4E7Z A;  3A11 A;  2HFI A;  5COG A;  3ZTZ A;  3ATP A;  1WAT A;  3KPH A;  1C03 A;  4IAR A;  1ZHW A;  3MLG A;  4MTO A;  2BL2 A;  2OU6 A;  4N4W A;  2DGJ A;  2OQM A;  3C63 A;  1YAR O;  1UFB A;  5L0G A;  3G4Z A;  5BQI A;  3HNK A;  5L3V A;  1E2X A;  3VF0 A;  3IQC A;  2CGE A;  4YN0 B;  5A6J A;  3LAY A;  1H7I A;  5JVE A;  3NMJ A;  4DXW A;  3L8I A;  4FAP B;  4IJJ A;  1H9T A;  4K7B A;  1LE4 A;  3CAX A;  5CIV A;  3K33 A;  1A0B A;  2G3V A;  3IQ5 A;  4G7H F;  2CNW D;  4JIO A;  4NC3 A;  3U0C A;  1O5H A;  2XS1 A;  2AP3 A;  2OOC A;  1ZVZ A;  4IAO A;  3DE9 A;  3ITF A;  2HMQ A;  2EIJ C;  3TJ6 A;  3ECS A;  3NG1 A;  1PV3 A;  2VCC A;  1LI5 A;  3AG2 C;  2HKV A;  2Q9A A;  4U5F E;  3EZH A;  4Q5S F;  3NYM A;  1CPQ A;  3Q6M A;  5B3I A;  2J9W A;  4XLN F;  3L0I A;  4IWB A;  1M2O A;  3ASN C;  1WGW A;  1TQG A;  1Z23 A;  2R7O A;  4XTK A;  3ZQV A;  4L6R A;  4YL0 A;  4JCH A;  2HJ3 A;  3U8P A;  1BZ4 A;  2A6E F;  4JJG A;  4ULV A;  5KYW A;  1OW7 A;  3AJM A;  3WHN A;  3HNL A;  2KW3 C;  2Y3G A;  1EKY A;  2XLO A;  5JRA A;  2F22 A;  5EHH A;  4DOZ A;  4JCZ A;  3LLI A;  1NFN A;  1MMN A;  1Q0G A;  3I4U A;  1YDI A;  3W8H A;  1RJ9 A;  2C03 A;  5T1D B;  1N1C A;  1WAS A;  2NUP A;  4OIO F;  5DLJ A;  1I5N A;  3EG9 A;  4OD4 A;  3S90 A;  3ASO C;  2R7S A;  3SYN A;  2I15 A;  4JKV A;  4XQ1 A;  4BG0 A;  4ZLC A;  3PHF 2;  3U9M A;  1TWH A;  2W9Y A;  3UR3 C;  3KL4 A;  1KU2 A;  4EBK A;  2YVK A;  1RMV A;  3EGX B;  2D5R B;  3AQC A;  4MVZ A;  3FXH A;  1CPR A;  5B3S C;  3T9O A;  1MMD A;  2C04 A;  2GA0 A;  4W8P A;  5AGF A;  3S84 A;  2R7T A;  4YT2 A;  3RKO F;  2KSF A;  5T3T A;  4JJF A;  3Q6N A;  3EH2 A;  3DM5 A;  1QVX A;  4DVZ A;  3MYI A;  2LIG A;  1MND A;  4MVO A;  3UGP A;  2R7V A;  1VLS A;  3QZC A;  3NYL A;  4JTA B;  4OD5 A;  4W8K A;  4YT8 A;  2J0X A;  3U8V A;  2OEX A;  1QKR A;  4LDK A;  3LEO A;  3R2P A;  4ER9 A;  1LM3 B;  1M56 C;  1T6Q A;  4F4B A;  1ZHT A;  3CQZ A;  1BDJ B;  4RBN A;  1VOM A;  4Q7C A;  5JT4 A;  3DZA A;  4BJ6 C;  4CIH A;  2V3C C;  2R02 A;  1D0Y A;  1B68 A;  2KQ9 A;  4E18 A;  4JEA A;  2IOQ A;  2YL3 A;  3N0T A;  4YK5 A;  3U2M A;  5F28 E;  2LFF A;  3NKE A;  1WWP A;  1YYX A;  4MND A;  5JUA A;  1F1M A;  4MVM A;  2OJQ A;  2XLE A;  4NTB A;  3C7J A;  3RF3 A;  4XWJ A;  3T6B A;  2WZG A;  3EQL F;  3U3F A;  4HEA J;  2J9B A;  3M79 A;  1S7Z A;  3DI5 A;  1C17 M;  1EA8 A;  2PX3 A;  3FAP B;  1V4A A;  2YLG A;  1OCO C;  4XLP F;  5EGY A;  2KGO A;  3NYJ A;  1ZYR F;  4P9T A;  4E17 A;  1JOG A;  4I1M A;  1PD1 A;  5DVW A;  3V5Z A;  5A6A A;  3KYI A;  2IM8 A;  1L3P A;  2PF4 E;  3AGT A;  4WGZ A;  2NG1 A;  4AL0 A;  1H9G A;  2WVN A;  3UMH A;  4LDR A;  3RW0 A;  1JPJ A;  3ZDL A;  2Z15 A;  4O6N A;  3AGU A;  4MVS A;  3X1O A;  5CI9 A;  1Q0D A;  3U3B A;  2MHR A;  5IY5 C;  2J9V A;  2P6V A;  3TK0 A;  3LES A;  3LNM B;  4MW3 A;  1UG7 A;  2IXO A;  2A0B A;  1U89 A;  1L7C A;  1YYJ A;  2JX0 A;  2NUT B;  3I5Q A;  3TUL A;  1WOL A;  1VK5 A;  2W4M A;  2YQY A;  1YZA A;  2KYH A;  1Z3I X;  3EHM A;  4CS9 A;  1RCP A;  2YL1 A;  3JZ0 A;  4NQF A;  4NTA A;  4K0D A;  3ZC4 A;  3J06 A;  1ZU4 A;  3FOO A;  2P61 A;  1YA9 A;  2KK1 A;  2NUP B;  3KH2 A;  4MVQ A;  4CDV A;  2OJE D;  3SXZ A;  2CW0 F;  2ZXO A;  4CDA A;  3PDM P;  2XL8 A;  3C18 A;  2Y3B A;  4NTF A;  4G7Z F;  2YHS A;  3F47 A;  4N06 A;  3CZ6 A;  3I5P A;  2IXN A;  4I44 A;  1YA7 O;  3S28 A;  1CGO A;  2BE5 F;  4OIR F;  5TJ5 E;  4DJ9 A;  1OW6 A;  2VB6 A;  3HNI A;  4DBQ A;  3KKB A;  1SR2 A;  2H7V C;  1T9K A;  3GEH A;  3KMI A;  4YT4 A;  4YL3 A;  1ZW2 A;  2XM0 A;  4XPY A;  1A7E A;  3V7O A;  1TR2 A;  3UMI A;  2A68 F;  4CIP A;  2PP4 A;  2QLA A;  1FAP B;  2EPK X;  2P1A A;  1T6U A;  1A7D A;  2FGY A;  1OR2 A;  1M57 C;  1BR4 A;  1K05 A;  3AG1 C;  3DXJ F;  3G4X A;  4O6M A;  3O10 A;  4QDL A;  4UDV A;  5KYN A;  4JEB A;  2V26 A;  1V54 C;  2HV6 A;  2VCA A;  3FHD A;  3S9O A;  1YAU O;  4PK4 A;  2H7O A;  4XEK A;  5L0J A;  3B0V C;  3WOD F;  3E9V A;  3HNJ A;  4AX2 A;  4YL1 A;  1TWG A;  1YVI A;  1AVO B;  2X51 A;  2XRH A;  3GAN A;  2EPL X;  4JTC B;  4IAQ A;  3US6 A;  1FNT c;  4C3E A;  4DBR A;  2MYS A;  2VH3 A;  2R7U A;  4BJ5 A;  2EIN C;  1ORS C;  3JYY A;  3LEV A;  4HFK B;  4IRU A;  3JTL O;  1D1A A;  4CJG A;  1Q0M A;  2J0W A;  4JE9 A;  4QI0 A;  2B0H A;  1R4T A;  1RKE B;  1YZC A;  4BPM A;  1ZHY A;  2CNW A;  2IYL D;  2QE9 A;  2RSE B;  2XLD A;  3GEI A;  2YZS A;  3NMK A;  3QMK A;  4KBL A;  3W4Y A;  2HSB A;  2R7X A;  2GWW A;  2JD3 A;  5A6B D;  3ZQY A;  1TKN A;  2ZPA A;  2L9J A;  3K6B A;  2EPO A;  1BR1 A;  4LER A;  4YWQ A;  2PNO A;  2GAQ A;  1D1B A;  3B0P A;  3B29 A;  4G0H A;  5AC4 A;  1GQA A;  4BJT A;  4C3B A;  5KYX A;  3N2Z B;  3E70 C;  3C62 A;  3DAF A;  2JPU A;  4Z9I A;  2M64 A;  2HSQ A;  4JVS A;  4DRJ B;  1T5O A;  2NSG A;  2H7B A;  1R5I D;  1SZI A;  1WN0 A;  1VB5 A;  1FMW A;  3EZI A;  2Y3D A;  1PD0 A;  3M4B A;  4PJM A;  1IW7 F;  2HS5 A;  3DD7 A;  3SXY A;  4E7S A;  1FMV A;  1YLM A;  1LIH A;  2P7V A;  1OCZ C;  1O87 A;  1JPN A;  2KJG A;  5DS5 A;  4KI2 A;  2RD9 A;  1Y4C A;  2X0C A;  3JRT A;  3TD7 A;  3EH1 A;  4U5D E;  3DAG A;  2Q4F A;  4A4A A;  2G3K A;  3HJC A;  5BQG A;  2L6F A;  1V55 C;  3G50 A;  4CSA A;  2Y3H A;  2LD6 A;  3NRH A;  5FCL A;  2R7W A;  1LS4 A;  3DJN B;  5L3Q A;  1TFO B;  2FFH A;  2R7Q A;  3EG9 B;  2ETS A;  3O55 A;  4ZLD A;  4H4K C;  1ZHX A;  5DS6 A;  3SNH A;  2PX0 A;  4PJJ A;  3K1I A;  3EFO B;  3UMK A;  1LVK A;  2L6G A;  3POV A;  3BEH A;  1Q0F A;  3F46 A;  3GEE A;  2YWA A;  5F5F A;  1NU9 C;  4EKW A;  3RYL A;  256B A;  3RFY A;  3HTK C;  1AUE A;  3C8G B;  1QLE C;  4MW8 A;  1DOW A;  3VRC A;  4BEJ A;  4PR9 A;  2J8W A;  1T6I A;  4U5G A;  2XSE A;  4PJL A;  4IGG A;  1A7V A;  3JT1 A;  4PAC A;  3QTH A;  1HW1 A;  3W2W A;  3CEX A;  1K04 A;  2EIL C;  4JTD B;  3UNG C;  2LK4 A;  1HMD A;  5KYW B;  1YJG A;  2Q7R A;  1OKK D;  1D0X A;  2LFD A;  2YKZ A;  3L34 A;  4U9D A;  5BQH A;  4ONS A;  3ZG1 A;  2UUH A;  3EHN A;  2W45 A;  3GOR A;  4EWC A;  4MVR A;  1FFT C;  2A1D D;  3ABK C;  4ULW A;  1VTM P;  4N6C A;  3TOL A;  3LUT B;  3OEO A;  3Q7G A;  4P6I C;  3ZVR A;  5D91 A;  3LLK A;  3RQE A;  3AG3 C;  4N6H A;  4YJW A;  5BUO A;  2QY9 A;  1HMO A;  1FFH A;  5L0C A;  1OXK A;  5DQZ A;  1I4Y A;  1OKK A;  4KNV A;  4A2N B;  4D4N A;  3FDQ A;  1J8M F;  2CCY A;  3QW0 A;  5D92 A;  2MWQ A;  2J7P A;  2XLH A;  4Z9H A;  2AU5 A;  1ZZP A;  2WZF A;  3O39 A;  2L7A A;  4NCQ A;  2ICW G;  4CJO A;  4G78 A;  2Q9C A;  4C7O A;  4M63 A;  1OXB A;  3GOD A;  4OIN F;  1NG1 A;  3X2Q C;  1ZHZ A;  2VCB A;  2TMV P;  2ZXP A;  1HY5 A;  2AWY A;  3IPM O;  2OKU A;  2OG2 A;  3MBG A;  3JSZ A;  4JC7 A;  5E3C A;  4B6I A;  4PFO A;  3B71 A;  5DQT A;  3SEO A;  5E3A A;  1HE9 A;  3W8I A;  4K1O A;  4YT5 A;  4EBB A;  3AG4 C;  4KC9 A;  1WTY A;  3M15 A;  1K40 A;  1NLX A;  3EGD B;  3B9Q A;  4PJN A;  4XEF A;  1RKE A;  5JP7 A;  4AE4 B;  3ABM C;  3N24 A;  3VM6 A;  3K1H A;  2YLD A;  4HE8 D;  3ZTM A;  4PFP A;  3M4C A;  1RKC A;  3K1I C;  4LDQ A;  3RVY A;  1J8Y F;  2WZL A;  4JZA A;  1HW2 A;  2J7P D;  5FZT A;  1D1C A;  5A6K A;  1LE2 A;  2WVQ A;  1XZQ A;  4XPW A;  2HJM A;  2XM4 A;  1NFO A;  4BJ5 C;  3IQT A;  4MTG A;  3LS0 A;  4CS8 C;  2EIM C;  4P9F A;  1QQ3 A;  5COF A;  1JR8 A;  2XLM A;  2J46 A;  1ORJ A;  3C8G D;  4RD9 A;  1JAF A;  4JUR I;  3DMD A;  1FTS A;  1M2V B;  3H65 A;  3T6J A;  3IQ6 A;  3HKK A;  3EPV A;  2R05 A;  4GEH A;  2B0J A;  2UUI A;  5K0I A;  4KNW A;  3WG7 C;  4BJ6 A;  1D0Z A;  2R25 A;  3KYJ A;  4G7O F;  3V5X A;  2LQG A;  2YLI A;  3FVY A;  2ZXR A;  1E85 A;  2A0U A;  3RIP A;  3O6X A;  1RXQ A;  2IXM A;  3R7C A;  1LI7 A;  3QW1 A;  2Y39 A;  3JRM O;  2L6H A;  4EHP A;  1E86 A;  1KTM A;  3TJ5 A;  2PBE A;  1GGQ A;  1TWC A;  5DS4 A;  2H8A A;  4O7G A;  4H54 A;  1TFK B;  4IB4 A;  2XXA B;  1O3U A;  5GPG B;  3T4R A;  2WL8 A;  5KYU B;  1VMA A;  1W2W A;  2AVK A;  2J45 A;  1A41 A;  1SMY F;  3M1C B;  3S27 A;  4U9E A;  4R32 A;  2J9U A;  1VLT A;  1KNY A;  3EFO A;  3NKD A;  1OW8 A;  2ZD9 A;  1LPE A;  2WVO A;  4E0H A;  2I8B A;  4FWV A;  5COM A;  1E83 A;  4OIP F;  5KYU A;  4ANJ A;  1JMW A;  1SF8 A;  4FX5 A;  3RH3 A;  4CDY A;  2LSE A;  3S29 A;  2VC9 A;  4DVY P;  2VAS A;  5JSL A;  1VYI A;  1GM5 A;  3NDB B;  2DB4 A;  2YL0 A;  1S05 A;  3MX3 A;  3DM9 B;  4GYT A;  1BBH A;  5E2Q A;  1G4W R;  4HFF B;  5L0I A;  1MQV A;  2R03 A;  2XLV A;  3MYF A;  4C3D A;  4CS7 A;  5EK0 A;  1GS9 A;  3GWN A;  3MFN A;  2Q00 A;  3JSE O;  1APC A;  3RQG A;  3EGX A;  4MVU A;  1SYQ A;  3A9C A;  3K66 A;  3VYW A;  2HUJ A;  2Q3T A;  3DWW A;  2G62 A;  3L8J A;  4RDA A;  2M4E A;  3ABL C;  4O79 A;  2HV7 A;  5CI8 A;  4AK9 A;  4NY3 A;  2ZXW C;  1MMG A;  1Q0K A;  4FES A;  2L81 A;  3W2V A;  1VYK A; 
#chains in the Genus database with same CATH homology
 4CDA A;  4N6H A;  2XL8 A;  3DE9 A;  4D4N A;  2CCY A;  3QW0 A;  1CGO A;  2XLH A;  1CPQ A;  3HNI A;  5B3I A;  4CJO A;  2XM0 A;  3ZQV A;  4L6R A;  4CIP A;  2QLA A;  5JLI A;  3U8P A;  4ULV A;  1EKY A;  3HNL A;  2XLO A;  4JEB A;  5JRA A;  3M15 A;  1M6T A;  5JP7 A;  1NBB A;  3HNJ A;  3L1M A;  4CX9 A;  2YLD A;  3ZTM A;  3M4C A;  4JKV A;  4IAQ A;  1QPU A;  2XM4 A;  4CJG A;  1E84 A;  4JE9 A;  1CPR A;  5JS5 A;  3TOM A;  5AGF A;  1QQ3 A;  1YZC A;  2BC5 A;  2XLM A;  1JAF A;  2XLD A;  3NMK A;  3IQ6 A;  3QVY A;  3ZQY A;  2YL7 A;  2XL6 A;  2YLI A;  2XLW A;  1E85 A;  4ER9 A;  1GQA A;  1LM3 B;  3C62 A;  3QW1 A;  5JT4 A;  1E86 A;  3FOP A;  3M4B A;  4JEA A;  3DE8 A;  4IB4 A;  1CGN A;  2YL3 A;  5JUA A;  1YYX A;  3NMI A;  2XLE A;  4EIY A;  3ZWI A;  4U9E A;  2J9B A;  3M79 A;  4WGY A;  2YLG A;  1E83 A;  4CDY A;  5JSL A;  4D4X A;  2YL0 A;  1S05 A;  3QVZ A;  4WGZ A;  1BBH A;  256B A;  1MQV A;  2XLV A;  3VRC A;  2J8W A;  3ZTZ A;  4IAR A;  1A7V A;  4N4W A;  1APC A;  3C63 A;  1YYJ A;  3HNK A;  2YKZ A;  4U9D A;  1YZA A;  5JVE A;  3NMJ A;  1RCP A;  2YL1 A;  3FOO A;  3IQ5 A;  3TOL A;  4NC3 A;  4CDV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...