1QPUA

Solution structure of oxidized escherichia coli cytochrome b562
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
106
structure length
106
Chain Sequence
b'ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYHQKYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME B562
publication title The solution structure of oxidized Escherichia coli cytochrome b562.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 38
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1999-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1qpuA00
3ZTMA 5B3IA 1S05A 3ZTZA 4IB4A 5JLIA 3M79A 1YYXA 1E86A 4EIYA 2XLEA 3NMIA 5JUAA 3HNIA 3U8PA 4CJGA 2J9BA 2J8WA 5AGFA 4CJOA 1MQVA 2CCYA 1YYJA 3IQ5A 3TOMA 3DE9A 3M15A 2YL7A 3HNJA 2YKZA 1YZCA 4CIPA 4CDAA 4IARA 3QVYA 5JVEA 3HNKA 4U9EA 4U9DA 3IQ6A 1EKYA 1YZAA 4CDVA 2XLHA 4JKVA 1E83A 2YL0A 1APCA 1LM3B 4IAQA 1BBHA 2YLDA 2XLVA 5JSLA 3QW0A 5JP7A 3L1MA 3TOLA 3NMJA 5JS5A 4JEBA 4JEAA 1QPUA 4CX9A 4L6RA 1RCPA 3DE8A 4ULVA 1CGNA 5JT4A 4WGZA 3C62A 3QVZA 2YL1A 2BC5A 3FOPA 2XL8A 4WGYA 3HNLA 3C63A 2QLAA 1CGOA 4D4NA 2YLGA 3M4BA 1CPQA 5JRAA 1A7VA 1E84A 2YLIA 2XL6A 2XM0A 1GQAA 3ZWIA 2XLWA 3NMKA 4N4WA 4D4XA 3M4CA 3ZQYA 2XLMA 3VRCA 2XLOA 3FOOA 1NBBA 4JE9A 1JAFA 2XLDA 2YL3A 1M6TA 4NC3A 2XM4A 1E85A 3ZQVA 1CPRA 3QW1A 256BA 4CDYA 4N6HA 1QQ3A 4ER9A
chains in the Genus database with same CATH superfamily
3ZTMA 4XLPF 3EQLF 2H7OA 1MMAA 4N06A 5A6JA 4ONSA 5B3IA 2LSEA 3U8VA 1PV3A 4I3MA 4DOZA 3I4UA 4EIYA 1OW8A 3U2LA 4A4AA 2OKUA 1YA9A 3EZHA 1VOMA 4EUKB 2HFIA 2OU6A 3JTLO 3TQOA 1XZQA 2J45A 5KYNA 1RXQA 3H2UA 3JRMO 2KGOA 5CI8A 3T6GB 4J32B 3TD7A 5CIVA 2JD3A 3AG2C 5K0IA 1TR2A 2HMQA 3VM6A 2QTVA 1MQVA 1VMAA 3IQ5A 4DVZA 2B0JA 1SYQA 3UGPA 2KYHA 4YK5A 1K05A 4CS8C 1M2OA 4YT4A 3VF0A 2YL7A 3HNJA 1YA7O 2C03A 2Q9CA 4IGGA 1ZHWA 2FGYA 1QLEC 3DM9B 3EGDB 5L0DA 1HW2A 4W8PA 3U9MA 3W2WA 1DOVA 3RVYA 2CGEA 2AU5A 1T5OA 2B0HA 2IBFA 1FR0A 4W8KA 2DYSC 1E2XA 1NU9C 4CDAA 4JC7A 5BQIA 3QVYA 2LK4A 3LEVA 3HNKA 4IRUA 4PJLA 1EA8A 3WAQA 4XPWA 4CS7A 3B0VC 4LERA 3KYJA 4I44A 4LACB 4DRHB 3GM1A 5FZTA 1LM3B 2ZXRA 4DBQA 1ZHXA 4AK9A 1V55C 4JVSA 4XPYA 2R7VA 2D5RB 4XTKA 4U5GA 2Z15A 1F1MA 5L3QA 1BBHA 2R7QA 1BR1A 3RIPA 4E18A 3NDBB 1WASA 3DI5A 4YL1A 1Q0KA 4E0IA 5L3VA 2R7WA 2R03A 3O6XA 3US6A 1QVXA 4BEJA 4N6CA 3ZIBA 2Y3HA 3CAXA 4GEHA 3N2ZB 4Q4ZF 1Y6DA 1LPEA 3AJMA 4JTAB 3EFOB 4AL0A 4MTFA 3N0TA 4CX9A 1ZU5A 1SR2A 2IXNA 5F5FA 3C18A 5L0FA 1OR3A 1Q0MA 3G4ZA 1RCPA 3U2MA 1YDIA 3DE8A 3FHDA 5AC5A 2HV6A 4E7ZA 2X51A 3RQEA 3KYIA 4MVUA 2XXAA 1NU7D 3SNHA 5JT4A 4KNVA 1I4YA 2P7VA 3WHNA 1MNEA 1Z7Qc 3C62A 4AL1A 1OW7A 5COGA 2YL1A 5B1AC 3LS1A 3UR3C 1G8XA 2XL8A 2XRHA 3F46A 1Z3IX 3JSEO 2L9JA 3EH1A 1KTMA 4JIOA 3PCVA 4BJ6C 1SF8A 3SXZA 2R05A 5DVWA 1Q0GA 3FXHA 5F28E 4EBBA 5A6AA 3U3FA 4RDAA 3MFNA 3TJ5A 3POVA 3K33A 2W4MA 4OIRF 2OJQA 3L0IA 4P6IC 4MW8A 2AP3A 1RKCA 3E9VA 2XM0A 4JCZA 3SZRA 2IXPA 3RQFA 1AVOB 1U6HA 3LEOA 4GYTA 3DKAA 3T6BA 4CSAC 2OG2A 2J9UA 3ABLC 3EGXA 4G0HA 2F22A 1QZXA 1O5HA 2AVKA 2Y69C 4D4XA 5KYUB 3U9JA 3LLIA 4Z9JA 3FOOA 5D92A 2W45A 3TK0A 2L6GA 3JSZA 4M63A 1K40A 1Z23A 2YL3A 2JX0A 3K1IC 4MVZA 3FDQA 1LE2A 1WN0A 1TWHA 5KYYA 1JOGA 4UDVA 1R4TA 2OEXA 3U0CA 3VAYA 1O3UA 4QDLA 4CS8A 2Q00A 3FMSA 3RYLA 2E87A 2A1DD 1CPRA 3AGUA 4MW3A 2DI3A 1FTSA 3UMKA 5DS4A 3LESA 2EILC 4H4KC 4N6HA 4CDYA 1QQ3A 3KMIA 1ZYRF 4MVRA 4OD4A 3FAJA 3A11A 1S05A 2Q7RA 4EBKA 1FMVA 2R7OA 3HKKA 3K66A 3EG9B 2EINC 1T6UA 3EZIA 4MS2A 3IEEA 1T9KA 4YT8A 1E86A 1OCOC 3NMIA 4IJJA 4JCHA 5A6BA 3HNIA 1RJ9B 3ITFA 4DXWA 5L0IA 1XZPA 3ABKC 1GGQA 2TMVP 5AGFA 3GEEA 1V4AA 1ZHYA 2P61A 1H7IA 3JYYA 3TULA 4LDKA 5HV9A 1MNDA 2A68F 4OIPF 1FFHA 3R2PA 3KPHA 1ORYA 3M15A 4O6YA 4ANJA 4E0HA 4XLNF 4G7OF 4XWJA 5BUOA 3AG1C 3EJNA 3B0UX 3C8GA 1U89A 1TKNA 3AG3C 2C04A 1W2WA 3SEOA 4IARA 3C8GB 1B68A 4HFFB 5JVEA 2HUJA 4H54A 3OEOA 4C7OA 1D1AA 4A2NB 3W4YA 1LS1A 1UG7A 3V5XA 4KI2A 3DJNB 3AQCA 3AQBA 4CDVA 2R02A 4C7OB 4OD5A 1WWPA 1EKYA 4FWVA 2YL0A 1E83A 2Q4FA 3K1HA 4JJGA 3ASNC 1HE9A 3DJUB 4XEKA 1BR2A 2L81A 3LS0A 2YLDA 4KBLA 3RFYA 3HTKC 1M57C 2MHRA 1JMWA 1ZW2A 2YVKA 2XL4A 3GORA 1V74B 3EGDA 3QW0A 2VASA 3TOLA 4DVYP 3T4RA 3NMJA 3RQGA 2GAQA 2Q9AA 3W8HA 3C8ZA 1YAUO 1VB5A 2IXMA 1TWCA 2PX3A 1VLSA 1LE4A 1OKKD 1ST6A 3AG4C 3X2QC 2WVQA 3DD7A 2H7BA 1XWJA 4HE8D 1QPUA 5DLJA 1OR2A 2Y3BA 4CSAA 1H9GA 3OWTA 2MWQA 5TJ5E 2HMZA 4ULVA 2KSFA 2A6HF 3JT1A 4E7SA 3ASOC 2X0CA 3UNGC 5BQGA 1I5NA 4IAOA 3EHNA 3GEIA 2L7AA 2BE5F 2M64A 2LQGA 3GWLA 3K1IA 2VCCA 5B3SC 3J06A 1A41A 1OKKA 3FOPA 4MVSA 1JR8A 1ZHTA 4PK4A 1OW6A 2A0UA 4WGYA 3HNLA 1AEPA 3O10A 1ZU4A 2XS1A 2QLAA 4PFPA 1CGOA 1WATA 4JRZA 4NCQA 1M2VA 4RD9A 1WOLA 3M4BA 1L7CA 3Q6NA 3ZSUA 5JRAA 1A7VA 3EFOA 2PX0A 3GEHA 1VLTA 1M2VB 4YL3A 5L0JA 2XL6A 4G7HF 1GQAA 1HMDA 2J7PA 2J9VA 3HJCA 3T9OA 2P0NA 2XLWA 3NMKA 1O87A 3QTHA 5HSWA 4N4WA 1SZIA 1TFKB 3LNRA 3V7OA 3KKBA 1BZ4A 1A0BA 2I8BA 2IM8A 2DYRC 4J30B 3EHMA 4EKWA 3S84A 4PJJA 2NSFA 1VYKA 3RF3A 1JAFA 2XLDA 3DZAA 4F4BA 4MTOA 4NC3A 2EIJC 1MMGA 2XM4A 2RD9A 4X0RA 2EPNA 4CS9C 1J8YF 4EBJA 1E85A 4BJ5C 4K1OA 5KYXB 3NG1A 5E2QA 1JPJA 2IOQA 3S29A 1D1CA 3X1OA 1OCCC 4JZAA 5AC4A 1Y4CA 4IB4A 5JLIA 1Q0DA 2I15A 1BDJB 3M79A 1MMNA 4WABA 1YYXA 2XLEA 5GPGB 2KC3A 5KYUA 5JUAA 1N1CA 3FAPB 3U8PA 5B1BC 1LS4A 4O7GA 1KNYA 4YN0B 5F5HA 1U0BB 2ICWG 5T1DB 2J9BA 2J8WA 3ATPA 1FFTC 4BEMJ 1A7DA 3GM2A 4B6IA 4CJOA 2CCYA 1YYJA 3I5QA 4DRJB 5DQZA 3OA1A 5A6BD 4U5EE 2CYDA 3NYMA 2WZLA 2WZFA 2G3KA 3MBGA 4MTGA 2ZD9A 1TQGA 1TWGA 4DRIB 2HZ8A 2QNLA 4EHPA 4YL0A 3EG9A 3DAFA 4LLCA 2W9YA 1YZCA 3U3BA 2NUPB 1K04A 3QZCA 2R7SA 4NTBA 3GANA 1C17M 4PR9A 4YWQA 1RJ9A 2WVNA 3L34A 4U9DA 1BR4A 1NZEA 3L8IA 3IQ6A 3G50A 1T6IA 1YZAA 1NFNA 3RW0A 3WG7C 4DBRA 3ZG1A 2V3CC 1APCA 3AGTA 3C8GD 2R9RB 4NTFA 2YQYA 1IW7F 2EIMC 2VCBA 4IAQA 4PJNA 5L0GA 1NG1A 1WTYA 1M56C 1R5ID 2KK1A 4WJ0A 1A7EA 3IQCA 1JRAA 2LP4A 3VYWA 1ZZPA 3NYJA 2EPMX 5DS5A 2QE9A 2G3VA 3IHUA 2H7VC 3JYHA 3I5PA 1LI5A 5JS5A 4C3BA 3TJ6A 3DWWA 3HLZA 4QI2A 1RKEB 1YARO 4JEAA 3N24A 2ZPAA 5E3AA 2UUIA 4P9FA 4BG0A 4YJWA 1TWAA 3AOUA 1NSGB 3R7CA 1FMWA 2GFHA 3IQTA 4LDQA 5A69A 3CEXA 5KYWB 1VTMP 1FAPB 4E17A 3V5YA 3EH2A 4XEVA 4I1OB 4MVQA 4Q5SF 1CGNA 3IPMO 4G78A 4U5FE 4I1MA 4PJMA 3O55A 2ZXPA 1EQ1A 4HFKB 3A9CA 2NSGA 3GODA 2AWCA 2M4EA 3SXKA 4RBNA 2BC5A 1H6GA 3C7JA 3O39A 4AE4A 1HW1A 2XS8A 2HKVA 3C63A 1DOWA 2CNWA 2RSEB 1YVIA 2LIGA 3L8JA 2J0XA 4HEAJ 4U5HA 4BJ6A 4GQHA 4AE4B 3Q7LA 2PNOA 4Z9IA 2WB7A 2HSBA 4AX2A 2CDQA 1E84A 5EGYA 2IXOA 5IY5C 1T6QA 4PFOA 5D91A 4ZLCA 3NRHA 3UMIA 4Z9HA 3GWNA 1Z6AA 2Q3TA 3MYIA 2JPUA 1EI7A 2FAPB 1SMYF 2A0BA 5E33A 3M4CA 3ZQYA 1YJGA 4FESA 4J7YA 1ZVZA 2XLMA 3FVYA 3KL4A 1G4WR 1H9TA 2XLOA 1NBBA 2QUPA 4JURI 4JE9A 2J7PD 4PACA 2AWYA 3B9QA 1LVKA 5COFA 1GM5A 3LLKA 3Q6MA 1J8MF 3S9OA 1L3PA 2PP4A 3CZ6A 4BPMA 2FFHA 4QI0A 2HS5A 2NPUA 1JPNA 5BQHA 3G4XA 3B29A 4BJTA 4CIPA 1OCZC 2HV7A 3KH2A 2MYSA 4MVMA 3CSKA 3ZTZA 4K7BA 3ZVRA 3F47A 1Z5ZA 5EHHA 1D1BA 2PF4E 1CGME 1HY5A 3W8IA 2LD6A 3PHF2 2KNHA 5L0CA 1HE1A 3CQZA 4OIQF 2HSQA 1ORSC 5COMA 1UFBA 4XPXA 2DGJA 2NG1A 3NKEA 3QMKA 4CJGA 4LDRA 5DQTA 3S27A 4P9TA 2EPKX 4DJ9A 3ABMC 2QY9A 3WODF 1MMDA 3BRJA 3ZC4A 2GWWA 2IYLD 3TOMA 2ZXWC 4JW1A 3RH3A 3W2VA 2R7RA 5CI9A 2EPOA 2OEVA 1ZW3A 4IWBA 1T01A 3DE9A 3U5SA 2ZXOA 5KYXA 1HMOA 3NKDA 3K6BA 2GA0A 2VB6A 2YWAA 4KC9A 3MX3A 5FCLA 1OXKA 1LI7A 4MQ9F 4NY3A 2YKZA 3S90A 2DB4A 1LKXA 4NQFA 4G7ZF 3ZDLA 3RVZA 2KW3C 1Z63A 2VH3A 4JTCB 1C03A 4U9EA 4XEFA 4C3EA 5A6KA 4U5DE 4YT2A 3SP1A 2XLHA 3B71A 4JKVA 4C3DA 3MYFA 3DM5A 3K7DA 4JTDB 2XXAB 2L6HA 3M1CB 1D0XA 4CBEA 5L0HA 2PBEA 3LAYA 4MNDA 5T3WA 3RKOF 4BJ1A 1QKRA 4FX5A 2BL2A 2LFDA 3LUTB 3S28A 2WVOA 2XLVA 5JSLA 3Q7GA 5JP7A 3LJBA 3L1MA 3E70C 1VYIA 2YZSA 2EPLX 1I4ZA 2G62A 4JEBA 2KQ9A 3DAGA 1YLMA 3S0XA 2NUPA 2W4BA 3JRTA 2Q9BA 3ECSA 4ZLDA 3JZ0A 2Y3DA 2Y39A 4KNWA 2KJGA 4L6RA 3BEHA 2PFDA 1OCRC 3DMDA 2Y3GA 4OINF 4LLEA 3DXJF 3EGXB 2H8AA 4OIOF 1V54C 4WGZA 5DS6A 4O79A 2R7TA 2P6VA 5EK0A 2A69F 3QVZA 2LFFA 3EPVA 2J0WA 3PMRA 4MVOA 1D0ZA 4EWCA 2R25A 3GM3A 2V26A 3NYLA 4JJFA 5KYYB 2UUHA 1S7ZA 2XSEA 2YHSA 2VCAA 3V5ZA 1LIHA 5E3CA 3JCUQ 2YLGA 1RKEA 1Q0FA 4D4NA 1NFOA 4FAPB 3UGOA 3SXYA 3LNMB 1CPQA 1AUEA 4NTAA 2A6EF 1QSPA 2OCCC 3T6JA 2O9XA 2WZGA 4K0DA 2CW0F 3H65A 4Q7CA 3H2VA 1G5ZA 2YLIA 1NLXA 1FNTc 1TFOB 3PDMP 2D4UA 3ZWIA 5KYWA 2VC9A 1ZHZA 2ETSA 1PD1A 2HJ3A 1ORJA 1PCXA 2CNWD 2GDCA 2J46A 4U5BE 3SYNA 3UMHA 2L6FA 3B0PA 4O6MA 1D0YA 1OQCA 4J7TA 2NUTA 3SXMA 5T3TA 2OOCA 1VK5A 2EIKC 2YEVA 3VRCA 1PD0A 2P1AA 2OJED 4ULWA 1RMVA 2HJMA 2NUTB 2R7XA 4O6NA 2ASRA 2YRFA 2LCHA 1KU2A 1M6TA 4U5CE 2OQMA 3MLGA 2WL8A 2R7UA 3ZQVA 4XQ1A 4YT5A 1G4US 4CS9A 3QW1A 1OXBA 4CIHA 2J9WA 1C02A 256BA 1GS9A 1WGWA 4BJ5A 1IZMA 4R32A 4ER9A
chains in the Genus database with same CATH topology
3ZTMA 5B3IA 1S05A 3ZTZA 4IB4A 5JLIA 3M79A 1YYXA 1E86A 4EIYA 2XLEA 3NMIA 5JUAA 3HNIA 3U8PA 4CJGA 2J9BA 2J8WA 5AGFA 4CJOA 1MQVA 2CCYA 1YYJA 3IQ5A 3TOMA 3DE9A 3M15A 2YL7A 3HNJA 2YKZA 1YZCA 4CIPA 4CDAA 4IARA 3QVYA 5JVEA 3HNKA 4U9EA 4U9DA 3IQ6A 1EKYA 1YZAA 4CDVA 2XLHA 4JKVA 1E83A 2YL0A 1APCA 1LM3B 4IAQA 1BBHA 2YLDA 2XLVA 5JSLA 3QW0A 5JP7A 3L1MA 3TOLA 3NMJA 5JS5A 4JEBA 4JEAA 1QPUA 4CX9A 4L6RA 1RCPA 3DE8A 4ULVA 1CGNA 5JT4A 4WGZA 3C62A 3QVZA 2YL1A 2BC5A 3FOPA 2XL8A 4WGYA 3HNLA 3C63A 2QLAA 1CGOA 4D4NA 2YLGA 3M4BA 1CPQA 5JRAA 1A7VA 1E84A 2YLIA 2XL6A 2XM0A 1GQAA 3ZWIA 2XLWA 3NMKA 4N4WA 4D4XA 3M4CA 3ZQYA 2XLMA 3VRCA 2XLOA 3FOOA 1NBBA 4JE9A 1JAFA 2XLDA 2YL3A 1M6TA 4NC3A 2XM4A 1E85A 3ZQVA 1CPRA 3QW1A 256BA 4CDYA 4N6HA 1QQ3A 4ER9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZTM A;  5B3I A;  1S05 A;  3ZTZ A;  4IB4 A;  5JLI A;  3M79 A;  1YYX A;  1E86 A;  4EIY A;  2XLE A;  3NMI A;  5JUA A;  3HNI A;  3U8P A;  4CJG A;  2J9B A;  2J8W A;  5AGF A;  4CJO A;  1MQV A;  2CCY A;  1YYJ A;  3IQ5 A;  3TOM A;  3DE9 A;  3M15 A;  2YL7 A;  3HNJ A;  2YKZ A;  1YZC A;  4CIP A;  4CDA A;  4IAR A;  3QVY A;  5JVE A;  3HNK A;  4U9E A;  4U9D A;  3IQ6 A;  1EKY A;  1YZA A;  4CDV A;  2XLH A;  4JKV A;  1E83 A;  2YL0 A;  1APC A;  1LM3 B;  4IAQ A;  1BBH A;  2YLD A;  2XLV A;  5JSL A;  3QW0 A;  5JP7 A;  3L1M A;  3TOL A;  3NMJ A;  5JS5 A;  4JEB A;  4JEA A;  1QPU A;  4CX9 A;  4L6R A;  1RCP A;  3DE8 A;  4ULV A;  1CGN A;  5JT4 A;  4WGZ A;  3C62 A;  3QVZ A;  2YL1 A;  2BC5 A;  3FOP A;  2XL8 A;  4WGY A;  3HNL A;  3C63 A;  2QLA A;  1CGO A;  4D4N A;  2YLG A;  3M4B A;  1CPQ A;  5JRA A;  1A7V A;  1E84 A;  2YLI A;  2XL6 A;  2XM0 A;  1GQA A;  3ZWI A;  2XLW A;  3NMK A;  4N4W A;  4D4X A;  3M4C A;  3ZQY A;  2XLM A;  3VRC A;  2XLO A;  3FOO A;  1NBB A;  4JE9 A;  1JAF A;  2XLD A;  2YL3 A;  1M6T A;  4NC3 A;  2XM4 A;  1E85 A;  3ZQV A;  1CPR A;  3QW1 A;  256B A;  4CDY A;  4N6H A;  1QQ3 A;  4ER9 A; 
#chains in the Genus database with same CATH topology
 3ZTM A;  4XLP F;  3EQL F;  2H7O A;  1MMA A;  4N06 A;  5A6J A;  4ONS A;  5B3I A;  2LSE A;  3U8V A;  1PV3 A;  4I3M A;  4DOZ A;  3I4U A;  4EIY A;  1OW8 A;  3U2L A;  4A4A A;  2OKU A;  1YA9 A;  3EZH A;  1VOM A;  4EUK B;  2HFI A;  2OU6 A;  3JTL O;  3TQO A;  1XZQ A;  2J45 A;  5KYN A;  1RXQ A;  3H2U A;  3JRM O;  2KGO A;  5CI8 A;  3T6G B;  4J32 B;  3TD7 A;  5CIV A;  2JD3 A;  3AG2 C;  5K0I A;  1TR2 A;  2HMQ A;  3VM6 A;  2QTV A;  1MQV A;  1VMA A;  3IQ5 A;  4DVZ A;  2B0J A;  1SYQ A;  3UGP A;  2KYH A;  4YK5 A;  1K05 A;  4CS8 C;  1M2O A;  4YT4 A;  3VF0 A;  2YL7 A;  3HNJ A;  1YA7 O;  2C03 A;  2Q9C A;  4IGG A;  1ZHW A;  2FGY A;  1QLE C;  3DM9 B;  3EGD B;  5L0D A;  1HW2 A;  4W8P A;  3U9M A;  3W2W A;  1DOV A;  3RVY A;  2CGE A;  2AU5 A;  1T5O A;  2B0H A;  2IBF A;  1FR0 A;  4W8K A;  2DYS C;  1E2X A;  1NU9 C;  4CDA A;  4JC7 A;  5BQI A;  3QVY A;  2LK4 A;  3LEV A;  3HNK A;  4IRU A;  4PJL A;  1EA8 A;  3WAQ A;  4XPW A;  4CS7 A;  3B0V C;  4LER A;  3KYJ A;  4I44 A;  4LAC B;  4DRH B;  3GM1 A;  5FZT A;  1LM3 B;  2ZXR A;  4DBQ A;  1ZHX A;  4AK9 A;  1V55 C;  4JVS A;  4XPY A;  2R7V A;  2D5R B;  4XTK A;  4U5G A;  2Z15 A;  1F1M A;  5L3Q A;  1BBH A;  2R7Q A;  1BR1 A;  3RIP A;  4E18 A;  3NDB B;  1WAS A;  3DI5 A;  4YL1 A;  1Q0K A;  4E0I A;  5L3V A;  2R7W A;  2R03 A;  3O6X A;  3US6 A;  1QVX A;  4BEJ A;  4N6C A;  3ZIB A;  2Y3H A;  3CAX A;  4GEH A;  3N2Z B;  4Q4Z F;  1Y6D A;  1LPE A;  3AJM A;  4JTA B;  3EFO B;  4AL0 A;  4MTF A;  3N0T A;  4CX9 A;  1ZU5 A;  1SR2 A;  2IXN A;  5F5F A;  3C18 A;  5L0F A;  1OR3 A;  1Q0M A;  3G4Z A;  1RCP A;  3U2M A;  1YDI A;  3DE8 A;  3FHD A;  5AC5 A;  2HV6 A;  4E7Z A;  2X51 A;  3RQE A;  3KYI A;  4MVU A;  2XXA A;  1NU7 D;  3SNH A;  5JT4 A;  4KNV A;  1I4Y A;  2P7V A;  3WHN A;  1MNE A;  1Z7Q c;  3C62 A;  4AL1 A;  1OW7 A;  5COG A;  2YL1 A;  5B1A C;  3LS1 A;  3UR3 C;  1G8X A;  2XL8 A;  2XRH A;  3F46 A;  1Z3I X;  3JSE O;  2L9J A;  3EH1 A;  1KTM A;  4JIO A;  3PCV A;  4BJ6 C;  1SF8 A;  3SXZ A;  2R05 A;  5DVW A;  1Q0G A;  3FXH A;  5F28 E;  4EBB A;  5A6A A;  3U3F A;  4RDA A;  3MFN A;  3TJ5 A;  3POV A;  3K33 A;  2W4M A;  4OIR F;  2OJQ A;  3L0I A;  4P6I C;  4MW8 A;  2AP3 A;  1RKC A;  3E9V A;  2XM0 A;  4JCZ A;  3SZR A;  2IXP A;  3RQF A;  1AVO B;  1U6H A;  3LEO A;  4GYT A;  3DKA A;  3T6B A;  4CSA C;  2OG2 A;  2J9U A;  3ABL C;  3EGX A;  4G0H A;  2F22 A;  1QZX A;  1O5H A;  2AVK A;  2Y69 C;  4D4X A;  5KYU B;  3U9J A;  3LLI A;  4Z9J A;  3FOO A;  5D92 A;  2W45 A;  3TK0 A;  2L6G A;  3JSZ A;  4M63 A;  1K40 A;  1Z23 A;  2YL3 A;  2JX0 A;  3K1I C;  4MVZ A;  3FDQ A;  1LE2 A;  1WN0 A;  1TWH A;  5KYY A;  1JOG A;  4UDV A;  1R4T A;  2OEX A;  3U0C A;  3VAY A;  1O3U A;  4QDL A;  4CS8 A;  2Q00 A;  3FMS A;  3RYL A;  2E87 A;  2A1D D;  1CPR A;  3AGU A;  4MW3 A;  2DI3 A;  1FTS A;  3UMK A;  5DS4 A;  3LES A;  2EIL C;  4H4K C;  4N6H A;  4CDY A;  1QQ3 A;  3KMI A;  1ZYR F;  4MVR A;  4OD4 A;  3FAJ A;  3A11 A;  1S05 A;  2Q7R A;  4EBK A;  1FMV A;  2R7O A;  3HKK A;  3K66 A;  3EG9 B;  2EIN C;  1T6U A;  3EZI A;  4MS2 A;  3IEE A;  1T9K A;  4YT8 A;  1E86 A;  1OCO C;  3NMI A;  4IJJ A;  4JCH A;  5A6B A;  3HNI A;  1RJ9 B;  3ITF A;  4DXW A;  5L0I A;  1XZP A;  3ABK C;  1GGQ A;  2TMV P;  5AGF A;  3GEE A;  1V4A A;  1ZHY A;  2P61 A;  1H7I A;  3JYY A;  3TUL A;  4LDK A;  5HV9 A;  1MND A;  2A68 F;  4OIP F;  1FFH A;  3R2P A;  3KPH A;  1ORY A;  3M15 A;  4O6Y A;  4ANJ A;  4E0H A;  4XLN F;  4G7O F;  4XWJ A;  5BUO A;  3AG1 C;  3EJN A;  3B0U X;  3C8G A;  1U89 A;  1TKN A;  3AG3 C;  2C04 A;  1W2W A;  3SEO A;  4IAR A;  3C8G B;  1B68 A;  4HFF B;  5JVE A;  2HUJ A;  4H54 A;  3OEO A;  4C7O A;  1D1A A;  4A2N B;  3W4Y A;  1LS1 A;  1UG7 A;  3V5X A;  4KI2 A;  3DJN B;  3AQC A;  3AQB A;  4CDV A;  2R02 A;  4C7O B;  4OD5 A;  1WWP A;  1EKY A;  4FWV A;  2YL0 A;  1E83 A;  2Q4F A;  3K1H A;  4JJG A;  3ASN C;  1HE9 A;  3DJU B;  4XEK A;  1BR2 A;  2L81 A;  3LS0 A;  2YLD A;  4KBL A;  3RFY A;  3HTK C;  1M57 C;  2MHR A;  1JMW A;  1ZW2 A;  2YVK A;  2XL4 A;  3GOR A;  1V74 B;  3EGD A;  3QW0 A;  2VAS A;  3TOL A;  4DVY P;  3T4R A;  3NMJ A;  3RQG A;  2GAQ A;  2Q9A A;  3W8H A;  3C8Z A;  1YAU O;  1VB5 A;  2IXM A;  1TWC A;  2PX3 A;  1VLS A;  1LE4 A;  1OKK D;  1ST6 A;  3AG4 C;  3X2Q C;  2WVQ A;  3DD7 A;  2H7B A;  1XWJ A;  4HE8 D;  1QPU A;  5DLJ A;  1OR2 A;  2Y3B A;  4CSA A;  1H9G A;  3OWT A;  2MWQ A;  5TJ5 E;  2HMZ A;  4ULV A;  2KSF A;  2A6H F;  3JT1 A;  4E7S A;  3ASO C;  2X0C A;  3UNG C;  5BQG A;  1I5N A;  4IAO A;  3EHN A;  3GEI A;  2L7A A;  2BE5 F;  2M64 A;  2LQG A;  3GWL A;  3K1I A;  2VCC A;  5B3S C;  3J06 A;  1A41 A;  1OKK A;  3FOP A;  4MVS A;  1JR8 A;  1ZHT A;  4PK4 A;  1OW6 A;  2A0U A;  4WGY A;  3HNL A;  1AEP A;  3O10 A;  1ZU4 A;  2XS1 A;  2QLA A;  4PFP A;  1CGO A;  1WAT A;  4JRZ A;  4NCQ A;  1M2V A;  4RD9 A;  1WOL A;  3M4B A;  1L7C A;  3Q6N A;  3ZSU A;  5JRA A;  1A7V A;  3EFO A;  2PX0 A;  3GEH A;  1VLT A;  1M2V B;  4YL3 A;  5L0J A;  2XL6 A;  4G7H F;  1GQA A;  1HMD A;  2J7P A;  2J9V A;  3HJC A;  3T9O A;  2P0N A;  2XLW A;  3NMK A;  1O87 A;  3QTH A;  5HSW A;  4N4W A;  1SZI A;  1TFK B;  3LNR A;  3V7O A;  3KKB A;  1BZ4 A;  1A0B A;  2I8B A;  2IM8 A;  2DYR C;  4J30 B;  3EHM A;  4EKW A;  3S84 A;  4PJJ A;  2NSF A;  1VYK A;  3RF3 A;  1JAF A;  2XLD A;  3DZA A;  4F4B A;  4MTO A;  4NC3 A;  2EIJ C;  1MMG A;  2XM4 A;  2RD9 A;  4X0R A;  2EPN A;  4CS9 C;  1J8Y F;  4EBJ A;  1E85 A;  4BJ5 C;  4K1O A;  5KYX B;  3NG1 A;  5E2Q A;  1JPJ A;  2IOQ A;  3S29 A;  1D1C A;  3X1O A;  1OCC C;  4JZA A;  5AC4 A;  1Y4C A;  4IB4 A;  5JLI A;  1Q0D A;  2I15 A;  1BDJ B;  3M79 A;  1MMN A;  4WAB A;  1YYX A;  2XLE A;  5GPG B;  2KC3 A;  5KYU A;  5JUA A;  1N1C A;  3FAP B;  3U8P A;  5B1B C;  1LS4 A;  4O7G A;  1KNY A;  4YN0 B;  5F5H A;  1U0B B;  2ICW G;  5T1D B;  2J9B A;  2J8W A;  3ATP A;  1FFT C;  4BEM J;  1A7D A;  3GM2 A;  4B6I A;  4CJO A;  2CCY A;  1YYJ A;  3I5Q A;  4DRJ B;  5DQZ A;  3OA1 A;  5A6B D;  4U5E E;  2CYD A;  3NYM A;  2WZL A;  2WZF A;  2G3K A;  3MBG A;  4MTG A;  2ZD9 A;  1TQG A;  1TWG A;  4DRI B;  2HZ8 A;  2QNL A;  4EHP A;  4YL0 A;  3EG9 A;  3DAF A;  4LLC A;  2W9Y A;  1YZC A;  3U3B A;  2NUP B;  1K04 A;  3QZC A;  2R7S A;  4NTB A;  3GAN A;  1C17 M;  4PR9 A;  4YWQ A;  1RJ9 A;  2WVN A;  3L34 A;  4U9D A;  1BR4 A;  1NZE A;  3L8I A;  3IQ6 A;  3G50 A;  1T6I A;  1YZA A;  1NFN A;  3RW0 A;  3WG7 C;  4DBR A;  3ZG1 A;  2V3C C;  1APC A;  3AGT A;  3C8G D;  2R9R B;  4NTF A;  2YQY A;  1IW7 F;  2EIM C;  2VCB A;  4IAQ A;  4PJN A;  5L0G A;  1NG1 A;  1WTY A;  1M56 C;  1R5I D;  2KK1 A;  4WJ0 A;  1A7E A;  3IQC A;  1JRA A;  2LP4 A;  3VYW A;  1ZZP A;  3NYJ A;  2EPM X;  5DS5 A;  2QE9 A;  2G3V A;  3IHU A;  2H7V C;  3JYH A;  3I5P A;  1LI5 A;  5JS5 A;  4C3B A;  3TJ6 A;  3DWW A;  3HLZ A;  4QI2 A;  1RKE B;  1YAR O;  4JEA A;  3N24 A;  2ZPA A;  5E3A A;  2UUI A;  4P9F A;  4BG0 A;  4YJW A;  1TWA A;  3AOU A;  1NSG B;  3R7C A;  1FMW A;  2GFH A;  3IQT A;  4LDQ A;  5A69 A;  3CEX A;  5KYW B;  1VTM P;  1FAP B;  4E17 A;  3V5Y A;  3EH2 A;  4XEV A;  4I1O B;  4MVQ A;  4Q5S F;  1CGN A;  3IPM O;  4G78 A;  4U5F E;  4I1M A;  4PJM A;  3O55 A;  2ZXP A;  1EQ1 A;  4HFK B;  3A9C A;  2NSG A;  3GOD A;  2AWC A;  2M4E A;  3SXK A;  4RBN A;  2BC5 A;  1H6G A;  3C7J A;  3O39 A;  4AE4 A;  1HW1 A;  2XS8 A;  2HKV A;  3C63 A;  1DOW A;  2CNW A;  2RSE B;  1YVI A;  2LIG A;  3L8J A;  2J0X A;  4HEA J;  4U5H A;  4BJ6 A;  4GQH A;  4AE4 B;  3Q7L A;  2PNO A;  4Z9I A;  2WB7 A;  2HSB A;  4AX2 A;  2CDQ A;  1E84 A;  5EGY A;  2IXO A;  5IY5 C;  1T6Q A;  4PFO A;  5D91 A;  4ZLC A;  3NRH A;  3UMI A;  4Z9H A;  3GWN A;  1Z6A A;  2Q3T A;  3MYI A;  2JPU A;  1EI7 A;  2FAP B;  1SMY F;  2A0B A;  5E33 A;  3M4C A;  3ZQY A;  1YJG A;  4FES A;  4J7Y A;  1ZVZ A;  2XLM A;  3FVY A;  3KL4 A;  1G4W R;  1H9T A;  2XLO A;  1NBB A;  2QUP A;  4JUR I;  4JE9 A;  2J7P D;  4PAC A;  2AWY A;  3B9Q A;  1LVK A;  5COF A;  1GM5 A;  3LLK A;  3Q6M A;  1J8M F;  3S9O A;  1L3P A;  2PP4 A;  3CZ6 A;  4BPM A;  2FFH A;  4QI0 A;  2HS5 A;  2NPU A;  1JPN A;  5BQH A;  3G4X A;  3B29 A;  4BJT A;  4CIP A;  1OCZ C;  2HV7 A;  3KH2 A;  2MYS A;  4MVM A;  3CSK A;  3ZTZ A;  4K7B A;  3ZVR A;  3F47 A;  1Z5Z A;  5EHH A;  1D1B A;  2PF4 E;  1CGM E;  1HY5 A;  3W8I A;  2LD6 A;  3PHF 2;  2KNH A;  5L0C A;  1HE1 A;  3CQZ A;  4OIQ F;  2HSQ A;  1ORS C;  5COM A;  1UFB A;  4XPX A;  2DGJ A;  2NG1 A;  3NKE A;  3QMK A;  4CJG A;  4LDR A;  5DQT A;  3S27 A;  4P9T A;  2EPK X;  4DJ9 A;  3ABM C;  2QY9 A;  3WOD F;  1MMD A;  3BRJ A;  3ZC4 A;  2GWW A;  2IYL D;  3TOM A;  2ZXW C;  4JW1 A;  3RH3 A;  3W2V A;  2R7R A;  5CI9 A;  2EPO A;  2OEV A;  1ZW3 A;  4IWB A;  1T01 A;  3DE9 A;  3U5S A;  2ZXO A;  5KYX A;  1HMO A;  3NKD A;  3K6B A;  2GA0 A;  2VB6 A;  2YWA A;  4KC9 A;  3MX3 A;  5FCL A;  1OXK A;  1LI7 A;  4MQ9 F;  4NY3 A;  2YKZ A;  3S90 A;  2DB4 A;  1LKX A;  4NQF A;  4G7Z F;  3ZDL A;  3RVZ A;  2KW3 C;  1Z63 A;  2VH3 A;  4JTC B;  1C03 A;  4U9E A;  4XEF A;  4C3E A;  5A6K A;  4U5D E;  4YT2 A;  3SP1 A;  2XLH A;  3B71 A;  4JKV A;  4C3D A;  3MYF A;  3DM5 A;  3K7D A;  4JTD B;  2XXA B;  2L6H A;  3M1C B;  1D0X A;  4CBE A;  5L0H A;  2PBE A;  3LAY A;  4MND A;  5T3W A;  3RKO F;  4BJ1 A;  1QKR A;  4FX5 A;  2BL2 A;  2LFD A;  3LUT B;  3S28 A;  2WVO A;  2XLV A;  5JSL A;  3Q7G A;  5JP7 A;  3LJB A;  3L1M A;  3E70 C;  1VYI A;  2YZS A;  2EPL X;  1I4Z A;  2G62 A;  4JEB A;  2KQ9 A;  3DAG A;  1YLM A;  3S0X A;  2NUP A;  2W4B A;  3JRT A;  2Q9B A;  3ECS A;  4ZLD A;  3JZ0 A;  2Y3D A;  2Y39 A;  4KNW A;  2KJG A;  4L6R A;  3BEH A;  2PFD A;  1OCR C;  3DMD A;  2Y3G A;  4OIN F;  4LLE A;  3DXJ F;  3EGX B;  2H8A A;  4OIO F;  1V54 C;  4WGZ A;  5DS6 A;  4O79 A;  2R7T A;  2P6V A;  5EK0 A;  2A69 F;  3QVZ A;  2LFF A;  3EPV A;  2J0W A;  3PMR A;  4MVO A;  1D0Z A;  4EWC A;  2R25 A;  3GM3 A;  2V26 A;  3NYL A;  4JJF A;  5KYY B;  2UUH A;  1S7Z A;  2XSE A;  2YHS A;  2VCA A;  3V5Z A;  1LIH A;  5E3C A;  3JCU Q;  2YLG A;  1RKE A;  1Q0F A;  4D4N A;  1NFO A;  4FAP B;  3UGO A;  3SXY A;  3LNM B;  1CPQ A;  1AUE A;  4NTA A;  2A6E F;  1QSP A;  2OCC C;  3T6J A;  2O9X A;  2WZG A;  4K0D A;  2CW0 F;  3H65 A;  4Q7C A;  3H2V A;  1G5Z A;  2YLI A;  1NLX A;  1FNT c;  1TFO B;  3PDM P;  2D4U A;  3ZWI A;  5KYW A;  2VC9 A;  1ZHZ A;  2ETS A;  1PD1 A;  2HJ3 A;  1ORJ A;  1PCX A;  2CNW D;  2GDC A;  2J46 A;  4U5B E;  3SYN A;  3UMH A;  2L6F A;  3B0P A;  4O6M A;  1D0Y A;  1OQC A;  4J7T A;  2NUT A;  3SXM A;  5T3T A;  2OOC A;  1VK5 A;  2EIK C;  2YEV A;  3VRC A;  1PD0 A;  2P1A A;  2OJE D;  4ULW A;  1RMV A;  2HJM A;  2NUT B;  2R7X A;  4O6N A;  2ASR A;  2YRF A;  2LCH A;  1KU2 A;  1M6T A;  4U5C E;  2OQM A;  3MLG A;  2WL8 A;  2R7U A;  3ZQV A;  4XQ1 A;  4YT5 A;  1G4U S;  4CS9 A;  3QW1 A;  1OXB A;  4CIH A;  2J9W A;  1C02 A;  256B A;  1GS9 A;  1WGW A;  4BJ5 A;  1IZM A;  4R32 A;  4ER9 A; 
#chains in the Genus database with same CATH homology
 3ZTM A;  5B3I A;  1S05 A;  3ZTZ A;  4IB4 A;  5JLI A;  3M79 A;  1YYX A;  1E86 A;  4EIY A;  2XLE A;  3NMI A;  5JUA A;  3HNI A;  3U8P A;  4CJG A;  2J9B A;  2J8W A;  5AGF A;  4CJO A;  1MQV A;  2CCY A;  1YYJ A;  3IQ5 A;  3TOM A;  3DE9 A;  3M15 A;  2YL7 A;  3HNJ A;  2YKZ A;  1YZC A;  4CIP A;  4CDA A;  4IAR A;  3QVY A;  5JVE A;  3HNK A;  4U9E A;  4U9D A;  3IQ6 A;  1EKY A;  1YZA A;  4CDV A;  2XLH A;  4JKV A;  1E83 A;  2YL0 A;  1APC A;  1LM3 B;  4IAQ A;  1BBH A;  2YLD A;  2XLV A;  5JSL A;  3QW0 A;  5JP7 A;  3L1M A;  3TOL A;  3NMJ A;  5JS5 A;  4JEB A;  4JEA A;  1QPU A;  4CX9 A;  4L6R A;  1RCP A;  3DE8 A;  4ULV A;  1CGN A;  5JT4 A;  4WGZ A;  3C62 A;  3QVZ A;  2YL1 A;  2BC5 A;  3FOP A;  2XL8 A;  4WGY A;  3HNL A;  3C63 A;  2QLA A;  1CGO A;  4D4N A;  2YLG A;  3M4B A;  1CPQ A;  5JRA A;  1A7V A;  1E84 A;  2YLI A;  2XL6 A;  2XM0 A;  1GQA A;  3ZWI A;  2XLW A;  3NMK A;  4N4W A;  4D4X A;  3M4C A;  3ZQY A;  2XLM A;  3VRC A;  2XLO A;  3FOO A;  1NBB A;  4JE9 A;  1JAF A;  2XLD A;  2YL3 A;  1M6T A;  4NC3 A;  2XM4 A;  1E85 A;  3ZQV A;  1CPR A;  3QW1 A;  256B A;  4CDY A;  4N6H A;  1QQ3 A;  4ER9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...