1QPUA

Solution structure of oxidized escherichia coli cytochrome b562
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CYTOCHROME B562
publication title The solution structure of oxidized Escherichia coli cytochrome b562.
pubmed doi rcsb
source organism Escherichia coli
total genus 38
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1999-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1qpuA00
2YLGA 3IQ5A 3M79A 2XM4A 3M4BA 2XL6A 3QVZA 1QPUA 2YKZA 3ZTMA 2XLDA 1QQ3A 4ER9A 3IQ6A 3ZTZA 4CDYA 4L6RA 4EIYA 4ULVA 2YL1A 2CCYA 5JLIA 1EKYA 1YYJA 3TOMA 3DE9A 4IARA 4IAQA 1BBHA 2XL8A 5B3IA 2XLWA 4U9EA 1NBBA 1YZCA 2XM0A 1A7VA 1YYXA 3ZQYA 3ZQVA 3C63A 3L1MA 2XLHA 3NMJA 4U9DA 1GQAA 2QLAA 4D4NA 5JSLA 1E86A 3U8PA 1E85A 3HNKA 1CPQA 4CIPA 3ZWIA 4CJOA 2XLVA 2XLMA 4WGZA 3QW0A 1CGOA 2YL7A 4NC3A 5JT4A 3DE8A 1M6TA 1RCPA 4N4WA 4CDAA 3NMIA 4WGYA 4JE9A 5JVEA 3QW1A 4JEAA 3HNIA 4JEBA 5JS5A 4CDVA 1E84A 5AGFA 1LM3B 3M15A 5JUAA 5JRAA 4IB4A 1APCA 1CGNA 3M4CA 1E83A 2J9BA 3HNJA 2XLOA 4JKVA 2YL3A 3TOLA 3VRCA 4N6HA 2YL0A 1MQVA 1S05A 256BA 2J8WA 2YLIA 3NMKA 1YZAA 4CX9A 1JAFA 3FOPA 2XLEA 4D4XA 3FOOA 4CJGA 2YLDA 5JP7A 2BC5A 3HNLA 3QVYA 3C62A 1CPRA
chains in the Genus database with same CATH superfamily
2YLGA 3GEIA 5B1BC 1OR2A 2WL8A 1PD0A 4O7GA 3S28A 1HMDA 3M79A 4E18A 2XM4A 4Q4ZF 3DWWA 1R5ID 2XL6A 2IXNA 1TWAA 2A69F 3AG3C 3EGDB 2HFIA 3KKBA 1RKEB 4HEAJ 3DKAA 4Z9IA 1JRAA 1ZU4A 4DVZA 2YKZA 2DYRC 3EH2A 3H65A 2AWYA 1FTSA 1SF8A 2R7RA 1MMGA 5K0IA 2QTVA 3N2ZB 3OEOA 4CIHA 1VK5A 4P6IC 1WWPA 2YQYA 1M57C 1ST6A 3IQ6A 5T3WA 5A6KA 4I3MA 4AK9A 2DGJA 2CYDA 4Q7CA 5D91A 2LD6A 1OCRC 1OCCC 2YHSA 2Q7RA 2YL1A 1JPNA 4C3DA 3NDBB 1GS9A 3DZAA 4MVUA 1QLEC 1A7DA 4CS7A 3RF3A 4FESA 3W8IA 4IAQA 5B3SC 1RKEA 3ZSUA 1BDJB 3MBGA 4NTFA 1MMAA 1FMWA 1OXKA 1Y6DA 1ZVZA 2Q9AA 3LEOA 2XL8A 4OINF 4QI2A 4U5GA 5A6AA 3GM3A 2Q9CA 4P9FA 2XLWA 1NBBA 3KMIA 1H9TA 1L7CA 3ABKC 3A11A 4C3EA 2HS5A 2R9RB 3FAJA 2H8AA 2KJGA 2G3KA 3NYMA 3EHMA 2A1DD 5L0GA 3LS1A 2QUPA 4C7OB 1GQAA 3EZHA 2YWAA 4NCQA 2LP4A 3RFYA 4FAPB 2Z15A 1LI5A 2X51A 5L0JA 3FHDA 4D4NA 3H2UA 3LJBA 2L6GA 2M4EA 3AQBA 1PCXA 1RJ9B 2D4UA 3RW0A 3E70C 5A6BA 1K40A 1B68A 1SMYF 3U9JA 2OQMA 3RQFA 3EZIA 3S84A 3PMRA 2W45A 1M56C 2QY9A 4O6NA 4G0HA 4MVSA 3JYYA 2DB4A 1T5OA 4O79A 1TFOB 2XLMA 2OCCC 3EQLF 3PCVA 4WGZA 2AP3A 3E9VA 3MYIA 3K1HA 3L34A 4EUKB 1XWJA 4PJMA 2A0BA 2R7QA 1Y4CA 3K7DA 5DS4A 3ASOC 1YVIA 4WGYA 2ZXRA 4J32B 3QW1A 4U5EE 3X1OA 4C7OA 3LEVA 3AQCA 4YT8A 5E33A 5KYXB 4BEMJ 1M2OA 1NZEA 2OEVA 3DI5A 3UMKA 1Z6AA 1LE2A 4MVOA 2F22A 1T6IA 5FZTA 1ZHYA 1EQ1A 1VYKA 4IB4A 3U2LA 2PFDA 3DM5A 3M4CA 1VYIA 2LCHA 1YARO 4MTFA 4PJLA 3TJ5A 4EBJA 1SZIA 1G4US 3U0CA 2Y3BA 2CW0F 4PK4A 1EA8A 3SYNA 4J7TA 3VRCA 4IWBA 2ZXPA 2XRHA 2GDCA 1AVOB 3GWLA 4U5FE 3RQEA 2JX0A 2J8WA 2YLIA 3W4YA 5KYXA 2JD3A 4GQHA 4XQ1A 1JAFA 5KYUB 1G5ZA 5CI9A 1FFHA 4D4XA 3BEHA 3FOOA 1J8YF 3EG9B 4Z9JA 3NYLA 3CZ6A 3GORA 3UGPA 3J06A 2VH3A 4BEJA 5IY5C 4MS2A 2YLDA 4EKWA 1YDIA 5FCLA 3G50A 1WASA 3GODA 4RD9A 4AL1A 1HE1A 1T01A 1ZZPA 3MYFA 4K1OA 3MLGA 3SXZA 2R7XA 3ZC4A 2RSEB 1C02A 2J45A 2L6FA 3O10A 3O39A 1ORSC 3QVZA 1V55C 1W2WA 2BE5F 1L3PA 1Z63A 4PR9A 2J7PA 3KPHA 4OIRF 1BZ4A 3WHNA 2XL4A 2ICWG 4DBQA 5KYUA 2LQGA 1T6UA 3VYWA 3UMIA 4ER9A 4OIOF 4FX5A 3EG9A 2G3VA 4CBEA 2HKVA 5COGA 3AG4C 1I4YA 5COMA 4QDLA 1OXBA 4JCHA 3RVYA 3SXKA 4CS9C 4KNWA 3X2QC 2EIJC 4JTCB 2R7TA 4JTAB 4EBBA 3S9OA 4AE4A 1RXQA 3U9MA 5BUOA 4JCZA 4JZAA 4JJFA 3C7JA 1Z5ZA 4O6YA 1MNEA 3FMSA 3W2WA 3OWTA 2DI3A 4ULWA 1MMDA 2OKUA 1D0ZA 1JOGA 4YWQA 3G4XA 2J9VA 2PF4E 3K1IA 3EPVA 3RIPA 3POVA 2WZGA 1O87A 1IW7F 5AC5A 5L0HA 3O55A 2XM0A 4H54A 4MVRA 4N06A 1LS4A 2I8BA 1LS1A 5EK0A 2ETSA 2WB7A 3KH2A 3U3FA 5KYNA 1FNTc 3C63A 4U5HA 4DVYP 1LI7A 2J9WA 1OW6A 2XLHA 4YL0A 5F28E 1HE9A 1QKRA 4U9DA 3M1CB 1ZHXA 5E3CA 3LUTB 3N0TA 4IRUA 1VLSA 1KNYA 5BQGA 3VF0A 4DBRA 2GWWA 5JSLA 2KC3A 4W8KA 3B0UX 1WATA 4OD5A 3RYLA 5E2QA 2OG2A 3RQGA 1E85A 1D1BA 3DXJF 3HNKA 2B0JA 3CQZA 4ZLCA 3B0VC 3SP1A 2ZPAA 4BJ6C 4LLCA 5B1AC 4PJJA 5T1DB 3SXYA 2J9UA 4CSAC 3EGDA 3EH1A 3US6A 1G8XA 2WVQA 3C18A 3O6XA 3KL4A 4MTGA 2IBFA 1G4WR 2YRFA 1K04A 3W2VA 4DRHB 5EGYA 2EIMC 3DE8A 1M6TA 3QMKA 4NTAA 3FVYA 2L6HA 4U5BE 4CDAA 2J7PD 4MW8A 4JE9A 5JVEA 3T6GB 3B0PA 4JEAA 4KC9A 3U8VA 3WG7C 4NTBA 4E0IA 3LLKA 3NKDA 5L0FA 1PV3A 4CDVA 1E84A 3V5YA 4QI0A 3I5QA 1U89A 5AGFA 1LM3B 1OR3A 3G4ZA 3M15A 3V5ZA 5JRAA 1OW8A 5KYWB 4UDVA 4RBNA 1APCA 1ORJA 1E83A 2EPLX 1OCZC 2IOQA 1JPJA 1FFTC 3F46A 1EI7A 3FDQA 1H9GA 3UMHA 4Q5SF 3LLIA 3MX3A 2EPOA 3AJMA 4XEVA 3JRMO 1A0BA 3EHNA 3TD7A 3H2VA 1TWGA 4G78A 3RH3A 1V4AA 3S90A 1A41A 3PDMP 1WGWA 1D1AA 4N6HA 1QSPA 2Q9BA 2R05A 2YL0A 5L3VA 5DS5A 2R7VA 3I4UA 3T6JA 4ZLDA 3B9QA 2YVKA 4BJ1A 3HTKC 3GANA 1TKNA 1HW1A 2EINC 2R7UA 1XZPA 5E3AA 2HSBA 4BJ5A 3ITFA 4YT2A 4PACA 3K33A 3DMDA 1K05A 1V74B 1Q0FA 1E2XA 3DD7A 4CJGA 2KQ9A 5KYWA 1RJ9A 3FXHA 1QVXA 3Q7LA 3HNLA 3K6BA 3QVYA 1VLTA 1NU9C 1NU7D 1CPRA 1LE4A 1Q0KA 2J0WA 1O3UA 3IQ5A 4JVSA 3TJ6A 2IM8A 2VCCA 1ZU5A 3ATPA 2KSFA 2DYSC 3LESA 1M2VB 4CS9A 3KYIA 1Z23A 2GFHA 4LLEA 3ZG1A 2WZLA 3OA1A 2P7VA 1FMVA 4YL3A 4JURI 2XXAB 1VMAA 2RD9A 2IXPA 2YZSA 2Y3GA 4RDAA 3RKOF 5CIVA 2PX0A 3IEEA 3NG1A 1DOVA 2W9YA 4DOZA 4HFFB 1HY5A 4MVMA 5L0IA 4YK5A 3SXMA 1CGME 3SEOA 1VB5A 3GEEA 4G7HF 1D0XA 3CAXA 1ZW3A 1NFOA 4CDYA 3DJUB 4L6RA 2HJMA 3BRJA 4EIYA 2P6VA 3ABMC 1I4ZA 2H7VC 1OW7A 3JYHA 2ASRA 2OJED 2PBEA 4IAOA 3U3BA 2CCYA 2OEXA 4I1OB 5KYYA 2L7AA 3TK0A 3IPMO 2OU6A 2Y39A 3L0IA 1YYJA 3EFOB 3IQTA 1YAUO 3TOMA 4PFPA 1VTMP 4IARA 4YL1A 1Q0MA 3K66A 2V3CC 1Q0GA 3WAQA 2KGOA 1LVKA 3A9CA 2Y69C 1FAPB 4BG0A 1D0YA 5F5FA 1QZXA 2NSFA 2IYLD 5B3IA 2NUTB 1WN0A 5TJ5E 3ABLC 2A0UA 2EILC 3R7CA 5DLJA 1A7VA 4KI2A 1WOLA 2J46A 1YYXA 2W4MA 1T9KA 1I5NA 3CEXA 4NY3A 2G62A 2P61A 4U5CE 4XPWA 4XLPF 3JT1A 3LAYA 5F5HA 4N6CA 1E86A 3HLZA 1LPEA 2GA0A 3PHF2 4YJWA 4DRJB 3AG2C 4U5DE 1FR0A 3ASNC 5CI8A 5GPGB 4B6IA 1XZQA 2CNWA 2XSEA 2ZXOA 3ZWIA 4BJTA 2XLVA 1D1CA 3JZ0A 3U5SA 3LS0A 1HW2A 1ORYA 2HSQA 2WZFA 3IHUA 2KNHA 2VCBA 4XTKA 3VM6A 2LFFA 1TFKB 3B29A 4N4WA 3UR3C 3NMIA 4IJJA 2M64A 1YA9A 3U2MA 4G7OF 1YA7O 3F47A 4JEBA 4P9TA 3C8GB 1TR2A 2HUJA 3N24A 1GM5A 1LKXA 2Q3TA 2O9XA 2LFDA 4K0DA 3HJCA 5JUAA 5COFA 1CGNA 1NG1A 3QZCA 3S0XA 1IZMA 1UG7A 4JIOA 1LIHA 2NUPB 2IXMA 4A2NB 5L3QA 2MHRA 3L8JA 2EPMX 2NPUA 2P1AA 1PD1A 2YL3A 1SR2A 2R7SA 3UNGC 3WODF 1NLXA 1U6HA 2C04A 4JRZA 4A4AA 2J0XA 4PJNA 2L81A 3AGTA 4OIQF 1Z7Qc 3Q6NA 1C03A 256BA 4MQ9F 4E7ZA 3DAFA 1YZAA 4EWCA 1AUEA 3C8GA 2XLEA 1NFNA 3AG1C 3B71A 1HMOA 2NSGA 4EBKA 3C8ZA 1Q0DA 4KBLA 3HKKA 4MW3A 1H7IA 4JTDB 4YT4A 4F4BA 3AOUA 2PNOA 3LNMB 5EHHA 4XWJA 3C62A 2R02A 3VAYA 3DAGA 2FGYA 2R03A 4J7YA 2NUPA 4I44A 2OOCA 2VC9A 4ONSA 4AL0A 2WVNA 4E7SA 3GM1A 1VOMA 2Y3DA 3ECSA 3KYJA 3M4BA 1Z3IX 4MVZA 3W8HA 3UGOA 2HMZA 2X0CA 2HZ8A 2R25A 1OKKA 4NQFA 4X0RA 4YT5A 5T3TA 2CNWD 2CGEA 4DXWA 2HJ3A 4JJGA 4Z9HA 5L0CA 1QPUA 4JW1A 3Q6MA 5KYYB 4G7ZF 2HV7A 4C3BA 3T9OA 3ZTMA 1AEPA 1JMWA 1H6GA 2B0HA 2FAPB 2XLDA 2R7OA 4GEHA 1RMVA 1QQ3A 1ZHTA 4CS8C 2JPUA 1ZW2A 3EJNA 4LDKA 4LDRA 1MNDA 1ZYRF 3I5PA 4J30B 4XPYA 4KNVA 4JC7A 2A68F 3ZDLA 3CSKA 3ZTZA 1DOWA 3DM9B 2D5RB 4XPXA 2R7WA 1KU2A 1TQGA 5A69A 3K1IC 5D92A 3TQOA 1JR8A 2LSEA 4ULVA 2VB6A 3NKEA 1T6QA 5JLIA 4I1MA 1EKYA 1YJGA 4MVQA 4EHPA 4OIPF 1ZHZA 4M63A 2Q00A 1MMNA 3DE9A 1KTMA 1A7EA 2AU5A 3V5XA 1BBHA 3GM2A 1NSGB 2EPKX 1OQCA 4WABA 1F1MA 1J8MF 4K7BA 3MFNA 1YZCA 4U9EA 1U0BB 2L9JA 3Q7GA 2XS1A 3QTHA 4XLNF 2KYHA 4XEFA 3ZQYA 1V54C 3ZQVA 2ZXWC 2LIGA 3L1MA 1BR4A 3NMJA 2KW3C 1S7ZA 2HV6A 5DQZA 2VASA 3C8GD 2UUIA 2QLAA 3NRHA 4E0HA 3T4RA 4DJ9A 3U8PA 3LNRA 4MNDA 2CDQA 2C03A 2VCAA 4H4KC 1CPQA 3S27A 1GGQA 3EGXB 1M2VA 1N1CA 3S29A 4CIPA 1WTYA 3JRTA 4LDQA 1BR2A 5A6JA 4CJOA 4E17A 2XS8A 2LK4A 2UUHA 1SYQA 2FFHA 4GYTA 3QW0A 2BL2A 3GEHA 4WJ0A 1CGOA 2XXAA 2QNLA 1R4TA 4OD4A 2YL7A 4NC3A 1OKKD 5JT4A 3V7OA 2HMQA 5DVWA 3JCUQ 4BJ6A 1RCPA 3DJNB 4O6MA 4IGGA 4AX2A 5BQHA 4CSAA 5AC4A 2IXOA 3AGUA 3GWNA 2AVKA 1YLMA 2GAQA 2H7BA 3HNIA 3TULA 2A6EF 1OCOC 1RKCA 4YN0B 1C17M 3R2PA 5JS5A 2TMVP 4R32A 5BQIA 2I15A 2YEVA 4W8PA 4XEKA 1TWCA 1ZHWA 3ZVRA 3SNHA 1UFBA 2V26A 3EGXA 4LERA 5A6BD 2Q4FA 4AE4B 4HFKB 3EFOA 2E87A 2WVOA 2KK1A 2J9BA 3HNJA 2XLOA 2EIKC 3T6BA 5DS6A 2ZD9A 4ANJA 4JKVA 3IQCA 3JSZA 4BJ5C 2NUTA 2MYSA 3TOLA 4HE8D 2P0NA 3NYJA 4PFOA 1O5HA 2QE9A 3RVZA 3ZIBA 2OJQA 4FWVA 2NG1A 1MQVA 1S05A 2W4BA 1BR1A 3NMKA 4DRIB 2H7OA 3SZRA 4CX9A 2A6HF 3FOPA 3L8IA 2PP4A 3FAPB 2MWQA 1TWHA 2EPNA 2PX3A 5L0DA 4MTOA 2AWCA 2Y3HA 5HV9A 4CS8A 5DQTA 4BPMA 5JP7A 5HSWA 2BC5A 3JSEO 4LACB 3JTLO
chains in the Genus database with same CATH topology
2YLGA 3IQ5A 3M79A 2XM4A 3M4BA 2XL6A 3QVZA 1QPUA 2YKZA 3ZTMA 2XLDA 1QQ3A 4ER9A 3IQ6A 3ZTZA 4CDYA 4L6RA 4EIYA 4ULVA 2YL1A 2CCYA 5JLIA 1EKYA 1YYJA 3TOMA 3DE9A 4IARA 4IAQA 1BBHA 2XL8A 5B3IA 2XLWA 4U9EA 1NBBA 1YZCA 2XM0A 1A7VA 1YYXA 3ZQYA 3ZQVA 3C63A 3L1MA 2XLHA 3NMJA 4U9DA 1GQAA 2QLAA 4D4NA 5JSLA 1E86A 3U8PA 1E85A 3HNKA 1CPQA 4CIPA 3ZWIA 4CJOA 2XLVA 2XLMA 4WGZA 3QW0A 1CGOA 2YL7A 4NC3A 5JT4A 3DE8A 1M6TA 1RCPA 4N4WA 4CDAA 3NMIA 4WGYA 4JE9A 5JVEA 3QW1A 4JEAA 3HNIA 4JEBA 5JS5A 4CDVA 1E84A 5AGFA 1LM3B 3M15A 5JUAA 5JRAA 4IB4A 1APCA 1CGNA 3M4CA 1E83A 2J9BA 3HNJA 2XLOA 4JKVA 2YL3A 3TOLA 3VRCA 4N6HA 2YL0A 1MQVA 1S05A 256BA 2J8WA 2YLIA 3NMKA 1YZAA 4CX9A 1JAFA 3FOPA 2XLEA 4D4XA 3FOOA 4CJGA 2YLDA 5JP7A 2BC5A 3HNLA 3QVYA 3C62A 1CPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YLG A;  3IQ5 A;  3M79 A;  2XM4 A;  3M4B A;  2XL6 A;  3QVZ A;  1QPU A;  2YKZ A;  3ZTM A;  2XLD A;  1QQ3 A;  4ER9 A;  3IQ6 A;  3ZTZ A;  4CDY A;  4L6R A;  4EIY A;  4ULV A;  2YL1 A;  2CCY A;  5JLI A;  1EKY A;  1YYJ A;  3TOM A;  3DE9 A;  4IAR A;  4IAQ A;  1BBH A;  2XL8 A;  5B3I A;  2XLW A;  4U9E A;  1NBB A;  1YZC A;  2XM0 A;  1A7V A;  1YYX A;  3ZQY A;  3ZQV A;  3C63 A;  3L1M A;  2XLH A;  3NMJ A;  4U9D A;  1GQA A;  2QLA A;  4D4N A;  5JSL A;  1E86 A;  3U8P A;  1E85 A;  3HNK A;  1CPQ A;  4CIP A;  3ZWI A;  4CJO A;  2XLV A;  2XLM A;  4WGZ A;  3QW0 A;  1CGO A;  2YL7 A;  4NC3 A;  5JT4 A;  3DE8 A;  1M6T A;  1RCP A;  4N4W A;  4CDA A;  3NMI A;  4WGY A;  4JE9 A;  5JVE A;  3QW1 A;  4JEA A;  3HNI A;  4JEB A;  5JS5 A;  4CDV A;  1E84 A;  5AGF A;  1LM3 B;  3M15 A;  5JUA A;  5JRA A;  4IB4 A;  1APC A;  1CGN A;  3M4C A;  1E83 A;  2J9B A;  3HNJ A;  2XLO A;  4JKV A;  2YL3 A;  3TOL A;  3VRC A;  4N6H A;  2YL0 A;  1MQV A;  1S05 A;  256B A;  2J8W A;  2YLI A;  3NMK A;  1YZA A;  4CX9 A;  1JAF A;  3FOP A;  2XLE A;  4D4X A;  3FOO A;  4CJG A;  2YLD A;  5JP7 A;  2BC5 A;  3HNL A;  3QVY A;  3C62 A;  1CPR A; 
#chains in the Genus database with same CATH topology
 2YLG A;  3GEI A;  5B1B C;  1OR2 A;  2WL8 A;  1PD0 A;  4O7G A;  3S28 A;  1HMD A;  3M79 A;  4E18 A;  2XM4 A;  4Q4Z F;  3DWW A;  1R5I D;  2XL6 A;  2IXN A;  1TWA A;  2A69 F;  3AG3 C;  3EGD B;  2HFI A;  3KKB A;  1RKE B;  4HEA J;  3DKA A;  4Z9I A;  1JRA A;  1ZU4 A;  4DVZ A;  2YKZ A;  2DYR C;  3EH2 A;  3H65 A;  2AWY A;  1FTS A;  1SF8 A;  2R7R A;  1MMG A;  5K0I A;  2QTV A;  3N2Z B;  3OEO A;  4CIH A;  1VK5 A;  4P6I C;  1WWP A;  2YQY A;  1M57 C;  1ST6 A;  3IQ6 A;  5T3W A;  5A6K A;  4I3M A;  4AK9 A;  2DGJ A;  2CYD A;  4Q7C A;  5D91 A;  2LD6 A;  1OCR C;  1OCC C;  2YHS A;  2Q7R A;  2YL1 A;  1JPN A;  4C3D A;  3NDB B;  1GS9 A;  3DZA A;  4MVU A;  1QLE C;  1A7D A;  4CS7 A;  3RF3 A;  4FES A;  3W8I A;  4IAQ A;  5B3S C;  1RKE A;  3ZSU A;  1BDJ B;  3MBG A;  4NTF A;  1MMA A;  1FMW A;  1OXK A;  1Y6D A;  1ZVZ A;  2Q9A A;  3LEO A;  2XL8 A;  4OIN F;  4QI2 A;  4U5G A;  5A6A A;  3GM3 A;  2Q9C A;  4P9F A;  2XLW A;  1NBB A;  3KMI A;  1H9T A;  1L7C A;  3ABK C;  3A11 A;  4C3E A;  2HS5 A;  2R9R B;  3FAJ A;  2H8A A;  2KJG A;  2G3K A;  3NYM A;  3EHM A;  2A1D D;  5L0G A;  3LS1 A;  2QUP A;  4C7O B;  1GQA A;  3EZH A;  2YWA A;  4NCQ A;  2LP4 A;  3RFY A;  4FAP B;  2Z15 A;  1LI5 A;  2X51 A;  5L0J A;  3FHD A;  4D4N A;  3H2U A;  3LJB A;  2L6G A;  2M4E A;  3AQB A;  1PCX A;  1RJ9 B;  2D4U A;  3RW0 A;  3E70 C;  5A6B A;  1K40 A;  1B68 A;  1SMY F;  3U9J A;  2OQM A;  3RQF A;  3EZI A;  3S84 A;  3PMR A;  2W45 A;  1M56 C;  2QY9 A;  4O6N A;  4G0H A;  4MVS A;  3JYY A;  2DB4 A;  1T5O A;  4O79 A;  1TFO B;  2XLM A;  2OCC C;  3EQL F;  3PCV A;  4WGZ A;  2AP3 A;  3E9V A;  3MYI A;  3K1H A;  3L34 A;  4EUK B;  1XWJ A;  4PJM A;  2A0B A;  2R7Q A;  1Y4C A;  3K7D A;  5DS4 A;  3ASO C;  1YVI A;  4WGY A;  2ZXR A;  4J32 B;  3QW1 A;  4U5E E;  3X1O A;  4C7O A;  3LEV A;  3AQC A;  4YT8 A;  5E33 A;  5KYX B;  4BEM J;  1M2O A;  1NZE A;  2OEV A;  3DI5 A;  3UMK A;  1Z6A A;  1LE2 A;  4MVO A;  2F22 A;  1T6I A;  5FZT A;  1ZHY A;  1EQ1 A;  1VYK A;  4IB4 A;  3U2L A;  2PFD A;  3DM5 A;  3M4C A;  1VYI A;  2LCH A;  1YAR O;  4MTF A;  4PJL A;  3TJ5 A;  4EBJ A;  1SZI A;  1G4U S;  3U0C A;  2Y3B A;  2CW0 F;  4PK4 A;  1EA8 A;  3SYN A;  4J7T A;  3VRC A;  4IWB A;  2ZXP A;  2XRH A;  2GDC A;  1AVO B;  3GWL A;  4U5F E;  3RQE A;  2JX0 A;  2J8W A;  2YLI A;  3W4Y A;  5KYX A;  2JD3 A;  4GQH A;  4XQ1 A;  1JAF A;  5KYU B;  1G5Z A;  5CI9 A;  1FFH A;  4D4X A;  3BEH A;  3FOO A;  1J8Y F;  3EG9 B;  4Z9J A;  3NYL A;  3CZ6 A;  3GOR A;  3UGP A;  3J06 A;  2VH3 A;  4BEJ A;  5IY5 C;  4MS2 A;  2YLD A;  4EKW A;  1YDI A;  5FCL A;  3G50 A;  1WAS A;  3GOD A;  4RD9 A;  4AL1 A;  1HE1 A;  1T01 A;  1ZZP A;  3MYF A;  4K1O A;  3MLG A;  3SXZ A;  2R7X A;  3ZC4 A;  2RSE B;  1C02 A;  2J45 A;  2L6F A;  3O10 A;  3O39 A;  1ORS C;  3QVZ A;  1V55 C;  1W2W A;  2BE5 F;  1L3P A;  1Z63 A;  4PR9 A;  2J7P A;  3KPH A;  4OIR F;  1BZ4 A;  3WHN A;  2XL4 A;  2ICW G;  4DBQ A;  5KYU A;  2LQG A;  1T6U A;  3VYW A;  3UMI A;  4ER9 A;  4OIO F;  4FX5 A;  3EG9 A;  2G3V A;  4CBE A;  2HKV A;  5COG A;  3AG4 C;  1I4Y A;  5COM A;  4QDL A;  1OXB A;  4JCH A;  3RVY A;  3SXK A;  4CS9 C;  4KNW A;  3X2Q C;  2EIJ C;  4JTC B;  2R7T A;  4JTA B;  4EBB A;  3S9O A;  4AE4 A;  1RXQ A;  3U9M A;  5BUO A;  4JCZ A;  4JZA A;  4JJF A;  3C7J A;  1Z5Z A;  4O6Y A;  1MNE A;  3FMS A;  3W2W A;  3OWT A;  2DI3 A;  4ULW A;  1MMD A;  2OKU A;  1D0Z A;  1JOG A;  4YWQ A;  3G4X A;  2J9V A;  2PF4 E;  3K1I A;  3EPV A;  3RIP A;  3POV A;  2WZG A;  1O87 A;  1IW7 F;  5AC5 A;  5L0H A;  3O55 A;  2XM0 A;  4H54 A;  4MVR A;  4N06 A;  1LS4 A;  2I8B A;  1LS1 A;  5EK0 A;  2ETS A;  2WB7 A;  3KH2 A;  3U3F A;  5KYN A;  1FNT c;  3C63 A;  4U5H A;  4DVY P;  1LI7 A;  2J9W A;  1OW6 A;  2XLH A;  4YL0 A;  5F28 E;  1HE9 A;  1QKR A;  4U9D A;  3M1C B;  1ZHX A;  5E3C A;  3LUT B;  3N0T A;  4IRU A;  1VLS A;  1KNY A;  5BQG A;  3VF0 A;  4DBR A;  2GWW A;  5JSL A;  2KC3 A;  4W8K A;  3B0U X;  1WAT A;  4OD5 A;  3RYL A;  5E2Q A;  2OG2 A;  3RQG A;  1E85 A;  1D1B A;  3DXJ F;  3HNK A;  2B0J A;  3CQZ A;  4ZLC A;  3B0V C;  3SP1 A;  2ZPA A;  4BJ6 C;  4LLC A;  5B1A C;  4PJJ A;  5T1D B;  3SXY A;  2J9U A;  4CSA C;  3EGD A;  3EH1 A;  3US6 A;  1G8X A;  2WVQ A;  3C18 A;  3O6X A;  3KL4 A;  4MTG A;  2IBF A;  1G4W R;  2YRF A;  1K04 A;  3W2V A;  4DRH B;  5EGY A;  2EIM C;  3DE8 A;  1M6T A;  3QMK A;  4NTA A;  3FVY A;  2L6H A;  4U5B E;  4CDA A;  2J7P D;  4MW8 A;  4JE9 A;  5JVE A;  3T6G B;  3B0P A;  4JEA A;  4KC9 A;  3U8V A;  3WG7 C;  4NTB A;  4E0I A;  3LLK A;  3NKD A;  5L0F A;  1PV3 A;  4CDV A;  1E84 A;  3V5Y A;  4QI0 A;  3I5Q A;  1U89 A;  5AGF A;  1LM3 B;  1OR3 A;  3G4Z A;  3M15 A;  3V5Z A;  5JRA A;  1OW8 A;  5KYW B;  4UDV A;  4RBN A;  1APC A;  1ORJ A;  1E83 A;  2EPL X;  1OCZ C;  2IOQ A;  1JPJ A;  1FFT C;  3F46 A;  1EI7 A;  3FDQ A;  1H9G A;  3UMH A;  4Q5S F;  3LLI A;  3MX3 A;  2EPO A;  3AJM A;  4XEV A;  3JRM O;  1A0B A;  3EHN A;  3TD7 A;  3H2V A;  1TWG A;  4G78 A;  3RH3 A;  1V4A A;  3S90 A;  1A41 A;  3PDM P;  1WGW A;  1D1A A;  4N6H A;  1QSP A;  2Q9B A;  2R05 A;  2YL0 A;  5L3V A;  5DS5 A;  2R7V A;  3I4U A;  3T6J A;  4ZLD A;  3B9Q A;  2YVK A;  4BJ1 A;  3HTK C;  3GAN A;  1TKN A;  1HW1 A;  2EIN C;  2R7U A;  1XZP A;  5E3A A;  2HSB A;  4BJ5 A;  3ITF A;  4YT2 A;  4PAC A;  3K33 A;  3DMD A;  1K05 A;  1V74 B;  1Q0F A;  1E2X A;  3DD7 A;  4CJG A;  2KQ9 A;  5KYW A;  1RJ9 A;  3FXH A;  1QVX A;  3Q7L A;  3HNL A;  3K6B A;  3QVY A;  1VLT A;  1NU9 C;  1NU7 D;  1CPR A;  1LE4 A;  1Q0K A;  2J0W A;  1O3U A;  3IQ5 A;  4JVS A;  3TJ6 A;  2IM8 A;  2VCC A;  1ZU5 A;  3ATP A;  2KSF A;  2DYS C;  3LES A;  1M2V B;  4CS9 A;  3KYI A;  1Z23 A;  2GFH A;  4LLE A;  3ZG1 A;  2WZL A;  3OA1 A;  2P7V A;  1FMV A;  4YL3 A;  4JUR I;  2XXA B;  1VMA A;  2RD9 A;  2IXP A;  2YZS A;  2Y3G A;  4RDA A;  3RKO F;  5CIV A;  2PX0 A;  3IEE A;  3NG1 A;  1DOV A;  2W9Y A;  4DOZ A;  4HFF B;  1HY5 A;  4MVM A;  5L0I A;  4YK5 A;  3SXM A;  1CGM E;  3SEO A;  1VB5 A;  3GEE A;  4G7H F;  1D0X A;  3CAX A;  1ZW3 A;  1NFO A;  4CDY A;  3DJU B;  4L6R A;  2HJM A;  3BRJ A;  4EIY A;  2P6V A;  3ABM C;  1I4Z A;  2H7V C;  1OW7 A;  3JYH A;  2ASR A;  2OJE D;  2PBE A;  4IAO A;  3U3B A;  2CCY A;  2OEX A;  4I1O B;  5KYY A;  2L7A A;  3TK0 A;  3IPM O;  2OU6 A;  2Y39 A;  3L0I A;  1YYJ A;  3EFO B;  3IQT A;  1YAU O;  3TOM A;  4PFP A;  1VTM P;  4IAR A;  4YL1 A;  1Q0M A;  3K66 A;  2V3C C;  1Q0G A;  3WAQ A;  2KGO A;  1LVK A;  3A9C A;  2Y69 C;  1FAP B;  4BG0 A;  1D0Y A;  5F5F A;  1QZX A;  2NSF A;  2IYL D;  5B3I A;  2NUT B;  1WN0 A;  5TJ5 E;  3ABL C;  2A0U A;  2EIL C;  3R7C A;  5DLJ A;  1A7V A;  4KI2 A;  1WOL A;  2J46 A;  1YYX A;  2W4M A;  1T9K A;  1I5N A;  3CEX A;  4NY3 A;  2G62 A;  2P61 A;  4U5C E;  4XPW A;  4XLP F;  3JT1 A;  3LAY A;  5F5H A;  4N6C A;  1E86 A;  3HLZ A;  1LPE A;  2GA0 A;  3PHF 2;  4YJW A;  4DRJ B;  3AG2 C;  4U5D E;  1FR0 A;  3ASN C;  5CI8 A;  5GPG B;  4B6I A;  1XZQ A;  2CNW A;  2XSE A;  2ZXO A;  3ZWI A;  4BJT A;  2XLV A;  1D1C A;  3JZ0 A;  3U5S A;  3LS0 A;  1HW2 A;  1ORY A;  2HSQ A;  2WZF A;  3IHU A;  2KNH A;  2VCB A;  4XTK A;  3VM6 A;  2LFF A;  1TFK B;  3B29 A;  4N4W A;  3UR3 C;  3NMI A;  4IJJ A;  2M64 A;  1YA9 A;  3U2M A;  4G7O F;  1YA7 O;  3F47 A;  4JEB A;  4P9T A;  3C8G B;  1TR2 A;  2HUJ A;  3N24 A;  1GM5 A;  1LKX A;  2Q3T A;  2O9X A;  2LFD A;  4K0D A;  3HJC A;  5JUA A;  5COF A;  1CGN A;  1NG1 A;  3QZC A;  3S0X A;  1IZM A;  1UG7 A;  4JIO A;  1LIH A;  2NUP B;  2IXM A;  4A2N B;  5L3Q A;  2MHR A;  3L8J A;  2EPM X;  2NPU A;  2P1A A;  1PD1 A;  2YL3 A;  1SR2 A;  2R7S A;  3UNG C;  3WOD F;  1NLX A;  1U6H A;  2C04 A;  4JRZ A;  4A4A A;  2J0X A;  4PJN A;  2L81 A;  3AGT A;  4OIQ F;  1Z7Q c;  3Q6N A;  1C03 A;  256B A;  4MQ9 F;  4E7Z A;  3DAF A;  1YZA A;  4EWC A;  1AUE A;  3C8G A;  2XLE A;  1NFN A;  3AG1 C;  3B71 A;  1HMO A;  2NSG A;  4EBK A;  3C8Z A;  1Q0D A;  4KBL A;  3HKK A;  4MW3 A;  1H7I A;  4JTD B;  4YT4 A;  4F4B A;  3AOU A;  2PNO A;  3LNM B;  5EHH A;  4XWJ A;  3C62 A;  2R02 A;  3VAY A;  3DAG A;  2FGY A;  2R03 A;  4J7Y A;  2NUP A;  4I44 A;  2OOC A;  2VC9 A;  4ONS A;  4AL0 A;  2WVN A;  4E7S A;  3GM1 A;  1VOM A;  2Y3D A;  3ECS A;  3KYJ A;  3M4B A;  1Z3I X;  4MVZ A;  3W8H A;  3UGO A;  2HMZ A;  2X0C A;  2HZ8 A;  2R25 A;  1OKK A;  4NQF A;  4X0R A;  4YT5 A;  5T3T A;  2CNW D;  2CGE A;  4DXW A;  2HJ3 A;  4JJG A;  4Z9H A;  5L0C A;  1QPU A;  4JW1 A;  3Q6M A;  5KYY B;  4G7Z F;  2HV7 A;  4C3B A;  3T9O A;  3ZTM A;  1AEP A;  1JMW A;  1H6G A;  2B0H A;  2FAP B;  2XLD A;  2R7O A;  4GEH A;  1RMV A;  1QQ3 A;  1ZHT A;  4CS8 C;  2JPU A;  1ZW2 A;  3EJN A;  4LDK A;  4LDR A;  1MND A;  1ZYR F;  3I5P A;  4J30 B;  4XPY A;  4KNV A;  4JC7 A;  2A68 F;  3ZDL A;  3CSK A;  3ZTZ A;  1DOW A;  3DM9 B;  2D5R B;  4XPX A;  2R7W A;  1KU2 A;  1TQG A;  5A69 A;  3K1I C;  5D92 A;  3TQO A;  1JR8 A;  2LSE A;  4ULV A;  2VB6 A;  3NKE A;  1T6Q A;  5JLI A;  4I1M A;  1EKY A;  1YJG A;  4MVQ A;  4EHP A;  4OIP F;  1ZHZ A;  4M63 A;  2Q00 A;  1MMN A;  3DE9 A;  1KTM A;  1A7E A;  2AU5 A;  3V5X A;  1BBH A;  3GM2 A;  1NSG B;  2EPK X;  1OQC A;  4WAB A;  1F1M A;  1J8M F;  4K7B A;  3MFN A;  1YZC A;  4U9E A;  1U0B B;  2L9J A;  3Q7G A;  2XS1 A;  3QTH A;  4XLN F;  2KYH A;  4XEF A;  3ZQY A;  1V54 C;  3ZQV A;  2ZXW C;  2LIG A;  3L1M A;  1BR4 A;  3NMJ A;  2KW3 C;  1S7Z A;  2HV6 A;  5DQZ A;  2VAS A;  3C8G D;  2UUI A;  2QLA A;  3NRH A;  4E0H A;  3T4R A;  4DJ9 A;  3U8P A;  3LNR A;  4MND A;  2CDQ A;  2C03 A;  2VCA A;  4H4K C;  1CPQ A;  3S27 A;  1GGQ A;  3EGX B;  1M2V A;  1N1C A;  3S29 A;  4CIP A;  1WTY A;  3JRT A;  4LDQ A;  1BR2 A;  5A6J A;  4CJO A;  4E17 A;  2XS8 A;  2LK4 A;  2UUH A;  1SYQ A;  2FFH A;  4GYT A;  3QW0 A;  2BL2 A;  3GEH A;  4WJ0 A;  1CGO A;  2XXA A;  2QNL A;  1R4T A;  4OD4 A;  2YL7 A;  4NC3 A;  1OKK D;  5JT4 A;  3V7O A;  2HMQ A;  5DVW A;  3JCU Q;  4BJ6 A;  1RCP A;  3DJN B;  4O6M A;  4IGG A;  4AX2 A;  5BQH A;  4CSA A;  5AC4 A;  2IXO A;  3AGU A;  3GWN A;  2AVK A;  1YLM A;  2GAQ A;  2H7B A;  3HNI A;  3TUL A;  2A6E F;  1OCO C;  1RKC A;  4YN0 B;  1C17 M;  3R2P A;  5JS5 A;  2TMV P;  4R32 A;  5BQI A;  2I15 A;  2YEV A;  4W8P A;  4XEK A;  1TWC A;  1ZHW A;  3ZVR A;  3SNH A;  1UFB A;  2V26 A;  3EGX A;  4LER A;  5A6B D;  2Q4F A;  4AE4 B;  4HFK B;  3EFO A;  2E87 A;  2WVO A;  2KK1 A;  2J9B A;  3HNJ A;  2XLO A;  2EIK C;  3T6B A;  5DS6 A;  2ZD9 A;  4ANJ A;  4JKV A;  3IQC A;  3JSZ A;  4BJ5 C;  2NUT A;  2MYS A;  3TOL A;  4HE8 D;  2P0N A;  3NYJ A;  4PFO A;  1O5H A;  2QE9 A;  3RVZ A;  3ZIB A;  2OJQ A;  4FWV A;  2NG1 A;  1MQV A;  1S05 A;  2W4B A;  1BR1 A;  3NMK A;  4DRI B;  2H7O A;  3SZR A;  4CX9 A;  2A6H F;  3FOP A;  3L8I A;  2PP4 A;  3FAP B;  2MWQ A;  1TWH A;  2EPN A;  2PX3 A;  5L0D A;  4MTO A;  2AWC A;  2Y3H A;  5HV9 A;  4CS8 A;  5DQT A;  4BPM A;  5JP7 A;  5HSW A;  2BC5 A;  3JSE O;  4LAC B;  3JTL O; 
#chains in the Genus database with same CATH homology
 2YLG A;  3IQ5 A;  3M79 A;  2XM4 A;  3M4B A;  2XL6 A;  3QVZ A;  1QPU A;  2YKZ A;  3ZTM A;  2XLD A;  1QQ3 A;  4ER9 A;  3IQ6 A;  3ZTZ A;  4CDY A;  4L6R A;  4EIY A;  4ULV A;  2YL1 A;  2CCY A;  5JLI A;  1EKY A;  1YYJ A;  3TOM A;  3DE9 A;  4IAR A;  4IAQ A;  1BBH A;  2XL8 A;  5B3I A;  2XLW A;  4U9E A;  1NBB A;  1YZC A;  2XM0 A;  1A7V A;  1YYX A;  3ZQY A;  3ZQV A;  3C63 A;  3L1M A;  2XLH A;  3NMJ A;  4U9D A;  1GQA A;  2QLA A;  4D4N A;  5JSL A;  1E86 A;  3U8P A;  1E85 A;  3HNK A;  1CPQ A;  4CIP A;  3ZWI A;  4CJO A;  2XLV A;  2XLM A;  4WGZ A;  3QW0 A;  1CGO A;  2YL7 A;  4NC3 A;  5JT4 A;  3DE8 A;  1M6T A;  1RCP A;  4N4W A;  4CDA A;  3NMI A;  4WGY A;  4JE9 A;  5JVE A;  3QW1 A;  4JEA A;  3HNI A;  4JEB A;  5JS5 A;  4CDV A;  1E84 A;  5AGF A;  1LM3 B;  3M15 A;  5JUA A;  5JRA A;  4IB4 A;  1APC A;  1CGN A;  3M4C A;  1E83 A;  2J9B A;  3HNJ A;  2XLO A;  4JKV A;  2YL3 A;  3TOL A;  3VRC A;  4N6H A;  2YL0 A;  1MQV A;  1S05 A;  256B A;  2J8W A;  2YLI A;  3NMK A;  1YZA A;  4CX9 A;  1JAF A;  3FOP A;  2XLE A;  4D4X A;  3FOO A;  4CJG A;  2YLD A;  5JP7 A;  2BC5 A;  3HNL A;  3QVY A;  3C62 A;  1CPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...