1QPUA

Solution structure of oxidized escherichia coli cytochrome b562
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME B562
publication title The solution structure of oxidized Escherichia coli cytochrome b562.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 38
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1999-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1qpuA00
3ZQVA 1E83A 1QPUA 2YL3A 4U9DA 2YL0A 1CPQA 1E86A 2XL6A 4WGZA 1CGOA 3DE9A 3QW0A 2YLGA 3QW1A 3HNKA 1QQ3A 4N6HA 3IQ5A 1GQAA 5JP7A 3ZQYA 2YLDA 1M6TA 2XLDA 3C62A 2XM0A 5JSLA 1YZAA 3NMIA 3L1MA 2YL7A 1YZCA 2XLHA 1NBBA 4JEBA 1A7VA 1S05A 3QVYA 5AGFA 1EKYA 1LM3B 3C63A 4JEAA 5JLIA 5JUAA 1JAFA 3VRCA 3IQ6A 2YKZA 3M4BA 3M79A 2XL8A 4L6RA 1RCPA 3HNJA 3ZTMA 2CCYA 3HNIA 1CGNA 4CJOA 4CIPA 1BBHA 4ULVA 4CX9A 3M4CA 3U8PA 256BA 3FOOA 2J9BA 4N4WA 3HNLA 4IARA 3M15A 3TOLA 1E84A 5JS5A 1YYXA 3NMKA 1MQVA 5JRAA 1E85A 3FOPA 2YLIA 4D4XA 5JVEA 3ZWIA 2XM4A 4ER9A 2XLVA 1APCA 5B3IA 2XLEA 4WGYA 2YL1A 4U9EA 4D4NA 2BC5A 3NMJA 4JKVA 2QLAA 4IAQA 1CPRA 4EIYA 3DE8A 4CJGA 5JT4A 3ZTZA 2XLWA 4CDVA 4CDAA 4CDYA 2J8WA 2XLMA 1YYJA 4JE9A 2XLOA 4IB4A 3QVZA 3TOMA 4NC3A
chains in the Genus database with same CATH superfamily
3C8GB 5FZTA 4JURI 3RYLA 1QPUA 2R7OA 3PDMP 1T6UA 4KNVA 2R7TA 4I1MA 4B6IA 2XL6A 2H7BA 3EGDB 4Q5SF 1HW2A 1XWJA 5KYYB 2OKUA 3QMKA 3QW0A 4IWBA 4YK5A 3SZRA 4JRZA 3V7OA 2A0BA 1Q0KA 5A69A 4J32B 3SXYA 4YT8A 1D1CA 1M57C 2ZXRA 2L6FA 3I5QA 2QTVA 3IQ5A 5D91A 1VYKA 3ZC4A 2FAPB 1QLEC 5L0JA 4OINF 1SYQA 2GWWA 2OJED 1BR2A 2WVQA 3LLKA 4MW8A 4EWCA 5KYWA 1NLXA 1OXKA 2HJMA 1A41A 4FAPB 3V5YA 2QY9A 1OR2A 2H7VC 2XM0A 3ITFA 3A9CA 1VLTA 1LE2A 3NMIA 3X1OA 3E9VA 4JC7A 4MNDA 4BJ6A 4ANJA 2UUHA 2L7AA 4MVUA 1FFTC 2UUIA 4YT2A 3CEXA 1OW6A 4E17A 1TFKB 1YJGA 3O39A 2W4MA 1OCCC 2A68F 2EIJC 5E2QA 5D92A 2EPNA 2HJ3A 1YDIA 2G62A 5DLJA 1ZHWA 5L0GA 3E70C 2WVNA 2WZGA 3EHMA 5K0IA 1TQGA 4ZLDA 4Q4ZF 1H9TA 2PBEA 2LQGA 3B29A 4U5CE 2OEXA 3ABMC 2E87A 3EH2A 3S0XA 1RCPA 3MFNA 4HE8D 2VCBA 2Q3TA 3VF0A 4G7HF 4C7OB 2CNWD 2LD6A 4QDLA 4WABA 3HNIA 4Z9IA 1VMAA 2XS8A 4H54A 3FMSA 3RQFA 5EGYA 3UNGC 3K1IA 3TD7A 1CGNA 2OEVA 1DOVA 1JOGA 3K33A 4EUKB 4CS9C 1WWPA 4XPWA 1BBHA 2R05A 2BE5F 3LS0A 5F28E 3CSKA 2HFIA 2DB4A 2X0CA 3FDQA 1WATA 3H2UA 3WAQA 1WOLA 2NG1A 2XSEA 4AE4B 3NRHA 3AOUA 4DBQA 1Z63A 1JPNA 3HTKC 4N4WA 4PJLA 4XPYA 4FX5A 4ONSA 4JTDB 4PK4A 3TJ6A 1FR0A 3ZSUA 5L0CA 4IAOA 1LE4A 2ICWG 3S27A 2CGEA 3I4UA 3LNMB 1JPJA 3U5SA 5KYUB 4O6MA 3FOPA 2YLIA 1K04A 2F22A 2KGOA 1RJ9A 1Y4CA 4K7BA 2EINC 4GYTA 3SP1A 3EHNA 5AC4A 2XLVA 1FAPB 1APCA 1RKCA 3S28A 5A6AA 1NU7D 1V74B 2XLEA 2WZLA 1AUEA 4U9EA 2BC5A 2LSEA 4MS2A 1YAUO 2QLAA 4RD9A 4PJNA 2JX0A 4AL0A 3U9JA 2XS1A 4CJGA 2A0UA 3G4ZA 3RH3A 4PFPA 5BQGA 3UMHA 3JRMO 4C3BA 1MNEA 3BRJA 3DKAA 4X0RA 3GM3A 2ZXPA 4AX2A 4CBEA 4CDVA 3OWTA 3EG9B 4G0HA 2A1DD 1O3UA 1D0YA 3SXMA 4YL1A 1G8XA 2MWQA 3JYHA 1G5ZA 4DJ9A 3MYFA 3JT1A 4JE9A 2IOQA 2IXNA 2D5RB 3TOMA 2Q9AA 2VC9A 3C8GD 3VAYA 4NC3A 4PJJA 3W8IA 5DS5A 1MMDA 1RKEB 3K6BA 1PD0A 4IRUA 5B1BC 3T6JA 3LJBA 1AEPA 1ST6A 3RW0A 1T5OA 4WGZA 3SNHA 4ZLCA 1CGOA 1OCOC 2WVOA 1MMAA 3DE9A 4HEAJ 2YLGA 3LEOA 1V54C 1BR1A 5KYWB 1T9KA 2G3VA 3HNKA 1J8MF 3UMKA 5L0HA 4OIQF 3NDBB 1NFNA 1QQ3A 1XZQA 1O5HA 1OCZC 4JIOA 2MYSA 1GQAA 1A0BA 2D4UA 3IHUA 3L8IA 5L0FA 2W9YA 1L7CA 1HY5A 1M6TA 1QVXA 2KW3C 4QI2A 2XLDA 5T1DB 5F5FA 1EI7A 1PV3A 2XXAA 2WL8A 4J7YA 2O9XA 4XEKA 3GEEA 2HSQA 1T6QA 4DBRA 1DOWA 3LS1A 3SXZA 3T9OA 1Q0FA 4OIRF 4BJ5C 1M2VA 4CSAA 1U6HA 4CS8C 3EQLF 3AJMA 3LAYA 1OW8A 4MTGA 4N06A 1HW1A 2VH3A 4HFKB 1C17M 1ZW2A 2A6HF 3EH1A 3U3FA 3UMIA 5A6BD 2R7UA 1A7VA 5HV9A 3FHDA 3GWLA 1V55C 1ZU4A 4NTBA 3HJCA 3OA1A 5EK0A 1LM3B 3C63A 4BJ1A 3KKBA 1ZHYA 1JAFA 1MNDA 2G3KA 2NUTA 2VCAA 1KNYA 2J9WA 2GA0A 3SEOA 3M4BA 4LERA 3NYMA 2VB6A 4IGGA 2XL8A 4L6RA 4LDQA 1ZYRF 3HNJA 4XPXA 4CS9A 4I1OB 4E7ZA 1R5ID 3EZHA 4YT5A 2HMZA 2YRFA 3G50A 2CCYA 1OKKD 1JR8A 1YVIA 4WJ0A 1ZHZA 5BQIA 3DJUB 5COGA 2YEVA 2W4BA 3W2VA 1N1CA 4JCHA 1ORYA 1LI5A 1C03A 2VASA 3BEHA 1H6GA 2MHRA 4CJOA 3DM5A 2LFFA 1HE1A 2HZ8A 2L9JA 2NSGA 3T6BA 3TK0A 3U3BA 4PFOA 4CX9A 5T3TA 4UDVA 2Y69C 3AG3C 1T6IA 256BA 4E18A 3GORA 4DRIB 3UGPA 2J0XA 4OD5A 4E0HA 4AK9A 1RJ9B 1SF8A 4DVZA 3L34A 3M15A 4RBNA 2LIGA 1ZW3A 4Q7CA 3TOLA 4HFFB 1XZPA 1YYXA 1MQVA 3MBGA 1D1BA 3GWNA 2IYLD 4O6NA 3SXKA 3RVYA 1E85A 1SMYF 4U5FE 2KSFA 2AWYA 2RSEB 2PF4E 1Z7Qc 2R25A 1GM5A 2J7PD 3Q7LA 2VCCA 4I44A 1WGWA 4PR9A 1VLSA 2Q7RA 2BL2A 2CW0F 1TWGA 3KMIA 5B3IA 1Q0MA 2XRHA 4MVMA 4WGYA 3ZIBA 4K1OA 3US6A 4D4NA 2J9VA 4C3DA 1RXQA 1G4US 5GPGB 4BEJA 5JT4A 5L0IA 3KPHA 3LESA 2V3CC 3DMDA 4U5BE 4OIOF 4LDKA 4MTOA 3RIPA 4YWQA 2IXPA 5KYXA 3EGDA 4P6IC 1LVKA 2P1AA 2P0NA 5KYYA 1VOMA 2J45A 3GEHA 3EFOB 4P9TA 2OJQA 2J46A 4CSAC 2EILC 2IXMA 1UG7A 1YYJA 2QUPA 1NFOA 1D0ZA 2DGJA 2XLOA 2ZXOA 4G78A 4R32A 2L6GA 3QVZA 2YWAA 3UR3C 4FESA 2PP4A 2Q00A 4JJFA 1E83A 1AVOB 1R4TA 3C8ZA 3K7DA 1MMGA 1ZU5A 4I3MA 4U9DA 4KNWA 2NSFA 2YL0A 1VTMP 1UFBA 1CPQA 3N2ZB 1E86A 1S7ZA 3B71A 3F47A 3CQZA 3W2WA 4YN0B 1QSPA 1Q0GA 4U5GA 3G4XA 2GDCA 5DS6A 3S90A 1ORJA 2GAQA 5DS4A 4MQ9F 4DRHB 2YLDA 4N6CA 4BG0A 1M2VB 2IXOA 2Q9CA 3PMRA 3ECSA 4XQ1A 3DAFA 4MVQA 4BJ5A 1FNTc 4XEFA 4CS8A 3C62A 3OEOA 1YA7O 4XEVA 4CS7A 4AL1A 2P7VA 3ABKC 3VYWA 2TMVP 4YJWA 3LLIA 5JSLA 1YZAA 3L1MA 3CAXA 4KC9A 1YZCA 3TJ5A 2NUTB 3QZCA 1TKNA 4O6YA 3V5ZA 1M56C 3RQGA 3AG2C 4C7OA 3HLZA 5A6KA 1S05A 3DAGA 2ZPAA 2R7QA 3IQTA 2RD9A 3KYIA 3AG1C 1NZEA 3NG1A 5KYNA 3QVYA 3C7JA 1FMVA 1TR2A 3JCUQ 3HKKA 2CDQA 3S29A 2EIMC 1MMNA 3NKDA 5JLIA 2R7SA 1EKYA 1HMOA 1PD1A 4NTAA 4Z9JA 2Y39A 3JSEO 2Z15A 3V5XA 2L6HA 1IZMA 1TWCA 3T6GB 3ZVRA 2A69F 4U5EE 1W2WA 3IQCA 5TJ5E 2ZD9A 2AVKA 3AGUA 3K66A 1G4WR 3IEEA 3U2MA 5DQTA 3S9OA 4YT4A 3MX3A 3RKOF 3O10A 1Z23A 1TWHA 2I15A 3EJNA 3N0TA 4GEHA 3MLGA 1FTSA 2A6EF 5KYXB 5EHHA 1M2OA 4P9FA 5KYUA 2Q4FA 1LS4A 3EGXA 2LP4A 3M4CA 4XWJA 3JSZA 3U8PA 1EA8A 2EPKX 4DVYP 1SR2A 1WTYA 1OW7A 2CNWA 3FOOA 2FGYA 2DYSC 5F5HA 4CIHA 4EKWA 1Q0DA 2KQ9A 1I4YA 2OQMA 3GM1A 3AQCA 3O6XA 1OXBA 4MVOA 3RQEA 3Q6NA 1ZHXA 4XTKA 4H4KC 2C03A 2YQYA 3U9MA 1BZ4A 4A2NB 5JS5A 1I4ZA 3AQBA 1FMWA 2KK1A 4J30B 4W8KA 3WODF 3K1HA 5L0DA 2V26A 1F1MA 3DXJF 4LDRA 3R2PA 4D4XA 1BR4A 5JVEA 2L81A 2R7WA 3ZWIA 4F4BA 2WZFA 3EG9A 3DD7A 1YA9A 3LNRA 3RVZA 5CI8A 1T01A 3N24A 4JTAB 2NUPA 4MVSA 4IJJA 3R7CA 1VB5A 3RF3A 3SYNA 4M63A 4U5HA 3B9QA 1HE9A 3NMJA 2HS5A 3TULA 3T4RA 4ULWA 1Z5ZA 5COMA 4EBKA 1WN0A 3GM2A 4JTCB 1K40A 1NU9C 1GS9A 1CPRA 1RKEA 1LPEA 1VK5A 2J9UA 2X51A 1JMWA 3IPMO 3M1CB 3MYIA 2OG2A 4GQHA 3VM6A 1O87A 4OD4A 2XLWA 5L3VA 4JW1A 1QKRA 4CDAA 2EPMX 3ZG1A 4XLPF 2ASRA 2HUJA 4PJMA 1LIHA 4CDYA 4DRJB 2W45A 4K0DA 2EPOA 3JTLO 3KH2A 1FFHA 2ETSA 2YZSA 2XL4A 3EZIA 4JJGA 1KTMA 1IW7F 3FXHA 1J8YF 2FFHA 1TFOB 3ZQVA 1YLMA 1V4AA 1RMVA 1A7EA 4XLNF 2YL3A 3DZAA 4FWVA 2R03A 1OCRC 3JRTA 3W4YA 1H9GA 1ZHTA 3FVYA 3QTHA 3I5PA 1LI7A 3QW1A 3GANA 4O7GA 2AP3A 2KJGA 3C8GA 3U0CA 3W8HA 1PCXA 2YHSA 4N6HA 2EPLX 4EHPA 3POVA 2R7XA 3H65A 3WG7C 5JP7A 3ABLC 3ZQYA 2WB7A 1U0BB 2IM8A 3EPVA 5DQZA 2I8BA 3JZ0A 3AGTA 2P61A 3DI5A 4QI0A 3WHNA 5A6JA 3PHF2 2B0JA 1Y6DA 2H8AA 2JPUA 3U2LA 3NKEA 2PFDA 2AU5A 4DXWA 3O55A 5E3AA 2HSBA 1WASA 4MVRA 4BJTA 2YL7A 3DM9B 2Q9BA 4EBBA 4O79A 4KI2A 2XLHA 5FCLA 4MW3A 1OR3A 2Y3GA 3TQOA 4A4AA 2PX3A 1NBBA 1NSGB 3U8VA 3UGOA 3FAPB 4JEBA 1Z3IX 4PACA 3B0VC 3L8JA 5CIVA 2KNHA 5COFA 2OOCA 4LACB 4J7TA 5DVWA 4BJ6C 2Y3BA 4U5DE 1K05A 1Z6AA 5AC5A 3A11A 3CZ6A 2XXAB 2P6VA 5AGFA 4JVSA 4E7SA 5BUOA 4JEAA 4NTFA 5JUAA 3H2VA 4EBJA 3VRCA 1A7DA 3IQ6A 4YL0A 4KBLA 2YKZA 3M79A 5T3WA 1QZXA 2HV6A 2CYDA 1HMDA 1ZVZA 1NG1A 1LKXA 2AWCA 2DI3A 2KC3A 2NPUA 2YVKA 4JZAA 5A6BA 5B1AC 3ZTMA 2OCCC 1EQ1A 3EGXB 5E3CA 2Y3DA 1GGQA 3C18A 2EIKC 1LS1A 3LEVA 4LLCA 4MVZA 5BQHA 3F46A 5L3QA 1ZZPA 2J0WA 2R02A 2LCHA 4BPMA 4CIPA 4YL3A 1TWAA 2R9RB 4W8PA 1E2XA 3J06A 1I5NA 3ZDLA 4ULVA 2QE9A 3AG4C 4DOZA 3K1IC 3X2QC 2QNLA 1OKKA 4JCZA 1L3PA 1OQCA 2B0HA 2J9BA 3B0PA 3Q7GA 4OIPF 3HNLA 4IARA 1CGME 1E84A 3NYJA 2NUPB 3LUTB 3NMKA 2LK4A 5JRAA 4AE4A 1D0XA 1KU2A 3ASOC 1D1AA 5B3SC 4G7OF 2PX0A 3ATPA 4E0IA 2H7OA 4NCQA 2XM4A 2R7VA 4MTFA 2DYRC 2GFHA 3PCVA 4NY3A 4ER9A 3EFOA 4C3EA 3FAJA 2HMQA 3KYJA 1BDJB 2IBFA 1U89A 2YL1A 3L0IA 3DWWA 4JKVA 4RDAA 5CI9A 5HSWA 2KYHA 4Z9HA 1SZIA 2ZXWC 2C04A 3S84A 4IAQA 3GEIA 1C02A 3DJNB 3JYYA 3B0UX 1ORSC 1H7IA 2Y3HA 3DE8A 4BEMJ 4EIYA 1B68A 1YARO 3GODA 2LFDA 3RFYA 3ZTZA 2M4EA 1JRAA 2J7PA 2M64A 2R7RA 3ASNC 2PNOA 2JD3A 2J8WA 3NYLA 4LLEA 1VYIA 2HKVA 5IY5C 4G7ZF 2XLMA 2OU6A 2HV7A 5E33A 4IB4A 3KL4A 4NQFA 3Q6MA
chains in the Genus database with same CATH topology
3ZQVA 1E83A 1QPUA 2YL3A 4U9DA 2YL0A 1CPQA 1E86A 2XL6A 4WGZA 1CGOA 3DE9A 3QW0A 2YLGA 3QW1A 3HNKA 1QQ3A 4N6HA 3IQ5A 1GQAA 5JP7A 3ZQYA 2YLDA 1M6TA 2XLDA 3C62A 2XM0A 5JSLA 1YZAA 3NMIA 3L1MA 2YL7A 1YZCA 2XLHA 1NBBA 4JEBA 1A7VA 1S05A 3QVYA 5AGFA 1EKYA 1LM3B 3C63A 4JEAA 5JLIA 5JUAA 1JAFA 3VRCA 3IQ6A 2YKZA 3M4BA 3M79A 2XL8A 4L6RA 1RCPA 3HNJA 3ZTMA 2CCYA 3HNIA 1CGNA 4CJOA 4CIPA 1BBHA 4ULVA 4CX9A 3M4CA 3U8PA 256BA 3FOOA 2J9BA 4N4WA 3HNLA 4IARA 3M15A 3TOLA 1E84A 5JS5A 1YYXA 3NMKA 1MQVA 5JRAA 1E85A 3FOPA 2YLIA 4D4XA 5JVEA 3ZWIA 2XM4A 4ER9A 2XLVA 1APCA 5B3IA 2XLEA 4WGYA 2YL1A 4U9EA 4D4NA 2BC5A 3NMJA 4JKVA 2QLAA 4IAQA 1CPRA 4EIYA 3DE8A 4CJGA 5JT4A 3ZTZA 2XLWA 4CDVA 4CDAA 4CDYA 2J8WA 2XLMA 1YYJA 4JE9A 2XLOA 4IB4A 3QVZA 3TOMA 4NC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZQV A;  1E83 A;  1QPU A;  2YL3 A;  4U9D A;  2YL0 A;  1CPQ A;  1E86 A;  2XL6 A;  4WGZ A;  1CGO A;  3DE9 A;  3QW0 A;  2YLG A;  3QW1 A;  3HNK A;  1QQ3 A;  4N6H A;  3IQ5 A;  1GQA A;  5JP7 A;  3ZQY A;  2YLD A;  1M6T A;  2XLD A;  3C62 A;  2XM0 A;  5JSL A;  1YZA A;  3NMI A;  3L1M A;  2YL7 A;  1YZC A;  2XLH A;  1NBB A;  4JEB A;  1A7V A;  1S05 A;  3QVY A;  5AGF A;  1EKY A;  1LM3 B;  3C63 A;  4JEA A;  5JLI A;  5JUA A;  1JAF A;  3VRC A;  3IQ6 A;  2YKZ A;  3M4B A;  3M79 A;  2XL8 A;  4L6R A;  1RCP A;  3HNJ A;  3ZTM A;  2CCY A;  3HNI A;  1CGN A;  4CJO A;  4CIP A;  1BBH A;  4ULV A;  4CX9 A;  3M4C A;  3U8P A;  256B A;  3FOO A;  2J9B A;  4N4W A;  3HNL A;  4IAR A;  3M15 A;  3TOL A;  1E84 A;  5JS5 A;  1YYX A;  3NMK A;  1MQV A;  5JRA A;  1E85 A;  3FOP A;  2YLI A;  4D4X A;  5JVE A;  3ZWI A;  2XM4 A;  4ER9 A;  2XLV A;  1APC A;  5B3I A;  2XLE A;  4WGY A;  2YL1 A;  4U9E A;  4D4N A;  2BC5 A;  3NMJ A;  4JKV A;  2QLA A;  4IAQ A;  1CPR A;  4EIY A;  3DE8 A;  4CJG A;  5JT4 A;  3ZTZ A;  2XLW A;  4CDV A;  4CDA A;  4CDY A;  2J8W A;  2XLM A;  1YYJ A;  4JE9 A;  2XLO A;  4IB4 A;  3QVZ A;  3TOM A;  4NC3 A; 
#chains in the Genus database with same CATH topology
 3C8G B;  5FZT A;  4JUR I;  3RYL A;  1QPU A;  2R7O A;  3PDM P;  1T6U A;  4KNV A;  2R7T A;  4I1M A;  4B6I A;  2XL6 A;  2H7B A;  3EGD B;  4Q5S F;  1HW2 A;  1XWJ A;  5KYY B;  2OKU A;  3QMK A;  3QW0 A;  4IWB A;  4YK5 A;  3SZR A;  4JRZ A;  3V7O A;  2A0B A;  1Q0K A;  5A69 A;  4J32 B;  3SXY A;  4YT8 A;  1D1C A;  1M57 C;  2ZXR A;  2L6F A;  3I5Q A;  2QTV A;  3IQ5 A;  5D91 A;  1VYK A;  3ZC4 A;  2FAP B;  1QLE C;  5L0J A;  4OIN F;  1SYQ A;  2GWW A;  2OJE D;  1BR2 A;  2WVQ A;  3LLK A;  4MW8 A;  4EWC A;  5KYW A;  1NLX A;  1OXK A;  2HJM A;  1A41 A;  4FAP B;  3V5Y A;  2QY9 A;  1OR2 A;  2H7V C;  2XM0 A;  3ITF A;  3A9C A;  1VLT A;  1LE2 A;  3NMI A;  3X1O A;  3E9V A;  4JC7 A;  4MND A;  4BJ6 A;  4ANJ A;  2UUH A;  2L7A A;  4MVU A;  1FFT C;  2UUI A;  4YT2 A;  3CEX A;  1OW6 A;  4E17 A;  1TFK B;  1YJG A;  3O39 A;  2W4M A;  1OCC C;  2A68 F;  2EIJ C;  5E2Q A;  5D92 A;  2EPN A;  2HJ3 A;  1YDI A;  2G62 A;  5DLJ A;  1ZHW A;  5L0G A;  3E70 C;  2WVN A;  2WZG A;  3EHM A;  5K0I A;  1TQG A;  4ZLD A;  4Q4Z F;  1H9T A;  2PBE A;  2LQG A;  3B29 A;  4U5C E;  2OEX A;  3ABM C;  2E87 A;  3EH2 A;  3S0X A;  1RCP A;  3MFN A;  4HE8 D;  2VCB A;  2Q3T A;  3VF0 A;  4G7H F;  4C7O B;  2CNW D;  2LD6 A;  4QDL A;  4WAB A;  3HNI A;  4Z9I A;  1VMA A;  2XS8 A;  4H54 A;  3FMS A;  3RQF A;  5EGY A;  3UNG C;  3K1I A;  3TD7 A;  1CGN A;  2OEV A;  1DOV A;  1JOG A;  3K33 A;  4EUK B;  4CS9 C;  1WWP A;  4XPW A;  1BBH A;  2R05 A;  2BE5 F;  3LS0 A;  5F28 E;  3CSK A;  2HFI A;  2DB4 A;  2X0C A;  3FDQ A;  1WAT A;  3H2U A;  3WAQ A;  1WOL A;  2NG1 A;  2XSE A;  4AE4 B;  3NRH A;  3AOU A;  4DBQ A;  1Z63 A;  1JPN A;  3HTK C;  4N4W A;  4PJL A;  4XPY A;  4FX5 A;  4ONS A;  4JTD B;  4PK4 A;  3TJ6 A;  1FR0 A;  3ZSU A;  5L0C A;  4IAO A;  1LE4 A;  2ICW G;  3S27 A;  2CGE A;  3I4U A;  3LNM B;  1JPJ A;  3U5S A;  5KYU B;  4O6M A;  3FOP A;  2YLI A;  1K04 A;  2F22 A;  2KGO A;  1RJ9 A;  1Y4C A;  4K7B A;  2EIN C;  4GYT A;  3SP1 A;  3EHN A;  5AC4 A;  2XLV A;  1FAP B;  1APC A;  1RKC A;  3S28 A;  5A6A A;  1NU7 D;  1V74 B;  2XLE A;  2WZL A;  1AUE A;  4U9E A;  2BC5 A;  2LSE A;  4MS2 A;  1YAU O;  2QLA A;  4RD9 A;  4PJN A;  2JX0 A;  4AL0 A;  3U9J A;  2XS1 A;  4CJG A;  2A0U A;  3G4Z A;  3RH3 A;  4PFP A;  5BQG A;  3UMH A;  3JRM O;  4C3B A;  1MNE A;  3BRJ A;  3DKA A;  4X0R A;  3GM3 A;  2ZXP A;  4AX2 A;  4CBE A;  4CDV A;  3OWT A;  3EG9 B;  4G0H A;  2A1D D;  1O3U A;  1D0Y A;  3SXM A;  4YL1 A;  1G8X A;  2MWQ A;  3JYH A;  1G5Z A;  4DJ9 A;  3MYF A;  3JT1 A;  4JE9 A;  2IOQ A;  2IXN A;  2D5R B;  3TOM A;  2Q9A A;  2VC9 A;  3C8G D;  3VAY A;  4NC3 A;  4PJJ A;  3W8I A;  5DS5 A;  1MMD A;  1RKE B;  3K6B A;  1PD0 A;  4IRU A;  5B1B C;  3T6J A;  3LJB A;  1AEP A;  1ST6 A;  3RW0 A;  1T5O A;  4WGZ A;  3SNH A;  4ZLC A;  1CGO A;  1OCO C;  2WVO A;  1MMA A;  3DE9 A;  4HEA J;  2YLG A;  3LEO A;  1V54 C;  1BR1 A;  5KYW B;  1T9K A;  2G3V A;  3HNK A;  1J8M F;  3UMK A;  5L0H A;  4OIQ F;  3NDB B;  1NFN A;  1QQ3 A;  1XZQ A;  1O5H A;  1OCZ C;  4JIO A;  2MYS A;  1GQA A;  1A0B A;  2D4U A;  3IHU A;  3L8I A;  5L0F A;  2W9Y A;  1L7C A;  1HY5 A;  1M6T A;  1QVX A;  2KW3 C;  4QI2 A;  2XLD A;  5T1D B;  5F5F A;  1EI7 A;  1PV3 A;  2XXA A;  2WL8 A;  4J7Y A;  2O9X A;  4XEK A;  3GEE A;  2HSQ A;  1T6Q A;  4DBR A;  1DOW A;  3LS1 A;  3SXZ A;  3T9O A;  1Q0F A;  4OIR F;  4BJ5 C;  1M2V A;  4CSA A;  1U6H A;  4CS8 C;  3EQL F;  3AJM A;  3LAY A;  1OW8 A;  4MTG A;  4N06 A;  1HW1 A;  2VH3 A;  4HFK B;  1C17 M;  1ZW2 A;  2A6H F;  3EH1 A;  3U3F A;  3UMI A;  5A6B D;  2R7U A;  1A7V A;  5HV9 A;  3FHD A;  3GWL A;  1V55 C;  1ZU4 A;  4NTB A;  3HJC A;  3OA1 A;  5EK0 A;  1LM3 B;  3C63 A;  4BJ1 A;  3KKB A;  1ZHY A;  1JAF A;  1MND A;  2G3K A;  2NUT A;  2VCA A;  1KNY A;  2J9W A;  2GA0 A;  3SEO A;  3M4B A;  4LER A;  3NYM A;  2VB6 A;  4IGG A;  2XL8 A;  4L6R A;  4LDQ A;  1ZYR F;  3HNJ A;  4XPX A;  4CS9 A;  4I1O B;  4E7Z A;  1R5I D;  3EZH A;  4YT5 A;  2HMZ A;  2YRF A;  3G50 A;  2CCY A;  1OKK D;  1JR8 A;  1YVI A;  4WJ0 A;  1ZHZ A;  5BQI A;  3DJU B;  5COG A;  2YEV A;  2W4B A;  3W2V A;  1N1C A;  4JCH A;  1ORY A;  1LI5 A;  1C03 A;  2VAS A;  3BEH A;  1H6G A;  2MHR A;  4CJO A;  3DM5 A;  2LFF A;  1HE1 A;  2HZ8 A;  2L9J A;  2NSG A;  3T6B A;  3TK0 A;  3U3B A;  4PFO A;  4CX9 A;  5T3T A;  4UDV A;  2Y69 C;  3AG3 C;  1T6I A;  256B A;  4E18 A;  3GOR A;  4DRI B;  3UGP A;  2J0X A;  4OD5 A;  4E0H A;  4AK9 A;  1RJ9 B;  1SF8 A;  4DVZ A;  3L34 A;  3M15 A;  4RBN A;  2LIG A;  1ZW3 A;  4Q7C A;  3TOL A;  4HFF B;  1XZP A;  1YYX A;  1MQV A;  3MBG A;  1D1B A;  3GWN A;  2IYL D;  4O6N A;  3SXK A;  3RVY A;  1E85 A;  1SMY F;  4U5F E;  2KSF A;  2AWY A;  2RSE B;  2PF4 E;  1Z7Q c;  2R25 A;  1GM5 A;  2J7P D;  3Q7L A;  2VCC A;  4I44 A;  1WGW A;  4PR9 A;  1VLS A;  2Q7R A;  2BL2 A;  2CW0 F;  1TWG A;  3KMI A;  5B3I A;  1Q0M A;  2XRH A;  4MVM A;  4WGY A;  3ZIB A;  4K1O A;  3US6 A;  4D4N A;  2J9V A;  4C3D A;  1RXQ A;  1G4U S;  5GPG B;  4BEJ A;  5JT4 A;  5L0I A;  3KPH A;  3LES A;  2V3C C;  3DMD A;  4U5B E;  4OIO F;  4LDK A;  4MTO A;  3RIP A;  4YWQ A;  2IXP A;  5KYX A;  3EGD A;  4P6I C;  1LVK A;  2P1A A;  2P0N A;  5KYY A;  1VOM A;  2J45 A;  3GEH A;  3EFO B;  4P9T A;  2OJQ A;  2J46 A;  4CSA C;  2EIL C;  2IXM A;  1UG7 A;  1YYJ A;  2QUP A;  1NFO A;  1D0Z A;  2DGJ A;  2XLO A;  2ZXO A;  4G78 A;  4R32 A;  2L6G A;  3QVZ A;  2YWA A;  3UR3 C;  4FES A;  2PP4 A;  2Q00 A;  4JJF A;  1E83 A;  1AVO B;  1R4T A;  3C8Z A;  3K7D A;  1MMG A;  1ZU5 A;  4I3M A;  4U9D A;  4KNW A;  2NSF A;  2YL0 A;  1VTM P;  1UFB A;  1CPQ A;  3N2Z B;  1E86 A;  1S7Z A;  3B71 A;  3F47 A;  3CQZ A;  3W2W A;  4YN0 B;  1QSP A;  1Q0G A;  4U5G A;  3G4X A;  2GDC A;  5DS6 A;  3S90 A;  1ORJ A;  2GAQ A;  5DS4 A;  4MQ9 F;  4DRH B;  2YLD A;  4N6C A;  4BG0 A;  1M2V B;  2IXO A;  2Q9C A;  3PMR A;  3ECS A;  4XQ1 A;  3DAF A;  4MVQ A;  4BJ5 A;  1FNT c;  4XEF A;  4CS8 A;  3C62 A;  3OEO A;  1YA7 O;  4XEV A;  4CS7 A;  4AL1 A;  2P7V A;  3ABK C;  3VYW A;  2TMV P;  4YJW A;  3LLI A;  5JSL A;  1YZA A;  3L1M A;  3CAX A;  4KC9 A;  1YZC A;  3TJ5 A;  2NUT B;  3QZC A;  1TKN A;  4O6Y A;  3V5Z A;  1M56 C;  3RQG A;  3AG2 C;  4C7O A;  3HLZ A;  5A6K A;  1S05 A;  3DAG A;  2ZPA A;  2R7Q A;  3IQT A;  2RD9 A;  3KYI A;  3AG1 C;  1NZE A;  3NG1 A;  5KYN A;  3QVY A;  3C7J A;  1FMV A;  1TR2 A;  3JCU Q;  3HKK A;  2CDQ A;  3S29 A;  2EIM C;  1MMN A;  3NKD A;  5JLI A;  2R7S A;  1EKY A;  1HMO A;  1PD1 A;  4NTA A;  4Z9J A;  2Y39 A;  3JSE O;  2Z15 A;  3V5X A;  2L6H A;  1IZM A;  1TWC A;  3T6G B;  3ZVR A;  2A69 F;  4U5E E;  1W2W A;  3IQC A;  5TJ5 E;  2ZD9 A;  2AVK A;  3AGU A;  3K66 A;  1G4W R;  3IEE A;  3U2M A;  5DQT A;  3S9O A;  4YT4 A;  3MX3 A;  3RKO F;  3O10 A;  1Z23 A;  1TWH A;  2I15 A;  3EJN A;  3N0T A;  4GEH A;  3MLG A;  1FTS A;  2A6E F;  5KYX B;  5EHH A;  1M2O A;  4P9F A;  5KYU A;  2Q4F A;  1LS4 A;  3EGX A;  2LP4 A;  3M4C A;  4XWJ A;  3JSZ A;  3U8P A;  1EA8 A;  2EPK X;  4DVY P;  1SR2 A;  1WTY A;  1OW7 A;  2CNW A;  3FOO A;  2FGY A;  2DYS C;  5F5H A;  4CIH A;  4EKW A;  1Q0D A;  2KQ9 A;  1I4Y A;  2OQM A;  3GM1 A;  3AQC A;  3O6X A;  1OXB A;  4MVO A;  3RQE A;  3Q6N A;  1ZHX A;  4XTK A;  4H4K C;  2C03 A;  2YQY A;  3U9M A;  1BZ4 A;  4A2N B;  5JS5 A;  1I4Z A;  3AQB A;  1FMW A;  2KK1 A;  4J30 B;  4W8K A;  3WOD F;  3K1H A;  5L0D A;  2V26 A;  1F1M A;  3DXJ F;  4LDR A;  3R2P A;  4D4X A;  1BR4 A;  5JVE A;  2L81 A;  2R7W A;  3ZWI A;  4F4B A;  2WZF A;  3EG9 A;  3DD7 A;  1YA9 A;  3LNR A;  3RVZ A;  5CI8 A;  1T01 A;  3N24 A;  4JTA B;  2NUP A;  4MVS A;  4IJJ A;  3R7C A;  1VB5 A;  3RF3 A;  3SYN A;  4M63 A;  4U5H A;  3B9Q A;  1HE9 A;  3NMJ A;  2HS5 A;  3TUL A;  3T4R A;  4ULW A;  1Z5Z A;  5COM A;  4EBK A;  1WN0 A;  3GM2 A;  4JTC B;  1K40 A;  1NU9 C;  1GS9 A;  1CPR A;  1RKE A;  1LPE A;  1VK5 A;  2J9U A;  2X51 A;  1JMW A;  3IPM O;  3M1C B;  3MYI A;  2OG2 A;  4GQH A;  3VM6 A;  1O87 A;  4OD4 A;  2XLW A;  5L3V A;  4JW1 A;  1QKR A;  4CDA A;  2EPM X;  3ZG1 A;  4XLP F;  2ASR A;  2HUJ A;  4PJM A;  1LIH A;  4CDY A;  4DRJ B;  2W45 A;  4K0D A;  2EPO A;  3JTL O;  3KH2 A;  1FFH A;  2ETS A;  2YZS A;  2XL4 A;  3EZI A;  4JJG A;  1KTM A;  1IW7 F;  3FXH A;  1J8Y F;  2FFH A;  1TFO B;  3ZQV A;  1YLM A;  1V4A A;  1RMV A;  1A7E A;  4XLN F;  2YL3 A;  3DZA A;  4FWV A;  2R03 A;  1OCR C;  3JRT A;  3W4Y A;  1H9G A;  1ZHT A;  3FVY A;  3QTH A;  3I5P A;  1LI7 A;  3QW1 A;  3GAN A;  4O7G A;  2AP3 A;  2KJG A;  3C8G A;  3U0C A;  3W8H A;  1PCX A;  2YHS A;  4N6H A;  2EPL X;  4EHP A;  3POV A;  2R7X A;  3H65 A;  3WG7 C;  5JP7 A;  3ABL C;  3ZQY A;  2WB7 A;  1U0B B;  2IM8 A;  3EPV A;  5DQZ A;  2I8B A;  3JZ0 A;  3AGT A;  2P61 A;  3DI5 A;  4QI0 A;  3WHN A;  5A6J A;  3PHF 2;  2B0J A;  1Y6D A;  2H8A A;  2JPU A;  3U2L A;  3NKE A;  2PFD A;  2AU5 A;  4DXW A;  3O55 A;  5E3A A;  2HSB A;  1WAS A;  4MVR A;  4BJT A;  2YL7 A;  3DM9 B;  2Q9B A;  4EBB A;  4O79 A;  4KI2 A;  2XLH A;  5FCL A;  4MW3 A;  1OR3 A;  2Y3G A;  3TQO A;  4A4A A;  2PX3 A;  1NBB A;  1NSG B;  3U8V A;  3UGO A;  3FAP B;  4JEB A;  1Z3I X;  4PAC A;  3B0V C;  3L8J A;  5CIV A;  2KNH A;  5COF A;  2OOC A;  4LAC B;  4J7T A;  5DVW A;  4BJ6 C;  2Y3B A;  4U5D E;  1K05 A;  1Z6A A;  5AC5 A;  3A11 A;  3CZ6 A;  2XXA B;  2P6V A;  5AGF A;  4JVS A;  4E7S A;  5BUO A;  4JEA A;  4NTF A;  5JUA A;  3H2V A;  4EBJ A;  3VRC A;  1A7D A;  3IQ6 A;  4YL0 A;  4KBL A;  2YKZ A;  3M79 A;  5T3W A;  1QZX A;  2HV6 A;  2CYD A;  1HMD A;  1ZVZ A;  1NG1 A;  1LKX A;  2AWC A;  2DI3 A;  2KC3 A;  2NPU A;  2YVK A;  4JZA A;  5A6B A;  5B1A C;  3ZTM A;  2OCC C;  1EQ1 A;  3EGX B;  5E3C A;  2Y3D A;  1GGQ A;  3C18 A;  2EIK C;  1LS1 A;  3LEV A;  4LLC A;  4MVZ A;  5BQH A;  3F46 A;  5L3Q A;  1ZZP A;  2J0W A;  2R02 A;  2LCH A;  4BPM A;  4CIP A;  4YL3 A;  1TWA A;  2R9R B;  4W8P A;  1E2X A;  3J06 A;  1I5N A;  3ZDL A;  4ULV A;  2QE9 A;  3AG4 C;  4DOZ A;  3K1I C;  3X2Q C;  2QNL A;  1OKK A;  4JCZ A;  1L3P A;  1OQC A;  2B0H A;  2J9B A;  3B0P A;  3Q7G A;  4OIP F;  3HNL A;  4IAR A;  1CGM E;  1E84 A;  3NYJ A;  2NUP B;  3LUT B;  3NMK A;  2LK4 A;  5JRA A;  4AE4 A;  1D0X A;  1KU2 A;  3ASO C;  1D1A A;  5B3S C;  4G7O F;  2PX0 A;  3ATP A;  4E0I A;  2H7O A;  4NCQ A;  2XM4 A;  2R7V A;  4MTF A;  2DYR C;  2GFH A;  3PCV A;  4NY3 A;  4ER9 A;  3EFO A;  4C3E A;  3FAJ A;  2HMQ A;  3KYJ A;  1BDJ B;  2IBF A;  1U89 A;  2YL1 A;  3L0I A;  3DWW A;  4JKV A;  4RDA A;  5CI9 A;  5HSW A;  2KYH A;  4Z9H A;  1SZI A;  2ZXW C;  2C04 A;  3S84 A;  4IAQ A;  3GEI A;  1C02 A;  3DJN B;  3JYY A;  3B0U X;  1ORS C;  1H7I A;  2Y3H A;  3DE8 A;  4BEM J;  4EIY A;  1B68 A;  1YAR O;  3GOD A;  2LFD A;  3RFY A;  3ZTZ A;  2M4E A;  1JRA A;  2J7P A;  2M64 A;  2R7R A;  3ASN C;  2PNO A;  2JD3 A;  2J8W A;  3NYL A;  4LLE A;  1VYI A;  2HKV A;  5IY5 C;  4G7Z F;  2XLM A;  2OU6 A;  2HV7 A;  5E33 A;  4IB4 A;  3KL4 A;  4NQF A;  3Q6M A; 
#chains in the Genus database with same CATH homology
 3ZQV A;  1E83 A;  1QPU A;  2YL3 A;  4U9D A;  2YL0 A;  1CPQ A;  1E86 A;  2XL6 A;  4WGZ A;  1CGO A;  3DE9 A;  3QW0 A;  2YLG A;  3QW1 A;  3HNK A;  1QQ3 A;  4N6H A;  3IQ5 A;  1GQA A;  5JP7 A;  3ZQY A;  2YLD A;  1M6T A;  2XLD A;  3C62 A;  2XM0 A;  5JSL A;  1YZA A;  3NMI A;  3L1M A;  2YL7 A;  1YZC A;  2XLH A;  1NBB A;  4JEB A;  1A7V A;  1S05 A;  3QVY A;  5AGF A;  1EKY A;  1LM3 B;  3C63 A;  4JEA A;  5JLI A;  5JUA A;  1JAF A;  3VRC A;  3IQ6 A;  2YKZ A;  3M4B A;  3M79 A;  2XL8 A;  4L6R A;  1RCP A;  3HNJ A;  3ZTM A;  2CCY A;  3HNI A;  1CGN A;  4CJO A;  4CIP A;  1BBH A;  4ULV A;  4CX9 A;  3M4C A;  3U8P A;  256B A;  3FOO A;  2J9B A;  4N4W A;  3HNL A;  4IAR A;  3M15 A;  3TOL A;  1E84 A;  5JS5 A;  1YYX A;  3NMK A;  1MQV A;  5JRA A;  1E85 A;  3FOP A;  2YLI A;  4D4X A;  5JVE A;  3ZWI A;  2XM4 A;  4ER9 A;  2XLV A;  1APC A;  5B3I A;  2XLE A;  4WGY A;  2YL1 A;  4U9E A;  4D4N A;  2BC5 A;  3NMJ A;  4JKV A;  2QLA A;  4IAQ A;  1CPR A;  4EIY A;  3DE8 A;  4CJG A;  5JT4 A;  3ZTZ A;  2XLW A;  4CDV A;  4CDA A;  4CDY A;  2J8W A;  2XLM A;  1YYJ A;  4JE9 A;  2XLO A;  4IB4 A;  3QVZ A;  3TOM A;  4NC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...