4HFFB

Crystal structure of the type vi effector-immunity complex tae4-tai4 from salmonella typhimurium
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
100
structure length
100
Chain Sequence
EALTTQYSQSELLKNWALSHCLALVYKDDVVKNDARATASAYLEYGKQSVEIYHEIDEIAKKYSGLKYNGSISSDFNTMKCIDFIHDRELNELIKRRVEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Putative cytoplasmic protein
publication title Structure of the type VI effector-immunity complex (Tae4-Tai4) provides novel insights into the inhibition mechanism of the effector by its immunity protein
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 35
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16695 Tai4 Type VI secretion system (T6SS), amidase immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1620 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4hffB00
4AX2A 4J30B 4HFKB 4B6IA 4JURI 4HFFB 4J32B 3ZIBA
chains in the Genus database with same CATH superfamily
1JOGA 1K40A 1FFTC 2P1AA 5JSLA 2QY9A 1Q0KA 2OJQA 3QZCA 5CI9A 4BG0A 3TULA 1D1CA 4ER9A 2IYLD 2L9JA 5B3SC 4RBNA 1D0XA 2XLOA 5JLIA 1VYIA 2G3KA 5T1DB 3WODF 1RXQA 2GWWA 1C17M 2YLDA 2H8AA 4FX5A 3M1CB 3HKKA 4J32B 3L1MA 2XLWA 2KYHA 1A41A 1M57C 2A69F 2HSBA 2L6GA 2G62A 2WB7A 5B3IA 5L3QA 1RJ9A 2CNWD 1G4WR 1XZPA 3E9VA 4O79A 4JURI 4PJJA 4EBJA 1PCXA 2I15A 4JTAB 3G4ZA 1RCPA 1YLMA 3EFOA 2NUTB 1QZXA 3C7JA 4JE9A 2P61A 1RKCA 5E2QA 3E70C 5HSWA 3B9QA 4OD5A 4J30B 3K1HA 4PK4A 3DE8A 3LUTB 3NYLA 4GYTA 3RH3A 2MHRA 3M79A 5EK0A 4BPMA 4QI0A 2VCCA 3DXJF 4IWBA 3V5ZA 4PJNA 1V55C 4EUKB 4E18A 5KYUA 3KYIA 3GWNA 3GEHA 2J8WA 3RYLA 5L0CA 4I44A 1QKRA 1PD1A 1A7EA 4NCQA 3U2MA 4K0DA 4LDQA 2B0JA 3EGDA 2DI3A 1YA7O 3K7DA 1WTYA 3NKDA 4JTDB 4KNWA 4XEVA 1M56C 4E7ZA 4CIPA 3S27A 3HJCA 1LPEA 4MW8A 3C8GB 1S05A 3GM2A 4XQ1A 3LEVA 4NY3A 5E33A 2M64A 2NUPA 4O7GA 4E0IA 2XS8A 2B0HA 1WOLA 4GEHA 1N1CA 1D0ZA 1JRAA 1K04A 1I4ZA 2A6EF 4G7OF 3VF0A 3BRJA 4BJ5A 2R7VA 2PBEA 1QPUA 3EQLF 3FOPA 3GEIA 3NYMA 4I3MA 3K6BA 1OR3A 2WZLA 1HW1A 4MVSA 1TR2A 3GM3A 1QLEC 1RMVA 4OINF 1SF8A 4CBEA 2EPOA 3ABLC 3AQCA 1WATA 2IXNA 1W2WA 2W45A 3NRHA 4FWVA 2R7TA 3K33A 1ZHTA 5EGYA 1S7ZA 1G5ZA 1E85A 1OCZC 2QUPA 3LJBA 4IAOA 2J9BA 2HMZA 4YN0B 4BJ6C 2BC5A 4LLEA 2QE9A 4CX9A 4YT2A 4C3EA 1V74B 3B0VC 4L6RA 3JYHA 1I5NA 1ORJA 1ZVZA 2IOQA 2OOCA 3L0IA 4JEBA 5DS4A 1JAFA 2EIKC 3Q7LA 3GANA 4JCHA 3TD7A 1QVXA 1MMDA 1J8YF 2YLGA 4O6NA 4HFKB 4K7BA 2EPMX 4JTCB 3CZ6A 1Z3IX 3WHNA 3ZVRA 3S90A 4CSAC 4I1OB 3M4BA 2P7VA 5CI8A 3H2UA 2LFFA 2ICWG 4WABA 1ZHWA 2R9RB 3U0CA 3ZG1A 2XRHA 4KNVA 5KYYA 1M6TA 2IXPA 2J9WA 4P9FA 3DJNB 1YA9A 2QLAA 4JC7A 3FAPB 2W9YA 5AGFA 1YAUO 2Y69C 3EGXB 3CEXA 4HFFB 5BQIA 4D4XA 2HFIA 1APCA 1I4YA 2W4BA 5COMA 2WZGA 1LVKA 3EG9B 2AU5A 2X51A 2A6HF 3GM1A 5A69A 2Q7RA 2YLIA 2YVKA 3O10A 4U5HA 3MFNA 4YT8A 1MQVA 2HV7A 5BQHA 3PDMP 2JD3A 2PP4A 2YQYA 4YT5A 1NZEA 3RQFA 2Q00A 3ZC4A 1HMOA 3ZTZA 4U9DA 4MVZA 4CS9A 2UUIA 1OW8A 3H65A 4MVUA 2ZD9A 3PCVA 3IEEA 1FR0A 3AGTA 4OD4A 4WJ0A 5KYNA 4P6IC 3T9OA 1LKXA 4DVZA 4C7OA 3UMHA 4NTAA 3DWWA 2A0BA 4EIYA 4JEAA 1TWHA 3LAYA 2H7OA 3LLKA 1EA8A 2FAPB 2ZXWC 4KBLA 3W8HA 4IARA 1T6UA 1BDJB 1RKEB 2OEXA 5AC4A 1R4TA 2HS5A 3JCUQ 3TOMA 5A6JA 5GPGB 1T5OA 4N6CA 1WWPA 3CSKA 4MW3A 3U3FA 2HUJA 1C03A 3AGUA 4MTOA 2ZXOA 1YZAA 3MYIA 4K1OA 2NSGA 2J45A 5KYWB 2C03A 2LSEA 4GQHA 4PR9A 4AE4A 3CAXA 5T3TA 4BEJA 2LP4A 2YL1A 1YARO 3AJMA 4KI2A 3V5XA 2OJED 2OQMA 2XLMA 3DM9B 3FHDA 1GGQA 3G50A 3KH2A 4NC3A 3SXKA 1TFOB 2PX3A 1PV3A 1NFNA 4MVRA 3DD7A 4LLCA 4CJGA 1PD0A 3O6XA 3I5PA 3SEOA 4UDVA 2IXOA 2XLEA 2C04A 1VTMP 1IW7F 3IPMO 4IGGA 3EFOB 3ASOC 2XLDA 3BEHA 3W4YA 4BJ5C 3UGOA 3FAJA 3S28A 1HY5A 1VOMA 3JTLO 2Y3BA 2DYSC 4PACA 2JPUA 2PF4E 3H2VA 5B1BC 2ZXRA 4YWQA 1M2VA 3J06A 2XL4A 1G8XA 2XXAB 2IM8A 1GS9A 2IXMA 3HLZA 4G0HA 2Q4FA 4ANJA 4I1MA 3EJNA 1BR1A 2R7SA 5KYUB 1T01A 4HEAJ 4B6IA 2M4EA 1SZIA 2KC3A 2G3VA 4EHPA 2BE5F 3MYFA 3HNLA 4XPWA 4M63A 2OEVA 4NTFA 4WGYA 3EGDB 5COFA 3IQ6A 3N0TA 4E17A 2V3CC 4IAQA 1LM3B 3C8ZA 2L81A 1VB5A 3GWLA 1TWCA 3T6GB 3V5YA 4MNDA 4QDLA 3T6JA 4XEFA 1AVOB 2Q9BA 4LACB 1D1BA 2FFHA 5A6BA 5JS5A 1M2OA 1H9TA 2R7UA 3JRTA 3S9OA 2R7XA 2O9XA 2AWYA 4W8KA 3U2LA 4FESA 1ZW2A 1XWJA 2NUTA 1A7VA 3B0UX 1G4US 4KC9A 5L3VA 4Z9JA 3UNGC 3FXHA 5L0FA 3UR3C 2FGYA 2QNLA 3TK0A 4MQ9F 4WGZA 3UGPA 3B0PA 4J7YA 1OCRC 5F5HA 3U3BA 3K1IA 3LEOA 2LD6A 4DRIB 3QW0A 3WG7C 5DLJA 3HNKA 5A6BD 3EZIA 1OCOC 2YWAA 3DI5A 2HSQA 1L3PA 2EIMC 2WL8A 3NYJA 1SR2A 3W8IA 3KL4A 2KQ9A 2HV6A 4CS9C 2Q9AA 3FDQA 2MYSA 2OU6A 1H9GA 2J9VA 2PNOA 3LNRA 3M4CA 1O87A 3U8PA 1OCCC 2J7PA 3PMRA 4XPYA 4CS7A 4ULVA 3C8GA 3ZDLA 5L0JA 4C3BA 4D4NA 4JZAA 3R7CA 2VH3A 3T4RA 3X2QC 3QW1A 3SXMA 3KYJA 2EPKX 3W2VA 5DQTA 5CIVA 2Q9CA 2QTVA 1ZHYA 3MBGA 1KNYA 3I5QA 1Y6DA 1NU7D 1NLXA 3QVZA 4U5CE 1YVIA 1F1MA 1YJGA 4XWJA 4Q7CA 4YJWA 3M15A 3ZQYA 4PFPA 2R7RA 4Q5SF 4YL0A 2J7PD 5L0HA 3B29A 1EI7A 3C8GD 2XLHA 3VM6A 3RKOF 2KW3C 3POVA 4QI2A 1AUEA 1SYQA 4XLPF 1ZHXA 2ZXPA 2NSFA 4JRZA 1IZMA 2R05A 2VCAA 3LS0A 4DBQA 3OEOA 3FMSA 4EBBA 5COGA 1OKKA 3PHF2 4EKWA 3R2PA 3VRCA 5L0GA 2J46A 2L7AA 3JSZA 4PJMA 3RF3A 5A6KA 2XL8A 3U8VA 4OIPF 1B68A 2J0WA 4XPXA 4DRHB 3DJUB 3Q6NA 4AL1A 4ZLDA 1L7CA 4AK9A 4JW1A 2R25A 3QMKA 4NTBA 3SYNA 1NBBA 1LI5A 4YT4A 5KYXB 2EPNA 2UUHA 1VMAA 1BR4A 1WGWA 4JVSA 5JP7A 3NMJA 1C02A 2A68F 2L6FA 2CW0F 1TQGA 1LIHA 2YL3A 3Q6MA 4YK5A 4G7HF 2VASA 3MLGA 5DS5A 3EGXA 3NMIA 1GQAA 5EHHA 2VB6A 3RIPA 1OKKD 1XZQA 3IQCA 4JCZA 4BEMJ 3A9CA 3RVYA 3EG9A 3EHMA 3EHNA 1ZHZA 2KJGA 2R7OA 3EPVA 2CCYA 3KMIA 4LDKA 4A2NB 4CDVA 4OIOF 3RQGA 3U9JA 1WN0A 1Q0GA 2D5RB 2LFDA 2MWQA 3OWTA 1D0YA 1JPJA 3K66A 1HE9A 2VC9A 5DS6A 1E83A 1YYJA 2Q3TA 3CQZA 2D4UA 3C18A 3SXZA 1LE4A 3QVYA 3ATPA 2GA0A 2HZ8A 2VCBA 3S29A 1T6IA 3N24A 1U0BB 1FTSA 1MMGA 2PX0A 1MNEA 1RJ9B 4N06A 1NSGB 1KTMA 3FOOA 3JRMO 1Z63A 4XEKA 2OKUA 3OA1A 1FNTc 1Q0FA 1LE2A 1RKEA 4G7ZF 2GAQA 1AEPA 2Z15A 4MVQA 5BUOA 3US6A 3EZHA 2A0UA 1ZZPA 2XS1A 1LS4A 3UMIA 1NG1A 2YL0A 3C62A 2GFHA 3SNHA 2F22A 3AG2C 3K1IC 3ZQVA 3ZSUA 1GM5A 3IQTA 1A0BA 4G78A 4MTGA 4R32A 3EH1A 1WASA 5B1AC 3LLIA 2V26A 2XM4A 3Q7GA 5KYWA 2YKZA 1Q0DA 3F46A 5FZTA 3V7OA 1VK5A 3S0XA 4H4KC 1T6QA 1U89A 3O55A 1D1AA 2H7BA 4CIHA 1CGME 2WVQA 1CPQA 2KNHA 3SP1A 2YL7A 3RFYA 4A4AA 1OXBA 2A1DD 2KGOA 2NG1A 2L6HA 2E87A 1EKYA 2LQGA 4RDAA 2NUPB 4MS2A 4CJOA 2W4MA 4ONSA 2WZFA 3DMDA 3GORA 1BR2A 1OR2A 3AQBA 5JRAA 3KKBA 4RD9A 1SMYF 5DQZA 4DVYP 2RSEB 1TFKB 4CS8C 2R7WA 4BJ1A 2LCHA 3FVYA 1O5HA 4E7SA 4N4WA 4O6MA 3ZWIA 3TQOA 5E3CA 4F4BA 4YL3A 2XXAA 4JJFA 1YZCA 5E3AA 1ZW3A 3NDBB 4FAPB 2Y3HA 1H6GA 1Z23A 4DOZA 1Q0MA 2LK4A 2WVOA 4MTFA 4DBRA 2XSEA 1Z5ZA 1ORSC 1YDIA 2BL2A 2XLVA 2YRFA 3L8IA 2CDQA 4E0HA 3N2ZB 2ETSA 1ZU4A 2LIGA 3LNMB 3UMKA 1O3UA 3ECSA 1V4AA 4DRJB 3DE9A 5K0IA 1MMNA 1J8MF 5D91A 4EBKA 2R7QA 2I8BA 4BJTA 4JJGA 3KPHA 3DM5A 1Z6AA 3A11A 3ABKC 5BQGA 1FMWA 3JSEO 2XL6A 1V54C 4JIOA 4MVMA 3LS1A 4LERA 3L34A 1VLSA 4U5EE 2R02A 1A7DA 3TOLA 1NFOA 2EILC 3HNJA 4HE8D 3TJ6A 5KYYB 4U5FE 1OW7A 2HMQA 3EH2A 1KU2A 3JYYA 1ZYRF 1JMWA 1DOVA 1CPRA 4ZLCA 2OG2A 2EPLX 4NQFA 1HMDA 4U9EA 2ASRA 2HJMA 2AWCA 3U9MA 3GEEA 2RD9A 1Z7Qc 1OQCA 1U6HA 1DOWA 3TJ5A 3ZIBA 4C3DA 1UFBA 4DJ9A 2J9UA 3AG4C 3NKEA 1NU9C 2WVNA 3G4XA 4EWCA 2R03A 1HW2A 3HTKC 4X0RA 4CDYA 3QTHA 4U5GA 5JVEA 1TWAA 4PFOA 2TMVP 2DGJA 3LESA 1R5ID 2HJ3A 1TKNA 3VAYA 2J0XA 4P9TA 3NMKA 3B71A 3I4UA 4H54A 1E2XA 4IB4A 2XM0A 3U5SA 4C7OB 3AOUA 3AG3C 4XLNF 3DZAA 2CGEA 5IY5C 4MVOA 2YHSA 5A6AA 5HV9A 4Q4ZF 1JPNA 2Y3GA 1QSPA 3DAGA 4CDAA 4CS8A 5JT4A 1Y4CA 2AVKA 2Y39A 2AP3A 4JKVA 3F47A 1ORYA 2DYRC 3W2WA 4LDRA 3DAFA 1CGOA 4N6HA 1TWGA 4U5BE 2KK1A 3IQ5A 3L8JA 4U5DE 5DVWA 4DXWA 3ABMC 1FMVA 3NG1A 4YL1A 3WAQA 5L0IA 4OIQF 2P6VA 1EQ1A 2H7VC 1H7IA 1JR8A 3C63A 4O6YA 4Z9HA 2JX0A 4AE4B 3S84A 1ZU5A 3T6BA 1LI7A 3X1OA 4BJ6A 4PJLA 2DB4A 1K05A 3ITFA 5L0DA 3ASNC 2KSFA 2HKVA 1OXKA 4IRUA 1MMAA 2OCCC 3AG1C 3IHUA 2Y3DA 5TJ5E 3RQEA 3RVZA 3O39A 1E84A 1UG7A 1FFHA 3DKAA 3JT1A 3HNIA 3MX3A 4IJJA 1MNDA 4OIRF 1CGNA 256BA 3VYWA 5AC5A 4CSAA 2YZSA 4Z9IA 1T9KA 2NPUA 3SZRA 2ZPAA 2IBFA 5D92A 1HE1A 2EIJC 5KYXA 5T3WA 3RW0A 3SXYA 1ST6A 1QQ3A 4W8PA 4AX2A 1VYKA 1YYXA 3ZTMA 4AL0A 1OW6A 1M2VB 3GODA 5JUAA 2PFDA 5F28E 4ULWA 1FAPB 2GDCA 1E86A 4J7TA 5F5FA 3JZ0A 1BZ4A 2EINC 2CYDA 2X0CA 2CNWA 1BBHA 1LS1A 4XTKA 2P0NA 2YEVA 5FCLA 1VLTA
chains in the Genus database with same CATH topology
1FFTC 2QY9A 3QZCA 5CI9A 4BG0A 1D1CA 2IYLD 2L9JA 5B3SC 4RBNA 1D0XA 1VYIA 2G3KA 5T1DB 3WODF 4FX5A 3M1CB 4J32B 1M57C 2A69F 2G62A 2WB7A 5L3QA 1RJ9A 2CNWD 3E9VA 4O79A 4PJJA 4JURI 1PCXA 3EFOA 2NUTB 1QZXA 5E2QA 3E70C 5HSWA 3B9QA 4OD5A 4J30B 3K1HA 4PK4A 4GYTA 3NYLA 3RH3A 4QI0A 3DXJF 4IWBA 4PJNA 1V55C 5KYUA 3RYLA 4I44A 1PD1A 4K0DA 2B0JA 3EGDA 3NKDA 3K7DA 4E7ZA 4KNWA 1M56C 3S27A 3HJCA 3LEVA 4NY3A 5E33A 4O7GA 2NUPA 4GEHA 1N1CA 1D0ZA 2A6EF 4G7OF 4BJ5A 2R7VA 3EQLF 3NYMA 4I3MA 3K6BA 2WZLA 1TR2A 1QLEC 4OINF 1SF8A 4CBEA 3AQCA 3ABLC 2IXNA 1W2WA 2W45A 3NRHA 4FWVA 2R7TA 3K33A 1ZHTA 5EGYA 1S7ZA 1OCZC 3LJBA 4IAOA 4YN0B 4BJ6C 4LLEA 4YT2A 4C3EA 3JYHA 3L0IA 2IOQA 5DS4A 2EIKC 3Q7LA 3GANA 4JCHA 3TD7A 1MMDA 1J8YF 4O6NA 4HFKB 4K7BA 3CZ6A 1Z3IX 4CSAC 3ZVRA 4I1OB 2P7VA 5CI8A 1ZHWA 3ZG1A 2XRHA 4KNVA 5KYYA 2IXPA 2J9WA 3DJNB 2W9YA 2Y69C 3EGXB 4HFFB 2W4BA 2WZGA 1LVKA 3EG9B 2X51A 2A6HF 4U5HA 4YT8A 2HV7A 2JD3A 2PP4A 4YT5A 1NZEA 3ZC4A 4CS9A 3H65A 3IEEA 4OD4A 5KYNA 4WJ0A 4P6IC 1LKXA 4DVZA 4C7OA 3UMHA 1TWHA 3LAYA 2H7OA 3LLKA 2ZXWC 4KBLA 3W8HA 3JCUQ 3CSKA 2ZXOA 2J45A 5KYWB 2C03A 2LSEA 4AE4A 4BEJA 5T3TA 4KI2A 3DM9B 3FHDA 3KH2A 2PX3A 3DD7A 4LLCA 1PD0A 3O6XA 3I5PA 3SEOA 2IXOA 2C04A 1IW7F 3EFOB 3ASOC 4BJ5C 3UGOA 3FAJA 3S28A 1VOMA 2Y3BA 2DYSC 2PF4E 5B1BC 2ZXRA 4YWQA 1M2VA 2XL4A 1G8XA 2XXAB 2IXMA 3HLZA 4G0HA 4ANJA 2R7SA 4I1MA 3EJNA 1BR1A 5KYUB 4HEAJ 4B6IA 2M4EA 1SZIA 2G3VA 2BE5F 4M63A 3EGDB 3N0TA 2V3CC 2L81A 1TWCA 4MNDA 4QDLA 3T6JA 2Q9BA 4LACB 1D1BA 2FFHA 1M2OA 2R7XA 2R7UA 3JRTA 2O9XA 4W8KA 4FESA 2NUTA 3B0UX 4KC9A 5L3VA 3UNGC 3UR3C 2FGYA 4MQ9F 3UGPA 3B0PA 1OCRC 5F5HA 3WG7C 5DLJA 3EZIA 1OCOC 2EIMC 2WL8A 3NYJA 3W8IA 4CS9C 3KL4A 2KQ9A 2HV6A 3FDQA 2Q9AA 2MYSA 2J9VA 3LNRA 1O87A 1OCCC 2J7PA 3PMRA 4CS7A 4C3BA 4JZAA 2VH3A 3T4RA 3X2QC 3W2VA 5DQTA 2Q9CA 2QTVA 1ZHYA 4U5CE 3I5QA 4CS8A 1NU7D 4XWJA 4YJWA 4Q7CA 4PFPA 2R7RA 4Q5SF 2J7PD 3RKOF 2KW3C 3POVA 4QI2A 4XLPF 1ZHXA 2ZXPA 1IZMA 3LS0A 4DBQA 3OEOA 4EBBA 1OKKA 3PHF2 2J46A 3JSZA 4PJMA 4OIPF 2J0WA 3DJUB 3Q6NA 4ZLDA 4AK9A 4JW1A 3QMKA 3SYNA 4YT4A 5KYXB 1VMAA 1BR4A 1WGWA 4JVSA 2A68F 3Q6MA 2CW0F 4G7HF 2VASA 3MLGA 5DS5A 3EGXA 5EHHA 2VB6A 3RIPA 1OKKD 3EG9A 3EHMA 3EHNA 1ZHZA 2KJGA 2R7OA 3EPVA 4A2NB 3KMIA 4OIOF 3OWTA 2D5RB 2MWQA 1D0YA 1JPJA 3K66A 5DS6A 2Q3TA 3CQZA 3S29A 3N24A 1FTSA 1MMGA 2PX0A 1MNEA 1RJ9B 4N06A 1Z63A 3OA1A 4G7ZF 2Z15A 5BUOA 3EZHA 3UMIA 1NG1A 2GFHA 3SNHA 3AG2C 3K1IC 3ZSUA 3EH1A 5B1AC 3LLIA 2V26A 3Q7GA 5KYWA 3F46A 3S0XA 3V7OA 1VK5A 4H4KC 1D1AA 2H7BA 4CIHA 2WVQA 2KNHA 3SP1A 3RFYA 2A1DD 2KGOA 2NG1A 2E87A 4RDAA 2NUPB 2W4MA 2WZFA 3DMDA 1BR2A 3AQBA 3KKBA 4RD9A 1SMYF 5DQZA 4DVYP 4CS8C 2R7WA 4BJ1A 4E7SA 3FVYA 1O5HA 4O6MA 5E3CA 4F4BA 2XXAA 4JJFA 3NDBB 5E3AA 2Y3HA 1Z23A 4DOZA 2WVOA 4DBRA 2XSEA 1Z5ZA 2CDQA 3N2ZB 1ZU4A 3UMKA 3ECSA 1MMNA 1J8MF 5D91A 2R7QA 2I8BA 4BJTA 4JJGA 3DM5A 1Z6AA 3ABKC 1FMWA 1V54C 3LS1A 4LERA 3L34A 4U5EE 2EILC 4HE8D 5KYYB 4U5FE 3EH2A 1KU2A 1ZYRF 4ZLCA 2OG2A 4C3DA 3ZIBA 2J9UA 3NKEA 3AG4C 1NU9C 2WVNA 4EWCA 3HTKC 4X0RA 4U5GA 1TWAA 4PFOA 2DGJA 3LESA 1TKNA 3VAYA 2J0XA 3I4UA 4C7OB 3AG3C 4XLNF 3DZAA 2CGEA 5IY5C 4Q4ZF 2YHSA 1JPNA 2Y3GA 3DAGA 2Y39A 3F47A 2DYRC 3W2WA 3B0VC 3DAFA 5DVWA 1TWGA 4U5BE 4U5DE 3ABMC 1FMVA 3NG1A 4OIQF 2P6VA 2H7VC 4O6YA 4AE4B 1ZU5A 3T6BA 3X1OA 4BJ6A 4PJLA 3ITFA 3ASNC 4IRUA 1MMAA 2OCCC 3AG1C 2Y3DA 3O39A 1FFHA 3JT1A 3MX3A 4IJJA 1MNDA 4OIRF 3VYWA 4CSAA 2YZSA 3SZRA 2ZPAA 5D92A 2EIJC 5KYXA 5T3WA 1ST6A 4AX2A 1VYKA 1M2VB 3GODA 2PFDA 4ULWA 5F5FA 2EINC 2CNWA 1LS1A 4XTKA 2YEVA 5FCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AX2 A;  4J30 B;  4HFK B;  4B6I A;  4JUR I;  4HFF B;  4J32 B;  3ZIB A; 
#chains in the Genus database with same CATH topology
 1JOG A;  1K40 A;  1FFT C;  2P1A A;  5JSL A;  2QY9 A;  1Q0K A;  2OJQ A;  3QZC A;  5CI9 A;  4BG0 A;  3TUL A;  1D1C A;  4ER9 A;  2IYL D;  2L9J A;  5B3S C;  4RBN A;  1D0X A;  2XLO A;  5JLI A;  1VYI A;  2G3K A;  5T1D B;  3WOD F;  1RXQ A;  2GWW A;  1C17 M;  2YLD A;  2H8A A;  4FX5 A;  3M1C B;  3HKK A;  4J32 B;  3L1M A;  2XLW A;  2KYH A;  1A41 A;  1M57 C;  2A69 F;  2HSB A;  2L6G A;  2G62 A;  2WB7 A;  5B3I A;  5L3Q A;  1RJ9 A;  2CNW D;  1G4W R;  1XZP A;  3E9V A;  4O79 A;  4JUR I;  4PJJ A;  4EBJ A;  1PCX A;  2I15 A;  4JTA B;  3G4Z A;  1RCP A;  1YLM A;  3EFO A;  2NUT B;  1QZX A;  3C7J A;  4JE9 A;  2P61 A;  1RKC A;  5E2Q A;  3E70 C;  5HSW A;  3B9Q A;  4OD5 A;  4J30 B;  3K1H A;  4PK4 A;  3DE8 A;  3LUT B;  3NYL A;  4GYT A;  3RH3 A;  2MHR A;  3M79 A;  5EK0 A;  4BPM A;  4QI0 A;  2VCC A;  3DXJ F;  4IWB A;  3V5Z A;  4PJN A;  1V55 C;  4EUK B;  4E18 A;  5KYU A;  3KYI A;  3GWN A;  3GEH A;  2J8W A;  3RYL A;  5L0C A;  4I44 A;  1QKR A;  1PD1 A;  1A7E A;  4NCQ A;  3U2M A;  4K0D A;  4LDQ A;  2B0J A;  3EGD A;  2DI3 A;  1YA7 O;  3K7D A;  1WTY A;  3NKD A;  4JTD B;  4KNW A;  4XEV A;  1M56 C;  4E7Z A;  4CIP A;  3S27 A;  3HJC A;  1LPE A;  4MW8 A;  3C8G B;  1S05 A;  3GM2 A;  4XQ1 A;  3LEV A;  4NY3 A;  5E33 A;  2M64 A;  2NUP A;  4O7G A;  4E0I A;  2XS8 A;  2B0H A;  1WOL A;  4GEH A;  1N1C A;  1D0Z A;  1JRA A;  1K04 A;  1I4Z A;  2A6E F;  4G7O F;  3VF0 A;  3BRJ A;  4BJ5 A;  2R7V A;  2PBE A;  1QPU A;  3EQL F;  3FOP A;  3GEI A;  3NYM A;  4I3M A;  3K6B A;  1OR3 A;  2WZL A;  1HW1 A;  4MVS A;  1TR2 A;  3GM3 A;  1QLE C;  1RMV A;  4OIN F;  1SF8 A;  4CBE A;  2EPO A;  3ABL C;  3AQC A;  1WAT A;  2IXN A;  1W2W A;  2W45 A;  3NRH A;  4FWV A;  2R7T A;  3K33 A;  1ZHT A;  5EGY A;  1S7Z A;  1G5Z A;  1E85 A;  1OCZ C;  2QUP A;  3LJB A;  4IAO A;  2J9B A;  2HMZ A;  4YN0 B;  4BJ6 C;  2BC5 A;  4LLE A;  2QE9 A;  4CX9 A;  4YT2 A;  4C3E A;  1V74 B;  3B0V C;  4L6R A;  3JYH A;  1I5N A;  1ORJ A;  1ZVZ A;  2IOQ A;  2OOC A;  3L0I A;  4JEB A;  5DS4 A;  1JAF A;  2EIK C;  3Q7L A;  3GAN A;  4JCH A;  3TD7 A;  1QVX A;  1MMD A;  1J8Y F;  2YLG A;  4O6N A;  4HFK B;  4K7B A;  2EPM X;  4JTC B;  3CZ6 A;  1Z3I X;  3WHN A;  3ZVR A;  3S90 A;  4CSA C;  4I1O B;  3M4B A;  2P7V A;  5CI8 A;  3H2U A;  2LFF A;  2ICW G;  4WAB A;  1ZHW A;  2R9R B;  3U0C A;  3ZG1 A;  2XRH A;  4KNV A;  5KYY A;  1M6T A;  2IXP A;  2J9W A;  4P9F A;  3DJN B;  1YA9 A;  2QLA A;  4JC7 A;  3FAP B;  2W9Y A;  5AGF A;  1YAU O;  2Y69 C;  3EGX B;  3CEX A;  4HFF B;  5BQI A;  4D4X A;  2HFI A;  1APC A;  1I4Y A;  2W4B A;  5COM A;  2WZG A;  1LVK A;  3EG9 B;  2AU5 A;  2X51 A;  2A6H F;  3GM1 A;  5A69 A;  2Q7R A;  2YLI A;  2YVK A;  3O10 A;  4U5H A;  3MFN A;  4YT8 A;  1MQV A;  2HV7 A;  5BQH A;  3PDM P;  2JD3 A;  2PP4 A;  2YQY A;  4YT5 A;  1NZE A;  3RQF A;  2Q00 A;  3ZC4 A;  1HMO A;  3ZTZ A;  4U9D A;  4MVZ A;  4CS9 A;  2UUI A;  1OW8 A;  3H65 A;  4MVU A;  2ZD9 A;  3PCV A;  3IEE A;  1FR0 A;  3AGT A;  4OD4 A;  4WJ0 A;  5KYN A;  4P6I C;  3T9O A;  1LKX A;  4DVZ A;  4C7O A;  3UMH A;  4NTA A;  3DWW A;  2A0B A;  4EIY A;  4JEA A;  1TWH A;  3LAY A;  2H7O A;  3LLK A;  1EA8 A;  2FAP B;  2ZXW C;  4KBL A;  3W8H A;  4IAR A;  1T6U A;  1BDJ B;  1RKE B;  2OEX A;  5AC4 A;  1R4T A;  2HS5 A;  3JCU Q;  3TOM A;  5A6J A;  5GPG B;  1T5O A;  4N6C A;  1WWP A;  3CSK A;  4MW3 A;  3U3F A;  2HUJ A;  1C03 A;  3AGU A;  4MTO A;  2ZXO A;  1YZA A;  3MYI A;  4K1O A;  2NSG A;  2J45 A;  5KYW B;  2C03 A;  2LSE A;  4GQH A;  4PR9 A;  4AE4 A;  3CAX A;  5T3T A;  4BEJ A;  2LP4 A;  2YL1 A;  1YAR O;  3AJM A;  4KI2 A;  3V5X A;  2OJE D;  2OQM A;  2XLM A;  3DM9 B;  3FHD A;  1GGQ A;  3G50 A;  3KH2 A;  4NC3 A;  3SXK A;  1TFO B;  2PX3 A;  1PV3 A;  1NFN A;  4MVR A;  3DD7 A;  4LLC A;  4CJG A;  1PD0 A;  3O6X A;  3I5P A;  3SEO A;  4UDV A;  2IXO A;  2XLE A;  2C04 A;  1VTM P;  1IW7 F;  3IPM O;  4IGG A;  3EFO B;  3ASO C;  2XLD A;  3BEH A;  3W4Y A;  4BJ5 C;  3UGO A;  3FAJ A;  3S28 A;  1HY5 A;  1VOM A;  3JTL O;  2Y3B A;  2DYS C;  4PAC A;  2JPU A;  2PF4 E;  3H2V A;  5B1B C;  2ZXR A;  4YWQ A;  1M2V A;  3J06 A;  2XL4 A;  1G8X A;  2XXA B;  2IM8 A;  1GS9 A;  2IXM A;  3HLZ A;  4G0H A;  2Q4F A;  4ANJ A;  4I1M A;  3EJN A;  1BR1 A;  2R7S A;  5KYU B;  1T01 A;  4HEA J;  4B6I A;  2M4E A;  1SZI A;  2KC3 A;  2G3V A;  4EHP A;  2BE5 F;  3MYF A;  3HNL A;  4XPW A;  4M63 A;  2OEV A;  4NTF A;  4WGY A;  3EGD B;  5COF A;  3IQ6 A;  3N0T A;  4E17 A;  2V3C C;  4IAQ A;  1LM3 B;  3C8Z A;  2L81 A;  1VB5 A;  3GWL A;  1TWC A;  3T6G B;  3V5Y A;  4MND A;  4QDL A;  3T6J A;  4XEF A;  1AVO B;  2Q9B A;  4LAC B;  1D1B A;  2FFH A;  5A6B A;  5JS5 A;  1M2O A;  1H9T A;  2R7U A;  3JRT A;  3S9O A;  2R7X A;  2O9X A;  2AWY A;  4W8K A;  3U2L A;  4FES A;  1ZW2 A;  1XWJ A;  2NUT A;  1A7V A;  3B0U X;  1G4U S;  4KC9 A;  5L3V A;  4Z9J A;  3UNG C;  3FXH A;  5L0F A;  3UR3 C;  2FGY A;  2QNL A;  3TK0 A;  4MQ9 F;  4WGZ A;  3UGP A;  3B0P A;  4J7Y A;  1OCR C;  5F5H A;  3U3B A;  3K1I A;  3LEO A;  2LD6 A;  4DRI B;  3QW0 A;  3WG7 C;  5DLJ A;  3HNK A;  5A6B D;  3EZI A;  1OCO C;  2YWA A;  3DI5 A;  2HSQ A;  1L3P A;  2EIM C;  2WL8 A;  3NYJ A;  1SR2 A;  3W8I A;  3KL4 A;  2KQ9 A;  2HV6 A;  4CS9 C;  2Q9A A;  3FDQ A;  2MYS A;  2OU6 A;  1H9G A;  2J9V A;  2PNO A;  3LNR A;  3M4C A;  1O87 A;  3U8P A;  1OCC C;  2J7P A;  3PMR A;  4XPY A;  4CS7 A;  4ULV A;  3C8G A;  3ZDL A;  5L0J A;  4C3B A;  4D4N A;  4JZA A;  3R7C A;  2VH3 A;  3T4R A;  3X2Q C;  3QW1 A;  3SXM A;  3KYJ A;  2EPK X;  3W2V A;  5DQT A;  5CIV A;  2Q9C A;  2QTV A;  1ZHY A;  3MBG A;  1KNY A;  3I5Q A;  1Y6D A;  1NU7 D;  1NLX A;  3QVZ A;  4U5C E;  1YVI A;  1F1M A;  1YJG A;  4XWJ A;  4Q7C A;  4YJW A;  3M15 A;  3ZQY A;  4PFP A;  2R7R A;  4Q5S F;  4YL0 A;  2J7P D;  5L0H A;  3B29 A;  1EI7 A;  3C8G D;  2XLH A;  3VM6 A;  3RKO F;  2KW3 C;  3POV A;  4QI2 A;  1AUE A;  1SYQ A;  4XLP F;  1ZHX A;  2ZXP A;  2NSF A;  4JRZ A;  1IZM A;  2R05 A;  2VCA A;  3LS0 A;  4DBQ A;  3OEO A;  3FMS A;  4EBB A;  5COG A;  1OKK A;  3PHF 2;  4EKW A;  3R2P A;  3VRC A;  5L0G A;  2J46 A;  2L7A A;  3JSZ A;  4PJM A;  3RF3 A;  5A6K A;  2XL8 A;  3U8V A;  4OIP F;  1B68 A;  2J0W A;  4XPX A;  4DRH B;  3DJU B;  3Q6N A;  4AL1 A;  4ZLD A;  1L7C A;  4AK9 A;  4JW1 A;  2R25 A;  3QMK A;  4NTB A;  3SYN A;  1NBB A;  1LI5 A;  4YT4 A;  5KYX B;  2EPN A;  2UUH A;  1VMA A;  1BR4 A;  1WGW A;  4JVS A;  5JP7 A;  3NMJ A;  1C02 A;  2A68 F;  2L6F A;  2CW0 F;  1TQG A;  1LIH A;  2YL3 A;  3Q6M A;  4YK5 A;  4G7H F;  2VAS A;  3MLG A;  5DS5 A;  3EGX A;  3NMI A;  1GQA A;  5EHH A;  2VB6 A;  3RIP A;  1OKK D;  1XZQ A;  3IQC A;  4JCZ A;  4BEM J;  3A9C A;  3RVY A;  3EG9 A;  3EHM A;  3EHN A;  1ZHZ A;  2KJG A;  2R7O A;  3EPV A;  2CCY A;  3KMI A;  4LDK A;  4A2N B;  4CDV A;  4OIO F;  3RQG A;  3U9J A;  1WN0 A;  1Q0G A;  2D5R B;  2LFD A;  2MWQ A;  3OWT A;  1D0Y A;  1JPJ A;  3K66 A;  1HE9 A;  2VC9 A;  5DS6 A;  1E83 A;  1YYJ A;  2Q3T A;  3CQZ A;  2D4U A;  3C18 A;  3SXZ A;  1LE4 A;  3QVY A;  3ATP A;  2GA0 A;  2HZ8 A;  2VCB A;  3S29 A;  1T6I A;  3N24 A;  1U0B B;  1FTS A;  1MMG A;  2PX0 A;  1MNE A;  1RJ9 B;  4N06 A;  1NSG B;  1KTM A;  3FOO A;  3JRM O;  1Z63 A;  4XEK A;  2OKU A;  3OA1 A;  1FNT c;  1Q0F A;  1LE2 A;  1RKE A;  4G7Z F;  2GAQ A;  1AEP A;  2Z15 A;  4MVQ A;  5BUO A;  3US6 A;  3EZH A;  2A0U A;  1ZZP A;  2XS1 A;  1LS4 A;  3UMI A;  1NG1 A;  2YL0 A;  3C62 A;  2GFH A;  3SNH A;  2F22 A;  3AG2 C;  3K1I C;  3ZQV A;  3ZSU A;  1GM5 A;  3IQT A;  1A0B A;  4G78 A;  4MTG A;  4R32 A;  3EH1 A;  1WAS A;  5B1A C;  3LLI A;  2V26 A;  2XM4 A;  3Q7G A;  5KYW A;  2YKZ A;  1Q0D A;  3F46 A;  5FZT A;  3V7O A;  1VK5 A;  3S0X A;  4H4K C;  1T6Q A;  1U89 A;  3O55 A;  1D1A A;  2H7B A;  4CIH A;  1CGM E;  2WVQ A;  1CPQ A;  2KNH A;  3SP1 A;  2YL7 A;  3RFY A;  4A4A A;  1OXB A;  2A1D D;  2KGO A;  2NG1 A;  2L6H A;  2E87 A;  1EKY A;  2LQG A;  4RDA A;  2NUP B;  4MS2 A;  4CJO A;  2W4M A;  4ONS A;  2WZF A;  3DMD A;  3GOR A;  1BR2 A;  1OR2 A;  3AQB A;  5JRA A;  3KKB A;  4RD9 A;  1SMY F;  5DQZ A;  4DVY P;  2RSE B;  1TFK B;  4CS8 C;  2R7W A;  4BJ1 A;  2LCH A;  3FVY A;  1O5H A;  4E7S A;  4N4W A;  4O6M A;  3ZWI A;  3TQO A;  5E3C A;  4F4B A;  4YL3 A;  2XXA A;  4JJF A;  1YZC A;  5E3A A;  1ZW3 A;  3NDB B;  4FAP B;  2Y3H A;  1H6G A;  1Z23 A;  4DOZ A;  1Q0M A;  2LK4 A;  2WVO A;  4MTF A;  4DBR A;  2XSE A;  1Z5Z A;  1ORS C;  1YDI A;  2BL2 A;  2XLV A;  2YRF A;  3L8I A;  2CDQ A;  4E0H A;  3N2Z B;  2ETS A;  1ZU4 A;  2LIG A;  3LNM B;  3UMK A;  1O3U A;  3ECS A;  1V4A A;  4DRJ B;  3DE9 A;  5K0I A;  1MMN A;  1J8M F;  5D91 A;  4EBK A;  2R7Q A;  2I8B A;  4BJT A;  4JJG A;  3KPH A;  3DM5 A;  1Z6A A;  3A11 A;  3ABK C;  5BQG A;  1FMW A;  3JSE O;  2XL6 A;  1V54 C;  4JIO A;  4MVM A;  3LS1 A;  4LER A;  3L34 A;  1VLS A;  4U5E E;  2R02 A;  1A7D A;  3TOL A;  1NFO A;  2EIL C;  3HNJ A;  4HE8 D;  3TJ6 A;  5KYY B;  4U5F E;  1OW7 A;  2HMQ A;  3EH2 A;  1KU2 A;  3JYY A;  1ZYR F;  1JMW A;  1DOV A;  1CPR A;  4ZLC A;  2OG2 A;  2EPL X;  4NQF A;  1HMD A;  4U9E A;  2ASR A;  2HJM A;  2AWC A;  3U9M A;  3GEE A;  2RD9 A;  1Z7Q c;  1OQC A;  1U6H A;  1DOW A;  3TJ5 A;  3ZIB A;  4C3D A;  1UFB A;  4DJ9 A;  2J9U A;  3AG4 C;  3NKE A;  1NU9 C;  2WVN A;  3G4X A;  4EWC A;  2R03 A;  1HW2 A;  3HTK C;  4X0R A;  4CDY A;  3QTH A;  4U5G A;  5JVE A;  1TWA A;  4PFO A;  2TMV P;  2DGJ A;  3LES A;  1R5I D;  2HJ3 A;  1TKN A;  3VAY A;  2J0X A;  4P9T A;  3NMK A;  3B71 A;  3I4U A;  4H54 A;  1E2X A;  4IB4 A;  2XM0 A;  3U5S A;  4C7O B;  3AOU A;  3AG3 C;  4XLN F;  3DZA A;  2CGE A;  5IY5 C;  4MVO A;  2YHS A;  5A6A A;  5HV9 A;  4Q4Z F;  1JPN A;  2Y3G A;  1QSP A;  3DAG A;  4CDA A;  4CS8 A;  5JT4 A;  1Y4C A;  2AVK A;  2Y39 A;  2AP3 A;  4JKV A;  3F47 A;  1ORY A;  2DYR C;  3W2W A;  4LDR A;  3DAF A;  1CGO A;  4N6H A;  1TWG A;  4U5B E;  2KK1 A;  3IQ5 A;  3L8J A;  4U5D E;  5DVW A;  4DXW A;  3ABM C;  1FMV A;  3NG1 A;  4YL1 A;  3WAQ A;  5L0I A;  4OIQ F;  2P6V A;  1EQ1 A;  2H7V C;  1H7I A;  1JR8 A;  3C63 A;  4O6Y A;  4Z9H A;  2JX0 A;  4AE4 B;  3S84 A;  1ZU5 A;  3T6B A;  1LI7 A;  3X1O A;  4BJ6 A;  4PJL A;  2DB4 A;  1K05 A;  3ITF A;  5L0D A;  3ASN C;  2KSF A;  2HKV A;  1OXK A;  4IRU A;  1MMA A;  2OCC C;  3AG1 C;  3IHU A;  2Y3D A;  5TJ5 E;  3RQE A;  3RVZ A;  3O39 A;  1E84 A;  1UG7 A;  1FFH A;  3DKA A;  3JT1 A;  3HNI A;  3MX3 A;  4IJJ A;  1MND A;  4OIR F;  1CGN A;  256B A;  3VYW A;  5AC5 A;  4CSA A;  2YZS A;  4Z9I A;  1T9K A;  2NPU A;  3SZR A;  2ZPA A;  2IBF A;  5D92 A;  1HE1 A;  2EIJ C;  5KYX A;  5T3W A;  3RW0 A;  3SXY A;  1ST6 A;  1QQ3 A;  4W8P A;  4AX2 A;  1VYK A;  1YYX A;  3ZTM A;  4AL0 A;  1OW6 A;  1M2V B;  3GOD A;  5JUA A;  2PFD A;  5F28 E;  4ULW A;  1FAP B;  2GDC A;  1E86 A;  4J7T A;  5F5F A;  3JZ0 A;  1BZ4 A;  2EIN C;  2CYD A;  2X0C A;  2CNW A;  1BBH A;  1LS1 A;  4XTK A;  2P0N A;  2YEV A;  5FCL A;  1VLT A; 
#chains in the Genus database with same CATH homology
 1FFT C;  2QY9 A;  3QZC A;  5CI9 A;  4BG0 A;  1D1C A;  2IYL D;  2L9J A;  5B3S C;  4RBN A;  1D0X A;  1VYI A;  2G3K A;  5T1D B;  3WOD F;  4FX5 A;  3M1C B;  4J32 B;  1M57 C;  2A69 F;  2G62 A;  2WB7 A;  5L3Q A;  1RJ9 A;  2CNW D;  3E9V A;  4O79 A;  4PJJ A;  4JUR I;  1PCX A;  3EFO A;  2NUT B;  1QZX A;  5E2Q A;  3E70 C;  5HSW A;  3B9Q A;  4OD5 A;  4J30 B;  3K1H A;  4PK4 A;  4GYT A;  3NYL A;  3RH3 A;  4QI0 A;  3DXJ F;  4IWB A;  4PJN A;  1V55 C;  5KYU A;  3RYL A;  4I44 A;  1PD1 A;  4K0D A;  2B0J A;  3EGD A;  3NKD A;  3K7D A;  4E7Z A;  4KNW A;  1M56 C;  3S27 A;  3HJC A;  3LEV A;  4NY3 A;  5E33 A;  4O7G A;  2NUP A;  4GEH A;  1N1C A;  1D0Z A;  2A6E F;  4G7O F;  4BJ5 A;  2R7V A;  3EQL F;  3NYM A;  4I3M A;  3K6B A;  2WZL A;  1TR2 A;  1QLE C;  4OIN F;  1SF8 A;  4CBE A;  3AQC A;  3ABL C;  2IXN A;  1W2W A;  2W45 A;  3NRH A;  4FWV A;  2R7T A;  3K33 A;  1ZHT A;  5EGY A;  1S7Z A;  1OCZ C;  3LJB A;  4IAO A;  4YN0 B;  4BJ6 C;  4LLE A;  4YT2 A;  4C3E A;  3JYH A;  3L0I A;  2IOQ A;  5DS4 A;  2EIK C;  3Q7L A;  3GAN A;  4JCH A;  3TD7 A;  1MMD A;  1J8Y F;  4O6N A;  4HFK B;  4K7B A;  3CZ6 A;  1Z3I X;  4CSA C;  3ZVR A;  4I1O B;  2P7V A;  5CI8 A;  1ZHW A;  3ZG1 A;  2XRH A;  4KNV A;  5KYY A;  2IXP A;  2J9W A;  3DJN B;  2W9Y A;  2Y69 C;  3EGX B;  4HFF B;  2W4B A;  2WZG A;  1LVK A;  3EG9 B;  2X51 A;  2A6H F;  4U5H A;  4YT8 A;  2HV7 A;  2JD3 A;  2PP4 A;  4YT5 A;  1NZE A;  3ZC4 A;  4CS9 A;  3H65 A;  3IEE A;  4OD4 A;  5KYN A;  4WJ0 A;  4P6I C;  1LKX A;  4DVZ A;  4C7O A;  3UMH A;  1TWH A;  3LAY A;  2H7O A;  3LLK A;  2ZXW C;  4KBL A;  3W8H A;  3JCU Q;  3CSK A;  2ZXO A;  2J45 A;  5KYW B;  2C03 A;  2LSE A;  4AE4 A;  4BEJ A;  5T3T A;  4KI2 A;  3DM9 B;  3FHD A;  3KH2 A;  2PX3 A;  3DD7 A;  4LLC A;  1PD0 A;  3O6X A;  3I5P A;  3SEO A;  2IXO A;  2C04 A;  1IW7 F;  3EFO B;  3ASO C;  4BJ5 C;  3UGO A;  3FAJ A;  3S28 A;  1VOM A;  2Y3B A;  2DYS C;  2PF4 E;  5B1B C;  2ZXR A;  4YWQ A;  1M2V A;  2XL4 A;  1G8X A;  2XXA B;  2IXM A;  3HLZ A;  4G0H A;  4ANJ A;  2R7S A;  4I1M A;  3EJN A;  1BR1 A;  5KYU B;  4HEA J;  4B6I A;  2M4E A;  1SZI A;  2G3V A;  2BE5 F;  4M63 A;  3EGD B;  3N0T A;  2V3C C;  2L81 A;  1TWC A;  4MND A;  4QDL A;  3T6J A;  2Q9B A;  4LAC B;  1D1B A;  2FFH A;  1M2O A;  2R7X A;  2R7U A;  3JRT A;  2O9X A;  4W8K A;  4FES A;  2NUT A;  3B0U X;  4KC9 A;  5L3V A;  3UNG C;  3UR3 C;  2FGY A;  4MQ9 F;  3UGP A;  3B0P A;  1OCR C;  5F5H A;  3WG7 C;  5DLJ A;  3EZI A;  1OCO C;  2EIM C;  2WL8 A;  3NYJ A;  3W8I A;  4CS9 C;  3KL4 A;  2KQ9 A;  2HV6 A;  3FDQ A;  2Q9A A;  2MYS A;  2J9V A;  3LNR A;  1O87 A;  1OCC C;  2J7P A;  3PMR A;  4CS7 A;  4C3B A;  4JZA A;  2VH3 A;  3T4R A;  3X2Q C;  3W2V A;  5DQT A;  2Q9C A;  2QTV A;  1ZHY A;  4U5C E;  3I5Q A;  4CS8 A;  1NU7 D;  4XWJ A;  4YJW A;  4Q7C A;  4PFP A;  2R7R A;  4Q5S F;  2J7P D;  3RKO F;  2KW3 C;  3POV A;  4QI2 A;  4XLP F;  1ZHX A;  2ZXP A;  1IZM A;  3LS0 A;  4DBQ A;  3OEO A;  4EBB A;  1OKK A;  3PHF 2;  2J46 A;  3JSZ A;  4PJM A;  4OIP F;  2J0W A;  3DJU B;  3Q6N A;  4ZLD A;  4AK9 A;  4JW1 A;  3QMK A;  3SYN A;  4YT4 A;  5KYX B;  1VMA A;  1BR4 A;  1WGW A;  4JVS A;  2A68 F;  3Q6M A;  2CW0 F;  4G7H F;  2VAS A;  3MLG A;  5DS5 A;  3EGX A;  5EHH A;  2VB6 A;  3RIP A;  1OKK D;  3EG9 A;  3EHM A;  3EHN A;  1ZHZ A;  2KJG A;  2R7O A;  3EPV A;  4A2N B;  3KMI A;  4OIO F;  3OWT A;  2D5R B;  2MWQ A;  1D0Y A;  1JPJ A;  3K66 A;  5DS6 A;  2Q3T A;  3CQZ A;  3S29 A;  3N24 A;  1FTS A;  1MMG A;  2PX0 A;  1MNE A;  1RJ9 B;  4N06 A;  1Z63 A;  3OA1 A;  4G7Z F;  2Z15 A;  5BUO A;  3EZH A;  3UMI A;  1NG1 A;  2GFH A;  3SNH A;  3AG2 C;  3K1I C;  3ZSU A;  3EH1 A;  5B1A C;  3LLI A;  2V26 A;  3Q7G A;  5KYW A;  3F46 A;  3S0X A;  3V7O A;  1VK5 A;  4H4K C;  1D1A A;  2H7B A;  4CIH A;  2WVQ A;  2KNH A;  3SP1 A;  3RFY A;  2A1D D;  2KGO A;  2NG1 A;  2E87 A;  4RDA A;  2NUP B;  2W4M A;  2WZF A;  3DMD A;  1BR2 A;  3AQB A;  3KKB A;  4RD9 A;  1SMY F;  5DQZ A;  4DVY P;  4CS8 C;  2R7W A;  4BJ1 A;  4E7S A;  3FVY A;  1O5H A;  4O6M A;  5E3C A;  4F4B A;  2XXA A;  4JJF A;  3NDB B;  5E3A A;  2Y3H A;  1Z23 A;  4DOZ A;  2WVO A;  4DBR A;  2XSE A;  1Z5Z A;  2CDQ A;  3N2Z B;  1ZU4 A;  3UMK A;  3ECS A;  1MMN A;  1J8M F;  5D91 A;  2R7Q A;  2I8B A;  4BJT A;  4JJG A;  3DM5 A;  1Z6A A;  3ABK C;  1FMW A;  1V54 C;  3LS1 A;  4LER A;  3L34 A;  4U5E E;  2EIL C;  4HE8 D;  5KYY B;  4U5F E;  3EH2 A;  1KU2 A;  1ZYR F;  4ZLC A;  2OG2 A;  4C3D A;  3ZIB A;  2J9U A;  3NKE A;  3AG4 C;  1NU9 C;  2WVN A;  4EWC A;  3HTK C;  4X0R A;  4U5G A;  1TWA A;  4PFO A;  2DGJ A;  3LES A;  1TKN A;  3VAY A;  2J0X A;  3I4U A;  4C7O B;  3AG3 C;  4XLN F;  3DZA A;  2CGE A;  5IY5 C;  4Q4Z F;  2YHS A;  1JPN A;  2Y3G A;  3DAG A;  2Y39 A;  3F47 A;  2DYR C;  3W2W A;  3B0V C;  3DAF A;  5DVW A;  1TWG A;  4U5B E;  4U5D E;  3ABM C;  1FMV A;  3NG1 A;  4OIQ F;  2P6V A;  2H7V C;  4O6Y A;  4AE4 B;  1ZU5 A;  3T6B A;  3X1O A;  4BJ6 A;  4PJL A;  3ITF A;  3ASN C;  4IRU A;  1MMA A;  2OCC C;  3AG1 C;  2Y3D A;  3O39 A;  1FFH A;  3JT1 A;  3MX3 A;  4IJJ A;  1MND A;  4OIR F;  3VYW A;  4CSA A;  2YZS A;  3SZR A;  2ZPA A;  5D92 A;  2EIJ C;  5KYX A;  5T3W A;  1ST6 A;  4AX2 A;  1VYK A;  1M2V B;  3GOD A;  2PFD A;  4ULW A;  5F5F A;  2EIN C;  2CNW A;  1LS1 A;  4XTK A;  2YEV A;  5FCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...