4HFFB

Crystal structure of the type vi effector-immunity complex tae4-tai4 from salmonella typhimurium
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
100
structure length
100
Chain Sequence
EALTTQYSQSELLKNWALSHCLALVYKDDVVKNDARATASAYLEYGKQSVEIYHEIDEIAKKYSGLKYNGSISSDFNTMKCIDFIHDRELNELIKRRVEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative cytoplasmic protein
publication title Structure of the type VI effector-immunity complex (Tae4-Tai4) provides novel insights into the inhibition mechanism of the effector by its immunity protein
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Hydrolase
total genus 35
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16695 Tai4 Type VI secretion system (T6SS), amidase immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1620 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4hffB00
4HFFB 4HFKB 4B6IA 4J32B 4AX2A 4J30B 3ZIBA 4JURI
chains in the Genus database with same CATH superfamily
1O87A 1YDIA 4CBEA 3GM3A 4NTAA 4MS2A 1ZVZA 5A6KA 4BJ5A 1LKXA 1GQAA 3B0UX 4XEVA 1C17M 1L3PA 2EPNA 2HMQA 2R7OA 1APCA 2OJQA 2CNWD 2YRFA 2ZXOA 3S29A 4CS9A 4CS8C 3HNIA 3LS1A 4P9TA 3LESA 3EG9B 1WWPA 3S90A 5T1DB 1RJ9A 3NDBB 3I5PA 5DVWA 3A11A 1EKYA 4CDAA 3C8ZA 1WN0A 2YL1A 2CYDA 1E84A 2HJ3A 1BZ4A 4U5FE 1O5HA 1JR8A 3S84A 1TFKB 2EILC 1TR2A 1ST6A 1GGQA 2H7VC 1J8MF 1QZXA 5BQGA 1M2VB 4FX5A 3U5SA 3WAQA 3AG4C 1XZPA 3QW0A 3GM1A 4IJJA 4JJGA 4CX9A 2R7WA 2R7TA 2YL3A 4YJWA 3NMIA 5BQHA 1FAPB 1Z63A 1SR2A 3HNKA 2M4EA 3EGXB 4JEAA 5K0IA 2A1DD 1LI5A 2H7BA 3QMKA 4PJNA 3V5ZA 1BR1A 2ZPAA 3CQZA 3K7DA 2HSQA 4WJ0A 3U8PA 4C3EA 1Q0GA 2D5RB 3BEHA 2AWYA 4OIOF 4MTGA 2P61A 3AG1C 3M15A 4JW1A 4XPXA 1NBBA 1RCPA 2VB6A 1MQVA 3CSKA 4W8KA 2J7PA 2PF4E 2IM8A 2M64A 1NG1A 3JYHA 4JCHA 4YT4A 3POVA 3M79A 256BA 3ZIBA 1EQ1A 1EA8A 3ATPA 1QKRA 5KYUA 2R7SA 2A6EF 3EH2A 2TMVP 2CW0F 2PX0A 2FFHA 4F4BA 3SXMA 3NKEA 2UUIA 3UMKA 1OCZC 2NUTB 4G7OF 4FAPB 5DLJA 3B9QA 3FVYA 3V7OA 2JD3A 4U5CE 2IYLD 2J45A 1XZQA 2Q9BA 2ZD9A 2H7OA 1LIHA 3HNLA 3K1IA 4O6YA 1WASA 2QTVA 3JTLO 4CJGA 4MW8A 4D4XA 2WVQA 3C62A 1AEPA 1T6QA 5D92A 4BJ6C 2Y69C 2QLAA 4YT8A 1E85A 3DM5A 5BQIA 1OQCA 5L0JA 2YWAA 3IEEA 5IY5C 1SMYF 5A6BA 1IW7F 4J7TA 2YQYA 3H65A 3FMSA 3EG9A 3EH1A 4ULVA 4HFKB 4NY3A 4MVSA 2F22A 1HE9A 1PV3A 2LFFA 5E3CA 2HZ8A 3GORA 3ZVRA 2Y3GA 4H4KC 2DB4A 3L8IA 2X0CA 3T6BA 5DQZA 3SNHA 2KNHA 3AG2C 4HFFB 5F5HA 4G7ZF 1OKKD 1YYJA 2L6FA 4PJMA 4U5EE 2R7QA 2Q7RA 2YLDA 1PCXA 3J06A 2P7VA 4DBRA 3AGTA 3S0XA 5EGYA 3JYYA 4XLPF 4MVQA 4OIPF 1M2VA 1VLSA 3EGDB 4OD5A 1MMAA 1QVXA 3FAPB 1CPQA 1Q0DA 3JRMO 3JT1A 3MYIA 1G8XA 5DS4A 4MVOA 3JSZA 4Z9JA 5L3QA 3IQCA 1TWGA 3EGXA 3FXHA 2QNLA 2AP3A 2LP4A 2HSBA 3MX3A 3TJ6A 3W8IA 4LLCA 5A6JA 2FGYA 1E83A 3SXYA 4BPMA 2HFIA 2EPKX 1CGME 3U2LA 1HW2A 2XL8A 2MYSA 2KC3A 3LAYA 2I8BA 4BEJA 3CZ6A 5FZTA 4LDKA 1SZIA 4W8PA 1ZU5A 4CSAA 2XL4A 4MNDA 4ZLCA 4BJTA 5AC5A 1V54C 1ZHYA 2VC9A 3EJNA 2Q9AA 2WVNA 4JTCB 4WGYA 3ABLC 1MNEA 3O39A 5COMA 4E0IA 3FOOA 3NKDA 3DWWA 2LQGA 4EWCA 5B3IA 4C7OB 3RW0A 4MVUA 2NUTA 1V55C 5KYWB 1RMVA 1OR3A 1K05A 5T3WA 3W2WA 2XS8A 3K66A 1LS1A 1T9KA 1M2OA 1RKEB 3DD7A 4ER9A 1TWCA 1LS4A 2XLOA 3JZ0A 4XLNF 4IAQA 2NSFA 1OR2A 3WG7C 3FDQA 3C8GD 5B1AC 1ZZPA 2KGOA 3TULA 1MMGA 3A9CA 4PJJA 2LCHA 3ABMC 1NSGB 3GEIA 4M63A 1OW6A 1AVOB 2OG2A 4LLEA 3RYLA 4G0HA 1I4YA 2UUHA 3KYJA 1D1BA 2NSGA 3FHDA 1YYXA 1U6HA 5HV9A 1ZHXA 4RD9A 3L0IA 5TJ5E 2YLIA 3ZQYA 3BRJA 4PACA 2R05A 3N0TA 4IWBA 2NUPA 3W4YA 1NFOA 2VCCA 2HKVA 3PHF2 4DVYP 2ASRA 3I4UA 3HNJA 3RIPA 4UDVA 2Y39A 4JTAB 3FOPA 1FTSA 3V5XA 2YL0A 2YL7A 1Z3IX 5L0GA 2J46A 2KW3C 4EIYA 3VM6A 1YZAA 2XLDA 3GANA 4I1MA 1K40A 3EHNA 3T6JA 2GA0A 2DI3A 4CIHA 1B68A 2L6GA 2J9VA 3EGDA 1OCCC 5JT4A 4YL0A 4YT2A 3CEXA 1OCRC 3KL4A 1WATA 1D0XA 4H54A 1A41A 4PK4A 3G4ZA 1ORSC 4WABA 2WZFA 4NCQA 3N2ZB 2C04A 2VASA 3UGOA 2GAQA 2R03A 2RD9A 2L7AA 3ABKC 5KYXB 2LFDA 2OCCC 2IOQA 1YVIA 1QSPA 2CCYA 4IARA 2HV6A 1VLTA 1PD1A 2B0JA 1U89A 1HMOA 3TQOA 2NPUA 4C3DA 4YN0B 3KYIA 4AX2A 1KNYA 1QLEC 1CGNA 1T01A 4ONSA 3SXKA 3FAJA 3G50A 4P9FA 3U0CA 4OIQF 3QTHA 5E3AA 3RKOF 1N1CA 2BC5A 2WZGA 1HW1A 4XEFA 2V3CC 4C7OA 4I1OB 5KYWA 1YLMA 1YA9A 4DRHB 2P6VA 4L6RA 2XSEA 4PJLA 3Q7GA 1RKEA 3AQCA 3DJUB 3R7CA 2RSEB 4CS8A 2VH3A 5CIVA 1FFTC 3IQTA 2AU5A 4HE8D 3NRHA 3ZSUA 3LNMB 1NU9C 1T5OA 4KBLA 2L9JA 5GPGB 2OJED 1G5ZA 5B3SC 1S7ZA 1Q0KA 1LM3B 2R25A 2YLGA 4JKVA 4U5GA 1Z6AA 1SF8A 2DYSC 1ZHWA 5CI8A 4OD4A 1RKCA 4CDVA 4JEBA 4IGGA 4EUKB 3SYNA 3DAGA 4BG0A 2X51A 4RBNA 3V5YA 4OINF 2J7PD 2QE9A 1DOVA 2L6HA 4JE9A 4DOZA 4CDYA 4U5HA 4J7YA 4DJ9A 1A0BA 3U9MA 3LUTB 3OA1A 1VYKA 5F5FA 2R7UA 4CIPA 2R02A 3MYFA 1D1CA 2IXPA 3LNRA 4NC3A 4E17A 3Q6NA 2MWQA 2Q00A 3DXJF 3GEHA 4J32B 3W8HA 2BE5F 1NLXA 2DGJA 3OWTA 1Z7Qc 1CGOA 1I5NA 3GM2A 4LDRA 4MTOA 2C03A 5E33A 4BEMJ 3SEOA 3JRTA 5EHHA 2LSEA 4JIOA 1VB5A 3DKAA 4XQ1A 3GWLA 5DS5A 5JVEA 5KYXA 1LPEA 4JCZA 1HMDA 3L8JA 2OU6A 4EBKA 1JMWA 4DXWA 2FAPB 5DS6A 5A6BD 3B0VC 2IBFA 1FMVA 2YEVA 2WVOA 2DYRC 2XM4A 4JC7A 4DVZA 1FFHA 3EPVA 3QVZA 2W9YA 3DZAA 3O55A 4Q7CA 3O6XA 4G7HF 5T3TA 4O6MA 4D4NA 4BJ1A 4AK9A 1ZHZA 2XLMA 4JVSA 3DAFA 3B29A 3L1MA 3LEOA 4MVRA 4NQFA 4BJ6A 1M57C 3IPMO 2W4MA 3U3FA 4E0HA 1AUEA 2EPMX 2ETSA 2R7VA 3HTKC 3I5QA 3E70C 5EK0A 4OIRF 2QUPA 5KYNA 1GM5A 2W4BA 3RF3A 2YKZA 2IXMA 2HV7A 3GODA 3ZC4A 4RDAA 4KI2A 2W45A 1VK5A 4IRUA 4N6HA 5JSLA 1U0BB 1JRAA 1WTYA 4BJ5C 1H9GA 5L0IA 3JSEO 2EIKC 4LERA 1EI7A 5DQTA 4CS9C 1H7IA 2J9WA 1CPRA 3HLZA 3MLGA 1D1AA 4MW3A 2OEVA 4YL3A 4AL0A 3T6GB 5JUAA 2QY9A 3DI5A 1Z23A 3IQ5A 3RQFA 4G78A 1R5ID 4WGZA 3M4CA 3QZCA 3TOMA 3Q6MA 2VCBA 1D0YA 2J8WA 3ASNC 2G3VA 4YL1A 4PFOA 1V74B 3NYMA 3R2PA 2VCAA 4IB4A 3T9OA 5KYYB 1NFNA 3AG3C 1YA7O 4MQ9F 4B6IA 3ECSA 2A0UA 3MBGA 4U5DE 2CNWA 3L34A 3RVYA 1UG7A 3K33A 3LEVA 2EIMC 1L7CA 2CDQA 1TWHA 1A7EA 3N24A 4LACB 2CGEA 5AGFA 4R32A 1C03A 2HMZA 4NTBA 4JRZA 4XTKA 3VAYA 4YWQA 1ZW3A 5HSWA 2Y3DA 2KQ9A 3EQLF 3F46A 3RVZA 1PD0A 4E7SA 3EZIA 1HY5A 2XS1A 3UGPA 5BUOA 1Y6DA 1TQGA 2ICWG 3AJMA 4K7BA 2ZXRA 1LVKA 2EIJC 2H8AA 3E9VA 1H6GA 3O10A 1R4TA 2XLWA 4Z9HA 2JX0A 5D91A 4AE4B 1D0ZA 1ZYRF 1Z5ZA 3AGUA 1C02A 4O79A 3U3BA 4ULWA 1XWJA 1YZCA 1E2XA 4EBJA 4MVMA 5L3VA 3IQ6A 2MHRA 4O6NA 3X2QC 2KK1A 4KC9A 4GQHA 5CI9A 3C18A 4FWVA 2Y3BA 4XEKA 1OW8A 3ITFA 2A68F 1VTMP 1NU7D 3RFYA 2AWCA 4MTFA 2PBEA 4Q4ZF 1IZMA 1QPUA 4XPWA 3K1IC 1WOLA 4E7ZA 1VYIA 4DBQA 1TWAA 2A6HF 5L0DA 4I44A 3KPHA 3SP1A 4JJFA 1O3UA 3G4XA 2A69F 3UMHA 3AOUA 4JTDB 3TJ5A 1DOWA 3TD7A 2WZLA 3M1CB 3US6A 3GWNA 3ZWIA 4DRJB 1LI7A 3WODF 1G4US 1SYQA 2BL2A 4O7GA 4NTFA 1Q0MA 2LD6A 4CJOA 5A69A 2YZSA 4JURI 4MVZA 4QDLA 2KJGA 2LK4A 1NZEA 4GYTA 3S28A 1RXQA 3ASOC 4ANJA 4N4WA 1S05A 3ZDLA 3C8GB 3WHNA 2IXOA 1W2WA 3RH3A 2GFHA 3LJBA 5COFA 5F28E 5KYYA 3HJCA 3UMIA 5FCLA 4A4AA 4K1OA 4LDQA 5E2QA 2EINC 1KTMA 1M6TA 1A7DA 1FR0A 3Q7LA 3DM9B 1JPNA 2EPOA 3KH2A 3PMRA 2A0BA 2I15A 4P6IC 4PFPA 4U9EA 2NG1A 2XXAB 3VRCA 1JAFA 1YARO 3UNGC 4HEAJ 3KKBA 3AQBA 1MNDA 4X0RA 1VOMA 1YAUO 3DE8A 3CAXA 3NMJA 1LE4A 2YHSA 1BR2A 3DJNB 3DMDA 3HKKA 1UFBA 4EHPA 1A7VA 1OKKA 2PP4A 3H2UA 3DE9A 1I4ZA 3UR3C 1T6UA 4QI0A 1H9TA 4AE4A 1J8YF 3EFOB 4JZAA 3U2MA 1WGWA 3W2VA 2PFDA 5JRAA 1E86A 1LE2A 4CSAC 2WB7A 2J9UA 3KMIA 3NMKA 3VF0A 1GS9A 1Y4CA 2XL6A 3IHUA 2OQMA 1QQ3A 3H2VA 2R7RA 1OCOC 3MFNA 4J30B 2Y3HA 1TKNA 1M56C 1ORYA 2XLHA 4U9DA 2GWWA 2KYHA 2LIGA 4ZLDA 2NUPB 1G4WR 2G3KA 5JLIA 5L0FA 1F1MA 3LLIA 3B71A 2OEXA 1ZHTA 2B0HA 3LLKA 5AC4A 1K04A 2P0NA 1T6IA 2ZXWC 4A2NB 3K1HA 1OW7A 4EBBA 3TK0A 2G62A 2PNOA 2Q3TA 5L0CA 2EPLX 4K0DA 4PR9A 1RJ9B 1BDJB 2JPUA 1KU2A 2XLVA 3RQEA 5JP7A 5JS5A 3QW1A 2HUJA 2R9RB 1FMWA 3C63A 4GEHA 3VYWA 2OKUA 2XLEA 3ZQVA 4Z9IA 1OXKA 3U8VA 2HJMA 3PCVA 3U9JA 4CS7A 1TFOB 3NYLA 4C3BA 1ORJA 2J0XA 2Z15A 3JCUQ 2R7XA 2YVKA 3TOLA 4I3MA 2E87A 2KSFA 2AVKA 3GEEA 3SZRA 3ZG1A 4AL1A 2OOCA 3PDMP 1YJGA 4Q5SF 3C8GA 3OEOA 3LS0A 3S27A 2XRHA 3C7JA 2L81A 4FESA 1V4AA 2Q9CA 1FNTc 3EHMA 1JPJA 3EZHA 3NG1A 3ZTZA 4N6CA 1MMNA 1Q0FA 2HS5A 3RQGA 3B0PA 3K6BA 3QVYA 4YK5A 1HE1A 4YT5A 4DRIB 4QI2A 1ZW2A 3X1OA 2XXAA 1BR4A 3T4RA 5A6AA 3F47A 3ZTMA 4XPYA 4KNVA 5B1BC 2XM0A 4E18A 5KYUB 1BBHA 3SXZA 1ZU4A 2O9XA 3NYJA 2WL8A 4N06A 2GDCA 2J0WA 1OXBA 2Q4FA 2V26A 4EKWA 1MMDA 3EFOA 4IAOA 4U5BE 2IXNA 2ZXPA 2P1AA 1JOGA 1VMAA 2J9BA 2PX3A 3M4BA 5L0HA 4XWJA 3S9OA 5COGA 2D4UA 4KNWA
chains in the Genus database with same CATH topology
1O87A 4CBEA 4BJ5A 1LKXA 3B0UX 2R7OA 2ZXOA 2CNWD 3S29A 4CS8C 4CS9A 3LS1A 3LESA 3EG9B 5T1DB 1RJ9A 3NDBB 3I5PA 5DVWA 4U5FE 1O5HA 2EILC 1TR2A 1ST6A 2H7VC 1QZXA 1J8MF 1M2VB 4FX5A 3AG4C 2R7WA 4IJJA 4JJGA 2R7TA 4YJWA 1Z63A 2M4EA 3EGXB 2A1DD 4PJNA 2H7BA 3QMKA 1BR1A 2ZPAA 3CQZA 3K7DA 4WJ0A 4C3EA 2D5RB 4OIOF 3AG1C 4JW1A 2VB6A 3CSKA 4W8KA 2J7PA 2PF4E 1NG1A 3JYHA 4JCHA 4YT4A 3POVA 3ZIBA 2R7SA 5KYUA 2A6EF 3EH2A 2CW0F 2PX0A 2FFHA 4F4BA 3NKEA 3UMKA 1OCZC 2NUTB 4G7OF 5DLJA 3B9QA 3FVYA 3V7OA 2JD3A 4U5CE 2IYLD 2J45A 2Q9BA 2H7OA 4O6YA 2QTVA 2WVQA 5D92A 4BJ6C 2Y69C 4YT8A 3DM5A 5IY5C 3IEEA 1SMYF 1IW7F 3H65A 3EG9A 3EH1A 4HFKB 4NY3A 3ZVRA 5E3CA 2Y3GA 4H4KC 3T6BA 5DQZA 3SNHA 2KNHA 3AG2C 4HFFB 5F5HA 4G7ZF 1OKKD 4U5EE 4PJMA 2R7QA 1PCXA 2P7VA 4DBRA 3S0XA 5EGYA 4XLPF 4OIPF 1M2VA 3EGDB 4OD5A 1MMAA 3JT1A 1G8XA 5DS4A 3JSZA 5L3QA 1TWGA 3EGXA 3MX3A 3W8IA 4LLCA 2FGYA 2MYSA 3LAYA 2I8BA 4BEJA 3CZ6A 1SZIA 1ZU5A 4CSAA 2XL4A 4MNDA 4ZLCA 4BJTA 1V54C 1ZHYA 3EJNA 2Q9AA 2WVNA 3ABLC 1MNEA 3O39A 3NKDA 4EWCA 4C7OB 2NUTA 1V55C 5KYWB 5T3WA 3W2WA 3K66A 1LS1A 3DD7A 1M2OA 1TWCA 4XLNF 3WG7C 3FDQA 5B1AC 2KGOA 1MMGA 4PJJA 3ABMC 4M63A 2OG2A 4LLEA 3RYLA 4G0HA 1D1BA 3FHDA 1ZHXA 4RD9A 3L0IA 3N0TA 4IWBA 2NUPA 3PHF2 4DVYP 3I4UA 3RIPA 2Y39A 1FTSA 1Z3IX 2J46A 2KW3C 3GANA 4I1MA 3EHNA 3T6JA 4CIHA 2J9VA 3EGDA 1OCCC 4YT2A 1OCRC 3KL4A 1D0XA 4PK4A 2WZFA 3N2ZB 2C04A 2VASA 3UGOA 3ABKC 5KYXB 2OCCC 2IOQA 2HV6A 1PD1A 2B0JA 4C3DA 4YN0B 4AX2A 1QLEC 3FAJA 4OIQF 5E3AA 3RKOF 1N1CA 2WZGA 2V3CC 4C7OA 4I1OB 5KYWA 2P6VA 2XSEA 4PJLA 3Q7GA 3AQCA 3DJUB 4CS8A 2VH3A 1FFTC 4HE8D 3NRHA 3ZSUA 4KBLA 1NU9C 2L9JA 5B3SC 1S7ZA 4U5GA 1Z6AA 1SF8A 2DYSC 1ZHWA 5CI8A 4OD4A 3SYNA 3DAGA 4BG0A 2X51A 4RBNA 4OINF 2J7PD 4DOZA 4U5HA 3OA1A 1VYKA 5F5FA 2R7UA 1D1CA 2IXPA 3LNRA 3Q6NA 2MWQA 3DXJF 4J32B 3W8HA 2BE5F 2DGJA 3OWTA 2C03A 5E33A 3SEOA 3JRTA 5EHHA 2LSEA 5DS5A 5KYXA 3B0VC 5DS6A 1FMVA 2YEVA 2WVOA 2DYRC 4DVZA 1FFHA 3EPVA 2W9YA 3DZAA 4Q7CA 3O6XA 4G7HF 5T3TA 4O6MA 4BJ1A 4AK9A 1ZHZA 4JVSA 3DAFA 4BJ6A 1M57C 2W4MA 2R7VA 3HTKC 3I5QA 3E70C 4OIRF 5KYNA 2W4BA 3GODA 2IXMA 2HV7A 3ZC4A 4RDAA 4KI2A 2W45A 1VK5A 4IRUA 4BJ5C 2EIKC 4LERA 5DQTA 4CS9C 2J9WA 3MLGA 3HLZA 1D1AA 2QY9A 1Z23A 3QZCA 3Q6MA 1D0YA 3ASNC 2G3VA 4PFOA 3NYMA 5KYYB 3AG3C 4MQ9F 4B6IA 3ECSA 4U5DE 2CNWA 3L34A 3K33A 3LEVA 2EIMC 2CDQA 1TWHA 3N24A 4LACB 2CGEA 3VAYA 4XTKA 4YWQA 5HSWA 2Y3DA 2KQ9A 3EQLF 3F46A 4E7SA 1PD0A 3EZIA 3UGPA 5BUOA 4K7BA 2ZXRA 1LVKA 2EIJC 3E9VA 5D91A 4AE4B 1D0ZA 1ZYRF 1Z5ZA 4O79A 4ULWA 5L3VA 4O6NA 3X2QC 4KC9A 5CI9A 4FWVA 2Y3BA 3ITFA 2A68F 1NU7D 3RFYA 4Q4ZF 1IZMA 3K1IC 4E7ZA 1VYIA 4DBQA 1TWAA 2A6HF 4I44A 3SP1A 4JJFA 2A69F 3UMHA 3TD7A 2WZLA 3M1CB 3WODF 4O7GA 2YZSA 4JURI 4QDLA 2KJGA 1NZEA 4GYTA 3S28A 3ASOC 4ANJA 2IXOA 1W2WA 3RH3A 2GFHA 3LJBA 5KYYA 3HJCA 3UMIA 5FCLA 5E2QA 2EINC 3Q7LA 3DM9B 1JPNA 3KH2A 3PMRA 4P6IC 4PFPA 2NG1A 2XXAB 3UNGC 4HEAJ 3KKBA 3AQBA 1MNDA 4X0RA 1VOMA 2YHSA 3DMDA 1BR2A 3DJNB 2PP4A 1OKKA 3UR3C 4QI0A 4AE4A 1J8YF 3EFOB 4JZAA 3W2VA 1WGWA 4CSAC 2PFDA 2WB7A 2J9UA 3KMIA 2R7RA 1OCOC 4J30B 2Y3HA 1TKNA 1M56C 4ZLDA 2NUPB 2G3KA 3LLIA 1ZHTA 3LLKA 2ZXWC 4A2NB 3K1HA 4EBBA 2G62A 2Q3TA 4K0DA 1RJ9B 1KU2A 1FMWA 4GEHA 3VYWA 4CS7A 3NYLA 4C3BA 2Z15A 2J0XA 3JCUQ 2R7XA 4I3MA 2E87A 3SZRA 3ZG1A 4Q5SF 3OEOA 3S27A 3LS0A 2XRHA 2L81A 4FESA 2Q9CA 3EHMA 1JPJA 3EZHA 3NG1A 1MMNA 3B0PA 3K6BA 4YT5A 4QI2A 3X1OA 2XXAA 1BR4A 3T4RA 3F47A 4KNVA 5B1BC 5KYUB 1ZU4A 2O9XA 3NYJA 2WL8A 4N06A 2J0WA 2V26A 1MMDA 3EFOA 4IAOA 4U5BE 2IXNA 2ZXPA 1VMAA 2PX3A 4XWJA 4KNWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HFF B;  4HFK B;  4B6I A;  4J32 B;  4AX2 A;  4J30 B;  3ZIB A;  4JUR I; 
#chains in the Genus database with same CATH topology
 1O87 A;  1YDI A;  4CBE A;  3GM3 A;  4NTA A;  4MS2 A;  1ZVZ A;  5A6K A;  4BJ5 A;  1LKX A;  1GQA A;  3B0U X;  4XEV A;  1C17 M;  1L3P A;  2EPN A;  2HMQ A;  2R7O A;  1APC A;  2OJQ A;  2CNW D;  2YRF A;  2ZXO A;  3S29 A;  4CS9 A;  4CS8 C;  3HNI A;  3LS1 A;  4P9T A;  3LES A;  3EG9 B;  1WWP A;  3S90 A;  5T1D B;  1RJ9 A;  3NDB B;  3I5P A;  5DVW A;  3A11 A;  1EKY A;  4CDA A;  3C8Z A;  1WN0 A;  2YL1 A;  2CYD A;  1E84 A;  2HJ3 A;  1BZ4 A;  4U5F E;  1O5H A;  1JR8 A;  3S84 A;  1TFK B;  2EIL C;  1TR2 A;  1ST6 A;  1GGQ A;  2H7V C;  1J8M F;  1QZX A;  5BQG A;  1M2V B;  4FX5 A;  3U5S A;  3WAQ A;  3AG4 C;  1XZP A;  3QW0 A;  3GM1 A;  4IJJ A;  4JJG A;  4CX9 A;  2R7W A;  2R7T A;  2YL3 A;  4YJW A;  3NMI A;  5BQH A;  1FAP B;  1Z63 A;  1SR2 A;  3HNK A;  2M4E A;  3EGX B;  4JEA A;  5K0I A;  2A1D D;  1LI5 A;  2H7B A;  3QMK A;  4PJN A;  3V5Z A;  1BR1 A;  2ZPA A;  3CQZ A;  3K7D A;  2HSQ A;  4WJ0 A;  3U8P A;  4C3E A;  1Q0G A;  2D5R B;  3BEH A;  2AWY A;  4OIO F;  4MTG A;  2P61 A;  3AG1 C;  3M15 A;  4JW1 A;  4XPX A;  1NBB A;  1RCP A;  2VB6 A;  1MQV A;  3CSK A;  4W8K A;  2J7P A;  2PF4 E;  2IM8 A;  2M64 A;  1NG1 A;  3JYH A;  4JCH A;  4YT4 A;  3POV A;  3M79 A;  256B A;  3ZIB A;  1EQ1 A;  1EA8 A;  3ATP A;  1QKR A;  5KYU A;  2R7S A;  2A6E F;  3EH2 A;  2TMV P;  2CW0 F;  2PX0 A;  2FFH A;  4F4B A;  3SXM A;  3NKE A;  2UUI A;  3UMK A;  1OCZ C;  2NUT B;  4G7O F;  4FAP B;  5DLJ A;  3B9Q A;  3FVY A;  3V7O A;  2JD3 A;  4U5C E;  2IYL D;  2J45 A;  1XZQ A;  2Q9B A;  2ZD9 A;  2H7O A;  1LIH A;  3HNL A;  3K1I A;  4O6Y A;  1WAS A;  2QTV A;  3JTL O;  4CJG A;  4MW8 A;  4D4X A;  2WVQ A;  3C62 A;  1AEP A;  1T6Q A;  5D92 A;  4BJ6 C;  2Y69 C;  2QLA A;  4YT8 A;  1E85 A;  3DM5 A;  5BQI A;  1OQC A;  5L0J A;  2YWA A;  3IEE A;  5IY5 C;  1SMY F;  5A6B A;  1IW7 F;  4J7T A;  2YQY A;  3H65 A;  3FMS A;  3EG9 A;  3EH1 A;  4ULV A;  4HFK B;  4NY3 A;  4MVS A;  2F22 A;  1HE9 A;  1PV3 A;  2LFF A;  5E3C A;  2HZ8 A;  3GOR A;  3ZVR A;  2Y3G A;  4H4K C;  2DB4 A;  3L8I A;  2X0C A;  3T6B A;  5DQZ A;  3SNH A;  2KNH A;  3AG2 C;  4HFF B;  5F5H A;  4G7Z F;  1OKK D;  1YYJ A;  2L6F A;  4PJM A;  4U5E E;  2R7Q A;  2Q7R A;  2YLD A;  1PCX A;  3J06 A;  2P7V A;  4DBR A;  3AGT A;  3S0X A;  5EGY A;  3JYY A;  4XLP F;  4MVQ A;  4OIP F;  1M2V A;  1VLS A;  3EGD B;  4OD5 A;  1MMA A;  1QVX A;  3FAP B;  1CPQ A;  1Q0D A;  3JRM O;  3JT1 A;  3MYI A;  1G8X A;  5DS4 A;  4MVO A;  3JSZ A;  4Z9J A;  5L3Q A;  3IQC A;  1TWG A;  3EGX A;  3FXH A;  2QNL A;  2AP3 A;  2LP4 A;  2HSB A;  3MX3 A;  3TJ6 A;  3W8I A;  4LLC A;  5A6J A;  2FGY A;  1E83 A;  3SXY A;  4BPM A;  2HFI A;  2EPK X;  1CGM E;  3U2L A;  1HW2 A;  2XL8 A;  2MYS A;  2KC3 A;  3LAY A;  2I8B A;  4BEJ A;  3CZ6 A;  5FZT A;  4LDK A;  1SZI A;  4W8P A;  1ZU5 A;  4CSA A;  2XL4 A;  4MND A;  4ZLC A;  4BJT A;  5AC5 A;  1V54 C;  1ZHY A;  2VC9 A;  3EJN A;  2Q9A A;  2WVN A;  4JTC B;  4WGY A;  3ABL C;  1MNE A;  3O39 A;  5COM A;  4E0I A;  3FOO A;  3NKD A;  3DWW A;  2LQG A;  4EWC A;  5B3I A;  4C7O B;  3RW0 A;  4MVU A;  2NUT A;  1V55 C;  5KYW B;  1RMV A;  1OR3 A;  1K05 A;  5T3W A;  3W2W A;  2XS8 A;  3K66 A;  1LS1 A;  1T9K A;  1M2O A;  1RKE B;  3DD7 A;  4ER9 A;  1TWC A;  1LS4 A;  2XLO A;  3JZ0 A;  4XLN F;  4IAQ A;  2NSF A;  1OR2 A;  3WG7 C;  3FDQ A;  3C8G D;  5B1A C;  1ZZP A;  2KGO A;  3TUL A;  1MMG A;  3A9C A;  4PJJ A;  2LCH A;  3ABM C;  1NSG B;  3GEI A;  4M63 A;  1OW6 A;  1AVO B;  2OG2 A;  4LLE A;  3RYL A;  4G0H A;  1I4Y A;  2UUH A;  3KYJ A;  1D1B A;  2NSG A;  3FHD A;  1YYX A;  1U6H A;  5HV9 A;  1ZHX A;  4RD9 A;  3L0I A;  5TJ5 E;  2YLI A;  3ZQY A;  3BRJ A;  4PAC A;  2R05 A;  3N0T A;  4IWB A;  2NUP A;  3W4Y A;  1NFO A;  2VCC A;  2HKV A;  3PHF 2;  4DVY P;  2ASR A;  3I4U A;  3HNJ A;  3RIP A;  4UDV A;  2Y39 A;  4JTA B;  3FOP A;  1FTS A;  3V5X A;  2YL0 A;  2YL7 A;  1Z3I X;  5L0G A;  2J46 A;  2KW3 C;  4EIY A;  3VM6 A;  1YZA A;  2XLD A;  3GAN A;  4I1M A;  1K40 A;  3EHN A;  3T6J A;  2GA0 A;  2DI3 A;  4CIH A;  1B68 A;  2L6G A;  2J9V A;  3EGD A;  1OCC C;  5JT4 A;  4YL0 A;  4YT2 A;  3CEX A;  1OCR C;  3KL4 A;  1WAT A;  1D0X A;  4H54 A;  1A41 A;  4PK4 A;  3G4Z A;  1ORS C;  4WAB A;  2WZF A;  4NCQ A;  3N2Z B;  2C04 A;  2VAS A;  3UGO A;  2GAQ A;  2R03 A;  2RD9 A;  2L7A A;  3ABK C;  5KYX B;  2LFD A;  2OCC C;  2IOQ A;  1YVI A;  1QSP A;  2CCY A;  4IAR A;  2HV6 A;  1VLT A;  1PD1 A;  2B0J A;  1U89 A;  1HMO A;  3TQO A;  2NPU A;  4C3D A;  4YN0 B;  3KYI A;  4AX2 A;  1KNY A;  1QLE C;  1CGN A;  1T01 A;  4ONS A;  3SXK A;  3FAJ A;  3G50 A;  4P9F A;  3U0C A;  4OIQ F;  3QTH A;  5E3A A;  3RKO F;  1N1C A;  2BC5 A;  2WZG A;  1HW1 A;  4XEF A;  2V3C C;  4C7O A;  4I1O B;  5KYW A;  1YLM A;  1YA9 A;  4DRH B;  2P6V A;  4L6R A;  2XSE A;  4PJL A;  3Q7G A;  1RKE A;  3AQC A;  3DJU B;  3R7C A;  2RSE B;  4CS8 A;  2VH3 A;  5CIV A;  1FFT C;  3IQT A;  2AU5 A;  4HE8 D;  3NRH A;  3ZSU A;  3LNM B;  1NU9 C;  1T5O A;  4KBL A;  2L9J A;  5GPG B;  2OJE D;  1G5Z A;  5B3S C;  1S7Z A;  1Q0K A;  1LM3 B;  2R25 A;  2YLG A;  4JKV A;  4U5G A;  1Z6A A;  1SF8 A;  2DYS C;  1ZHW A;  5CI8 A;  4OD4 A;  1RKC A;  4CDV A;  4JEB A;  4IGG A;  4EUK B;  3SYN A;  3DAG A;  4BG0 A;  2X51 A;  4RBN A;  3V5Y A;  4OIN F;  2J7P D;  2QE9 A;  1DOV A;  2L6H A;  4JE9 A;  4DOZ A;  4CDY A;  4U5H A;  4J7Y A;  4DJ9 A;  1A0B A;  3U9M A;  3LUT B;  3OA1 A;  1VYK A;  5F5F A;  2R7U A;  4CIP A;  2R02 A;  3MYF A;  1D1C A;  2IXP A;  3LNR A;  4NC3 A;  4E17 A;  3Q6N A;  2MWQ A;  2Q00 A;  3DXJ F;  3GEH A;  4J32 B;  3W8H A;  2BE5 F;  1NLX A;  2DGJ A;  3OWT A;  1Z7Q c;  1CGO A;  1I5N A;  3GM2 A;  4LDR A;  4MTO A;  2C03 A;  5E33 A;  4BEM J;  3SEO A;  3JRT A;  5EHH A;  2LSE A;  4JIO A;  1VB5 A;  3DKA A;  4XQ1 A;  3GWL A;  5DS5 A;  5JVE A;  5KYX A;  1LPE A;  4JCZ A;  1HMD A;  3L8J A;  2OU6 A;  4EBK A;  1JMW A;  4DXW A;  2FAP B;  5DS6 A;  5A6B D;  3B0V C;  2IBF A;  1FMV A;  2YEV A;  2WVO A;  2DYR C;  2XM4 A;  4JC7 A;  4DVZ A;  1FFH A;  3EPV A;  3QVZ A;  2W9Y A;  3DZA A;  3O55 A;  4Q7C A;  3O6X A;  4G7H F;  5T3T A;  4O6M A;  4D4N A;  4BJ1 A;  4AK9 A;  1ZHZ A;  2XLM A;  4JVS A;  3DAF A;  3B29 A;  3L1M A;  3LEO A;  4MVR A;  4NQF A;  4BJ6 A;  1M57 C;  3IPM O;  2W4M A;  3U3F A;  4E0H A;  1AUE A;  2EPM X;  2ETS A;  2R7V A;  3HTK C;  3I5Q A;  3E70 C;  5EK0 A;  4OIR F;  2QUP A;  5KYN A;  1GM5 A;  2W4B A;  3RF3 A;  2YKZ A;  2IXM A;  2HV7 A;  3GOD A;  3ZC4 A;  4RDA A;  4KI2 A;  2W45 A;  1VK5 A;  4IRU A;  4N6H A;  5JSL A;  1U0B B;  1JRA A;  1WTY A;  4BJ5 C;  1H9G A;  5L0I A;  3JSE O;  2EIK C;  4LER A;  1EI7 A;  5DQT A;  4CS9 C;  1H7I A;  2J9W A;  1CPR A;  3HLZ A;  3MLG A;  1D1A A;  4MW3 A;  2OEV A;  4YL3 A;  4AL0 A;  3T6G B;  5JUA A;  2QY9 A;  3DI5 A;  1Z23 A;  3IQ5 A;  3RQF A;  4G78 A;  1R5I D;  4WGZ A;  3M4C A;  3QZC A;  3TOM A;  3Q6M A;  2VCB A;  1D0Y A;  2J8W A;  3ASN C;  2G3V A;  4YL1 A;  4PFO A;  1V74 B;  3NYM A;  3R2P A;  2VCA A;  4IB4 A;  3T9O A;  5KYY B;  1NFN A;  3AG3 C;  1YA7 O;  4MQ9 F;  4B6I A;  3ECS A;  2A0U A;  3MBG A;  4U5D E;  2CNW A;  3L34 A;  3RVY A;  1UG7 A;  3K33 A;  3LEV A;  2EIM C;  1L7C A;  2CDQ A;  1TWH A;  1A7E A;  3N24 A;  4LAC B;  2CGE A;  5AGF A;  4R32 A;  1C03 A;  2HMZ A;  4NTB A;  4JRZ A;  4XTK A;  3VAY A;  4YWQ A;  1ZW3 A;  5HSW A;  2Y3D A;  2KQ9 A;  3EQL F;  3F46 A;  3RVZ A;  1PD0 A;  4E7S A;  3EZI A;  1HY5 A;  2XS1 A;  3UGP A;  5BUO A;  1Y6D A;  1TQG A;  2ICW G;  3AJM A;  4K7B A;  2ZXR A;  1LVK A;  2EIJ C;  2H8A A;  3E9V A;  1H6G A;  3O10 A;  1R4T A;  2XLW A;  4Z9H A;  2JX0 A;  5D91 A;  4AE4 B;  1D0Z A;  1ZYR F;  1Z5Z A;  3AGU A;  1C02 A;  4O79 A;  3U3B A;  4ULW A;  1XWJ A;  1YZC A;  1E2X A;  4EBJ A;  4MVM A;  5L3V A;  3IQ6 A;  2MHR A;  4O6N A;  3X2Q C;  2KK1 A;  4KC9 A;  4GQH A;  5CI9 A;  3C18 A;  4FWV A;  2Y3B A;  4XEK A;  1OW8 A;  3ITF A;  2A68 F;  1VTM P;  1NU7 D;  3RFY A;  2AWC A;  4MTF A;  2PBE A;  4Q4Z F;  1IZM A;  1QPU A;  4XPW A;  3K1I C;  1WOL A;  4E7Z A;  1VYI A;  4DBQ A;  1TWA A;  2A6H F;  5L0D A;  4I44 A;  3KPH A;  3SP1 A;  4JJF A;  1O3U A;  3G4X A;  2A69 F;  3UMH A;  3AOU A;  4JTD B;  3TJ5 A;  1DOW A;  3TD7 A;  2WZL A;  3M1C B;  3US6 A;  3GWN A;  3ZWI A;  4DRJ B;  1LI7 A;  3WOD F;  1G4U S;  1SYQ A;  2BL2 A;  4O7G A;  4NTF A;  1Q0M A;  2LD6 A;  4CJO A;  5A69 A;  2YZS A;  4JUR I;  4MVZ A;  4QDL A;  2KJG A;  2LK4 A;  1NZE A;  4GYT A;  3S28 A;  1RXQ A;  3ASO C;  4ANJ A;  4N4W A;  1S05 A;  3ZDL A;  3C8G B;  3WHN A;  2IXO A;  1W2W A;  3RH3 A;  2GFH A;  3LJB A;  5COF A;  5F28 E;  5KYY A;  3HJC A;  3UMI A;  5FCL A;  4A4A A;  4K1O A;  4LDQ A;  5E2Q A;  2EIN C;  1KTM A;  1M6T A;  1A7D A;  1FR0 A;  3Q7L A;  3DM9 B;  1JPN A;  2EPO A;  3KH2 A;  3PMR A;  2A0B A;  2I15 A;  4P6I C;  4PFP A;  4U9E A;  2NG1 A;  2XXA B;  3VRC A;  1JAF A;  1YAR O;  3UNG C;  4HEA J;  3KKB A;  3AQB A;  1MND A;  4X0R A;  1VOM A;  1YAU O;  3DE8 A;  3CAX A;  3NMJ A;  1LE4 A;  2YHS A;  1BR2 A;  3DJN B;  3DMD A;  3HKK A;  1UFB A;  4EHP A;  1A7V A;  1OKK A;  2PP4 A;  3H2U A;  3DE9 A;  1I4Z A;  3UR3 C;  1T6U A;  4QI0 A;  1H9T A;  4AE4 A;  1J8Y F;  3EFO B;  4JZA A;  3U2M A;  1WGW A;  3W2V A;  2PFD A;  5JRA A;  1E86 A;  1LE2 A;  4CSA C;  2WB7 A;  2J9U A;  3KMI A;  3NMK A;  3VF0 A;  1GS9 A;  1Y4C A;  2XL6 A;  3IHU A;  2OQM A;  1QQ3 A;  3H2V A;  2R7R A;  1OCO C;  3MFN A;  4J30 B;  2Y3H A;  1TKN A;  1M56 C;  1ORY A;  2XLH A;  4U9D A;  2GWW A;  2KYH A;  2LIG A;  4ZLD A;  2NUP B;  1G4W R;  2G3K A;  5JLI A;  5L0F A;  1F1M A;  3LLI A;  3B71 A;  2OEX A;  1ZHT A;  2B0H A;  3LLK A;  5AC4 A;  1K04 A;  2P0N A;  1T6I A;  2ZXW C;  4A2N B;  3K1H A;  1OW7 A;  4EBB A;  3TK0 A;  2G62 A;  2PNO A;  2Q3T A;  5L0C A;  2EPL X;  4K0D A;  4PR9 A;  1RJ9 B;  1BDJ B;  2JPU A;  1KU2 A;  2XLV A;  3RQE A;  5JP7 A;  5JS5 A;  3QW1 A;  2HUJ A;  2R9R B;  1FMW A;  3C63 A;  4GEH A;  3VYW A;  2OKU A;  2XLE A;  3ZQV A;  4Z9I A;  1OXK A;  3U8V A;  2HJM A;  3PCV A;  3U9J A;  4CS7 A;  1TFO B;  3NYL A;  4C3B A;  1ORJ A;  2J0X A;  2Z15 A;  3JCU Q;  2R7X A;  2YVK A;  3TOL A;  4I3M A;  2E87 A;  2KSF A;  2AVK A;  3GEE A;  3SZR A;  3ZG1 A;  4AL1 A;  2OOC A;  3PDM P;  1YJG A;  4Q5S F;  3C8G A;  3OEO A;  3LS0 A;  3S27 A;  2XRH A;  3C7J A;  2L81 A;  4FES A;  1V4A A;  2Q9C A;  1FNT c;  3EHM A;  1JPJ A;  3EZH A;  3NG1 A;  3ZTZ A;  4N6C A;  1MMN A;  1Q0F A;  2HS5 A;  3RQG A;  3B0P A;  3K6B A;  3QVY A;  4YK5 A;  1HE1 A;  4YT5 A;  4DRI B;  4QI2 A;  1ZW2 A;  3X1O A;  2XXA A;  1BR4 A;  3T4R A;  5A6A A;  3F47 A;  3ZTM A;  4XPY A;  4KNV A;  5B1B C;  2XM0 A;  4E18 A;  5KYU B;  1BBH A;  3SXZ A;  1ZU4 A;  2O9X A;  3NYJ A;  2WL8 A;  4N06 A;  2GDC A;  2J0W A;  1OXB A;  2Q4F A;  2V26 A;  4EKW A;  1MMD A;  3EFO A;  4IAO A;  4U5B E;  2IXN A;  2ZXP A;  2P1A A;  1JOG A;  1VMA A;  2J9B A;  2PX3 A;  3M4B A;  5L0H A;  4XWJ A;  3S9O A;  5COG A;  2D4U A;  4KNW A; 
#chains in the Genus database with same CATH homology
 1O87 A;  4CBE A;  4BJ5 A;  1LKX A;  3B0U X;  2R7O A;  2ZXO A;  2CNW D;  3S29 A;  4CS8 C;  4CS9 A;  3LS1 A;  3LES A;  3EG9 B;  5T1D B;  1RJ9 A;  3NDB B;  3I5P A;  5DVW A;  4U5F E;  1O5H A;  2EIL C;  1TR2 A;  1ST6 A;  2H7V C;  1QZX A;  1J8M F;  1M2V B;  4FX5 A;  3AG4 C;  2R7W A;  4IJJ A;  4JJG A;  2R7T A;  4YJW A;  1Z63 A;  2M4E A;  3EGX B;  2A1D D;  4PJN A;  2H7B A;  3QMK A;  1BR1 A;  2ZPA A;  3CQZ A;  3K7D A;  4WJ0 A;  4C3E A;  2D5R B;  4OIO F;  3AG1 C;  4JW1 A;  2VB6 A;  3CSK A;  4W8K A;  2J7P A;  2PF4 E;  1NG1 A;  3JYH A;  4JCH A;  4YT4 A;  3POV A;  3ZIB A;  2R7S A;  5KYU A;  2A6E F;  3EH2 A;  2CW0 F;  2PX0 A;  2FFH A;  4F4B A;  3NKE A;  3UMK A;  1OCZ C;  2NUT B;  4G7O F;  5DLJ A;  3B9Q A;  3FVY A;  3V7O A;  2JD3 A;  4U5C E;  2IYL D;  2J45 A;  2Q9B A;  2H7O A;  4O6Y A;  2QTV A;  2WVQ A;  5D92 A;  4BJ6 C;  2Y69 C;  4YT8 A;  3DM5 A;  5IY5 C;  3IEE A;  1SMY F;  1IW7 F;  3H65 A;  3EG9 A;  3EH1 A;  4HFK B;  4NY3 A;  3ZVR A;  5E3C A;  2Y3G A;  4H4K C;  3T6B A;  5DQZ A;  3SNH A;  2KNH A;  3AG2 C;  4HFF B;  5F5H A;  4G7Z F;  1OKK D;  4U5E E;  4PJM A;  2R7Q A;  1PCX A;  2P7V A;  4DBR A;  3S0X A;  5EGY A;  4XLP F;  4OIP F;  1M2V A;  3EGD B;  4OD5 A;  1MMA A;  3JT1 A;  1G8X A;  5DS4 A;  3JSZ A;  5L3Q A;  1TWG A;  3EGX A;  3MX3 A;  3W8I A;  4LLC A;  2FGY A;  2MYS A;  3LAY A;  2I8B A;  4BEJ A;  3CZ6 A;  1SZI A;  1ZU5 A;  4CSA A;  2XL4 A;  4MND A;  4ZLC A;  4BJT A;  1V54 C;  1ZHY A;  3EJN A;  2Q9A A;  2WVN A;  3ABL C;  1MNE A;  3O39 A;  3NKD A;  4EWC A;  4C7O B;  2NUT A;  1V55 C;  5KYW B;  5T3W A;  3W2W A;  3K66 A;  1LS1 A;  3DD7 A;  1M2O A;  1TWC A;  4XLN F;  3WG7 C;  3FDQ A;  5B1A C;  2KGO A;  1MMG A;  4PJJ A;  3ABM C;  4M63 A;  2OG2 A;  4LLE A;  3RYL A;  4G0H A;  1D1B A;  3FHD A;  1ZHX A;  4RD9 A;  3L0I A;  3N0T A;  4IWB A;  2NUP A;  3PHF 2;  4DVY P;  3I4U A;  3RIP A;  2Y39 A;  1FTS A;  1Z3I X;  2J46 A;  2KW3 C;  3GAN A;  4I1M A;  3EHN A;  3T6J A;  4CIH A;  2J9V A;  3EGD A;  1OCC C;  4YT2 A;  1OCR C;  3KL4 A;  1D0X A;  4PK4 A;  2WZF A;  3N2Z B;  2C04 A;  2VAS A;  3UGO A;  3ABK C;  5KYX B;  2OCC C;  2IOQ A;  2HV6 A;  1PD1 A;  2B0J A;  4C3D A;  4YN0 B;  4AX2 A;  1QLE C;  3FAJ A;  4OIQ F;  5E3A A;  3RKO F;  1N1C A;  2WZG A;  2V3C C;  4C7O A;  4I1O B;  5KYW A;  2P6V A;  2XSE A;  4PJL A;  3Q7G A;  3AQC A;  3DJU B;  4CS8 A;  2VH3 A;  1FFT C;  4HE8 D;  3NRH A;  3ZSU A;  4KBL A;  1NU9 C;  2L9J A;  5B3S C;  1S7Z A;  4U5G A;  1Z6A A;  1SF8 A;  2DYS C;  1ZHW A;  5CI8 A;  4OD4 A;  3SYN A;  3DAG A;  4BG0 A;  2X51 A;  4RBN A;  4OIN F;  2J7P D;  4DOZ A;  4U5H A;  3OA1 A;  1VYK A;  5F5F A;  2R7U A;  1D1C A;  2IXP A;  3LNR A;  3Q6N A;  2MWQ A;  3DXJ F;  4J32 B;  3W8H A;  2BE5 F;  2DGJ A;  3OWT A;  2C03 A;  5E33 A;  3SEO A;  3JRT A;  5EHH A;  2LSE A;  5DS5 A;  5KYX A;  3B0V C;  5DS6 A;  1FMV A;  2YEV A;  2WVO A;  2DYR C;  4DVZ A;  1FFH A;  3EPV A;  2W9Y A;  3DZA A;  4Q7C A;  3O6X A;  4G7H F;  5T3T A;  4O6M A;  4BJ1 A;  4AK9 A;  1ZHZ A;  4JVS A;  3DAF A;  4BJ6 A;  1M57 C;  2W4M A;  2R7V A;  3HTK C;  3I5Q A;  3E70 C;  4OIR F;  5KYN A;  2W4B A;  3GOD A;  2IXM A;  2HV7 A;  3ZC4 A;  4RDA A;  4KI2 A;  2W45 A;  1VK5 A;  4IRU A;  4BJ5 C;  2EIK C;  4LER A;  5DQT A;  4CS9 C;  2J9W A;  3MLG A;  3HLZ A;  1D1A A;  2QY9 A;  1Z23 A;  3QZC A;  3Q6M A;  1D0Y A;  3ASN C;  2G3V A;  4PFO A;  3NYM A;  5KYY B;  3AG3 C;  4MQ9 F;  4B6I A;  3ECS A;  4U5D E;  2CNW A;  3L34 A;  3K33 A;  3LEV A;  2EIM C;  2CDQ A;  1TWH A;  3N24 A;  4LAC B;  2CGE A;  3VAY A;  4XTK A;  4YWQ A;  5HSW A;  2Y3D A;  2KQ9 A;  3EQL F;  3F46 A;  4E7S A;  1PD0 A;  3EZI A;  3UGP A;  5BUO A;  4K7B A;  2ZXR A;  1LVK A;  2EIJ C;  3E9V A;  5D91 A;  4AE4 B;  1D0Z A;  1ZYR F;  1Z5Z A;  4O79 A;  4ULW A;  5L3V A;  4O6N A;  3X2Q C;  4KC9 A;  5CI9 A;  4FWV A;  2Y3B A;  3ITF A;  2A68 F;  1NU7 D;  3RFY A;  4Q4Z F;  1IZM A;  3K1I C;  4E7Z A;  1VYI A;  4DBQ A;  1TWA A;  2A6H F;  4I44 A;  3SP1 A;  4JJF A;  2A69 F;  3UMH A;  3TD7 A;  2WZL A;  3M1C B;  3WOD F;  4O7G A;  2YZS A;  4JUR I;  4QDL A;  2KJG A;  1NZE A;  4GYT A;  3S28 A;  3ASO C;  4ANJ A;  2IXO A;  1W2W A;  3RH3 A;  2GFH A;  3LJB A;  5KYY A;  3HJC A;  3UMI A;  5FCL A;  5E2Q A;  2EIN C;  3Q7L A;  3DM9 B;  1JPN A;  3KH2 A;  3PMR A;  4P6I C;  4PFP A;  2NG1 A;  2XXA B;  3UNG C;  4HEA J;  3KKB A;  3AQB A;  1MND A;  4X0R A;  1VOM A;  2YHS A;  3DMD A;  1BR2 A;  3DJN B;  2PP4 A;  1OKK A;  3UR3 C;  4QI0 A;  4AE4 A;  1J8Y F;  3EFO B;  4JZA A;  3W2V A;  1WGW A;  4CSA C;  2PFD A;  2WB7 A;  2J9U A;  3KMI A;  2R7R A;  1OCO C;  4J30 B;  2Y3H A;  1TKN A;  1M56 C;  4ZLD A;  2NUP B;  2G3K A;  3LLI A;  1ZHT A;  3LLK A;  2ZXW C;  4A2N B;  3K1H A;  4EBB A;  2G62 A;  2Q3T A;  4K0D A;  1RJ9 B;  1KU2 A;  1FMW A;  4GEH A;  3VYW A;  4CS7 A;  3NYL A;  4C3B A;  2Z15 A;  2J0X A;  3JCU Q;  2R7X A;  4I3M A;  2E87 A;  3SZR A;  3ZG1 A;  4Q5S F;  3OEO A;  3S27 A;  3LS0 A;  2XRH A;  2L81 A;  4FES A;  2Q9C A;  3EHM A;  1JPJ A;  3EZH A;  3NG1 A;  1MMN A;  3B0P A;  3K6B A;  4YT5 A;  4QI2 A;  3X1O A;  2XXA A;  1BR4 A;  3T4R A;  3F47 A;  4KNV A;  5B1B C;  5KYU B;  1ZU4 A;  2O9X A;  3NYJ A;  2WL8 A;  4N06 A;  2J0W A;  2V26 A;  1MMD A;  3EFO A;  4IAO A;  4U5B E;  2IXN A;  2ZXP A;  1VMA A;  2PX3 A;  4XWJ A;  4KNW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...