3MFNA

Dfer_2879 protein of unknown function from dyadobacter fermentans
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
125
structure length
125
Chain Sequence
AQEAVIEAKRYLNNAKDILRDKGGKEDGFYQDSKYVKMAGHTAYSGVLFALDHYFGKKTKGRKDVDWYKSNLAQQDKKILNTFVSVYEQLHLVMAYDGVGDAEVVKLGFQRAEIIIDWVERRLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of Dfer_2879 protein of unknown function from Dyadobacter fermentans.
rcsb
source organism Dyadobacter fermentans
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 47
structure length 125
sequence length 125
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18498 DUF5618 Domain of unknown function (DUF5618)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3mfnA00
2L6FA 3C18A 3BRJA 1K04A 4XEKA 1KTMA 3TULA 3C8GB 1V4AA 2LK4A 2L6HA 2HSBA 3RQGA 3L8JA 5F28E 2JX0A 3GM3A 3GM2A 3C8GA 3U0CA 3K7DA 3GM1A 4XEVA 1OW6A 4XEFA 4EBJA 1K05A 1JOGA 1O3UA 3JZ0A 3O10A 4EBKA 3C8GD 1OW7A 3RQEA 3U3FA 1UFBA 4R32A 2JPUA 1WTYA 1ZZPA 1KNYA 3JYYA 1WWPA 2PBEA 1PV3A 2L6GA 2KK1A 1OW8A 2Q00A 3AJMA 3S9OA 4NQFA 3RQFA 1WOLA 3L8IA 3MFNA 1K40A 1QVXA 3B71A 2YWAA
chains in the Genus database with same CATH superfamily
2WZGA 3IEEA 3RW0A 3SYNA 4FAPB 2LK4A 2IBFA 3GEIA 5COMA 3DWWA 3Q6NA 4FESA 4ULVA 3X2QC 4DRIB 5F28E 3SZRA 1D0ZA 3R7CA 1R5ID 3Q7LA 2HJ3A 3L1MA 4XEFA 5TJ5E 1H7IA 1MMNA 1TFKB 4OINF 1JOGA 3OWTA 1VOMA 1U6HA 1M6TA 2A6EF 4I44A 2A0UA 3TJ6A 5DLJA 1ZW2A 1FFHA 3ATPA 2FFHA 1KNYA 2Y39A 1FFTC 2YHSA 4PACA 1L7CA 3ITFA 1WWPA 3PCVA 1EA8A 1YAUO 3KL4A 4YN0B 3US6A 2EPMX 3CAXA 3MX3A 2L6GA 2C04A 3AJMA 3EH2A 3RF3A 2ICWG 2R7TA 3EFOB 4DJ9A 1WOLA 1ZHXA 4CBEA 5GPGB 5KYWB 3G4XA 1KTMA 2A1DD 4C3EA 3O39A 4AE4B 3QTHA 3POVA 1LI5A 4ER9A 4CIHA 2WZFA 3ASOC 3B29A 1VMAA 2KC3A 1G8XA 4K1OA 3C8GA 5DS6A 4X0RA 3K1HA 2JD3A 2HMZA 4M63A 4XPXA 1Q0FA 3VM6A 4EBKA 2B0JA 5DQZA 4CX9A 4ZLDA 3S84A 4AX2A 3HTKC 3R2PA 1MMDA 1FNTc 3PHF2 1H9GA 3V5XA 3LESA 1T6UA 2B0HA 1FMWA 3GORA 1Z7Qc 4NTAA 3B0UX 3U2MA 2Y69C 3T6JA 2J9VA 4LDQA 3CSKA 3K1IA 5JUAA 5L0IA 1Z5ZA 3G50A 2ZXWC 4MVRA 5T3TA 3V5ZA 2HZ8A 5L0FA 3HKKA 4U5FE 5DVWA 3U9MA 5E2QA 2C03A 4JJFA 4PJNA 4RDAA 256BA 3VF0A 4Z9IA 1AUEA 4G7ZF 2W4BA 4IJJA 4OIPF 1RJ9B 3RVZA 2XL8A 3JTLO 2PNOA 2HFIA 5JS5A 3LUTB 3ZVRA 2YVKA 3VRCA 3N24A 4Z9JA 3LJBA 3U0CA 2NG1A 1XZPA 1K05A 1YA9A 3GANA 1D1BA 2W4MA 4XWJA 1Y6DA 3RYLA 3NRHA 3SEOA 4WGZA 2QTVA 2R25A 2CGEA 3SP1A 1IZMA 3NDBB 3U8VA 5B1AC 2KK1A 5B3SC 3EJNA 1CPQA 1ORJA 2J0XA 2R05A 4MTFA 1EI7A 1JPJA 4MVQA 4K0DA 2L9JA 1ZU4A 1VTMP 3NYLA 2HSQA 3EFOA 3RIPA 2VC9A 3TULA 4LERA 4IAOA 2XRHA 1LPEA 1C17M 1YYJA 2Q9AA 2WB7A 3JCUQ 4I3MA 3LEVA 1QSPA 1B68A 4G0HA 4XTKA 3SXKA 3RKOF 4KNVA 4U9EA 3HJCA 4U5DE 2R7OA 4AE4A 1OW6A 2D5RB 4IAQA 2OKUA 3U3FA 2KW3C 1BR4A 4BJ6C 2MWQA 1ZZPA 4JZAA 2YLGA 4H4KC 3T6GB 1YYXA 4MW3A 3ZTMA 5L0GA 2L81A 1BR2A 2YL0A 2HJMA 2LCHA 3TD7A 3EGXA 1OXBA 2HMQA 3UMKA 4CSAA 1NU9C 4NQFA 1MMGA 3W8IA 1T9KA 3L8IA 2GWWA 5CIVA 4IB4A 2IM8A 1QQ3A 5F5HA 5A6KA 1LKXA 2L7AA 4JRZA 1HMDA 2GFHA 4O7GA 1QPUA 4J32B 4NCQA 4DBRA 2GA0A 3ZIBA 3MLGA 2NUTA 2J0WA 1UG7A 3KYIA 1LE4A 4OD5A 2EPNA 3AGTA 1RJ9A 3NKEA 1NFNA 1O5HA 4E0HA 3ZDLA 1PD1A 4O79A 3C8GD 2UUIA 1BR1A 5E3AA 3T6BA 1WASA 1PD0A 1V74B 3EQLF 3DE8A 1E85A 3SXMA 4JCZA 3S28A 1OCCC 4Z9HA 4AL0A 4CJOA 1NSGB 2J9BA 2PF4E 1ORSC 2PX3A 2Q00A 2R9RB 3BEHA 5DS5A 5JT4A 4O6NA 4KC9A 1ZHZA 4JJGA 3HLZA 4XQ1A 5KYXA 3L34A 2ASRA 1D0XA 2CCYA 5COFA 5B3IA 2J9UA 3DI5A 3JRMO 1Q0MA 3NMKA 4ONSA 1VLSA 1VLTA 4WABA 3V7OA 3W2WA 1NLXA 2A68F 5BQGA 5IY5C 4A4AA 2RD9A 3KKBA 2P6VA 4IRUA 2G62A 3EHMA 3GM3A 4NTFA 4I1MA 4CS7A 5KYNA 2ZXPA 3K7DA 2UUHA 2WVQA 3LS0A 4IARA 3TJ5A 4DBQA 3HNIA 2OJQA 2YQYA 4FX5A 4MVZA 5HSWA 5L0JA 4BPMA 1ZHWA 4JTAB 4P6IC 1TR2A 4G7OF 4W8KA 2XL4A 1GM5A 3L0IA 3T4RA 2XXAB 2PP4A 3UNGC 4OIOF 2I15A 5B1BC 4JC7A 1Y4CA 3U9JA 1C03A 1OQCA 1CGME 3B0PA 2WZLA 2J7PD 1W2WA 1N1CA 1GS9A 2BL2A 1NZEA 1ZHYA 4XPYA 2A69F 4J7TA 3Q6MA 3C18A 4CS8A 1QKRA 3EZIA 4LACB 1RKCA 1JR8A 1CGOA 5COGA 1YJGA 2Y3BA 1T01A 3E70C 4Q5SF 2VH3A 1SZIA 1OCOC 1QZXA 2KNHA 2QUPA 4RD9A 4CDVA 1NBBA 3K1IC 2CNWD 2EPLX 5E33A 3EPVA 1M2VB 2NPUA 3H65A 1HW2A 2R7VA 4L6RA 3UR3C 1WN0A 2M4EA 3QW1A 4EIYA 4F4BA 3FHDA 4LLEA 1RKEA 2QY9A 2Y3GA 4LDKA 1EKYA 5AGFA 1M56C 2P7VA 4J30B 5DQTA 1NFOA 2VASA 5E3CA 2IXPA 5BUOA 4U9DA 4CS9C 2NUPB 2MHRA 4NC3A 2W45A 2HS5A 3EGDB 3OEOA 3U2LA 3N0TA 1G5ZA 4JKVA 4YT4A 5L3VA 2L6FA 5KYYB 2CDQA 3FVYA 3ZWIA 2CYDA 5DS4A 2H7BA 1S05A 1J8MF 2YL1A 2H8AA 1V4AA 1XZQA 3C8GB 3DE9A 4Q7CA 4C7OA 2YL7A 4N6CA 3FXHA 4CDAA 1FMVA 1Q0DA 2M64A 1NG1A 1RCPA 1T6QA 1HE1A 3GWNA 4DRJB 4RBNA 1RMVA 2KYHA 3I5QA 3I5PA 3O10A 3A9CA 1TWHA 3DAGA 3GEHA 2AP3A 1HE9A 2VCBA 5FZTA 4U5BE 1TFOB 4GQHA 3K6BA 4MQ9F 3AG2C 3JT1A 3CEXA 5K0IA 3KPHA 2J45A 1O87A 2YRFA 3HNLA 3K33A 4U5EE 3DAFA 2XXAA 1BBHA 1OKKA 2RSEB 4PFPA 3S9OA 4G7HF 3AG1C 4JURI 4NTBA 1TWAA 1K40A 1RXQA 1QVXA 2OQMA 2ZPAA 3H2VA 4WGYA 2XM0A 2P61A 2R7UA 3UMHA 4BEMJ 2X0CA 1HW1A 2EPOA 3DMDA 4PJJA 2PFDA 2R7QA 4E7SA 2FGYA 4CDYA 4BG0A 3PMRA 4EBJA 3JZ0A 3AQBA 3ABLC 3JRTA 4C3BA 3AOUA 2DB4A 3EZHA 2OEVA 4DVZA 1LVKA 1GQAA 2XLOA 1FR0A 1YDIA 1TQGA 3G4ZA 4YL1A 5EGYA 3RH3A 1LIHA 2XM4A 1C02A 4HFKB 3T9OA 3QZCA 3IQ5A 3ZTZA 5L0HA 4CS8C 4O6YA 3HNKA 4HEAJ 1AEPA 1KU2A 2R7WA 2WVNA 3ECSA 2IOQA 1YA7O 1YARO 1L3PA 4H54A 2Z15A 4LDRA 1U0BB 3N2ZB 2ZXRA 5HV9A 1SMYF 2XLWA 4KBLA 2A0BA 2AU5A 4JVSA 3AGUA 2NSFA 4XEKA 2IXOA 1JRAA 2R02A 3WAQA 3L8JA 5KYYA 2DI3A 3M4CA 3NYMA 4BJ6A 4C7OB 1OR2A 2A6HF 4PJLA 1NU7D 3GM1A 4PFOA 5JSLA 2Q4FA 3CZ6A 4UDVA 3IPMO 4JEBA 3DJUB 2JPUA 1WTYA 3LLIA 2VB6A 4WJ0A 2CNWA 1H6GA 4ANJA 1CPRA 4PR9A 5F5FA 1JMWA 1DOWA 3U8PA 3IQTA 3KMIA 3ZQVA 2HKVA 1ZVZA 1VB5A 2EILC 1OW8A 1CGNA 1V55C 4JCHA 4Q4ZF 1ZYRF 2FAPB 4J7YA 5CI8A 4C3DA 3C7JA 4YT5A 1APCA 3NKDA 4E17A 2LD6A 4P9TA 4EHPA 3J06A 4XLNF 3MYFA 3EG9B 4P9FA 4E7ZA 4MVUA 1T6IA 3MYIA 3C62A 2DGJA 3GODA 2Q7RA 2J8WA 1PCXA 1I4YA 2JX0A 2OCCC 2GAQA 5JVEA 3TOMA 2AWYA 1SR2A 4XEVA 2Y3HA 1WATA 1V54C 1XWJA 4JE9A 5EHHA 3PDMP 3EHNA 2KGOA 3ABKC 3OA1A 4HFFB 1UFBA 4ULWA 3V5YA 5KYUB 4E18A 3B0VC 2G3VA 2R7SA 4BEJA 4JW1A 1QLEC 2PX0A 2LFDA 3WODF 1PV3A 1BZ4A 3QVZA 3W4YA 2J46A 4XPWA 4YK5A 1AVOB 2IXMA 1E86A 4CSAC 1SF8A 4OD4A 1VYKA 5JRAA 4BJ5C 4D4XA 2I8BA 1HMOA 1VYIA 2DYRC 1MQVA 3FDQA 1Z23A 2LP4A 5KYWA 5A6BA 1TWCA 2HV6A 1FTSA 4PK4A 3GM2A 3VYWA 1H9TA 2KJGA 3C8ZA 2QLAA 3SXYA 5AC4A 1O3UA 4PJMA 3SXZA 3JSEO 3RFYA 2XLVA 2GDCA 1TWGA 3EH1A 2X51A 5AC5A 4GEHA 2AWCA 3AQCA 3KYJA 3NYJA 2G3KA 4U5CE 3M15A 1M57C 5L3QA 3A11A 3F46A 3FMSA 4W8PA 1JPNA 3UMIA 4JEAA 5JLIA 2TMVP 3VAYA 3TK0A 2OU6A 1LS4A 3ASNC 1IW7F 2J9WA 3QW0A 5A6JA 1Z3IX 2KSFA 3ZC4A 4QI2A 3B71A 4FWVA 1D1CA 3NG1A 3KH2A 1D1AA 4JTCB 2IXNA 3NMIA 2L6HA 1OKKD 1Q0GA 1R4TA 2EIJC 1MNEA 2QNLA 2YL3A 2LQGA 1M2VA 2YEVA 1ZHTA 3EG9A 4EUKB 2OG2A 1F1MA 2H7OA 3DD7A 2V3CC 4O6MA 4N4WA 4XLPF 1RKEB 3RVYA 3LNRA 1JAFA 4R32A 3X1OA 1BDJB 2ETSA 4IWBA 5EK0A 3ZG1A 4JTDB 5A6AA 3TOLA 4YL0A 3ZQYA 1ZU5A 5L0DA 1G4US 2NUPA 1Z6AA 3IHUA 1Q0KA 2O9XA 5KYUA 3WHNA 3JYHA 3EGDA 3LS1A 3K66A 2BC5A 3LEOA 3I4UA 4K7BA 1D0YA 5A6BD 4QI0A 2BE5F 2LIGA 3E9VA 5CI9A 1YZAA 1ORYA 2YWAA 3LLKA 2VCAA 4U5HA 1A7EA 4MW8A 3FAJA 4DVYP 3S0XA 1I5NA 2P1AA 2HV7A 4I1OB 5A69A 2EPKX 2F22A 1E83A 2R03A 1OW7A 2Q3TA 2YKZA 3RQEA 3IQCA 1LE2A 1OXKA 4MVSA 4JIOA 2DYSC 2Q9CA 4HE8D 3GWLA 4BJ1A 5L0CA 1HY5A 4KNWA 4U5GA 5T1DB 4E0IA 3F47A 1Z63A 3MBGA 1LM3B 4YT2A 4EKWA 4BJ5A 4YT8A 3NMJA 2J7PA 3M4BA 2OEXA 3O55A 3FAPB 2ZXOA 4MNDA 4B6IA 4CS9A 1OCRC 4LLCA 2KQ9A 4GYTA 1VK5A 3W8HA 3EGXB 3CQZA 4N06A 1DOVA 2WVOA 2XLDA 4YWQA 2P0NA 2HSBA 4D4NA 1YVIA 1A41A 3DM5A 1U89A 3JSZA 4N6HA 3B9QA 2EIMC 4OIRF 1T5OA 3ABMC 1I4ZA 2XLEA 4MS2A 1YLMA 2NUTB 4AK9A 3UGPA 2NSGA 3QVYA 3ZSUA 3AG4C 1YZCA 3DJNB 4EBBA 4A2NB 2XS8A 3FOOA 4MVOA 1ST6A 2AVKA 1OCZC 1A7DA 2XL6A 3U5SA 2R7RA 5D92A 4YJWA 2H7VC 2LFFA 3Q7GA 2OOCA 4ZLCA 1WGWA 2XLHA 1OR3A 2HUJA 4MVMA 4CIPA 3TQOA 4CJGA 1ZW3A 1SYQA 1M2OA 2XSEA 3SNHA 3RQFA 3IQ6A 3MFNA 1LS1A 3DM9B 4MTOA 2XLMA 4OIQF 2WL8A 4KI2A 2R7XA 2IYLD 4QDLA 3BRJA 1K04A 4NY3A 5T3WA 1A7VA 2EIKC 2MYSA 3W2VA 2Y3DA 3HNJA 4IGGA 4G78A 3S27A 4DOZA 5KYXB 3RQGA 1E2XA 1FAPB 3O6XA 2E87A 2ZD9A 2EINC 3WG7C 4EWCA 2VCCA 3LNMB 4YL3A 3FOPA 1MNDA 5BQIA 3UGOA 3DZAA 1EQ1A 1MMAA 1G4WR 2LSEA 1S7ZA 4MTGA 4DXWA 2D4UA 3DKAA 5D91A 3M79A 3C63A 2V26A 3U3BA 1J8YF 2YLIA 4DRHB 4BJTA 4AL1A 3JYYA 2PBEA 1TKNA 3DXJF 3M1CB 1A0BA 3S90A 2Q9BA 5BQHA 2CW0F 3H2UA 3LAYA 2OJED 3AG3C 5JP7A 2W9YA 3GEEA 2YZSA 2XS1A 5FCLA 1E84A 3QMKA 2YLDA 1LI7A 1GGQA 3S29A 2QE9A
chains in the Genus database with same CATH topology
2L6FA 3C18A 3BRJA 1K04A 4XEKA 1KTMA 3TULA 3C8GB 1V4AA 2LK4A 2L6HA 2HSBA 3RQGA 3L8JA 5F28E 2JX0A 3GM3A 3GM2A 3C8GA 3U0CA 3K7DA 3GM1A 4XEVA 1OW6A 4XEFA 4EBJA 1K05A 1JOGA 1O3UA 3JZ0A 3O10A 4EBKA 3C8GD 1OW7A 3RQEA 3U3FA 1UFBA 4R32A 2JPUA 1WTYA 1ZZPA 1KNYA 3JYYA 1WWPA 2PBEA 1PV3A 2L6GA 2KK1A 1OW8A 2Q00A 3AJMA 3S9OA 4NQFA 3RQFA 1WOLA 3L8IA 3MFNA 1K40A 1QVXA 3B71A 2YWAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L6F A;  3C18 A;  3BRJ A;  1K04 A;  4XEK A;  1KTM A;  3TUL A;  3C8G B;  1V4A A;  2LK4 A;  2L6H A;  2HSB A;  3RQG A;  3L8J A;  5F28 E;  2JX0 A;  3GM3 A;  3GM2 A;  3C8G A;  3U0C A;  3K7D A;  3GM1 A;  4XEV A;  1OW6 A;  4XEF A;  4EBJ A;  1K05 A;  1JOG A;  1O3U A;  3JZ0 A;  3O10 A;  4EBK A;  3C8G D;  1OW7 A;  3RQE A;  3U3F A;  1UFB A;  4R32 A;  2JPU A;  1WTY A;  1ZZP A;  1KNY A;  3JYY A;  1WWP A;  2PBE A;  1PV3 A;  2L6G A;  2KK1 A;  1OW8 A;  2Q00 A;  3AJM A;  3S9O A;  4NQF A;  3RQF A;  1WOL A;  3L8I A;  3MFN A;  1K40 A;  1QVX A;  3B71 A;  2YWA A; 
#chains in the Genus database with same CATH topology
 2WZG A;  3IEE A;  3RW0 A;  3SYN A;  4FAP B;  2LK4 A;  2IBF A;  3GEI A;  5COM A;  3DWW A;  3Q6N A;  4FES A;  4ULV A;  3X2Q C;  4DRI B;  5F28 E;  3SZR A;  1D0Z A;  3R7C A;  1R5I D;  3Q7L A;  2HJ3 A;  3L1M A;  4XEF A;  5TJ5 E;  1H7I A;  1MMN A;  1TFK B;  4OIN F;  1JOG A;  3OWT A;  1VOM A;  1U6H A;  1M6T A;  2A6E F;  4I44 A;  2A0U A;  3TJ6 A;  5DLJ A;  1ZW2 A;  1FFH A;  3ATP A;  2FFH A;  1KNY A;  2Y39 A;  1FFT C;  2YHS A;  4PAC A;  1L7C A;  3ITF A;  1WWP A;  3PCV A;  1EA8 A;  1YAU O;  3KL4 A;  4YN0 B;  3US6 A;  2EPM X;  3CAX A;  3MX3 A;  2L6G A;  2C04 A;  3AJM A;  3EH2 A;  3RF3 A;  2ICW G;  2R7T A;  3EFO B;  4DJ9 A;  1WOL A;  1ZHX A;  4CBE A;  5GPG B;  5KYW B;  3G4X A;  1KTM A;  2A1D D;  4C3E A;  3O39 A;  4AE4 B;  3QTH A;  3POV A;  1LI5 A;  4ER9 A;  4CIH A;  2WZF A;  3ASO C;  3B29 A;  1VMA A;  2KC3 A;  1G8X A;  4K1O A;  3C8G A;  5DS6 A;  4X0R A;  3K1H A;  2JD3 A;  2HMZ A;  4M63 A;  4XPX A;  1Q0F A;  3VM6 A;  4EBK A;  2B0J A;  5DQZ A;  4CX9 A;  4ZLD A;  3S84 A;  4AX2 A;  3HTK C;  3R2P A;  1MMD A;  1FNT c;  3PHF 2;  1H9G A;  3V5X A;  3LES A;  1T6U A;  2B0H A;  1FMW A;  3GOR A;  1Z7Q c;  4NTA A;  3B0U X;  3U2M A;  2Y69 C;  3T6J A;  2J9V A;  4LDQ A;  3CSK A;  3K1I A;  5JUA A;  5L0I A;  1Z5Z A;  3G50 A;  2ZXW C;  4MVR A;  5T3T A;  3V5Z A;  2HZ8 A;  5L0F A;  3HKK A;  4U5F E;  5DVW A;  3U9M A;  5E2Q A;  2C03 A;  4JJF A;  4PJN A;  4RDA A;  256B A;  3VF0 A;  4Z9I A;  1AUE A;  4G7Z F;  2W4B A;  4IJJ A;  4OIP F;  1RJ9 B;  3RVZ A;  2XL8 A;  3JTL O;  2PNO A;  2HFI A;  5JS5 A;  3LUT B;  3ZVR A;  2YVK A;  3VRC A;  3N24 A;  4Z9J A;  3LJB A;  3U0C A;  2NG1 A;  1XZP A;  1K05 A;  1YA9 A;  3GAN A;  1D1B A;  2W4M A;  4XWJ A;  1Y6D A;  3RYL A;  3NRH A;  3SEO A;  4WGZ A;  2QTV A;  2R25 A;  2CGE A;  3SP1 A;  1IZM A;  3NDB B;  3U8V A;  5B1A C;  2KK1 A;  5B3S C;  3EJN A;  1CPQ A;  1ORJ A;  2J0X A;  2R05 A;  4MTF A;  1EI7 A;  1JPJ A;  4MVQ A;  4K0D A;  2L9J A;  1ZU4 A;  1VTM P;  3NYL A;  2HSQ A;  3EFO A;  3RIP A;  2VC9 A;  3TUL A;  4LER A;  4IAO A;  2XRH A;  1LPE A;  1C17 M;  1YYJ A;  2Q9A A;  2WB7 A;  3JCU Q;  4I3M A;  3LEV A;  1QSP A;  1B68 A;  4G0H A;  4XTK A;  3SXK A;  3RKO F;  4KNV A;  4U9E A;  3HJC A;  4U5D E;  2R7O A;  4AE4 A;  1OW6 A;  2D5R B;  4IAQ A;  2OKU A;  3U3F A;  2KW3 C;  1BR4 A;  4BJ6 C;  2MWQ A;  1ZZP A;  4JZA A;  2YLG A;  4H4K C;  3T6G B;  1YYX A;  4MW3 A;  3ZTM A;  5L0G A;  2L81 A;  1BR2 A;  2YL0 A;  2HJM A;  2LCH A;  3TD7 A;  3EGX A;  1OXB A;  2HMQ A;  3UMK A;  4CSA A;  1NU9 C;  4NQF A;  1MMG A;  3W8I A;  1T9K A;  3L8I A;  2GWW A;  5CIV A;  4IB4 A;  2IM8 A;  1QQ3 A;  5F5H A;  5A6K A;  1LKX A;  2L7A A;  4JRZ A;  1HMD A;  2GFH A;  4O7G A;  1QPU A;  4J32 B;  4NCQ A;  4DBR A;  2GA0 A;  3ZIB A;  3MLG A;  2NUT A;  2J0W A;  1UG7 A;  3KYI A;  1LE4 A;  4OD5 A;  2EPN A;  3AGT A;  1RJ9 A;  3NKE A;  1NFN A;  1O5H A;  4E0H A;  3ZDL A;  1PD1 A;  4O79 A;  3C8G D;  2UUI A;  1BR1 A;  5E3A A;  3T6B A;  1WAS A;  1PD0 A;  1V74 B;  3EQL F;  3DE8 A;  1E85 A;  3SXM A;  4JCZ A;  3S28 A;  1OCC C;  4Z9H A;  4AL0 A;  4CJO A;  1NSG B;  2J9B A;  2PF4 E;  1ORS C;  2PX3 A;  2Q00 A;  2R9R B;  3BEH A;  5DS5 A;  5JT4 A;  4O6N A;  4KC9 A;  1ZHZ A;  4JJG A;  3HLZ A;  4XQ1 A;  5KYX A;  3L34 A;  2ASR A;  1D0X A;  2CCY A;  5COF A;  5B3I A;  2J9U A;  3DI5 A;  3JRM O;  1Q0M A;  3NMK A;  4ONS A;  1VLS A;  1VLT A;  4WAB A;  3V7O A;  3W2W A;  1NLX A;  2A68 F;  5BQG A;  5IY5 C;  4A4A A;  2RD9 A;  3KKB A;  2P6V A;  4IRU A;  2G62 A;  3EHM A;  3GM3 A;  4NTF A;  4I1M A;  4CS7 A;  5KYN A;  2ZXP A;  3K7D A;  2UUH A;  2WVQ A;  3LS0 A;  4IAR A;  3TJ5 A;  4DBQ A;  3HNI A;  2OJQ A;  2YQY A;  4FX5 A;  4MVZ A;  5HSW A;  5L0J A;  4BPM A;  1ZHW A;  4JTA B;  4P6I C;  1TR2 A;  4G7O F;  4W8K A;  2XL4 A;  1GM5 A;  3L0I A;  3T4R A;  2XXA B;  2PP4 A;  3UNG C;  4OIO F;  2I15 A;  5B1B C;  4JC7 A;  1Y4C A;  3U9J A;  1C03 A;  1OQC A;  1CGM E;  3B0P A;  2WZL A;  2J7P D;  1W2W A;  1N1C A;  1GS9 A;  2BL2 A;  1NZE A;  1ZHY A;  4XPY A;  2A69 F;  4J7T A;  3Q6M A;  3C18 A;  4CS8 A;  1QKR A;  3EZI A;  4LAC B;  1RKC A;  1JR8 A;  1CGO A;  5COG A;  1YJG A;  2Y3B A;  1T01 A;  3E70 C;  4Q5S F;  2VH3 A;  1SZI A;  1OCO C;  1QZX A;  2KNH A;  2QUP A;  4RD9 A;  4CDV A;  1NBB A;  3K1I C;  2CNW D;  2EPL X;  5E33 A;  3EPV A;  1M2V B;  2NPU A;  3H65 A;  1HW2 A;  2R7V A;  4L6R A;  3UR3 C;  1WN0 A;  2M4E A;  3QW1 A;  4EIY A;  4F4B A;  3FHD A;  4LLE A;  1RKE A;  2QY9 A;  2Y3G A;  4LDK A;  1EKY A;  5AGF A;  1M56 C;  2P7V A;  4J30 B;  5DQT A;  1NFO A;  2VAS A;  5E3C A;  2IXP A;  5BUO A;  4U9D A;  4CS9 C;  2NUP B;  2MHR A;  4NC3 A;  2W45 A;  2HS5 A;  3EGD B;  3OEO A;  3U2L A;  3N0T A;  1G5Z A;  4JKV A;  4YT4 A;  5L3V A;  2L6F A;  5KYY B;  2CDQ A;  3FVY A;  3ZWI A;  2CYD A;  5DS4 A;  2H7B A;  1S05 A;  1J8M F;  2YL1 A;  2H8A A;  1V4A A;  1XZQ A;  3C8G B;  3DE9 A;  4Q7C A;  4C7O A;  2YL7 A;  4N6C A;  3FXH A;  4CDA A;  1FMV A;  1Q0D A;  2M64 A;  1NG1 A;  1RCP A;  1T6Q A;  1HE1 A;  3GWN A;  4DRJ B;  4RBN A;  1RMV A;  2KYH A;  3I5Q A;  3I5P A;  3O10 A;  3A9C A;  1TWH A;  3DAG A;  3GEH A;  2AP3 A;  1HE9 A;  2VCB A;  5FZT A;  4U5B E;  1TFO B;  4GQH A;  3K6B A;  4MQ9 F;  3AG2 C;  3JT1 A;  3CEX A;  5K0I A;  3KPH A;  2J45 A;  1O87 A;  2YRF A;  3HNL A;  3K33 A;  4U5E E;  3DAF A;  2XXA A;  1BBH A;  1OKK A;  2RSE B;  4PFP A;  3S9O A;  4G7H F;  3AG1 C;  4JUR I;  4NTB A;  1TWA A;  1K40 A;  1RXQ A;  1QVX A;  2OQM A;  2ZPA A;  3H2V A;  4WGY A;  2XM0 A;  2P61 A;  2R7U A;  3UMH A;  4BEM J;  2X0C A;  1HW1 A;  2EPO A;  3DMD A;  4PJJ A;  2PFD A;  2R7Q A;  4E7S A;  2FGY A;  4CDY A;  4BG0 A;  3PMR A;  4EBJ A;  3JZ0 A;  3AQB A;  3ABL C;  3JRT A;  4C3B A;  3AOU A;  2DB4 A;  3EZH A;  2OEV A;  4DVZ A;  1LVK A;  1GQA A;  2XLO A;  1FR0 A;  1YDI A;  1TQG A;  3G4Z A;  4YL1 A;  5EGY A;  3RH3 A;  1LIH A;  2XM4 A;  1C02 A;  4HFK B;  3T9O A;  3QZC A;  3IQ5 A;  3ZTZ A;  5L0H A;  4CS8 C;  4O6Y A;  3HNK A;  4HEA J;  1AEP A;  1KU2 A;  2R7W A;  2WVN A;  3ECS A;  2IOQ A;  1YA7 O;  1YAR O;  1L3P A;  4H54 A;  2Z15 A;  4LDR A;  1U0B B;  3N2Z B;  2ZXR A;  5HV9 A;  1SMY F;  2XLW A;  4KBL A;  2A0B A;  2AU5 A;  4JVS A;  3AGU A;  2NSF A;  4XEK A;  2IXO A;  1JRA A;  2R02 A;  3WAQ A;  3L8J A;  5KYY A;  2DI3 A;  3M4C A;  3NYM A;  4BJ6 A;  4C7O B;  1OR2 A;  2A6H F;  4PJL A;  1NU7 D;  3GM1 A;  4PFO A;  5JSL A;  2Q4F A;  3CZ6 A;  4UDV A;  3IPM O;  4JEB A;  3DJU B;  2JPU A;  1WTY A;  3LLI A;  2VB6 A;  4WJ0 A;  2CNW A;  1H6G A;  4ANJ A;  1CPR A;  4PR9 A;  5F5F A;  1JMW A;  1DOW A;  3U8P A;  3IQT A;  3KMI A;  3ZQV A;  2HKV A;  1ZVZ A;  1VB5 A;  2EIL C;  1OW8 A;  1CGN A;  1V55 C;  4JCH A;  4Q4Z F;  1ZYR F;  2FAP B;  4J7Y A;  5CI8 A;  4C3D A;  3C7J A;  4YT5 A;  1APC A;  3NKD A;  4E17 A;  2LD6 A;  4P9T A;  4EHP A;  3J06 A;  4XLN F;  3MYF A;  3EG9 B;  4P9F A;  4E7Z A;  4MVU A;  1T6I A;  3MYI A;  3C62 A;  2DGJ A;  3GOD A;  2Q7R A;  2J8W A;  1PCX A;  1I4Y A;  2JX0 A;  2OCC C;  2GAQ A;  5JVE A;  3TOM A;  2AWY A;  1SR2 A;  4XEV A;  2Y3H A;  1WAT A;  1V54 C;  1XWJ A;  4JE9 A;  5EHH A;  3PDM P;  3EHN A;  2KGO A;  3ABK C;  3OA1 A;  4HFF B;  1UFB A;  4ULW A;  3V5Y A;  5KYU B;  4E18 A;  3B0V C;  2G3V A;  2R7S A;  4BEJ A;  4JW1 A;  1QLE C;  2PX0 A;  2LFD A;  3WOD F;  1PV3 A;  1BZ4 A;  3QVZ A;  3W4Y A;  2J46 A;  4XPW A;  4YK5 A;  1AVO B;  2IXM A;  1E86 A;  4CSA C;  1SF8 A;  4OD4 A;  1VYK A;  5JRA A;  4BJ5 C;  4D4X A;  2I8B A;  1HMO A;  1VYI A;  2DYR C;  1MQV A;  3FDQ A;  1Z23 A;  2LP4 A;  5KYW A;  5A6B A;  1TWC A;  2HV6 A;  1FTS A;  4PK4 A;  3GM2 A;  3VYW A;  1H9T A;  2KJG A;  3C8Z A;  2QLA A;  3SXY A;  5AC4 A;  1O3U A;  4PJM A;  3SXZ A;  3JSE O;  3RFY A;  2XLV A;  2GDC A;  1TWG A;  3EH1 A;  2X51 A;  5AC5 A;  4GEH A;  2AWC A;  3AQC A;  3KYJ A;  3NYJ A;  2G3K A;  4U5C E;  3M15 A;  1M57 C;  5L3Q A;  3A11 A;  3F46 A;  3FMS A;  4W8P A;  1JPN A;  3UMI A;  4JEA A;  5JLI A;  2TMV P;  3VAY A;  3TK0 A;  2OU6 A;  1LS4 A;  3ASN C;  1IW7 F;  2J9W A;  3QW0 A;  5A6J A;  1Z3I X;  2KSF A;  3ZC4 A;  4QI2 A;  3B71 A;  4FWV A;  1D1C A;  3NG1 A;  3KH2 A;  1D1A A;  4JTC B;  2IXN A;  3NMI A;  2L6H A;  1OKK D;  1Q0G A;  1R4T A;  2EIJ C;  1MNE A;  2QNL A;  2YL3 A;  2LQG A;  1M2V A;  2YEV A;  1ZHT A;  3EG9 A;  4EUK B;  2OG2 A;  1F1M A;  2H7O A;  3DD7 A;  2V3C C;  4O6M A;  4N4W A;  4XLP F;  1RKE B;  3RVY A;  3LNR A;  1JAF A;  4R32 A;  3X1O A;  1BDJ B;  2ETS A;  4IWB A;  5EK0 A;  3ZG1 A;  4JTD B;  5A6A A;  3TOL A;  4YL0 A;  3ZQY A;  1ZU5 A;  5L0D A;  1G4U S;  2NUP A;  1Z6A A;  3IHU A;  1Q0K A;  2O9X A;  5KYU A;  3WHN A;  3JYH A;  3EGD A;  3LS1 A;  3K66 A;  2BC5 A;  3LEO A;  3I4U A;  4K7B A;  1D0Y A;  5A6B D;  4QI0 A;  2BE5 F;  2LIG A;  3E9V A;  5CI9 A;  1YZA A;  1ORY A;  2YWA A;  3LLK A;  2VCA A;  4U5H A;  1A7E A;  4MW8 A;  3FAJ A;  4DVY P;  3S0X A;  1I5N A;  2P1A A;  2HV7 A;  4I1O B;  5A69 A;  2EPK X;  2F22 A;  1E83 A;  2R03 A;  1OW7 A;  2Q3T A;  2YKZ A;  3RQE A;  3IQC A;  1LE2 A;  1OXK A;  4MVS A;  4JIO A;  2DYS C;  2Q9C A;  4HE8 D;  3GWL A;  4BJ1 A;  5L0C A;  1HY5 A;  4KNW A;  4U5G A;  5T1D B;  4E0I A;  3F47 A;  1Z63 A;  3MBG A;  1LM3 B;  4YT2 A;  4EKW A;  4BJ5 A;  4YT8 A;  3NMJ A;  2J7P A;  3M4B A;  2OEX A;  3O55 A;  3FAP B;  2ZXO A;  4MND A;  4B6I A;  4CS9 A;  1OCR C;  4LLC A;  2KQ9 A;  4GYT A;  1VK5 A;  3W8H A;  3EGX B;  3CQZ A;  4N06 A;  1DOV A;  2WVO A;  2XLD A;  4YWQ A;  2P0N A;  2HSB A;  4D4N A;  1YVI A;  1A41 A;  3DM5 A;  1U89 A;  3JSZ A;  4N6H A;  3B9Q A;  2EIM C;  4OIR F;  1T5O A;  3ABM C;  1I4Z A;  2XLE A;  4MS2 A;  1YLM A;  2NUT B;  4AK9 A;  3UGP A;  2NSG A;  3QVY A;  3ZSU A;  3AG4 C;  1YZC A;  3DJN B;  4EBB A;  4A2N B;  2XS8 A;  3FOO A;  4MVO A;  1ST6 A;  2AVK A;  1OCZ C;  1A7D A;  2XL6 A;  3U5S A;  2R7R A;  5D92 A;  4YJW A;  2H7V C;  2LFF A;  3Q7G A;  2OOC A;  4ZLC A;  1WGW A;  2XLH A;  1OR3 A;  2HUJ A;  4MVM A;  4CIP A;  3TQO A;  4CJG A;  1ZW3 A;  1SYQ A;  1M2O A;  2XSE A;  3SNH A;  3RQF A;  3IQ6 A;  3MFN A;  1LS1 A;  3DM9 B;  4MTO A;  2XLM A;  4OIQ F;  2WL8 A;  4KI2 A;  2R7X A;  2IYL D;  4QDL A;  3BRJ A;  1K04 A;  4NY3 A;  5T3W A;  1A7V A;  2EIK C;  2MYS A;  3W2V A;  2Y3D A;  3HNJ A;  4IGG A;  4G78 A;  3S27 A;  4DOZ A;  5KYX B;  3RQG A;  1E2X A;  1FAP B;  3O6X A;  2E87 A;  2ZD9 A;  2EIN C;  3WG7 C;  4EWC A;  2VCC A;  3LNM B;  4YL3 A;  3FOP A;  1MND A;  5BQI A;  3UGO A;  3DZA A;  1EQ1 A;  1MMA A;  1G4W R;  2LSE A;  1S7Z A;  4MTG A;  4DXW A;  2D4U A;  3DKA A;  5D91 A;  3M79 A;  3C63 A;  2V26 A;  3U3B A;  1J8Y F;  2YLI A;  4DRH B;  4BJT A;  4AL1 A;  3JYY A;  2PBE A;  1TKN A;  3DXJ F;  3M1C B;  1A0B A;  3S90 A;  2Q9B A;  5BQH A;  2CW0 F;  3H2U A;  3LAY A;  2OJE D;  3AG3 C;  5JP7 A;  2W9Y A;  3GEE A;  2YZS A;  2XS1 A;  5FCL A;  1E84 A;  3QMK A;  2YLD A;  1LI7 A;  1GGQ A;  3S29 A;  2QE9 A; 
#chains in the Genus database with same CATH homology
 2L6F A;  3C18 A;  3BRJ A;  1K04 A;  4XEK A;  1KTM A;  3TUL A;  3C8G B;  1V4A A;  2LK4 A;  2L6H A;  2HSB A;  3RQG A;  3L8J A;  5F28 E;  2JX0 A;  3GM3 A;  3GM2 A;  3C8G A;  3U0C A;  3K7D A;  3GM1 A;  4XEV A;  1OW6 A;  4XEF A;  4EBJ A;  1K05 A;  1JOG A;  1O3U A;  3JZ0 A;  3O10 A;  4EBK A;  3C8G D;  1OW7 A;  3RQE A;  3U3F A;  1UFB A;  4R32 A;  2JPU A;  1WTY A;  1ZZP A;  1KNY A;  3JYY A;  1WWP A;  2PBE A;  1PV3 A;  2L6G A;  2KK1 A;  1OW8 A;  2Q00 A;  3AJM A;  3S9O A;  4NQF A;  3RQF A;  1WOL A;  3L8I A;  3MFN A;  1K40 A;  1QVX A;  3B71 A;  2YWA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...