3MFNA

Dfer_2879 protein of unknown function from dyadobacter fermentans
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
125
structure length
125
Chain Sequence
AQEAVIEAKRYLNNAKDILRDKGGKEDGFYQDSKYVKMAGHTAYSGVLFALDHYFGKKTKGRKDVDWYKSNLAQQDKKILNTFVSVYEQLHLVMAYDGVGDAEVVKLGFQRAEIIIDWVERRLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
publication title X-ray crystal structure of Dfer_2879 protein of unknown function from Dyadobacter fermentans.
rcsb
source organism Dyadobacter fermentans
total genus 47
structure length 125
sequence length 125
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18498 DUF5618 Domain of unknown function (DUF5618)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3mfnA00
3U3FA 1ZZPA 3RQEA 4XEKA 3JYYA 3GM1A 3BRJA 4XEVA 3JZ0A 3O10A 1OW7A 1WWPA 1UFBA 3RQGA 1OW8A 2YWAA 2HSBA 1K05A 3C8GD 1O3UA 1WOLA 2L6FA 1OW6A 2KK1A 1PV3A 3AJMA 3TULA 1KTMA 3GM3A 3C8GA 1K40A 1KNYA 1V4AA 3K7DA 5F28E 4EBJA 2L6GA 3C18A 4R32A 4NQFA 3MFNA 2JX0A 2JPUA 1QVXA 1WTYA 3S9OA 3GM2A 4EBKA 1K04A 3C8GB 3L8IA 4XEFA 2PBEA 2L6HA 3RQFA 3U0CA 2Q00A 3B71A 2LK4A 3L8JA 1JOGA
chains in the Genus database with same CATH superfamily
5JS5A 2DI3A 1FAPB 3EH1A 4J7YA 1TWCA 3RYLA 4A4AA 1JPJA 2Q7RA 2YEVA 2YKZA 3US6A 1JMWA 5CI8A 1UG7A 2H7OA 2R02A 4K1OA 4IAQA 1O87A 2CW0F 3AG3C 1NFOA 4JW1A 1M2VB 2P61A 3EHMA 3HJCA 1A41A 5BUOA 1E85A 3AG2C 3GEHA 3K6BA 2EINC 1WOLA 3ZQYA 3TQOA 4DRJB 5A6JA 3I5PA 1RJ9B 3T4RA 2G3KA 3NRHA 4DXWA 1V4AA 3LLIA 5IY5C 4RBNA 3FOOA 3U8VA 3UR3C 1E86A 4OIOF 3RF3A 2LD6A 3AGUA 2L7AA 1JRAA 4XPYA 3JRTA 2Y3GA 1K04A 3LESA 1SR2A 4J32B 4CBEA 3NDBB 4WABA 4Z9JA 3RQFA 1HW2A 1TWGA 2LK4A 4O6MA 3DD7A 3ECSA 1ZVZA 3U2MA 3UMKA 4YK5A 4AK9A 2B0HA 4CJOA 4RDAA 1U0BB 3KPHA 3M4BA 3RQGA 2KGOA 3GODA 3QZCA 3VYWA 4O6YA 4YT8A 3UMIA 5JUAA 4P9TA 3RKOF 1BZ4A 1YZAA 1BBHA 2HJ3A 2ZD9A 3KYIA 1RKCA 4GQHA 3RW0A 3GEIA 4ZLDA 4NCQA 3W4YA 3SNHA 1Z6AA 2AVKA 2L6GA 3NKEA 4FESA 5DQZA 1YARO 2QE9A 3C62A 1ZW2A 1LS1A 2YLIA 4JTAB 4LDKA 3AG1C 4LLCA 3DAGA 1E2XA 4NTFA 4X0RA 5E33A 1CPQA 3HNJA 3CEXA 3J06A 1JOGA 5A6BD 4JC7A 2E87A 4QI0A 5DS6A 2MWQA 5KYNA 1YLMA 3JYYA 4XLPF 1DOWA 4XEVA 1Z63A 2WB7A 2IXOA 1HY5A 1ST6A 3CAXA 4JKVA 2WVQA 2VCCA 4U9EA 4F4BA 1WGWA 1H9TA 1WWPA 5JLIA 4CIPA 1OQCA 5HV9A 3KH2A 1I4YA 1U89A 1M57C 1MNEA 1XZQA 3B9QA 3JSZA 4W8KA 1NZEA 5DS5A 1T5OA 2Q3TA 2OQMA 2G3VA 1D1AA 2PX3A 3SXYA 3ASOC 4DBRA 3PCVA 3DM9B 2HV6A 4H54A 1MMDA 2JPUA 1V54C 4P9FA 3OA1A 4JCZA 3N0TA 2NPUA 4XWJA 1D1CA 2YZSA 4L6RA 3TD7A 3EG9B 5K0IA 1LS4A 4G7ZF 2VCAA 2WZLA 1IW7F 4BJ1A 2Z15A 3JYHA 4BJ5C 1Q0GA 3PDMP 4C7OA 3KYJA 3SXMA 4XEKA 2GAQA 3HNKA 1D1BA 3JZ0A 4MTOA 4D4NA 4G7OF 2OCCC 1W2WA 5L0DA 2J7PD 2L9JA 3DWWA 3DMDA 2YWAA 3N24A 4J7TA 4YL1A 3U3BA 2DYSC 5JVEA 2Q9CA 1I5NA 2HFIA 1TKNA 4U5DE 3HNIA 2R9RB 4FAPB 5JP7A 4YWQA 1PV3A 2F22A 4O79A 2HKVA 5COMA 3DAFA 1SMYF 3QVYA 4IGGA 2R7RA 1ZHZA 2J9BA 1TWAA 2V26A 1JR8A 4CIHA 1D0YA 4IRUA 1YZCA 3L0IA 1VLSA 2KSFA 1Y4CA 2XSEA 2PNOA 3GWLA 5KYUA 3LEOA 1HMOA 2R25A 1J8YF 1G5ZA 2Y69C 3IQTA 1M2VA 1C17M 2GWWA 4NC3A 4CJGA 4G7HF 1S7ZA 5F5FA 3IEEA 3X2QC 4C7OB 2A69F 1IZMA 1N1CA 1LM3B 4PR9A 4NTAA 5E3CA 1A7EA 1U6HA 1E84A 2WZGA 4CS8C 2ASRA 4DVZA 4OIQF 2I8BA 1LIHA 4AL1A 4JCHA 1D0ZA 5KYYA 1KNYA 1YA7O 3ABKC 1YYXA 5JSLA 2VASA 2D4UA 1GQAA 2QNLA 3K1IC 1MMAA 4U5CE 4U5EE 4PACA 2ICWG 2W9YA 4EBBA 3RFYA 2ZXOA 1CGME 1DOVA 4KNWA 3AOUA 4U9DA 3SEOA 1MMGA 1G4US 2XM0A 2ZXRA 2R7XA 4PK4A 2WZFA 4G78A 4MW8A 4JZAA 3FHDA 3VF0A 4KBLA 2YL3A 1RCPA 3C63A 4AX2A 4MW3A 2YVKA 2EIJC 1TFKB 2QUPA 3R2PA 3TOMA 2PX0A 2VH3A 2NUPA 5KYUB 2NSFA 2OKUA 2DGJA 2Q4FA 1EA8A 3FXHA 1A7VA 4IAOA 1Q0MA 3ZWIA 3UNGC 3IPMO 4IB4A 3C8GA 1WN0A 4MS2A 3O55A 2CNWA 3I5QA 3NMKA 2OU6A 2Y39A 3MFNA 1VLTA 4JJGA 2JX0A 4OD5A 2KQ9A 2R03A 1FMVA 2UUHA 5KYYB 1NLXA 2L6HA 2VB6A 3RIPA 3U9MA 4A2NB 3PMRA 3W2WA 2W4BA 1AEPA 2IXNA 3JTLO 4N6HA 3LS0A 3TOLA 3U3FA 1WASA 2EPLX 2YL1A 4O7GA 2OJQA 4KI2A 3DXJF 1ZYRF 3W8IA 2CYDA 4YL3A 2J9VA 4CS9C 4Q5SF 2QY9A 2R05A 1OKKD 5GPGB 2ETSA 2XS8A 4EKWA 2J9UA 2OG2A 4E0HA 3B0VC 4CDYA 2R7UA 2YRFA 3EHNA 3T6GB 2IBFA 1V55C 2NUPB 4MTFA 3M1CB 3S29A 1C02A 3TJ5A 4BG0A 5BQHA 2HJMA 2OOCA 1C03A 2GDCA 2EIKC 1M2OA 2MHRA 1NG1A 3EG9A 4LDRA 4MVRA 4W8PA 5E3AA 3QW0A 3ZQVA 4MTGA 1WTYA 4PFPA 2GA0A 4C3EA 3ZC4A 2LSEA 3UMHA 3C8GB 2AU5A 4XEFA 1OCCC 1YDIA 2MYSA 4HFFB 4BEMJ 1LKXA 3W8HA 2H7BA 4E7SA 2HZ8A 2FFHA 1TWHA 5T3WA 3R7CA 2Y3DA 3A9CA 2I15A 3Q7GA 4CSAC 3U2LA 3M79A 5JRAA 3AQCA 3L34A 2OJED 3EQLF 3WAQA 4CS9A 2HS5A 2Y3HA 5B1BC 3RH3A 3ZSUA 4ZLCA 1O3UA 4ULWA 2HMQA 5T1DB 5KYXA 2KK1A 2R7TA 1Q0FA 2A1DD 4LLEA 1TFOB 2JD3A 4JTCB 2J45A 1OCOC 4MVZA 3C18A 4YN0B 4EHPA 5A6AA 1JAFA 4XPWA 3ASNC 3HLZA 2LP4A 4J30B 5E2QA 1RMVA 4IARA 3FDQA 1MMNA 1KU2A 2XM4A 3DI5A 1L3PA 1Z23A 2O9XA 3K66A 4HEAJ 1G8XA 4JEAA 3VAYA 4DJ9A 3WHNA 3MLGA 3NG1A 4CS7A 4FWVA 3TK0A 3B0UX 3V5ZA 2M4EA 2WVNA 3IHUA 1LVKA 3B0PA 4XTKA 3CQZA 4CSAA 3S27A 3Q6NA 1VYKA 1VK5A 2CDQA 1RXQA 1V74B 2Q9AA 3EGDA 4P6IC 4WGZA 2V3CC 3L1MA 2EPOA 2YLDA 3EZIA 3QMKA 2P0NA 4JTDB 4U5HA 4Q4ZF 2A6HF 5FCLA 1F1MA 2R7QA 3EPVA 2XLMA 3T9OA 3AJMA 4LACB 5DS4A 3CZ6A 3GWNA 3LLKA 1T01A 3KMIA 2PP4A 4DBQA 3FVYA 2R7SA 2Y3BA 5D91A 1QVXA 2A0UA 5KYXB 3WG7C 3ABLC 2XLDA 3DM5A 3HNLA 3SXKA 1LE2A 3E9VA 3V5XA 1Z5ZA 3V7OA 3IQCA 3ZIBA 1OR3A 1VMAA 2P6VA 3U5SA 1QQ3A 4MVMA 4OIPF 4BJ5A 1Q0KA 3NYJA 2NSGA 2WL8A 3SZRA 1H9GA 1Z7Qc 3BEHA 3NKDA 5BQGA 4DOZA 1AVOB 1PD1A 5L0CA 3FOPA 4JRZA 2IOQA 2EIMC 3MYIA 3NMJA 4E7ZA 2XS1A 1NFNA 2HV7A 3DE9A 4K0DA 2IXPA 2J7PA 4BJ6C 1ZHXA 4LDQA 2QTVA 2KYHA 256BA 4KC9A 3EGDB 2R7OA 1GM5A 1H7IA 2EPKX 3GANA 2YHSA 4QDLA 5DVWA 4BJTA 2DYRC 5L0HA 2VC9A 4WJ0A 2P1AA 3U9JA 3QW1A 4CDAA 1T6IA 2IM8A 3AQBA 2LCHA 2RSEB 3K1HA 2LIGA 3L8IA 1FMWA 1YJGA 2J8WA 4MNDA 4E0IA 5B3IA 4BEJA 3H2VA 4MVSA 4K7BA 3EFOB 2W4MA 2P7VA 4FX5A 3MX3A 3DKAA 1OR2A 1YYJA 1XWJA 3DZAA 3L8JA 4WGYA 5EGYA 4GYTA 1OXBA 4PJNA 1T6UA 5DQTA 2YL0A 3EJNA 2EPNA 1LI5A 1YVIA 2XLVA 3K33A 3ZTMA 5L0IA 2XRHA 2Q9BA 1I4ZA 2J0WA 5COFA 2NUTA 3Q6MA 3G4XA 1QKRA 1UFBA 5B1AC 4O6NA 1OW8A 4MVUA 3DE8A 1CGOA 1MQVA 4HE8D 2CNWD 3DJNB 4BJ6A 2EILC 4CS8A 1PCXA 3DJUB 1HMDA 3C8ZA 3K7DA 4MVQA 4PJJA 5TJ5E 3RVYA 2C03A 2XL6A 4JE9A 3HKKA 1Y6DA 3O6XA 2PFDA 5EHHA 4YL0A 3S9OA 2AWYA 2J9WA 1VYIA 3K1IA 4NY3A 2LFFA 2G62A 2KJGA 3EH2A 1CPRA 4JEBA 3SYNA 3U8PA 1LE4A 3O39A 2AWCA 1BR2A 2X0CA 1M56C 5HSWA 1ZZPA 3RQEA 4MVOA 4BPMA 4ER9A 3WODF 4YT4A 1T9KA 2BL2A 4Q7CA 5F5HA 5B3SC 2R7WA 3EGXA 5D92A 3CSKA 4JIOA 4U5BE 4JVSA 3SP1A 1D0XA 1BR4A 3JCUQ 4IWBA 1ORYA 1OXKA 4PJLA 4EIYA 1K05A 4UDVA 3FAPB 2IXMA 3KL4A 4G0HA 4NTBA 3LJBA 4ULVA 5COGA 2NUTB 2XLEA 3ATPA 1OW6A 3LNRA 4OINF 3ZDLA 1A0BA 2W45A 1RKEA 1GGQA 2EPMX 3FMSA 3G50A 4ONSA 3G4ZA 4OIRF 1EI7A 3JSEO 3QTHA 1S05A 3ITFA 4XPXA 4DRIB 3PHF2 3I4UA 5L0JA 1YA9A 5L0GA 1MNDA 3FAJA 2B0JA 2ZXPA 5EK0A 4JJFA 4YT2A 5A6KA 3POVA 3NYLA 2R7VA 1ZU4A 3HTKC 2HMZA 3C7JA 2UUIA 2KNHA 2BC5A 1R4TA 3OWTA 4IJJA 3ZG1A 3BRJA 3ABMC 3S28A 1ZHTA 2C04A 5AGFA 5CI9A 4XLNF 2HSBA 2BE5F 2PF4E 3S90A 2HUJA 2H8AA 1H6GA 3EGXB 1BR1A 4I1OB 1ZW3A 4B6IA 2L81A 1A7DA 1OKKA 2A0BA 5F28E 2RD9A 3V5YA 4NQFA 4N06A 4PFOA 4I1MA 3H65A 5AC5A 2J0XA 5KYWA 2HSQA 5FZTA 1EQ1A 3H2UA 1QZXA 1RKEB 4DVYP 2TMVP 4EWCA 3SXZA 3U0CA 4EBJA 5L0FA 4U5FE 4N6CA 4M63A 3E70C 1QPUA 3VM6A 2AP3A 3LEVA 3KKBA 4RD9A 3ZTZA 5A69A 1QLEC 1FNTc 1PD0A 2KC3A 1LI7A 5A6BA 1ORJA 4XQ1A 1OCRC 4ANJA 1E83A 3IQ6A 2YL7A 5AC4A 5CIVA 4H4KC 1FR0A 3B29A 4LERA 2A68F 3RVZA 4AL0A 2A6EF 4GEHA 4C3DA 2DB4A 1WATA 4Z9HA 1NBBA 4Z9IA 3OEOA 3W2VA 4DRHB 1NU7D 2ZXWC 1G4WR 1ZHWA 1OCZC 5T3TA 1HW1A 3TJ6A 1VTMP 2YLGA 1T6QA 3MYFA 3EFOA 3AG4C 1GS9A 2XLOA 2XXAA 4MQ9F 1CGNA 2CCYA 3LAYA 5KYWB 1FFTC 3T6BA 2XLHA 1VOMA 2LFDA 1TQGA 2FGYA 3GM1A 1OW7A 3EZHA 1NSGB 1R5ID 4KNVA 1L7CA 4QI2A 2WVOA 3MBGA 4I44A 3NYMA 5DLJA 1ZU5A 2YQYA 3GEEA 4E17A 3F46A 2VCBA 2L6FA 3ZVRA 2QLAA 2LQGA 1KTMA 1SYQA 2GFHA 4AE4A 5L3QA 2XLWA 3VRCA 4I3MA 4HFKB 3S84A 5BQIA 2CGEA 2IYLD 1FFHA 1ZHYA 1ORSC 1EKYA 2J46A 4EBKA 4CDVA 1NU9C 3X1OA 2FAPB 1YAUO 2PBEA 2NG1A 3LUTB 3QVZA 3UGOA 1B68A 3B71A 3GORA 3JRMO 2M64A 1XZPA 3F47A 3A11A 2H7VC 1HE1A 3LNMB 3N2ZB 4U5GA 2XXAB 3O10A 4CX9A 3NMIA 2D5RB 1RJ9A 1VB5A 1SZIA 3T6JA 1AUEA 1FTSA 1QSPA 3C8GD 1Q0DA 3M15A 1J8MF 4JURI 4E18A 1LPEA 4EUKB 4C3BA 1SF8A 3TULA 2XL4A 3GM3A 1K40A 1Z3IX 2X51A 3S0XA 4OD4A 4YJWA 2XL8A 4R32A 4YT5A 3AGTA 4N4WA 1JPNA 5JT4A 2OEXA 4D4XA 1O5HA 3LS1A 3GM2A 1APCA 2ZPAA 3Q7LA 4PJMA 4AE4B 2OEVA 5L3VA 3JT1A 3M4CA 1HE9A 1TR2A 2KW3C 2Q00A 1BDJB 3UGPA 3IQ5A 1M6TA
chains in the Genus database with same CATH topology
3U3FA 1ZZPA 3RQEA 4XEKA 3JYYA 3GM1A 3BRJA 4XEVA 3JZ0A 3O10A 1OW7A 1WWPA 1UFBA 3RQGA 1OW8A 2YWAA 2HSBA 1K05A 3C8GD 1O3UA 1WOLA 2L6FA 1OW6A 2KK1A 1PV3A 3AJMA 3TULA 1KTMA 3GM3A 3C8GA 1K40A 1KNYA 1V4AA 3K7DA 5F28E 4EBJA 2L6GA 3C18A 4R32A 4NQFA 3MFNA 2JX0A 2JPUA 1QVXA 1WTYA 3S9OA 3GM2A 4EBKA 1K04A 3C8GB 3L8IA 4XEFA 2PBEA 2L6HA 3RQFA 3U0CA 2Q00A 3B71A 2LK4A 3L8JA 1JOGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U3F A;  1ZZP A;  3RQE A;  4XEK A;  3JYY A;  3GM1 A;  3BRJ A;  4XEV A;  3JZ0 A;  3O10 A;  1OW7 A;  1WWP A;  1UFB A;  3RQG A;  1OW8 A;  2YWA A;  2HSB A;  1K05 A;  3C8G D;  1O3U A;  1WOL A;  2L6F A;  1OW6 A;  2KK1 A;  1PV3 A;  3AJM A;  3TUL A;  1KTM A;  3GM3 A;  3C8G A;  1K40 A;  1KNY A;  1V4A A;  3K7D A;  5F28 E;  4EBJ A;  2L6G A;  3C18 A;  4R32 A;  4NQF A;  3MFN A;  2JX0 A;  2JPU A;  1QVX A;  1WTY A;  3S9O A;  3GM2 A;  4EBK A;  1K04 A;  3C8G B;  3L8I A;  4XEF A;  2PBE A;  2L6H A;  3RQF A;  3U0C A;  2Q00 A;  3B71 A;  2LK4 A;  3L8J A;  1JOG A; 
#chains in the Genus database with same CATH topology
 5JS5 A;  2DI3 A;  1FAP B;  3EH1 A;  4J7Y A;  1TWC A;  3RYL A;  4A4A A;  1JPJ A;  2Q7R A;  2YEV A;  2YKZ A;  3US6 A;  1JMW A;  5CI8 A;  1UG7 A;  2H7O A;  2R02 A;  4K1O A;  4IAQ A;  1O87 A;  2CW0 F;  3AG3 C;  1NFO A;  4JW1 A;  1M2V B;  2P61 A;  3EHM A;  3HJC A;  1A41 A;  5BUO A;  1E85 A;  3AG2 C;  3GEH A;  3K6B A;  2EIN C;  1WOL A;  3ZQY A;  3TQO A;  4DRJ B;  5A6J A;  3I5P A;  1RJ9 B;  3T4R A;  2G3K A;  3NRH A;  4DXW A;  1V4A A;  3LLI A;  5IY5 C;  4RBN A;  3FOO A;  3U8V A;  3UR3 C;  1E86 A;  4OIO F;  3RF3 A;  2LD6 A;  3AGU A;  2L7A A;  1JRA A;  4XPY A;  3JRT A;  2Y3G A;  1K04 A;  3LES A;  1SR2 A;  4J32 B;  4CBE A;  3NDB B;  4WAB A;  4Z9J A;  3RQF A;  1HW2 A;  1TWG A;  2LK4 A;  4O6M A;  3DD7 A;  3ECS A;  1ZVZ A;  3U2M A;  3UMK A;  4YK5 A;  4AK9 A;  2B0H A;  4CJO A;  4RDA A;  1U0B B;  3KPH A;  3M4B A;  3RQG A;  2KGO A;  3GOD A;  3QZC A;  3VYW A;  4O6Y A;  4YT8 A;  3UMI A;  5JUA A;  4P9T A;  3RKO F;  1BZ4 A;  1YZA A;  1BBH A;  2HJ3 A;  2ZD9 A;  3KYI A;  1RKC A;  4GQH A;  3RW0 A;  3GEI A;  4ZLD A;  4NCQ A;  3W4Y A;  3SNH A;  1Z6A A;  2AVK A;  2L6G A;  3NKE A;  4FES A;  5DQZ A;  1YAR O;  2QE9 A;  3C62 A;  1ZW2 A;  1LS1 A;  2YLI A;  4JTA B;  4LDK A;  3AG1 C;  4LLC A;  3DAG A;  1E2X A;  4NTF A;  4X0R A;  5E33 A;  1CPQ A;  3HNJ A;  3CEX A;  3J06 A;  1JOG A;  5A6B D;  4JC7 A;  2E87 A;  4QI0 A;  5DS6 A;  2MWQ A;  5KYN A;  1YLM A;  3JYY A;  4XLP F;  1DOW A;  4XEV A;  1Z63 A;  2WB7 A;  2IXO A;  1HY5 A;  1ST6 A;  3CAX A;  4JKV A;  2WVQ A;  2VCC A;  4U9E A;  4F4B A;  1WGW A;  1H9T A;  1WWP A;  5JLI A;  4CIP A;  1OQC A;  5HV9 A;  3KH2 A;  1I4Y A;  1U89 A;  1M57 C;  1MNE A;  1XZQ A;  3B9Q A;  3JSZ A;  4W8K A;  1NZE A;  5DS5 A;  1T5O A;  2Q3T A;  2OQM A;  2G3V A;  1D1A A;  2PX3 A;  3SXY A;  3ASO C;  4DBR A;  3PCV A;  3DM9 B;  2HV6 A;  4H54 A;  1MMD A;  2JPU A;  1V54 C;  4P9F A;  3OA1 A;  4JCZ A;  3N0T A;  2NPU A;  4XWJ A;  1D1C A;  2YZS A;  4L6R A;  3TD7 A;  3EG9 B;  5K0I A;  1LS4 A;  4G7Z F;  2VCA A;  2WZL A;  1IW7 F;  4BJ1 A;  2Z15 A;  3JYH A;  4BJ5 C;  1Q0G A;  3PDM P;  4C7O A;  3KYJ A;  3SXM A;  4XEK A;  2GAQ A;  3HNK A;  1D1B A;  3JZ0 A;  4MTO A;  4D4N A;  4G7O F;  2OCC C;  1W2W A;  5L0D A;  2J7P D;  2L9J A;  3DWW A;  3DMD A;  2YWA A;  3N24 A;  4J7T A;  4YL1 A;  3U3B A;  2DYS C;  5JVE A;  2Q9C A;  1I5N A;  2HFI A;  1TKN A;  4U5D E;  3HNI A;  2R9R B;  4FAP B;  5JP7 A;  4YWQ A;  1PV3 A;  2F22 A;  4O79 A;  2HKV A;  5COM A;  3DAF A;  1SMY F;  3QVY A;  4IGG A;  2R7R A;  1ZHZ A;  2J9B A;  1TWA A;  2V26 A;  1JR8 A;  4CIH A;  1D0Y A;  4IRU A;  1YZC A;  3L0I A;  1VLS A;  2KSF A;  1Y4C A;  2XSE A;  2PNO A;  3GWL A;  5KYU A;  3LEO A;  1HMO A;  2R25 A;  1J8Y F;  1G5Z A;  2Y69 C;  3IQT A;  1M2V A;  1C17 M;  2GWW A;  4NC3 A;  4CJG A;  4G7H F;  1S7Z A;  5F5F A;  3IEE A;  3X2Q C;  4C7O B;  2A69 F;  1IZM A;  1N1C A;  1LM3 B;  4PR9 A;  4NTA A;  5E3C A;  1A7E A;  1U6H A;  1E84 A;  2WZG A;  4CS8 C;  2ASR A;  4DVZ A;  4OIQ F;  2I8B A;  1LIH A;  4AL1 A;  4JCH A;  1D0Z A;  5KYY A;  1KNY A;  1YA7 O;  3ABK C;  1YYX A;  5JSL A;  2VAS A;  2D4U A;  1GQA A;  2QNL A;  3K1I C;  1MMA A;  4U5C E;  4U5E E;  4PAC A;  2ICW G;  2W9Y A;  4EBB A;  3RFY A;  2ZXO A;  1CGM E;  1DOV A;  4KNW A;  3AOU A;  4U9D A;  3SEO A;  1MMG A;  1G4U S;  2XM0 A;  2ZXR A;  2R7X A;  4PK4 A;  2WZF A;  4G78 A;  4MW8 A;  4JZA A;  3FHD A;  3VF0 A;  4KBL A;  2YL3 A;  1RCP A;  3C63 A;  4AX2 A;  4MW3 A;  2YVK A;  2EIJ C;  1TFK B;  2QUP A;  3R2P A;  3TOM A;  2PX0 A;  2VH3 A;  2NUP A;  5KYU B;  2NSF A;  2OKU A;  2DGJ A;  2Q4F A;  1EA8 A;  3FXH A;  1A7V A;  4IAO A;  1Q0M A;  3ZWI A;  3UNG C;  3IPM O;  4IB4 A;  3C8G A;  1WN0 A;  4MS2 A;  3O55 A;  2CNW A;  3I5Q A;  3NMK A;  2OU6 A;  2Y39 A;  3MFN A;  1VLT A;  4JJG A;  2JX0 A;  4OD5 A;  2KQ9 A;  2R03 A;  1FMV A;  2UUH A;  5KYY B;  1NLX A;  2L6H A;  2VB6 A;  3RIP A;  3U9M A;  4A2N B;  3PMR A;  3W2W A;  2W4B A;  1AEP A;  2IXN A;  3JTL O;  4N6H A;  3LS0 A;  3TOL A;  3U3F A;  1WAS A;  2EPL X;  2YL1 A;  4O7G A;  2OJQ A;  4KI2 A;  3DXJ F;  1ZYR F;  3W8I A;  2CYD A;  4YL3 A;  2J9V A;  4CS9 C;  4Q5S F;  2QY9 A;  2R05 A;  1OKK D;  5GPG B;  2ETS A;  2XS8 A;  4EKW A;  2J9U A;  2OG2 A;  4E0H A;  3B0V C;  4CDY A;  2R7U A;  2YRF A;  3EHN A;  3T6G B;  2IBF A;  1V55 C;  2NUP B;  4MTF A;  3M1C B;  3S29 A;  1C02 A;  3TJ5 A;  4BG0 A;  5BQH A;  2HJM A;  2OOC A;  1C03 A;  2GDC A;  2EIK C;  1M2O A;  2MHR A;  1NG1 A;  3EG9 A;  4LDR A;  4MVR A;  4W8P A;  5E3A A;  3QW0 A;  3ZQV A;  4MTG A;  1WTY A;  4PFP A;  2GA0 A;  4C3E A;  3ZC4 A;  2LSE A;  3UMH A;  3C8G B;  2AU5 A;  4XEF A;  1OCC C;  1YDI A;  2MYS A;  4HFF B;  4BEM J;  1LKX A;  3W8H A;  2H7B A;  4E7S A;  2HZ8 A;  2FFH A;  1TWH A;  5T3W A;  3R7C A;  2Y3D A;  3A9C A;  2I15 A;  3Q7G A;  4CSA C;  3U2L A;  3M79 A;  5JRA A;  3AQC A;  3L34 A;  2OJE D;  3EQL F;  3WAQ A;  4CS9 A;  2HS5 A;  2Y3H A;  5B1B C;  3RH3 A;  3ZSU A;  4ZLC A;  1O3U A;  4ULW A;  2HMQ A;  5T1D B;  5KYX A;  2KK1 A;  2R7T A;  1Q0F A;  2A1D D;  4LLE A;  1TFO B;  2JD3 A;  4JTC B;  2J45 A;  1OCO C;  4MVZ A;  3C18 A;  4YN0 B;  4EHP A;  5A6A A;  1JAF A;  4XPW A;  3ASN C;  3HLZ A;  2LP4 A;  4J30 B;  5E2Q A;  1RMV A;  4IAR A;  3FDQ A;  1MMN A;  1KU2 A;  2XM4 A;  3DI5 A;  1L3P A;  1Z23 A;  2O9X A;  3K66 A;  4HEA J;  1G8X A;  4JEA A;  3VAY A;  4DJ9 A;  3WHN A;  3MLG A;  3NG1 A;  4CS7 A;  4FWV A;  3TK0 A;  3B0U X;  3V5Z A;  2M4E A;  2WVN A;  3IHU A;  1LVK A;  3B0P A;  4XTK A;  3CQZ A;  4CSA A;  3S27 A;  3Q6N A;  1VYK A;  1VK5 A;  2CDQ A;  1RXQ A;  1V74 B;  2Q9A A;  3EGD A;  4P6I C;  4WGZ A;  2V3C C;  3L1M A;  2EPO A;  2YLD A;  3EZI A;  3QMK A;  2P0N A;  4JTD B;  4U5H A;  4Q4Z F;  2A6H F;  5FCL A;  1F1M A;  2R7Q A;  3EPV A;  2XLM A;  3T9O A;  3AJM A;  4LAC B;  5DS4 A;  3CZ6 A;  3GWN A;  3LLK A;  1T01 A;  3KMI A;  2PP4 A;  4DBQ A;  3FVY A;  2R7S A;  2Y3B A;  5D91 A;  1QVX A;  2A0U A;  5KYX B;  3WG7 C;  3ABL C;  2XLD A;  3DM5 A;  3HNL A;  3SXK A;  1LE2 A;  3E9V A;  3V5X A;  1Z5Z A;  3V7O A;  3IQC A;  3ZIB A;  1OR3 A;  1VMA A;  2P6V A;  3U5S A;  1QQ3 A;  4MVM A;  4OIP F;  4BJ5 A;  1Q0K A;  3NYJ A;  2NSG A;  2WL8 A;  3SZR A;  1H9G A;  1Z7Q c;  3BEH A;  3NKD A;  5BQG A;  4DOZ A;  1AVO B;  1PD1 A;  5L0C A;  3FOP A;  4JRZ A;  2IOQ A;  2EIM C;  3MYI A;  3NMJ A;  4E7Z A;  2XS1 A;  1NFN A;  2HV7 A;  3DE9 A;  4K0D A;  2IXP A;  2J7P A;  4BJ6 C;  1ZHX A;  4LDQ A;  2QTV A;  2KYH A;  256B A;  4KC9 A;  3EGD B;  2R7O A;  1GM5 A;  1H7I A;  2EPK X;  3GAN A;  2YHS A;  4QDL A;  5DVW A;  4BJT A;  2DYR C;  5L0H A;  2VC9 A;  4WJ0 A;  2P1A A;  3U9J A;  3QW1 A;  4CDA A;  1T6I A;  2IM8 A;  3AQB A;  2LCH A;  2RSE B;  3K1H A;  2LIG A;  3L8I A;  1FMW A;  1YJG A;  2J8W A;  4MND A;  4E0I A;  5B3I A;  4BEJ A;  3H2V A;  4MVS A;  4K7B A;  3EFO B;  2W4M A;  2P7V A;  4FX5 A;  3MX3 A;  3DKA A;  1OR2 A;  1YYJ A;  1XWJ A;  3DZA A;  3L8J A;  4WGY A;  5EGY A;  4GYT A;  1OXB A;  4PJN A;  1T6U A;  5DQT A;  2YL0 A;  3EJN A;  2EPN A;  1LI5 A;  1YVI A;  2XLV A;  3K33 A;  3ZTM A;  5L0I A;  2XRH A;  2Q9B A;  1I4Z A;  2J0W A;  5COF A;  2NUT A;  3Q6M A;  3G4X A;  1QKR A;  1UFB A;  5B1A C;  4O6N A;  1OW8 A;  4MVU A;  3DE8 A;  1CGO A;  1MQV A;  4HE8 D;  2CNW D;  3DJN B;  4BJ6 A;  2EIL C;  4CS8 A;  1PCX A;  3DJU B;  1HMD A;  3C8Z A;  3K7D A;  4MVQ A;  4PJJ A;  5TJ5 E;  3RVY A;  2C03 A;  2XL6 A;  4JE9 A;  3HKK A;  1Y6D A;  3O6X A;  2PFD A;  5EHH A;  4YL0 A;  3S9O A;  2AWY A;  2J9W A;  1VYI A;  3K1I A;  4NY3 A;  2LFF A;  2G62 A;  2KJG A;  3EH2 A;  1CPR A;  4JEB A;  3SYN A;  3U8P A;  1LE4 A;  3O39 A;  2AWC A;  1BR2 A;  2X0C A;  1M56 C;  5HSW A;  1ZZP A;  3RQE A;  4MVO A;  4BPM A;  4ER9 A;  3WOD F;  4YT4 A;  1T9K A;  2BL2 A;  4Q7C A;  5F5H A;  5B3S C;  2R7W A;  3EGX A;  5D92 A;  3CSK A;  4JIO A;  4U5B E;  4JVS A;  3SP1 A;  1D0X A;  1BR4 A;  3JCU Q;  4IWB A;  1ORY A;  1OXK A;  4PJL A;  4EIY A;  1K05 A;  4UDV A;  3FAP B;  2IXM A;  3KL4 A;  4G0H A;  4NTB A;  3LJB A;  4ULV A;  5COG A;  2NUT B;  2XLE A;  3ATP A;  1OW6 A;  3LNR A;  4OIN F;  3ZDL A;  1A0B A;  2W45 A;  1RKE A;  1GGQ A;  2EPM X;  3FMS A;  3G50 A;  4ONS A;  3G4Z A;  4OIR F;  1EI7 A;  3JSE O;  3QTH A;  1S05 A;  3ITF A;  4XPX A;  4DRI B;  3PHF 2;  3I4U A;  5L0J A;  1YA9 A;  5L0G A;  1MND A;  3FAJ A;  2B0J A;  2ZXP A;  5EK0 A;  4JJF A;  4YT2 A;  5A6K A;  3POV A;  3NYL A;  2R7V A;  1ZU4 A;  3HTK C;  2HMZ A;  3C7J A;  2UUI A;  2KNH A;  2BC5 A;  1R4T A;  3OWT A;  4IJJ A;  3ZG1 A;  3BRJ A;  3ABM C;  3S28 A;  1ZHT A;  2C04 A;  5AGF A;  5CI9 A;  4XLN F;  2HSB A;  2BE5 F;  2PF4 E;  3S90 A;  2HUJ A;  2H8A A;  1H6G A;  3EGX B;  1BR1 A;  4I1O B;  1ZW3 A;  4B6I A;  2L81 A;  1A7D A;  1OKK A;  2A0B A;  5F28 E;  2RD9 A;  3V5Y A;  4NQF A;  4N06 A;  4PFO A;  4I1M A;  3H65 A;  5AC5 A;  2J0X A;  5KYW A;  2HSQ A;  5FZT A;  1EQ1 A;  3H2U A;  1QZX A;  1RKE B;  4DVY P;  2TMV P;  4EWC A;  3SXZ A;  3U0C A;  4EBJ A;  5L0F A;  4U5F E;  4N6C A;  4M63 A;  3E70 C;  1QPU A;  3VM6 A;  2AP3 A;  3LEV A;  3KKB A;  4RD9 A;  3ZTZ A;  5A69 A;  1QLE C;  1FNT c;  1PD0 A;  2KC3 A;  1LI7 A;  5A6B A;  1ORJ A;  4XQ1 A;  1OCR C;  4ANJ A;  1E83 A;  3IQ6 A;  2YL7 A;  5AC4 A;  5CIV A;  4H4K C;  1FR0 A;  3B29 A;  4LER A;  2A68 F;  3RVZ A;  4AL0 A;  2A6E F;  4GEH A;  4C3D A;  2DB4 A;  1WAT A;  4Z9H A;  1NBB A;  4Z9I A;  3OEO A;  3W2V A;  4DRH B;  1NU7 D;  2ZXW C;  1G4W R;  1ZHW A;  1OCZ C;  5T3T A;  1HW1 A;  3TJ6 A;  1VTM P;  2YLG A;  1T6Q A;  3MYF A;  3EFO A;  3AG4 C;  1GS9 A;  2XLO A;  2XXA A;  4MQ9 F;  1CGN A;  2CCY A;  3LAY A;  5KYW B;  1FFT C;  3T6B A;  2XLH A;  1VOM A;  2LFD A;  1TQG A;  2FGY A;  3GM1 A;  1OW7 A;  3EZH A;  1NSG B;  1R5I D;  4KNV A;  1L7C A;  4QI2 A;  2WVO A;  3MBG A;  4I44 A;  3NYM A;  5DLJ A;  1ZU5 A;  2YQY A;  3GEE A;  4E17 A;  3F46 A;  2VCB A;  2L6F A;  3ZVR A;  2QLA A;  2LQG A;  1KTM A;  1SYQ A;  2GFH A;  4AE4 A;  5L3Q A;  2XLW A;  3VRC A;  4I3M A;  4HFK B;  3S84 A;  5BQI A;  2CGE A;  2IYL D;  1FFH A;  1ZHY A;  1ORS C;  1EKY A;  2J46 A;  4EBK A;  4CDV A;  1NU9 C;  3X1O A;  2FAP B;  1YAU O;  2PBE A;  2NG1 A;  3LUT B;  3QVZ A;  3UGO A;  1B68 A;  3B71 A;  3GOR A;  3JRM O;  2M64 A;  1XZP A;  3F47 A;  3A11 A;  2H7V C;  1HE1 A;  3LNM B;  3N2Z B;  4U5G A;  2XXA B;  3O10 A;  4CX9 A;  3NMI A;  2D5R B;  1RJ9 A;  1VB5 A;  1SZI A;  3T6J A;  1AUE A;  1FTS A;  1QSP A;  3C8G D;  1Q0D A;  3M15 A;  1J8M F;  4JUR I;  4E18 A;  1LPE A;  4EUK B;  4C3B A;  1SF8 A;  3TUL A;  2XL4 A;  3GM3 A;  1K40 A;  1Z3I X;  2X51 A;  3S0X A;  4OD4 A;  4YJW A;  2XL8 A;  4R32 A;  4YT5 A;  3AGT A;  4N4W A;  1JPN A;  5JT4 A;  2OEX A;  4D4X A;  1O5H A;  3LS1 A;  3GM2 A;  1APC A;  2ZPA A;  3Q7L A;  4PJM A;  4AE4 B;  2OEV A;  5L3V A;  3JT1 A;  3M4C A;  1HE9 A;  1TR2 A;  2KW3 C;  2Q00 A;  1BDJ B;  3UGP A;  3IQ5 A;  1M6T A; 
#chains in the Genus database with same CATH homology
 3U3F A;  1ZZP A;  3RQE A;  4XEK A;  3JYY A;  3GM1 A;  3BRJ A;  4XEV A;  3JZ0 A;  3O10 A;  1OW7 A;  1WWP A;  1UFB A;  3RQG A;  1OW8 A;  2YWA A;  2HSB A;  1K05 A;  3C8G D;  1O3U A;  1WOL A;  2L6F A;  1OW6 A;  2KK1 A;  1PV3 A;  3AJM A;  3TUL A;  1KTM A;  3GM3 A;  3C8G A;  1K40 A;  1KNY A;  1V4A A;  3K7D A;  5F28 E;  4EBJ A;  2L6G A;  3C18 A;  4R32 A;  4NQF A;  3MFN A;  2JX0 A;  2JPU A;  1QVX A;  1WTY A;  3S9O A;  3GM2 A;  4EBK A;  1K04 A;  3C8G B;  3L8I A;  4XEF A;  2PBE A;  2L6H A;  3RQF A;  3U0C A;  2Q00 A;  3B71 A;  2LK4 A;  3L8J A;  1JOG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...