3MFNA

Dfer_2879 protein of unknown function from dyadobacter fermentans
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
125
structure length
125
Chain Sequence
AQEAVIEAKRYLNNAKDILRDKGGKEDGFYQDSKYVKMAGHTAYSGVLFALDHYFGKKTKGRKDVDWYKSNLAQQDKKILNTFVSVYEQLHLVMAYDGVGDAEVVKLGFQRAEIIIDWVERRLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title X-ray crystal structure of Dfer_2879 protein of unknown function from Dyadobacter fermentans.
rcsb
source organism Dyadobacter fermentans
molecule tags Structural genomics, unknown function
total genus 47
structure length 125
sequence length 125
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18498 DUF5618 Domain of unknown function (DUF5618)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3mfnA00
1K04A 1PV3A 3AJMA 3RQFA 2KK1A 2PBEA 2L6GA 2JX0A 4XEFA 1OW7A 1K40A 1WWPA 2L6FA 1WOLA 3L8JA 3JYYA 1O3UA 1WTYA 1V4AA 1QVXA 2HSBA 4NQFA 3O10A 3L8IA 5F28E 1OW6A 1ZZPA 1K05A 1JOGA 3C18A 2YWAA 3C8GD 4EBKA 3GM1A 3U3FA 3BRJA 3RQGA 3U0CA 3GM3A 3K7DA 3RQEA 4EBJA 1KTMA 1KNYA 3C8GA 1OW8A 4XEVA 3TULA 4XEKA 3S9OA 4R32A 2LK4A 3B71A 2JPUA 3GM2A 2Q00A 3MFNA 3C8GB 1UFBA 3JZ0A 2L6HA
chains in the Genus database with same CATH superfamily
4U5DE 4CDYA 1G5ZA 3CZ6A 4JE9A 1IZMA 1BR4A 4CJOA 3ZTMA 2JX0A 1J8YF 4GYTA 3WAQA 1VYIA 1WWPA 3M1CB 1ZHWA 1GM5A 3IPMO 1PCXA 4UDVA 4XPWA 1WOLA 2J9UA 2EILC 2DGJA 3LNRA 3UMHA 1FFHA 3T6JA 3EJNA 3EGDB 3FHDA 4LERA 1JOGA 1QSPA 2A6HF 3ZWIA 2CYDA 4H54A 5L0CA 3UR3C 1Q0GA 4RBNA 2W4BA 4NCQA 4O7GA 2R7SA 5AGFA 4O79A 4DRHB 1G8XA 2IXMA 2XLEA 2LCHA 5KYUB 2X0CA 1Y6DA 1A41A 2R7XA 4BJ5C 2Q00A 5T3TA 1CPQA 5FZTA 1MNEA 1L3PA 4MVUA 4C3EA 5AC5A 1YJGA 4E7SA 3K66A 1PV3A 3VM6A 5KYNA 3UGPA 2DB4A 3R2PA 4D4XA 5GPGB 4C3BA 1H6GA 1NU7D 2B0JA 4MVRA 1YVIA 5JUAA 5CI8A 1HW1A 1VLSA 3FMSA 1A7EA 3I4UA 3U9JA 3UGOA 3NKDA 5COFA 5KYYA 3FOPA 1VYKA 4PJJA 3S27A 5E2QA 5DS4A 1FTSA 2LP4A 5L3QA 4NTAA 4MS2A 2XLOA 2YZSA 4CS9A 1FR0A 3TD7A 2AWCA 5COGA 1LVKA 1GQAA 1TFKB 2I8BA 2OU6A 4J7TA 3MX3A 2YLGA 4FAPB 2OKUA 4U5EE 4E0HA 1ORSC 4JZAA 5CIVA 4JCHA 1DOVA 1KU2A 2HJ3A 5L0HA 3EZHA 4W8PA 3CQZA 1E84A 4CS7A 1Z7Qc 4ZLCA 5KYWA 2CNWA 4YT5A 4O6YA 3AJMA 2GDCA 2Z15A 2B0HA 2ZXWC 4FESA 4HFKB 2M4EA 5BQIA 4ANJA 1LKXA 4YT2A 1YA9A 3V5ZA 1RKEB 3O6XA 2J45A 3MYFA 1HY5A 4PR9A 2A0BA 3EG9B 5A6JA 1M57C 1Q0MA 1APCA 2LQGA 4PJMA 3TJ6A 2L7AA 3C8GD 2P0NA 5DQTA 4P9FA 3Q7GA 3LS1A 3BRJA 3TOMA 3H2UA 1KNYA 4QI2A 3ABLC 3R7CA 1QZXA 1OW8A 2YL1A 4MNDA 4LLCA 4XWJA 5E33A 3RVZA 5KYXA 1D1CA 3JSZA 2C03A 5B1AC 1F1MA 3KYIA 1D0YA 2G3KA 1V74B 2J0XA 1ZHZA 1ZHYA 3K33A 1V54C 4WABA 4YL3A 2XLMA 3Q6NA 2YEVA 3RVYA 2OCCC 4FX5A 5JSLA 1JR8A 1XZQA 2J46A 2Y69C 1JPNA 2TMVP 4HEAJ 3E9VA 3SEOA 2L6FA 1LE4A 2Q4FA 4PK4A 2IM8A 3DI5A 3FOOA 3SXYA 5A6AA 3SZRA 4IB4A 1J8MF 5B3IA 1YA7O 4JEBA 3W2VA 3O10A 2FFHA 3DXJF 4MW8A 1M56C 5F28E 5DQZA 2YRFA 1VK5A 2IYLD 2YWAA 3HTKC 4C7OA 3HNKA 1FAPB 5BQGA 3PDMP 3J06A 3GM3A 1T9KA 2ZXOA 3C63A 3K7DA 1NFOA 2P61A 3SXMA 3C8GA 4O6MA 4EBJA 2YVKA 2EPKX 2J9VA 3EH2A 4IRUA 1PD1A 3L34A 3TOLA 1YARO 2WZGA 3QW0A 3TULA 1HMOA 1CPRA 1VOMA 3C62A 3RF3A 4U9EA 3GM2A 2QUPA 4G78A 3U2MA 3ZVRA 1U6HA 4YT8A 5L0FA 2HZ8A 1UFBA 4BJ6A 3KYJA 1RKCA 2ICWG 3JRTA 1HMDA 2QY9A 4JC7A 4CS9C 3RQFA 3NDBB 3T9OA 3UNGC 3A9CA 2YL0A 3U8VA 2R03A 4DRIB 2NUPA 2YLDA 2GA0A 1ZYRF 2HUJA 4JCZA 3I5QA 3V5XA 3WHNA 4YJWA 4JIOA 4DBRA 3DWWA 4NQFA 2UUHA 4NTBA 2Y3HA 4PFOA 4IJJA 4N6CA 4YK5A 3FAJA 1C03A 3GM1A 5E3AA 3B0UX 2HV6A 2KGOA 2WL8A 3LUTB 3NG1A 5DS6A 2ZXPA 1ZU5A 2P1AA 3H65A 2QTVA 3ASNC 5JP7A 3DM9B 1Q0KA 4U5BE 3GEIA 5B1BC 3AGUA 4IARA 5T1DB 4CS8A 3LEOA 4L6RA 2R7RA 4KI2A 5KYXB 3IQ6A 3S29A 5EGYA 1K04A 3W8IA 3N2ZB 3B9QA 2D4UA 2VC9A 2WVOA 3NMJA 3X1OA 1NSGB 3MBGA 5EHHA 3SP1A 5JVEA 3K1IA 2NSGA 3U5SA 4F4BA 4NC3A 1SMYF 4KNWA 1XWJA 4ULWA 1T01A 2R02A 3HLZA 2NUTA 2V26A 3W8HA 3S90A 2KQ9A 3EHNA 3EGXA 3X2QC 4IAOA 3NRHA 3HNJA 1OR2A 3F46A 4ULVA 2VCBA 3G4XA 256BA 3Q7LA 2AU5A 3QZCA 3ZSUA 2G3VA 4JTAB 4N6HA 4AL0A 1SR2A 4QI0A 1VTMP 1C17M 2CCYA 1U89A 2J9BA 2L81A 2MYSA 2Y3GA 4JVSA 1I4YA 1Q0FA 3OWTA 2CNWD 3NYJA 2KJGA 3C8GB 3FVYA 2XSEA 4XTKA 3RIPA 2H7BA 3VRCA 1E83A 4A2NB 2EPLX 2ASRA 2XL6A 2XS1A 5DLJA 5DS5A 1M2VA 2KK1A 3E70C 1W2WA 2DYRC 2H8AA 2J9WA 2VASA 4AL1A 5L0GA 2PFDA 1Z3IX 4PJNA 3V5YA 1NLXA 2HSQA 2ZD9A 3RFYA 4G0HA 3O55A 1OR3A 4J7YA 4MTOA 3NMIA 1V4AA 4OD4A 4BJ6C 4YWQA 5JLIA 4CJGA 3DM5A 5JRAA 1V55C 4JTDB 2CDQA 4K0DA 3LEVA 3W2WA 2FGYA 2LSEA 4ONSA 2A6EF 1WASA 2YLIA 3TK0A 4U5HA 3RQEA 2H7OA 1A7VA 4NY3A 2HJMA 4YL1A 3ZIBA 3JT1A 4CBEA 2GWWA 3GEHA 1TWGA 4JJGA 4CSAC 1OQCA 1YYXA 2HKVA 1YYJA 1S05A 5EK0A 4Q5SF 3B71A 4MTFA 3B0VC 2WB7A 3ZQVA 3GEEA 1SYQA 1ORYA 2R05A 3L1MA 4Q4ZF 2J8WA 2IXNA 1QPUA 5F5HA 4MTGA 4XLPF 3AGTA 4MVMA 3ZTZA 4JRZA 1LI7A 4N4WA 4W8KA 4AE4B 1RJ9A 2IXPA 3LNMB 3S84A 1MNDA 4D4NA 3F47A 4U5GA 3JSEO 5IY5C 1QQ3A 3RYLA 1QVXA 2HSBA 2J7PA 3V7OA 1HW2A 4OIOF 2F22A 2X51A 2XM4A 3SXZA 2LFFA 3U3FA 4BJ1A 1RMVA 4WGYA 4NTFA 4BJTA 4JKVA 2NSFA 3IQCA 3KL4A 3GORA 1H9TA 2OEXA 3NYMA 4DVYP 4Z9JA 1A7DA 4PFPA 1UG7A 1D1BA 2VCAA 3RH3A 1ZVZA 1EI7A 3FXHA 2BE5F 4EWCA 3GWNA 4OIQF 4PACA 3N0TA 1YZAA 3DE9A 3AG1C 2EIKC 4DOZA 2JD3A 1U0BB 4OINF 2MHRA 2A1DD 4RD9A 1HE9A 4A4AA 1I5NA 5FCLA 2W9YA 2AP3A 1M2VB 3KPHA 3S28A 2YQYA 2I15A 4G7HF 1G4WR 1M2OA 3N24A 4RDAA 5TJ5E 4HE8D 3TJ5A 4I1OB 3M15A 1Z23A 3IEEA 2EPNA 2KYHA 1KTMA 4K1OA 4J30B 1Q0DA 4JW1A 4MVSA 3HNIA 3NKEA 1EKYA 4J32B 4N06A 5AC4A 4JURI 5KYYB 1WGWA 2BL2A 3U8PA 4BEJA 2XLVA 2AWYA 3FDQA 3S0XA 3ABKC 1FMVA 4JTCB 5BUOA 2P6VA 1M6TA 2YHSA 2G62A 1TWAA 2Y3BA 1N1CA 4XEFA 2QE9A 3T6BA 1D1AA 3LS0A 4H4KC 4XQ1A 3AG4C 4P9TA 3M79A 1RCPA 2RD9A 3G50A 4HFFB 5JT4A 5KYWB 3ATPA 4BJ5A 5KYUA 3DJNB 1FNTc 1AVOB 3L8IA 3LAYA 5K0IA 4EBKA 1QKRA 1ZHXA 3LJBA 1SF8A 3ASOC 2XM0A 3CEXA 1LI5A 3DMDA 2GFHA 2HS5A 1D0XA 2GAQA 2Q7RA 1Z63A 2OQMA 2KSFA 4R32A 2W45A 2UUIA 1R4TA 3H2VA 2W4MA 3VF0A 1T6QA 3MLGA 3RKOF 4MVZA 1MMAA 1OCZC 1ORJA 1VLTA 1YAUO 2PNOA 3CAXA 3JRMO 3LLIA 4CIPA 2L6GA 2EPOA 3HNLA 4JJFA 4AK9A 2XXAA 1OW7A 1H9GA 2WVNA 3EFOA 3O39A 2NG1A 4E17A 5BQHA 5HV9A 5CI9A 2KC3A 1LPEA 2Q9AA 1CGOA 1O3UA 5L0DA 1BDJB 3UMIA 3WODF 3L0IA 3EH1A 2AVKA 2EPMX 2OOCA 3DE8A 2XLDA 3C18A 3U9MA 4E7ZA 1NZEA 2PP4A 5L0JA 4B6IA 4IWBA 3QVZA 3DKAA 3WG7C 3QVYA 2ZXRA 3QMKA 3EHMA 4XEVA 1EA8A 2YL7A 1XZPA 4U9DA 3VYWA 3M4BA 5JS5A 4C7OB 2YKZA 1WATA 1TKNA 3MFNA 4LDRA 4DRJB 5DVWA 2IBFA 2IOQA 1RXQA 1GGQA 3JZ0A 1WN0A 1LS1A 1I4ZA 3EG9A 3IHUA 1T6IA 2XL8A 2A0UA 4ZLDA 2WZFA 3JYHA 2P7VA 3M4CA 5A6BA 1AUEA 2IXOA 3G4ZA 3K6BA 2J7PD 1EQ1A 3L8JA 2XS8A 3KH2A 2HFIA 4PJLA 4WJ0A 5D92A 5D91A 1LM3B 2LFDA 3NMKA 4DVZA 1TR2A 4I1MA 5A69A 2OJED 1OCRC 3EZIA 2NUPB 2V3CC 4EKWA 3OEOA 2EINC 2VCCA 1NFNA 2A68F 3B29A 2OG2A 2Q9BA 3AOUA 5L0IA 2O9XA 3ZQYA 4I3MA 1L7CA 1TQGA 1B68A 1C02A 1NG1A 2R7QA 3JTLO 4OIRF 4AX2A 2LIGA 2JPUA 4BEMJ 1FFTC 4C3DA 2OJQA 4IGGA 4EHPA 1NBBA 2QNLA 3POVA 3C7JA 3EPVA 3IQTA 1YZCA 2YL3A 2DYSC 1SZIA 3IQ5A 4I44A 3DZAA 4O6NA 4U5CE 4CX9A 3U2LA 4LACB 1O5HA 1AEPA 1TWHA 2R25A 1VB5A 1Z5ZA 3NYLA 3QTHA 4BPMA 5B3SC 2XRHA 5HSWA 1K40A 1BR2A 3QW1A 1VMAA 3DD7A 1FMWA 3ZG1A 2ETSA 3U3BA 3JYYA 3PCVA 4MQ9F 4CS8C 2R7UA 2XXAB 2EIJC 1NU9C 1T5OA 1ZZPA 2H7VC 3EFOB 1LIHA 1OCCC 4Z9HA 3SXKA 2HMZA 2XLHA 1YLMA 1Z6AA 1BR1A 4GQHA 4OD5A 3FAPB 4XPYA 3K1IC 2NUTB 1TWCA 3Q6MA 3EGXB 3S9OA 2R9RB 2R7TA 4EUKB 2EIMC 3US6A 4E0IA 1DOWA 3LLKA 1MMGA 1BBHA 1OXBA 2BC5A 3BEHA 4P6IC 4YL0A 4K7BA 3T4RA 3W4YA 2RSEB 1IW7F 4MW3A 4GEHA 4DBQA 4CIHA 1E85A 4KBLA 2D5RB 1PD0A 1JRAA 2Q9CA 2XL4A 3AQBA 1WTYA 4M63A 4DJ9A 3ABMC 1JAFA 4WGZA 2OEVA 3K1HA 1TFOB 2HMQA 2R7OA 3ZDLA 1ZW2A 3SYNA 4YT4A 4EBBA 3UMKA 1S7ZA 2WVQA 3U0CA 4LLEA 1ZHTA 2LD6A 1ZW3A 2VH3A 4BG0A 2J0WA 4LDQA 3A11A 4QDLA 2ZPAA 2LK4A 2CW0F 3OA1A 1OKKD 2FAPB 5F5FA 4YN0B 4OIPF 2XLWA 2KNHA 4G7ZF 3EGDA 3C8ZA 1QLEC 1JMWA 4Z9IA 5A6KA 4CDAA 1D0ZA 4CDVA 1MMDA 1H7IA 3HJCA 1CGNA 4IAQA 4G7OF 1CGME 1T6UA 3PMRA 3I5PA 1OW6A 2CGEA 1A0BA 1GS9A 1K05A 1RJ9B 1YDIA 3AG2C 3LESA 2PF4E 3DJUB 3ECSA 3GANA 3ZC4A 3PHF2 4XLNF 1BZ4A 1HE1A 3HKKA 4EIYA 4KC9A 4DXWA 3GODA 1Y4CA 1LS4A 3RW0A 4XEKA 1LE2A 2MWQA 4LDKA 2Y39A 2PX0A 2C04A 4ER9A 2L6HA 5COMA 2KW3C 3JCUQ 1OXKA 2PBEA 1MQVA 1OKKA 3DAFA 3GWLA 5A6BD 5L3VA 3T6GB 1OCOC 4FWVA 1ST6A 3VAYA 2R7VA 2DI3A 4CSAA 2QLAA 3ITFA 4U5FE 5T3WA 4KNVA 2VB6A 4MVOA 2A69F 4X0RA 3KKBA 2R7WA 4Q7CA 2PX3A 3DAGA 3KMIA 1MMNA 4MVQA 5E3CA 3RQGA 1E2XA 3AG3C 2Q3TA 2HV7A 3MYIA 3B0PA 3TQOA 2E87A 3AQCA 1ZU4A 2NPUA 3CSKA 3SNHA 1G4US 4JEAA 1E86A 1R5ID 2WZLA 1O87A 4AE4A 4E18A 3EQLF 2L9JA 1RKEA 2Y3DA 4XPXA 2M64A 1JPJA
chains in the Genus database with same CATH topology
1K04A 1PV3A 3AJMA 3RQFA 2KK1A 2PBEA 2L6GA 2JX0A 4XEFA 1OW7A 1K40A 1WWPA 2L6FA 1WOLA 3L8JA 3JYYA 1O3UA 1WTYA 1V4AA 1QVXA 2HSBA 4NQFA 3O10A 3L8IA 5F28E 1OW6A 1ZZPA 1K05A 1JOGA 3C18A 2YWAA 3C8GD 4EBKA 3GM1A 3U3FA 3BRJA 3RQGA 3U0CA 3GM3A 3K7DA 3RQEA 4EBJA 1KTMA 1KNYA 3C8GA 1OW8A 4XEVA 3TULA 4XEKA 3S9OA 4R32A 2LK4A 3B71A 2JPUA 3GM2A 2Q00A 3MFNA 3C8GB 1UFBA 3JZ0A 2L6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K04 A;  1PV3 A;  3AJM A;  3RQF A;  2KK1 A;  2PBE A;  2L6G A;  2JX0 A;  4XEF A;  1OW7 A;  1K40 A;  1WWP A;  2L6F A;  1WOL A;  3L8J A;  3JYY A;  1O3U A;  1WTY A;  1V4A A;  1QVX A;  2HSB A;  4NQF A;  3O10 A;  3L8I A;  5F28 E;  1OW6 A;  1ZZP A;  1K05 A;  1JOG A;  3C18 A;  2YWA A;  3C8G D;  4EBK A;  3GM1 A;  3U3F A;  3BRJ A;  3RQG A;  3U0C A;  3GM3 A;  3K7D A;  3RQE A;  4EBJ A;  1KTM A;  1KNY A;  3C8G A;  1OW8 A;  4XEV A;  3TUL A;  4XEK A;  3S9O A;  4R32 A;  2LK4 A;  3B71 A;  2JPU A;  3GM2 A;  2Q00 A;  3MFN A;  3C8G B;  1UFB A;  3JZ0 A;  2L6H A; 
#chains in the Genus database with same CATH topology
 4U5D E;  4CDY A;  1G5Z A;  3CZ6 A;  4JE9 A;  1IZM A;  1BR4 A;  4CJO A;  3ZTM A;  2JX0 A;  1J8Y F;  4GYT A;  3WAQ A;  1VYI A;  1WWP A;  3M1C B;  1ZHW A;  1GM5 A;  3IPM O;  1PCX A;  4UDV A;  4XPW A;  1WOL A;  2J9U A;  2EIL C;  2DGJ A;  3LNR A;  3UMH A;  1FFH A;  3T6J A;  3EJN A;  3EGD B;  3FHD A;  4LER A;  1JOG A;  1QSP A;  2A6H F;  3ZWI A;  2CYD A;  4H54 A;  5L0C A;  3UR3 C;  1Q0G A;  4RBN A;  2W4B A;  4NCQ A;  4O7G A;  2R7S A;  5AGF A;  4O79 A;  4DRH B;  1G8X A;  2IXM A;  2XLE A;  2LCH A;  5KYU B;  2X0C A;  1Y6D A;  1A41 A;  2R7X A;  4BJ5 C;  2Q00 A;  5T3T A;  1CPQ A;  5FZT A;  1MNE A;  1L3P A;  4MVU A;  4C3E A;  5AC5 A;  1YJG A;  4E7S A;  3K66 A;  1PV3 A;  3VM6 A;  5KYN A;  3UGP A;  2DB4 A;  3R2P A;  4D4X A;  5GPG B;  4C3B A;  1H6G A;  1NU7 D;  2B0J A;  4MVR A;  1YVI A;  5JUA A;  5CI8 A;  1HW1 A;  1VLS A;  3FMS A;  1A7E A;  3I4U A;  3U9J A;  3UGO A;  3NKD A;  5COF A;  5KYY A;  3FOP A;  1VYK A;  4PJJ A;  3S27 A;  5E2Q A;  5DS4 A;  1FTS A;  2LP4 A;  5L3Q A;  4NTA A;  4MS2 A;  2XLO A;  2YZS A;  4CS9 A;  1FR0 A;  3TD7 A;  2AWC A;  5COG A;  1LVK A;  1GQA A;  1TFK B;  2I8B A;  2OU6 A;  4J7T A;  3MX3 A;  2YLG A;  4FAP B;  2OKU A;  4U5E E;  4E0H A;  1ORS C;  4JZA A;  5CIV A;  4JCH A;  1DOV A;  1KU2 A;  2HJ3 A;  5L0H A;  3EZH A;  4W8P A;  3CQZ A;  1E84 A;  4CS7 A;  1Z7Q c;  4ZLC A;  5KYW A;  2CNW A;  4YT5 A;  4O6Y A;  3AJM A;  2GDC A;  2Z15 A;  2B0H A;  2ZXW C;  4FES A;  4HFK B;  2M4E A;  5BQI A;  4ANJ A;  1LKX A;  4YT2 A;  1YA9 A;  3V5Z A;  1RKE B;  3O6X A;  2J45 A;  3MYF A;  1HY5 A;  4PR9 A;  2A0B A;  3EG9 B;  5A6J A;  1M57 C;  1Q0M A;  1APC A;  2LQG A;  4PJM A;  3TJ6 A;  2L7A A;  3C8G D;  2P0N A;  5DQT A;  4P9F A;  3Q7G A;  3LS1 A;  3BRJ A;  3TOM A;  3H2U A;  1KNY A;  4QI2 A;  3ABL C;  3R7C A;  1QZX A;  1OW8 A;  2YL1 A;  4MND A;  4LLC A;  4XWJ A;  5E33 A;  3RVZ A;  5KYX A;  1D1C A;  3JSZ A;  2C03 A;  5B1A C;  1F1M A;  3KYI A;  1D0Y A;  2G3K A;  1V74 B;  2J0X A;  1ZHZ A;  1ZHY A;  3K33 A;  1V54 C;  4WAB A;  4YL3 A;  2XLM A;  3Q6N A;  2YEV A;  3RVY A;  2OCC C;  4FX5 A;  5JSL A;  1JR8 A;  1XZQ A;  2J46 A;  2Y69 C;  1JPN A;  2TMV P;  4HEA J;  3E9V A;  3SEO A;  2L6F A;  1LE4 A;  2Q4F A;  4PK4 A;  2IM8 A;  3DI5 A;  3FOO A;  3SXY A;  5A6A A;  3SZR A;  4IB4 A;  1J8M F;  5B3I A;  1YA7 O;  4JEB A;  3W2V A;  3O10 A;  2FFH A;  3DXJ F;  4MW8 A;  1M56 C;  5F28 E;  5DQZ A;  2YRF A;  1VK5 A;  2IYL D;  2YWA A;  3HTK C;  4C7O A;  3HNK A;  1FAP B;  5BQG A;  3PDM P;  3J06 A;  3GM3 A;  1T9K A;  2ZXO A;  3C63 A;  3K7D A;  1NFO A;  2P61 A;  3SXM A;  3C8G A;  4O6M A;  4EBJ A;  2YVK A;  2EPK X;  2J9V A;  3EH2 A;  4IRU A;  1PD1 A;  3L34 A;  3TOL A;  1YAR O;  2WZG A;  3QW0 A;  3TUL A;  1HMO A;  1CPR A;  1VOM A;  3C62 A;  3RF3 A;  4U9E A;  3GM2 A;  2QUP A;  4G78 A;  3U2M A;  3ZVR A;  1U6H A;  4YT8 A;  5L0F A;  2HZ8 A;  1UFB A;  4BJ6 A;  3KYJ A;  1RKC A;  2ICW G;  3JRT A;  1HMD A;  2QY9 A;  4JC7 A;  4CS9 C;  3RQF A;  3NDB B;  3T9O A;  3UNG C;  3A9C A;  2YL0 A;  3U8V A;  2R03 A;  4DRI B;  2NUP A;  2YLD A;  2GA0 A;  1ZYR F;  2HUJ A;  4JCZ A;  3I5Q A;  3V5X A;  3WHN A;  4YJW A;  4JIO A;  4DBR A;  3DWW A;  4NQF A;  2UUH A;  4NTB A;  2Y3H A;  4PFO A;  4IJJ A;  4N6C A;  4YK5 A;  3FAJ A;  1C03 A;  3GM1 A;  5E3A A;  3B0U X;  2HV6 A;  2KGO A;  2WL8 A;  3LUT B;  3NG1 A;  5DS6 A;  2ZXP A;  1ZU5 A;  2P1A A;  3H65 A;  2QTV A;  3ASN C;  5JP7 A;  3DM9 B;  1Q0K A;  4U5B E;  3GEI A;  5B1B C;  3AGU A;  4IAR A;  5T1D B;  4CS8 A;  3LEO A;  4L6R A;  2R7R A;  4KI2 A;  5KYX B;  3IQ6 A;  3S29 A;  5EGY A;  1K04 A;  3W8I A;  3N2Z B;  3B9Q A;  2D4U A;  2VC9 A;  2WVO A;  3NMJ A;  3X1O A;  1NSG B;  3MBG A;  5EHH A;  3SP1 A;  5JVE A;  3K1I A;  2NSG A;  3U5S A;  4F4B A;  4NC3 A;  1SMY F;  4KNW A;  1XWJ A;  4ULW A;  1T01 A;  2R02 A;  3HLZ A;  2NUT A;  2V26 A;  3W8H A;  3S90 A;  2KQ9 A;  3EHN A;  3EGX A;  3X2Q C;  4IAO A;  3NRH A;  3HNJ A;  1OR2 A;  3F46 A;  4ULV A;  2VCB A;  3G4X A;  256B A;  3Q7L A;  2AU5 A;  3QZC A;  3ZSU A;  2G3V A;  4JTA B;  4N6H A;  4AL0 A;  1SR2 A;  4QI0 A;  1VTM P;  1C17 M;  2CCY A;  1U89 A;  2J9B A;  2L81 A;  2MYS A;  2Y3G A;  4JVS A;  1I4Y A;  1Q0F A;  3OWT A;  2CNW D;  3NYJ A;  2KJG A;  3C8G B;  3FVY A;  2XSE A;  4XTK A;  3RIP A;  2H7B A;  3VRC A;  1E83 A;  4A2N B;  2EPL X;  2ASR A;  2XL6 A;  2XS1 A;  5DLJ A;  5DS5 A;  1M2V A;  2KK1 A;  3E70 C;  1W2W A;  2DYR C;  2H8A A;  2J9W A;  2VAS A;  4AL1 A;  5L0G A;  2PFD A;  1Z3I X;  4PJN A;  3V5Y A;  1NLX A;  2HSQ A;  2ZD9 A;  3RFY A;  4G0H A;  3O55 A;  1OR3 A;  4J7Y A;  4MTO A;  3NMI A;  1V4A A;  4OD4 A;  4BJ6 C;  4YWQ A;  5JLI A;  4CJG A;  3DM5 A;  5JRA A;  1V55 C;  4JTD B;  2CDQ A;  4K0D A;  3LEV A;  3W2W A;  2FGY A;  2LSE A;  4ONS A;  2A6E F;  1WAS A;  2YLI A;  3TK0 A;  4U5H A;  3RQE A;  2H7O A;  1A7V A;  4NY3 A;  2HJM A;  4YL1 A;  3ZIB A;  3JT1 A;  4CBE A;  2GWW A;  3GEH A;  1TWG A;  4JJG A;  4CSA C;  1OQC A;  1YYX A;  2HKV A;  1YYJ A;  1S05 A;  5EK0 A;  4Q5S F;  3B71 A;  4MTF A;  3B0V C;  2WB7 A;  3ZQV A;  3GEE A;  1SYQ A;  1ORY A;  2R05 A;  3L1M A;  4Q4Z F;  2J8W A;  2IXN A;  1QPU A;  5F5H A;  4MTG A;  4XLP F;  3AGT A;  4MVM A;  3ZTZ A;  4JRZ A;  1LI7 A;  4N4W A;  4W8K A;  4AE4 B;  1RJ9 A;  2IXP A;  3LNM B;  3S84 A;  1MND A;  4D4N A;  3F47 A;  4U5G A;  3JSE O;  5IY5 C;  1QQ3 A;  3RYL A;  1QVX A;  2HSB A;  2J7P A;  3V7O A;  1HW2 A;  4OIO F;  2F22 A;  2X51 A;  2XM4 A;  3SXZ A;  2LFF A;  3U3F A;  4BJ1 A;  1RMV A;  4WGY A;  4NTF A;  4BJT A;  4JKV A;  2NSF A;  3IQC A;  3KL4 A;  3GOR A;  1H9T A;  2OEX A;  3NYM A;  4DVY P;  4Z9J A;  1A7D A;  4PFP A;  1UG7 A;  1D1B A;  2VCA A;  3RH3 A;  1ZVZ A;  1EI7 A;  3FXH A;  2BE5 F;  4EWC A;  3GWN A;  4OIQ F;  4PAC A;  3N0T A;  1YZA A;  3DE9 A;  3AG1 C;  2EIK C;  4DOZ A;  2JD3 A;  1U0B B;  4OIN F;  2MHR A;  2A1D D;  4RD9 A;  1HE9 A;  4A4A A;  1I5N A;  5FCL A;  2W9Y A;  2AP3 A;  1M2V B;  3KPH A;  3S28 A;  2YQY A;  2I15 A;  4G7H F;  1G4W R;  1M2O A;  3N24 A;  4RDA A;  5TJ5 E;  4HE8 D;  3TJ5 A;  4I1O B;  3M15 A;  1Z23 A;  3IEE A;  2EPN A;  2KYH A;  1KTM A;  4K1O A;  4J30 B;  1Q0D A;  4JW1 A;  4MVS A;  3HNI A;  3NKE A;  1EKY A;  4J32 B;  4N06 A;  5AC4 A;  4JUR I;  5KYY B;  1WGW A;  2BL2 A;  3U8P A;  4BEJ A;  2XLV A;  2AWY A;  3FDQ A;  3S0X A;  3ABK C;  1FMV A;  4JTC B;  5BUO A;  2P6V A;  1M6T A;  2YHS A;  2G62 A;  1TWA A;  2Y3B A;  1N1C A;  4XEF A;  2QE9 A;  3T6B A;  1D1A A;  3LS0 A;  4H4K C;  4XQ1 A;  3AG4 C;  4P9T A;  3M79 A;  1RCP A;  2RD9 A;  3G50 A;  4HFF B;  5JT4 A;  5KYW B;  3ATP A;  4BJ5 A;  5KYU A;  3DJN B;  1FNT c;  1AVO B;  3L8I A;  3LAY A;  5K0I A;  4EBK A;  1QKR A;  1ZHX A;  3LJB A;  1SF8 A;  3ASO C;  2XM0 A;  3CEX A;  1LI5 A;  3DMD A;  2GFH A;  2HS5 A;  1D0X A;  2GAQ A;  2Q7R A;  1Z63 A;  2OQM A;  2KSF A;  4R32 A;  2W45 A;  2UUI A;  1R4T A;  3H2V A;  2W4M A;  3VF0 A;  1T6Q A;  3MLG A;  3RKO F;  4MVZ A;  1MMA A;  1OCZ C;  1ORJ A;  1VLT A;  1YAU O;  2PNO A;  3CAX A;  3JRM O;  3LLI A;  4CIP A;  2L6G A;  2EPO A;  3HNL A;  4JJF A;  4AK9 A;  2XXA A;  1OW7 A;  1H9G A;  2WVN A;  3EFO A;  3O39 A;  2NG1 A;  4E17 A;  5BQH A;  5HV9 A;  5CI9 A;  2KC3 A;  1LPE A;  2Q9A A;  1CGO A;  1O3U A;  5L0D A;  1BDJ B;  3UMI A;  3WOD F;  3L0I A;  3EH1 A;  2AVK A;  2EPM X;  2OOC A;  3DE8 A;  2XLD A;  3C18 A;  3U9M A;  4E7Z A;  1NZE A;  2PP4 A;  5L0J A;  4B6I A;  4IWB A;  3QVZ A;  3DKA A;  3WG7 C;  3QVY A;  2ZXR A;  3QMK A;  3EHM A;  4XEV A;  1EA8 A;  2YL7 A;  1XZP A;  4U9D A;  3VYW A;  3M4B A;  5JS5 A;  4C7O B;  2YKZ A;  1WAT A;  1TKN A;  3MFN A;  4LDR A;  4DRJ B;  5DVW A;  2IBF A;  2IOQ A;  1RXQ A;  1GGQ A;  3JZ0 A;  1WN0 A;  1LS1 A;  1I4Z A;  3EG9 A;  3IHU A;  1T6I A;  2XL8 A;  2A0U A;  4ZLD A;  2WZF A;  3JYH A;  2P7V A;  3M4C A;  5A6B A;  1AUE A;  2IXO A;  3G4Z A;  3K6B A;  2J7P D;  1EQ1 A;  3L8J A;  2XS8 A;  3KH2 A;  2HFI A;  4PJL A;  4WJ0 A;  5D92 A;  5D91 A;  1LM3 B;  2LFD A;  3NMK A;  4DVZ A;  1TR2 A;  4I1M A;  5A69 A;  2OJE D;  1OCR C;  3EZI A;  2NUP B;  2V3C C;  4EKW A;  3OEO A;  2EIN C;  2VCC A;  1NFN A;  2A68 F;  3B29 A;  2OG2 A;  2Q9B A;  3AOU A;  5L0I A;  2O9X A;  3ZQY A;  4I3M A;  1L7C A;  1TQG A;  1B68 A;  1C02 A;  1NG1 A;  2R7Q A;  3JTL O;  4OIR F;  4AX2 A;  2LIG A;  2JPU A;  4BEM J;  1FFT C;  4C3D A;  2OJQ A;  4IGG A;  4EHP A;  1NBB A;  2QNL A;  3POV A;  3C7J A;  3EPV A;  3IQT A;  1YZC A;  2YL3 A;  2DYS C;  1SZI A;  3IQ5 A;  4I44 A;  3DZA A;  4O6N A;  4U5C E;  4CX9 A;  3U2L A;  4LAC B;  1O5H A;  1AEP A;  1TWH A;  2R25 A;  1VB5 A;  1Z5Z A;  3NYL A;  3QTH A;  4BPM A;  5B3S C;  2XRH A;  5HSW A;  1K40 A;  1BR2 A;  3QW1 A;  1VMA A;  3DD7 A;  1FMW A;  3ZG1 A;  2ETS A;  3U3B A;  3JYY A;  3PCV A;  4MQ9 F;  4CS8 C;  2R7U A;  2XXA B;  2EIJ C;  1NU9 C;  1T5O A;  1ZZP A;  2H7V C;  3EFO B;  1LIH A;  1OCC C;  4Z9H A;  3SXK A;  2HMZ A;  2XLH A;  1YLM A;  1Z6A A;  1BR1 A;  4GQH A;  4OD5 A;  3FAP B;  4XPY A;  3K1I C;  2NUT B;  1TWC A;  3Q6M A;  3EGX B;  3S9O A;  2R9R B;  2R7T A;  4EUK B;  2EIM C;  3US6 A;  4E0I A;  1DOW A;  3LLK A;  1MMG A;  1BBH A;  1OXB A;  2BC5 A;  3BEH A;  4P6I C;  4YL0 A;  4K7B A;  3T4R A;  3W4Y A;  2RSE B;  1IW7 F;  4MW3 A;  4GEH A;  4DBQ A;  4CIH A;  1E85 A;  4KBL A;  2D5R B;  1PD0 A;  1JRA A;  2Q9C A;  2XL4 A;  3AQB A;  1WTY A;  4M63 A;  4DJ9 A;  3ABM C;  1JAF A;  4WGZ A;  2OEV A;  3K1H A;  1TFO B;  2HMQ A;  2R7O A;  3ZDL A;  1ZW2 A;  3SYN A;  4YT4 A;  4EBB A;  3UMK A;  1S7Z A;  2WVQ A;  3U0C A;  4LLE A;  1ZHT A;  2LD6 A;  1ZW3 A;  2VH3 A;  4BG0 A;  2J0W A;  4LDQ A;  3A11 A;  4QDL A;  2ZPA A;  2LK4 A;  2CW0 F;  3OA1 A;  1OKK D;  2FAP B;  5F5F A;  4YN0 B;  4OIP F;  2XLW A;  2KNH A;  4G7Z F;  3EGD A;  3C8Z A;  1QLE C;  1JMW A;  4Z9I A;  5A6K A;  4CDA A;  1D0Z A;  4CDV A;  1MMD A;  1H7I A;  3HJC A;  1CGN A;  4IAQ A;  4G7O F;  1CGM E;  1T6U A;  3PMR A;  3I5P A;  1OW6 A;  2CGE A;  1A0B A;  1GS9 A;  1K05 A;  1RJ9 B;  1YDI A;  3AG2 C;  3LES A;  2PF4 E;  3DJU B;  3ECS A;  3GAN A;  3ZC4 A;  3PHF 2;  4XLN F;  1BZ4 A;  1HE1 A;  3HKK A;  4EIY A;  4KC9 A;  4DXW A;  3GOD A;  1Y4C A;  1LS4 A;  3RW0 A;  4XEK A;  1LE2 A;  2MWQ A;  4LDK A;  2Y39 A;  2PX0 A;  2C04 A;  4ER9 A;  2L6H A;  5COM A;  2KW3 C;  3JCU Q;  1OXK A;  2PBE A;  1MQV A;  1OKK A;  3DAF A;  3GWL A;  5A6B D;  5L3V A;  3T6G B;  1OCO C;  4FWV A;  1ST6 A;  3VAY A;  2R7V A;  2DI3 A;  4CSA A;  2QLA A;  3ITF A;  4U5F E;  5T3W A;  4KNV A;  2VB6 A;  4MVO A;  2A69 F;  4X0R A;  3KKB A;  2R7W A;  4Q7C A;  2PX3 A;  3DAG A;  3KMI A;  1MMN A;  4MVQ A;  5E3C A;  3RQG A;  1E2X A;  3AG3 C;  2Q3T A;  2HV7 A;  3MYI A;  3B0P A;  3TQO A;  2E87 A;  3AQC A;  1ZU4 A;  2NPU A;  3CSK A;  3SNH A;  1G4U S;  4JEA A;  1E86 A;  1R5I D;  2WZL A;  1O87 A;  4AE4 A;  4E18 A;  3EQL F;  2L9J A;  1RKE A;  2Y3D A;  4XPX A;  2M64 A;  1JPJ A; 
#chains in the Genus database with same CATH homology
 1K04 A;  1PV3 A;  3AJM A;  3RQF A;  2KK1 A;  2PBE A;  2L6G A;  2JX0 A;  4XEF A;  1OW7 A;  1K40 A;  1WWP A;  2L6F A;  1WOL A;  3L8J A;  3JYY A;  1O3U A;  1WTY A;  1V4A A;  1QVX A;  2HSB A;  4NQF A;  3O10 A;  3L8I A;  5F28 E;  1OW6 A;  1ZZP A;  1K05 A;  1JOG A;  3C18 A;  2YWA A;  3C8G D;  4EBK A;  3GM1 A;  3U3F A;  3BRJ A;  3RQG A;  3U0C A;  3GM3 A;  3K7D A;  3RQE A;  4EBJ A;  1KTM A;  1KNY A;  3C8G A;  1OW8 A;  4XEV A;  3TUL A;  4XEK A;  3S9O A;  4R32 A;  2LK4 A;  3B71 A;  2JPU A;  3GM2 A;  2Q00 A;  3MFN A;  3C8G B;  1UFB A;  3JZ0 A;  2L6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...