3MFNA

Dfer_2879 protein of unknown function from dyadobacter fermentans
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
125
structure length
125
Chain Sequence
AQEAVIEAKRYLNNAKDILRDKGGKEDGFYQDSKYVKMAGHTAYSGVLFALDHYFGKKTKGRKDVDWYKSNLAQQDKKILNTFVSVYEQLHLVMAYDGVGDAEVVKLGFQRAEIIIDWVERRLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title X-ray crystal structure of Dfer_2879 protein of unknown function from Dyadobacter fermentans.
rcsb
source organism Dyadobacter fermentans
molecule tags Structural genomics, unknown function
total genus 47
structure length 125
sequence length 125
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18498 DUF5618 Domain of unknown function (DUF5618)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3mfnA00
1QVXA 4XEKA 1PV3A 3C8GB 3L8JA 3TULA 1WWPA 4R32A 2PBEA 1O3UA 2L6FA 1V4AA 1K40A 4EBKA 2L6HA 3AJMA 2JX0A 1OW6A 4EBJA 3C18A 3U3FA 3O10A 3U0CA 1KTMA 1ZZPA 2Q00A 4XEVA 1JOGA 1K05A 1OW8A 3L8IA 3RQFA 2HSBA 4NQFA 3C8GA 3GM1A 3S9OA 3JYYA 2L6GA 5F28E 3JZ0A 3C8GD 3RQEA 1WOLA 2KK1A 3MFNA 3RQGA 2LK4A 3K7DA 3BRJA 4XEFA 1OW7A 1KNYA 1K04A 1WTYA 2YWAA 3GM2A 2JPUA 3GM3A 3B71A 1UFBA
chains in the Genus database with same CATH superfamily
2FGYA 2J45A 3FDQA 3OWTA 2YRFA 2NUPA 3L8JA 1YVIA 2QY9A 4JVSA 5DS4A 2YLIA 3EHMA 4DVZA 4PACA 2J9BA 1I4YA 5B1AC 1LIHA 3ABMC 1ZZPA 2Y39A 4AL0A 2PX3A 4JIOA 1ORJA 3SNHA 1LI7A 3JTLO 3NG1A 4NQFA 3RQFA 3MX3A 3V5ZA 3W2VA 4JCZA 3WHNA 1OCRC 4YWQA 2XLOA 4J32B 4EKWA 1D1CA 1S05A 2LFFA 3KH2A 2R02A 4YL0A 4YT8A 2R03A 3IHUA 5KYYB 2ZXOA 3Q7GA 3QW0A 3R7CA 3IPMO 3K1HA 2WVNA 2Y3DA 4LLEA 3T6GB 4LDRA 4EBBA 4MW3A 4K1OA 2TMVP 2EPLX 2YZSA 2V26A 1OKKA 2XM0A 3NMIA 3ZG1A 1H6GA 2R7VA 4CBEA 1QVXA 1JR8A 2WZLA 3KPHA 3MBGA 1NU7D 3VRCA 1M56C 2A68F 3DE8A 3GWNA 1MNDA 2L6HA 3AJMA 3ECSA 1GQAA 2WZFA 4J7TA 1EA8A 4BJ5C 4CS9A 4A2NB 1VMAA 1VLTA 3LLIA 2YL7A 4IAQA 4HEAJ 2EINC 4KC9A 1ZHWA 2EIKC 1FTSA 2HV6A 1CPRA 4U5BE 4XPXA 2EIMC 2AWYA 4Z9HA 4F4BA 4IJJA 1QLEC 3ZTMA 3DZAA 3RVYA 3C8GD 4EWCA 3Q7LA 1YARO 2OOCA 2JD3A 1YJGA 3W2WA 2KQ9A 1I4ZA 4XQ1A 4H54A 3EGDB 3GWLA 2DYSC 3KYJA 5A6BA 5JVEA 4QI2A 3HJCA 3RF3A 1DOWA 1QKRA 4U9DA 3T4RA 2XLHA 4OIOF 4MS2A 4YL3A 1E2XA 3RVZA 3KKBA 2Q4FA 3NYMA 3L0IA 1C03A 2R7OA 4EBJA 3B0UX 1M2VA 5CI9A 2NSGA 1EKYA 1ZHZA 3L34A 4JC7A 5KYUA 4LACB 2VC9A 1ZVZA 3IEEA 4YL1A 2G3KA 2XLWA 3EZIA 3ZC4A 3C62A 3MLGA 3B0PA 4OD4A 2HMZA 1H9TA 1R5ID 2A0UA 2IOQA 3F46A 5K0IA 3K6BA 1OXKA 4O79A 4OINF 3A11A 2OJED 4P9FA 4E17A 1OR2A 3UR3C 3HNKA 1NFNA 5COFA 4AK9A 3EH2A 2Y3GA 5KYYA 3AGTA 5T3WA 3K1IC 3WODF 1G5ZA 3CSKA 4JTDB 4QDLA 1GS9A 3T6JA 4I44A 1EQ1A 3VAYA 5L0IA 3EHNA 2DB4A 4BJ1A 5F5FA 2PBEA 4A4AA 5DQTA 4PFPA 5B3IA 3S84A 3X1OA 3DAGA 3EQLF 4MVUA 4CJGA 5COGA 3C18A 5DS6A 2WB7A 3EGXB 2AP3A 2DYRC 2J0XA 3JYHA 4U5EE 4DRJB 4MNDA 1HE1A 3B0VC 3SXKA 1TKNA 2J0WA 3DD7A 2E87A 5TJ5E 4FAPB 2R7QA 3S29A 3V7OA 3NRHA 1TWHA 1LE4A 1BR4A 1Z6AA 2O9XA 3F47A 4XEFA 4D4NA 5EHHA 5HV9A 4C7OA 4GQHA 1WTYA 4Q7CA 3PHF2 1SZIA 2IBFA 3O6XA 1G8XA 3AOUA 4N6HA 4CS7A 4D4XA 2L81A 2RSEB 1TWCA 3S27A 4XLPF 1L7CA 1Q0MA 2YLDA 3ITFA 3M4BA 3EGDA 3ZDLA 4MTOA 3IQCA 4PR9A 5BQIA 3U8VA 3U0CA 5KYWA 3EH1A 2OEVA 3PMRA 3EG9B 4Z9IA 3H2VA 2X51A 5JS5A 2VH3A 4NY3A 1LM3B 1B68A 1MMNA 1NU9C 4AX2A 2PNOA 1QQ3A 4O6MA 5A6JA 3NMJA 3SXZA 2L7AA 2XL6A 4MTGA 3AG4C 3MFNA 3TQOA 1E84A 4P9TA 3FOOA 3GORA 2NUTA 4ULWA 4N06A 3WAQA 2AWCA 3LESA 4G7OF 3TD7A 4MW8A 2YWAA 5GPGB 3EFOA 1M57C 1U0BB 1NZEA 3B71A 1M2VB 1YAUO 4RDAA 4W8PA 3HNLA 3EJNA 4JJFA 2V3CC 4OIQF 2H7VC 4ONSA 3K66A 4HFFB 3QZCA 2KGOA 1RKCA 2XLDA 1PD1A 3KYIA 2Y3BA 4C3EA 3K33A 5JRAA 1E86A 1SR2A 1V74B 3GEEA 3S9OA 4WJ0A 4E0IA 1LVKA 4Z9JA 2AVKA 4YJWA 4RD9A 3TJ5A 3LS0A 1JPJA 4U9EA 4ZLCA 3EGXA 1AVOB 2VCAA 5AC5A 2B0HA 2PX0A 4U5DE 2YL1A 2EILC 4MVSA 1LI5A 2J7PD 4KNVA 1WN0A 3GM3A 4LDKA 4E0HA 2XLMA 2M64A 2XM4A 4LDQA 3JCUQ 5EK0A 3U5SA 4U5FE 3LUTB 4PFOA 2OKUA 5L3VA 1D0YA 2R7UA 2OEXA 2HZ8A 2G3VA 2P6VA 4E18A 1OR3A 2KC3A 5DLJA 2VASA 3IQTA 3SYNA 4BJ6C 1BBHA 2EPMX 3U9JA 4EBKA 3O10A 4XWJA 3DXJF 1KTMA 3KL4A 4JZAA 3RH3A 2OQMA 2OJQA 1KU2A 3V5XA 4C3DA 1Q0DA 1O87A 1ZU5A 3SXMA 1VB5A 4C7OB 3ABKC 5FCLA 3UMKA 4ANJA 2KNHA 3KMIA 1VTMP 2KK1A 2Q3TA 2XRHA 4U5HA 3ZSUA 3EG9A 3SEOA 1GM5A 4JJGA 4YN0B 4XPYA 3R2PA 4K0DA 4BEJA 2R7RA 3JSZA 1EI7A 1FAPB 2ZXPA 4BJ5A 1D0XA 3NMKA 3S28A 3LNRA 4NC3A 1C02A 4KBLA 5KYWB 2XL4A 2MYSA 2IXMA 1OQCA 3ZQYA 1OKKD 2YVKA 4E7SA 2C04A 1FMVA 3U2LA 1TFOB 3TOLA 2VCCA 1Z23A 2ICWG 1K40A 3LEVA 4JKVA 2DI3A 2WVOA 2YLGA 2Z15A 2ZD9A 3DWWA 3MYIA 1G4WR 1ORSC 1HY5A 2R9RB 4UDVA 4M63A 4N6CA 2NUTB 4JTAB 3DJUB 3M15A 3TOMA 5D92A 1LKXA 3FOPA 3PCVA 1C17M 4OIRF 1JMWA 3E70C 3JZ0A 3ABLC 2HFIA 2W4BA 1QSPA 3EFOB 2BC5A 2AU5A 2LK4A 4WGYA 4O6YA 1VOMA 3IQ6A 4EUKB 5JT4A 1FNTc 2Y69C 4U5GA 4LERA 4OIPF 4YK5A 5COMA 3SXYA 3UMHA 2YQYA 4X0RA 2XLEA 3LNMB 3RIPA 3HNJA 5CIVA 2R7SA 3AGUA 5A6BD 2H7OA 1T5OA 1WGWA 1RMVA 5FZTA 2J9VA 3W8HA 2YHSA 4KNWA 1RXQA 3CEXA 5L3QA 4PJJA 2CW0F 4JEAA 2ZPAA 3U8PA 4LLCA 2R7TA 4CDYA 2HKVA 3LJBA 1M2OA 2LP4A 2LSEA 1MMGA 3FAJA 4DXWA 1VYIA 2P61A 3A9CA 3S0XA 1IW7F 3M79A 1AUEA 1CGOA 2EIJC 2NPUA 3JYYA 3K1IA 3WG7C 2R7WA 1YA9A 3NYJA 3C8ZA 3UNGC 5DVWA 4MVRA 1RKEA 2LFDA 2XXAA 2HMQA 2LQGA 3HLZA 3K7DA 3ASOC 3AG2C 4CS8C 1ZW2A 3DJNB 3HTKC 3SP1A 2YL3A 5E33A 2PFDA 1OW7A 4NTAA 4DJ9A 1E83A 3LAYA 4HE8D 2IXPA 2OCCC 2ETSA 3G4XA 1NBBA 2PP4A 2CNWA 2JPUA 1AEPA 2KW3C 2WZGA 3RW0A 1CPQA 4DRIB 5JUAA 5L0CA 5L0HA 2C03A 1FR0A 1YYXA 3ZTZA 4XEKA 3RKOF 3C8GB 1SYQA 2J8WA 2BE5F 3X2QC 2GFHA 3LS1A 1YYJA 1ST6A 4DBRA 3OA1A 1CGNA 2KSFA 2W45A 4G78A 2CGEA 2HUJA 4Q5SF 1JOGA 4EIYA 4IRUA 4CJOA 5KYNA 3ZIBA 5F28E 1BR1A 1LE2A 2VCBA 2W4MA 1FFTC 4L6RA 1T6IA 1WOLA 1G4US 4CIHA 1I5NA 4CSAA 2ZXRA 2DGJA 2ASRA 3I4UA 3NYLA 3FHDA 3RFYA 3H65A 5L0JA 3VF0A 2J9UA 1A7EA 1U6HA 2MWQA 3FXHA 1LS1A 1ZW3A 4GYTA 1PV3A 4FESA 4MVQA 2QLAA 1O3UA 3G50A 1J8YF 1Q0GA 4BPMA 1MNEA 1VLSA 2UUIA 3CQZA 1J8MF 1OCCC 1NSGB 2H7BA 1YZAA 3B9QA 5JLIA 2HSBA 2XS1A 3W8IA 3GM1A 5EGYA 1MMAA 4PJMA 4KI2A 1HE9A 4FWVA 5AGFA 3GODA 1OXBA 4NTBA 2HJMA 2M4EA 3W4YA 4OD5A 4MVZA 1Y4CA 2Q9CA 1OCOC 4JRZA 3CZ6A 1TWAA 4ZLDA 3HNIA 4DBQA 4JW1A 2EPOA 3TJ6A 5L0DA 1T6UA 3GANA 5A6AA 4CIPA 1UFBA 4I1MA 1TQGA 2J9WA 1YLMA 1D1AA 2MHRA 3DMDA 4O6NA 5L0GA 2HV7A 5L0FA 2HS5A 1E85A 2OU6A 3TULA 5DQZA 2UUHA 3N0TA 4ER9A 3U9MA 1HW2A 2IYLD 1JPNA 3M4CA 1NLXA 4NTFA 1GGQA 5T3TA 4YT5A 2XXAB 1RKEB 2Q00A 2QUPA 3DI5A 3LEOA 1OW8A 2NSFA 4MVMA 1YZCA 3DM5A 3C8GA 1LPEA 2D4UA 2P0NA 2KJGA 2PF4E 4CDVA 2FAPB 2ZXWC 5E3CA 3V5YA 2Q9AA 1VK5A 1QZXA 1UG7A 1SMYF 5A6KA 5CI8A 3ZQVA 4CS9C 4JCHA 2H8AA 4BJ6A 3C7JA 5B1BC 1NFOA 3DE9A 3I5PA 5BQHA 3ATPA 1SF8A 4PK4A 3GM2A 4YT4A 3QMKA 5BQGA 3DKAA 3TK0A 1RJ9B 4FX5A 4G7ZF 1RCPA 4J7YA 1Z63A 1A7DA 3EPVA 2L9JA 3H2UA 5JSLA 1BR2A 1H9GA 2QE9A 1JRAA 1M6TA 2R25A 1WWPA 4IARA 2XSEA 5AC4A 3C63A 3NKDA 4Q4ZF 5B3SC 4IB4A 256BA 1OW6A 3FAPB 4IGGA 1ORYA 4WGZA 2CDQA 2WVQA 5A69A 4P6IC 1ZHTA 4XTKA 1PD0A 2XLVA 1V54C 3L8IA 3AQBA 2A6HF 3L1MA 3T9OA 2YEVA 4I3MA 2FFHA 1O5HA 2YKZA 3JRTA 3LLKA 4JTCB 4PJNA 3US6A 4G0HA 1OCZC 2GDCA 1W2WA 4W8KA 3QW1A 2Y3HA 1XZQA 3BRJA 3VYWA 2P7VA 2R05A 5E2QA 2LIGA 4JURI 3Q6NA 4BEMJ 3J06A 1QPUA 1ZHYA 1DOVA 4AE4B 1U89A 2X0CA 1T9KA 3CAXA 1WATA 3UMIA 2A69F 2I15A 2IXOA 3FVYA 2F22A 3N2ZB 4EHPA 4DVYP 3VM6A 5KYXB 2OG2A 1Q0KA 1MMDA 1HMOA 4XEVA 4MVOA 4CX9A 3ZWIA 1A41A 3QTHA 4YT2A 3DM9B 5IY5C 3RQEA 3GEIA 2XL8A 3MYFA 3O55A 4NCQA 1H7IA 4DOZA 1V55C 4QI0A 2NUPB 3JT1A 3RYLA 3SZRA 1JAFA 1K04A 1TR2A 3UGOA 2W9YA 1ZHXA 3BEHA 5JP7A 2RD9A 2CYDA 3NKEA 2QTVA 2J46A 5E3AA 1ZU4A 1Z3IX 4U5CE 5HSWA 4HFKB 2EPNA 3HKKA 1D0ZA 3E9VA 2NG1A 4I1OB 2L6FA 1YA7O 1V4AA 1A7VA 2IXNA 4AL1A 1XZPA 4BG0A 1RJ9A 4CS8A 2XS8A 2Q9BA 2I8BA 4MQ9F 3AQCA 1R4TA 4PJLA 1K05A 3OEOA 1L3PA 2G62A 3B29A 5F5HA 1LS4A 2L6GA 4BJTA 4JEBA 4MTFA 3I5QA 1T6QA 1FFHA 1Y6DA 3U3BA 1F1MA 3GEHA 4XLNF 3PDMP 2A0BA 3G4ZA 5DS5A 4XPWA 1TWGA 2GWWA 1S7ZA 3N24A 3ASNC 3O39A 3S90A 1TFKB 2D5RB 2VB6A 4H4KC 4IAOA 2WL8A 1Z5ZA 4G7HF 1T01A 2A1DD 1A0BA 1VYKA 2P1AA 4B6IA 5BUOA 2R7XA 3NDBB 4ULVA 1BDJB 1BZ4A 2EPKX 3JRMO 3POVA 2CNWD 1MQVA 4JE9A 4CSAC 1YDIA 4R32A 2QNLA 3JSEO 1Q0FA 1HMDA 1ZYRF 2HJ3A 2YL0A 2JX0A 3QVYA 4RBNA 4WABA 1NG1A 1XWJA 3U3FA 4AE4A 1PCXA 4C3BA 3UGPA 2HSQA 4DRHB 3U2MA 4N4WA 3AG1C 2LD6A 3FMSA 3ZVRA 1IZMA 4GEHA 5KYXA 4E7ZA 2LCHA 4J30B 1APCA 2A6EF 3DAFA 1WASA 1FMWA 2GA0A 3RQGA 2IM8A 2J7PA 3M1CB 1N1CA 3EZHA 4O7GA 1D1BA 2B0JA 3IQ5A 1KNYA 2KYHA 3QVZA 1Z7Qc 3T6BA 3Q6MA 3AG3C 2Q7RA 4K7BA 1HW1A 2BL2A 5D91A 4CDAA 2GAQA 1CGME 5T1DB 2CCYA 5KYUB 4IWBA
chains in the Genus database with same CATH topology
1QVXA 4XEKA 1PV3A 3C8GB 3L8JA 3TULA 1WWPA 4R32A 2PBEA 1O3UA 2L6FA 1V4AA 1K40A 4EBKA 2L6HA 3AJMA 2JX0A 1OW6A 4EBJA 3C18A 3U3FA 3O10A 3U0CA 1KTMA 1ZZPA 2Q00A 4XEVA 1JOGA 1K05A 1OW8A 3L8IA 3RQFA 2HSBA 4NQFA 3C8GA 3GM1A 3S9OA 3JYYA 2L6GA 5F28E 3JZ0A 3C8GD 3RQEA 1WOLA 2KK1A 3MFNA 3RQGA 2LK4A 3K7DA 3BRJA 4XEFA 1OW7A 1KNYA 1K04A 1WTYA 2YWAA 3GM2A 2JPUA 3GM3A 3B71A 1UFBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVX A;  4XEK A;  1PV3 A;  3C8G B;  3L8J A;  3TUL A;  1WWP A;  4R32 A;  2PBE A;  1O3U A;  2L6F A;  1V4A A;  1K40 A;  4EBK A;  2L6H A;  3AJM A;  2JX0 A;  1OW6 A;  4EBJ A;  3C18 A;  3U3F A;  3O10 A;  3U0C A;  1KTM A;  1ZZP A;  2Q00 A;  4XEV A;  1JOG A;  1K05 A;  1OW8 A;  3L8I A;  3RQF A;  2HSB A;  4NQF A;  3C8G A;  3GM1 A;  3S9O A;  3JYY A;  2L6G A;  5F28 E;  3JZ0 A;  3C8G D;  3RQE A;  1WOL A;  2KK1 A;  3MFN A;  3RQG A;  2LK4 A;  3K7D A;  3BRJ A;  4XEF A;  1OW7 A;  1KNY A;  1K04 A;  1WTY A;  2YWA A;  3GM2 A;  2JPU A;  3GM3 A;  3B71 A;  1UFB A; 
#chains in the Genus database with same CATH topology
 2FGY A;  2J45 A;  3FDQ A;  3OWT A;  2YRF A;  2NUP A;  3L8J A;  1YVI A;  2QY9 A;  4JVS A;  5DS4 A;  2YLI A;  3EHM A;  4DVZ A;  4PAC A;  2J9B A;  1I4Y A;  5B1A C;  1LIH A;  3ABM C;  1ZZP A;  2Y39 A;  4AL0 A;  2PX3 A;  4JIO A;  1ORJ A;  3SNH A;  1LI7 A;  3JTL O;  3NG1 A;  4NQF A;  3RQF A;  3MX3 A;  3V5Z A;  3W2V A;  4JCZ A;  3WHN A;  1OCR C;  4YWQ A;  2XLO A;  4J32 B;  4EKW A;  1D1C A;  1S05 A;  2LFF A;  3KH2 A;  2R02 A;  4YL0 A;  4YT8 A;  2R03 A;  3IHU A;  5KYY B;  2ZXO A;  3Q7G A;  3QW0 A;  3R7C A;  3IPM O;  3K1H A;  2WVN A;  2Y3D A;  4LLE A;  3T6G B;  4LDR A;  4EBB A;  4MW3 A;  4K1O A;  2TMV P;  2EPL X;  2YZS A;  2V26 A;  1OKK A;  2XM0 A;  3NMI A;  3ZG1 A;  1H6G A;  2R7V A;  4CBE A;  1QVX A;  1JR8 A;  2WZL A;  3KPH A;  3MBG A;  1NU7 D;  3VRC A;  1M56 C;  2A68 F;  3DE8 A;  3GWN A;  1MND A;  2L6H A;  3AJM A;  3ECS A;  1GQA A;  2WZF A;  4J7T A;  1EA8 A;  4BJ5 C;  4CS9 A;  4A2N B;  1VMA A;  1VLT A;  3LLI A;  2YL7 A;  4IAQ A;  4HEA J;  2EIN C;  4KC9 A;  1ZHW A;  2EIK C;  1FTS A;  2HV6 A;  1CPR A;  4U5B E;  4XPX A;  2EIM C;  2AWY A;  4Z9H A;  4F4B A;  4IJJ A;  1QLE C;  3ZTM A;  3DZA A;  3RVY A;  3C8G D;  4EWC A;  3Q7L A;  1YAR O;  2OOC A;  2JD3 A;  1YJG A;  3W2W A;  2KQ9 A;  1I4Z A;  4XQ1 A;  4H54 A;  3EGD B;  3GWL A;  2DYS C;  3KYJ A;  5A6B A;  5JVE A;  4QI2 A;  3HJC A;  3RF3 A;  1DOW A;  1QKR A;  4U9D A;  3T4R A;  2XLH A;  4OIO F;  4MS2 A;  4YL3 A;  1E2X A;  3RVZ A;  3KKB A;  2Q4F A;  3NYM A;  3L0I A;  1C03 A;  2R7O A;  4EBJ A;  3B0U X;  1M2V A;  5CI9 A;  2NSG A;  1EKY A;  1ZHZ A;  3L34 A;  4JC7 A;  5KYU A;  4LAC B;  2VC9 A;  1ZVZ A;  3IEE A;  4YL1 A;  2G3K A;  2XLW A;  3EZI A;  3ZC4 A;  3C62 A;  3MLG A;  3B0P A;  4OD4 A;  2HMZ A;  1H9T A;  1R5I D;  2A0U A;  2IOQ A;  3F46 A;  5K0I A;  3K6B A;  1OXK A;  4O79 A;  4OIN F;  3A11 A;  2OJE D;  4P9F A;  4E17 A;  1OR2 A;  3UR3 C;  3HNK A;  1NFN A;  5COF A;  4AK9 A;  3EH2 A;  2Y3G A;  5KYY A;  3AGT A;  5T3W A;  3K1I C;  3WOD F;  1G5Z A;  3CSK A;  4JTD B;  4QDL A;  1GS9 A;  3T6J A;  4I44 A;  1EQ1 A;  3VAY A;  5L0I A;  3EHN A;  2DB4 A;  4BJ1 A;  5F5F A;  2PBE A;  4A4A A;  5DQT A;  4PFP A;  5B3I A;  3S84 A;  3X1O A;  3DAG A;  3EQL F;  4MVU A;  4CJG A;  5COG A;  3C18 A;  5DS6 A;  2WB7 A;  3EGX B;  2AP3 A;  2DYR C;  2J0X A;  3JYH A;  4U5E E;  4DRJ B;  4MND A;  1HE1 A;  3B0V C;  3SXK A;  1TKN A;  2J0W A;  3DD7 A;  2E87 A;  5TJ5 E;  4FAP B;  2R7Q A;  3S29 A;  3V7O A;  3NRH A;  1TWH A;  1LE4 A;  1BR4 A;  1Z6A A;  2O9X A;  3F47 A;  4XEF A;  4D4N A;  5EHH A;  5HV9 A;  4C7O A;  4GQH A;  1WTY A;  4Q7C A;  3PHF 2;  1SZI A;  2IBF A;  3O6X A;  1G8X A;  3AOU A;  4N6H A;  4CS7 A;  4D4X A;  2L81 A;  2RSE B;  1TWC A;  3S27 A;  4XLP F;  1L7C A;  1Q0M A;  2YLD A;  3ITF A;  3M4B A;  3EGD A;  3ZDL A;  4MTO A;  3IQC A;  4PR9 A;  5BQI A;  3U8V A;  3U0C A;  5KYW A;  3EH1 A;  2OEV A;  3PMR A;  3EG9 B;  4Z9I A;  3H2V A;  2X51 A;  5JS5 A;  2VH3 A;  4NY3 A;  1LM3 B;  1B68 A;  1MMN A;  1NU9 C;  4AX2 A;  2PNO A;  1QQ3 A;  4O6M A;  5A6J A;  3NMJ A;  3SXZ A;  2L7A A;  2XL6 A;  4MTG A;  3AG4 C;  3MFN A;  3TQO A;  1E84 A;  4P9T A;  3FOO A;  3GOR A;  2NUT A;  4ULW A;  4N06 A;  3WAQ A;  2AWC A;  3LES A;  4G7O F;  3TD7 A;  4MW8 A;  2YWA A;  5GPG B;  3EFO A;  1M57 C;  1U0B B;  1NZE A;  3B71 A;  1M2V B;  1YAU O;  4RDA A;  4W8P A;  3HNL A;  3EJN A;  4JJF A;  2V3C C;  4OIQ F;  2H7V C;  4ONS A;  3K66 A;  4HFF B;  3QZC A;  2KGO A;  1RKC A;  2XLD A;  1PD1 A;  3KYI A;  2Y3B A;  4C3E A;  3K33 A;  5JRA A;  1E86 A;  1SR2 A;  1V74 B;  3GEE A;  3S9O A;  4WJ0 A;  4E0I A;  1LVK A;  4Z9J A;  2AVK A;  4YJW A;  4RD9 A;  3TJ5 A;  3LS0 A;  1JPJ A;  4U9E A;  4ZLC A;  3EGX A;  1AVO B;  2VCA A;  5AC5 A;  2B0H A;  2PX0 A;  4U5D E;  2YL1 A;  2EIL C;  4MVS A;  1LI5 A;  2J7P D;  4KNV A;  1WN0 A;  3GM3 A;  4LDK A;  4E0H A;  2XLM A;  2M64 A;  2XM4 A;  4LDQ A;  3JCU Q;  5EK0 A;  3U5S A;  4U5F E;  3LUT B;  4PFO A;  2OKU A;  5L3V A;  1D0Y A;  2R7U A;  2OEX A;  2HZ8 A;  2G3V A;  2P6V A;  4E18 A;  1OR3 A;  2KC3 A;  5DLJ A;  2VAS A;  3IQT A;  3SYN A;  4BJ6 C;  1BBH A;  2EPM X;  3U9J A;  4EBK A;  3O10 A;  4XWJ A;  3DXJ F;  1KTM A;  3KL4 A;  4JZA A;  3RH3 A;  2OQM A;  2OJQ A;  1KU2 A;  3V5X A;  4C3D A;  1Q0D A;  1O87 A;  1ZU5 A;  3SXM A;  1VB5 A;  4C7O B;  3ABK C;  5FCL A;  3UMK A;  4ANJ A;  2KNH A;  3KMI A;  1VTM P;  2KK1 A;  2Q3T A;  2XRH A;  4U5H A;  3ZSU A;  3EG9 A;  3SEO A;  1GM5 A;  4JJG A;  4YN0 B;  4XPY A;  3R2P A;  4K0D A;  4BEJ A;  2R7R A;  3JSZ A;  1EI7 A;  1FAP B;  2ZXP A;  4BJ5 A;  1D0X A;  3NMK A;  3S28 A;  3LNR A;  4NC3 A;  1C02 A;  4KBL A;  5KYW B;  2XL4 A;  2MYS A;  2IXM A;  1OQC A;  3ZQY A;  1OKK D;  2YVK A;  4E7S A;  2C04 A;  1FMV A;  3U2L A;  1TFO B;  3TOL A;  2VCC A;  1Z23 A;  2ICW G;  1K40 A;  3LEV A;  4JKV A;  2DI3 A;  2WVO A;  2YLG A;  2Z15 A;  2ZD9 A;  3DWW A;  3MYI A;  1G4W R;  1ORS C;  1HY5 A;  2R9R B;  4UDV A;  4M63 A;  4N6C A;  2NUT B;  4JTA B;  3DJU B;  3M15 A;  3TOM A;  5D92 A;  1LKX A;  3FOP A;  3PCV A;  1C17 M;  4OIR F;  1JMW A;  3E70 C;  3JZ0 A;  3ABL C;  2HFI A;  2W4B A;  1QSP A;  3EFO B;  2BC5 A;  2AU5 A;  2LK4 A;  4WGY A;  4O6Y A;  1VOM A;  3IQ6 A;  4EUK B;  5JT4 A;  1FNT c;  2Y69 C;  4U5G A;  4LER A;  4OIP F;  4YK5 A;  5COM A;  3SXY A;  3UMH A;  2YQY A;  4X0R A;  2XLE A;  3LNM B;  3RIP A;  3HNJ A;  5CIV A;  2R7S A;  3AGU A;  5A6B D;  2H7O A;  1T5O A;  1WGW A;  1RMV A;  5FZT A;  2J9V A;  3W8H A;  2YHS A;  4KNW A;  1RXQ A;  3CEX A;  5L3Q A;  4PJJ A;  2CW0 F;  4JEA A;  2ZPA A;  3U8P A;  4LLC A;  2R7T A;  4CDY A;  2HKV A;  3LJB A;  1M2O A;  2LP4 A;  2LSE A;  1MMG A;  3FAJ A;  4DXW A;  1VYI A;  2P61 A;  3A9C A;  3S0X A;  1IW7 F;  3M79 A;  1AUE A;  1CGO A;  2EIJ C;  2NPU A;  3JYY A;  3K1I A;  3WG7 C;  2R7W A;  1YA9 A;  3NYJ A;  3C8Z A;  3UNG C;  5DVW A;  4MVR A;  1RKE A;  2LFD A;  2XXA A;  2HMQ A;  2LQG A;  3HLZ A;  3K7D A;  3ASO C;  3AG2 C;  4CS8 C;  1ZW2 A;  3DJN B;  3HTK C;  3SP1 A;  2YL3 A;  5E33 A;  2PFD A;  1OW7 A;  4NTA A;  4DJ9 A;  1E83 A;  3LAY A;  4HE8 D;  2IXP A;  2OCC C;  2ETS A;  3G4X A;  1NBB A;  2PP4 A;  2CNW A;  2JPU A;  1AEP A;  2KW3 C;  2WZG A;  3RW0 A;  1CPQ A;  4DRI B;  5JUA A;  5L0C A;  5L0H A;  2C03 A;  1FR0 A;  1YYX A;  3ZTZ A;  4XEK A;  3RKO F;  3C8G B;  1SYQ A;  2J8W A;  2BE5 F;  3X2Q C;  2GFH A;  3LS1 A;  1YYJ A;  1ST6 A;  4DBR A;  3OA1 A;  1CGN A;  2KSF A;  2W45 A;  4G78 A;  2CGE A;  2HUJ A;  4Q5S F;  1JOG A;  4EIY A;  4IRU A;  4CJO A;  5KYN A;  3ZIB A;  5F28 E;  1BR1 A;  1LE2 A;  2VCB A;  2W4M A;  1FFT C;  4L6R A;  1T6I A;  1WOL A;  1G4U S;  4CIH A;  1I5N A;  4CSA A;  2ZXR A;  2DGJ A;  2ASR A;  3I4U A;  3NYL A;  3FHD A;  3RFY A;  3H65 A;  5L0J A;  3VF0 A;  2J9U A;  1A7E A;  1U6H A;  2MWQ A;  3FXH A;  1LS1 A;  1ZW3 A;  4GYT A;  1PV3 A;  4FES A;  4MVQ A;  2QLA A;  1O3U A;  3G50 A;  1J8Y F;  1Q0G A;  4BPM A;  1MNE A;  1VLS A;  2UUI A;  3CQZ A;  1J8M F;  1OCC C;  1NSG B;  2H7B A;  1YZA A;  3B9Q A;  5JLI A;  2HSB A;  2XS1 A;  3W8I A;  3GM1 A;  5EGY A;  1MMA A;  4PJM A;  4KI2 A;  1HE9 A;  4FWV A;  5AGF A;  3GOD A;  1OXB A;  4NTB A;  2HJM A;  2M4E A;  3W4Y A;  4OD5 A;  4MVZ A;  1Y4C A;  2Q9C A;  1OCO C;  4JRZ A;  3CZ6 A;  1TWA A;  4ZLD A;  3HNI A;  4DBQ A;  4JW1 A;  2EPO A;  3TJ6 A;  5L0D A;  1T6U A;  3GAN A;  5A6A A;  4CIP A;  1UFB A;  4I1M A;  1TQG A;  2J9W A;  1YLM A;  1D1A A;  2MHR A;  3DMD A;  4O6N A;  5L0G A;  2HV7 A;  5L0F A;  2HS5 A;  1E85 A;  2OU6 A;  3TUL A;  5DQZ A;  2UUH A;  3N0T A;  4ER9 A;  3U9M A;  1HW2 A;  2IYL D;  1JPN A;  3M4C A;  1NLX A;  4NTF A;  1GGQ A;  5T3T A;  4YT5 A;  2XXA B;  1RKE B;  2Q00 A;  2QUP A;  3DI5 A;  3LEO A;  1OW8 A;  2NSF A;  4MVM A;  1YZC A;  3DM5 A;  3C8G A;  1LPE A;  2D4U A;  2P0N A;  2KJG A;  2PF4 E;  4CDV A;  2FAP B;  2ZXW C;  5E3C A;  3V5Y A;  2Q9A A;  1VK5 A;  1QZX A;  1UG7 A;  1SMY F;  5A6K A;  5CI8 A;  3ZQV A;  4CS9 C;  4JCH A;  2H8A A;  4BJ6 A;  3C7J A;  5B1B C;  1NFO A;  3DE9 A;  3I5P A;  5BQH A;  3ATP A;  1SF8 A;  4PK4 A;  3GM2 A;  4YT4 A;  3QMK A;  5BQG A;  3DKA A;  3TK0 A;  1RJ9 B;  4FX5 A;  4G7Z F;  1RCP A;  4J7Y A;  1Z63 A;  1A7D A;  3EPV A;  2L9J A;  3H2U A;  5JSL A;  1BR2 A;  1H9G A;  2QE9 A;  1JRA A;  1M6T A;  2R25 A;  1WWP A;  4IAR A;  2XSE A;  5AC4 A;  3C63 A;  3NKD A;  4Q4Z F;  5B3S C;  4IB4 A;  256B A;  1OW6 A;  3FAP B;  4IGG A;  1ORY A;  4WGZ A;  2CDQ A;  2WVQ A;  5A69 A;  4P6I C;  1ZHT A;  4XTK A;  1PD0 A;  2XLV A;  1V54 C;  3L8I A;  3AQB A;  2A6H F;  3L1M A;  3T9O A;  2YEV A;  4I3M A;  2FFH A;  1O5H A;  2YKZ A;  3JRT A;  3LLK A;  4JTC B;  4PJN A;  3US6 A;  4G0H A;  1OCZ C;  2GDC A;  1W2W A;  4W8K A;  3QW1 A;  2Y3H A;  1XZQ A;  3BRJ A;  3VYW A;  2P7V A;  2R05 A;  5E2Q A;  2LIG A;  4JUR I;  3Q6N A;  4BEM J;  3J06 A;  1QPU A;  1ZHY A;  1DOV A;  4AE4 B;  1U89 A;  2X0C A;  1T9K A;  3CAX A;  1WAT A;  3UMI A;  2A69 F;  2I15 A;  2IXO A;  3FVY A;  2F22 A;  3N2Z B;  4EHP A;  4DVY P;  3VM6 A;  5KYX B;  2OG2 A;  1Q0K A;  1MMD A;  1HMO A;  4XEV A;  4MVO A;  4CX9 A;  3ZWI A;  1A41 A;  3QTH A;  4YT2 A;  3DM9 B;  5IY5 C;  3RQE A;  3GEI A;  2XL8 A;  3MYF A;  3O55 A;  4NCQ A;  1H7I A;  4DOZ A;  1V55 C;  4QI0 A;  2NUP B;  3JT1 A;  3RYL A;  3SZR A;  1JAF A;  1K04 A;  1TR2 A;  3UGO A;  2W9Y A;  1ZHX A;  3BEH A;  5JP7 A;  2RD9 A;  2CYD A;  3NKE A;  2QTV A;  2J46 A;  5E3A A;  1ZU4 A;  1Z3I X;  4U5C E;  5HSW A;  4HFK B;  2EPN A;  3HKK A;  1D0Z A;  3E9V A;  2NG1 A;  4I1O B;  2L6F A;  1YA7 O;  1V4A A;  1A7V A;  2IXN A;  4AL1 A;  1XZP A;  4BG0 A;  1RJ9 A;  4CS8 A;  2XS8 A;  2Q9B A;  2I8B A;  4MQ9 F;  3AQC A;  1R4T A;  4PJL A;  1K05 A;  3OEO A;  1L3P A;  2G62 A;  3B29 A;  5F5H A;  1LS4 A;  2L6G A;  4BJT A;  4JEB A;  4MTF A;  3I5Q A;  1T6Q A;  1FFH A;  1Y6D A;  3U3B A;  1F1M A;  3GEH A;  4XLN F;  3PDM P;  2A0B A;  3G4Z A;  5DS5 A;  4XPW A;  1TWG A;  2GWW A;  1S7Z A;  3N24 A;  3ASN C;  3O39 A;  3S90 A;  1TFK B;  2D5R B;  2VB6 A;  4H4K C;  4IAO A;  2WL8 A;  1Z5Z A;  4G7H F;  1T01 A;  2A1D D;  1A0B A;  1VYK A;  2P1A A;  4B6I A;  5BUO A;  2R7X A;  3NDB B;  4ULV A;  1BDJ B;  1BZ4 A;  2EPK X;  3JRM O;  3POV A;  2CNW D;  1MQV A;  4JE9 A;  4CSA C;  1YDI A;  4R32 A;  2QNL A;  3JSE O;  1Q0F A;  1HMD A;  1ZYR F;  2HJ3 A;  2YL0 A;  2JX0 A;  3QVY A;  4RBN A;  4WAB A;  1NG1 A;  1XWJ A;  3U3F A;  4AE4 A;  1PCX A;  4C3B A;  3UGP A;  2HSQ A;  4DRH B;  3U2M A;  4N4W A;  3AG1 C;  2LD6 A;  3FMS A;  3ZVR A;  1IZM A;  4GEH A;  5KYX A;  4E7Z A;  2LCH A;  4J30 B;  1APC A;  2A6E F;  3DAF A;  1WAS A;  1FMW A;  2GA0 A;  3RQG A;  2IM8 A;  2J7P A;  3M1C B;  1N1C A;  3EZH A;  4O7G A;  1D1B A;  2B0J A;  3IQ5 A;  1KNY A;  2KYH A;  3QVZ A;  1Z7Q c;  3T6B A;  3Q6M A;  3AG3 C;  2Q7R A;  4K7B A;  1HW1 A;  2BL2 A;  5D91 A;  4CDA A;  2GAQ A;  1CGM E;  5T1D B;  2CCY A;  5KYU B;  4IWB A; 
#chains in the Genus database with same CATH homology
 1QVX A;  4XEK A;  1PV3 A;  3C8G B;  3L8J A;  3TUL A;  1WWP A;  4R32 A;  2PBE A;  1O3U A;  2L6F A;  1V4A A;  1K40 A;  4EBK A;  2L6H A;  3AJM A;  2JX0 A;  1OW6 A;  4EBJ A;  3C18 A;  3U3F A;  3O10 A;  3U0C A;  1KTM A;  1ZZP A;  2Q00 A;  4XEV A;  1JOG A;  1K05 A;  1OW8 A;  3L8I A;  3RQF A;  2HSB A;  4NQF A;  3C8G A;  3GM1 A;  3S9O A;  3JYY A;  2L6G A;  5F28 E;  3JZ0 A;  3C8G D;  3RQE A;  1WOL A;  2KK1 A;  3MFN A;  3RQG A;  2LK4 A;  3K7D A;  3BRJ A;  4XEF A;  1OW7 A;  1KNY A;  1K04 A;  1WTY A;  2YWA A;  3GM2 A;  2JPU A;  3GM3 A;  3B71 A;  1UFB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...