1HMDA

The structure of deoxy and oxy hemerythrin at 2.0 angstroms resolution
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
113
structure length
113
Chain Sequence
GFPIPDPYCWDISFRTFYTIIDDEHKTLFNGILLLSQADNADHLNELRRCTGKHFLNEQQLMQSSQYAGYAEHKKAHDDFIHKLDTWDGDVTYAKNWLVNHIKTIDFKYRGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEMERYTHRIN
publication title Structures of deoxy and oxy hemerythrin at 2.0 A resolution.
pubmed doi rcsb
source organism Themiste dyscritum
molecule tags Oxygen transport
total genus 48
structure length 113
sequence length 113
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1990-10-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 1hmdA00
3AGUA 4XPWA 2AWYA 1HMOA 3AGTA 4XPXA 2HMQA 3WHNA 1I4YA 2HMZA 1I4ZA 4XQ1A 3WAQA 2AVKA 4XPYA 1HMDA 1A7DA 1A7EA 2AWCA 2MHRA
chains in the Genus database with same CATH superfamily
3M4CA 2IYLD 4Q5SF 3Q7GA 1EI7A 2EIJC 2NUPB 2CNWA 5KYWA 2CW0F 1EA8A 2MYSA 4MVSA 4YL0A 2R25A 4O6YA 4JTCB 3LJBA 5L0IA 3Q7LA 4U5EE 2NUTA 1T6IA 2Y39A 1C03A 1R5ID 4DVZA 1ST6A 4NQFA 4DXWA 2GDCA 5CI9A 3VAYA 1V54C 4JCHA 1Z63A 2V3CC 2YWAA 1ZVZA 5A6BA 3RIPA 1FR0A 2LFDA 1Q0KA 4DVYP 3QVYA 3VRCA 3FDQA 1A7DA 1Z3IX 2FGYA 3LESA 2HV6A 4IRUA 3TJ5A 3TOLA 3RFYA 3K6BA 1OCCC 4J7TA 5DLJA 2XS8A 4JC7A 1OXBA 1WWPA 2D4UA 2F22A 1LKXA 3A9CA 3R7CA 2RSEB 4GYTA 1TQGA 4PJJA 5E2QA 3T4RA 2KYHA 2Z15A 3HLZA 4LACB 1DOVA 1XZPA 3AGUA 3CAXA 3EH1A 2GAQA 2Q3TA 2VB6A 3SXYA 1JPJA 2J9VA 4CBEA 2WVNA 1JAFA 1ZYRF 2ZPAA 2R7UA 1OXKA 3ZQVA 2Q9BA 3KPHA 2JD3A 1SMYF 1G4US 1M2OA 1OCZC 1NFNA 3FVYA 2UUHA 4LERA 4P9FA 2HJMA 3DJUB 2VH3A 3SXMA 3K66A 2Q00A 3EGDB 4JEBA 2HFIA 2P0NA 4JURI 4MQ9F 4YL1A 4W8PA 2XLVA 1LI7A 2ZXWC 1Q0MA 3NYLA 3QW1A 3U8PA 4YWQA 3S29A 1NZEA 4NTFA 1O87A 2ETSA 3N2ZB 2J0XA 3NMJA 4E7ZA 3ATPA 3SYNA 1HMDA 1QSPA 3F46A 4EIYA 1N1CA 4FX5A 3MYIA 3UNGC 4CJOA 1NG1A 1OKKA 1ZW2A 3A11A 3EZIA 1NU7D 1QQ3A 3MYFA 4G78A 4JJGA 3ZC4A 4HEAJ 5B1BC 3QZCA 4PJMA 5KYUA 2XXAA 2R7VA 3RKOF 4MVRA 3RQFA 4N6CA 2P61A 2UUIA 2OU6A 3I4UA 2YRFA 5E33A 4C7OA 5JVEA 4QDLA 3ZWIA 1V74B 4K7BA 4XPXA 3GM3A 1JOGA 1PCXA 3SNHA 3GM1A 2BL2A 1ZHZA 5T1DB 5L0DA 1FFTC 4IAOA 2XLEA 1OR3A 5L3QA 4MVOA 3NMKA 1UFBA 1UG7A 2ZXOA 1LIHA 1ORJA 2NUTB 2YZSA 3G4ZA 1QKRA 3T6BA 4EBJA 2VCBA 2A0UA 4L6RA 1T6UA 3V5ZA 1SF8A 2H7BA 4AE4B 4C3BA 4BJ6C 2AWCA 3CEXA 2XLHA 1M6TA 3EG9B 3MBGA 3O39A 5CI8A 2VCCA 1RKEA 3ZIBA 4PJLA 3HTKC 3Q6MA 3AG2C 3US6A 3VYWA 4XPWA 1YA7O 5JT4A 1YYJA 2XL6A 3U3BA 3W2VA 1C17M 2YL0A 3DXJF 3MFNA 2AWYA 2R03A 2WB7A 3GWLA 1VYKA 3X1OA 1F1MA 2HMQA 3S90A 4O7GA 3WHNA 5F28E 4MTGA 2IOQA 3DM5A 3SP1A 1W2WA 1O5HA 2QUPA 3GORA 3IQTA 3FAPB 1Z23A 3EFOB 3EZHA 2LCHA 2J7PD 2KNHA 2XL8A 3K33A 4M63A 4FESA 5D91A 1LVKA 3L1MA 3K1IC 1FFHA 4RBNA 3DI5A 4DRJB 2C04A 2D5RB 3AOUA 4EBBA 2L9JA 4FWVA 3OEOA 4N06A 3DAFA 3GODA 1CPQA 1U6HA 2EPMX 3C8GD 3FHDA 4YK5A 3S27A 2GA0A 4LLEA 4RDAA 4U5BE 1D0ZA 3PCVA 1L3PA 1SYQA 2P1AA 4MVMA 2PBEA 3S84A 3AQBA 2C03A 1VLTA 2DGJA 4MW3A 2ZXRA 5KYUB 2XXAB 4C3EA 3HNJA 3KL4A 3ZSUA 1YZCA 1ZZPA 4HFFB 4JTAB 5AC4A 1G4WR 1S7ZA 3C8GB 3DKAA 2QTVA 4KC9A 5B3SC 3B0PA 1D0YA 4I1OB 4HE8D 1K04A 3L8JA 4YJWA 2AVKA 3PHF2 3ITFA 1BR1A 4IWBA 5DS5A 4B6IA 2A6HF 1JR8A 1H6GA 3LEVA 3RVZA 2RD9A 1A7EA 3JT1A 3LAYA 1R4TA 3ZVRA 4MVZA 5BUOA 1YA9A 3JYYA 4NCQA 4W8KA 3IQCA 3HNLA 1S05A 3TULA 4GQHA 3H65A 1ZU5A 3DMDA 4ULVA 5CIVA 4OIPF 2Q7RA 2L6GA 5B3IA 1RKEB 1FMVA 3IPMO 4EUKB 3GEEA 3DE8A 3RW0A 3UMHA 1EKYA 2EIKC 1PD0A 4KNVA 4DRIB 4JW1A 2HMZA 4CDVA 3M4BA 4EWCA 1A41A 4CS9A 5A6AA 2XLOA 1FAPB 3U8VA 1RJ9A 2HSQA 4G7HF 4U5HA 2QE9A 2R7XA 5COFA 2Q9AA 3UGPA 1OW8A 2R7OA 2YL3A 4I44A 3DE9A 1TWHA 3UGOA 1H9GA 5E3CA 2P6VA 3UR3C 2JX0A 1T9KA 4BPMA 2J45A 1JMWA 1PV3A 2ASRA 3F47A 2EIMC 3KYJA 3NKEA 3NRHA 1LPEA 4U9DA 1ZHTA 4NY3A 4P6IC 4NTAA 1E85A 2L6FA 1BDJB 2Q4FA 5DVWA 3B71A 1BR2A 2KC3A 2L81A 1ZW3A 5JS5A 256BA 3IQ5A 3H2UA 1KTMA 2PP4A 3BEHA 2R9RB 4IAQA 4CSAC 2M64A 5KYNA 3K7DA 3TD7A 2A68F 2FFHA 3AJMA 1I5NA 1SR2A 4K0DA 5COMA 1WGWA 3TQOA 1ZHWA 1LE2A 1OCOC 1LE4A 1RMVA 2ICWG 2X51A 2ZD9A 3H2VA 2Y3BA 3KH2A 1YZAA 3GEIA 2HKVA 4JRZA 3CSKA 3DJNB 1ORYA 4WGYA 4WJ0A 2Y3GA 4CIPA 5A69A 1MMGA 4JKVA 3LNRA 3I5QA 1BR4A 3U9MA 1RXQA 2G3KA 4ANJA 3RH3A 2OQMA 3M79A 1M57C 1MMAA 4PFPA 1TKNA 5KYYB 2HSBA 5AGFA 1M2VB 3JSZA 3G50A 3DWWA 2B0HA 4D4NA 1HY5A 2OEXA 2XL4A 3NYJA 2A0BA 3KYIA 4K1OA 3B0UX 4DOZA 3L0IA 4XEVA 4HFKB 1QZXA 1TWGA 1IZMA 4QI0A 2PNOA 2XRHA 2CYDA 1I4ZA 1VMAA 1E2XA 3W2WA 5KYWB 3U3FA 1E84A 3Q6NA 3NG1A 2GWWA 1VLSA 3WAQA 2LFFA 4H54A 4U5DE 2EINC 3TOMA 2LSEA 4JJFA 1T01A 2CCYA 2QY9A 2J7PA 5JUAA 5FCLA 4MVQA 2NPUA 4R32A 1AVOB 2XLDA 3AG3C 3JCUQ 4NC3A 3RVYA 3HNKA 2J9WA 3EQLF 4O6NA 3NYMA 3B29A 3K1HA 4MS2A 1T6QA 2XS1A 1Z5ZA 1VYIA 2YHSA 2XM0A 3ABMC 3CQZA 4XTKA 3AG4C 4E7SA 3ECSA 1Z7Qc 4NTBA 5DQZA 2A6EF 2AP3A 3C62A 1I4YA 2OJED 4CDAA 4E17A 5IY5C 3CZ6A 4PJNA 4CS8A 2YKZA 3IHUA 3UMIA 2W9YA 4ZLCA 3T9OA 2Q9CA 2DB4A 1B68A 1YARO 1ZHYA 2W4BA 3B9QA 1SZIA 4OD4A 3ABLC 4BEJA 1OKKD 1U89A 2OG2A 2NUPA 1LS4A 2J46A 3M1CB 1LI5A 4G0HA 3JRMO 4LDKA 3RF3A 3QTHA 1OW6A 5K0IA 3KMIA 3B0VC 2VASA 2P7VA 5JRAA 3C18A 2CGEA 1LM3B 4U5GA 5T3TA 4CS7A 2WZFA 4WABA 3U2MA 3O10A 1XWJA 1GS9A 2A1DD 3U5SA 4E0HA 4A2NB 2LP4A 1RKCA 1TFOB 4AX2A 1YLMA 1ZHXA 2PX0A 3JSEO 4BJ5A 1HW2A 2IBFA 4CDYA 4OIQF 1G8XA 3X2QC 4C7OB 1JRAA 1A0BA 2WVOA 1HE1A 1HW1A 2O9XA 2EILC 4KNWA 2IXOA 4JZAA 4BJ1A 3V5YA 2NSGA 1K05A 5EHHA 3FOPA 3FMSA 1FMWA 4JVSA 3ZTZA 3SEOA 3MX3A 4ZLDA 2J8WA 2OCCC 1YYXA 3RQGA 2KQ9A 2LQGA 5L0JA 2R7RA 1NBBA 2X0CA 5JLIA 4AK9A 2CDQA 1GQAA 2I15A 2DI3A 3DD7A 4PR9A 2EPLX 3EGDA 1NU9C 3OWTA 1DOWA 3AGTA 3FXHA 4ONSA 4PACA 4C3DA 1OCRC 3R2PA 4O79A 4E18A 1IW7F 1V4AA 2LD6A 3QW0A 1V55C 3JRTA 2OOCA 4XLNF 2G3VA 4EKWA 2HV7A 5D92A 2R7TA 1BBHA 2BE5F 3POVA 1U0BB 3DAGA 4XPYA 4MTFA 3K1IA 4D4XA 2XM4A 3G4XA 3GWNA 4U5CE 4P9TA 3S9OA 3ZG1A 5B1AC 1T5OA 5L3VA 2EPNA 4GEHA 3KKBA 2G62A 2J9BA 1D0XA 1O3UA 3AG1C 4YL3A 1GGQA 1G5ZA 3C7JA 1MMDA 1OQCA 4LDQA 3LNMB 2HUJA 3ZQYA 4DBRA 2L7AA 4F4BA 1YDIA 2GFHA 4AL0A 3NDBB 4G7OF 1Q0GA 2HJ3A 3EHNA 2YLDA 3OA1A 4O6MA 4J30B 4EBKA 3L34A 1QVXA 3U9JA 1AEPA 3PDMP 3WODF 1A7VA 1Y6DA 3W8HA 4BG0A 2WL8A 3EH2A 3JZ0A 3NKDA 4XQ1A 5F5HA 2PFDA 1MMNA 1OW7A 2XLMA 3I5PA 2M4EA 2J9UA 2WZGA 3EG9A 1MQVA 3JTLO 5GPGB 1QLEC 4QI2A 3HJCA 4Q7CA 2W45A 1FNTc 3W8IA 1VB5A 1AUEA 3EJNA 4OIOF 4IB4A 3DM9B 4LDRA 4BEMJ 4FAPB 2Y3DA 3EGXA 4JTDB 4PK4A 3GANA 2FAPB 1Y4CA 5BQIA 1NLXA 5HSWA 2CNWD 2Y3HA 3LS0A 2R02A 3GM2A 4MW8A 2EPOA 5COGA 5A6KA 3S0XA 1APCA 1WATA 2NG1A 1CPRA 4YT5A 1FTSA 4A4AA 5DS4A 2KSFA 3EHMA 2HZ8A 3EFOA 2WZLA 2YQYA 3U0CA 2TMVP 1E86A 4CS8C 4Z9JA 5A6BD 1CGME 3HKKA 3TK0A 4ER9A 3LLKA 3LS1A 5L0HA 2H7OA 3N0TA 5A6JA 2J0WA 4DRHB 3W4YA 2XLWA 1KNYA 1LS1A 1TWCA 4OD5A 1WOLA 1TR2A 5KYXA 2YL7A 5EK0A 4YT4A 4YT8A 1GM5A 4CJGA 4XLPF 1RJ9B 4DJ9A 3NMIA 2MHRA 2I8BA 5JSLA 1CGNA 1WN0A 2AU5A 2ZXPA 1CGOA 4ULWA 1E83A 3SZRA 3J06A 1Q0FA 2LK4A 3C8GA 1HMOA 1VK5A 1MNEA 2IXNA 2PF4E 3FAJA 3QMKA 1Z6AA 4JE9A 5FZTA 4U9EA 5DQTA 5AC5A 4I1MA 4U5FE 1QPUA 4CIHA 4CSAA 2KK1A 3ZDLA 4BJ5C 2IXPA 2L6HA 3ABKC 3BRJA 2VCAA 4Z9HA 3LEOA 5L0GA 1KU2A 3N24A 2HS5A 2R7WA 4MNDA 3O55A 2IM8A 2E87A 2JPUA 1OR2A 3IQ6A 1MNDA 2YLIA 3O6XA 5TJ5E 2DYRC 4XEKA 1D1CA 3ZTMA 1PD1A 3E9VA 2OEVA 4XEFA 1VTMP 4CX9A 1EQ1A 4BJTA 1HE9A 5BQHA 4Z9IA 1C02A 5HV9A 1H7IA 3SXZA 3EGXB 1BZ4A 3C63A 3U2LA 2OJQA 4IARA 3VM6A 5L0CA 4YN0B 3QVZA 5L0FA 1WTYA 2EPKX 2PX3A 3V5XA 2W4MA 4PFOA 4JCZA 2OKUA 3FOOA 1YJGA 4X0RA 4J32B 2YEVA 4JEAA 4CS9C 1J8MF 1NSGB 2R05A 4JIOA 1J8YF 5T3WA 5EGYA 1D1BA 2MWQA 4AL1A 3GEHA 3V7OA 1XZQA 1H9TA 1ZU4A 5E3AA 2H7VC 2R7QA 4BJ6A 1D1AA 4G7ZF 3IEEA 2KGOA 1K40A 1YAUO 1JPNA 2YVKA 2DYSC 4I3MA 3L8IA 3T6GB 5KYXB 2A69F 2WVQA 1M56C 4XWJA 4YT2A 4UDVA 4H4KC 3MLGA 4J7YA 4MVUA 1VOMA 4LLCA 2R7SA 4N6HA 2QNLA 3LUTB 2LIGA 4KBLA 1TFKB 3M15A 3TJ6A 3SXKA 4RD9A 1L7CA 1TWAA 2V26A 2KJGA 2VC9A 3PMRA 4E0IA 4Q4ZF 1ORSC 1WASA 2QLAA 2YLGA 3ASOC 3EPVA 3JYHA 4EHPA 5DS6A 2KW3C 3T6JA 3AQCA 3RYLA 3E70C 4WGZA 3UMKA 1NFOA 5F5FA 5BQGA 3C8ZA 4IGGA 2NSFA 2H8AA 3S28A 3WG7C 3ASNC 1YVIA 4OIRF 1M2VA 2Y69C 4DBQA 2BC5A 2XSEA 5KYYA 5JP7A 3RQEA 4N4WA 2IXMA 1RCPA 3LLIA 4MTOA 3VF0A 4AE4A 4IJJA 4KI2A 2YL1A 2B0JA 1Q0DA 3HNIA 3DZAA 4OINF
chains in the Genus database with same CATH topology
3AGUA 4XPWA 2AWYA 1HMOA 3AGTA 4XPXA 2HMQA 3WHNA 1I4YA 2HMZA 1I4ZA 4XQ1A 3WAQA 2AVKA 4XPYA 1HMDA 1A7DA 1A7EA 2AWCA 2MHRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AGU A;  4XPW A;  2AWY A;  1HMO A;  3AGT A;  4XPX A;  2HMQ A;  3WHN A;  1I4Y A;  2HMZ A;  1I4Z A;  4XQ1 A;  3WAQ A;  2AVK A;  4XPY A;  1HMD A;  1A7D A;  1A7E A;  2AWC A;  2MHR A; 
#chains in the Genus database with same CATH topology
 3M4C A;  2IYL D;  4Q5S F;  3Q7G A;  1EI7 A;  2EIJ C;  2NUP B;  2CNW A;  5KYW A;  2CW0 F;  1EA8 A;  2MYS A;  4MVS A;  4YL0 A;  2R25 A;  4O6Y A;  4JTC B;  3LJB A;  5L0I A;  3Q7L A;  4U5E E;  2NUT A;  1T6I A;  2Y39 A;  1C03 A;  1R5I D;  4DVZ A;  1ST6 A;  4NQF A;  4DXW A;  2GDC A;  5CI9 A;  3VAY A;  1V54 C;  4JCH A;  1Z63 A;  2V3C C;  2YWA A;  1ZVZ A;  5A6B A;  3RIP A;  1FR0 A;  2LFD A;  1Q0K A;  4DVY P;  3QVY A;  3VRC A;  3FDQ A;  1A7D A;  1Z3I X;  2FGY A;  3LES A;  2HV6 A;  4IRU A;  3TJ5 A;  3TOL A;  3RFY A;  3K6B A;  1OCC C;  4J7T A;  5DLJ A;  2XS8 A;  4JC7 A;  1OXB A;  1WWP A;  2D4U A;  2F22 A;  1LKX A;  3A9C A;  3R7C A;  2RSE B;  4GYT A;  1TQG A;  4PJJ A;  5E2Q A;  3T4R A;  2KYH A;  2Z15 A;  3HLZ A;  4LAC B;  1DOV A;  1XZP A;  3AGU A;  3CAX A;  3EH1 A;  2GAQ A;  2Q3T A;  2VB6 A;  3SXY A;  1JPJ A;  2J9V A;  4CBE A;  2WVN A;  1JAF A;  1ZYR F;  2ZPA A;  2R7U A;  1OXK A;  3ZQV A;  2Q9B A;  3KPH A;  2JD3 A;  1SMY F;  1G4U S;  1M2O A;  1OCZ C;  1NFN A;  3FVY A;  2UUH A;  4LER A;  4P9F A;  2HJM A;  3DJU B;  2VH3 A;  3SXM A;  3K66 A;  2Q00 A;  3EGD B;  4JEB A;  2HFI A;  2P0N A;  4JUR I;  4MQ9 F;  4YL1 A;  4W8P A;  2XLV A;  1LI7 A;  2ZXW C;  1Q0M A;  3NYL A;  3QW1 A;  3U8P A;  4YWQ A;  3S29 A;  1NZE A;  4NTF A;  1O87 A;  2ETS A;  3N2Z B;  2J0X A;  3NMJ A;  4E7Z A;  3ATP A;  3SYN A;  1HMD A;  1QSP A;  3F46 A;  4EIY A;  1N1C A;  4FX5 A;  3MYI A;  3UNG C;  4CJO A;  1NG1 A;  1OKK A;  1ZW2 A;  3A11 A;  3EZI A;  1NU7 D;  1QQ3 A;  3MYF A;  4G78 A;  4JJG A;  3ZC4 A;  4HEA J;  5B1B C;  3QZC A;  4PJM A;  5KYU A;  2XXA A;  2R7V A;  3RKO F;  4MVR A;  3RQF A;  4N6C A;  2P61 A;  2UUI A;  2OU6 A;  3I4U A;  2YRF A;  5E33 A;  4C7O A;  5JVE A;  4QDL A;  3ZWI A;  1V74 B;  4K7B A;  4XPX A;  3GM3 A;  1JOG A;  1PCX A;  3SNH A;  3GM1 A;  2BL2 A;  1ZHZ A;  5T1D B;  5L0D A;  1FFT C;  4IAO A;  2XLE A;  1OR3 A;  5L3Q A;  4MVO A;  3NMK A;  1UFB A;  1UG7 A;  2ZXO A;  1LIH A;  1ORJ A;  2NUT B;  2YZS A;  3G4Z A;  1QKR A;  3T6B A;  4EBJ A;  2VCB A;  2A0U A;  4L6R A;  1T6U A;  3V5Z A;  1SF8 A;  2H7B A;  4AE4 B;  4C3B A;  4BJ6 C;  2AWC A;  3CEX A;  2XLH A;  1M6T A;  3EG9 B;  3MBG A;  3O39 A;  5CI8 A;  2VCC A;  1RKE A;  3ZIB A;  4PJL A;  3HTK C;  3Q6M A;  3AG2 C;  3US6 A;  3VYW A;  4XPW A;  1YA7 O;  5JT4 A;  1YYJ A;  2XL6 A;  3U3B A;  3W2V A;  1C17 M;  2YL0 A;  3DXJ F;  3MFN A;  2AWY A;  2R03 A;  2WB7 A;  3GWL A;  1VYK A;  3X1O A;  1F1M A;  2HMQ A;  3S90 A;  4O7G A;  3WHN A;  5F28 E;  4MTG A;  2IOQ A;  3DM5 A;  3SP1 A;  1W2W A;  1O5H A;  2QUP A;  3GOR A;  3IQT A;  3FAP B;  1Z23 A;  3EFO B;  3EZH A;  2LCH A;  2J7P D;  2KNH A;  2XL8 A;  3K33 A;  4M63 A;  4FES A;  5D91 A;  1LVK A;  3L1M A;  3K1I C;  1FFH A;  4RBN A;  3DI5 A;  4DRJ B;  2C04 A;  2D5R B;  3AOU A;  4EBB A;  2L9J A;  4FWV A;  3OEO A;  4N06 A;  3DAF A;  3GOD A;  1CPQ A;  1U6H A;  2EPM X;  3C8G D;  3FHD A;  4YK5 A;  3S27 A;  2GA0 A;  4LLE A;  4RDA A;  4U5B E;  1D0Z A;  3PCV A;  1L3P A;  1SYQ A;  2P1A A;  4MVM A;  2PBE A;  3S84 A;  3AQB A;  2C03 A;  1VLT A;  2DGJ A;  4MW3 A;  2ZXR A;  5KYU B;  2XXA B;  4C3E A;  3HNJ A;  3KL4 A;  3ZSU A;  1YZC A;  1ZZP A;  4HFF B;  4JTA B;  5AC4 A;  1G4W R;  1S7Z A;  3C8G B;  3DKA A;  2QTV A;  4KC9 A;  5B3S C;  3B0P A;  1D0Y A;  4I1O B;  4HE8 D;  1K04 A;  3L8J A;  4YJW A;  2AVK A;  3PHF 2;  3ITF A;  1BR1 A;  4IWB A;  5DS5 A;  4B6I A;  2A6H F;  1JR8 A;  1H6G A;  3LEV A;  3RVZ A;  2RD9 A;  1A7E A;  3JT1 A;  3LAY A;  1R4T A;  3ZVR A;  4MVZ A;  5BUO A;  1YA9 A;  3JYY A;  4NCQ A;  4W8K A;  3IQC A;  3HNL A;  1S05 A;  3TUL A;  4GQH A;  3H65 A;  1ZU5 A;  3DMD A;  4ULV A;  5CIV A;  4OIP F;  2Q7R A;  2L6G A;  5B3I A;  1RKE B;  1FMV A;  3IPM O;  4EUK B;  3GEE A;  3DE8 A;  3RW0 A;  3UMH A;  1EKY A;  2EIK C;  1PD0 A;  4KNV A;  4DRI B;  4JW1 A;  2HMZ A;  4CDV A;  3M4B A;  4EWC A;  1A41 A;  4CS9 A;  5A6A A;  2XLO A;  1FAP B;  3U8V A;  1RJ9 A;  2HSQ A;  4G7H F;  4U5H A;  2QE9 A;  2R7X A;  5COF A;  2Q9A A;  3UGP A;  1OW8 A;  2R7O A;  2YL3 A;  4I44 A;  3DE9 A;  1TWH A;  3UGO A;  1H9G A;  5E3C A;  2P6V A;  3UR3 C;  2JX0 A;  1T9K A;  4BPM A;  2J45 A;  1JMW A;  1PV3 A;  2ASR A;  3F47 A;  2EIM C;  3KYJ A;  3NKE A;  3NRH A;  1LPE A;  4U9D A;  1ZHT A;  4NY3 A;  4P6I C;  4NTA A;  1E85 A;  2L6F A;  1BDJ B;  2Q4F A;  5DVW A;  3B71 A;  1BR2 A;  2KC3 A;  2L81 A;  1ZW3 A;  5JS5 A;  256B A;  3IQ5 A;  3H2U A;  1KTM A;  2PP4 A;  3BEH A;  2R9R B;  4IAQ A;  4CSA C;  2M64 A;  5KYN A;  3K7D A;  3TD7 A;  2A68 F;  2FFH A;  3AJM A;  1I5N A;  1SR2 A;  4K0D A;  5COM A;  1WGW A;  3TQO A;  1ZHW A;  1LE2 A;  1OCO C;  1LE4 A;  1RMV A;  2ICW G;  2X51 A;  2ZD9 A;  3H2V A;  2Y3B A;  3KH2 A;  1YZA A;  3GEI A;  2HKV A;  4JRZ A;  3CSK A;  3DJN B;  1ORY A;  4WGY A;  4WJ0 A;  2Y3G A;  4CIP A;  5A69 A;  1MMG A;  4JKV A;  3LNR A;  3I5Q A;  1BR4 A;  3U9M A;  1RXQ A;  2G3K A;  4ANJ A;  3RH3 A;  2OQM A;  3M79 A;  1M57 C;  1MMA A;  4PFP A;  1TKN A;  5KYY B;  2HSB A;  5AGF A;  1M2V B;  3JSZ A;  3G50 A;  3DWW A;  2B0H A;  4D4N A;  1HY5 A;  2OEX A;  2XL4 A;  3NYJ A;  2A0B A;  3KYI A;  4K1O A;  3B0U X;  4DOZ A;  3L0I A;  4XEV A;  4HFK B;  1QZX A;  1TWG A;  1IZM A;  4QI0 A;  2PNO A;  2XRH A;  2CYD A;  1I4Z A;  1VMA A;  1E2X A;  3W2W A;  5KYW B;  3U3F A;  1E84 A;  3Q6N A;  3NG1 A;  2GWW A;  1VLS A;  3WAQ A;  2LFF A;  4H54 A;  4U5D E;  2EIN C;  3TOM A;  2LSE A;  4JJF A;  1T01 A;  2CCY A;  2QY9 A;  2J7P A;  5JUA A;  5FCL A;  4MVQ A;  2NPU A;  4R32 A;  1AVO B;  2XLD A;  3AG3 C;  3JCU Q;  4NC3 A;  3RVY A;  3HNK A;  2J9W A;  3EQL F;  4O6N A;  3NYM A;  3B29 A;  3K1H A;  4MS2 A;  1T6Q A;  2XS1 A;  1Z5Z A;  1VYI A;  2YHS A;  2XM0 A;  3ABM C;  3CQZ A;  4XTK A;  3AG4 C;  4E7S A;  3ECS A;  1Z7Q c;  4NTB A;  5DQZ A;  2A6E F;  2AP3 A;  3C62 A;  1I4Y A;  2OJE D;  4CDA A;  4E17 A;  5IY5 C;  3CZ6 A;  4PJN A;  4CS8 A;  2YKZ A;  3IHU A;  3UMI A;  2W9Y A;  4ZLC A;  3T9O A;  2Q9C A;  2DB4 A;  1B68 A;  1YAR O;  1ZHY A;  2W4B A;  3B9Q A;  1SZI A;  4OD4 A;  3ABL C;  4BEJ A;  1OKK D;  1U89 A;  2OG2 A;  2NUP A;  1LS4 A;  2J46 A;  3M1C B;  1LI5 A;  4G0H A;  3JRM O;  4LDK A;  3RF3 A;  3QTH A;  1OW6 A;  5K0I A;  3KMI A;  3B0V C;  2VAS A;  2P7V A;  5JRA A;  3C18 A;  2CGE A;  1LM3 B;  4U5G A;  5T3T A;  4CS7 A;  2WZF A;  4WAB A;  3U2M A;  3O10 A;  1XWJ A;  1GS9 A;  2A1D D;  3U5S A;  4E0H A;  4A2N B;  2LP4 A;  1RKC A;  1TFO B;  4AX2 A;  1YLM A;  1ZHX A;  2PX0 A;  3JSE O;  4BJ5 A;  1HW2 A;  2IBF A;  4CDY A;  4OIQ F;  1G8X A;  3X2Q C;  4C7O B;  1JRA A;  1A0B A;  2WVO A;  1HE1 A;  1HW1 A;  2O9X A;  2EIL C;  4KNW A;  2IXO A;  4JZA A;  4BJ1 A;  3V5Y A;  2NSG A;  1K05 A;  5EHH A;  3FOP A;  3FMS A;  1FMW A;  4JVS A;  3ZTZ A;  3SEO A;  3MX3 A;  4ZLD A;  2J8W A;  2OCC C;  1YYX A;  3RQG A;  2KQ9 A;  2LQG A;  5L0J A;  2R7R A;  1NBB A;  2X0C A;  5JLI A;  4AK9 A;  2CDQ A;  1GQA A;  2I15 A;  2DI3 A;  3DD7 A;  4PR9 A;  2EPL X;  3EGD A;  1NU9 C;  3OWT A;  1DOW A;  3AGT A;  3FXH A;  4ONS A;  4PAC A;  4C3D A;  1OCR C;  3R2P A;  4O79 A;  4E18 A;  1IW7 F;  1V4A A;  2LD6 A;  3QW0 A;  1V55 C;  3JRT A;  2OOC A;  4XLN F;  2G3V A;  4EKW A;  2HV7 A;  5D92 A;  2R7T A;  1BBH A;  2BE5 F;  3POV A;  1U0B B;  3DAG A;  4XPY A;  4MTF A;  3K1I A;  4D4X A;  2XM4 A;  3G4X A;  3GWN A;  4U5C E;  4P9T A;  3S9O A;  3ZG1 A;  5B1A C;  1T5O A;  5L3V A;  2EPN A;  4GEH A;  3KKB A;  2G62 A;  2J9B A;  1D0X A;  1O3U A;  3AG1 C;  4YL3 A;  1GGQ A;  1G5Z A;  3C7J A;  1MMD A;  1OQC A;  4LDQ A;  3LNM B;  2HUJ A;  3ZQY A;  4DBR A;  2L7A A;  4F4B A;  1YDI A;  2GFH A;  4AL0 A;  3NDB B;  4G7O F;  1Q0G A;  2HJ3 A;  3EHN A;  2YLD A;  3OA1 A;  4O6M A;  4J30 B;  4EBK A;  3L34 A;  1QVX A;  3U9J A;  1AEP A;  3PDM P;  3WOD F;  1A7V A;  1Y6D A;  3W8H A;  4BG0 A;  2WL8 A;  3EH2 A;  3JZ0 A;  3NKD A;  4XQ1 A;  5F5H A;  2PFD A;  1MMN A;  1OW7 A;  2XLM A;  3I5P A;  2M4E A;  2J9U A;  2WZG A;  3EG9 A;  1MQV A;  3JTL O;  5GPG B;  1QLE C;  4QI2 A;  3HJC A;  4Q7C A;  2W45 A;  1FNT c;  3W8I A;  1VB5 A;  1AUE A;  3EJN A;  4OIO F;  4IB4 A;  3DM9 B;  4LDR A;  4BEM J;  4FAP B;  2Y3D A;  3EGX A;  4JTD B;  4PK4 A;  3GAN A;  2FAP B;  1Y4C A;  5BQI A;  1NLX A;  5HSW A;  2CNW D;  2Y3H A;  3LS0 A;  2R02 A;  3GM2 A;  4MW8 A;  2EPO A;  5COG A;  5A6K A;  3S0X A;  1APC A;  1WAT A;  2NG1 A;  1CPR A;  4YT5 A;  1FTS A;  4A4A A;  5DS4 A;  2KSF A;  3EHM A;  2HZ8 A;  3EFO A;  2WZL A;  2YQY A;  3U0C A;  2TMV P;  1E86 A;  4CS8 C;  4Z9J A;  5A6B D;  1CGM E;  3HKK A;  3TK0 A;  4ER9 A;  3LLK A;  3LS1 A;  5L0H A;  2H7O A;  3N0T A;  5A6J A;  2J0W A;  4DRH B;  3W4Y A;  2XLW A;  1KNY A;  1LS1 A;  1TWC A;  4OD5 A;  1WOL A;  1TR2 A;  5KYX A;  2YL7 A;  5EK0 A;  4YT4 A;  4YT8 A;  1GM5 A;  4CJG A;  4XLP F;  1RJ9 B;  4DJ9 A;  3NMI A;  2MHR A;  2I8B A;  5JSL A;  1CGN A;  1WN0 A;  2AU5 A;  2ZXP A;  1CGO A;  4ULW A;  1E83 A;  3SZR A;  3J06 A;  1Q0F A;  2LK4 A;  3C8G A;  1HMO A;  1VK5 A;  1MNE A;  2IXN A;  2PF4 E;  3FAJ A;  3QMK A;  1Z6A A;  4JE9 A;  5FZT A;  4U9E A;  5DQT A;  5AC5 A;  4I1M A;  4U5F E;  1QPU A;  4CIH A;  4CSA A;  2KK1 A;  3ZDL A;  4BJ5 C;  2IXP A;  2L6H A;  3ABK C;  3BRJ A;  2VCA A;  4Z9H A;  3LEO A;  5L0G A;  1KU2 A;  3N24 A;  2HS5 A;  2R7W A;  4MND A;  3O55 A;  2IM8 A;  2E87 A;  2JPU A;  1OR2 A;  3IQ6 A;  1MND A;  2YLI A;  3O6X A;  5TJ5 E;  2DYR C;  4XEK A;  1D1C A;  3ZTM A;  1PD1 A;  3E9V A;  2OEV A;  4XEF A;  1VTM P;  4CX9 A;  1EQ1 A;  4BJT A;  1HE9 A;  5BQH A;  4Z9I A;  1C02 A;  5HV9 A;  1H7I A;  3SXZ A;  3EGX B;  1BZ4 A;  3C63 A;  3U2L A;  2OJQ A;  4IAR A;  3VM6 A;  5L0C A;  4YN0 B;  3QVZ A;  5L0F A;  1WTY A;  2EPK X;  2PX3 A;  3V5X A;  2W4M A;  4PFO A;  4JCZ A;  2OKU A;  3FOO A;  1YJG A;  4X0R A;  4J32 B;  2YEV A;  4JEA A;  4CS9 C;  1J8M F;  1NSG B;  2R05 A;  4JIO A;  1J8Y F;  5T3W A;  5EGY A;  1D1B A;  2MWQ A;  4AL1 A;  3GEH A;  3V7O A;  1XZQ A;  1H9T A;  1ZU4 A;  5E3A A;  2H7V C;  2R7Q A;  4BJ6 A;  1D1A A;  4G7Z F;  3IEE A;  2KGO A;  1K40 A;  1YAU O;  1JPN A;  2YVK A;  2DYS C;  4I3M A;  3L8I A;  3T6G B;  5KYX B;  2A69 F;  2WVQ A;  1M56 C;  4XWJ A;  4YT2 A;  4UDV A;  4H4K C;  3MLG A;  4J7Y A;  4MVU A;  1VOM A;  4LLC A;  2R7S A;  4N6H A;  2QNL A;  3LUT B;  2LIG A;  4KBL A;  1TFK B;  3M15 A;  3TJ6 A;  3SXK A;  4RD9 A;  1L7C A;  1TWA A;  2V26 A;  2KJG A;  2VC9 A;  3PMR A;  4E0I A;  4Q4Z F;  1ORS C;  1WAS A;  2QLA A;  2YLG A;  3ASO C;  3EPV A;  3JYH A;  4EHP A;  5DS6 A;  2KW3 C;  3T6J A;  3AQC A;  3RYL A;  3E70 C;  4WGZ A;  3UMK A;  1NFO A;  5F5F A;  5BQG A;  3C8Z A;  4IGG A;  2NSF A;  2H8A A;  3S28 A;  3WG7 C;  3ASN C;  1YVI A;  4OIR F;  1M2V A;  2Y69 C;  4DBQ A;  2BC5 A;  2XSE A;  5KYY A;  5JP7 A;  3RQE A;  4N4W A;  2IXM A;  1RCP A;  3LLI A;  4MTO A;  3VF0 A;  4AE4 A;  4IJJ A;  4KI2 A;  2YL1 A;  2B0J A;  1Q0D A;  3HNI A;  3DZA A;  4OIN F; 
#chains in the Genus database with same CATH homology
 3AGU A;  4XPW A;  2AWY A;  1HMO A;  3AGT A;  4XPX A;  2HMQ A;  3WHN A;  1I4Y A;  2HMZ A;  1I4Z A;  4XQ1 A;  3WAQ A;  2AVK A;  4XPY A;  1HMD A;  1A7D A;  1A7E A;  2AWC A;  2MHR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...