1HMDA

The structure of deoxy and oxy hemerythrin at 2.0 angstroms resolution
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
113
structure length
113
Chain Sequence
b'GFPIPDPYCWDISFRTFYTIIDDEHKTLFNGILLLSQADNADHLNELRRCTGKHFLNEQQLMQSSQYAGYAEHKKAHDDFIHKLDTWDGDVTYAKNWLVNHIKTIDFKYRGKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEMERYTHRIN
molecule tags Oxygen transport
source organism Themiste dyscritum
publication title Structures of deoxy and oxy hemerythrin at 2.0 A resolution.
pubmed doi rcsb
total genus 48
structure length 113
sequence length 113
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1990-10-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 1hmdA00
4XPYA 2AVKA 3AGUA 3WHNA 1A7DA 2AWYA 3WAQA 1I4YA 3AGTA 1HMOA 2MHRA 1I4ZA 2HMQA 4XPXA 4XPWA 2AWCA 4XQ1A 2HMZA 1A7EA 1HMDA
chains in the Genus database with same CATH superfamily
1QPUA 2J9BA 3ZSUA 2D5RB 2OQMA 4WGYA 1I4YA 4MVQA 5F28E 5IY5C 2DYSC 4MTOA 3DKAA 3KYIA 4DVZA 3OEOA 3W2WA 2R02A 2J9VA 3U9MA 1T6QA 1J8YF 4G78A 4E0IA 1T6UA 2EILC 2KK1A 3GM1A 3ITFA 2FFHA 4O6NA 4FX5A 4RD9A 3ZTZA 3S27A 2Q3TA 4JC7A 1MMGA 2WVNA 2J45A 3L34A 3TJ5A 4AX2A 1ZU5A 2YL1A 4E17A 2R7VA 2YLIA 1U0BB 3IQ6A 2BL2A 1RXQA 2OKUA 4N6HA 1Z7Qc 4JCZA 1H6GA 2NSGA 3R2PA 2OJQA 1FFHA 4U9DA 5D92A 1OR2A 3VF0A 3X1OA 4XPWA 5A6JA 4B6IA 3U8PA 4WJ0A 2YEVA 3RIPA 5JRAA 3Q7LA 4GEHA 3FOPA 1J8MF 2R7RA 3MFNA 2EPMX 1QQ3A 3EGXB 1YDIA 5HV9A 4XLNF 3QMKA 4FESA 4YL3A 2XXAA 4K1OA 4EBBA 1OR3A 1YAUO 2MWQA 3LNMB 2L6GA 3Q7GA 1MNEA 1OCOC 1WWPA 1YVIA 2J46A 4LDKA 3TQOA 2YL3A 2VCAA 5JUAA 3TOMA 3DAGA 1NFOA 3DXJF 1EI7A 3AJMA 3FOOA 3HKKA 4U5BE 3B0UX 2R7XA 1VMAA 3U0CA 4HFKB 3UMHA 2OJED 4MQ9F 3L8JA 1VB5A 2Z15A 3FHDA 1RJ9A 3SNHA 4F4BA 2XSEA 1QSPA 5KYYA 1CGNA 4MTFA 1IW7F 2V26A 3WG7C 5B3IA 2V3CC 3LNRA 2P6VA 1Z23A 3C63A 3SYNA 1AEPA 3AGTA 4JURI 1EA8A 2KSFA 3IEEA 3RQFA 3U2MA 2HS5A 1FFTC 1ORSC 4WABA 1T6IA 2HFIA 1MMAA 3GORA 3SXKA 1T01A 4C7OA 2VCCA 2IXOA 3EGDB 2ETSA 3ZDLA 4M63A 1BZ4A 2EINC 3HNLA 4E0HA 2W4BA 1ST6A 3US6A 3GEIA 5L0FA 2NPUA 1A7DA 2DGJA 4IWBA 4LDRA 4AK9A 5L0CA 1FTSA 3ECSA 4C7OB 2Y3BA 2W9YA 4LLEA 4EIYA 1JOGA 2A1DD 2RD9A 3I5QA 5FZTA 2IXMA 1M2VA 3JRMO 4JTDB 2PBEA 2TMVP 4C3BA 3B0VC 4XTKA 1ZZPA 2IXNA 5L0HA 3C8GA 3FAJA 1NBBA 3O55A 1TKNA 2AP3A 2KW3C 3L8IA 4JW1A 2D4UA 4H54A 4MVZA 3DZAA 1Q0FA 3JSEO 4BJ6A 2KGOA 2X0CA 2YLGA 1G4WR 2AVKA 3RW0A 1D1BA 3C8GD 2QE9A 3GEHA 3GEEA 3NDBB 1LPEA 4CS7A 1LI7A 3EJNA 2LP4A 3MYFA 2RSEB 4AE4B 1L3PA 1TFOB 2Q4FA 3RFYA 1BBHA 2R7QA 3C18A 3MYIA 3MBGA 1D0ZA 3DJUB 4JTAB 3EGXA 3T6GB 5B3SC 3A9CA 3G4ZA 5DVWA 3K66A 4MVMA 3OWTA 4CX9A 3IPMO 1NU7D 2LK4A 3AG4C 1SF8A 3O10A 1BDJB 1PV3A 5D91A 4MVOA 4RDAA 2CYDA 2CDQA 4A2NB 2HUJA 2JPUA 2OEXA 5DQTA 1E85A 1G4US 4OIRF 4D4XA 1TWAA 4LACB 4GQHA 2FAPB 2OOCA 3SXYA 4KNWA 1ZYRF 5KYWB 4CIHA 1YARO 1TWCA 2CNWA 4IAOA 2R7OA 3NMIA 2WL8A 2NUTB 5JT4A 1LS4A 1NG1A 2ZD9A 1H7IA 2QTVA 3NMKA 2L81A 3EZHA 4LDQA 3RQEA 4YN0B 3ZIBA 4DJ9A 4JKVA 3ABKC 2NUPA 2A6EF 3K6BA 256BA 4XPYA 2DB4A 4W8KA 1Z6AA 3FXHA 4N6CA 5EHHA 3MX3A 1RKEB 1I4ZA 4XEFA 3T6JA 5AC5A 4JRZA 2X51A 1M57C 2I15A 5T3TA 5KYUA 2WVOA 4NC3A 3CEXA 3FVYA 1HMOA 3HLZA 4DXWA 4RBNA 4CBEA 4I44A 4MW8A 3TJ6A 4DRHB 4JJGA 2XS8A 5B1AC 2QNLA 3EH1A 5KYXB 3GWLA 1OXBA 1Q0KA 3GWNA 1OXKA 1BR4A 5E33A 4DBRA 3KH2A 3WODF 4EKWA 2NUPB 2XLHA 4WGZA 3BRJA 4J7YA 1XWJA 2Q00A 3JCUQ 1D0YA 4IAQA 2KYHA 1EKYA 1TFKB 4EHPA 3KL4A 4MW3A 3ASOC 1LVKA 2LCHA 5DS4A 2LIGA 5A6BA 4U5DE 2A0BA 1V4AA 4C3DA 5K0IA 1H9TA 3K33A 1NU9C 4JIOA 3DD7A 5BQIA 1LKXA 1VK5A 3V7OA 2PP4A 4PFPA 4BEJA 3W2VA 5BUOA 2ZPAA 3CZ6A 1ORJA 2J8WA 1V54C 1A7EA 1HMDA 1OW7A 4CIPA 2H7VC 1V74B 4Z9HA 1WGWA 3W8HA 2XM0A 1OQCA 3X2QC 4CS9C 5L0JA 3PMRA 4CDYA 3DM5A 2R7WA 5F5FA 1SZIA 1TWHA 2P0NA 4JEBA 4GYTA 4E7SA 2G62A 2XL6A 5BQGA 4QI2A 3EFOA 3ZG1A 4DRIB 1HY5A 2IM8A 3RVYA 3FAPB 5JSLA 3GANA 1BR1A 4YL1A 2LSEA 1Z3IX 4BJ6C 1QZXA 1VYKA 4Q5SF 1A0BA 2AWCA 1YA7O 1R4TA 1MMNA 2P1AA 4PJJA 3QZCA 2LQGA 2L6FA 1E83A 2HKVA 2Q9CA 4MTGA 4YK5A 4PJMA 2A0UA 1S7ZA 3UMIA 3JZ0A 1K04A 1OW6A 1QVXA 2KJGA 5L0IA 4ULWA 3MLGA 2IBFA 4I1MA 4CS8C 5DS5A 3SEOA 2KC3A 4ER9A 4OD5A 2DYRC 3HJCA 4U5HA 2LFFA 1OKKD 1E84A 4J30B 5CI8A 3CQZA 4EBJA 5EK0A 1DOVA 1LI5A 3K1IA 4MS2A 4CDVA 4PK4A 2R7SA 2XLOA 4ONSA 3SXMA 4JTCB 4NTFA 1JMWA 3AG1C 3ZQVA 3EPVA 5COFA 2XLEA 1CPQA 3WHNA 1NLXA 1TQGA 5L0GA 3FDQA 4XLPF 2AU5A 1GS9A 3U3BA 3F47A 3NYJA 2G3VA 1M2OA 3E9VA 3R7CA 2R9RB 4A4AA 5F5HA 3B29A 3EG9B 4Q4ZF 1UFBA 2A69F 1HE1A 2YRFA 5CIVA 4X0RA 1SR2A 4R32A 5HSWA 3S9OA 2LD6A 4OIOF 4LLCA 2VH3A 2YQYA 4BEMJ 4J32B 3RH3A 3QTHA 1W2WA 1D0XA 2H7BA 2PX3A 4IB4A 4BPMA 2DI3A 3JYYA 1HW1A 3T9OA 4OIQF 4CS8A 2BC5A 2EIJC 4O6YA 5AC4A 4XQ1A 2HMZA 2ZXPA 3M1CB 2WZLA 1LIHA 4YT8A 4G7HF 3VYWA 5B1BC 4IRUA 1O3UA 2J7PA 4YT2A 2VCBA 3LJBA 4U5CE 3CSKA 2C03A 3C8ZA 3NKDA 2ICWG 4CJGA 4L6RA 1M6TA 2XM4A 4C3EA 3WAQA 3ZWIA 4PJNA 3TD7A 4YL0A 2HSQA 2M4EA 5DS6A 2YLDA 3ZVRA 3UNGC 4HFFB 2QY9A 1YLMA 3Q6NA 1APCA 3TK0A 5KYXA 3M15A 5JP7A 1H9GA 2L9JA 1ZU4A 2W45A 1K40A 4NY3A 4AE4A 1SYQA 3N0TA 2JD3A 3TOLA 1G5ZA 2R03A 3U5SA 2BE5F 3U8VA 1Z63A 2GWWA 1FMWA 1JPNA 4NQFA 3LS1A 5COGA 1L7CA 3C8GB 4I3MA 2HSBA 1T9KA 4XEVA 1NSGB 4W8PA 1S05A 4O79A 1DOWA 3NMJA 4XWJA 2H8AA 1U89A 1RCPA 2O9XA 4BJ5C 2EPNA 3J06A 4IGGA 2WZFA 2J9UA 1QKRA 2Y69C 5DQZA 3M4CA 1GGQA 3M4BA 3A11A 2MYSA 2IYLD 3F46A 3HTKC 4HEAJ 4K7BA 1OCCC 1R5ID 3SP1A 3M79A 3T4RA 4DVYP 4U9EA 4MNDA 3BEHA 4UDVA 2H7OA 1JAFA 2AWYA 1PCXA 1ZHWA 2YZSA 2ZXRA 3NRHA 5L3QA 1VTMP 4CDAA 3EGDA 3NG1A 4NCQA 5A6KA 3UGOA 4QDLA 3EH2A 3IQTA 1E2XA 1LE2A 3H2UA 3ABLC 5T3WA 2VC9A 3U9JA 3QW0A 2VASA 1T5OA 4N06A 1WTYA 2R7UA 1ZVZA 4O6MA 1LM3B 2CCYA 3JSZA 2ZXOA 3QW1A 1KTMA 1MMDA 1K05A 2PFDA 4I1OB 4K0DA 4PR9A 1RKEA 1YJGA 1ZHXA 3PDMP 1FAPB 2KQ9A 2F22A 5JVEA 3L1MA 4PJLA 1FNTc 3GM3A 4N4WA 3DE8A 4FWVA 3SZRA 4AL0A 5DLJA 1FMVA 3K1IC 3N2ZB 1OW8A 1JR8A 2EPKX 3ASNC 4EUKB 2NUTA 5L0DA 2G3KA 1VLTA 4ANJA 4O7GA 1RMVA 4J7TA 4YT4A 1A7VA 1N1CA 4KC9A 2J9WA 4KBLA 2Q9AA 3S0XA 3C7JA 2YHSA 1HW2A 1XZQA 2KNHA 3HNIA 4JE9A 2HV6A 1VYIA 5E2QA 4JEAA 1YYXA 5JS5A 1CPRA 3LLKA 1M2VB 1ORYA 4MVSA 1OCRC 2HV7A 4Z9IA 1KU2A 1F1MA 3ZC4A 1Q0MA 2CW0F 2XLMA 3JT1A 4U5FE 5KYNA 3DWWA 3NYMA 5JLIA 2J0WA 4YT5A 3EHMA 1C03A 2J7PD 4NTBA 4P9FA 1C02A 2Y3HA 2OCCC 2GA0A 3QVZA 2I8BA 1VLSA 2WB7A 1FR0A 3EHNA 2OG2A 2XS1A 3HNJA 4XPXA 2EPLX 1AVOB 2WZGA 1BR2A 4OINF 3SXZA 2IOQA 3ZQYA 3DJNB 3ZTMA 3UGPA 1CGOA 2P61A 4JJFA 4CSAC 3HNKA 2HJMA 4BJTA 1TWGA 5E3AA 3LEVA 2NSFA 4FAPB 5AGFA 3TULA 3UMKA 1LS1A 2YL0A 3H65A 3S29A 1WN0A 2Q9BA 2R05A 2NG1A 1OCZC 3B71A 4P9TA 1AUEA 5E3CA 2HJ3A 4DBQA 4YWQA 1E86A 2HZ8A 1ZHZA 2E87A 2GAQA 4JZAA 1NFNA 1VOMA 3U2LA 1OKKA 4Q7CA 1YZCA 3RF3A 2XL8A 3B0PA 4JCHA 3PHF2 2A6HF 3V5YA 1O87A 2XXAB 5EGYA 3LLIA 1MNDA 5GPGB 2W4MA 3RYLA 5A69A 1ZHTA 2EPOA 3LS0A 2JX0A 5CI9A 4G7ZF 1ZW3A 4PACA 3QVYA 1A41A 5KYWA 5KYYB 4CS9A 1GQAA 1C17M 4KNVA 3K7DA 3POVA 1I5NA 4XEKA 3CAXA 4MVUA 3S90A 2C04A 3IHUA 1G8XA 4E18A 1B68A 2PX0A 2MHRA 1RJ9B 3AQBA 3I5PA 3H2VA 3JTLO 5BQHA 4HE8D 3O6XA 2XL4A 3LUTB 3RKOF 3EG9A 5T1DB 2PNOA 2P7VA 1QLEC 3AG3C 2Y3DA 2EIMC 3U3FA 1EQ1A 3VAYA 1ZW2A 1YZAA 3DMDA 2L6HA 4G7OF 2VB6A 3I4UA 2XRHA 2CGEA 3LEOA 1O5HA 4P6IC 3N24A 2OEVA 2R25A 1PD1A 3JRTA 4IJJA 1YA9A 4U5EE 3VRCA 3IQCA 1Z5ZA 3RQGA 4BJ1A 4CSAA 3E70C 3GODA 5COMA 5TJ5E 3LESA 1UG7A 4BJ5A 2Q7RA 1M56C 4BG0A 4MVRA 1U6HA 4ZLDA 5A6BD 1D1AA 3V5XA 3DE9A 3DM9B 2IXPA 2ASRA 2UUHA 3LAYA 3O39A 1MQVA 1LE4A 2YL7A 4NTAA 4PFOA 3IQ5A 3UR3C 1Q0DA 2J0XA 1WASA 1ZHYA 2XLWA 4H4KC 4EWCA 2EIKC 3G4XA 2B0HA 1SMYF 2YKZA 3G50A 1WOLA 2M64A 3PCVA 1IZMA 4EBKA 2WVQA 3KMIA 3GM2A 3DI5A 1HE9A 3K1HA 3AOUA 2A68F 3OA1A 2B0JA 2QUPA 4JVSA 3W4YA 1GM5A 2XLDA 4KI2A 2HMQA 3EZIA 1V55C 3ATPA 3Q6MA 3V5ZA 4CJOA 1JPJA 2ZXWC 4OD4A 3JYHA 2FGYA 4E7ZA 5KYUB 4ZLCA 2GFHA 3AQCA 1D1CA 3L0IA 2R7TA 3AG2C 4Z9JA 4QI0A 3KPHA 1KNYA 3EQLF 2LFDA 3B9QA 3S28A 4YJWA 1Y6DA 4U5GA 3W8IA 3C62A 5FCLA 4DOZA 2YWAA 3ABMC 3S84A 2XLVA 3NYLA 1WATA 1YYJA 2PF4E 2GDCA 1NZEA 3VM6A 4DRJB 5L3VA 4AL1A 2Y3GA 3FMSA 1JRAA 2L7AA 2UUIA 4LERA 1RKCA 4ULVA 5A6AA 2CNWD 3AGUA 3RVZA 2Y39A 3T6BA 1TR2A 4IARA 4OIPF 1Q0GA 1CGME 3DAFA 4D4NA 4G0HA 3KKBA 1Y4CA 1PD0A 3EFOB 2QLAA 1XZPA 3NKEA 2OU6A 2YVKA 3KYJA
chains in the Genus database with same CATH topology
4XPYA 2AVKA 3AGUA 3WHNA 1A7DA 2AWYA 3WAQA 1I4YA 3AGTA 1HMOA 2MHRA 1I4ZA 2HMQA 4XPXA 4XPWA 2AWCA 4XQ1A 2HMZA 1A7EA 1HMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XPY A;  2AVK A;  3AGU A;  3WHN A;  1A7D A;  2AWY A;  3WAQ A;  1I4Y A;  3AGT A;  1HMO A;  2MHR A;  1I4Z A;  2HMQ A;  4XPX A;  4XPW A;  2AWC A;  4XQ1 A;  2HMZ A;  1A7E A;  1HMD A; 
#chains in the Genus database with same CATH topology
 1QPU A;  2J9B A;  3ZSU A;  2D5R B;  2OQM A;  4WGY A;  1I4Y A;  4MVQ A;  5F28 E;  5IY5 C;  2DYS C;  4MTO A;  3DKA A;  3KYI A;  4DVZ A;  3OEO A;  3W2W A;  2R02 A;  2J9V A;  3U9M A;  1T6Q A;  1J8Y F;  4G78 A;  4E0I A;  1T6U A;  2EIL C;  2KK1 A;  3GM1 A;  3ITF A;  2FFH A;  4O6N A;  4FX5 A;  4RD9 A;  3ZTZ A;  3S27 A;  2Q3T A;  4JC7 A;  1MMG A;  2WVN A;  2J45 A;  3L34 A;  3TJ5 A;  4AX2 A;  1ZU5 A;  2YL1 A;  4E17 A;  2R7V A;  2YLI A;  1U0B B;  3IQ6 A;  2BL2 A;  1RXQ A;  2OKU A;  4N6H A;  1Z7Q c;  4JCZ A;  1H6G A;  2NSG A;  3R2P A;  2OJQ A;  1FFH A;  4U9D A;  5D92 A;  1OR2 A;  3VF0 A;  3X1O A;  4XPW A;  5A6J A;  4B6I A;  3U8P A;  4WJ0 A;  2YEV A;  3RIP A;  5JRA A;  3Q7L A;  4GEH A;  3FOP A;  1J8M F;  2R7R A;  3MFN A;  2EPM X;  1QQ3 A;  3EGX B;  1YDI A;  5HV9 A;  4XLN F;  3QMK A;  4FES A;  4YL3 A;  2XXA A;  4K1O A;  4EBB A;  1OR3 A;  1YAU O;  2MWQ A;  3LNM B;  2L6G A;  3Q7G A;  1MNE A;  1OCO C;  1WWP A;  1YVI A;  2J46 A;  4LDK A;  3TQO A;  2YL3 A;  2VCA A;  5JUA A;  3TOM A;  3DAG A;  1NFO A;  3DXJ F;  1EI7 A;  3AJM A;  3FOO A;  3HKK A;  4U5B E;  3B0U X;  2R7X A;  1VMA A;  3U0C A;  4HFK B;  3UMH A;  2OJE D;  4MQ9 F;  3L8J A;  1VB5 A;  2Z15 A;  3FHD A;  1RJ9 A;  3SNH A;  4F4B A;  2XSE A;  1QSP A;  5KYY A;  1CGN A;  4MTF A;  1IW7 F;  2V26 A;  3WG7 C;  5B3I A;  2V3C C;  3LNR A;  2P6V A;  1Z23 A;  3C63 A;  3SYN A;  1AEP A;  3AGT A;  4JUR I;  1EA8 A;  2KSF A;  3IEE A;  3RQF A;  3U2M A;  2HS5 A;  1FFT C;  1ORS C;  4WAB A;  1T6I A;  2HFI A;  1MMA A;  3GOR A;  3SXK A;  1T01 A;  4C7O A;  2VCC A;  2IXO A;  3EGD B;  2ETS A;  3ZDL A;  4M63 A;  1BZ4 A;  2EIN C;  3HNL A;  4E0H A;  2W4B A;  1ST6 A;  3US6 A;  3GEI A;  5L0F A;  2NPU A;  1A7D A;  2DGJ A;  4IWB A;  4LDR A;  4AK9 A;  5L0C A;  1FTS A;  3ECS A;  4C7O B;  2Y3B A;  2W9Y A;  4LLE A;  4EIY A;  1JOG A;  2A1D D;  2RD9 A;  3I5Q A;  5FZT A;  2IXM A;  1M2V A;  3JRM O;  4JTD B;  2PBE A;  2TMV P;  4C3B A;  3B0V C;  4XTK A;  1ZZP A;  2IXN A;  5L0H A;  3C8G A;  3FAJ A;  1NBB A;  3O55 A;  1TKN A;  2AP3 A;  2KW3 C;  3L8I A;  4JW1 A;  2D4U A;  4H54 A;  4MVZ A;  3DZA A;  1Q0F A;  3JSE O;  4BJ6 A;  2KGO A;  2X0C A;  2YLG A;  1G4W R;  2AVK A;  3RW0 A;  1D1B A;  3C8G D;  2QE9 A;  3GEH A;  3GEE A;  3NDB B;  1LPE A;  4CS7 A;  1LI7 A;  3EJN A;  2LP4 A;  3MYF A;  2RSE B;  4AE4 B;  1L3P A;  1TFO B;  2Q4F A;  3RFY A;  1BBH A;  2R7Q A;  3C18 A;  3MYI A;  3MBG A;  1D0Z A;  3DJU B;  4JTA B;  3EGX A;  3T6G B;  5B3S C;  3A9C A;  3G4Z A;  5DVW A;  3K66 A;  4MVM A;  3OWT A;  4CX9 A;  3IPM O;  1NU7 D;  2LK4 A;  3AG4 C;  1SF8 A;  3O10 A;  1BDJ B;  1PV3 A;  5D91 A;  4MVO A;  4RDA A;  2CYD A;  2CDQ A;  4A2N B;  2HUJ A;  2JPU A;  2OEX A;  5DQT A;  1E85 A;  1G4U S;  4OIR F;  4D4X A;  1TWA A;  4LAC B;  4GQH A;  2FAP B;  2OOC A;  3SXY A;  4KNW A;  1ZYR F;  5KYW B;  4CIH A;  1YAR O;  1TWC A;  2CNW A;  4IAO A;  2R7O A;  3NMI A;  2WL8 A;  2NUT B;  5JT4 A;  1LS4 A;  1NG1 A;  2ZD9 A;  1H7I A;  2QTV A;  3NMK A;  2L81 A;  3EZH A;  4LDQ A;  3RQE A;  4YN0 B;  3ZIB A;  4DJ9 A;  4JKV A;  3ABK C;  2NUP A;  2A6E F;  3K6B A;  256B A;  4XPY A;  2DB4 A;  4W8K A;  1Z6A A;  3FXH A;  4N6C A;  5EHH A;  3MX3 A;  1RKE B;  1I4Z A;  4XEF A;  3T6J A;  5AC5 A;  4JRZ A;  2X51 A;  1M57 C;  2I15 A;  5T3T A;  5KYU A;  2WVO A;  4NC3 A;  3CEX A;  3FVY A;  1HMO A;  3HLZ A;  4DXW A;  4RBN A;  4CBE A;  4I44 A;  4MW8 A;  3TJ6 A;  4DRH B;  4JJG A;  2XS8 A;  5B1A C;  2QNL A;  3EH1 A;  5KYX B;  3GWL A;  1OXB A;  1Q0K A;  3GWN A;  1OXK A;  1BR4 A;  5E33 A;  4DBR A;  3KH2 A;  3WOD F;  4EKW A;  2NUP B;  2XLH A;  4WGZ A;  3BRJ A;  4J7Y A;  1XWJ A;  2Q00 A;  3JCU Q;  1D0Y A;  4IAQ A;  2KYH A;  1EKY A;  1TFK B;  4EHP A;  3KL4 A;  4MW3 A;  3ASO C;  1LVK A;  2LCH A;  5DS4 A;  2LIG A;  5A6B A;  4U5D E;  2A0B A;  1V4A A;  4C3D A;  5K0I A;  1H9T A;  3K33 A;  1NU9 C;  4JIO A;  3DD7 A;  5BQI A;  1LKX A;  1VK5 A;  3V7O A;  2PP4 A;  4PFP A;  4BEJ A;  3W2V A;  5BUO A;  2ZPA A;  3CZ6 A;  1ORJ A;  2J8W A;  1V54 C;  1A7E A;  1HMD A;  1OW7 A;  4CIP A;  2H7V C;  1V74 B;  4Z9H A;  1WGW A;  3W8H A;  2XM0 A;  1OQC A;  3X2Q C;  4CS9 C;  5L0J A;  3PMR A;  4CDY A;  3DM5 A;  2R7W A;  5F5F A;  1SZI A;  1TWH A;  2P0N A;  4JEB A;  4GYT A;  4E7S A;  2G62 A;  2XL6 A;  5BQG A;  4QI2 A;  3EFO A;  3ZG1 A;  4DRI B;  1HY5 A;  2IM8 A;  3RVY A;  3FAP B;  5JSL A;  3GAN A;  1BR1 A;  4YL1 A;  2LSE A;  1Z3I X;  4BJ6 C;  1QZX A;  1VYK A;  4Q5S F;  1A0B A;  2AWC A;  1YA7 O;  1R4T A;  1MMN A;  2P1A A;  4PJJ A;  3QZC A;  2LQG A;  2L6F A;  1E83 A;  2HKV A;  2Q9C A;  4MTG A;  4YK5 A;  4PJM A;  2A0U A;  1S7Z A;  3UMI A;  3JZ0 A;  1K04 A;  1OW6 A;  1QVX A;  2KJG A;  5L0I A;  4ULW A;  3MLG A;  2IBF A;  4I1M A;  4CS8 C;  5DS5 A;  3SEO A;  2KC3 A;  4ER9 A;  4OD5 A;  2DYR C;  3HJC A;  4U5H A;  2LFF A;  1OKK D;  1E84 A;  4J30 B;  5CI8 A;  3CQZ A;  4EBJ A;  5EK0 A;  1DOV A;  1LI5 A;  3K1I A;  4MS2 A;  4CDV A;  4PK4 A;  2R7S A;  2XLO A;  4ONS A;  3SXM A;  4JTC B;  4NTF A;  1JMW A;  3AG1 C;  3ZQV A;  3EPV A;  5COF A;  2XLE A;  1CPQ A;  3WHN A;  1NLX A;  1TQG A;  5L0G A;  3FDQ A;  4XLP F;  2AU5 A;  1GS9 A;  3U3B A;  3F47 A;  3NYJ A;  2G3V A;  1M2O A;  3E9V A;  3R7C A;  2R9R B;  4A4A A;  5F5H A;  3B29 A;  3EG9 B;  4Q4Z F;  1UFB A;  2A69 F;  1HE1 A;  2YRF A;  5CIV A;  4X0R A;  1SR2 A;  4R32 A;  5HSW A;  3S9O A;  2LD6 A;  4OIO F;  4LLC A;  2VH3 A;  2YQY A;  4BEM J;  4J32 B;  3RH3 A;  3QTH A;  1W2W A;  1D0X A;  2H7B A;  2PX3 A;  4IB4 A;  4BPM A;  2DI3 A;  3JYY A;  1HW1 A;  3T9O A;  4OIQ F;  4CS8 A;  2BC5 A;  2EIJ C;  4O6Y A;  5AC4 A;  4XQ1 A;  2HMZ A;  2ZXP A;  3M1C B;  2WZL A;  1LIH A;  4YT8 A;  4G7H F;  3VYW A;  5B1B C;  4IRU A;  1O3U A;  2J7P A;  4YT2 A;  2VCB A;  3LJB A;  4U5C E;  3CSK A;  2C03 A;  3C8Z A;  3NKD A;  2ICW G;  4CJG A;  4L6R A;  1M6T A;  2XM4 A;  4C3E A;  3WAQ A;  3ZWI A;  4PJN A;  3TD7 A;  4YL0 A;  2HSQ A;  2M4E A;  5DS6 A;  2YLD A;  3ZVR A;  3UNG C;  4HFF B;  2QY9 A;  1YLM A;  3Q6N A;  1APC A;  3TK0 A;  5KYX A;  3M15 A;  5JP7 A;  1H9G A;  2L9J A;  1ZU4 A;  2W45 A;  1K40 A;  4NY3 A;  4AE4 A;  1SYQ A;  3N0T A;  2JD3 A;  3TOL A;  1G5Z A;  2R03 A;  3U5S A;  2BE5 F;  3U8V A;  1Z63 A;  2GWW A;  1FMW A;  1JPN A;  4NQF A;  3LS1 A;  5COG A;  1L7C A;  3C8G B;  4I3M A;  2HSB A;  1T9K A;  4XEV A;  1NSG B;  4W8P A;  1S05 A;  4O79 A;  1DOW A;  3NMJ A;  4XWJ A;  2H8A A;  1U89 A;  1RCP A;  2O9X A;  4BJ5 C;  2EPN A;  3J06 A;  4IGG A;  2WZF A;  2J9U A;  1QKR A;  2Y69 C;  5DQZ A;  3M4C A;  1GGQ A;  3M4B A;  3A11 A;  2MYS A;  2IYL D;  3F46 A;  3HTK C;  4HEA J;  4K7B A;  1OCC C;  1R5I D;  3SP1 A;  3M79 A;  3T4R A;  4DVY P;  4U9E A;  4MND A;  3BEH A;  4UDV A;  2H7O A;  1JAF A;  2AWY A;  1PCX A;  1ZHW A;  2YZS A;  2ZXR A;  3NRH A;  5L3Q A;  1VTM P;  4CDA A;  3EGD A;  3NG1 A;  4NCQ A;  5A6K A;  3UGO A;  4QDL A;  3EH2 A;  3IQT A;  1E2X A;  1LE2 A;  3H2U A;  3ABL C;  5T3W A;  2VC9 A;  3U9J A;  3QW0 A;  2VAS A;  1T5O A;  4N06 A;  1WTY A;  2R7U A;  1ZVZ A;  4O6M A;  1LM3 B;  2CCY A;  3JSZ A;  2ZXO A;  3QW1 A;  1KTM A;  1MMD A;  1K05 A;  2PFD A;  4I1O B;  4K0D A;  4PR9 A;  1RKE A;  1YJG A;  1ZHX A;  3PDM P;  1FAP B;  2KQ9 A;  2F22 A;  5JVE A;  3L1M A;  4PJL A;  1FNT c;  3GM3 A;  4N4W A;  3DE8 A;  4FWV A;  3SZR A;  4AL0 A;  5DLJ A;  1FMV A;  3K1I C;  3N2Z B;  1OW8 A;  1JR8 A;  2EPK X;  3ASN C;  4EUK B;  2NUT A;  5L0D A;  2G3K A;  1VLT A;  4ANJ A;  4O7G A;  1RMV A;  4J7T A;  4YT4 A;  1A7V A;  1N1C A;  4KC9 A;  2J9W A;  4KBL A;  2Q9A A;  3S0X A;  3C7J A;  2YHS A;  1HW2 A;  1XZQ A;  2KNH A;  3HNI A;  4JE9 A;  2HV6 A;  1VYI A;  5E2Q A;  4JEA A;  1YYX A;  5JS5 A;  1CPR A;  3LLK A;  1M2V B;  1ORY A;  4MVS A;  1OCR C;  2HV7 A;  4Z9I A;  1KU2 A;  1F1M A;  3ZC4 A;  1Q0M A;  2CW0 F;  2XLM A;  3JT1 A;  4U5F E;  5KYN A;  3DWW A;  3NYM A;  5JLI A;  2J0W A;  4YT5 A;  3EHM A;  1C03 A;  2J7P D;  4NTB A;  4P9F A;  1C02 A;  2Y3H A;  2OCC C;  2GA0 A;  3QVZ A;  2I8B A;  1VLS A;  2WB7 A;  1FR0 A;  3EHN A;  2OG2 A;  2XS1 A;  3HNJ A;  4XPX A;  2EPL X;  1AVO B;  2WZG A;  1BR2 A;  4OIN F;  3SXZ A;  2IOQ A;  3ZQY A;  3DJN B;  3ZTM A;  3UGP A;  1CGO A;  2P61 A;  4JJF A;  4CSA C;  3HNK A;  2HJM A;  4BJT A;  1TWG A;  5E3A A;  3LEV A;  2NSF A;  4FAP B;  5AGF A;  3TUL A;  3UMK A;  1LS1 A;  2YL0 A;  3H65 A;  3S29 A;  1WN0 A;  2Q9B A;  2R05 A;  2NG1 A;  1OCZ C;  3B71 A;  4P9T A;  1AUE A;  5E3C A;  2HJ3 A;  4DBQ A;  4YWQ A;  1E86 A;  2HZ8 A;  1ZHZ A;  2E87 A;  2GAQ A;  4JZA A;  1NFN A;  1VOM A;  3U2L A;  1OKK A;  4Q7C A;  1YZC A;  3RF3 A;  2XL8 A;  3B0P A;  4JCH A;  3PHF 2;  2A6H F;  3V5Y A;  1O87 A;  2XXA B;  5EGY A;  3LLI A;  1MND A;  5GPG B;  2W4M A;  3RYL A;  5A69 A;  1ZHT A;  2EPO A;  3LS0 A;  2JX0 A;  5CI9 A;  4G7Z F;  1ZW3 A;  4PAC A;  3QVY A;  1A41 A;  5KYW A;  5KYY B;  4CS9 A;  1GQA A;  1C17 M;  4KNV A;  3K7D A;  3POV A;  1I5N A;  4XEK A;  3CAX A;  4MVU A;  3S90 A;  2C04 A;  3IHU A;  1G8X A;  4E18 A;  1B68 A;  2PX0 A;  2MHR A;  1RJ9 B;  3AQB A;  3I5P A;  3H2V A;  3JTL O;  5BQH A;  4HE8 D;  3O6X A;  2XL4 A;  3LUT B;  3RKO F;  3EG9 A;  5T1D B;  2PNO A;  2P7V A;  1QLE C;  3AG3 C;  2Y3D A;  2EIM C;  3U3F A;  1EQ1 A;  3VAY A;  1ZW2 A;  1YZA A;  3DMD A;  2L6H A;  4G7O F;  2VB6 A;  3I4U A;  2XRH A;  2CGE A;  3LEO A;  1O5H A;  4P6I C;  3N24 A;  2OEV A;  2R25 A;  1PD1 A;  3JRT A;  4IJJ A;  1YA9 A;  4U5E E;  3VRC A;  3IQC A;  1Z5Z A;  3RQG A;  4BJ1 A;  4CSA A;  3E70 C;  3GOD A;  5COM A;  5TJ5 E;  3LES A;  1UG7 A;  4BJ5 A;  2Q7R A;  1M56 C;  4BG0 A;  4MVR A;  1U6H A;  4ZLD A;  5A6B D;  1D1A A;  3V5X A;  3DE9 A;  3DM9 B;  2IXP A;  2ASR A;  2UUH A;  3LAY A;  3O39 A;  1MQV A;  1LE4 A;  2YL7 A;  4NTA A;  4PFO A;  3IQ5 A;  3UR3 C;  1Q0D A;  2J0X A;  1WAS A;  1ZHY A;  2XLW A;  4H4K C;  4EWC A;  2EIK C;  3G4X A;  2B0H A;  1SMY F;  2YKZ A;  3G50 A;  1WOL A;  2M64 A;  3PCV A;  1IZM A;  4EBK A;  2WVQ A;  3KMI A;  3GM2 A;  3DI5 A;  1HE9 A;  3K1H A;  3AOU A;  2A68 F;  3OA1 A;  2B0J A;  2QUP A;  4JVS A;  3W4Y A;  1GM5 A;  2XLD A;  4KI2 A;  2HMQ A;  3EZI A;  1V55 C;  3ATP A;  3Q6M A;  3V5Z A;  4CJO A;  1JPJ A;  2ZXW C;  4OD4 A;  3JYH A;  2FGY A;  4E7Z A;  5KYU B;  4ZLC A;  2GFH A;  3AQC A;  1D1C A;  3L0I A;  2R7T A;  3AG2 C;  4Z9J A;  4QI0 A;  3KPH A;  1KNY A;  3EQL F;  2LFD A;  3B9Q A;  3S28 A;  4YJW A;  1Y6D A;  4U5G A;  3W8I A;  3C62 A;  5FCL A;  4DOZ A;  2YWA A;  3ABM C;  3S84 A;  2XLV A;  3NYL A;  1WAT A;  1YYJ A;  2PF4 E;  2GDC A;  1NZE A;  3VM6 A;  4DRJ B;  5L3V A;  4AL1 A;  2Y3G A;  3FMS A;  1JRA A;  2L7A A;  2UUI A;  4LER A;  1RKC A;  4ULV A;  5A6A A;  2CNW D;  3AGU A;  3RVZ A;  2Y39 A;  3T6B A;  1TR2 A;  4IAR A;  4OIP F;  1Q0G A;  1CGM E;  3DAF A;  4D4N A;  4G0H A;  3KKB A;  1Y4C A;  1PD0 A;  3EFO B;  2QLA A;  1XZP A;  3NKE A;  2OU6 A;  2YVK A;  3KYJ A; 
#chains in the Genus database with same CATH homology
 4XPY A;  2AVK A;  3AGU A;  3WHN A;  1A7D A;  2AWY A;  3WAQ A;  1I4Y A;  3AGT A;  1HMO A;  2MHR A;  1I4Z A;  2HMQ A;  4XPX A;  4XPW A;  2AWC A;  4XQ1 A;  2HMZ A;  1A7E A;  1HMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...