2KQ9A

Solution structure of dnak suppressor protein from agrobacterium tumefaciens c58. northeast structural genomics consortium target att12/ontario center for structural proteomics target atc0888
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
112
structure length
112
Chain Sequence
LAGGKSMNVESYEKILRDRQRELYRRLHKIEADFEEPRNPDDEDRASERSNDEVLDELGQVGQDELRAIDAALARIASGTFGTCVKCGKRISEDRLKAVPYTPFCQECAAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DnaK suppressor protein
publication title Solution Structure of DnaK protein from Agrobacterium tumefaciens C58. Northeast Structural Genomics Consortium target AtT12/Ontario Center for Structural Proteomics Target atc0888
rcsb
source organism Agrobacterium tumefaciens str. c58
molecule tags Transcription
total genus 25
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2009-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01258 zf-dskA_traR Prokaryotic dksA/traR C4-type zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.910 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2kq9A00
2KGOA 2KQ9A 4IJJA
chains in the Genus database with same CATH superfamily
2A0UA 2RD9A 3T9OA 3N0TA 4BEMJ 3JTLO 256BA 3ASOC 2J45A 3NRHA 4C7OA 4U9EA 3W2VA 3DWWA 3MFNA 3SXMA 3EGXA 2WZGA 2YQYA 5D91A 5KYUA 5F5FA 2V26A 4NTAA 2IYLD 4A2NB 3LLKA 4JJFA 2A1DD 4NY3A 4PFPA 3HNLA 3KPHA 1TWGA 5COGA 2M4EA 4IAOA 4CDAA 2R7XA 1F1MA 3FHDA 3CQZA 2AWYA 4JE9A 4PJJA 3DZAA 3I5PA 2R02A 3LJBA 2Y3BA 1T01A 1JR8A 1TFOB 1V4AA 2HFIA 2J0XA 2J9UA 1ZHWA 2YL1A 4I44A 4K7BA 4O6MA 2LIGA 4M63A 4MVOA 1YYXA 3TJ5A 1VTMP 4QI0A 1SZIA 4H54A 4E7ZA 3R2PA 2Y39A 4JIOA 2AU5A 3SEOA 5B3IA 1J8YF 2P7VA 5E3CA 1LI5A 2IXMA 4PK4A 4CDYA 2PBEA 2PX3A 1LS4A 1MMDA 3LUTB 3O55A 4MTGA 4U5HA 2XLVA 3NYLA 3AG3C 2GDCA 2ZPAA 3HTKC 3RVYA 4DJ9A 3NDBB 4CSAA 2DB4A 2PP4A 3MYIA 5HV9A 2ZXPA 3A9CA 4J32B 4YL3A 4K1OA 2XL4A 2QTVA 1I4ZA 4PJLA 5FZTA 3PCVA 3IQCA 2XS1A 3QVYA 2L81A 3W8HA 5AC4A 3KMIA 4L6RA 2YLGA 1YVIA 2YRFA 4MVSA 4PFOA 1EQ1A 3EHMA 1E84A 2TMVP 1S05A 5L0FA 4I3MA 2NUTB 1M2OA 3TD7A 5L0JA 4ULVA 5A6AA 3RQEA 3U2MA 1NSGB 2KJGA 2QY9A 4MTOA 3RKOF 5JRAA 4IWBA 2UUHA 2C03A 3AGTA 2AVKA 3T6GB 2PF4E 1M2VB 3U8VA 5L0GA 1E85A 3H65A 4IRUA 5IY5C 1HE9A 5T3TA 2BC5A 2KGOA 1DOWA 2KNHA 3CAXA 2CCYA 1U0BB 1Q0MA 1RKCA 2NUPB 1YARO 3F46A 4J7TA 4E7SA 1Z5ZA 1D0YA 4K0DA 5KYXA 1CPRA 2R7VA 1ORJA 2QUPA 3JYHA 2XRHA 1T6QA 3HJCA 2WVNA 2W45A 4C3DA 1T9KA 2WZLA 3VAYA 3UGPA 1NZEA 2R7OA 1APCA 5CI9A 4JEAA 3L8JA 2GA0A 1LVKA 3DM9B 3GEEA 4Q5SF 3LS0A 4MQ9F 3T4RA 2VB6A 2LSEA 3I5QA 1C03A 2J7PD 4WGYA 1MQVA 4OIOF 1ZZPA 1R4TA 1G4WR 2AP3A 4IARA 1MNDA 4NTBA 1XZQA 2ICWG 3HNJA 1D1AA 2MYSA 4X0RA 3L1MA 1HMDA 4KC9A 4ER9A 3AOUA 4BJ5C 2EIKC 4FESA 3W8IA 3JCUQ 5L3VA 2EPLX 4XEVA 1OCCC 2OKUA 1JRAA 4NQFA 1H9TA 4LDRA 4CJGA 3FAPB 1PV3A 4CSAC 2WZFA 2PNOA 5TJ5E 3HNIA 4C7OB 2VC9A 4Z9HA 2Q7RA 2D5RB 1M2VA 5A69A 2XLOA 3ZSUA 3EGXB 3TQOA 4EBKA 5KYUB 2J8WA 4RDAA 1D1CA 2Q9AA 1FR0A 3S27A 4B6IA 1OR3A 3IQ6A 3MYFA 5DQTA 1JMWA 3AG2C 4BG0A 2NG1A 2CNWA 5EGYA 1YZAA 2ZD9A 5FCLA 1KU2A 4BJ5A 1G5ZA 2NSGA 4MTFA 1LS1A 1DOVA 3U8PA 2HKVA 3UNGC 5B1BC 2G3KA 4CIPA 4O7GA 3S90A 2R9RB 2OEVA 4ZLCA 4YT5A 4XLNF 2IM8A 4CS7A 4QI2A 4U5GA 1OXBA 3GM1A 3LLIA 4HEAJ 4XQ1A 4DOZA 2Q3TA 2CGEA 3EZHA 3PDMP 4R32A 3EQLF 3NYJA 2OCCC 2R03A 3ZC4A 4IGGA 1M6TA 3L0IA 3M15A 4XPXA 4AL1A 3JZ0A 4MW3A 3UMHA 4BJ6A 4G0HA 2O9XA 3UGOA 3B9QA 4KNWA 2V3CC 1AEPA 2HUJA 4MVUA 1B68A 1WOLA 2EINC 2LK4A 4YL0A 4YT4A 4GYTA 2IXNA 4IAQA 5L0IA 3G4ZA 3KYJA 2P0NA 4N4WA 1GGQA 4EKWA 2B0HA 3DAGA 1WN0A 4U5BE 2FFHA 4DBQA 3C18A 1TWHA 3RQGA 2KSFA 2OOCA 4KNVA 3ZG1A 1VYIA 4DVZA 2J9BA 1H9GA 2OG2A 2XLWA 5BUOA 5JSLA 5CI8A 1ST6A 3FOPA 3Q7GA 1L7CA 3LNMB 4FX5A 3R7CA 3KH2A 2QE9A 1GM5A 1CGME 2CW0F 1G4US 4JCHA 3ECSA 4JJGA 4O6YA 2FAPB 3O10A 1RCPA 1VLTA 1QZXA 3GORA 3SNHA 2IXOA 1YJGA 4WABA 3M4BA 4PJNA 3SXKA 2R7UA 2KYHA 2XLMA 4JURI 5COMA 3V5ZA 3NKDA 1FFTC 4OD5A 3AQBA 1WWPA 1WGWA 2XLEA 5KYXB 1A7EA 1K04A 1OKKA 1TKNA 2JX0A 1YAUO 2LFFA 3EH1A 4YJWA 4MW8A 3ZIBA 1LM3B 2YZSA 2L6HA 4JTDB 4P9TA 4C3EA 1JPJA 1MMNA 3GM2A 4LLCA 3SP1A 2OQMA 3J06A 1JAFA 2VASA 1YLMA 3CZ6A 5T3WA 4OIPF 3SYNA 2H7OA 2BE5F 1ZHTA 4YK5A 2VH3A 4W8KA 3UR3C 4DVYP 3DE8A 3IEEA 4OIRF 3RH3A 4FAPB 1FMWA 1OXKA 1I4YA 1FNTc 1A0BA 2KW3C 4U9DA 4G7OF 4BJ1A 3QW1A 1ZU4A 1OCRC 3U0CA 3VRCA 2HMQA 2QLAA 5B3SC 1NFOA 3EG9A 3RVZA 2IOQA 2R05A 3U5SA 4MS2A 4Z9IA 5L0HA 3N24A 1T5OA 1XWJA 3FMSA 3V5XA 1VB5A 3ZQYA 1GS9A 1SYQA 1NLXA 2WVOA 1VLSA 1ZHXA 2HV6A 1SMYF 4E0IA 1EA8A 4NC3A 2F22A 1JOGA 5E33A 4BJTA 4GEHA 2WB7A 4OINF 2EILC 3K66A 3B0PA 4O79A 2LCHA 1A7DA 1UFBA 4BEJA 4D4NA 4XTKA 1BZ4A 1M56C 1GQAA 4XEFA 2GFHA 4EHPA 4EUKB 5JVEA 2BL2A 4AX2A 3L34A 1RKEA 1BR4A 3HLZA 2VCAA 2J46A 1UG7A 4LDQA 1KNYA 3U9JA 4AE4B 2I15A 3DI5A 2G62A 1QPUA 4UDVA 1T6IA 1RJ9A 3LEVA 2KK1A 3EHNA 2R7QA 4ZLDA 1NFNA 3C62A 4G7HF 2R7TA 2Q9CA 1Z63A 2LP4A 2XM4A 4DXWA 1FAPB 4EBBA 2AWCA 3B0UX 3BRJA 2UUIA 4CS9C 3T6BA 3Q7LA 5CIVA 5JLIA 1SF8A 4N6HA 1LIHA 4G78A 3W2WA 2GAQA 3C8GA 2XXAA 2PX0A 1BR1A 2HJ3A 3GODA 3C8ZA 4U5CE 3ZDLA 4E17A 4W8PA 3G4XA 3ABMC 3G50A 5KYWA 2MWQA 1VK5A 3OEOA 1HW2A 3DJNB 3TJ6A 3GANA 5A6BA 2A0BA 3JYYA 3UMKA 4O6NA 2HSBA 4BJ6C 4AK9A 3AJMA 4HFFB 4DBRA 1RMVA 2L6FA 1O5HA 4XPWA 2CNWD 5T1DB 1J8MF 2D4UA 3L8IA 1QVXA 2KQ9A 1IW7F 5BQIA 3NMIA 4E18A 4NCQA 4C3BA 4CS8C 1D0ZA 4OIQF 3DMDA 4U5DE 4CS9A 1H7IA 4GQHA 4EWCA 3VM6A 1XZPA 1V74B 3S0XA 3DAFA 3RYLA 2Q00A 4MVQA 3DD7A 2XLHA 2JPUA 3TULA 3JT1A 4I1OB 1Z6AA 4AE4A 3B0VC 4PR9A 3CEXA 1LI7A 3K1IA 1G8XA 3K6BA 2L6GA 3H2VA 3QTHA 3RFYA 4RD9A 3QW0A 1TFKB 1V55C 3M1CB 3EZIA 4YWQA 4JTAB 2XS8A 3S9OA 3T6JA 1YYJA 3BEHA 3US6A 1MMGA 2VCBA 2EIMC 3N2ZB 3NMJA 5DQZA 4CS8A 5EK0A 1T6UA 4HFKB 5K0IA 1QSPA 4LDKA 1Q0FA 2NSFA 2A69F 2W4BA 2Z15A 4FWVA 3RIPA 1QLEC 2WVQA 4MVMA 4ANJA 3FDQA 3A11A 2YLDA 3AG4C 3EG9B 2B0JA 3LESA 2CYDA 2X0CA 3ITFA 1OQCA 3LAYA 2LD6A 3WODF 3LNRA 3V7OA 1Y4CA 1N1CA 1RXQA 1BBHA 2HS5A 4CIHA 1BDJB 2L7AA 2PFDA 3TOMA 1E2XA 2H8AA 1TWAA 2W4MA 2EPNA 3Q6NA 2MHRA 4AL0A 1S7ZA 3V5YA 4E0HA 4JW1A 1BR2A 1NG1A 2OJQA 1OKKD 2W9YA 3JSZA 1PD0A 2H7VC 5COFA 5E3AA 3OWTA 1R5ID 1OCZC 5KYNA 3S28A 1AVOB 1W2WA 3IQ5A 3AGUA 1Z3IX 2A6EF 4XWJA 4DRJB 2EPKX 1VMAA 3WAQA 2IBFA 3IHUA 3QMKA 3DM5A 1HW1A 2HV7A 1OCOC 1RKEB 2XM0A 5F28E 4KI2A 2ZXWC 3DKAA 4P9FA 2Y3DA 2EPOA 5E2QA 2LFDA 4XPYA 4JCZA 1K40A 1RJ9B 4OD4A 3POVA 3E70C 1HY5A 3U9MA 3E9VA 3M4CA 3NMKA 2ASRA 3JSEO 1QKRA 2WL8A 3M79A 4XEKA 2RSEB 5A6JA 3K33A 1LE2A 1OR2A 1I5NA 2R25A 3C8GB 1MNEA 1MMAA 3KYIA 2ZXRA 2XXAB 3VF0A 5JT4A 2HSQA 2OJED 2HZ8A 3K7DA 1D0XA 1EI7A 5L0CA 1LPEA 1A7VA 4DRHB 5KYWB 2YL0A 2Y3HA 3NKEA 1YA7O 4IB4A 5DS5A 3C7JA 3EJNA 4CX9A 3AG1C 5EHHA 1K05A 5KYYA 3ZTMA 2XLDA 5A6KA 2DGJA 2J9WA 4BPMA 1FMVA 3LS1A 1JPNA 3GWLA 4U5EE 2IXPA 3JRMO 3PHF2 2G3VA 2H7BA 2EPMX 1HE1A 3RW0A 3EGDA 3O39A 3FAJA 2OEXA 4IJJA 2YL3A 1YZCA 1LE4A 3I4UA 3O6XA 4NTFA 3U3BA 4H4KC 5F5HA 3EFOB 3CSKA 3SXZA 2I8BA 4ULWA 5L0DA 1YDIA 4J7YA 4A4AA 3ABLC 3HNKA 2YHSA 3FXHA 1H6GA 2J9VA 3FVYA 4I1MA 1Y6DA 3KL4A 2FGYA 3LEOA 1HMOA 3NG1A 4JZAA 2HMZA 2DI3A 4LERA 2R7RA 3SXYA 5DVWA 1CGNA 1Z23A 1WASA 2Y3GA 1C02A 1TQGA 3GM3A 4CBEA 3C8GD 4PJMA 2QNLA 1CPQA 2ZXOA 3B71A 5JS5A 1U6HA 2DYRC 1ORSC 2XSEA 3JRTA 1EKYA 3F47A 3W4YA 4CDVA 1LKXA 1ZHZA 4EIYA 5A6BD 1AUEA 2Q4FA 4Z9JA 5DS4A 1VYKA 3H2UA 3K1IC 5DLJA 1IZMA 2YL7A 3QZCA 3U3FA 4Q7CA 1E83A 3OA1A 4XLPF 1ZW3A 1NBBA 3ZTZA 4F4BA 2P1AA 3AQCA 4JRZA 4QDLA 2NPUA 2R7WA 1U89A 1ZYRF 2J7PA 3QVZA 4YT2A 2Y69C 3ZQVA 2ETSA 3RQFA 1TWCA 4LLEA 2CDQA 2XL8A 1WATA 3IQTA 2L9JA 3B29A 1O3UA 5GPGB 3IPMO 3S29A 2A6HF 1WTYA 3EFOA 3GEIA 3C63A 1D1BA 1FTSA 3ZWIA 1O87A 2NUTA 2P61A 1PCXA 1PD1A 4U5FE 2VCCA 4YN0B 1ZW2A 2YVKA 2LQGA 3DXJF 2Q9BA 2HJMA 5B1AC 3X2QC 4DRIB 3EH2A 3MLGA 1SR2A 2DYSC 2YEVA 4WGZA 2M64A 4JKVA 4RBNA 4YL1A 3NYMA 1M57C 3ABKC 3VYWA 4HE8D 5AC5A 3DE9A 1A41A 5DS6A 4KBLA 4Q4ZF 4D4XA 5JUAA 2R7SA 2JD3A 1VOMA 3MX3A 3ATPA 2NUPA 3MBGA 3ASNC 4MVRA 1Z7Qc 1OW6A 3GEHA 2A68F 2YLIA 1QQ3A 3DJUB 2J0WA 4J30B 4MNDA 1ORYA 2YKZA 1E86A 1NU9C 2X51A 3KKBA 3X1OA 3EPVA 3U2LA 2KC3A 1OW8A 1Q0GA 2P6VA 1ZU5A 4JTCB 5HSWA 4PACA 1FFHA 4JEBA 5JP7A 4N6CA 1OW7A 4MVZA 1KTMA 5AGFA 5D92A 4EBJA 1Q0DA 4WJ0A 2XL6A 1Q0KA 1C17M 5BQHA 3GWNA 3TK0A 4JVSA 2EIJC 2YWAA 4ONSA 4N06A 3ZVRA 1V54C 4CJOA 5BQGA 3TOLA 1YA9A 1L3PA 1ZHYA 3K1HA 1CGOA 4JC7A 3RF3A 3SZRA 3WHNA 5L3QA 5KYYB 3S84A 3UMIA 2GWWA 3WG7C 4YT8A 1NU7D 3FOOA 2C04A 1ZVZA 4G7ZF 2OU6A 1TR2A 2E87A 4P6IC 3EGDB 3HKKA 3Q6MA 4LACB 3PMRA
chains in the Genus database with same CATH topology
3N0TA 4C7OA 3NRHA 3ASOC 2J45A 3W2VA 3EGXA 2WZGA 5D91A 5KYUA 5F5FA 2V26A 2IYLD 4A2NB 3LLKA 4JJFA 2A1DD 4NY3A 4PFPA 1TWGA 2M4EA 4IAOA 2R7XA 3FHDA 3CQZA 4PJJA 3DZAA 3I5PA 3LJBA 2Y3BA 2R7UA 2J0XA 2J9UA 4I44A 4O6MA 1ZHWA 4K7BA 4M63A 4QI0A 1SZIA 4E7ZA 2Y39A 3SEOA 1J8YF 2P7VA 5E3CA 2IXMA 4PK4A 2PX3A 1MMDA 4U5HA 3NYLA 3AG3C 3HTKC 2ZPAA 3NDBB 2PP4A 2ZXPA 4J32B 2XL4A 2QTVA 4PJLA 2L81A 3W8HA 3KMIA 4PFOA 3EHMA 4I3MA 2NUTB 1M2OA 3TD7A 2KJGA 2QY9A 3RKOF 4IWBA 2C03A 2PF4E 1M2VB 3H65A 4IRUA 5IY5C 5T3TA 2KGOA 2KNHA 2NUPB 3F46A 4E7SA 1Z5ZA 1D0YA 4K0DA 5KYXA 2R7VA 3JYHA 2XRHA 3HJCA 2WVNA 2W45A 4C3DA 2WZLA 3VAYA 3UGPA 1NZEA 2R7OA 5CI9A 1LVKA 3DM9B 4Q5SF 3LS0A 4MQ9F 3T4RA 2VB6A 2LSEA 3I5QA 2J7PD 4OIOF 1MNDA 1D1AA 2MYSA 4X0RA 4KC9A 4BJ5C 2EIKC 4FESA 3W8IA 3JCUQ 5L3VA 1OCCC 4CSAC 2WZFA 4C7OB 2D5RB 1M2VA 3ZSUA 3EGXB 5KYUB 4RDAA 1D1CA 2Q9AA 3S27A 4B6IA 5DQTA 3AG2C 4BG0A 2NG1A 2CNWA 5EGYA 5FCLA 1KU2A 4BJ5A 1LS1A 3UNGC 5B1BC 2G3KA 4O7GA 4ZLCA 4YT5A 4XLNF 4QI2A 4CS7A 4U5GA 4HEAJ 3LLIA 4CSAA 4DOZA 2Q3TA 2CGEA 3EZHA 3EQLF 3NYJA 2OCCC 3ZC4A 3L0IA 4BJ6A 3UGOA 3UMHA 4G0HA 2O9XA 3B9QA 4KNWA 2V3CC 2EINC 4YT4A 4GYTA 2IXNA 3DAGA 4U5BE 2FFHA 4DBQA 1TWHA 3ZG1A 4KNVA 1VYIA 4DVZA 5BUOA 2OG2A 5CI8A 1ST6A 3Q7GA 4FX5A 3KH2A 2CW0F 4JCHA 3ECSA 4JJGA 4O6YA 1QZXA 3SNHA 2IXOA 4PJNA 4JURI 3NKDA 1FFTC 4OD5A 3AQBA 1WGWA 5KYXB 1OKKA 1TKNA 4YJWA 3ZIBA 3EH1A 2YZSA 4C3EA 1JPJA 1MMNA 4LLCA 3SP1A 2VASA 3CZ6A 5T3WA 4OIPF 3SYNA 2H7OA 2BE5F 1ZHTA 2VH3A 4W8KA 3UR3C 4DVYP 3IEEA 4OIRF 3RH3A 1FMWA 2KW3C 4G7OF 4BJ1A 1ZU4A 1OCRC 5B3SC 3EG9A 2IOQA 3N24A 2WVOA 1ZHXA 2HV6A 1SMYF 5E33A 4BJTA 4GEHA 2WB7A 4OINF 2EILC 3K66A 3B0PA 4O79A 4BEJA 4XTKA 1M56C 2GFHA 4AX2A 3L34A 1BR4A 3HLZA 2J46A 4AE4B 2G62A 3LEVA 1RJ9A 3EHNA 2R7QA 4ZLDA 4G7HF 2R7TA 2Q9CA 1Z63A 4EBBA 3B0UX 4CS9C 3T6BA 3Q7LA 1SF8A 3W2WA 2XXAA 2PX0A 1BR1A 3GODA 4U5CE 5KYWA 3ABMC 2MWQA 1VK5A 3OEOA 3DJNB 3GANA 3UMKA 4O6NA 4BJ6C 4AK9A 4DBRA 4HFFB 1O5HA 2CNWD 5T1DB 1J8MF 2KQ9A 1IW7F 4C3BA 4CS8C 1D0ZA 4OIQF 3DMDA 4U5DE 4CS9A 4EWCA 3S0XA 3DAFA 3RYLA 3DD7A 3JT1A 4I1OB 1Z6AA 4AE4A 3B0VC 1G8XA 3K6BA 3RFYA 4RD9A 1V55C 3M1CB 3EZIA 4YWQA 3T6JA 1MMGA 3N2ZB 2EIMC 5DQZA 4CS8A 4HFKB 2Z15A 2A69F 2W4BA 4FWVA 3RIPA 1QLEC 2WVQA 3FDQA 4ANJA 3LESA 3AG4C 3EG9B 2B0JA 3ITFA 3WODF 3LAYA 3LNRA 3V7OA 1N1CA 4CIHA 2PFDA 1TWAA 2W4MA 3Q6NA 1S7ZA 4JW1A 1BR2A 1NG1A 1OKKD 2W9YA 3JSZA 1PD0A 2H7VC 5E3AA 3OWTA 1OCZC 5KYNA 3S28A 1W2WA 1Z3IX 2A6EF 4XWJA 1VMAA 3QMKA 3DM5A 4KI2A 2HV7A 1OCOC 2ZXWC 2Y3DA 5E2QA 1RJ9B 4OD4A 3POVA 3E70C 3E9VA 2WL8A 3K33A 2XXAB 1MNEA 1MMAA 2ZXRA 3K7DA 1D0XA 5KYWB 2Y3HA 3NKEA 5DS5A 3EJNA 3AG1C 5EHHA 5KYYA 2DGJA 2J9WA 1FMVA 3LS1A 1JPNA 4U5EE 2IXPA 3PHF2 2G3VA 2H7BA 3EGDA 3O39A 3FAJA 4IJJA 3O6XA 3I4UA 4H4KC 5F5HA 3EFOB 3CSKA 2I8BA 4ULWA 3ABLC 2YHSA 2J9VA 3FVYA 4I1MA 3KL4A 2FGYA 4JZAA 3NG1A 4LERA 2R7RA 5DVWA 1Z23A 2Y3GA 4CBEA 4PJMA 2ZXOA 2DYRC 2XSEA 3JRTA 3F47A 1LKXA 1ZHZA 5DS4A 1VYKA 3K1IC 5DLJA 1IZMA 3QZCA 4Q7CA 4XLPF 3OA1A 4F4BA 3AQCA 4QDLA 2R7WA 1ZYRF 2J7PA 4YT2A 2Y69C 1TWCA 4LLEA 2CDQA 3S29A 2L9JA 2A6HF 3EFOA 1D1BA 1FTSA 1O87A 2NUTA 1PCXA 1PD1A 4U5FE 4YN0B 3DXJF 2Q9BA 5B1AC 3X2QC 3EH2A 3MLGA 2DYSC 2YEVA 4RBNA 3NYMA 1M57C 3ABKC 3VYWA 4HE8D 5DS6A 4Q4ZF 4KBLA 2R7SA 2JD3A 1VOMA 3MX3A 2NUPA 3ASNC 2A68F 3DJUB 4J30B 2J0WA 4MNDA 1NU9C 2X51A 3KKBA 3X1OA 3EPVA 2P6VA 1ZU5A 5HSWA 1FFHA 5D92A 4WJ0A 4JVSA 2EIJC 3ZVRA 4N06A 1V54C 1ZHYA 3K1HA 5KYYB 5L3QA 3SZRA 3UMIA 4YT8A 3WG7C 1NU7D 2C04A 4G7ZF 1TR2A 2E87A 4P6IC 3EGDB 3Q6MA 4LACB 3PMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KGO A;  2KQ9 A;  4IJJ A; 
#chains in the Genus database with same CATH topology
 2A0U A;  2RD9 A;  3T9O A;  3N0T A;  4BEM J;  3JTL O;  256B A;  3ASO C;  2J45 A;  3NRH A;  4C7O A;  4U9E A;  3W2V A;  3DWW A;  3MFN A;  3SXM A;  3EGX A;  2WZG A;  2YQY A;  5D91 A;  5KYU A;  5F5F A;  2V26 A;  4NTA A;  2IYL D;  4A2N B;  3LLK A;  4JJF A;  2A1D D;  4NY3 A;  4PFP A;  3HNL A;  3KPH A;  1TWG A;  5COG A;  2M4E A;  4IAO A;  4CDA A;  2R7X A;  1F1M A;  3FHD A;  3CQZ A;  2AWY A;  4JE9 A;  4PJJ A;  3DZA A;  3I5P A;  2R02 A;  3LJB A;  2Y3B A;  1T01 A;  1JR8 A;  1TFO B;  1V4A A;  2HFI A;  2J0X A;  2J9U A;  1ZHW A;  2YL1 A;  4I44 A;  4K7B A;  4O6M A;  2LIG A;  4M63 A;  4MVO A;  1YYX A;  3TJ5 A;  1VTM P;  4QI0 A;  1SZI A;  4H54 A;  4E7Z A;  3R2P A;  2Y39 A;  4JIO A;  2AU5 A;  3SEO A;  5B3I A;  1J8Y F;  2P7V A;  5E3C A;  1LI5 A;  2IXM A;  4PK4 A;  4CDY A;  2PBE A;  2PX3 A;  1LS4 A;  1MMD A;  3LUT B;  3O55 A;  4MTG A;  4U5H A;  2XLV A;  3NYL A;  3AG3 C;  2GDC A;  2ZPA A;  3HTK C;  3RVY A;  4DJ9 A;  3NDB B;  4CSA A;  2DB4 A;  2PP4 A;  3MYI A;  5HV9 A;  2ZXP A;  3A9C A;  4J32 B;  4YL3 A;  4K1O A;  2XL4 A;  2QTV A;  1I4Z A;  4PJL A;  5FZT A;  3PCV A;  3IQC A;  2XS1 A;  3QVY A;  2L81 A;  3W8H A;  5AC4 A;  3KMI A;  4L6R A;  2YLG A;  1YVI A;  2YRF A;  4MVS A;  4PFO A;  1EQ1 A;  3EHM A;  1E84 A;  2TMV P;  1S05 A;  5L0F A;  4I3M A;  2NUT B;  1M2O A;  3TD7 A;  5L0J A;  4ULV A;  5A6A A;  3RQE A;  3U2M A;  1NSG B;  2KJG A;  2QY9 A;  4MTO A;  3RKO F;  5JRA A;  4IWB A;  2UUH A;  2C03 A;  3AGT A;  2AVK A;  3T6G B;  2PF4 E;  1M2V B;  3U8V A;  5L0G A;  1E85 A;  3H65 A;  4IRU A;  5IY5 C;  1HE9 A;  5T3T A;  2BC5 A;  2KGO A;  1DOW A;  2KNH A;  3CAX A;  2CCY A;  1U0B B;  1Q0M A;  1RKC A;  2NUP B;  1YAR O;  3F46 A;  4J7T A;  4E7S A;  1Z5Z A;  1D0Y A;  4K0D A;  5KYX A;  1CPR A;  2R7V A;  1ORJ A;  2QUP A;  3JYH A;  2XRH A;  1T6Q A;  3HJC A;  2WVN A;  2W45 A;  4C3D A;  1T9K A;  2WZL A;  3VAY A;  3UGP A;  1NZE A;  2R7O A;  1APC A;  5CI9 A;  4JEA A;  3L8J A;  2GA0 A;  1LVK A;  3DM9 B;  3GEE A;  4Q5S F;  3LS0 A;  4MQ9 F;  3T4R A;  2VB6 A;  2LSE A;  3I5Q A;  1C03 A;  2J7P D;  4WGY A;  1MQV A;  4OIO F;  1ZZP A;  1R4T A;  1G4W R;  2AP3 A;  4IAR A;  1MND A;  4NTB A;  1XZQ A;  2ICW G;  3HNJ A;  1D1A A;  2MYS A;  4X0R A;  3L1M A;  1HMD A;  4KC9 A;  4ER9 A;  3AOU A;  4BJ5 C;  2EIK C;  4FES A;  3W8I A;  3JCU Q;  5L3V A;  2EPL X;  4XEV A;  1OCC C;  2OKU A;  1JRA A;  4NQF A;  1H9T A;  4LDR A;  4CJG A;  3FAP B;  1PV3 A;  4CSA C;  2WZF A;  2PNO A;  5TJ5 E;  3HNI A;  4C7O B;  2VC9 A;  4Z9H A;  2Q7R A;  2D5R B;  1M2V A;  5A69 A;  2XLO A;  3ZSU A;  3EGX B;  3TQO A;  4EBK A;  5KYU B;  2J8W A;  4RDA A;  1D1C A;  2Q9A A;  1FR0 A;  3S27 A;  4B6I A;  1OR3 A;  3IQ6 A;  3MYF A;  5DQT A;  1JMW A;  3AG2 C;  4BG0 A;  2NG1 A;  2CNW A;  5EGY A;  1YZA A;  2ZD9 A;  5FCL A;  1KU2 A;  4BJ5 A;  1G5Z A;  2NSG A;  4MTF A;  1LS1 A;  1DOV A;  3U8P A;  2HKV A;  3UNG C;  5B1B C;  2G3K A;  4CIP A;  4O7G A;  3S90 A;  2R9R B;  2OEV A;  4ZLC A;  4YT5 A;  4XLN F;  2IM8 A;  4CS7 A;  4QI2 A;  4U5G A;  1OXB A;  3GM1 A;  3LLI A;  4HEA J;  4XQ1 A;  4DOZ A;  2Q3T A;  2CGE A;  3EZH A;  3PDM P;  4R32 A;  3EQL F;  3NYJ A;  2OCC C;  2R03 A;  3ZC4 A;  4IGG A;  1M6T A;  3L0I A;  3M15 A;  4XPX A;  4AL1 A;  3JZ0 A;  4MW3 A;  3UMH A;  4BJ6 A;  4G0H A;  2O9X A;  3UGO A;  3B9Q A;  4KNW A;  2V3C C;  1AEP A;  2HUJ A;  4MVU A;  1B68 A;  1WOL A;  2EIN C;  2LK4 A;  4YL0 A;  4YT4 A;  4GYT A;  2IXN A;  4IAQ A;  5L0I A;  3G4Z A;  3KYJ A;  2P0N A;  4N4W A;  1GGQ A;  4EKW A;  2B0H A;  3DAG A;  1WN0 A;  4U5B E;  2FFH A;  4DBQ A;  3C18 A;  1TWH A;  3RQG A;  2KSF A;  2OOC A;  4KNV A;  3ZG1 A;  1VYI A;  4DVZ A;  2J9B A;  1H9G A;  2OG2 A;  2XLW A;  5BUO A;  5JSL A;  5CI8 A;  1ST6 A;  3FOP A;  3Q7G A;  1L7C A;  3LNM B;  4FX5 A;  3R7C A;  3KH2 A;  2QE9 A;  1GM5 A;  1CGM E;  2CW0 F;  1G4U S;  4JCH A;  3ECS A;  4JJG A;  4O6Y A;  2FAP B;  3O10 A;  1RCP A;  1VLT A;  1QZX A;  3GOR A;  3SNH A;  2IXO A;  1YJG A;  4WAB A;  3M4B A;  4PJN A;  3SXK A;  2R7U A;  2KYH A;  2XLM A;  4JUR I;  5COM A;  3V5Z A;  3NKD A;  1FFT C;  4OD5 A;  3AQB A;  1WWP A;  1WGW A;  2XLE A;  5KYX B;  1A7E A;  1K04 A;  1OKK A;  1TKN A;  2JX0 A;  1YAU O;  2LFF A;  3EH1 A;  4YJW A;  4MW8 A;  3ZIB A;  1LM3 B;  2YZS A;  2L6H A;  4JTD B;  4P9T A;  4C3E A;  1JPJ A;  1MMN A;  3GM2 A;  4LLC A;  3SP1 A;  2OQM A;  3J06 A;  1JAF A;  2VAS A;  1YLM A;  3CZ6 A;  5T3W A;  4OIP F;  3SYN A;  2H7O A;  2BE5 F;  1ZHT A;  4YK5 A;  2VH3 A;  4W8K A;  3UR3 C;  4DVY P;  3DE8 A;  3IEE A;  4OIR F;  3RH3 A;  4FAP B;  1FMW A;  1OXK A;  1I4Y A;  1FNT c;  1A0B A;  2KW3 C;  4U9D A;  4G7O F;  4BJ1 A;  3QW1 A;  1ZU4 A;  1OCR C;  3U0C A;  3VRC A;  2HMQ A;  2QLA A;  5B3S C;  1NFO A;  3EG9 A;  3RVZ A;  2IOQ A;  2R05 A;  3U5S A;  4MS2 A;  4Z9I A;  5L0H A;  3N24 A;  1T5O A;  1XWJ A;  3FMS A;  3V5X A;  1VB5 A;  3ZQY A;  1GS9 A;  1SYQ A;  1NLX A;  2WVO A;  1VLS A;  1ZHX A;  2HV6 A;  1SMY F;  4E0I A;  1EA8 A;  4NC3 A;  2F22 A;  1JOG A;  5E33 A;  4BJT A;  4GEH A;  2WB7 A;  4OIN F;  2EIL C;  3K66 A;  3B0P A;  4O79 A;  2LCH A;  1A7D A;  1UFB A;  4BEJ A;  4D4N A;  4XTK A;  1BZ4 A;  1M56 C;  1GQA A;  4XEF A;  2GFH A;  4EHP A;  4EUK B;  5JVE A;  2BL2 A;  4AX2 A;  3L34 A;  1RKE A;  1BR4 A;  3HLZ A;  2VCA A;  2J46 A;  1UG7 A;  4LDQ A;  1KNY A;  3U9J A;  4AE4 B;  2I15 A;  3DI5 A;  2G62 A;  1QPU A;  4UDV A;  1T6I A;  1RJ9 A;  3LEV A;  2KK1 A;  3EHN A;  2R7Q A;  4ZLD A;  1NFN A;  3C62 A;  4G7H F;  2R7T A;  2Q9C A;  1Z63 A;  2LP4 A;  2XM4 A;  4DXW A;  1FAP B;  4EBB A;  2AWC A;  3B0U X;  3BRJ A;  2UUI A;  4CS9 C;  3T6B A;  3Q7L A;  5CIV A;  5JLI A;  1SF8 A;  4N6H A;  1LIH A;  4G78 A;  3W2W A;  2GAQ A;  3C8G A;  2XXA A;  2PX0 A;  1BR1 A;  2HJ3 A;  3GOD A;  3C8Z A;  4U5C E;  3ZDL A;  4E17 A;  4W8P A;  3G4X A;  3ABM C;  3G50 A;  5KYW A;  2MWQ A;  1VK5 A;  3OEO A;  1HW2 A;  3DJN B;  3TJ6 A;  3GAN A;  5A6B A;  2A0B A;  3JYY A;  3UMK A;  4O6N A;  2HSB A;  4BJ6 C;  4AK9 A;  3AJM A;  4HFF B;  4DBR A;  1RMV A;  2L6F A;  1O5H A;  4XPW A;  2CNW D;  5T1D B;  1J8M F;  2D4U A;  3L8I A;  1QVX A;  2KQ9 A;  1IW7 F;  5BQI A;  3NMI A;  4E18 A;  4NCQ A;  4C3B A;  4CS8 C;  1D0Z A;  4OIQ F;  3DMD A;  4U5D E;  4CS9 A;  1H7I A;  4GQH A;  4EWC A;  3VM6 A;  1XZP A;  1V74 B;  3S0X A;  3DAF A;  3RYL A;  2Q00 A;  4MVQ A;  3DD7 A;  2XLH A;  2JPU A;  3TUL A;  3JT1 A;  4I1O B;  1Z6A A;  4AE4 A;  3B0V C;  4PR9 A;  3CEX A;  1LI7 A;  3K1I A;  1G8X A;  3K6B A;  2L6G A;  3H2V A;  3QTH A;  3RFY A;  4RD9 A;  3QW0 A;  1TFK B;  1V55 C;  3M1C B;  3EZI A;  4YWQ A;  4JTA B;  2XS8 A;  3S9O A;  3T6J A;  1YYJ A;  3BEH A;  3US6 A;  1MMG A;  2VCB A;  2EIM C;  3N2Z B;  3NMJ A;  5DQZ A;  4CS8 A;  5EK0 A;  1T6U A;  4HFK B;  5K0I A;  1QSP A;  4LDK A;  1Q0F A;  2NSF A;  2A69 F;  2W4B A;  2Z15 A;  4FWV A;  3RIP A;  1QLE C;  2WVQ A;  4MVM A;  4ANJ A;  3FDQ A;  3A11 A;  2YLD A;  3AG4 C;  3EG9 B;  2B0J A;  3LES A;  2CYD A;  2X0C A;  3ITF A;  1OQC A;  3LAY A;  2LD6 A;  3WOD F;  3LNR A;  3V7O A;  1Y4C A;  1N1C A;  1RXQ A;  1BBH A;  2HS5 A;  4CIH A;  1BDJ B;  2L7A A;  2PFD A;  3TOM A;  1E2X A;  2H8A A;  1TWA A;  2W4M A;  2EPN A;  3Q6N A;  2MHR A;  4AL0 A;  1S7Z A;  3V5Y A;  4E0H A;  4JW1 A;  1BR2 A;  1NG1 A;  2OJQ A;  1OKK D;  2W9Y A;  3JSZ A;  1PD0 A;  2H7V C;  5COF A;  5E3A A;  3OWT A;  1R5I D;  1OCZ C;  5KYN A;  3S28 A;  1AVO B;  1W2W A;  3IQ5 A;  3AGU A;  1Z3I X;  2A6E F;  4XWJ A;  4DRJ B;  2EPK X;  1VMA A;  3WAQ A;  2IBF A;  3IHU A;  3QMK A;  3DM5 A;  1HW1 A;  2HV7 A;  1OCO C;  1RKE B;  2XM0 A;  5F28 E;  4KI2 A;  2ZXW C;  3DKA A;  4P9F A;  2Y3D A;  2EPO A;  5E2Q A;  2LFD A;  4XPY A;  4JCZ A;  1K40 A;  1RJ9 B;  4OD4 A;  3POV A;  3E70 C;  1HY5 A;  3U9M A;  3E9V A;  3M4C A;  3NMK A;  2ASR A;  3JSE O;  1QKR A;  2WL8 A;  3M79 A;  4XEK A;  2RSE B;  5A6J A;  3K33 A;  1LE2 A;  1OR2 A;  1I5N A;  2R25 A;  3C8G B;  1MNE A;  1MMA A;  3KYI A;  2ZXR A;  2XXA B;  3VF0 A;  5JT4 A;  2HSQ A;  2OJE D;  2HZ8 A;  3K7D A;  1D0X A;  1EI7 A;  5L0C A;  1LPE A;  1A7V A;  4DRH B;  5KYW B;  2YL0 A;  2Y3H A;  3NKE A;  1YA7 O;  4IB4 A;  5DS5 A;  3C7J A;  3EJN A;  4CX9 A;  3AG1 C;  5EHH A;  1K05 A;  5KYY A;  3ZTM A;  2XLD A;  5A6K A;  2DGJ A;  2J9W A;  4BPM A;  1FMV A;  3LS1 A;  1JPN A;  3GWL A;  4U5E E;  2IXP A;  3JRM O;  3PHF 2;  2G3V A;  2H7B A;  2EPM X;  1HE1 A;  3RW0 A;  3EGD A;  3O39 A;  3FAJ A;  2OEX A;  4IJJ A;  2YL3 A;  1YZC A;  1LE4 A;  3I4U A;  3O6X A;  4NTF A;  3U3B A;  4H4K C;  5F5H A;  3EFO B;  3CSK A;  3SXZ A;  2I8B A;  4ULW A;  5L0D A;  1YDI A;  4J7Y A;  4A4A A;  3ABL C;  3HNK A;  2YHS A;  3FXH A;  1H6G A;  2J9V A;  3FVY A;  4I1M A;  1Y6D A;  3KL4 A;  2FGY A;  3LEO A;  1HMO A;  3NG1 A;  4JZA A;  2HMZ A;  2DI3 A;  4LER A;  2R7R A;  3SXY A;  5DVW A;  1CGN A;  1Z23 A;  1WAS A;  2Y3G A;  1C02 A;  1TQG A;  3GM3 A;  4CBE A;  3C8G D;  4PJM A;  2QNL A;  1CPQ A;  2ZXO A;  3B71 A;  5JS5 A;  1U6H A;  2DYR C;  1ORS C;  2XSE A;  3JRT A;  1EKY A;  3F47 A;  3W4Y A;  4CDV A;  1LKX A;  1ZHZ A;  4EIY A;  5A6B D;  1AUE A;  2Q4F A;  4Z9J A;  5DS4 A;  1VYK A;  3H2U A;  3K1I C;  5DLJ A;  1IZM A;  2YL7 A;  3QZC A;  3U3F A;  4Q7C A;  1E83 A;  3OA1 A;  4XLP F;  1ZW3 A;  1NBB A;  3ZTZ A;  4F4B A;  2P1A A;  3AQC A;  4JRZ A;  4QDL A;  2NPU A;  2R7W A;  1U89 A;  1ZYR F;  2J7P A;  3QVZ A;  4YT2 A;  2Y69 C;  3ZQV A;  2ETS A;  3RQF A;  1TWC A;  4LLE A;  2CDQ A;  2XL8 A;  1WAT A;  3IQT A;  2L9J A;  3B29 A;  1O3U A;  5GPG B;  3IPM O;  3S29 A;  2A6H F;  1WTY A;  3EFO A;  3GEI A;  3C63 A;  1D1B A;  1FTS A;  3ZWI A;  1O87 A;  2NUT A;  2P61 A;  1PCX A;  1PD1 A;  4U5F E;  2VCC A;  4YN0 B;  1ZW2 A;  2YVK A;  2LQG A;  3DXJ F;  2Q9B A;  2HJM A;  5B1A C;  3X2Q C;  4DRI B;  3EH2 A;  3MLG A;  1SR2 A;  2DYS C;  2YEV A;  4WGZ A;  2M64 A;  4JKV A;  4RBN A;  4YL1 A;  3NYM A;  1M57 C;  3ABK C;  3VYW A;  4HE8 D;  5AC5 A;  3DE9 A;  1A41 A;  5DS6 A;  4KBL A;  4Q4Z F;  4D4X A;  5JUA A;  2R7S A;  2JD3 A;  1VOM A;  3MX3 A;  3ATP A;  2NUP A;  3MBG A;  3ASN C;  4MVR A;  1Z7Q c;  1OW6 A;  3GEH A;  2A68 F;  2YLI A;  1QQ3 A;  3DJU B;  2J0W A;  4J30 B;  4MND A;  1ORY A;  2YKZ A;  1E86 A;  1NU9 C;  2X51 A;  3KKB A;  3X1O A;  3EPV A;  3U2L A;  2KC3 A;  1OW8 A;  1Q0G A;  2P6V A;  1ZU5 A;  4JTC B;  5HSW A;  4PAC A;  1FFH A;  4JEB A;  5JP7 A;  4N6C A;  1OW7 A;  4MVZ A;  1KTM A;  5AGF A;  5D92 A;  4EBJ A;  1Q0D A;  4WJ0 A;  2XL6 A;  1Q0K A;  1C17 M;  5BQH A;  3GWN A;  3TK0 A;  4JVS A;  2EIJ C;  2YWA A;  4ONS A;  4N06 A;  3ZVR A;  1V54 C;  4CJO A;  5BQG A;  3TOL A;  1YA9 A;  1L3P A;  1ZHY A;  3K1H A;  1CGO A;  4JC7 A;  3RF3 A;  3SZR A;  3WHN A;  5L3Q A;  5KYY B;  3S84 A;  3UMI A;  2GWW A;  3WG7 C;  4YT8 A;  1NU7 D;  3FOO A;  2C04 A;  1ZVZ A;  4G7Z F;  2OU6 A;  1TR2 A;  2E87 A;  4P6I C;  3EGD B;  3HKK A;  3Q6M A;  4LAC B;  3PMR A; 
#chains in the Genus database with same CATH homology
 3N0T A;  4C7O A;  3NRH A;  3ASO C;  2J45 A;  3W2V A;  3EGX A;  2WZG A;  5D91 A;  5KYU A;  5F5F A;  2V26 A;  2IYL D;  4A2N B;  3LLK A;  4JJF A;  2A1D D;  4NY3 A;  4PFP A;  1TWG A;  2M4E A;  4IAO A;  2R7X A;  3FHD A;  3CQZ A;  4PJJ A;  3DZA A;  3I5P A;  3LJB A;  2Y3B A;  2R7U A;  2J0X A;  2J9U A;  4I44 A;  4O6M A;  1ZHW A;  4K7B A;  4M63 A;  4QI0 A;  1SZI A;  4E7Z A;  2Y39 A;  3SEO A;  1J8Y F;  2P7V A;  5E3C A;  2IXM A;  4PK4 A;  2PX3 A;  1MMD A;  4U5H A;  3NYL A;  3AG3 C;  3HTK C;  2ZPA A;  3NDB B;  2PP4 A;  2ZXP A;  4J32 B;  2XL4 A;  2QTV A;  4PJL A;  2L81 A;  3W8H A;  3KMI A;  4PFO A;  3EHM A;  4I3M A;  2NUT B;  1M2O A;  3TD7 A;  2KJG A;  2QY9 A;  3RKO F;  4IWB A;  2C03 A;  2PF4 E;  1M2V B;  3H65 A;  4IRU A;  5IY5 C;  5T3T A;  2KGO A;  2KNH A;  2NUP B;  3F46 A;  4E7S A;  1Z5Z A;  1D0Y A;  4K0D A;  5KYX A;  2R7V A;  3JYH A;  2XRH A;  3HJC A;  2WVN A;  2W45 A;  4C3D A;  2WZL A;  3VAY A;  3UGP A;  1NZE A;  2R7O A;  5CI9 A;  1LVK A;  3DM9 B;  4Q5S F;  3LS0 A;  4MQ9 F;  3T4R A;  2VB6 A;  2LSE A;  3I5Q A;  2J7P D;  4OIO F;  1MND A;  1D1A A;  2MYS A;  4X0R A;  4KC9 A;  4BJ5 C;  2EIK C;  4FES A;  3W8I A;  3JCU Q;  5L3V A;  1OCC C;  4CSA C;  2WZF A;  4C7O B;  2D5R B;  1M2V A;  3ZSU A;  3EGX B;  5KYU B;  4RDA A;  1D1C A;  2Q9A A;  3S27 A;  4B6I A;  5DQT A;  3AG2 C;  4BG0 A;  2NG1 A;  2CNW A;  5EGY A;  5FCL A;  1KU2 A;  4BJ5 A;  1LS1 A;  3UNG C;  5B1B C;  2G3K A;  4O7G A;  4ZLC A;  4YT5 A;  4XLN F;  4QI2 A;  4CS7 A;  4U5G A;  4HEA J;  3LLI A;  4CSA A;  4DOZ A;  2Q3T A;  2CGE A;  3EZH A;  3EQL F;  3NYJ A;  2OCC C;  3ZC4 A;  3L0I A;  4BJ6 A;  3UGO A;  3UMH A;  4G0H A;  2O9X A;  3B9Q A;  4KNW A;  2V3C C;  2EIN C;  4YT4 A;  4GYT A;  2IXN A;  3DAG A;  4U5B E;  2FFH A;  4DBQ A;  1TWH A;  3ZG1 A;  4KNV A;  1VYI A;  4DVZ A;  5BUO A;  2OG2 A;  5CI8 A;  1ST6 A;  3Q7G A;  4FX5 A;  3KH2 A;  2CW0 F;  4JCH A;  3ECS A;  4JJG A;  4O6Y A;  1QZX A;  3SNH A;  2IXO A;  4PJN A;  4JUR I;  3NKD A;  1FFT C;  4OD5 A;  3AQB A;  1WGW A;  5KYX B;  1OKK A;  1TKN A;  4YJW A;  3ZIB A;  3EH1 A;  2YZS A;  4C3E A;  1JPJ A;  1MMN A;  4LLC A;  3SP1 A;  2VAS A;  3CZ6 A;  5T3W A;  4OIP F;  3SYN A;  2H7O A;  2BE5 F;  1ZHT A;  2VH3 A;  4W8K A;  3UR3 C;  4DVY P;  3IEE A;  4OIR F;  3RH3 A;  1FMW A;  2KW3 C;  4G7O F;  4BJ1 A;  1ZU4 A;  1OCR C;  5B3S C;  3EG9 A;  2IOQ A;  3N24 A;  2WVO A;  1ZHX A;  2HV6 A;  1SMY F;  5E33 A;  4BJT A;  4GEH A;  2WB7 A;  4OIN F;  2EIL C;  3K66 A;  3B0P A;  4O79 A;  4BEJ A;  4XTK A;  1M56 C;  2GFH A;  4AX2 A;  3L34 A;  1BR4 A;  3HLZ A;  2J46 A;  4AE4 B;  2G62 A;  3LEV A;  1RJ9 A;  3EHN A;  2R7Q A;  4ZLD A;  4G7H F;  2R7T A;  2Q9C A;  1Z63 A;  4EBB A;  3B0U X;  4CS9 C;  3T6B A;  3Q7L A;  1SF8 A;  3W2W A;  2XXA A;  2PX0 A;  1BR1 A;  3GOD A;  4U5C E;  5KYW A;  3ABM C;  2MWQ A;  1VK5 A;  3OEO A;  3DJN B;  3GAN A;  3UMK A;  4O6N A;  4BJ6 C;  4AK9 A;  4DBR A;  4HFF B;  1O5H A;  2CNW D;  5T1D B;  1J8M F;  2KQ9 A;  1IW7 F;  4C3B A;  4CS8 C;  1D0Z A;  4OIQ F;  3DMD A;  4U5D E;  4CS9 A;  4EWC A;  3S0X A;  3DAF A;  3RYL A;  3DD7 A;  3JT1 A;  4I1O B;  1Z6A A;  4AE4 A;  3B0V C;  1G8X A;  3K6B A;  3RFY A;  4RD9 A;  1V55 C;  3M1C B;  3EZI A;  4YWQ A;  3T6J A;  1MMG A;  3N2Z B;  2EIM C;  5DQZ A;  4CS8 A;  4HFK B;  2Z15 A;  2A69 F;  2W4B A;  4FWV A;  3RIP A;  1QLE C;  2WVQ A;  3FDQ A;  4ANJ A;  3LES A;  3AG4 C;  3EG9 B;  2B0J A;  3ITF A;  3WOD F;  3LAY A;  3LNR A;  3V7O A;  1N1C A;  4CIH A;  2PFD A;  1TWA A;  2W4M A;  3Q6N A;  1S7Z A;  4JW1 A;  1BR2 A;  1NG1 A;  1OKK D;  2W9Y A;  3JSZ A;  1PD0 A;  2H7V C;  5E3A A;  3OWT A;  1OCZ C;  5KYN A;  3S28 A;  1W2W A;  1Z3I X;  2A6E F;  4XWJ A;  1VMA A;  3QMK A;  3DM5 A;  4KI2 A;  2HV7 A;  1OCO C;  2ZXW C;  2Y3D A;  5E2Q A;  1RJ9 B;  4OD4 A;  3POV A;  3E70 C;  3E9V A;  2WL8 A;  3K33 A;  2XXA B;  1MNE A;  1MMA A;  2ZXR A;  3K7D A;  1D0X A;  5KYW B;  2Y3H A;  3NKE A;  5DS5 A;  3EJN A;  3AG1 C;  5EHH A;  5KYY A;  2DGJ A;  2J9W A;  1FMV A;  3LS1 A;  1JPN A;  4U5E E;  2IXP A;  3PHF 2;  2G3V A;  2H7B A;  3EGD A;  3O39 A;  3FAJ A;  4IJJ A;  3O6X A;  3I4U A;  4H4K C;  5F5H A;  3EFO B;  3CSK A;  2I8B A;  4ULW A;  3ABL C;  2YHS A;  2J9V A;  3FVY A;  4I1M A;  3KL4 A;  2FGY A;  4JZA A;  3NG1 A;  4LER A;  2R7R A;  5DVW A;  1Z23 A;  2Y3G A;  4CBE A;  4PJM A;  2ZXO A;  2DYR C;  2XSE A;  3JRT A;  3F47 A;  1LKX A;  1ZHZ A;  5DS4 A;  1VYK A;  3K1I C;  5DLJ A;  1IZM A;  3QZC A;  4Q7C A;  4XLP F;  3OA1 A;  4F4B A;  3AQC A;  4QDL A;  2R7W A;  1ZYR F;  2J7P A;  4YT2 A;  2Y69 C;  1TWC A;  4LLE A;  2CDQ A;  3S29 A;  2L9J A;  2A6H F;  3EFO A;  1D1B A;  1FTS A;  1O87 A;  2NUT A;  1PCX A;  1PD1 A;  4U5F E;  4YN0 B;  3DXJ F;  2Q9B A;  5B1A C;  3X2Q C;  3EH2 A;  3MLG A;  2DYS C;  2YEV A;  4RBN A;  3NYM A;  1M57 C;  3ABK C;  3VYW A;  4HE8 D;  5DS6 A;  4Q4Z F;  4KBL A;  2R7S A;  2JD3 A;  1VOM A;  3MX3 A;  2NUP A;  3ASN C;  2A68 F;  3DJU B;  4J30 B;  2J0W A;  4MND A;  1NU9 C;  2X51 A;  3KKB A;  3X1O A;  3EPV A;  2P6V A;  1ZU5 A;  5HSW A;  1FFH A;  5D92 A;  4WJ0 A;  4JVS A;  2EIJ C;  3ZVR A;  4N06 A;  1V54 C;  1ZHY A;  3K1H A;  5KYY B;  5L3Q A;  3SZR A;  3UMI A;  4YT8 A;  3WG7 C;  1NU7 D;  2C04 A;  4G7Z F;  1TR2 A;  2E87 A;  4P6I C;  3EGD B;  3Q6M A;  4LAC B;  3PMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...