2KQ9A

Solution structure of dnak suppressor protein from agrobacterium tumefaciens c58. northeast structural genomics consortium target att12/ontario center for structural proteomics target atc0888
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
112
structure length
112
Chain Sequence
LAGGKSMNVESYEKILRDRQRELYRRLHKIEADFEEPRNPDDEDRASERSNDEVLDELGQVGQDELRAIDAALARIASGTFGTCVKCGKRISEDRLKAVPYTPFCQECAAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DnaK suppressor protein
publication title Solution Structure of DnaK protein from Agrobacterium tumefaciens C58. Northeast Structural Genomics Consortium target AtT12/Ontario Center for Structural Proteomics Target atc0888
rcsb
source organism Agrobacterium tumefaciens str. c58
total genus 25
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2009-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01258 zf-dskA_traR Prokaryotic dksA/traR C4-type zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.910 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2kq9A00
4IJJA 2KGOA 2KQ9A
chains in the Genus database with same CATH superfamily
3C8ZA 3CSKA 3MFNA 1C02A 1Q0GA 2KGOA 4G0HA 4I1OB 4PJLA 4QDLA 3S84A 1K05A 1SF8A 2I8BA 2IOQA 3C8GD 3KYJA 4KBLA 2IXOA 2YLGA 3CEXA 4NC3A 4DBRA 3GORA 1NU9C 3DM9B 1R5ID 2KJGA 1QQ3A 1LPEA 2OOCA 2ETSA 3H2VA 4MVUA 3ZDLA 4AX2A 4YT5A 3GEHA 2KNHA 1VYIA 5E3AA 3UGOA 3EG9A 1RMVA 3WHNA 3W2VA 3IPMO 2A69F 1OXKA 1J8YF 3NRHA 3V5XA 1YZCA 1M57C 1ZVZA 256BA 1R4TA 5B3SC 1JPJA 3ABLC 3IQ5A 4MTOA 2XS8A 4CDVA 5A6BD 1ZW3A 3DZAA 4JJFA 3EQLF 2XLOA 1LI5A 3GM1A 1RKEA 3AGUA 5FZTA 1JR8A 2EIMC 4U5EE 3R7CA 1ZHTA 2CNWD 4OD4A 1JAFA 3RQGA 2Q9BA 5COFA 1Q0FA 3JZ0A 1ORYA 3RQFA 3ZQYA 4EWCA 3EH2A 4IAQA 1FNTc 3JYYA 3RF3A 1E84A 4PFOA 1I5NA 2LSEA 4U5CE 2Q3TA 4J7TA 2Q00A 2IXMA 3MLGA 1OW6A 2ICWG 2Y3DA 3K33A 3DJNB 2GWWA 2NSFA 2B0JA 1V54C 2EILC 3SXZA 1U6HA 1VLTA 4O6MA 4U5FE 4XPWA 4UDVA 2KW3C 2YEVA 3HLZA 4GYTA 3GEIA 2OJQA 1CPRA 3OEOA 3W2WA 3K1IC 3NYLA 1G4WR 3KL4A 3T9OA 3E70C 1D0YA 1U89A 4KNVA 2J9BA 3NDBB 1Y6DA 3OA1A 4JC7A 2XXAB 4I3MA 3HKKA 3S9OA 3SXYA 2CW0F 2H7BA 1EA8A 3E9VA 1J8MF 4EIYA 5KYXB 3LEVA 4BJ6A 1HW2A 2IXNA 4RD9A 4J32B 1CGME 1NFNA 4JCHA 4MVQA 1F1MA 1VYKA 3T6JA 3Q7LA 2NUTB 4JURI 4ONSA 3U9MA 4C3BA 4MVZA 1U0BB 3F46A 4PR9A 2XLHA 3JSZA 1WN0A 2L81A 4AE4B 3U2LA 4AK9A 3TK0A 4E7SA 1PD1A 2VB6A 4L6RA 2XLEA 2OQMA 4HFFB 4CS9C 3HTKC 1RJ9A 2A0BA 3VAYA 2J9UA 3WG7C 1H7IA 4P9FA 4WGZA 1YA7O 5GPGB 3RQEA 1JOGA 3KPHA 1MQVA 4XEKA 3V7OA 1GS9A 2XS1A 4C3EA 3BRJA 5F28E 5L0HA 3EFOB 2WVNA 1TFOB 1ZYRF 4DRIB 3X1OA 4IAOA 2DYSC 3DAFA 1LE4A 2UUHA 2HZ8A 4YN0B 2P7VA 1A7VA 4OIRF 2R05A 4KNWA 2A6EF 1MMAA 3V5ZA 4G7HF 2J0WA 1QPUA 1AUEA 2PP4A 2W4BA 3LEOA 3VF0A 2CCYA 2OU6A 4DVYP 4Q5SF 1V74B 3ZQVA 2XRHA 4MVRA 3AQBA 2TMVP 2J45A 3EZIA 3M15A 2Y69C 5E2QA 3N2ZB 3HJCA 2CGEA 3B0PA 2OCCC 5AC4A 2WZLA 4OINF 4FWVA 1S7ZA 3EH1A 3NMJA 4LLEA 3SP1A 1O87A 3QZCA 2LK4A 5L3VA 4PJJA 3GWLA 3JRTA 2KC3A 4HEAJ 2W9YA 3KKBA 2PNOA 4ER9A 3S27A 1RCPA 1KTMA 1OCZC 2G3VA 3HNKA 3JTLO 2GDCA 1IW7F 2A6HF 3KH2A 2Z15A 3DJUB 3AG3C 2NSGA 4NTBA 5COGA 4E17A 3SXMA 4A4AA 2ZXWC 4LDRA 4PJNA 3LNRA 2X0CA 3C63A 4C3DA 3W4YA 3FHDA 2XLVA 1BBHA 1LS1A 2F22A 3FOOA 1L7CA 3UR3C 5DQTA 1CGNA 4ULVA 1QSPA 2PF4E 3PDMP 3B9QA 3BEHA 1VB5A 4RBNA 4N06A 2NUPA 5D91A 4N6HA 3V5YA 5BQHA 1LKXA 2ZXOA 1K40A 1QKRA 2WVOA 4D4NA 1D1BA 1ST6A 5DLJA 4FAPB 4CS7A 5AGFA 2E87A 4CDYA 2HV6A 2R02A 3RFYA 1WOLA 3EGDA 2YL3A 3O39A 3ABKC 5KYYB 1G5ZA 4JKVA 3JRMO 5DS6A 3O6XA 3AOUA 3TOMA 3RVYA 5FCLA 1YDIA 2XM0A 1BR4A 2M64A 5T3WA 4JJGA 1ZHYA 3UNGC 4P6IC 2HMQA 4JIOA 4OD5A 2GAQA 1WASA 2P0NA 3HNJA 1Z23A 3NYJA 4AE4A 4DRJB 3C8GB 2LFDA 3F47A 5JLIA 1TR2A 1XZQA 4MQ9F 5T1DB 2R7UA 1BDJB 3LUTB 5B1AC 4HE8D 3L1MA 3RH3A 1QZXA 4WJ0A 4F4BA 4BJ5C 1TWAA 4N6CA 1I4ZA 2P1AA 3TJ5A 3DAGA 1GGQA 2VCAA 2BE5F 3QVYA 3LLKA 4W8KA 5DS5A 2C03A 3EZHA 3T4RA 2NPUA 1ZU5A 3SXKA 4J7YA 2PX3A 5A69A 4K7BA 2OKUA 1WATA 3I5PA 5E33A 2J0XA 4OIPF 3M1CB 5K0IA 5KYNA 3U5SA 3ASOC 5B1BC 1C03A 1UG7A 1OR3A 3UMIA 2QLAA 2QTVA 3U8VA 2BC5A 3AQCA 1OCCC 1WTYA 1OW7A 2ZD9A 1D1AA 3K1IA 3LJBA 4BEJA 5EHHA 1MNDA 2LD6A 3MBGA 2HS5A 2MYSA 3K7DA 2VCBA 2R7VA 3GM2A 3SZRA 5JSLA 2J8WA 3O10A 3TULA 2PX0A 4U9EA 1MNEA 1DOWA 4XLNF 3N0TA 2VH3A 1M2OA 3ZSUA 4U5DE 3C18A 3G4XA 1M6TA 4H4KC 3LNMB 2RD9A 2Q4FA 2PBEA 5T3TA 4YL0A 1OQCA 2LP4A 5KYXA 1AEPA 1D1CA 3N24A 2AWCA 2J9VA 5KYUA 2R03A 3C7JA 4XWJA 2EPMX 2HKVA 4YL1A 5JT4A 3T6GB 4CS8C 1YZAA 3LLIA 2KYHA 3DE9A 3M4CA 1OCOC 1FFHA 1I4YA 2KQ9A 2L7AA 1VLSA 4CS9A 3EGXB 5HV9A 5L0DA 1EKYA 4JEAA 3B0VC 4CSAC 2UUIA 4PK4A 1G8XA 3FOPA 5L0GA 4C7OB 1M2VB 2KSFA 3M4BA 4HFKB 2AU5A 2YL1A 2YVKA 3NYMA 3O55A 3JCUQ 2HV7A 2LIGA 3ECSA 4YL3A 3X2QC 3QMKA 1GQAA 1LS4A 2YLDA 1KU2A 4AL0A 4IWBA 1FAPB 2H8AA 3NMKA 3VRCA 3ZWIA 3UGPA 1QVXA 3HNLA 4QI2A 1YARO 2EIJC 2M4EA 5D92A 2JPUA 4Z9HA 3IQ6A 4Q7CA 2ZXPA 2YQYA 3FVYA 4LACB 4LLCA 2IXPA 5JRAA 4Q4ZF 4R32A 1HMDA 4YT8A 3U2MA 4CDAA 1VMAA 4XQ1A 4KC9A 1A41A 4NCQA 4U5BE 2Y3BA 4OIOF 1A7EA 3I5QA 4NY3A 3K6BA 4FX5A 3ASNC 3QW1A 4XTKA 1TKNA 4JE9A 4CIPA 4E0IA 2Y3HA 4G7ZF 4Z9JA 3DD7A 3LS1A 2XLMA 1KNYA 1Y4CA 5L3QA 5A6JA 1DOVA 1XWJA 1FR0A 2P6VA 1UFBA 1ZW2A 1NLXA 1T9KA 4YK5A 4EBJA 2EPLX 1HY5A 4O6NA 1APCA 1NBBA 3NKDA 5HSWA 4K1OA 4ZLDA 2OJED 2G62A 1O3UA 3Q7GA 2XXAA 3POVA 1WGWA 1A0BA 1ZHXA 2A0UA 3AG1C 3DE8A 3EG9B 2R25A 3FMSA 4W8PA 5CI9A 3SYNA 2V3CC 3UMHA 4MVMA 2XLDA 3RYLA 4EBBA 4O6YA 5L0JA 1T5OA 1TWGA 1CPQA 2IYLD 1D0ZA 3NMIA 5E3CA 3UMKA 2AVKA 2LQGA 2YKZA 4DXWA 3L8IA 3TJ6A 4EBKA 3L8JA 2HMZA 2EINC 3TD7A 1IZMA 4D4XA 4OIQF 3S90A 3JT1A 4GEHA 1NG1A 3AJMA 4I1MA 4X0RA 2R7TA 1V55C 1YLMA 4QI0A 4B6IA 2L9JA 4LDQA 4DJ9A 2WZGA 3M79A 1RKEB 2XM4A 1FMVA 4J30B 3B29A 4MVOA 4P9TA 3PMRA 2GFHA 2CYDA 2WB7A 4MS2A 2QY9A 1Q0DA 3CZ6A 3I4UA 1VOMA 2XL4A 3W8HA 3J06A 1H9TA 3VM6A 5BQIA 4IGGA 4EUKB 3EHNA 3US6A 3AG4C 3W8IA 5KYWA 2MWQA 3U0CA 3NG1A 4CIHA 3GEEA 4DBQA 2D5RB 3GWNA 4RDAA 2WL8A 2R7RA 1T6UA 3FAJA 3G4ZA 3PCVA 4BPMA 1E83A 1LVKA 4MVSA 1WWPA 3U8PA 4BJ5A 2Q9AA 1Z7Qc 4E18A 3IEEA 4YWQA 2L6HA 3MX3A 1OKKA 1YVIA 4LERA 3VYWA 2YRFA 1SR2A 4DRHB 4YT2A 4FESA 3ZTMA 3G50A 2YL7A 3ZC4A 3ZVRA 3ATPA 1FFTC 5A6AA 4ZLCA 1Q0MA 4JTDB 4BJTA 1E86A 1Z63A 1T01A 2X51A 5COMA 4EHPA 2OEVA 3GANA 2Q7RA 5JUAA 3MYIA 5AC5A 4MTGA 3CQZA 2Y39A 4XPXA 1OW8A 3RVZA 4I44A 4G7OF 1ZHZA 5L0CA 1RXQA 3B71A 3LAYA 3DMDA 3AG2C 2DI3A 2HJMA 3DKAA 2IM8A 2XL8A 3S0XA 2ZPAA 1FTSA 1YYXA 3FXHA 1QLEC 4ULWA 2EPKX 3EPVA 4AL1A 2D4UA 2NG1A 1S05A 3HNIA 4LDKA 1E2XA 1ZZPA 3A11A 3SNHA 1RJ9B 3S28A 1Z6AA 2J7PA 5L0FA 3RW0A 5EK0A 2A68F 3PHF2 2R9RB 5BUOA 4YJWA 4JW1A 1H6GA 3ABMC 3Q6MA 2AP3A 2BL2A 2YLIA 2DB4A 3RIPA 1OR2A 1NZEA 2ASRA 2EPNA 3MYFA 4CS8A 3JYHA 2QUPA 4G78A 1H9GA 5KYYA 5DS4A 2EPOA 3DWWA 2QNLA 4K0DA 1TWHA 3IHUA 2O9XA 1BR2A 4U5HA 3A9CA 2AWYA 4CSAA 2WZFA 3K1HA 3DXJF 3L0IA 1HMOA 4JVSA 3C8GA 1K04A 4NQFA 3KMIA 4JEBA 1LIHA 3R2PA 1M56C 1MMGA 1T6IA 4CJOA 2JX0A 3Q6NA 4JTAB 4ANJA 4EKWA 3QW0A 3TOLA 2QE9A 4N4WA 4U5GA 1EQ1A 4JCZA 2R7QA 1LM3B 2XL6A 5DVWA 3RKOF 4IJJA 5F5FA 1LI7A 3GM3A 2B0HA 2FFHA 4BG0A 2YWAA 4KI2A 2ZXRA 1ORJA 3LS0A 1YYJA 4PFPA 2VC9A 4DVZA 1C17M 1Q0KA 1VK5A 4CJGA 5JS5A 4GQHA 2A1DD 4MTFA 3ZTZA 4CBEA 1PV3A 2OG2A 1SYQA 5IY5C 3CAXA 4BJ6C 1JPNA 2I15A 3IQTA 5A6BA 2MHRA 2R7SA 2HFIA 3K66A 2HUJA 2FAPB 2NUPB 1TFKB 1YJGA 2VASA 5BQGA 5TJ5E 4NTFA 1V4AA 3WODF 2GA0A 2V26A 1SMYF 2CNWA 3B0UX 2R7XA 1HE9A 1W2WA 3ZIBA 3TQOA 4E7ZA 1BR1A 1ZHWA 3NKEA 4WABA 1E85A 4JZAA 4XLPF 2JD3A 4NTAA 2IBFA 3EHMA 3U3FA 1TQGA 1TWCA 1HE1A 3DI5A 3EGDB 3U3BA 2J46A 5CIVA 3QTHA 1GM5A 1OKKD 1PD0A 4PACA 1MMNA 1T6QA 2R7WA 3ZG1A 1Z5ZA 1L3PA 1YAUO 2YZSA 3QVZA 4MNDA 3T6BA 3ITFA 4WGYA 4E0HA 1A7DA 5EGYA 1Z3IX 3JSEO 3LESA 2R7OA 1NU7D 1O5HA 1XZPA 5JP7A 2H7VC 4MW3A 2EIKC 2DGJA 3GODA 1JRAA 3C62A 4A2NB 3FAPB 4DOZA 5KYWB 1ORSC 5CI8A 4IARA 3SEOA 2C04A 3IQCA 3U9JA 4CX9A 1AVOB 3FDQA 1D0XA 1NFOA 1NSGB 2NUTA 1YA9A 1B68A 3EGXA 2PFDA 1CGOA 3WAQA 3OWTA 2LCHA 1JMWA 1ZU4A 1FMWA 2HSBA 1N1CA 1EI7A 4IB4A 4C7OA 4JRZA 2L6FA 2XLWA 5JVEA 1M2VA 1SZIA 3H65A 1MMDA 4YT4A 2G3KA 5F5HA 4BJ1A 3EJNA 4XPYA 5L0IA 1OXBA 2J7PD 3KYIA 4U9DA 2W45A 2VCCA 1LE2A 1VTMP 4IRUA 1PCXA 2Q9CA 3DM5A 3EFOA 4M63A 2KK1A 4XEVA 1BZ4A 4Z9IA 1G4US 3H2UA 2XSEA 4MW8A 1OCRC 4O79A 2DYRC 2LFFA 2OEXA 2YHSA 2H7OA 2HJ3A 2RSEB 2CDQA 2Y3GA 2HSQA 2YL0A 4JTCB 4O7GA 5B3IA 2FGYA 5A6KA 4PJMA 5KYUB 4H54A 4BEMJ 2L6GA 2J9WA 1HW1A 2P61A 1RKCA 3AGTA 3L34A 2W4MA 5DQZA 3S29A 4XEFA 2WVQA
chains in the Genus database with same CATH topology
3CSKA 4I1OB 2KGOA 4G0HA 4PJLA 4QDLA 2I8BA 1SF8A 2IOQA 4KBLA 4DBRA 2IXOA 1NU9C 3DM9B 2KJGA 5KYUB 4AX2A 4YT5A 2KNHA 1VYIA 5E3AA 3UGOA 3EG9A 3W2VA 2A69F 1J8YF 3NRHA 1M57C 5B3SC 1JPJA 3ABLC 3DZAA 4JJFA 3EQLF 2EIMC 4U5EE 1ZHTA 2CNWD 4OD4A 2Q9BA 4EWCA 3EH2A 4PFOA 2LSEA 4U5CE 2Q3TA 2IXMA 3MLGA 2Y3DA 3K33A 3DJNB 2B0JA 1V54C 2EILC 4O6MA 4U5FE 2KW3C 2YEVA 3HLZA 4GYTA 3OEOA 3W2WA 3K1IC 3NYLA 3KL4A 3E70C 1D0YA 3NDBB 4KNVA 3OA1A 2XXAB 4I3MA 2CW0F 2H7BA 3E9VA 5KYXB 1J8MF 3LEVA 4BJ6A 2IXNA 4RD9A 4J32B 4JCHA 1VYKA 3T6JA 3Q7LA 2NUTB 4JURI 4C3BA 3F46A 3JSZA 2L81A 4AK9A 4E7SA 1PD1A 2VB6A 4CS9C 4HFFB 3HTKC 1RJ9A 3VAYA 2J9UA 3WG7C 3V7OA 5KYWB 4C3EA 3EFOB 2WVNA 1ZYRF 3X1OA 4IAOA 2DYSC 3DAFA 4YN0B 2P7VA 4OIRF 4KNWA 2A6EF 1MMAA 4G7HF 2J0WA 2W4BA 2PP4A 4Q5SF 4DVYP 2XRHA 3AQBA 2J45A 3EZIA 2Y69C 5E2QA 3N2ZB 3HJCA 2CGEA 3B0PA 2OCCC 2WZLA 4OINF 4FWVA 1S7ZA 3EH1A 4LLEA 3SP1A 1O87A 3QZCA 5L3VA 4PJJA 3JRTA 4HEAJ 2W9YA 3KKBA 3S27A 1OCZC 2G3VA 1IW7F 2A6HF 3KH2A 2Z15A 3DJUB 3AG3C 2ZXWC 4PJNA 3LNRA 4C3DA 3FHDA 1LS1A 3UR3C 5DQTA 2PF4E 3B9QA 4RBNA 4N06A 2NUPA 5D91A 1LKXA 2ZXOA 2WVOA 1D1BA 1ST6A 5DLJA 4CS7A 2E87A 2HV6A 3RFYA 3EGDA 3O39A 3ABKC 5KYYB 5DS6A 3O6XA 5FCLA 1BR4A 5T3WA 4JJGA 1ZHYA 3UNGC 4P6IC 4OD5A 4AE4A 1Z23A 3NYJA 3F47A 1TR2A 4MQ9F 5T1DB 2R7UA 5B1AC 4HE8D 3RH3A 1QZXA 4WJ0A 4F4BA 4BJ5C 1TWAA 3DAGA 2BE5F 3LLKA 4W8KA 5DS5A 2C03A 3EZHA 3T4RA 1ZU5A 2PX3A 4K7BA 3I5PA 5E33A 2J0XA 4OIPF 3M1CB 5KYNA 3ASOC 5B1BC 3UMIA 2QTVA 3AQCA 1OCCC 5EHHA 1D1AA 3LJBA 4BEJA 1MNDA 2MYSA 3K7DA 2R7VA 3SZRA 2PX0A 1MNEA 4XLNF 3ZSUA 3N0TA 2VH3A 1M2OA 4U5DE 4H4KC 5T3TA 1D1CA 3N24A 2J9VA 5KYUA 4XWJA 4CS8C 3LLIA 1OCOC 1FFHA 2KQ9A 4CS9A 3EGXB 3B0VC 4CSAC 4PK4A 1G8XA 4C7OB 1M2VB 4HFKB 3NYMA 3JCUQ 2HV7A 3ECSA 3X2QC 3QMKA 1KU2A 4IWBA 4QI2A 3UGPA 2EIJC 5D92A 2M4EA 4Q7CA 2ZXPA 4LACB 3FVYA 4LLCA 2IXPA 4Q4ZF 4YT8A 1VMAA 4KC9A 4U5BE 2Y3BA 4OIOF 3I5QA 4NY3A 3K6BA 4FX5A 3ASNC 4XTKA 1TKNA 4G7ZF 2Y3HA 3DD7A 3LS1A 5L3QA 2P6VA 5HSWA 4ZLDA 4O6NA 3NKDA 2G62A 2XXAA 3Q7GA 3POVA 1WGWA 1ZHXA 4AE4B 5KYXA 3AG1C 5CI9A 3EG9B 3SYNA 2V3CC 3UMHA 3RYLA 4EBBA 4O6YA 1TWGA 5E3CA 3UMKA 2IYLD 1D0ZA 2EINC 3TD7A 1IZMA 4OIQF 3JT1A 4GEHA 1NG1A 4I1MA 4X0RA 2R7TA 1V55C 4QI0A 4B6IA 2L9JA 2WZGA 4J30B 1FMVA 3PMRA 2GFHA 2WB7A 3ZC4A 2QY9A 3CZ6A 3I4UA 3W8HA 1VOMA 2XL4A 3EHNA 3AG4C 3W8IA 5KYWA 2MWQA 3NG1A 4CIHA 4DBQA 2D5RB 4RDAA 2R7RA 2WL8A 3FAJA 1LVKA 4BJ5A 2Q9AA 4YWQA 3IEEA 3MX3A 1OKKA 4LERA 3VYWA 4YT2A 4FESA 3ZVRA 1FFTC 4ZLCA 4BJTA 2X51A 3GANA 3CQZA 2Y39A 4I44A 4G7OF 1ZHZA 3LAYA 3DMDA 3AG2C 3S0XA 2ZPAA 1FTSA 4ULWA 1QLEC 3EPVA 2NG1A 3SNHA 1RJ9B 3S28A 2J7PA 1Z6AA 2A68F 3PHF2 5BUOA 4YJWA 4JW1A 3ABMC 3Q6MA 3RIPA 1NZEA 4CS8A 3JYHA 5KYYA 5DS4A 4K0DA 1TWHA 2O9XA 1BR2A 4U5HA 4CSAA 2WZFA 3K1HA 3DXJF 3L0IA 4JVSA 3KMIA 1M56C 1MMGA 3Q6NA 4ANJA 4U5GA 2R7QA 5DVWA 3RKOF 5F5FA 4IJJA 4KI2A 2FFHA 4BG0A 2ZXRA 3LS0A 4PFPA 4DVZA 1VK5A 2A1DD 4CBEA 2OG2A 5IY5C 4BJ6C 1JPNA 2R7SA 3K66A 2NUPB 2VASA 3WODF 3B0UX 2R7XA 2V26A 1SMYF 2CNWA 1W2WA 3ZIBA 4E7ZA 1BR1A 1ZHWA 3NKEA 4XLPF 4JZAA 2JD3A 3EHMA 1TWCA 3EGDB 2J46A 1OKKD 1PD0A 1MMNA 2R7WA 3ZG1A 1Z5ZA 2YZSA 3T6BA 4MNDA 3ITFA 5EGYA 1Z3IX 3LESA 2R7OA 1NU7D 1O5HA 2H7VC 2EIKC 2DGJA 3GODA 4A2NB 4DOZA 5CI8A 3SEOA 2C04A 3FDQA 1D0XA 2NUTA 3EGXA 2PFDA 3OWTA 1ZU4A 1FMWA 1N1CA 4C7OA 1M2VA 1SZIA 3H65A 1MMDA 4YT4A 2G3KA 5F5HA 4BJ1A 3EJNA 2J7PD 2W45A 4IRUA 1PCXA 2Q9CA 3DM5A 3EFOA 4M63A 2XSEA 1OCRC 4O79A 2DYRC 2YHSA 2H7OA 2CDQA 2Y3GA 4O7GA 2FGYA 4PJMA 2J9WA 3L34A 1Z63A 2W4MA 5DQZA 3S29A 2WVQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJJ A;  2KGO A;  2KQ9 A; 
#chains in the Genus database with same CATH topology
 3C8Z A;  3CSK A;  3MFN A;  1C02 A;  1Q0G A;  2KGO A;  4G0H A;  4I1O B;  4PJL A;  4QDL A;  3S84 A;  1K05 A;  1SF8 A;  2I8B A;  2IOQ A;  3C8G D;  3KYJ A;  4KBL A;  2IXO A;  2YLG A;  3CEX A;  4NC3 A;  4DBR A;  3GOR A;  1NU9 C;  3DM9 B;  1R5I D;  2KJG A;  1QQ3 A;  1LPE A;  2OOC A;  2ETS A;  3H2V A;  4MVU A;  3ZDL A;  4AX2 A;  4YT5 A;  3GEH A;  2KNH A;  1VYI A;  5E3A A;  3UGO A;  3EG9 A;  1RMV A;  3WHN A;  3W2V A;  3IPM O;  2A69 F;  1OXK A;  1J8Y F;  3NRH A;  3V5X A;  1YZC A;  1M57 C;  1ZVZ A;  256B A;  1R4T A;  5B3S C;  1JPJ A;  3ABL C;  3IQ5 A;  4MTO A;  2XS8 A;  4CDV A;  5A6B D;  1ZW3 A;  3DZA A;  4JJF A;  3EQL F;  2XLO A;  1LI5 A;  3GM1 A;  1RKE A;  3AGU A;  5FZT A;  1JR8 A;  2EIM C;  4U5E E;  3R7C A;  1ZHT A;  2CNW D;  4OD4 A;  1JAF A;  3RQG A;  2Q9B A;  5COF A;  1Q0F A;  3JZ0 A;  1ORY A;  3RQF A;  3ZQY A;  4EWC A;  3EH2 A;  4IAQ A;  1FNT c;  3JYY A;  3RF3 A;  1E84 A;  4PFO A;  1I5N A;  2LSE A;  4U5C E;  2Q3T A;  4J7T A;  2Q00 A;  2IXM A;  3MLG A;  1OW6 A;  2ICW G;  2Y3D A;  3K33 A;  3DJN B;  2GWW A;  2NSF A;  2B0J A;  1V54 C;  2EIL C;  3SXZ A;  1U6H A;  1VLT A;  4O6M A;  4U5F E;  4XPW A;  4UDV A;  2KW3 C;  2YEV A;  3HLZ A;  4GYT A;  3GEI A;  2OJQ A;  1CPR A;  3OEO A;  3W2W A;  3K1I C;  3NYL A;  1G4W R;  3KL4 A;  3T9O A;  3E70 C;  1D0Y A;  1U89 A;  4KNV A;  2J9B A;  3NDB B;  1Y6D A;  3OA1 A;  4JC7 A;  2XXA B;  4I3M A;  3HKK A;  3S9O A;  3SXY A;  2CW0 F;  2H7B A;  1EA8 A;  3E9V A;  1J8M F;  4EIY A;  5KYX B;  3LEV A;  4BJ6 A;  1HW2 A;  2IXN A;  4RD9 A;  4J32 B;  1CGM E;  1NFN A;  4JCH A;  4MVQ A;  1F1M A;  1VYK A;  3T6J A;  3Q7L A;  2NUT B;  4JUR I;  4ONS A;  3U9M A;  4C3B A;  4MVZ A;  1U0B B;  3F46 A;  4PR9 A;  2XLH A;  3JSZ A;  1WN0 A;  2L81 A;  4AE4 B;  3U2L A;  4AK9 A;  3TK0 A;  4E7S A;  1PD1 A;  2VB6 A;  4L6R A;  2XLE A;  2OQM A;  4HFF B;  4CS9 C;  3HTK C;  1RJ9 A;  2A0B A;  3VAY A;  2J9U A;  3WG7 C;  1H7I A;  4P9F A;  4WGZ A;  1YA7 O;  5GPG B;  3RQE A;  1JOG A;  3KPH A;  1MQV A;  4XEK A;  3V7O A;  1GS9 A;  2XS1 A;  4C3E A;  3BRJ A;  5F28 E;  5L0H A;  3EFO B;  2WVN A;  1TFO B;  1ZYR F;  4DRI B;  3X1O A;  4IAO A;  2DYS C;  3DAF A;  1LE4 A;  2UUH A;  2HZ8 A;  4YN0 B;  2P7V A;  1A7V A;  4OIR F;  2R05 A;  4KNW A;  2A6E F;  1MMA A;  3V5Z A;  4G7H F;  2J0W A;  1QPU A;  1AUE A;  2PP4 A;  2W4B A;  3LEO A;  3VF0 A;  2CCY A;  2OU6 A;  4DVY P;  4Q5S F;  1V74 B;  3ZQV A;  2XRH A;  4MVR A;  3AQB A;  2TMV P;  2J45 A;  3EZI A;  3M15 A;  2Y69 C;  5E2Q A;  3N2Z B;  3HJC A;  2CGE A;  3B0P A;  2OCC C;  5AC4 A;  2WZL A;  4OIN F;  4FWV A;  1S7Z A;  3EH1 A;  3NMJ A;  4LLE A;  3SP1 A;  1O87 A;  3QZC A;  2LK4 A;  5L3V A;  4PJJ A;  3GWL A;  3JRT A;  2KC3 A;  4HEA J;  2W9Y A;  3KKB A;  2PNO A;  4ER9 A;  3S27 A;  1RCP A;  1KTM A;  1OCZ C;  2G3V A;  3HNK A;  3JTL O;  2GDC A;  1IW7 F;  2A6H F;  3KH2 A;  2Z15 A;  3DJU B;  3AG3 C;  2NSG A;  4NTB A;  5COG A;  4E17 A;  3SXM A;  4A4A A;  2ZXW C;  4LDR A;  4PJN A;  3LNR A;  2X0C A;  3C63 A;  4C3D A;  3W4Y A;  3FHD A;  2XLV A;  1BBH A;  1LS1 A;  2F22 A;  3FOO A;  1L7C A;  3UR3 C;  5DQT A;  1CGN A;  4ULV A;  1QSP A;  2PF4 E;  3PDM P;  3B9Q A;  3BEH A;  1VB5 A;  4RBN A;  4N06 A;  2NUP A;  5D91 A;  4N6H A;  3V5Y A;  5BQH A;  1LKX A;  2ZXO A;  1K40 A;  1QKR A;  2WVO A;  4D4N A;  1D1B A;  1ST6 A;  5DLJ A;  4FAP B;  4CS7 A;  5AGF A;  2E87 A;  4CDY A;  2HV6 A;  2R02 A;  3RFY A;  1WOL A;  3EGD A;  2YL3 A;  3O39 A;  3ABK C;  5KYY B;  1G5Z A;  4JKV A;  3JRM O;  5DS6 A;  3O6X A;  3AOU A;  3TOM A;  3RVY A;  5FCL A;  1YDI A;  2XM0 A;  1BR4 A;  2M64 A;  5T3W A;  4JJG A;  1ZHY A;  3UNG C;  4P6I C;  2HMQ A;  4JIO A;  4OD5 A;  2GAQ A;  1WAS A;  2P0N A;  3HNJ A;  1Z23 A;  3NYJ A;  4AE4 A;  4DRJ B;  3C8G B;  2LFD A;  3F47 A;  5JLI A;  1TR2 A;  1XZQ A;  4MQ9 F;  5T1D B;  2R7U A;  1BDJ B;  3LUT B;  5B1A C;  4HE8 D;  3L1M A;  3RH3 A;  1QZX A;  4WJ0 A;  4F4B A;  4BJ5 C;  1TWA A;  4N6C A;  1I4Z A;  2P1A A;  3TJ5 A;  3DAG A;  1GGQ A;  2VCA A;  2BE5 F;  3QVY A;  3LLK A;  4W8K A;  5DS5 A;  2C03 A;  3EZH A;  3T4R A;  2NPU A;  1ZU5 A;  3SXK A;  4J7Y A;  2PX3 A;  5A69 A;  4K7B A;  2OKU A;  1WAT A;  3I5P A;  5E33 A;  2J0X A;  4OIP F;  3M1C B;  5K0I A;  5KYN A;  3U5S A;  3ASO C;  5B1B C;  1C03 A;  1UG7 A;  1OR3 A;  3UMI A;  2QLA A;  2QTV A;  3U8V A;  2BC5 A;  3AQC A;  1OCC C;  1WTY A;  1OW7 A;  2ZD9 A;  1D1A A;  3K1I A;  3LJB A;  4BEJ A;  5EHH A;  1MND A;  2LD6 A;  3MBG A;  2HS5 A;  2MYS A;  3K7D A;  2VCB A;  2R7V A;  3GM2 A;  3SZR A;  5JSL A;  2J8W A;  3O10 A;  3TUL A;  2PX0 A;  4U9E A;  1MNE A;  1DOW A;  4XLN F;  3N0T A;  2VH3 A;  1M2O A;  3ZSU A;  4U5D E;  3C18 A;  3G4X A;  1M6T A;  4H4K C;  3LNM B;  2RD9 A;  2Q4F A;  2PBE A;  5T3T A;  4YL0 A;  1OQC A;  2LP4 A;  5KYX A;  1AEP A;  1D1C A;  3N24 A;  2AWC A;  2J9V A;  5KYU A;  2R03 A;  3C7J A;  4XWJ A;  2EPM X;  2HKV A;  4YL1 A;  5JT4 A;  3T6G B;  4CS8 C;  1YZA A;  3LLI A;  2KYH A;  3DE9 A;  3M4C A;  1OCO C;  1FFH A;  1I4Y A;  2KQ9 A;  2L7A A;  1VLS A;  4CS9 A;  3EGX B;  5HV9 A;  5L0D A;  1EKY A;  4JEA A;  3B0V C;  4CSA C;  2UUI A;  4PK4 A;  1G8X A;  3FOP A;  5L0G A;  4C7O B;  1M2V B;  2KSF A;  3M4B A;  4HFK B;  2AU5 A;  2YL1 A;  2YVK A;  3NYM A;  3O55 A;  3JCU Q;  2HV7 A;  2LIG A;  3ECS A;  4YL3 A;  3X2Q C;  3QMK A;  1GQA A;  1LS4 A;  2YLD A;  1KU2 A;  4AL0 A;  4IWB A;  1FAP B;  2H8A A;  3NMK A;  3VRC A;  3ZWI A;  3UGP A;  1QVX A;  3HNL A;  4QI2 A;  1YAR O;  2EIJ C;  2M4E A;  5D92 A;  2JPU A;  4Z9H A;  3IQ6 A;  4Q7C A;  2ZXP A;  2YQY A;  3FVY A;  4LAC B;  4LLC A;  2IXP A;  5JRA A;  4Q4Z F;  4R32 A;  1HMD A;  4YT8 A;  3U2M A;  4CDA A;  1VMA A;  4XQ1 A;  4KC9 A;  1A41 A;  4NCQ A;  4U5B E;  2Y3B A;  4OIO F;  1A7E A;  3I5Q A;  4NY3 A;  3K6B A;  4FX5 A;  3ASN C;  3QW1 A;  4XTK A;  1TKN A;  4JE9 A;  4CIP A;  4E0I A;  2Y3H A;  4G7Z F;  4Z9J A;  3DD7 A;  3LS1 A;  2XLM A;  1KNY A;  1Y4C A;  5L3Q A;  5A6J A;  1DOV A;  1XWJ A;  1FR0 A;  2P6V A;  1UFB A;  1ZW2 A;  1NLX A;  1T9K A;  4YK5 A;  4EBJ A;  2EPL X;  1HY5 A;  4O6N A;  1APC A;  1NBB A;  3NKD A;  5HSW A;  4K1O A;  4ZLD A;  2OJE D;  2G62 A;  1O3U A;  3Q7G A;  2XXA A;  3POV A;  1WGW A;  1A0B A;  1ZHX A;  2A0U A;  3AG1 C;  3DE8 A;  3EG9 B;  2R25 A;  3FMS A;  4W8P A;  5CI9 A;  3SYN A;  2V3C C;  3UMH A;  4MVM A;  2XLD A;  3RYL A;  4EBB A;  4O6Y A;  5L0J A;  1T5O A;  1TWG A;  1CPQ A;  2IYL D;  1D0Z A;  3NMI A;  5E3C A;  3UMK A;  2AVK A;  2LQG A;  2YKZ A;  4DXW A;  3L8I A;  3TJ6 A;  4EBK A;  3L8J A;  2HMZ A;  2EIN C;  3TD7 A;  1IZM A;  4D4X A;  4OIQ F;  3S90 A;  3JT1 A;  4GEH A;  1NG1 A;  3AJM A;  4I1M A;  4X0R A;  2R7T A;  1V55 C;  1YLM A;  4QI0 A;  4B6I A;  2L9J A;  4LDQ A;  4DJ9 A;  2WZG A;  3M79 A;  1RKE B;  2XM4 A;  1FMV A;  4J30 B;  3B29 A;  4MVO A;  4P9T A;  3PMR A;  2GFH A;  2CYD A;  2WB7 A;  4MS2 A;  2QY9 A;  1Q0D A;  3CZ6 A;  3I4U A;  1VOM A;  2XL4 A;  3W8H A;  3J06 A;  1H9T A;  3VM6 A;  5BQI A;  4IGG A;  4EUK B;  3EHN A;  3US6 A;  3AG4 C;  3W8I A;  5KYW A;  2MWQ A;  3U0C A;  3NG1 A;  4CIH A;  3GEE A;  4DBQ A;  2D5R B;  3GWN A;  4RDA A;  2WL8 A;  2R7R A;  1T6U A;  3FAJ A;  3G4Z A;  3PCV A;  4BPM A;  1E83 A;  1LVK A;  4MVS A;  1WWP A;  3U8P A;  4BJ5 A;  2Q9A A;  1Z7Q c;  4E18 A;  3IEE A;  4YWQ A;  2L6H A;  3MX3 A;  1OKK A;  1YVI A;  4LER A;  3VYW A;  2YRF A;  1SR2 A;  4DRH B;  4YT2 A;  4FES A;  3ZTM A;  3G50 A;  2YL7 A;  3ZC4 A;  3ZVR A;  3ATP A;  1FFT C;  5A6A A;  4ZLC A;  1Q0M A;  4JTD B;  4BJT A;  1E86 A;  1Z63 A;  1T01 A;  2X51 A;  5COM A;  4EHP A;  2OEV A;  3GAN A;  2Q7R A;  5JUA A;  3MYI A;  5AC5 A;  4MTG A;  3CQZ A;  2Y39 A;  4XPX A;  1OW8 A;  3RVZ A;  4I44 A;  4G7O F;  1ZHZ A;  5L0C A;  1RXQ A;  3B71 A;  3LAY A;  3DMD A;  3AG2 C;  2DI3 A;  2HJM A;  3DKA A;  2IM8 A;  2XL8 A;  3S0X A;  2ZPA A;  1FTS A;  1YYX A;  3FXH A;  1QLE C;  4ULW A;  2EPK X;  3EPV A;  4AL1 A;  2D4U A;  2NG1 A;  1S05 A;  3HNI A;  4LDK A;  1E2X A;  1ZZP A;  3A11 A;  3SNH A;  1RJ9 B;  3S28 A;  1Z6A A;  2J7P A;  5L0F A;  3RW0 A;  5EK0 A;  2A68 F;  3PHF 2;  2R9R B;  5BUO A;  4YJW A;  4JW1 A;  1H6G A;  3ABM C;  3Q6M A;  2AP3 A;  2BL2 A;  2YLI A;  2DB4 A;  3RIP A;  1OR2 A;  1NZE A;  2ASR A;  2EPN A;  3MYF A;  4CS8 A;  3JYH A;  2QUP A;  4G78 A;  1H9G A;  5KYY A;  5DS4 A;  2EPO A;  3DWW A;  2QNL A;  4K0D A;  1TWH A;  3IHU A;  2O9X A;  1BR2 A;  4U5H A;  3A9C A;  2AWY A;  4CSA A;  2WZF A;  3K1H A;  3DXJ F;  3L0I A;  1HMO A;  4JVS A;  3C8G A;  1K04 A;  4NQF A;  3KMI A;  4JEB A;  1LIH A;  3R2P A;  1M56 C;  1MMG A;  1T6I A;  4CJO A;  2JX0 A;  3Q6N A;  4JTA B;  4ANJ A;  4EKW A;  3QW0 A;  3TOL A;  2QE9 A;  4N4W A;  4U5G A;  1EQ1 A;  4JCZ A;  2R7Q A;  1LM3 B;  2XL6 A;  5DVW A;  3RKO F;  4IJJ A;  5F5F A;  1LI7 A;  3GM3 A;  2B0H A;  2FFH A;  4BG0 A;  2YWA A;  4KI2 A;  2ZXR A;  1ORJ A;  3LS0 A;  1YYJ A;  4PFP A;  2VC9 A;  4DVZ A;  1C17 M;  1Q0K A;  1VK5 A;  4CJG A;  5JS5 A;  4GQH A;  2A1D D;  4MTF A;  3ZTZ A;  4CBE A;  1PV3 A;  2OG2 A;  1SYQ A;  5IY5 C;  3CAX A;  4BJ6 C;  1JPN A;  2I15 A;  3IQT A;  5A6B A;  2MHR A;  2R7S A;  2HFI A;  3K66 A;  2HUJ A;  2FAP B;  2NUP B;  1TFK B;  1YJG A;  2VAS A;  5BQG A;  5TJ5 E;  4NTF A;  1V4A A;  3WOD F;  2GA0 A;  2V26 A;  1SMY F;  2CNW A;  3B0U X;  2R7X A;  1HE9 A;  1W2W A;  3ZIB A;  3TQO A;  4E7Z A;  1BR1 A;  1ZHW A;  3NKE A;  4WAB A;  1E85 A;  4JZA A;  4XLP F;  2JD3 A;  4NTA A;  2IBF A;  3EHM A;  3U3F A;  1TQG A;  1TWC A;  1HE1 A;  3DI5 A;  3EGD B;  3U3B A;  2J46 A;  5CIV A;  3QTH A;  1GM5 A;  1OKK D;  1PD0 A;  4PAC A;  1MMN A;  1T6Q A;  2R7W A;  3ZG1 A;  1Z5Z A;  1L3P A;  1YAU O;  2YZS A;  3QVZ A;  4MND A;  3T6B A;  3ITF A;  4WGY A;  4E0H A;  1A7D A;  5EGY A;  1Z3I X;  3JSE O;  3LES A;  2R7O A;  1NU7 D;  1O5H A;  1XZP A;  5JP7 A;  2H7V C;  4MW3 A;  2EIK C;  2DGJ A;  3GOD A;  1JRA A;  3C62 A;  4A2N B;  3FAP B;  4DOZ A;  5KYW B;  1ORS C;  5CI8 A;  4IAR A;  3SEO A;  2C04 A;  3IQC A;  3U9J A;  4CX9 A;  1AVO B;  3FDQ A;  1D0X A;  1NFO A;  1NSG B;  2NUT A;  1YA9 A;  1B68 A;  3EGX A;  2PFD A;  1CGO A;  3WAQ A;  3OWT A;  2LCH A;  1JMW A;  1ZU4 A;  1FMW A;  2HSB A;  1N1C A;  1EI7 A;  4IB4 A;  4C7O A;  4JRZ A;  2L6F A;  2XLW A;  5JVE A;  1M2V A;  1SZI A;  3H65 A;  1MMD A;  4YT4 A;  2G3K A;  5F5H A;  4BJ1 A;  3EJN A;  4XPY A;  5L0I A;  1OXB A;  2J7P D;  3KYI A;  4U9D A;  2W45 A;  2VCC A;  1LE2 A;  1VTM P;  4IRU A;  1PCX A;  2Q9C A;  3DM5 A;  3EFO A;  4M63 A;  2KK1 A;  4XEV A;  1BZ4 A;  4Z9I A;  1G4U S;  3H2U A;  2XSE A;  4MW8 A;  1OCR C;  4O79 A;  2DYR C;  2LFF A;  2OEX A;  2YHS A;  2H7O A;  2HJ3 A;  2RSE B;  2CDQ A;  2Y3G A;  2HSQ A;  2YL0 A;  4JTC B;  4O7G A;  5B3I A;  2FGY A;  5A6K A;  4PJM A;  5KYU B;  4H54 A;  4BEM J;  2L6G A;  2J9W A;  1HW1 A;  2P61 A;  1RKC A;  3AGT A;  3L34 A;  2W4M A;  5DQZ A;  3S29 A;  4XEF A;  2WVQ A; 
#chains in the Genus database with same CATH homology
 3CSK A;  4I1O B;  2KGO A;  4G0H A;  4PJL A;  4QDL A;  2I8B A;  1SF8 A;  2IOQ A;  4KBL A;  4DBR A;  2IXO A;  1NU9 C;  3DM9 B;  2KJG A;  5KYU B;  4AX2 A;  4YT5 A;  2KNH A;  1VYI A;  5E3A A;  3UGO A;  3EG9 A;  3W2V A;  2A69 F;  1J8Y F;  3NRH A;  1M57 C;  5B3S C;  1JPJ A;  3ABL C;  3DZA A;  4JJF A;  3EQL F;  2EIM C;  4U5E E;  1ZHT A;  2CNW D;  4OD4 A;  2Q9B A;  4EWC A;  3EH2 A;  4PFO A;  2LSE A;  4U5C E;  2Q3T A;  2IXM A;  3MLG A;  2Y3D A;  3K33 A;  3DJN B;  2B0J A;  1V54 C;  2EIL C;  4O6M A;  4U5F E;  2KW3 C;  2YEV A;  3HLZ A;  4GYT A;  3OEO A;  3W2W A;  3K1I C;  3NYL A;  3KL4 A;  3E70 C;  1D0Y A;  3NDB B;  4KNV A;  3OA1 A;  2XXA B;  4I3M A;  2CW0 F;  2H7B A;  3E9V A;  5KYX B;  1J8M F;  3LEV A;  4BJ6 A;  2IXN A;  4RD9 A;  4J32 B;  4JCH A;  1VYK A;  3T6J A;  3Q7L A;  2NUT B;  4JUR I;  4C3B A;  3F46 A;  3JSZ A;  2L81 A;  4AK9 A;  4E7S A;  1PD1 A;  2VB6 A;  4CS9 C;  4HFF B;  3HTK C;  1RJ9 A;  3VAY A;  2J9U A;  3WG7 C;  3V7O A;  5KYW B;  4C3E A;  3EFO B;  2WVN A;  1ZYR F;  3X1O A;  4IAO A;  2DYS C;  3DAF A;  4YN0 B;  2P7V A;  4OIR F;  4KNW A;  2A6E F;  1MMA A;  4G7H F;  2J0W A;  2W4B A;  2PP4 A;  4Q5S F;  4DVY P;  2XRH A;  3AQB A;  2J45 A;  3EZI A;  2Y69 C;  5E2Q A;  3N2Z B;  3HJC A;  2CGE A;  3B0P A;  2OCC C;  2WZL A;  4OIN F;  4FWV A;  1S7Z A;  3EH1 A;  4LLE A;  3SP1 A;  1O87 A;  3QZC A;  5L3V A;  4PJJ A;  3JRT A;  4HEA J;  2W9Y A;  3KKB A;  3S27 A;  1OCZ C;  2G3V A;  1IW7 F;  2A6H F;  3KH2 A;  2Z15 A;  3DJU B;  3AG3 C;  2ZXW C;  4PJN A;  3LNR A;  4C3D A;  3FHD A;  1LS1 A;  3UR3 C;  5DQT A;  2PF4 E;  3B9Q A;  4RBN A;  4N06 A;  2NUP A;  5D91 A;  1LKX A;  2ZXO A;  2WVO A;  1D1B A;  1ST6 A;  5DLJ A;  4CS7 A;  2E87 A;  2HV6 A;  3RFY A;  3EGD A;  3O39 A;  3ABK C;  5KYY B;  5DS6 A;  3O6X A;  5FCL A;  1BR4 A;  5T3W A;  4JJG A;  1ZHY A;  3UNG C;  4P6I C;  4OD5 A;  4AE4 A;  1Z23 A;  3NYJ A;  3F47 A;  1TR2 A;  4MQ9 F;  5T1D B;  2R7U A;  5B1A C;  4HE8 D;  3RH3 A;  1QZX A;  4WJ0 A;  4F4B A;  4BJ5 C;  1TWA A;  3DAG A;  2BE5 F;  3LLK A;  4W8K A;  5DS5 A;  2C03 A;  3EZH A;  3T4R A;  1ZU5 A;  2PX3 A;  4K7B A;  3I5P A;  5E33 A;  2J0X A;  4OIP F;  3M1C B;  5KYN A;  3ASO C;  5B1B C;  3UMI A;  2QTV A;  3AQC A;  1OCC C;  5EHH A;  1D1A A;  3LJB A;  4BEJ A;  1MND A;  2MYS A;  3K7D A;  2R7V A;  3SZR A;  2PX0 A;  1MNE A;  4XLN F;  3ZSU A;  3N0T A;  2VH3 A;  1M2O A;  4U5D E;  4H4K C;  5T3T A;  1D1C A;  3N24 A;  2J9V A;  5KYU A;  4XWJ A;  4CS8 C;  3LLI A;  1OCO C;  1FFH A;  2KQ9 A;  4CS9 A;  3EGX B;  3B0V C;  4CSA C;  4PK4 A;  1G8X A;  4C7O B;  1M2V B;  4HFK B;  3NYM A;  3JCU Q;  2HV7 A;  3ECS A;  3X2Q C;  3QMK A;  1KU2 A;  4IWB A;  4QI2 A;  3UGP A;  2EIJ C;  5D92 A;  2M4E A;  4Q7C A;  2ZXP A;  4LAC B;  3FVY A;  4LLC A;  2IXP A;  4Q4Z F;  4YT8 A;  1VMA A;  4KC9 A;  4U5B E;  2Y3B A;  4OIO F;  3I5Q A;  4NY3 A;  3K6B A;  4FX5 A;  3ASN C;  4XTK A;  1TKN A;  4G7Z F;  2Y3H A;  3DD7 A;  3LS1 A;  5L3Q A;  2P6V A;  5HSW A;  4ZLD A;  4O6N A;  3NKD A;  2G62 A;  2XXA A;  3Q7G A;  3POV A;  1WGW A;  1ZHX A;  4AE4 B;  5KYX A;  3AG1 C;  5CI9 A;  3EG9 B;  3SYN A;  2V3C C;  3UMH A;  3RYL A;  4EBB A;  4O6Y A;  1TWG A;  5E3C A;  3UMK A;  2IYL D;  1D0Z A;  2EIN C;  3TD7 A;  1IZM A;  4OIQ F;  3JT1 A;  4GEH A;  1NG1 A;  4I1M A;  4X0R A;  2R7T A;  1V55 C;  4QI0 A;  4B6I A;  2L9J A;  2WZG A;  4J30 B;  1FMV A;  3PMR A;  2GFH A;  2WB7 A;  3ZC4 A;  2QY9 A;  3CZ6 A;  3I4U A;  3W8H A;  1VOM A;  2XL4 A;  3EHN A;  3AG4 C;  3W8I A;  5KYW A;  2MWQ A;  3NG1 A;  4CIH A;  4DBQ A;  2D5R B;  4RDA A;  2R7R A;  2WL8 A;  3FAJ A;  1LVK A;  4BJ5 A;  2Q9A A;  4YWQ A;  3IEE A;  3MX3 A;  1OKK A;  4LER A;  3VYW A;  4YT2 A;  4FES A;  3ZVR A;  1FFT C;  4ZLC A;  4BJT A;  2X51 A;  3GAN A;  3CQZ A;  2Y39 A;  4I44 A;  4G7O F;  1ZHZ A;  3LAY A;  3DMD A;  3AG2 C;  3S0X A;  2ZPA A;  1FTS A;  4ULW A;  1QLE C;  3EPV A;  2NG1 A;  3SNH A;  1RJ9 B;  3S28 A;  2J7P A;  1Z6A A;  2A68 F;  3PHF 2;  5BUO A;  4YJW A;  4JW1 A;  3ABM C;  3Q6M A;  3RIP A;  1NZE A;  4CS8 A;  3JYH A;  5KYY A;  5DS4 A;  4K0D A;  1TWH A;  2O9X A;  1BR2 A;  4U5H A;  4CSA A;  2WZF A;  3K1H A;  3DXJ F;  3L0I A;  4JVS A;  3KMI A;  1M56 C;  1MMG A;  3Q6N A;  4ANJ A;  4U5G A;  2R7Q A;  5DVW A;  3RKO F;  5F5F A;  4IJJ A;  4KI2 A;  2FFH A;  4BG0 A;  2ZXR A;  3LS0 A;  4PFP A;  4DVZ A;  1VK5 A;  2A1D D;  4CBE A;  2OG2 A;  5IY5 C;  4BJ6 C;  1JPN A;  2R7S A;  3K66 A;  2NUP B;  2VAS A;  3WOD F;  3B0U X;  2R7X A;  2V26 A;  1SMY F;  2CNW A;  1W2W A;  3ZIB A;  4E7Z A;  1BR1 A;  1ZHW A;  3NKE A;  4XLP F;  4JZA A;  2JD3 A;  3EHM A;  1TWC A;  3EGD B;  2J46 A;  1OKK D;  1PD0 A;  1MMN A;  2R7W A;  3ZG1 A;  1Z5Z A;  2YZS A;  3T6B A;  4MND A;  3ITF A;  5EGY A;  1Z3I X;  3LES A;  2R7O A;  1NU7 D;  1O5H A;  2H7V C;  2EIK C;  2DGJ A;  3GOD A;  4A2N B;  4DOZ A;  5CI8 A;  3SEO A;  2C04 A;  3FDQ A;  1D0X A;  2NUT A;  3EGX A;  2PFD A;  3OWT A;  1ZU4 A;  1FMW A;  1N1C A;  4C7O A;  1M2V A;  1SZI A;  3H65 A;  1MMD A;  4YT4 A;  2G3K A;  5F5H A;  4BJ1 A;  3EJN A;  2J7P D;  2W45 A;  4IRU A;  1PCX A;  2Q9C A;  3DM5 A;  3EFO A;  4M63 A;  2XSE A;  1OCR C;  4O79 A;  2DYR C;  2YHS A;  2H7O A;  2CDQ A;  2Y3G A;  4O7G A;  2FGY A;  4PJM A;  2J9W A;  3L34 A;  1Z63 A;  2W4M A;  5DQZ A;  3S29 A;  2WVQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...