4JRZA

Human ltc4 synthase in complex with product analogs - implications for enzyme catalysis
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
155
structure length
155
Chain Sequence
MHHHHHHKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALFLLVALAALGLLAHFLPAALRAALLGRLRTLLPW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leukotriene C4 synthase
publication title Crystal Structures of Leukotriene C4 Synthase in Complex with Product Analogs: IMPLICATIONS FOR THE ENZYME MECHANISM.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 60
structure length 155
sequence length 155
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4jrzA00
4AL1A 4NTBA 2Q7RA 3PCVA 2PNOA 4YL1A 4WABA 4NTAA 4JCZA 2UUHA 2UUIA 5BQGA 4YL0A 5K0IA 4BPMA 5BQIA 5BQHA 3LEOA 3DWWA 4JRZA 3B29A 5HV9A 4YK5A 2H8AA 4YL3A 4JC7A 4NTFA 3HKKA 4J7TA 4J7YA 4AL0A
chains in the Genus database with same CATH superfamily
4ULWA 2R7WA 3NYMA 4DBRA 2R7OA 1UFBA 2XLEA 4MS2A 4N6CA 4BJ6C 4C3BA 2YKZA 5DQZA 1WOLA 2P6VA 3EQLF 4U5DE 3KH2A 4YL1A 1JPNA 2W4MA 2NUTB 4NTAA 3RVYA 1V74B 1Y4CA 2AVKA 2F22A 2UUHA 3N2ZB 3S90A 2VC9A 4AE4B 1G5ZA 1E86A 3TD7A 4O6YA 4I3MA 1NFOA 4U5BE 4IJJA 4O7GA 2HZ8A 3DI5A 1D0ZA 1MMAA 4JEAA 5L0GA 3U0CA 2Q3TA 1AUEA 4JRZA 2YLIA 3BRJA 3EZHA 4Z9IA 1NLXA 3S9OA 1QPUA 2NUPB 4OIRF 3F46A 1SYQA 1C03A 1MMNA 1RKEA 3ECSA 5AC4A 4E0IA 4G7OF 1TQGA 1Q0GA 3EGXB 4IAOA 4C7OA 3VF0A 2W4BA 1NG1A 1OXBA 4ANJA 1EKYA 2CDQA 3C8ZA 4ZLDA 1MNDA 1GQAA 2Y3DA 1LI5A 3GWLA 3FOOA 2Q7RA 3SNHA 1XWJA 2WB7A 1PCXA 1LPEA 2IXNA 3WODF 2OCCC 3NKDA 4MTGA 2VCCA 5JLIA 3UGOA 1C17M 3TULA 2LFFA 4W8KA 2HV7A 2A68F 2LP4A 1HW2A 2H7OA 4LLEA 1LVKA 2EPKX 2R05A 4BPMA 3EHMA 4DVYP 2V3CC 1OR2A 4QI0A 4K1OA 4JJFA 2A0UA 3V5ZA 4KNWA 1EA8A 2YHSA 3POVA 1EQ1A 1ZYRF 1SMYF 2E87A 3C8GD 1PD0A 2B0JA 3FVYA 1VYIA 1CPQA 4WJ0A 1V4AA 1S05A 2KC3A 3FAJA 4JVSA 4WGZA 3R7CA 2ICWG 3SXKA 1OCZC 3M15A 2XRHA 1TKNA 1NBBA 2A1DD 4J32B 2IOQA 3SEOA 1WTYA 4FESA 3F47A 3C62A 3GORA 4O6MA 4AL1A 3G4ZA 5E33A 2L81A 3H2UA 2RSEB 4JW1A 4MVOA 3DD7A 5IY5C 2XLMA 4NCQA 4JIOA 5KYXA 4JCZA 3SXZA 4JEBA 5A6KA 3ZDLA 3OA1A 1PD1A 1ZHZA 4BEMJ 4JE9A 4ULVA 4DOZA 2XLHA 4O6NA 5L0HA 1WWPA 1Z5ZA 2FAPB 1I4YA 3ABLC 1GS9A 2HSQA 2VASA 3VYWA 2OQMA 3A9CA 3ZTZA 4CJOA 1B68A 1SF8A 3EG9B 2L9JA 5CI9A 4CS9A 3WG7C 2Q4FA 2R7SA 2QLAA 1YYJA 2Q00A 4H54A 4J30B 1HE9A 4JURI 4J7TA 4J7YA 5B3SC 1GGQA 3L1MA 1FR0A 4JZAA 4WGYA 3HTKC 2XM4A 5CIVA 4YT2A 5EHHA 3S29A 2P0NA 4CIPA 1BZ4A 3LLIA 1CGNA 3K1IC 1H6GA 3RVZA 3EH1A 2KK1A 1RCPA 2HMQA 5DS5A 4YL0A 2G3VA 3TOMA 3JCUQ 1L7CA 3AGUA 4CS8C 3RFYA 1TFOB 1APCA 1Z23A 3DMDA 5COGA 2CW0F 4CSAC 2EPNA 4DXWA 2Y69C 3QMKA 1OKKD 2XXAA 1T01A 1ZHTA 3L8IA 3HNJA 5B1AC 2ASRA 3MLGA 1OR3A 2KJGA 3U9MA 4BJ5A 4CX9A 3MYFA 3VRCA 4U5GA 3ZQYA 2J9BA 2J7PD 2CGEA 5A6JA 1ST6A 3HNLA 3ZIBA 3Q7LA 5KYUA 2YZSA 3E70C 2CYDA 5A6BD 3IQCA 2NSGA 5DS4A 1H7IA 1NU7D 2ETSA 1HW1A 1RJ9B 2R7RA 4DRJB 2LK4A 3TOLA 3AQCA 3I5QA 4FX5A 4DVZA 3Q6MA 4E0HA 256BA 1VB5A 3G50A 3IHUA 1PV3A 3FMSA 4NQFA 1FNTc 5BQGA 1Q0MA 3AG3C 4EUKB 2H7BA 4H4KC 1A0BA 2JD3A 5JVEA 2YLGA 4F4BA 2PP4A 2QNLA 2EILC 1QKRA 2J8WA 4DJ9A 3U5SA 5F5HA 2Q9CA 4A2NB 4ONSA 1E2XA 1ZW2A 4KBLA 2GAQA 3DE9A 2I15A 2GDCA 4BJTA 3N0TA 1WATA 4MTOA 3ZQVA 3KYJA 1WN0A 1YARO 2Y3GA 2IXOA 3GM2A 2OOCA 4ZLCA 3ZWIA 3FXHA 5JT4A 2R7QA 3DZAA 4BEJA 2KQ9A 2VB6A 4EBJA 2DYSC 4BJ1A 2LSEA 4PK4A 1LI7A 4KI2A 2LQGA 2GA0A 1F1MA 3QW1A 2L6GA 1M57C 3U3BA 3UMHA 4MVUA 5JRAA 1RKEB 3NG1A 2XLDA 3LS1A 1JMWA 1LE2A 2UUIA 1NU9C 4EHPA 4C7OB 5BQIA 1M56C 2P61A 2G62A 3MFNA 1TWAA 2EIMC 2IXMA 4BG0A 3O39A 5L3QA 1LE4A 2Y3BA 1E84A 4YK5A 3U8VA 3UNGC 3QVYA 5AGFA 2HFIA 2KSFA 3KPHA 1O3UA 2X51A 2RD9A 4PJNA 4FAPB 4CIHA 2J45A 4G0HA 1RMVA 2LCHA 3MBGA 4U9EA 4YT5A 1FMWA 2EPOA 5JSLA 4RDAA 2QE9A 4IAQA 4U5CE 3DXJF 1DOWA 4CDYA 4EBBA 2WZGA 4JCHA 4QDLA 3EH2A 5KYYA 4X0RA 3DJNB 2DGJA 2L7AA 3C8GA 3B0UX 1YVIA 1H9TA 3LNMB 4N6HA 3UR3C 5DQTA 4EBKA 2PBEA 4PFPA 2XS1A 4C3DA 3EZIA 5E3AA 1YYXA 2OJED 3O55A 3W8IA 2HJ3A 1VK5A 1V54C 2WVOA 1CGOA 5T3TA 1T9KA 5HV9A 3S0XA 2AWCA 1IW7F 5HSWA 1FMVA 3RYLA 3TK0A 4AK9A 3K66A 4AX2A 1E83A 3IPMO 3LS0A 3U3FA 3CSKA 1A7EA 1MMDA 3QTHA 3NYLA 3AG2C 3ZSUA 1ORYA 3HNKA 1FFTC 2FFHA 1Y6DA 4E18A 3H65A 3GM3A 2XLVA 3U8PA 1BR1A 1OXKA 2R25A 1MNEA 1OW8A 1U0BB 2HV6A 2PX0A 4XQ1A 2GFHA 3FOPA 1K04A 1YA9A 1FAPB 3QZCA 2XS8A 2C03A 1YA7O 2W9YA 4PJMA 1Q0FA 2HJMA 5A69A 4QI2A 1OW7A 3MX3A 3L0IA 4XLNF 4G7HF 2DI3A 3DWWA 4IGGA 3AJMA 2XL8A 1MQVA 3K1IA 4DRHB 4GYTA 4Q4ZF 2EPMX 2OG2A 3US6A 1ORSC 1ZU4A 2ZXOA 4MVRA 2XSEA 4GEHA 4YL3A 3U2MA 2EIKC 3VAYA 2Y3HA 2OEVA 3W8HA 4CS8A 1WGWA 2CNWD 4CS7A 2G3KA 4D4XA 4IB4A 1W2WA 1LS1A 2R7TA 2R7VA 2MYSA 3ASNC 1M2VA 2EPLX 4C3EA 3L8JA 4U5EE 1FFHA 4NTBA 5KYWA 4NC3A 2KNHA 2L6HA 2YEVA 2YL1A 2EIJC 2XXAB 3OWTA 2XLOA 2YL0A 3ATPA 1OKKA 3J06A 3PMRA 2M4EA 3NMIA 3M1CB 1OCRC 1Q0KA 1J8MF 4LACB 5K0IA 2YVKA 3B71A 3JYYA 3V5YA 4IARA 3TJ6A 2J7PA 5KYUB 3FHDA 2OJQA 3JTLO 4N4WA 2MHRA 3HJCA 2D5RB 1J8YF 1U89A 4ER9A 1VTMP 3GEIA 3NKEA 5TJ5E 3B29A 3B0PA 1S7ZA 4Z9JA 2IYLD 5A6BA 2A6HF 3HNIA 1AVOB 1I5NA 2BL2A 3DKAA 2O9XA 4P9FA 1EI7A 2PX3A 3C18A 1LKXA 3C7JA 3EFOA 1HMDA 2J9WA 5EK0A 3SP1A 4EKWA 2BE5F 4OIQF 1TWCA 4E7ZA 3KKBA 2HUJA 2PF4E 4YT4A 4AL0A 1O87A 3GM1A 2VCBA 4G78A 5D92A 5E3CA 1K05A 3L34A 5E2QA 4JKVA 2R03A 1Z7Qc 4DBQA 1GM5A 1R4TA 2J9VA 3A11A 4YWQA 1KTMA 3H2VA 2A0BA 4N06A 5BQHA 2CCYA 4L6RA 1VOMA 4BJ6A 4G7ZF 1YDIA 4MVSA 2J0XA 5DS6A 4OIOF 5CI8A 3S27A 3K33A 2NG1A 1JPJA 3EPVA 3JSZA 4HEAJ 4KC9A 4O79A 5COMA 2ZPAA 3NDBB 1D1CA 2R02A 2WL8A 2WZFA 3SYNA 4JC7A 4NTFA 3E9VA 2D4UA 3C63A 2R7UA 2HKVA 3DJUB 4PFOA 4E17A 2XM0A 2DB4A 3M4CA 1LIHA 4PJLA 1VLTA 3JYHA 3U2LA 5GPGB 3R2PA 4K0DA 4MW8A 2V26A 4BJ5C 5T1DB 1V55C 1T6QA 4I1OB 3QW0A 1JOGA 4LDKA 5F5FA 3KL4A 1M6TA 3KMIA 1NSGB 5FZTA 2HMZA 4PACA 1M2OA 3BEHA 2FGYA 3Q6NA 5L0FA 4R32A 3UMKA 3JRTA 2B0HA 3VM6A 1D1AA 1OCCC 2P1AA 2MWQA 4HE8D 4YN0B 3DM5A 3DE8A 1YZCA 1NZEA 2Q9AA 3ZTMA 5B3IA 4OIPF 3UMIA 1BBHA 2KW3C 5EGYA 5KYYB 3RQGA 1AEPA 2DYRC 3C8GB 2X0CA 1ZW3A 3ZC4A 2XLWA 4LDRA 4U9DA 2BC5A 3SXMA 3UGPA 3CQZA 2NSFA 3Q7GA 1XZQA 1A7DA 4W8PA 2A6EF 3RQFA 2YRFA 2PNOA 1JAFA 4XTKA 4P6IC 2NPUA 1K40A 3G4XA 2ZXPA 3EGDA 3RKOF 3ABMC 1Z63A 1NFNA 4RD9A 4Q7CA 2QY9A 4MQ9F 3T4RA 2HS5A 3HLZA 4D4NA 1BDJB 3RH3A 5JP7A 3KYIA 4JJGA 3GODA 4LLCA 3S84A 4LDQA 4MW3A 2TMVP 3TJ5A 2OU6A 2J9UA 2OKUA 1WASA 3IQ6A 4CJGA 2R7XA 2NUTA 1H9GA 2WVNA 5BUOA 2AWYA 5JS5A 3B0VC 4AE4A 2H7VC 4XPXA 1Z3IX 1IZMA 1QQ3A 1ZU5A 1Q0DA 3EHNA 3OEOA 5T3WA 4YT8A 3LLKA 5A6AA 3ABKC 1T5OA 1BR4A 3JZ0A 5L0IA 4XEFA 3ITFA 2L6FA 4U5HA 2NUPA 3PCVA 3O10A 3CAXA 3O6XA 1O5HA 1ORJA 1JRAA 2GWWA 4A4AA 4JTAB 3NYJA 3TQOA 3V7OA 1RKCA 2IM8A 1HE1A 4XLPF 3PDMP 3LNRA 3EGXA 1QVXA 1I4ZA 2I8BA 3CZ6A 2CNWA 3GEHA 1JR8A 3W2WA 3ZVRA 3DAFA 1M2VB 2KGOA 3SZRA 3FDQA 3SXYA 1CGME 4XWJA 5KYWB 2ZXWC 3RF3A 3K7DA 4JTCB 3FAPB 3T6BA 3V5XA 3LUTB 2ZD9A 3JSEO 1KU2A 4RBNA 3U9JA 1TFKB 4FWVA 3DAGA 1LM3B 1SZIA 1FTSA 1XZPA 3T6GB 4CSAA 4Z9HA 5AC5A 1RXQA 2YQYA 5F28E 1KNYA 5KYXB 2YLDA 4GQHA 3AQBA 4MVZA 1D0XA 3S28A 4MVQA 3EFOB 1T6IA 3AGTA 1TWHA 2QTVA 1HMOA 3LAYA 1QZXA 4NY3A 2J0WA 4OD4A 2YWAA 1TR2A 4CDAA 3M79A 3QVZA 4YJWA 3X2QC 3LEOA 4HFFB 1OW6A 2XL4A 5L3VA 3I4UA 4OINF 2LD6A 1L3PA 2H8AA 1QLEC 3AOUA 3M4BA 5B1BC 1ZHWA 3CEXA 3W4YA 4UDVA 2WVQA 2YL7A 4KNVA 2VH3A 4PR9A 3IQTA 3ZG1A 2WZLA 3GWNA 3X1OA 2EINC 2YL3A 2AP3A 3EJNA 3EG9A 3WHNA 5D91A 4EIYA 1VYKA 4E7SA 2J46A 5DLJA 1ZHYA 4HFKB 4WABA 1D0YA 1SR2A 4CS9C 5FCLA 4XPWA 2IXPA 3LEVA 1QSPA 1Z6AA 2A69F 4MNDA 2XL6A 4XEKA 1G4US 5DVWA 1OCOC 4M63A 4PJJA 3GANA 3AG1C 4I44A 1A41A 2P7VA 1G4WR 3K6BA 5COFA 2M64A 4B6IA 4EWCA 4LERA 3T6JA 1E85A 1A7VA 4OD5A 3LESA 3K1HA 3WAQA 1HY5A 1VMAA 1YLMA 3RW0A 3T9OA 4U5FE 3NRHA 2ZXRA 2Q9BA 2QUPA 3JT1A 4P9TA 2Z15A 2AU5A 4DRIB 3B9QA 1YAUO 3DM9B 1C02A 2LFDA 1YJGA 1YZAA 2Y39A 2W45A 1U6HA 3RQEA 2VCAA 4I1MA 5L0DA 2LIGA 5L0JA 2JPUA 2JX0A 1G8XA 3LJBA 3AG4C 5KYNA 2KYHA 3W2VA 1LS4A 4IWBA 4JTDB 3MYIA 1OQCA 2PFDA 4IRUA 1R5ID 4XEVA 1VLSA 2C04A 4XPYA 1T6UA 3JRMO 2R9RB 3I5PA 4MTFA 4CBEA 2IBFA 4MVMA 1ZZPA 3ASOC 3IEEA 1DOVA 1N1CA 1RJ9A 5JUAA 3NMKA 3NMJA 4CDVA 3IQ5A 3GEEA 1CPRA 1ZVZA 1MMGA 4K7BA 2OEXA 3EGDB 2HSBA 3HKKA 1BR2A 1D1BA 5L0CA 1TWGA 1UG7A 3RIPA 4Q5SF 3N24A 3PHF2 1ZHXA
chains in the Genus database with same CATH topology
4AL1A 4NTBA 2Q7RA 3PCVA 2PNOA 4YL1A 4WABA 4NTAA 4JCZA 2UUHA 2UUIA 5BQGA 4YL0A 5K0IA 4BPMA 5BQIA 5BQHA 3LEOA 3DWWA 4JRZA 3B29A 5HV9A 4YK5A 2H8AA 4YL3A 4JC7A 4NTFA 3HKKA 4J7TA 4J7YA 4AL0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AL1 A;  4NTB A;  2Q7R A;  3PCV A;  2PNO A;  4YL1 A;  4WAB A;  4NTA A;  4JCZ A;  2UUH A;  2UUI A;  5BQG A;  4YL0 A;  5K0I A;  4BPM A;  5BQI A;  5BQH A;  3LEO A;  3DWW A;  4JRZ A;  3B29 A;  5HV9 A;  4YK5 A;  2H8A A;  4YL3 A;  4JC7 A;  4NTF A;  3HKK A;  4J7T A;  4J7Y A;  4AL0 A; 
#chains in the Genus database with same CATH topology
 4ULW A;  2R7W A;  3NYM A;  4DBR A;  2R7O A;  1UFB A;  2XLE A;  4MS2 A;  4N6C A;  4BJ6 C;  4C3B A;  2YKZ A;  5DQZ A;  1WOL A;  2P6V A;  3EQL F;  4U5D E;  3KH2 A;  4YL1 A;  1JPN A;  2W4M A;  2NUT B;  4NTA A;  3RVY A;  1V74 B;  1Y4C A;  2AVK A;  2F22 A;  2UUH A;  3N2Z B;  3S90 A;  2VC9 A;  4AE4 B;  1G5Z A;  1E86 A;  3TD7 A;  4O6Y A;  4I3M A;  1NFO A;  4U5B E;  4IJJ A;  4O7G A;  2HZ8 A;  3DI5 A;  1D0Z A;  1MMA A;  4JEA A;  5L0G A;  3U0C A;  2Q3T A;  1AUE A;  4JRZ A;  2YLI A;  3BRJ A;  3EZH A;  4Z9I A;  1NLX A;  3S9O A;  1QPU A;  2NUP B;  4OIR F;  3F46 A;  1SYQ A;  1C03 A;  1MMN A;  1RKE A;  3ECS A;  5AC4 A;  4E0I A;  4G7O F;  1TQG A;  1Q0G A;  3EGX B;  4IAO A;  4C7O A;  3VF0 A;  2W4B A;  1NG1 A;  1OXB A;  4ANJ A;  1EKY A;  2CDQ A;  3C8Z A;  4ZLD A;  1MND A;  1GQA A;  2Y3D A;  1LI5 A;  3GWL A;  3FOO A;  2Q7R A;  3SNH A;  1XWJ A;  2WB7 A;  1PCX A;  1LPE A;  2IXN A;  3WOD F;  2OCC C;  3NKD A;  4MTG A;  2VCC A;  5JLI A;  3UGO A;  1C17 M;  3TUL A;  2LFF A;  4W8K A;  2HV7 A;  2A68 F;  2LP4 A;  1HW2 A;  2H7O A;  4LLE A;  1LVK A;  2EPK X;  2R05 A;  4BPM A;  3EHM A;  4DVY P;  2V3C C;  1OR2 A;  4QI0 A;  4K1O A;  4JJF A;  2A0U A;  3V5Z A;  4KNW A;  1EA8 A;  2YHS A;  3POV A;  1EQ1 A;  1ZYR F;  1SMY F;  2E87 A;  3C8G D;  1PD0 A;  2B0J A;  3FVY A;  1VYI A;  1CPQ A;  4WJ0 A;  1V4A A;  1S05 A;  2KC3 A;  3FAJ A;  4JVS A;  4WGZ A;  3R7C A;  2ICW G;  3SXK A;  1OCZ C;  3M15 A;  2XRH A;  1TKN A;  1NBB A;  2A1D D;  4J32 B;  2IOQ A;  3SEO A;  1WTY A;  4FES A;  3F47 A;  3C62 A;  3GOR A;  4O6M A;  4AL1 A;  3G4Z A;  5E33 A;  2L81 A;  3H2U A;  2RSE B;  4JW1 A;  4MVO A;  3DD7 A;  5IY5 C;  2XLM A;  4NCQ A;  4JIO A;  5KYX A;  4JCZ A;  3SXZ A;  4JEB A;  5A6K A;  3ZDL A;  3OA1 A;  1PD1 A;  1ZHZ A;  4BEM J;  4JE9 A;  4ULV A;  4DOZ A;  2XLH A;  4O6N A;  5L0H A;  1WWP A;  1Z5Z A;  2FAP B;  1I4Y A;  3ABL C;  1GS9 A;  2HSQ A;  2VAS A;  3VYW A;  2OQM A;  3A9C A;  3ZTZ A;  4CJO A;  1B68 A;  1SF8 A;  3EG9 B;  2L9J A;  5CI9 A;  4CS9 A;  3WG7 C;  2Q4F A;  2R7S A;  2QLA A;  1YYJ A;  2Q00 A;  4H54 A;  4J30 B;  1HE9 A;  4JUR I;  4J7T A;  4J7Y A;  5B3S C;  1GGQ A;  3L1M A;  1FR0 A;  4JZA A;  4WGY A;  3HTK C;  2XM4 A;  5CIV A;  4YT2 A;  5EHH A;  3S29 A;  2P0N A;  4CIP A;  1BZ4 A;  3LLI A;  1CGN A;  3K1I C;  1H6G A;  3RVZ A;  3EH1 A;  2KK1 A;  1RCP A;  2HMQ A;  5DS5 A;  4YL0 A;  2G3V A;  3TOM A;  3JCU Q;  1L7C A;  3AGU A;  4CS8 C;  3RFY A;  1TFO B;  1APC A;  1Z23 A;  3DMD A;  5COG A;  2CW0 F;  4CSA C;  2EPN A;  4DXW A;  2Y69 C;  3QMK A;  1OKK D;  2XXA A;  1T01 A;  1ZHT A;  3L8I A;  3HNJ A;  5B1A C;  2ASR A;  3MLG A;  1OR3 A;  2KJG A;  3U9M A;  4BJ5 A;  4CX9 A;  3MYF A;  3VRC A;  4U5G A;  3ZQY A;  2J9B A;  2J7P D;  2CGE A;  5A6J A;  1ST6 A;  3HNL A;  3ZIB A;  3Q7L A;  5KYU A;  2YZS A;  3E70 C;  2CYD A;  5A6B D;  3IQC A;  2NSG A;  5DS4 A;  1H7I A;  1NU7 D;  2ETS A;  1HW1 A;  1RJ9 B;  2R7R A;  4DRJ B;  2LK4 A;  3TOL A;  3AQC A;  3I5Q A;  4FX5 A;  4DVZ A;  3Q6M A;  4E0H A;  256B A;  1VB5 A;  3G50 A;  3IHU A;  1PV3 A;  3FMS A;  4NQF A;  1FNT c;  5BQG A;  1Q0M A;  3AG3 C;  4EUK B;  2H7B A;  4H4K C;  1A0B A;  2JD3 A;  5JVE A;  2YLG A;  4F4B A;  2PP4 A;  2QNL A;  2EIL C;  1QKR A;  2J8W A;  4DJ9 A;  3U5S A;  5F5H A;  2Q9C A;  4A2N B;  4ONS A;  1E2X A;  1ZW2 A;  4KBL A;  2GAQ A;  3DE9 A;  2I15 A;  2GDC A;  4BJT A;  3N0T A;  1WAT A;  4MTO A;  3ZQV A;  3KYJ A;  1WN0 A;  1YAR O;  2Y3G A;  2IXO A;  3GM2 A;  2OOC A;  4ZLC A;  3ZWI A;  3FXH A;  5JT4 A;  2R7Q A;  3DZA A;  4BEJ A;  2KQ9 A;  2VB6 A;  4EBJ A;  2DYS C;  4BJ1 A;  2LSE A;  4PK4 A;  1LI7 A;  4KI2 A;  2LQG A;  2GA0 A;  1F1M A;  3QW1 A;  2L6G A;  1M57 C;  3U3B A;  3UMH A;  4MVU A;  5JRA A;  1RKE B;  3NG1 A;  2XLD A;  3LS1 A;  1JMW A;  1LE2 A;  2UUI A;  1NU9 C;  4EHP A;  4C7O B;  5BQI A;  1M56 C;  2P61 A;  2G62 A;  3MFN A;  1TWA A;  2EIM C;  2IXM A;  4BG0 A;  3O39 A;  5L3Q A;  1LE4 A;  2Y3B A;  1E84 A;  4YK5 A;  3U8V A;  3UNG C;  3QVY A;  5AGF A;  2HFI A;  2KSF A;  3KPH A;  1O3U A;  2X51 A;  2RD9 A;  4PJN A;  4FAP B;  4CIH A;  2J45 A;  4G0H A;  1RMV A;  2LCH A;  3MBG A;  4U9E A;  4YT5 A;  1FMW A;  2EPO A;  5JSL A;  4RDA A;  2QE9 A;  4IAQ A;  4U5C E;  3DXJ F;  1DOW A;  4CDY A;  4EBB A;  2WZG A;  4JCH A;  4QDL A;  3EH2 A;  5KYY A;  4X0R A;  3DJN B;  2DGJ A;  2L7A A;  3C8G A;  3B0U X;  1YVI A;  1H9T A;  3LNM B;  4N6H A;  3UR3 C;  5DQT A;  4EBK A;  2PBE A;  4PFP A;  2XS1 A;  4C3D A;  3EZI A;  5E3A A;  1YYX A;  2OJE D;  3O55 A;  3W8I A;  2HJ3 A;  1VK5 A;  1V54 C;  2WVO A;  1CGO A;  5T3T A;  1T9K A;  5HV9 A;  3S0X A;  2AWC A;  1IW7 F;  5HSW A;  1FMV A;  3RYL A;  3TK0 A;  4AK9 A;  3K66 A;  4AX2 A;  1E83 A;  3IPM O;  3LS0 A;  3U3F A;  3CSK A;  1A7E A;  1MMD A;  3QTH A;  3NYL A;  3AG2 C;  3ZSU A;  1ORY A;  3HNK A;  1FFT C;  2FFH A;  1Y6D A;  4E18 A;  3H65 A;  3GM3 A;  2XLV A;  3U8P A;  1BR1 A;  1OXK A;  2R25 A;  1MNE A;  1OW8 A;  1U0B B;  2HV6 A;  2PX0 A;  4XQ1 A;  2GFH A;  3FOP A;  1K04 A;  1YA9 A;  1FAP B;  3QZC A;  2XS8 A;  2C03 A;  1YA7 O;  2W9Y A;  4PJM A;  1Q0F A;  2HJM A;  5A69 A;  4QI2 A;  1OW7 A;  3MX3 A;  3L0I A;  4XLN F;  4G7H F;  2DI3 A;  3DWW A;  4IGG A;  3AJM A;  2XL8 A;  1MQV A;  3K1I A;  4DRH B;  4GYT A;  4Q4Z F;  2EPM X;  2OG2 A;  3US6 A;  1ORS C;  1ZU4 A;  2ZXO A;  4MVR A;  2XSE A;  4GEH A;  4YL3 A;  3U2M A;  2EIK C;  3VAY A;  2Y3H A;  2OEV A;  3W8H A;  4CS8 A;  1WGW A;  2CNW D;  4CS7 A;  2G3K A;  4D4X A;  4IB4 A;  1W2W A;  1LS1 A;  2R7T A;  2R7V A;  2MYS A;  3ASN C;  1M2V A;  2EPL X;  4C3E A;  3L8J A;  4U5E E;  1FFH A;  4NTB A;  5KYW A;  4NC3 A;  2KNH A;  2L6H A;  2YEV A;  2YL1 A;  2EIJ C;  2XXA B;  3OWT A;  2XLO A;  2YL0 A;  3ATP A;  1OKK A;  3J06 A;  3PMR A;  2M4E A;  3NMI A;  3M1C B;  1OCR C;  1Q0K A;  1J8M F;  4LAC B;  5K0I A;  2YVK A;  3B71 A;  3JYY A;  3V5Y A;  4IAR A;  3TJ6 A;  2J7P A;  5KYU B;  3FHD A;  2OJQ A;  3JTL O;  4N4W A;  2MHR A;  3HJC A;  2D5R B;  1J8Y F;  1U89 A;  4ER9 A;  1VTM P;  3GEI A;  3NKE A;  5TJ5 E;  3B29 A;  3B0P A;  1S7Z A;  4Z9J A;  2IYL D;  5A6B A;  2A6H F;  3HNI A;  1AVO B;  1I5N A;  2BL2 A;  3DKA A;  2O9X A;  4P9F A;  1EI7 A;  2PX3 A;  3C18 A;  1LKX A;  3C7J A;  3EFO A;  1HMD A;  2J9W A;  5EK0 A;  3SP1 A;  4EKW A;  2BE5 F;  4OIQ F;  1TWC A;  4E7Z A;  3KKB A;  2HUJ A;  2PF4 E;  4YT4 A;  4AL0 A;  1O87 A;  3GM1 A;  2VCB A;  4G78 A;  5D92 A;  5E3C A;  1K05 A;  3L34 A;  5E2Q A;  4JKV A;  2R03 A;  1Z7Q c;  4DBQ A;  1GM5 A;  1R4T A;  2J9V A;  3A11 A;  4YWQ A;  1KTM A;  3H2V A;  2A0B A;  4N06 A;  5BQH A;  2CCY A;  4L6R A;  1VOM A;  4BJ6 A;  4G7Z F;  1YDI A;  4MVS A;  2J0X A;  5DS6 A;  4OIO F;  5CI8 A;  3S27 A;  3K33 A;  2NG1 A;  1JPJ A;  3EPV A;  3JSZ A;  4HEA J;  4KC9 A;  4O79 A;  5COM A;  2ZPA A;  3NDB B;  1D1C A;  2R02 A;  2WL8 A;  2WZF A;  3SYN A;  4JC7 A;  4NTF A;  3E9V A;  2D4U A;  3C63 A;  2R7U A;  2HKV A;  3DJU B;  4PFO A;  4E17 A;  2XM0 A;  2DB4 A;  3M4C A;  1LIH A;  4PJL A;  1VLT A;  3JYH A;  3U2L A;  5GPG B;  3R2P A;  4K0D A;  4MW8 A;  2V26 A;  4BJ5 C;  5T1D B;  1V55 C;  1T6Q A;  4I1O B;  3QW0 A;  1JOG A;  4LDK A;  5F5F A;  3KL4 A;  1M6T A;  3KMI A;  1NSG B;  5FZT A;  2HMZ A;  4PAC A;  1M2O A;  3BEH A;  2FGY A;  3Q6N A;  5L0F A;  4R32 A;  3UMK A;  3JRT A;  2B0H A;  3VM6 A;  1D1A A;  1OCC C;  2P1A A;  2MWQ A;  4HE8 D;  4YN0 B;  3DM5 A;  3DE8 A;  1YZC A;  1NZE A;  2Q9A A;  3ZTM A;  5B3I A;  4OIP F;  3UMI A;  1BBH A;  2KW3 C;  5EGY A;  5KYY B;  3RQG A;  1AEP A;  2DYR C;  3C8G B;  2X0C A;  1ZW3 A;  3ZC4 A;  2XLW A;  4LDR A;  4U9D A;  2BC5 A;  3SXM A;  3UGP A;  3CQZ A;  2NSF A;  3Q7G A;  1XZQ A;  1A7D A;  4W8P A;  2A6E F;  3RQF A;  2YRF A;  2PNO A;  1JAF A;  4XTK A;  4P6I C;  2NPU A;  1K40 A;  3G4X A;  2ZXP A;  3EGD A;  3RKO F;  3ABM C;  1Z63 A;  1NFN A;  4RD9 A;  4Q7C A;  2QY9 A;  4MQ9 F;  3T4R A;  2HS5 A;  3HLZ A;  4D4N A;  1BDJ B;  3RH3 A;  5JP7 A;  3KYI A;  4JJG A;  3GOD A;  4LLC A;  3S84 A;  4LDQ A;  4MW3 A;  2TMV P;  3TJ5 A;  2OU6 A;  2J9U A;  2OKU A;  1WAS A;  3IQ6 A;  4CJG A;  2R7X A;  2NUT A;  1H9G A;  2WVN A;  5BUO A;  2AWY A;  5JS5 A;  3B0V C;  4AE4 A;  2H7V C;  4XPX A;  1Z3I X;  1IZM A;  1QQ3 A;  1ZU5 A;  1Q0D A;  3EHN A;  3OEO A;  5T3W A;  4YT8 A;  3LLK A;  5A6A A;  3ABK C;  1T5O A;  1BR4 A;  3JZ0 A;  5L0I A;  4XEF A;  3ITF A;  2L6F A;  4U5H A;  2NUP A;  3PCV A;  3O10 A;  3CAX A;  3O6X A;  1O5H A;  1ORJ A;  1JRA A;  2GWW A;  4A4A A;  4JTA B;  3NYJ A;  3TQO A;  3V7O A;  1RKC A;  2IM8 A;  1HE1 A;  4XLP F;  3PDM P;  3LNR A;  3EGX A;  1QVX A;  1I4Z A;  2I8B A;  3CZ6 A;  2CNW A;  3GEH A;  1JR8 A;  3W2W A;  3ZVR A;  3DAF A;  1M2V B;  2KGO A;  3SZR A;  3FDQ A;  3SXY A;  1CGM E;  4XWJ A;  5KYW B;  2ZXW C;  3RF3 A;  3K7D A;  4JTC B;  3FAP B;  3T6B A;  3V5X A;  3LUT B;  2ZD9 A;  3JSE O;  1KU2 A;  4RBN A;  3U9J A;  1TFK B;  4FWV A;  3DAG A;  1LM3 B;  1SZI A;  1FTS A;  1XZP A;  3T6G B;  4CSA A;  4Z9H A;  5AC5 A;  1RXQ A;  2YQY A;  5F28 E;  1KNY A;  5KYX B;  2YLD A;  4GQH A;  3AQB A;  4MVZ A;  1D0X A;  3S28 A;  4MVQ A;  3EFO B;  1T6I A;  3AGT A;  1TWH A;  2QTV A;  1HMO A;  3LAY A;  1QZX A;  4NY3 A;  2J0W A;  4OD4 A;  2YWA A;  1TR2 A;  4CDA A;  3M79 A;  3QVZ A;  4YJW A;  3X2Q C;  3LEO A;  4HFF B;  1OW6 A;  2XL4 A;  5L3V A;  3I4U A;  4OIN F;  2LD6 A;  1L3P A;  2H8A A;  1QLE C;  3AOU A;  3M4B A;  5B1B C;  1ZHW A;  3CEX A;  3W4Y A;  4UDV A;  2WVQ A;  2YL7 A;  4KNV A;  2VH3 A;  4PR9 A;  3IQT A;  3ZG1 A;  2WZL A;  3GWN A;  3X1O A;  2EIN C;  2YL3 A;  2AP3 A;  3EJN A;  3EG9 A;  3WHN A;  5D91 A;  4EIY A;  1VYK A;  4E7S A;  2J46 A;  5DLJ A;  1ZHY A;  4HFK B;  4WAB A;  1D0Y A;  1SR2 A;  4CS9 C;  5FCL A;  4XPW A;  2IXP A;  3LEV A;  1QSP A;  1Z6A A;  2A69 F;  4MND A;  2XL6 A;  4XEK A;  1G4U S;  5DVW A;  1OCO C;  4M63 A;  4PJJ A;  3GAN A;  3AG1 C;  4I44 A;  1A41 A;  2P7V A;  1G4W R;  3K6B A;  5COF A;  2M64 A;  4B6I A;  4EWC A;  4LER A;  3T6J A;  1E85 A;  1A7V A;  4OD5 A;  3LES A;  3K1H A;  3WAQ A;  1HY5 A;  1VMA A;  1YLM A;  3RW0 A;  3T9O A;  4U5F E;  3NRH A;  2ZXR A;  2Q9B A;  2QUP A;  3JT1 A;  4P9T A;  2Z15 A;  2AU5 A;  4DRI B;  3B9Q A;  1YAU O;  3DM9 B;  1C02 A;  2LFD A;  1YJG A;  1YZA A;  2Y39 A;  2W45 A;  1U6H A;  3RQE A;  2VCA A;  4I1M A;  5L0D A;  2LIG A;  5L0J A;  2JPU A;  2JX0 A;  1G8X A;  3LJB A;  3AG4 C;  5KYN A;  2KYH A;  3W2V A;  1LS4 A;  4IWB A;  4JTD B;  3MYI A;  1OQC A;  2PFD A;  4IRU A;  1R5I D;  4XEV A;  1VLS A;  2C04 A;  4XPY A;  1T6U A;  3JRM O;  2R9R B;  3I5P A;  4MTF A;  4CBE A;  2IBF A;  4MVM A;  1ZZP A;  3ASO C;  3IEE A;  1DOV A;  1N1C A;  1RJ9 A;  5JUA A;  3NMK A;  3NMJ A;  4CDV A;  3IQ5 A;  3GEE A;  1CPR A;  1ZVZ A;  1MMG A;  4K7B A;  2OEX A;  3EGD B;  2HSB A;  3HKK A;  1BR2 A;  1D1B A;  5L0C A;  1TWG A;  1UG7 A;  3RIP A;  4Q5S F;  3N24 A;  3PHF 2;  1ZHX A; 
#chains in the Genus database with same CATH homology
 4AL1 A;  4NTB A;  2Q7R A;  3PCV A;  2PNO A;  4YL1 A;  4WAB A;  4NTA A;  4JCZ A;  2UUH A;  2UUI A;  5BQG A;  4YL0 A;  5K0I A;  4BPM A;  5BQI A;  5BQH A;  3LEO A;  3DWW A;  4JRZ A;  3B29 A;  5HV9 A;  4YK5 A;  2H8A A;  4YL3 A;  4JC7 A;  4NTF A;  3HKK A;  4J7T A;  4J7Y A;  4AL0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...