4JRZA

Human ltc4 synthase in complex with product analogs - implications for enzyme catalysis
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
155
structure length
155
Chain Sequence
MHHHHHHKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALFLLVALAALGLLAHFLPAALRAALLGRLRTLLPW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leukotriene C4 synthase
publication title Crystal Structures of Leukotriene C4 Synthase in Complex with Product Analogs: IMPLICATIONS FOR THE ENZYME MECHANISM.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 60
structure length 155
sequence length 155
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4jrzA00
4J7YA 2Q7RA 2PNOA 4BPMA 4YL0A 3DWWA 4JC7A 3B29A 4NTFA 5BQHA 3HKKA 2UUHA 5HV9A 4AL1A 4YL1A 2UUIA 4J7TA 4JRZA 5BQGA 4NTBA 4YK5A 4NTAA 4AL0A 2H8AA 4WABA 4JCZA 4YL3A 3LEOA 3PCVA 5BQIA 5K0IA
chains in the Genus database with same CATH superfamily
1BR1A 2VC9A 2XLDA 3KKBA 3AOUA 3DZAA 3G4ZA 1SYQA 2J7PD 4I3MA 5AC5A 4G7ZF 3EG9A 2XRHA 2KC3A 4EBKA 5L0CA 2XXAB 3VM6A 2YL7A 4EHPA 2GA0A 4RD9A 1OW7A 1MMNA 3EGXA 1M57C 1O3UA 5AC4A 1NU7D 1OR3A 2PF4E 4AE4A 1CGOA 4XEVA 2XLHA 1CGNA 2HSBA 4C7OA 3B0UX 4CIPA 5JVEA 3HLZA 4YJWA 2DYRC 2GWWA 5DQTA 4O79A 4LDKA 2AP3A 1BR2A 3US6A 1ORYA 3EGDB 1Z6AA 4CBEA 3CEXA 3K6BA 2P6VA 3C8GD 1V4AA 2J8WA 4XPYA 3HNIA 4GEHA 1TWAA 2W4MA 2NPUA 3EFOA 5JUAA 4W8KA 2LQGA 4BG0A 2J0XA 4EIYA 2HJMA 1VB5A 1B68A 3SZRA 1J8MF 2PP4A 3JCUQ 3NYJA 2A69F 3LLIA 1OKKA 3VAYA 2FFHA 1G4US 3U3BA 2A1DD 1UG7A 2DI3A 2XM0A 1T6IA 3IQTA 1A7DA 2WVQA 5BUOA 1E86A 4BJ5C 5DS5A 3DWWA 3M1CB 4WGZA 2DB4A 2HV7A 1D0ZA 1BR4A 3QVYA 4FESA 2LCHA 3ABLC 3QW1A 1WTYA 4QI0A 2W4BA 1SF8A 3GODA 1SMYF 5KYWA 4HEAJ 4Q7CA 4RDAA 3V7OA 4N6HA 2IXMA 3ZQVA 4FAPB 1NFOA 1ST6A 3EJNA 3U0CA 1D1BA 2Y3BA 1RKEB 1CGME 1YAUO 1ZHYA 3CSKA 2LD6A 1H9TA 1LKXA 1OR2A 1T5OA 1Z3IX 1T01A 2XLMA 3A11A 2G3VA 4HFKB 4PFOA 2QLAA 3V5YA 1LI7A 1RKCA 4DJ9A 4KNVA 2CDQA 3DAGA 3U8PA 4XTKA 3TD7A 4IAQA 2VCAA 4YN0B 1JRAA 2OQMA 3DAFA 3T6GB 1K05A 3S27A 2P61A 2OKUA 2XL8A 2HUJA 3BRJA 3C63A 3ECSA 2YL0A 4BJ5A 2G3KA 2A0UA 4YL1A 4J7TA 3LS1A 4OD4A 4JEAA 5A69A 5KYUB 1QLEC 3JZ0A 2EIMC 4ZLCA 2NG1A 1FMVA 1NZEA 2XLEA 3AG4C 4NTAA 2EPLX 3JSZA 3S9OA 3TOLA 1T6QA 2GFHA 2VCCA 4CDVA 1WWPA 2WVOA 1T6UA 2H7BA 3PCVA 4FX5A 4MS2A 5F28E 2KSFA 1EA8A 1LIHA 2R25A 5E33A 1FR0A 3W2VA 1ZU5A 2OEXA 4BJ6A 3V5XA 3C18A 3QVZA 4F4BA 2L7AA 4KI2A 2YHSA 2EILC 4JTCB 2VCBA 4XQ1A 4MTGA 1HY5A 1A41A 1JR8A 3M15A 3R2PA 4MVOA 3GEEA 5KYXB 1LM3B 1CPRA 1MMAA 1ZHZA 2UUHA 2ZPAA 2G62A 3DM9B 2A6HF 3W2WA 3JSEO 2R7VA 1PV3A 3EH2A 4E7SA 2J45A 1D1CA 2P1AA 4IARA 3DMDA 3HNKA 4O6YA 3WODF 1RMVA 4CDYA 4N06A 3O55A 4PJNA 3PHF2 3LAYA 4O7GA 2M64A 3LEOA 2IOQA 3RKOF 1R5ID 1G4WR 3CZ6A 4P9FA 4CJOA 3FAJA 3LLKA 5L0JA 4LACB 3EG9B 3LS0A 1VLSA 2M4EA 1L7CA 3FVYA 2IXNA 3C8ZA 1OXBA 4LLEA 3EGXB 1Z63A 4MTOA 4O6NA 3C62A 3KPHA 1OXKA 4JC7A 2YKZA 1I4YA 2R03A 3QW0A 1QPUA 1OQCA 1WOLA 1ZHXA 1E84A 5AGFA 2GDCA 3M79A 3UGOA 2UUIA 1F1MA 5A6JA 1LS1A 3LNMB 4MVMA 3O6XA 4G0HA 4WJ0A 5E3CA 5EHHA 4NC3A 4DRJB 3L0IA 2X0CA 1TKNA 2Z15A 3EFOB 5KYYA 4MVUA 3W8HA 2JD3A 2WZLA 3AG2C 5BQIA 2KYHA 2XLVA 1LPEA 4MVRA 3LUTB 5K0IA 1TFKB 1CPQA 3ABMC 1XZPA 4E7ZA 2HKVA 5DS6A 3N24A 3ZQYA 1EKYA 1S7ZA 4EKWA 4L6RA 5L0HA 3QTHA 2Q3TA 1Y6DA 3DE9A 3MLGA 1EI7A 3SXYA 2D5RB 4AL1A 5KYWB 4NCQA 3U9MA 1TWHA 3RF3A 4K0DA 2A6EF 1ORSC 2HZ8A 2QNLA 2Q00A 3C7JA 2CGEA 2P0NA 3RQGA 1YVIA 4YK5A 3WG7C 2MYSA 1VMAA 2R7XA 3M4BA 2ZXRA 4XPWA 3X1OA 2Y3GA 4U5FE 2TMVP 1HW1A 3SXKA 5JLIA 2R9RB 5JRAA 3S84A 4D4XA 1RJ9B 2R7OA 3AJMA 4IJJA 4QI2A 1BDJB 2XM4A 1IW7F 3L8JA 1J8YF 3JYYA 4JTDB 3RVZA 4B6IA 4YT8A 1V74B 2H7VC 2QY9A 3T6BA 4DOZA 3JT1A 1KTMA 2ETSA 4JJFA 1ZHWA 2EIKC 4OIRF 1D1AA 2IXOA 4ULWA 4DBRA 3FHDA 3GWNA 3KYIA 4A2NB 2ZXWC 1YARO 1TR2A 2RD9A 3TJ6A 3Q6MA 2CNWA 4PACA 2J9UA 4I44A 1JOGA 4CS9C 3VYWA 2R7WA 5B1BC 5F5FA 5FZTA 1LVKA 3GM1A 3DM5A 1MMDA 3JYHA 2BC5A 4MVSA 4E0IA 4JCZA 3ABKC 3DJUB 4JJGA 3POVA 2FAPB 2J9VA 4G7HF 1ZU4A 3EZIA 4ER9A 1KU2A 3E70C 3R7CA 3GWLA 2XLWA 1RCPA 1Q0FA 4ULVA 2HJ3A 2FGYA 2XXAA 3U8VA 4NTFA 3AQCA 5JSLA 3HKKA 4WGYA 3CAXA 1GGQA 3SXMA 4IGGA 2XSEA 4LDRA 3GEIA 5JP7A 1V54C 2R7RA 4DBQA 2XL6A 4I1OB 3GM3A 2IBFA 2J7PA 3RH3A 1WN0A 2Q9AA 3MFNA 3ZTZA 5DLJA 2R7TA 256BA 2YRFA 3MYIA 4YT5A 3OEOA 3FAPB 3T9OA 1FNTc 3NMIA 1WGWA 5COGA 4CDAA 3O39A 4DVYP 3B0PA 3U2MA 4U5GA 2EPNA 3EH1A 3UGPA 3FOOA 1LE2A 1NSGB 3G4XA 4J30B 3NRHA 3IEEA 3K1IC 2XL4A 1YZCA 3ZG1A 4BPMA 3LESA 4EBJA 5B3SC 4N4WA 3NMKA 3AG1C 5COMA 5F5HA 4Z9HA 1Z5ZA 2CYDA 3C8GA 5D92A 2LK4A 1Z23A 4RBNA 5D91A 2JPUA 3K33A 4P6IC 1MNDA 3ZTMA 4YT4A 1V55C 4LERA 2KQ9A 3ZSUA 5KYYB 5T1DB 2I15A 2PX3A 3E9VA 3UMHA 1G8XA 3PDMP 4MVZA 4JZAA 1AEPA 1JMWA 5DQZA 3NDBB 4U5DE 4E17A 1OCZC 2O9XA 1L3PA 1OCRC 4JKVA 4BEJA 1RKEA 2JX0A 4CX9A 2HS5A 2WZGA 4CS7A 4E0HA 5A6AA 1M2VA 1NU9C 2KW3C 1Q0GA 2Y3HA 4OIPF 2KNHA 4Z9IA 3HNLA 4G7OF 2L6HA 2OG2A 4J7YA 3W8IA 5L3QA 2IYLD 3AGUA 3ZWIA 2Y3DA 3K7DA 1YA7O 1Q0MA 2D4UA 3MBGA 1A0BA 2NUPA 4U5CE 4Z9JA 3T6JA 1BBHA 3V5ZA 3ZC4A 1C03A 1ZYRF 4AE4B 5FCLA 4CIHA 3Q7GA 1I5NA 2J0WA 3I5PA 3TOMA 4C7OB 3RYLA 1TQGA 1LE4A 2DYSC 4ZLDA 4GYTA 3Q7LA 4IB4A 3U9JA 2HV6A 1HMDA 2I8BA 4GQHA 4N6CA 4PK4A 2YLDA 5L0GA 4JTAB 1WASA 1Y4CA 1FFTC 5L0DA 2L9JA 1A7EA 2HMQA 5EK0A 4YT2A 3G50A 3K1HA 1U6HA 3GM2A 4YL3A 1K40A 4XPXA 5GPGB 2GAQA 3WAQA 2W9YA 2MWQA 2L81A 1U89A 4EBBA 3SYNA 1M56C 3MX3A 2V3CC 1OCOC 4ONSA 1OW8A 3TQOA 1C02A 3OWTA 4IAOA 1TFOB 3LJBA 3X2QC 1NLXA 3NKEA 5DVWA 4U5HA 3IHUA 3MYFA 1Q0DA 1KNYA 2J9WA 1FTSA 2YLGA 3EHNA 2H7OA 2NSFA 1HE1A 1VLTA 2LIGA 2OU6A 1HW2A 5KYXA 4HE8D 3F46A 4PFPA 4CS8C 3ITFA 1FMWA 3L34A 2OJQA 3UMIA 4E18A 1FFHA 2YL1A 2EIJC 3SXZA 2KK1A 1PD0A 2W45A 5CIVA 4PJJA 2AVKA 2VASA 3BEHA 2BE5F 2AWYA 4O6MA 2X51A 5B3IA 2A68F 3EHMA 2BL2A 1W2WA 3N0TA 2ZXPA 3VRCA 3CQZA 3I4UA 3NKDA 3RFYA 5E2QA 4AK9A 5L3VA 3NYMA 2Q7RA 2QUPA 1ZW3A 3FOPA 4OIQF 4NY3A 4YL0A 1G5ZA 1OCCC 5JS5A 4C3DA 3HNJA 2EPKX 3B29A 3UR3C 2L6FA 2XS8A 1JPJA 1O87A 5BQHA 4UDVA 2OOCA 3F47A 3AG3C 3T4RA 3DD7A 3LEVA 3KH2A 2VB6A 4DRHB 5BQGA 5KYNA 4DXWA 5DS4A 4OD5A 4C3BA 4C3EA 2F22A 3EPVA 3IPMO 3JTLO 4MQ9F 3DI5A 4CS8A 3NG1A 3S0XA 1JAFA 1H9GA 2H8AA 1E2XA 3RIPA 2LP4A 3IQ5A 4J32B 1ZZPA 4R32A 3N2ZB 2YEVA 4MW3A 5HSWA 1SZIA 3LNRA 3PMRA 3IQCA 1R4TA 1DOVA 2R7SA 2HFIA 1PCXA 2NUTA 3U3FA 4CSAC 3UNGC 3ZVRA 5TJ5E 3K66A 3I5QA 2PNOA 3VF0A 1LS4A 3C8GB 2Q9CA 2WVNA 1I4ZA 2YQYA 3DKAA 2EPOA 2KGOA 2OEVA 3KMIA 4HFFB 4IRUA 1NBBA 4PJLA 1HE9A 1EQ1A 2WZFA 1OW6A 3HJCA 1QKRA 2J9BA 4XLNF 1VTMP 3U2LA 4LDQA 2QTVA 1D0YA 1VYKA 2QE9A 1IZMA 2MHRA 2YWAA 3H2VA 4DVZA 2Q9BA 2WL8A 4H4KC 3GANA 3Q6NA 2LSEA 4P9TA 4XEFA 1UFBA 3SEOA 5L0IA 2PFDA 1GS9A 4MTFA 3B9QA 1M2VB 3AQBA 4CS9A 3EGDA 2RSEB 1TWCA 2AWCA 4BJTA 2XS1A 4BJ6C 2YZSA 1VK5A 1XWJA 1NFNA 1NG1A 1YA9A 4I1MA 1RJ9A 1QZXA 1YYXA 4KNWA 4MNDA 1TWGA 2ZD9A 2NUPB 4JE9A 4JW1A 1ZW2A 3O10A 1Z7Qc 3TJ5A 4JIOA 3W4YA 4CSAA 3EQLF 3SNHA 1VOMA 2HSQA 1QVXA 4PJMA 2OCCC 3DE8A 4AX2A 2P7VA 1M6TA 5A6BD 2WB7A 3RW0A 4XLPF 3NYLA 4MW8A 4KBLA 2YLIA 4W8PA 1U0BB 3JRMO 3SP1A 1S05A 5B1AC 1H6GA 4JCHA 1QSPA 2ZXOA 3QMKA 3U5SA 2J46A 3A9CA 4XEKA 4LLCA 4XWJA 4BEMJ 4DRIB 2A0BA 3L1MA 4JVSA 1SR2A 1WATA 2VH3A 1FAPB 2CCYA 2R05A 4U9DA 4JEBA 1APCA 2ICWG 3AGTA 4MVQA 3RVYA 2Y39A 4KC9A 1A7VA 3WHNA 4A4AA 4EWCA 1ZHTA 3JRTA 3DXJF 1YDIA 5COFA 3QZCA 5T3WA 1RXQA 4IWBA 3S90A 1Q0KA 2NSGA 4U9EA 5JT4A 1N1CA 1GM5A 2E87A 4OINF 1LI5A 1AVOB 3ASOC 3K1IA 3KL4A 3FMSA 3HTKC 1YLMA 3KYJA 3ZIBA 4QDLA 2HMZA 3TULA 2L6GA 1YYJA 1AUEA 2C04A 3ASNC 3ZDLA 4JRZA 2B0JA 3B71A 1OKKD 5T3TA 2R7UA 4EUKB 4U5EE 3EZHA 4AL0A 5KYUA 2YL3A 2IXPA 2AU5A 2OJED 1HMOA 4WABA 3OA1A 1ZVZA 4FWVA 3FDQA 1MQVA 2CNWD 1GQAA 2PX0A 1BZ4A 1VYIA 3FXHA 3RQFA 4ANJA 3B0VC 3J06A 3ATPA 2B0HA 3DJNB 4BJ1A 4YWQA 4M63A 1ORJA 3RQEA 1MNEA 1YJGA 2LFDA 2V26A 4X0RA 3GEHA 3S29A 2C03A 2XLOA 1JPNA 4JURI 1C17M 3S28A 4Q4ZF 5L0FA 5HV9A 3GORA 4D4NA 2ASRA 2IM8A 5CI8A 1O5HA 1YZAA 3UMKA 4PR9A 4K7BA 2YVKA 5EGYA 1T9KA 3L8IA 2Y69C 4CJGA 2LFFA 1QQ3A 2PBEA 3H65A 3M4CA 2CW0F 3NMJA 4NTBA 2DGJA 5E3AA 2R02A 2EPMX 1XZQA 2Q4FA 5A6BA 1E85A 4OIOF 3H2UA 4H54A 4U5BE 4K1OA 1PD1A 1H7IA 5A6KA 1M2OA 1DOWA 2NUTB 2R7QA 5IY5C 1E83A 2EINC 2KJGA 5CI9A 1MMGA 4NQFA 1K04A 3TK0A 1D0XA 4G78A 3IQ6A 4Q5SF
chains in the Genus database with same CATH topology
4J7YA 2Q7RA 2PNOA 4BPMA 4YL0A 3DWWA 4JC7A 3B29A 4NTFA 5BQHA 3HKKA 2UUHA 5HV9A 4AL1A 4YL1A 2UUIA 4J7TA 4JRZA 5BQGA 4NTBA 4YK5A 4NTAA 4AL0A 2H8AA 4WABA 4JCZA 4YL3A 3LEOA 3PCVA 5BQIA 5K0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J7Y A;  2Q7R A;  2PNO A;  4BPM A;  4YL0 A;  3DWW A;  4JC7 A;  3B29 A;  4NTF A;  5BQH A;  3HKK A;  2UUH A;  5HV9 A;  4AL1 A;  4YL1 A;  2UUI A;  4J7T A;  4JRZ A;  5BQG A;  4NTB A;  4YK5 A;  4NTA A;  4AL0 A;  2H8A A;  4WAB A;  4JCZ A;  4YL3 A;  3LEO A;  3PCV A;  5BQI A;  5K0I A; 
#chains in the Genus database with same CATH topology
 1BR1 A;  2VC9 A;  2XLD A;  3KKB A;  3AOU A;  3DZA A;  3G4Z A;  1SYQ A;  2J7P D;  4I3M A;  5AC5 A;  4G7Z F;  3EG9 A;  2XRH A;  2KC3 A;  4EBK A;  5L0C A;  2XXA B;  3VM6 A;  2YL7 A;  4EHP A;  2GA0 A;  4RD9 A;  1OW7 A;  1MMN A;  3EGX A;  1M57 C;  1O3U A;  5AC4 A;  1NU7 D;  1OR3 A;  2PF4 E;  4AE4 A;  1CGO A;  4XEV A;  2XLH A;  1CGN A;  2HSB A;  4C7O A;  3B0U X;  4CIP A;  5JVE A;  3HLZ A;  4YJW A;  2DYR C;  2GWW A;  5DQT A;  4O79 A;  4LDK A;  2AP3 A;  1BR2 A;  3US6 A;  1ORY A;  3EGD B;  1Z6A A;  4CBE A;  3CEX A;  3K6B A;  2P6V A;  3C8G D;  1V4A A;  2J8W A;  4XPY A;  3HNI A;  4GEH A;  1TWA A;  2W4M A;  2NPU A;  3EFO A;  5JUA A;  4W8K A;  2LQG A;  4BG0 A;  2J0X A;  4EIY A;  2HJM A;  1VB5 A;  1B68 A;  3SZR A;  1J8M F;  2PP4 A;  3JCU Q;  3NYJ A;  2A69 F;  3LLI A;  1OKK A;  3VAY A;  2FFH A;  1G4U S;  3U3B A;  2A1D D;  1UG7 A;  2DI3 A;  2XM0 A;  1T6I A;  3IQT A;  1A7D A;  2WVQ A;  5BUO A;  1E86 A;  4BJ5 C;  5DS5 A;  3DWW A;  3M1C B;  4WGZ A;  2DB4 A;  2HV7 A;  1D0Z A;  1BR4 A;  3QVY A;  4FES A;  2LCH A;  3ABL C;  3QW1 A;  1WTY A;  4QI0 A;  2W4B A;  1SF8 A;  3GOD A;  1SMY F;  5KYW A;  4HEA J;  4Q7C A;  4RDA A;  3V7O A;  4N6H A;  2IXM A;  3ZQV A;  4FAP B;  1NFO A;  1ST6 A;  3EJN A;  3U0C A;  1D1B A;  2Y3B A;  1RKE B;  1CGM E;  1YAU O;  1ZHY A;  3CSK A;  2LD6 A;  1H9T A;  1LKX A;  1OR2 A;  1T5O A;  1Z3I X;  1T01 A;  2XLM A;  3A11 A;  2G3V A;  4HFK B;  4PFO A;  2QLA A;  3V5Y A;  1LI7 A;  1RKC A;  4DJ9 A;  4KNV A;  2CDQ A;  3DAG A;  3U8P A;  4XTK A;  3TD7 A;  4IAQ A;  2VCA A;  4YN0 B;  1JRA A;  2OQM A;  3DAF A;  3T6G B;  1K05 A;  3S27 A;  2P61 A;  2OKU A;  2XL8 A;  2HUJ A;  3BRJ A;  3C63 A;  3ECS A;  2YL0 A;  4BJ5 A;  2G3K A;  2A0U A;  4YL1 A;  4J7T A;  3LS1 A;  4OD4 A;  4JEA A;  5A69 A;  5KYU B;  1QLE C;  3JZ0 A;  2EIM C;  4ZLC A;  2NG1 A;  1FMV A;  1NZE A;  2XLE A;  3AG4 C;  4NTA A;  2EPL X;  3JSZ A;  3S9O A;  3TOL A;  1T6Q A;  2GFH A;  2VCC A;  4CDV A;  1WWP A;  2WVO A;  1T6U A;  2H7B A;  3PCV A;  4FX5 A;  4MS2 A;  5F28 E;  2KSF A;  1EA8 A;  1LIH A;  2R25 A;  5E33 A;  1FR0 A;  3W2V A;  1ZU5 A;  2OEX A;  4BJ6 A;  3V5X A;  3C18 A;  3QVZ A;  4F4B A;  2L7A A;  4KI2 A;  2YHS A;  2EIL C;  4JTC B;  2VCB A;  4XQ1 A;  4MTG A;  1HY5 A;  1A41 A;  1JR8 A;  3M15 A;  3R2P A;  4MVO A;  3GEE A;  5KYX B;  1LM3 B;  1CPR A;  1MMA A;  1ZHZ A;  2UUH A;  2ZPA A;  2G62 A;  3DM9 B;  2A6H F;  3W2W A;  3JSE O;  2R7V A;  1PV3 A;  3EH2 A;  4E7S A;  2J45 A;  1D1C A;  2P1A A;  4IAR A;  3DMD A;  3HNK A;  4O6Y A;  3WOD F;  1RMV A;  4CDY A;  4N06 A;  3O55 A;  4PJN A;  3PHF 2;  3LAY A;  4O7G A;  2M64 A;  3LEO A;  2IOQ A;  3RKO F;  1R5I D;  1G4W R;  3CZ6 A;  4P9F A;  4CJO A;  3FAJ A;  3LLK A;  5L0J A;  4LAC B;  3EG9 B;  3LS0 A;  1VLS A;  2M4E A;  1L7C A;  3FVY A;  2IXN A;  3C8Z A;  1OXB A;  4LLE A;  3EGX B;  1Z63 A;  4MTO A;  4O6N A;  3C62 A;  3KPH A;  1OXK A;  4JC7 A;  2YKZ A;  1I4Y A;  2R03 A;  3QW0 A;  1QPU A;  1OQC A;  1WOL A;  1ZHX A;  1E84 A;  5AGF A;  2GDC A;  3M79 A;  3UGO A;  2UUI A;  1F1M A;  5A6J A;  1LS1 A;  3LNM B;  4MVM A;  3O6X A;  4G0H A;  4WJ0 A;  5E3C A;  5EHH A;  4NC3 A;  4DRJ B;  3L0I A;  2X0C A;  1TKN A;  2Z15 A;  3EFO B;  5KYY A;  4MVU A;  3W8H A;  2JD3 A;  2WZL A;  3AG2 C;  5BQI A;  2KYH A;  2XLV A;  1LPE A;  4MVR A;  3LUT B;  5K0I A;  1TFK B;  1CPQ A;  3ABM C;  1XZP A;  4E7Z A;  2HKV A;  5DS6 A;  3N24 A;  3ZQY A;  1EKY A;  1S7Z A;  4EKW A;  4L6R A;  5L0H A;  3QTH A;  2Q3T A;  1Y6D A;  3DE9 A;  3MLG A;  1EI7 A;  3SXY A;  2D5R B;  4AL1 A;  5KYW B;  4NCQ A;  3U9M A;  1TWH A;  3RF3 A;  4K0D A;  2A6E F;  1ORS C;  2HZ8 A;  2QNL A;  2Q00 A;  3C7J A;  2CGE A;  2P0N A;  3RQG A;  1YVI A;  4YK5 A;  3WG7 C;  2MYS A;  1VMA A;  2R7X A;  3M4B A;  2ZXR A;  4XPW A;  3X1O A;  2Y3G A;  4U5F E;  2TMV P;  1HW1 A;  3SXK A;  5JLI A;  2R9R B;  5JRA A;  3S84 A;  4D4X A;  1RJ9 B;  2R7O A;  3AJM A;  4IJJ A;  4QI2 A;  1BDJ B;  2XM4 A;  1IW7 F;  3L8J A;  1J8Y F;  3JYY A;  4JTD B;  3RVZ A;  4B6I A;  4YT8 A;  1V74 B;  2H7V C;  2QY9 A;  3T6B A;  4DOZ A;  3JT1 A;  1KTM A;  2ETS A;  4JJF A;  1ZHW A;  2EIK C;  4OIR F;  1D1A A;  2IXO A;  4ULW A;  4DBR A;  3FHD A;  3GWN A;  3KYI A;  4A2N B;  2ZXW C;  1YAR O;  1TR2 A;  2RD9 A;  3TJ6 A;  3Q6M A;  2CNW A;  4PAC A;  2J9U A;  4I44 A;  1JOG A;  4CS9 C;  3VYW A;  2R7W A;  5B1B C;  5F5F A;  5FZT A;  1LVK A;  3GM1 A;  3DM5 A;  1MMD A;  3JYH A;  2BC5 A;  4MVS A;  4E0I A;  4JCZ A;  3ABK C;  3DJU B;  4JJG A;  3POV A;  2FAP B;  2J9V A;  4G7H F;  1ZU4 A;  3EZI A;  4ER9 A;  1KU2 A;  3E70 C;  3R7C A;  3GWL A;  2XLW A;  1RCP A;  1Q0F A;  4ULV A;  2HJ3 A;  2FGY A;  2XXA A;  3U8V A;  4NTF A;  3AQC A;  5JSL A;  3HKK A;  4WGY A;  3CAX A;  1GGQ A;  3SXM A;  4IGG A;  2XSE A;  4LDR A;  3GEI A;  5JP7 A;  1V54 C;  2R7R A;  4DBQ A;  2XL6 A;  4I1O B;  3GM3 A;  2IBF A;  2J7P A;  3RH3 A;  1WN0 A;  2Q9A A;  3MFN A;  3ZTZ A;  5DLJ A;  2R7T A;  256B A;  2YRF A;  3MYI A;  4YT5 A;  3OEO A;  3FAP B;  3T9O A;  1FNT c;  3NMI A;  1WGW A;  5COG A;  4CDA A;  3O39 A;  4DVY P;  3B0P A;  3U2M A;  4U5G A;  2EPN A;  3EH1 A;  3UGP A;  3FOO A;  1LE2 A;  1NSG B;  3G4X A;  4J30 B;  3NRH A;  3IEE A;  3K1I C;  2XL4 A;  1YZC A;  3ZG1 A;  4BPM A;  3LES A;  4EBJ A;  5B3S C;  4N4W A;  3NMK A;  3AG1 C;  5COM A;  5F5H A;  4Z9H A;  1Z5Z A;  2CYD A;  3C8G A;  5D92 A;  2LK4 A;  1Z23 A;  4RBN A;  5D91 A;  2JPU A;  3K33 A;  4P6I C;  1MND A;  3ZTM A;  4YT4 A;  1V55 C;  4LER A;  2KQ9 A;  3ZSU A;  5KYY B;  5T1D B;  2I15 A;  2PX3 A;  3E9V A;  3UMH A;  1G8X A;  3PDM P;  4MVZ A;  4JZA A;  1AEP A;  1JMW A;  5DQZ A;  3NDB B;  4U5D E;  4E17 A;  1OCZ C;  2O9X A;  1L3P A;  1OCR C;  4JKV A;  4BEJ A;  1RKE A;  2JX0 A;  4CX9 A;  2HS5 A;  2WZG A;  4CS7 A;  4E0H A;  5A6A A;  1M2V A;  1NU9 C;  2KW3 C;  1Q0G A;  2Y3H A;  4OIP F;  2KNH A;  4Z9I A;  3HNL A;  4G7O F;  2L6H A;  2OG2 A;  4J7Y A;  3W8I A;  5L3Q A;  2IYL D;  3AGU A;  3ZWI A;  2Y3D A;  3K7D A;  1YA7 O;  1Q0M A;  2D4U A;  3MBG A;  1A0B A;  2NUP A;  4U5C E;  4Z9J A;  3T6J A;  1BBH A;  3V5Z A;  3ZC4 A;  1C03 A;  1ZYR F;  4AE4 B;  5FCL A;  4CIH A;  3Q7G A;  1I5N A;  2J0W A;  3I5P A;  3TOM A;  4C7O B;  3RYL A;  1TQG A;  1LE4 A;  2DYS C;  4ZLD A;  4GYT A;  3Q7L A;  4IB4 A;  3U9J A;  2HV6 A;  1HMD A;  2I8B A;  4GQH A;  4N6C A;  4PK4 A;  2YLD A;  5L0G A;  4JTA B;  1WAS A;  1Y4C A;  1FFT C;  5L0D A;  2L9J A;  1A7E A;  2HMQ A;  5EK0 A;  4YT2 A;  3G50 A;  3K1H A;  1U6H A;  3GM2 A;  4YL3 A;  1K40 A;  4XPX A;  5GPG B;  2GAQ A;  3WAQ A;  2W9Y A;  2MWQ A;  2L81 A;  1U89 A;  4EBB A;  3SYN A;  1M56 C;  3MX3 A;  2V3C C;  1OCO C;  4ONS A;  1OW8 A;  3TQO A;  1C02 A;  3OWT A;  4IAO A;  1TFO B;  3LJB A;  3X2Q C;  1NLX A;  3NKE A;  5DVW A;  4U5H A;  3IHU A;  3MYF A;  1Q0D A;  1KNY A;  2J9W A;  1FTS A;  2YLG A;  3EHN A;  2H7O A;  2NSF A;  1HE1 A;  1VLT A;  2LIG A;  2OU6 A;  1HW2 A;  5KYX A;  4HE8 D;  3F46 A;  4PFP A;  4CS8 C;  3ITF A;  1FMW A;  3L34 A;  2OJQ A;  3UMI A;  4E18 A;  1FFH A;  2YL1 A;  2EIJ C;  3SXZ A;  2KK1 A;  1PD0 A;  2W45 A;  5CIV A;  4PJJ A;  2AVK A;  2VAS A;  3BEH A;  2BE5 F;  2AWY A;  4O6M A;  2X51 A;  5B3I A;  2A68 F;  3EHM A;  2BL2 A;  1W2W A;  3N0T A;  2ZXP A;  3VRC A;  3CQZ A;  3I4U A;  3NKD A;  3RFY A;  5E2Q A;  4AK9 A;  5L3V A;  3NYM A;  2Q7R A;  2QUP A;  1ZW3 A;  3FOP A;  4OIQ F;  4NY3 A;  4YL0 A;  1G5Z A;  1OCC C;  5JS5 A;  4C3D A;  3HNJ A;  2EPK X;  3B29 A;  3UR3 C;  2L6F A;  2XS8 A;  1JPJ A;  1O87 A;  5BQH A;  4UDV A;  2OOC A;  3F47 A;  3AG3 C;  3T4R A;  3DD7 A;  3LEV A;  3KH2 A;  2VB6 A;  4DRH B;  5BQG A;  5KYN A;  4DXW A;  5DS4 A;  4OD5 A;  4C3B A;  4C3E A;  2F22 A;  3EPV A;  3IPM O;  3JTL O;  4MQ9 F;  3DI5 A;  4CS8 A;  3NG1 A;  3S0X A;  1JAF A;  1H9G A;  2H8A A;  1E2X A;  3RIP A;  2LP4 A;  3IQ5 A;  4J32 B;  1ZZP A;  4R32 A;  3N2Z B;  2YEV A;  4MW3 A;  5HSW A;  1SZI A;  3LNR A;  3PMR A;  3IQC A;  1R4T A;  1DOV A;  2R7S A;  2HFI A;  1PCX A;  2NUT A;  3U3F A;  4CSA C;  3UNG C;  3ZVR A;  5TJ5 E;  3K66 A;  3I5Q A;  2PNO A;  3VF0 A;  1LS4 A;  3C8G B;  2Q9C A;  2WVN A;  1I4Z A;  2YQY A;  3DKA A;  2EPO A;  2KGO A;  2OEV A;  3KMI A;  4HFF B;  4IRU A;  1NBB A;  4PJL A;  1HE9 A;  1EQ1 A;  2WZF A;  1OW6 A;  3HJC A;  1QKR A;  2J9B A;  4XLN F;  1VTM P;  3U2L A;  4LDQ A;  2QTV A;  1D0Y A;  1VYK A;  2QE9 A;  1IZM A;  2MHR A;  2YWA A;  3H2V A;  4DVZ A;  2Q9B A;  2WL8 A;  4H4K C;  3GAN A;  3Q6N A;  2LSE A;  4P9T A;  4XEF A;  1UFB A;  3SEO A;  5L0I A;  2PFD A;  1GS9 A;  4MTF A;  3B9Q A;  1M2V B;  3AQB A;  4CS9 A;  3EGD A;  2RSE B;  1TWC A;  2AWC A;  4BJT A;  2XS1 A;  4BJ6 C;  2YZS A;  1VK5 A;  1XWJ A;  1NFN A;  1NG1 A;  1YA9 A;  4I1M A;  1RJ9 A;  1QZX A;  1YYX A;  4KNW A;  4MND A;  1TWG A;  2ZD9 A;  2NUP B;  4JE9 A;  4JW1 A;  1ZW2 A;  3O10 A;  1Z7Q c;  3TJ5 A;  4JIO A;  3W4Y A;  4CSA A;  3EQL F;  3SNH A;  1VOM A;  2HSQ A;  1QVX A;  4PJM A;  2OCC C;  3DE8 A;  4AX2 A;  2P7V A;  1M6T A;  5A6B D;  2WB7 A;  3RW0 A;  4XLP F;  3NYL A;  4MW8 A;  4KBL A;  2YLI A;  4W8P A;  1U0B B;  3JRM O;  3SP1 A;  1S05 A;  5B1A C;  1H6G A;  4JCH A;  1QSP A;  2ZXO A;  3QMK A;  3U5S A;  2J46 A;  3A9C A;  4XEK A;  4LLC A;  4XWJ A;  4BEM J;  4DRI B;  2A0B A;  3L1M A;  4JVS A;  1SR2 A;  1WAT A;  2VH3 A;  1FAP B;  2CCY A;  2R05 A;  4U9D A;  4JEB A;  1APC A;  2ICW G;  3AGT A;  4MVQ A;  3RVY A;  2Y39 A;  4KC9 A;  1A7V A;  3WHN A;  4A4A A;  4EWC A;  1ZHT A;  3JRT A;  3DXJ F;  1YDI A;  5COF A;  3QZC A;  5T3W A;  1RXQ A;  4IWB A;  3S90 A;  1Q0K A;  2NSG A;  4U9E A;  5JT4 A;  1N1C A;  1GM5 A;  2E87 A;  4OIN F;  1LI5 A;  1AVO B;  3ASO C;  3K1I A;  3KL4 A;  3FMS A;  3HTK C;  1YLM A;  3KYJ A;  3ZIB A;  4QDL A;  2HMZ A;  3TUL A;  2L6G A;  1YYJ A;  1AUE A;  2C04 A;  3ASN C;  3ZDL A;  4JRZ A;  2B0J A;  3B71 A;  1OKK D;  5T3T A;  2R7U A;  4EUK B;  4U5E E;  3EZH A;  4AL0 A;  5KYU A;  2YL3 A;  2IXP A;  2AU5 A;  2OJE D;  1HMO A;  4WAB A;  3OA1 A;  1ZVZ A;  4FWV A;  3FDQ A;  1MQV A;  2CNW D;  1GQA A;  2PX0 A;  1BZ4 A;  1VYI A;  3FXH A;  3RQF A;  4ANJ A;  3B0V C;  3J06 A;  3ATP A;  2B0H A;  3DJN B;  4BJ1 A;  4YWQ A;  4M63 A;  1ORJ A;  3RQE A;  1MNE A;  1YJG A;  2LFD A;  2V26 A;  4X0R A;  3GEH A;  3S29 A;  2C03 A;  2XLO A;  1JPN A;  4JUR I;  1C17 M;  3S28 A;  4Q4Z F;  5L0F A;  5HV9 A;  3GOR A;  4D4N A;  2ASR A;  2IM8 A;  5CI8 A;  1O5H A;  1YZA A;  3UMK A;  4PR9 A;  4K7B A;  2YVK A;  5EGY A;  1T9K A;  3L8I A;  2Y69 C;  4CJG A;  2LFF A;  1QQ3 A;  2PBE A;  3H65 A;  3M4C A;  2CW0 F;  3NMJ A;  4NTB A;  2DGJ A;  5E3A A;  2R02 A;  2EPM X;  1XZQ A;  2Q4F A;  5A6B A;  1E85 A;  4OIO F;  3H2U A;  4H54 A;  4U5B E;  4K1O A;  1PD1 A;  1H7I A;  5A6K A;  1M2O A;  1DOW A;  2NUT B;  2R7Q A;  5IY5 C;  1E83 A;  2EIN C;  2KJG A;  5CI9 A;  1MMG A;  4NQF A;  1K04 A;  3TK0 A;  1D0X A;  4G78 A;  3IQ6 A;  4Q5S F; 
#chains in the Genus database with same CATH homology
 4J7Y A;  2Q7R A;  2PNO A;  4BPM A;  4YL0 A;  3DWW A;  4JC7 A;  3B29 A;  4NTF A;  5BQH A;  3HKK A;  2UUH A;  5HV9 A;  4AL1 A;  4YL1 A;  2UUI A;  4J7T A;  4JRZ A;  5BQG A;  4NTB A;  4YK5 A;  4NTA A;  4AL0 A;  2H8A A;  4WAB A;  4JCZ A;  4YL3 A;  3LEO A;  3PCV A;  5BQI A;  5K0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...