4JRZA

Human ltc4 synthase in complex with product analogs - implications for enzyme catalysis
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
155
structure length
155
Chain Sequence
MHHHHHHKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALFLLVALAALGLLAHFLPAALRAALLGRLRTLLPW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Leukotriene C4 synthase
publication title Crystal Structures of Leukotriene C4 Synthase in Complex with Product Analogs: IMPLICATIONS FOR THE ENZYME MECHANISM.
pubmed doi rcsb
source organism Homo sapiens
total genus 60
structure length 155
sequence length 155
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4jrzA00
3LEOA 2Q7RA 2UUIA 4JCZA 4YL3A 5BQIA 5BQHA 4YK5A 4NTBA 4WABA 4J7YA 5K0IA 4NTAA 4JC7A 4AL0A 4YL0A 4BPMA 2UUHA 3B29A 2H8AA 3HKKA 3PCVA 5BQGA 4YL1A 4J7TA 3DWWA 4NTFA 5HV9A 4JRZA 2PNOA 4AL1A
chains in the Genus database with same CATH superfamily
3ZTMA 1S7ZA 3C8GA 3U9MA 1MMAA 4FX5A 5JS5A 3O39A 4CBEA 1VOMA 3LESA 3JCUQ 3QW0A 1QPUA 4B6IA 4U5HA 2A0BA 1Z23A 2Q9AA 2PP4A 3IEEA 3NYLA 4IJJA 5DQTA 4FAPB 1A7EA 4EBKA 1TFKB 2DGJA 2YLIA 1QLEC 5DS6A 4LDQA 1AVOB 1VB5A 2D4UA 3I5PA 1QZXA 1ZHYA 1NU7D 3Q6MA 3TK0A 1MNDA 2KC3A 2R05A 3TQOA 4MVZA 1WOLA 2YQYA 1ORJA 2C03A 3K66A 2H7BA 3POVA 3DWWA 1F1MA 1YVIA 1KNYA 5JSLA 4YT4A 2Q4FA 1M2VB 2ZXPA 4HE8D 4IGGA 1M57C 5EK0A 4E7SA 2XLOA 4G0HA 1RKCA 2XXAA 1H9TA 3JZ0A 1B68A 1NSGB 2M4EA 3JSZA 4XPYA 4ONSA 5F5HA 5BQHA 4XEKA 1E2XA 1R4TA 4JKVA 4NTBA 4YK5A 1ZYRF 3TOLA 3UR3C 3V5YA 1NFOA 3EGDB 2CW0F 1UFBA 1U0BB 1VLSA 1UG7A 1TR2A 2AWYA 3JRMO 1YA9A 1RJ9A 4Z9IA 5JRAA 1JRAA 1LKXA 5E33A 5TJ5E 1Y4CA 4F4BA 2JD3A 2LIGA 1Q0DA 1BZ4A 4YWQA 1YZCA 2HFIA 4JJFA 2G62A 4YL1A 5AC4A 1QVXA 2NSFA 2LSEA 1BBHA 2HS5A 3C7JA 3K6BA 1A0BA 3LLKA 3H2UA 3SXZA 2PNOA 3EG9A 1H7IA 4CSAC 4PK4A 3K33A 4L6RA 4DRIB 1LS4A 3Q6NA 4JCZA 3T6BA 1TWAA 4C3BA 2F22A 1T01A 1JPNA 4QI2A 2Y3DA 2X0CA 3PDMP 2W4BA 2HKVA 3RIPA 1O3UA 256BA 2FGYA 2YLGA 2XSEA 4PFOA 1N1CA 2VC9A 3VAYA 3W4YA 4DOZA 1JR8A 3FAJA 3FVYA 2ICWG 4CS8C 1RCPA 1GQAA 2UUHA 5COGA 1T9KA 2AWCA 1E83A 3CZ6A 2R7WA 2H8AA 4JJGA 1C02A 3RFYA 3SP1A 3T6GB 5KYUA 4BJTA 2A68F 1RKEB 2MYSA 3GEHA 4N6CA 4A2NB 4BJ6C 2LQGA 2NSGA 4P9TA 2KK1A 5A6AA 1FAPB 4CS7A 3DJUB 4OIQF 5F28E 2R25A 2YEVA 1GS9A 3GEEA 1FR0A 1YZAA 4LDKA 2KNHA 4BJ6A 1IZMA 1YYJA 4W8PA 2HJ3A 4CDYA 5L0FA 3UMHA 1VLTA 4MTFA 5DLJA 4Q5SF 4D4XA 4PJJA 5IY5C 5KYYA 3TD7A 1YARO 5CIVA 1OKKA 3FXHA 3W2VA 2V26A 2XM0A 1KTMA 4XWJA 4OINF 2J9UA 4BPMA 4O79A 1M2VA 1BR4A 1ST6A 3ZQYA 5COMA 3NG1A 3PCVA 4XLNF 1ZU5A 1LVKA 3DKAA 3HTKC 1I4ZA 4IB4A 2ZXWC 4I3MA 1Z63A 4J7TA 4ANJA 3HNLA 3KYJA 2PX3A 3EGDA 2NUTB 4E0HA 3I5QA 1E84A 4HFKB 3EPVA 1EI7A 2WVOA 3GM3A 5AGFA 3V5XA 3LEOA 3X2QC 3B71A 3JYYA 1ORYA 1VMAA 2IXMA 1ZW2A 1FMWA 2CDQA 3DM9B 2XLHA 4IAOA 4DBQA 2VCBA 2YLDA 3AQCA 5CI8A 5FZTA 4KNVA 2J0XA 2QTVA 3GODA 2YL0A 4JVSA 2LFDA 3N0TA 4BJ1A 4NTAA 2L6HA 1LPEA 1T6QA 4G78A 3QVYA 2MWQA 3DD7A 1XZQA 4GEHA 3K1IA 4LERA 5AC5A 3RYLA 2DB4A 3WG7C 1BR1A 1NZEA 1LE4A 2ZD9A 3DJNB 4RD9A 2CGEA 2Y39A 3GEIA 4O6NA 3RF3A 2Y3GA 2AVKA 1C17M 1DOWA 2IM8A 2NG1A 3KH2A 4O6MA 3I4UA 3VYWA 2C04A 3EFOB 3O55A 4DVYP 2EILC 1CGOA 3LNRA 4P6IC 1TWHA 2WZLA 3EH1A 3SXYA 3U9JA 3S28A 2EPMX 3OWTA 3ZQVA 2R7RA 3QMKA 3U8PA 2CNWD 3MYFA 1HMOA 1NG1A 3GANA 4QI0A 4U5EE 3ZIBA 5JT4A 2GFHA 4IAQA 5HSWA 3AG2C 3VRCA 1FFTC 1Q0MA 3KPHA 2XLVA 4ULWA 4MTGA 1K40A 2R03A 2WZGA 1QKRA 2R7QA 4PJNA 1JMWA 2RSEB 3EZHA 4WABA 1OCRC 1OXBA 2R7TA 4MVRA 3U3BA 3SNHA 4AE4B 3RQFA 3C62A 2AP3A 1XZPA 3HNKA 1D1CA 4U5CE 1NFNA 2L9JA 1YYXA 2EIMC 2YL7A 5JLIA 4JTCB 3ZTZA 3IQCA 1JAFA 2DYRC 3JT1A 3V5ZA 3W2WA 5JUAA 2BC5A 1D1BA 1T5OA 4MW8A 5D92A 1OCZC 5T3TA 1FTSA 3NMKA 3L0IA 2QUPA 3U8VA 3US6A 5KYNA 3DZAA 2HMQA 2XLWA 3EHNA 5EGYA 4LLCA 1T6IA 2Y69C 4I1MA 2GAQA 3DE9A 1ZZPA 2Y3BA 4CIHA 3UGPA 1O5HA 3L8JA 2NUPB 3QW1A 4MS2A 4Q7CA 4C3EA 4CS9C 4EHPA 4MQ9F 4C7OA 4XPXA 2R7UA 4NY3A 2W45A 5DQZA 1A41A 5L0HA 2DI3A 4OD4A 3QVZA 5BUOA 3B0PA 3GORA 4EIYA 4UDVA 2YRFA 3MX3A 4JEAA 3S29A 3B0UX 4U9EA 5DVWA 2NUTA 2EIKC 4JEBA 4MVUA 1R5ID 3AGTA 2V3CC 2J46A 3QZCA 2TMVP 1V4AA 5L0DA 4XEFA 4PJMA 1ZHTA 4YT8A 2EPKX 3B9QA 2IYLD 3NKEA 2BE5F 3AG4C 4A4AA 3N24A 1OW7A 2P0NA 1K04A 1K05A 2OEVA 1WWPA 4WGYA 4ZLDA 1CGNA 2IBFA 5COFA 4C3DA 1OR2A 3HNJA 2CYDA 2XRHA 4U5DE 5A6BD 4ULVA 3CQZA 1I4YA 2LFFA 4K7BA 3JTLO 1S05A 2W4MA 2ASRA 2R9RB 2JPUA 2YVKA 2L6FA 1KU2A 2L7AA 2YL3A 4CSAA 3J06A 1BR2A 1OCOC 4U5FE 4JC7A 4P9FA 2L81A 1FFHA 5JVEA 2M64A 3B29A 1APCA 4DVZA 2FFHA 1CPQA 4U9DA 3FDQA 3UMIA 4KC9A 4LDRA 3AJMA 3GWLA 3DI5A 2G3KA 2A6EF 3DAFA 3RVZA 1J8YF 2IXNA 2OU6A 3MLGA 3ZG1A 4BEJA 3U2MA 1MQVA 2QLAA 4JCHA 4CS8A 4GQHA 4IRUA 3LS0A 1Z5ZA 4YJWA 3ZWIA 4NCQA 3S90A 3U0CA 4YT5A 4AE4A 5A69A 3T9OA 5GPGB 1D0XA 4JW1A 3EGXB 3SXKA 2IOQA 1Q0GA 3DMDA 1OR3A 3C8ZA 2WZFA 2LD6A 2EPOA 1SMYF 2YZSA 3ITFA 3C8GB 2CCYA 4U5GA 3EHMA 4Z9HA 2PX0A 2YWAA 1M6TA 2HZ8A 4BJ5C 3W8HA 1CGME 3U5SA 3EQLF 3PMRA 2HV7A 4KBLA 4EBBA 3EZIA 3ABMC 3OA1A 4XQ1A 4CJGA 2XS8A 1VTMP 3UMKA 1MMNA 3OEOA 3KKBA 2H7VC 3IQ5A 3SZRA 1WTYA 5HV9A 5CI9A 4EBJA 3DAGA 3V7OA 3RQEA 1LI7A 4YT2A 1FMVA 2OQMA 3ASNC 3RKOF 2OOCA 2UUIA 4CIPA 2ZXOA 3L8IA 1OW6A 5JP7A 2EINC 3ZDLA 2XLEA 2E87A 2XL8A 3MFNA 1L7CA 2A6HF 3IQ6A 2J9WA 3TJ6A 3X1OA 3ASOC 5EHHA 3VF0A 4XPWA 2G3VA 5L3VA 1ORSC 3K1HA 4JZAA 3FOPA 4OD5A 4W8KA 5T1DB 1HW2A 3H2VA 3JRTA 1A7VA 2J7PD 4YL0A 4I44A 1GGQA 4XEVA 4DRJB 5B1BC 4GYTA 1V74B 5DS5A 3HJCA 2PFDA 2OCCC 3A9CA 4DBRA 5BQGA 3JYHA 4K0DA 3WHNA 2EPNA 2HSQA 2HV6A 2CNWA 2IXPA 3SEOA 1RXQA 1J8MF 1VK5A 3ZC4A 1Z6AA 2VB6A 2YL1A 3IPMO 2J0WA 1QQ3A 2RD9A 3KL4A 3IHUA 2VCCA 3N2ZB 4WJ0A 3TJ5A 2YKZA 4JIOA 1D0YA 2J45A 3AG3C 4N06A 4BG0A 3MBGA 4MW3A 1LM3B 3KYIA 3NKDA 4YN0B 3O6XA 1TWGA 4AX2A 3RVYA 4JTAB 3FHDA 4CDVA 4N4WA 1RKEA 1WGWA 1Z3IX 4NC3A 3E70C 4KNWA 1BDJB 1ZU4A 3LAYA 2WVQA 1U6HA 2PBEA 3U3FA 4AL0A 2B0HA 2OKUA 4O7GA 3DE8A 2WL8A 4DXWA 1LI5A 2NPUA 2O9XA 1HE1A 1MMDA 1WN0A 5E2QA 1PCXA 3PHF2 2Y3HA 4MNDA 1PV3A 1VYKA 5L0JA 3R7CA 4K1OA 1AEPA 1AUEA 3GM2A 3Q7LA 2KYHA 4BEMJ 2XLMA 3TULA 4AL1A 3EJNA 3ZVRA 3IQTA 2Q9BA 3SXMA 5KYUB 4NQFA 3NMIA 2KSFA 3C8GD 1ZHWA 3S9OA 1LS1A 5DS4A 3WODF 2LK4A 4Z9JA 1G4WR 1M2OA 2J8WA 2HSBA 1H9GA 1NBBA 3BRJA 4PFPA 1ZW3A 1C03A 1W2WA 4DRHB 3G4ZA 1HMDA 4CS9A 2OJED 4J30B 1VYIA 2ZXRA 3T4RA 2VH3A 2A69F 3CEXA 1OCCC 3U2LA 1G4US 2PF4E 5KYYB 3UNGC 1OW8A 3AG1C 3NYJA 2P1AA 4OIOF 3FOOA 1TQGA 4CJOA 3M79A 4KI2A 4MTOA 5D91A 1YA7O 2ETSA 4RDAA 5L0CA 1M56C 1CPRA 2IXOA 1SR2A 1LE2A 2WB7A 2A1DD 5A6BA 3M4BA 2Q00A 3NYMA 3M1CB 2J9BA 2GWWA 3NMJA 3BEHA 1QSPA 1OQCA 2EPLX 3B0VC 1G5ZA 4ZLCA 4D4NA 2DYSC 5T3WA 3RW0A 1A7DA 1IW7F 2KW3C 2XL6A 2A0UA 3LEVA 4EUKB 4MVOA 3KMIA 2XLDA 3EFOA 1O87A 4J7YA 5B3IA 5B1AC 1ZHZA 2WVNA 3C18A 4EKWA 5A6JA 2W9YA 3M4CA 4E17A 1HY5A 5FCLA 4G7HF 4G7OF 1NU9C 2LP4A 3DXJF 1Q0KA 5B3SC 1LIHA 3LS1A 1MNEA 3ABKC 4LLEA 5A6KA 2HMZA 2QY9A 4HEAJ 2P6VA 2QE9A 1U89A 1TWCA 2P7VA 3S27A 3ABLC 2P61A 1TKNA 1E86A 2FAPB 2H7OA 2Q7RA 1YJGA 2BL2A 2KQ9A 3L34A 3T6JA 1D0ZA 1T6UA 2Z15A 1I5NA 4IWBA 5KYXB 3G50A 1EA8A 4FESA 3G4XA 4OIPF 1HE9A 5KYWB 2ZPAA 2Q9CA 1V54C 2HUJA 5K0IA 4MVSA 4H4KC 2OEXA 4J32B 4U5BE 4M63A 4H54A 4XTKA 4N6HA 4PJLA 2AU5A 5L0GA 1V55C 1SZIA 4I1OB 1MMGA 3NRHA 2I15A 2NUPA 2QNLA 5L0IA 1E85A 2B0JA 1HW1A 1ZHXA 3LUTB 3L1MA 1ZVZA 3F46A 4BJ5A 2LCHA 2OG2A 2GA0A 5L3QA 4XLPF 4JE9A 2R7SA 1JPJA 1PD0A 1NLXA 3MYIA 3DM5A 2YHSA 1YLMA 4JURI 2R7VA 3A11A 3WAQA 4RBNA 3M15A 2XS1A 3RH3A 3E9VA 1EQ1A 5E3CA 4PACA 2J7PA 4FWVA 3S0XA 2GDCA 1SYQA 5F5FA 1Y6DA 4MVQA 1DOVA 2I8BA 2X51A 4C7OB 4HFFB 1OKKD 4E7ZA 3AGUA 2XXAB 2R02A 4G7ZF 3AOUA 3LNMB 3HNIA 3AQBA 3O10A 3CAXA 3F47A 4X0RA 4AK9A 3SYNA 5E3AA 1FNTc 4Q4ZF 1YDIA 3TOMA 3FMSA 1RJ9B 3GWNA 4NTFA 4LACB 4PR9A 4E18A 2D5RB 2XM4A 4O6YA 2HJMA 3LLIA 3R2PA 4OIRF 4CX9A 3W8IA 3JSEO 3CSKA 4EWCA 3S84A 3K1IC 4YL3A 5BQIA 3UGOA 2VASA 3ATPA 3EH2A 1TFOB 3VM6A 4MVMA 2KJGA 3HLZA 4E0IA 2J9VA 1L3PA 3ZSUA 2JX0A 3H65A 1GM5A 4R32A 1G8XA 1Z7Qc 3EG9B 3LJBA 3RQGA 1WATA 4WGZA 1PD1A 2EIJC 3NDBB 4QDLA 2R7XA 1JOGA 1H6GA 2KGOA 3Q7GA 1Q0FA 1OXKA 2OJQA 2VCAA 3C63A 1XWJA 3HKKA 3K7DA 3QTHA 1WASA 4JTDB 4CDAA 4DJ9A 1RMVA 3GM1A 1EKYA 3EGXA 5KYXA 3FAPB 4IARA 2R7OA 2L6GA 1YAUO 2MHRA 4ER9A 2XL4A 1D1AA 1SF8A 2Q3TA 5KYWA 3ECSA 4JRZA
chains in the Genus database with same CATH topology
3LEOA 2Q7RA 2UUIA 4JCZA 4YL3A 5BQIA 5BQHA 4YK5A 4NTBA 4WABA 4J7YA 5K0IA 4NTAA 4JC7A 4AL0A 4YL0A 4BPMA 2UUHA 3B29A 2H8AA 3HKKA 3PCVA 5BQGA 4YL1A 4J7TA 3DWWA 4NTFA 5HV9A 4JRZA 2PNOA 4AL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LEO A;  2Q7R A;  2UUI A;  4JCZ A;  4YL3 A;  5BQI A;  5BQH A;  4YK5 A;  4NTB A;  4WAB A;  4J7Y A;  5K0I A;  4NTA A;  4JC7 A;  4AL0 A;  4YL0 A;  4BPM A;  2UUH A;  3B29 A;  2H8A A;  3HKK A;  3PCV A;  5BQG A;  4YL1 A;  4J7T A;  3DWW A;  4NTF A;  5HV9 A;  4JRZ A;  2PNO A;  4AL1 A; 
#chains in the Genus database with same CATH topology
 3ZTM A;  1S7Z A;  3C8G A;  3U9M A;  1MMA A;  4FX5 A;  5JS5 A;  3O39 A;  4CBE A;  1VOM A;  3LES A;  3JCU Q;  3QW0 A;  1QPU A;  4B6I A;  4U5H A;  2A0B A;  1Z23 A;  2Q9A A;  2PP4 A;  3IEE A;  3NYL A;  4IJJ A;  5DQT A;  4FAP B;  1A7E A;  4EBK A;  1TFK B;  2DGJ A;  2YLI A;  1QLE C;  5DS6 A;  4LDQ A;  1AVO B;  1VB5 A;  2D4U A;  3I5P A;  1QZX A;  1ZHY A;  1NU7 D;  3Q6M A;  3TK0 A;  1MND A;  2KC3 A;  2R05 A;  3TQO A;  4MVZ A;  1WOL A;  2YQY A;  1ORJ A;  2C03 A;  3K66 A;  2H7B A;  3POV A;  3DWW A;  1F1M A;  1YVI A;  1KNY A;  5JSL A;  4YT4 A;  2Q4F A;  1M2V B;  2ZXP A;  4HE8 D;  4IGG A;  1M57 C;  5EK0 A;  4E7S A;  2XLO A;  4G0H A;  1RKC A;  2XXA A;  1H9T A;  3JZ0 A;  1B68 A;  1NSG B;  2M4E A;  3JSZ A;  4XPY A;  4ONS A;  5F5H A;  5BQH A;  4XEK A;  1E2X A;  1R4T A;  4JKV A;  4NTB A;  4YK5 A;  1ZYR F;  3TOL A;  3UR3 C;  3V5Y A;  1NFO A;  3EGD B;  2CW0 F;  1UFB A;  1U0B B;  1VLS A;  1UG7 A;  1TR2 A;  2AWY A;  3JRM O;  1YA9 A;  1RJ9 A;  4Z9I A;  5JRA A;  1JRA A;  1LKX A;  5E33 A;  5TJ5 E;  1Y4C A;  4F4B A;  2JD3 A;  2LIG A;  1Q0D A;  1BZ4 A;  4YWQ A;  1YZC A;  2HFI A;  4JJF A;  2G62 A;  4YL1 A;  5AC4 A;  1QVX A;  2NSF A;  2LSE A;  1BBH A;  2HS5 A;  3C7J A;  3K6B A;  1A0B A;  3LLK A;  3H2U A;  3SXZ A;  2PNO A;  3EG9 A;  1H7I A;  4CSA C;  4PK4 A;  3K33 A;  4L6R A;  4DRI B;  1LS4 A;  3Q6N A;  4JCZ A;  3T6B A;  1TWA A;  4C3B A;  2F22 A;  1T01 A;  1JPN A;  4QI2 A;  2Y3D A;  2X0C A;  3PDM P;  2W4B A;  2HKV A;  3RIP A;  1O3U A;  256B A;  2FGY A;  2YLG A;  2XSE A;  4PFO A;  1N1C A;  2VC9 A;  3VAY A;  3W4Y A;  4DOZ A;  1JR8 A;  3FAJ A;  3FVY A;  2ICW G;  4CS8 C;  1RCP A;  1GQA A;  2UUH A;  5COG A;  1T9K A;  2AWC A;  1E83 A;  3CZ6 A;  2R7W A;  2H8A A;  4JJG A;  1C02 A;  3RFY A;  3SP1 A;  3T6G B;  5KYU A;  4BJT A;  2A68 F;  1RKE B;  2MYS A;  3GEH A;  4N6C A;  4A2N B;  4BJ6 C;  2LQG A;  2NSG A;  4P9T A;  2KK1 A;  5A6A A;  1FAP B;  4CS7 A;  3DJU B;  4OIQ F;  5F28 E;  2R25 A;  2YEV A;  1GS9 A;  3GEE A;  1FR0 A;  1YZA A;  4LDK A;  2KNH A;  4BJ6 A;  1IZM A;  1YYJ A;  4W8P A;  2HJ3 A;  4CDY A;  5L0F A;  3UMH A;  1VLT A;  4MTF A;  5DLJ A;  4Q5S F;  4D4X A;  4PJJ A;  5IY5 C;  5KYY A;  3TD7 A;  1YAR O;  5CIV A;  1OKK A;  3FXH A;  3W2V A;  2V26 A;  2XM0 A;  1KTM A;  4XWJ A;  4OIN F;  2J9U A;  4BPM A;  4O79 A;  1M2V A;  1BR4 A;  1ST6 A;  3ZQY A;  5COM A;  3NG1 A;  3PCV A;  4XLN F;  1ZU5 A;  1LVK A;  3DKA A;  3HTK C;  1I4Z A;  4IB4 A;  2ZXW C;  4I3M A;  1Z63 A;  4J7T A;  4ANJ A;  3HNL A;  3KYJ A;  2PX3 A;  3EGD A;  2NUT B;  4E0H A;  3I5Q A;  1E84 A;  4HFK B;  3EPV A;  1EI7 A;  2WVO A;  3GM3 A;  5AGF A;  3V5X A;  3LEO A;  3X2Q C;  3B71 A;  3JYY A;  1ORY A;  1VMA A;  2IXM A;  1ZW2 A;  1FMW A;  2CDQ A;  3DM9 B;  2XLH A;  4IAO A;  4DBQ A;  2VCB A;  2YLD A;  3AQC A;  5CI8 A;  5FZT A;  4KNV A;  2J0X A;  2QTV A;  3GOD A;  2YL0 A;  4JVS A;  2LFD A;  3N0T A;  4BJ1 A;  4NTA A;  2L6H A;  1LPE A;  1T6Q A;  4G78 A;  3QVY A;  2MWQ A;  3DD7 A;  1XZQ A;  4GEH A;  3K1I A;  4LER A;  5AC5 A;  3RYL A;  2DB4 A;  3WG7 C;  1BR1 A;  1NZE A;  1LE4 A;  2ZD9 A;  3DJN B;  4RD9 A;  2CGE A;  2Y39 A;  3GEI A;  4O6N A;  3RF3 A;  2Y3G A;  2AVK A;  1C17 M;  1DOW A;  2IM8 A;  2NG1 A;  3KH2 A;  4O6M A;  3I4U A;  3VYW A;  2C04 A;  3EFO B;  3O55 A;  4DVY P;  2EIL C;  1CGO A;  3LNR A;  4P6I C;  1TWH A;  2WZL A;  3EH1 A;  3SXY A;  3U9J A;  3S28 A;  2EPM X;  3OWT A;  3ZQV A;  2R7R A;  3QMK A;  3U8P A;  2CNW D;  3MYF A;  1HMO A;  1NG1 A;  3GAN A;  4QI0 A;  4U5E E;  3ZIB A;  5JT4 A;  2GFH A;  4IAQ A;  5HSW A;  3AG2 C;  3VRC A;  1FFT C;  1Q0M A;  3KPH A;  2XLV A;  4ULW A;  4MTG A;  1K40 A;  2R03 A;  2WZG A;  1QKR A;  2R7Q A;  4PJN A;  1JMW A;  2RSE B;  3EZH A;  4WAB A;  1OCR C;  1OXB A;  2R7T A;  4MVR A;  3U3B A;  3SNH A;  4AE4 B;  3RQF A;  3C62 A;  2AP3 A;  1XZP A;  3HNK A;  1D1C A;  4U5C E;  1NFN A;  2L9J A;  1YYX A;  2EIM C;  2YL7 A;  5JLI A;  4JTC B;  3ZTZ A;  3IQC A;  1JAF A;  2DYR C;  3JT1 A;  3V5Z A;  3W2W A;  5JUA A;  2BC5 A;  1D1B A;  1T5O A;  4MW8 A;  5D92 A;  1OCZ C;  5T3T A;  1FTS A;  3NMK A;  3L0I A;  2QUP A;  3U8V A;  3US6 A;  5KYN A;  3DZA A;  2HMQ A;  2XLW A;  3EHN A;  5EGY A;  4LLC A;  1T6I A;  2Y69 C;  4I1M A;  2GAQ A;  3DE9 A;  1ZZP A;  2Y3B A;  4CIH A;  3UGP A;  1O5H A;  3L8J A;  2NUP B;  3QW1 A;  4MS2 A;  4Q7C A;  4C3E A;  4CS9 C;  4EHP A;  4MQ9 F;  4C7O A;  4XPX A;  2R7U A;  4NY3 A;  2W45 A;  5DQZ A;  1A41 A;  5L0H A;  2DI3 A;  4OD4 A;  3QVZ A;  5BUO A;  3B0P A;  3GOR A;  4EIY A;  4UDV A;  2YRF A;  3MX3 A;  4JEA A;  3S29 A;  3B0U X;  4U9E A;  5DVW A;  2NUT A;  2EIK C;  4JEB A;  4MVU A;  1R5I D;  3AGT A;  2V3C C;  2J46 A;  3QZC A;  2TMV P;  1V4A A;  5L0D A;  4XEF A;  4PJM A;  1ZHT A;  4YT8 A;  2EPK X;  3B9Q A;  2IYL D;  3NKE A;  2BE5 F;  3AG4 C;  4A4A A;  3N24 A;  1OW7 A;  2P0N A;  1K04 A;  1K05 A;  2OEV A;  1WWP A;  4WGY A;  4ZLD A;  1CGN A;  2IBF A;  5COF A;  4C3D A;  1OR2 A;  3HNJ A;  2CYD A;  2XRH A;  4U5D E;  5A6B D;  4ULV A;  3CQZ A;  1I4Y A;  2LFF A;  4K7B A;  3JTL O;  1S05 A;  2W4M A;  2ASR A;  2R9R B;  2JPU A;  2YVK A;  2L6F A;  1KU2 A;  2L7A A;  2YL3 A;  4CSA A;  3J06 A;  1BR2 A;  1OCO C;  4U5F E;  4JC7 A;  4P9F A;  2L81 A;  1FFH A;  5JVE A;  2M64 A;  3B29 A;  1APC A;  4DVZ A;  2FFH A;  1CPQ A;  4U9D A;  3FDQ A;  3UMI A;  4KC9 A;  4LDR A;  3AJM A;  3GWL A;  3DI5 A;  2G3K A;  2A6E F;  3DAF A;  3RVZ A;  1J8Y F;  2IXN A;  2OU6 A;  3MLG A;  3ZG1 A;  4BEJ A;  3U2M A;  1MQV A;  2QLA A;  4JCH A;  4CS8 A;  4GQH A;  4IRU A;  3LS0 A;  1Z5Z A;  4YJW A;  3ZWI A;  4NCQ A;  3S90 A;  3U0C A;  4YT5 A;  4AE4 A;  5A69 A;  3T9O A;  5GPG B;  1D0X A;  4JW1 A;  3EGX B;  3SXK A;  2IOQ A;  1Q0G A;  3DMD A;  1OR3 A;  3C8Z A;  2WZF A;  2LD6 A;  2EPO A;  1SMY F;  2YZS A;  3ITF A;  3C8G B;  2CCY A;  4U5G A;  3EHM A;  4Z9H A;  2PX0 A;  2YWA A;  1M6T A;  2HZ8 A;  4BJ5 C;  3W8H A;  1CGM E;  3U5S A;  3EQL F;  3PMR A;  2HV7 A;  4KBL A;  4EBB A;  3EZI A;  3ABM C;  3OA1 A;  4XQ1 A;  4CJG A;  2XS8 A;  1VTM P;  3UMK A;  1MMN A;  3OEO A;  3KKB A;  2H7V C;  3IQ5 A;  3SZR A;  1WTY A;  5HV9 A;  5CI9 A;  4EBJ A;  3DAG A;  3V7O A;  3RQE A;  1LI7 A;  4YT2 A;  1FMV A;  2OQM A;  3ASN C;  3RKO F;  2OOC A;  2UUI A;  4CIP A;  2ZXO A;  3L8I A;  1OW6 A;  5JP7 A;  2EIN C;  3ZDL A;  2XLE A;  2E87 A;  2XL8 A;  3MFN A;  1L7C A;  2A6H F;  3IQ6 A;  2J9W A;  3TJ6 A;  3X1O A;  3ASO C;  5EHH A;  3VF0 A;  4XPW A;  2G3V A;  5L3V A;  1ORS C;  3K1H A;  4JZA A;  3FOP A;  4OD5 A;  4W8K A;  5T1D B;  1HW2 A;  3H2V A;  3JRT A;  1A7V A;  2J7P D;  4YL0 A;  4I44 A;  1GGQ A;  4XEV A;  4DRJ B;  5B1B C;  4GYT A;  1V74 B;  5DS5 A;  3HJC A;  2PFD A;  2OCC C;  3A9C A;  4DBR A;  5BQG A;  3JYH A;  4K0D A;  3WHN A;  2EPN A;  2HSQ A;  2HV6 A;  2CNW A;  2IXP A;  3SEO A;  1RXQ A;  1J8M F;  1VK5 A;  3ZC4 A;  1Z6A A;  2VB6 A;  2YL1 A;  3IPM O;  2J0W A;  1QQ3 A;  2RD9 A;  3KL4 A;  3IHU A;  2VCC A;  3N2Z B;  4WJ0 A;  3TJ5 A;  2YKZ A;  4JIO A;  1D0Y A;  2J45 A;  3AG3 C;  4N06 A;  4BG0 A;  3MBG A;  4MW3 A;  1LM3 B;  3KYI A;  3NKD A;  4YN0 B;  3O6X A;  1TWG A;  4AX2 A;  3RVY A;  4JTA B;  3FHD A;  4CDV A;  4N4W A;  1RKE A;  1WGW A;  1Z3I X;  4NC3 A;  3E70 C;  4KNW A;  1BDJ B;  1ZU4 A;  3LAY A;  2WVQ A;  1U6H A;  2PBE A;  3U3F A;  4AL0 A;  2B0H A;  2OKU A;  4O7G A;  3DE8 A;  2WL8 A;  4DXW A;  1LI5 A;  2NPU A;  2O9X A;  1HE1 A;  1MMD A;  1WN0 A;  5E2Q A;  1PCX A;  3PHF 2;  2Y3H A;  4MND A;  1PV3 A;  1VYK A;  5L0J A;  3R7C A;  4K1O A;  1AEP A;  1AUE A;  3GM2 A;  3Q7L A;  2KYH A;  4BEM J;  2XLM A;  3TUL A;  4AL1 A;  3EJN A;  3ZVR A;  3IQT A;  2Q9B A;  3SXM A;  5KYU B;  4NQF A;  3NMI A;  2KSF A;  3C8G D;  1ZHW A;  3S9O A;  1LS1 A;  5DS4 A;  3WOD F;  2LK4 A;  4Z9J A;  1G4W R;  1M2O A;  2J8W A;  2HSB A;  1H9G A;  1NBB A;  3BRJ A;  4PFP A;  1ZW3 A;  1C03 A;  1W2W A;  4DRH B;  3G4Z A;  1HMD A;  4CS9 A;  2OJE D;  4J30 B;  1VYI A;  2ZXR A;  3T4R A;  2VH3 A;  2A69 F;  3CEX A;  1OCC C;  3U2L A;  1G4U S;  2PF4 E;  5KYY B;  3UNG C;  1OW8 A;  3AG1 C;  3NYJ A;  2P1A A;  4OIO F;  3FOO A;  1TQG A;  4CJO A;  3M79 A;  4KI2 A;  4MTO A;  5D91 A;  1YA7 O;  2ETS A;  4RDA A;  5L0C A;  1M56 C;  1CPR A;  2IXO A;  1SR2 A;  1LE2 A;  2WB7 A;  2A1D D;  5A6B A;  3M4B A;  2Q00 A;  3NYM A;  3M1C B;  2J9B A;  2GWW A;  3NMJ A;  3BEH A;  1QSP A;  1OQC A;  2EPL X;  3B0V C;  1G5Z A;  4ZLC A;  4D4N A;  2DYS C;  5T3W A;  3RW0 A;  1A7D A;  1IW7 F;  2KW3 C;  2XL6 A;  2A0U A;  3LEV A;  4EUK B;  4MVO A;  3KMI A;  2XLD A;  3EFO A;  1O87 A;  4J7Y A;  5B3I A;  5B1A C;  1ZHZ A;  2WVN A;  3C18 A;  4EKW A;  5A6J A;  2W9Y A;  3M4C A;  4E17 A;  1HY5 A;  5FCL A;  4G7H F;  4G7O F;  1NU9 C;  2LP4 A;  3DXJ F;  1Q0K A;  5B3S C;  1LIH A;  3LS1 A;  1MNE A;  3ABK C;  4LLE A;  5A6K A;  2HMZ A;  2QY9 A;  4HEA J;  2P6V A;  2QE9 A;  1U89 A;  1TWC A;  2P7V A;  3S27 A;  3ABL C;  2P61 A;  1TKN A;  1E86 A;  2FAP B;  2H7O A;  2Q7R A;  1YJG A;  2BL2 A;  2KQ9 A;  3L34 A;  3T6J A;  1D0Z A;  1T6U A;  2Z15 A;  1I5N A;  4IWB A;  5KYX B;  3G50 A;  1EA8 A;  4FES A;  3G4X A;  4OIP F;  1HE9 A;  5KYW B;  2ZPA A;  2Q9C A;  1V54 C;  2HUJ A;  5K0I A;  4MVS A;  4H4K C;  2OEX A;  4J32 B;  4U5B E;  4M63 A;  4H54 A;  4XTK A;  4N6H A;  4PJL A;  2AU5 A;  5L0G A;  1V55 C;  1SZI A;  4I1O B;  1MMG A;  3NRH A;  2I15 A;  2NUP A;  2QNL A;  5L0I A;  1E85 A;  2B0J A;  1HW1 A;  1ZHX A;  3LUT B;  3L1M A;  1ZVZ A;  3F46 A;  4BJ5 A;  2LCH A;  2OG2 A;  2GA0 A;  5L3Q A;  4XLP F;  4JE9 A;  2R7S A;  1JPJ A;  1PD0 A;  1NLX A;  3MYI A;  3DM5 A;  2YHS A;  1YLM A;  4JUR I;  2R7V A;  3A11 A;  3WAQ A;  4RBN A;  3M15 A;  2XS1 A;  3RH3 A;  3E9V A;  1EQ1 A;  5E3C A;  4PAC A;  2J7P A;  4FWV A;  3S0X A;  2GDC A;  1SYQ A;  5F5F A;  1Y6D A;  4MVQ A;  1DOV A;  2I8B A;  2X51 A;  4C7O B;  4HFF B;  1OKK D;  4E7Z A;  3AGU A;  2XXA B;  2R02 A;  4G7Z F;  3AOU A;  3LNM B;  3HNI A;  3AQB A;  3O10 A;  3CAX A;  3F47 A;  4X0R A;  4AK9 A;  3SYN A;  5E3A A;  1FNT c;  4Q4Z F;  1YDI A;  3TOM A;  3FMS A;  1RJ9 B;  3GWN A;  4NTF A;  4LAC B;  4PR9 A;  4E18 A;  2D5R B;  2XM4 A;  4O6Y A;  2HJM A;  3LLI A;  3R2P A;  4OIR F;  4CX9 A;  3W8I A;  3JSE O;  3CSK A;  4EWC A;  3S84 A;  3K1I C;  4YL3 A;  5BQI A;  3UGO A;  2VAS A;  3ATP A;  3EH2 A;  1TFO B;  3VM6 A;  4MVM A;  2KJG A;  3HLZ A;  4E0I A;  2J9V A;  1L3P A;  3ZSU A;  2JX0 A;  3H65 A;  1GM5 A;  4R32 A;  1G8X A;  1Z7Q c;  3EG9 B;  3LJB A;  3RQG A;  1WAT A;  4WGZ A;  1PD1 A;  2EIJ C;  3NDB B;  4QDL A;  2R7X A;  1JOG A;  1H6G A;  2KGO A;  3Q7G A;  1Q0F A;  1OXK A;  2OJQ A;  2VCA A;  3C63 A;  1XWJ A;  3HKK A;  3K7D A;  3QTH A;  1WAS A;  4JTD B;  4CDA A;  4DJ9 A;  1RMV A;  3GM1 A;  1EKY A;  3EGX A;  5KYX A;  3FAP B;  4IAR A;  2R7O A;  2L6G A;  1YAU O;  2MHR A;  4ER9 A;  2XL4 A;  1D1A A;  1SF8 A;  2Q3T A;  5KYW A;  3ECS A;  4JRZ A; 
#chains in the Genus database with same CATH homology
 3LEO A;  2Q7R A;  2UUI A;  4JCZ A;  4YL3 A;  5BQI A;  5BQH A;  4YK5 A;  4NTB A;  4WAB A;  4J7Y A;  5K0I A;  4NTA A;  4JC7 A;  4AL0 A;  4YL0 A;  4BPM A;  2UUH A;  3B29 A;  2H8A A;  3HKK A;  3PCV A;  5BQG A;  4YL1 A;  4J7T A;  3DWW A;  4NTF A;  5HV9 A;  4JRZ A;  2PNO A;  4AL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...