2LK4A

Structural and mechanistic insights into the interaction between pat pyk2 and paxillin ld motif
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
135
structure length
135
Chain Sequence
b'ANLDRTDDLVYLNVMELVRAVLELKNELSQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEEAKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein-tyrosine kinase 2-beta
molecule tags Transferase
source organism Homo sapiens
publication title Structural and Mechanistic Insights into the Interaction between Pyk2 and Paxillin LD Motifs.
pubmed doi rcsb
total genus 26
structure length 135
sequence length 135
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 2lk4A00
4EBKA 1JOGA 2LK4A 3TULA 2Q00A 1V4AA 2L6HA 3C8GA 3C8GD 3RQGA 4NQFA 3C18A 1WTYA 2JX0A 3AJMA 3B71A 1WOLA 2L6FA 2L6GA 1K40A 3GM2A 1QVXA 3MFNA 3RQFA 3S9OA 3U3FA 1K05A 2KK1A 3C8GB 4R32A 4XEKA 1KTMA 4XEVA 3GM3A 2HSBA 1ZZPA 4EBJA 1OW8A 1OW6A 1PV3A 1WWPA 3K7DA 1UFBA 3GM1A 3JYYA 3L8IA 4XEFA 3O10A 3L8JA 3RQEA 1O3UA 3BRJA 1OW7A 2PBEA 1KNYA 3U0CA 2YWAA 2JPUA 3JZ0A 1K04A 5F28E
chains in the Genus database with same CATH superfamily
1CGNA 4U9DA 4DOZA 3TULA 4PJLA 4W8PA 2CNWD 4DVZA 1E2XA 1S05A 1FMVA 2DB4A 2Q3TA 4CDYA 1Q0DA 1WTYA 1ZHZA 5A69A 1C02A 1YVIA 2C03A 3UMHA 3U8PA 1WN0A 4FX5A 4O79A 4JJFA 3TQOA 3KKBA 3LLIA 1MQVA 2NG1A 2WB7A 3WAQA 2NUPA 2WL8A 5D92A 1NSGB 4IB4A 3ZG1A 5JS5A 1J8YF 1OW6A 2NPUA 4CS8C 5A6KA 3MBGA 1M57C 1M2OA 4I3MA 1XZPA 4EUKB 3HNJA 2XLWA 1AEPA 1Q0GA 3POVA 3E9VA 1TFKB 2ASRA 4JTAB 3ASNC 3SNHA 3VAYA 2EPMX 3M4CA 2BE5F 2Y3GA 2HMZA 4CX9A 2J9UA 3M79A 5KYWB 1IZMA 1N1CA 3Q6NA 4YT4A 4KNWA 1EKYA 5CI9A 1QLEC 3G4XA 1RJ9A 1H9GA 2Q7RA 3O6XA 4JZAA 1R5ID 3KH2A 1QZXA 1U0BB 4PJNA 4DRIB 2HMQA 1ZW2A 4NY3A 4Z9HA 2VCAA 3W8IA 3SYNA 5E2QA 3EH1A 1K05A 2KSFA 1Z6AA 3DZAA 3JT1A 3NYJA 3LUTB 4N4WA 4UDVA 3UNGC 3WG7C 2WZLA 2CYDA 3K7DA 1UG7A 2F22A 3DMDA 4J7TA 3PMRA 1LIHA 4MQ9F 4CJOA 1ZVZA 4LERA 3SXZA 1DOWA 3G4ZA 4O7GA 4O6MA 3V5XA 2B0JA 4IARA 3VYWA 4C3BA 3JTLO 3HNLA 4G7ZF 3Q7GA 3U9JA 1NU7D 1HE9A 2FGYA 1LM3B 2QNLA 3QVZA 3HKKA 4KNVA 3NMIA 2LQGA 3W4YA 5E3AA 1YA7O 2L9JA 5BUOA 3MLGA 3B29A 3H2UA 1G5ZA 4G7OF 4H4KC 5EHHA 5K0IA 1SMYF 1OR2A 4MVUA 2VASA 1ST6A 4E17A 3VF0A 2RSEB 2V26A 2WVNA 3EGDB 4DBRA 5F5HA 2MHRA 4I1OB 2LP4A 3TOMA 2L7AA 3HNIA 1GS9A 2YL1A 1YLMA 1SF8A 1S7ZA 1UFBA 2KGOA 2KQ9A 1Z7Qc 2YQYA 5JT4A 3ZDLA 3C62A 3M15A 2VB6A 2XLEA 1NU9C 4XWJA 4MTGA 3VM6A 2OQMA 4CS7A 2Q9AA 2XLHA 3ZIBA 1NFOA 4JCZA 4LLEA 3I5QA 2EINC 2R25A 2Y3DA 4G78A 2R7XA 1MNDA 4CJGA 1OR3A 1JOGA 2OU6A 1NG1A 1V4AA 2L6HA 2ZXWC 3T4RA 1CGME 2P0NA 2JX0A 3AJMA 3EPVA 4JC7A 3GEEA 1HE1A 3GANA 4H54A 1LVKA 4DXWA 2MWQA 4K1OA 1D1BA 5B1BC 5HSWA 2HJ3A 1LS4A 2HZ8A 3EJNA 4B6IA 4E18A 5DS4A 1OW8A 1EI7A 1VK5A 2ZXRA 3QW0A 4KBLA 3H2VA 3L8IA 2AU5A 2AP3A 4KI2A 2GWWA 4YL3A 4IAOA 2PBEA 3X2QC 1Z23A 2PP4A 4MS2A 1FNTc 4W8KA 2DGJA 3NYLA 3RVYA 2OCCC 1D1CA 3NRHA 4NTBA 4F4BA 3AG4C 3C18A 4MW3A 1QKRA 2IM8A 1LI7A 4PFPA 1U89A 2Y69C 3KYIA 1VLSA 4U5HA 5KYNA 4LLCA 4AE4A 2H7BA 3EFOA 3GEHA 3UMKA 1AUEA 3NKEA 1QPUA 4BEMJ 2CW0F 2R9RB 1LKXA 2Y3BA 3AG3C 3DI5A 3CSKA 1RXQA 3IHUA 2I8BA 3IPMO 3MX3A 3V5ZA 3S90A 3EGXA 1OCZC 1TFOB 2R7OA 2LFFA 3C63A 1WWPA 1M2VA 4N6CA 3EGDA 2IBFA 4YWQA 2WZGA 2JD3A 2HV7A 4CSAA 1TWGA 2NUTB 3J06A 1HY5A 4MVSA 3BRJA 4WGYA 5COMA 2A6EF 1ZU4A 2HSQA 3LNRA 3QTHA 3RIPA 1ZHTA 3DE9A 3B0UX 1I4ZA 2QUPA 1V54C 2D5RB 2HJMA 3ZVRA 4CIHA 4JURI 5GPGB 2WVQA 4BG0A 3TJ5A 2AVKA 3FXHA 2J7PD 3LJBA 1NZEA 1WOLA 4Q5SF 4C3DA 3EZIA 4K7BA 2C04A 5JVEA 1A7VA 3PHF2 3ZQYA 4XPWA 1LPEA 1E85A 4I1MA 4YL1A 2EPNA 4AK9A 4PJMA 4OIOF 4ZLDA 2J8WA 3C7JA 4P9FA 3A9CA 3HNKA 5TJ5E 2P61A 2XXAA 4JJGA 4OIRF 1G8XA 4U5CE 3OA1A 1PV3A 4P9TA 1L3PA 2HFIA 4ANJA 3UMIA 4YK5A 4D4XA 4EIYA 5A6AA 4MNDA 2R7RA 3IQ6A 3DAFA 3PDMP 4J30B 2YRFA 5COGA 3N0TA 4Q4ZF 2R7VA 2IXNA 4RDAA 1APCA 2G3VA 2R02A 4HEAJ 2Q4FA 2YKZA 1VMAA 3KPHA 2OEXA 4U9EA 5D91A 1A7DA 4FWVA 1Z63A 4OD4A 2V3CC 2LD6A 3PCVA 4J32B 4RBNA 3N24A 1XWJA 4Q7CA 2AWYA 2YLIA 3EQLF 1OQCA 3QMKA 4JW1A 3SP1A 1SZIA 2KK1A 5CIVA 5A6JA 1ZHXA 4XEVA 2HKVA 3LNMB 1HMDA 2LFDA 3K1HA 3TD7A 5L0CA 2YHSA 2P1AA 1D0XA 4N06A 4U5FE 4YT2A 4XEFA 1VLTA 1FFTC 1WGWA 4JCHA 2HV6A 3M4BA 3F46A 4AL1A 4JEAA 4MVRA 1FAPB 4PR9A 3DJNB 1TWAA 2YL3A 3T6BA 4CBEA 4CDAA 1K04A 3HLZA 4JRZA 4G7HF 3EG9B 3C8GA 3RKOF 1BR1A 2KJGA 1H9TA 2E87A 4K0DA 3W8HA 1YZCA 1OXKA 4IGGA 4CS9A 1MMNA 5T1DB 2CDQA 3U9MA 4BJ5C 4E0HA 1RMVA 1WATA 1RJ9B 3AOUA 2TMVP 1FFHA 5L3VA 4JE9A 4P6IC 3L1MA 3MYIA 5AC4A 1KTMA 2R7QA 3AQCA 4N6HA 4YT5A 5DQTA 2I15A 3R2PA 2Z15A 1J8MF 4KC9A 3SXKA 4ER9A 4QDLA 4IAQA 4CS8A 4OD5A 3ABLC 1OXBA 2FAPB 1L7CA 3JYYA 4EBBA 5FZTA 5BQIA 4E7ZA 4IWBA 3GEIA 3S27A 3B0VC 1G4WR 4XTKA 3SXMA 4ONSA 1E84A 5T3TA 2Q9CA 3K1IC 4GQHA 3NYMA 3GODA 3B0PA 3S28A 2GFHA 4L6RA 2BC5A 2XM0A 3B71A 4WGZA 3ZSUA 2EIMC 1SR2A 1ZW3A 2ICWG 4QI0A 1K40A 2W4MA 2WZFA 3K1IA 4ULWA 1ORJA 5CI8A 4EWCA 1RCPA 3JRMO 4R32A 2ZD9A 4O6YA 3G50A 3U3BA 1YZAA 1ZZPA 3AG1C 3FOOA 1JMWA 2J9BA 2KC3A 4U5BE 3RH3A 3V5YA 4BPMA 2G62A 2M4EA 4DRJB 1Z5ZA 3OWTA 4JTCB 3LAYA 3JSEO 3L8JA 3U2MA 5T3WA 3ZTZA 2EPKX 3FAPB 1M6TA 4ULVA 1I5NA 2FFHA 4I44A 2VCCA 1WASA 3RVZA 1F1MA 5L3QA 5KYUA 3US6A 2J9WA 4AE4B 2J7PA 3ZTMA 3HJCA 4BJ1A 3LLKA 1TQGA 3C8GD 4U5GA 1D1AA 2J46A 3LEVA 4NQFA 1QSPA 2EPOA 2Y3HA 2IXPA 2WVOA 4CS9C 2H8AA 3LESA 2GAQA 1TWCA 3T6GB 2KW3C 2W45A 3EZHA 2X0CA 2W4BA 1CPQA 1ORYA 2DYRC 2PF4E 2OEVA 1GQAA 1ORSC 2NUPB 2XL6A 2A69F 3ATPA 3C8GB 3DM5A 3FVYA 4Z9JA 2HSBA 2YEVA 1TKNA 1BR4A 4HFKB 1LS1A 2PFDA 2B0HA 3JYHA 2QY9A 4C7OA 5AC5A 2G3KA 2P6VA 4E7SA 2NSGA 2OOCA 1E86A 1JRAA 4PACA 1V74B 4JEBA 2XS8A 3WHNA 1ZHWA 1YYXA 3MYFA 3AQBA 4XLPF 2YWAA 3NG1A 2JPUA 5L0JA 3KMIA 1OCCC 2DI3A 3DD7A 3ECSA 2PNOA 3NKDA 2J9VA 2LK4A 2M64A 4DVYP 4CIPA 1VTMP 1GM5A 3AGUA 2BL2A 2HUJA 4RD9A 3S29A 2H7OA 1TWHA 5IY5C 3GM2A 4GEHA 3O55A 1W2WA 1HMOA 2KNHA 3U3FA 1NLXA 4EKWA 5JLIA 5L0GA 2EIKC 1JR8A 1RKEB 3IQTA 4XLNF 2XSEA 5JSLA 1T9KA 3IQ5A 2XXAB 4C3EA 4XPYA 1T6UA 3U5SA 3RYLA 3QW1A 1B68A 1Q0KA 1GGQA 3M1CB 2ETSA 3AGTA 2YL0A 2XS1A 3KYJA 1VB5A 1OCRC 3E70C 3SZRA 1T6IA 3ABMC 3RW0A 1PD1A 3UR3C 1A7EA 2EILC 4AL0A 5DVWA 3CQZA 3FAJA 3IQCA 2A68F 2H7VC 3DJUB 2A0BA 4WABA 5EK0A 3TK0A 2XL4A 5E3CA 4BJ5A 2RD9A 4AX2A 2Y39A 3JRTA 3MFNA 4XQ1A 3S84A 1R4TA 2ZXPA 4Z9IA 3V7OA 3R7CA 5AGFA 1SYQA 1Q0MA 2CGEA 4YN0B 4HFFB 4YT8A 2HS5A 1T5OA 2EIJC 1VYKA 2YLGA 2L81A 5KYUB 3T6JA 2CCYA 1CGOA 3JSZA 3K6BA 5B3IA 4IRUA 3FHDA 1T01A 4CSAC 2W9YA 5L0FA 2A6HF 2LSEA 1IW7F 1RKEA 2KYHA 2QTVA 3B9QA 4OINF 3TOLA 4A2NB 2R7UA 5DS6A 1O87A 1PD0A 1EA8A 3OEOA 2YZSA 1JPNA 3KL4A 5F28E 1CPRA 3EG9A 3N2ZB 4NTFA 1QQ3A 2ZPAA 1Z3IX 4PFOA 3NDBB 1YYJA 4ZLCA 3DE8A 2MYSA 5KYXA 2OKUA 1VOMA 1MNEA 2IXOA 3GWLA 3K66A 5DQZA 2L6GA 1LE2A 1ZU5A 5L0DA 5KYXB 4G0HA 4BEJA 3ASOC 3RQFA 2R7WA 4MW8A 1I4YA 1OKKD 2QLAA 3L34A 4HE8D 3DWWA 1E83A 2LCHA 2R03A 2XRHA 1KU2A 3FOPA 1T6QA 4DBQA 2EPLX 2NSFA 5B3SC 4U5DE 3RQEA 1G4US 4LDKA 3QVYA 3JCUQ 4JIOA 3SXYA 3WODF 4A4AA 4MVQA 1YAUO 1H7IA 2VH3A 2ZXOA 5HV9A 3UGOA 3ITFA 1M56C 3EFOB 1FR0A 2XLDA 1VYIA 1Y4CA 1TR2A 3CEXA 4MVOA 4EBKA 1RKCA 3ABKC 4XPXA 1HW1A 5KYYB 1NFNA 4FESA 2XLOA 3I4UA 5F5FA 2XLMA 1YARO 1C17M 2YL7A 5KYYA 5KYWA 1OCOC 2IOQA 4YL0A 3W2VA 3X1OA 1QVXA 2LIGA 5EGYA 4NCQA 2VC9A 4E0IA 3H65A 1HW2A 1A41A 4O6NA 4XEKA 3S0XA 256BA 4OIPF 3CAXA 4M63A 4DRHB 4EHPA 3GM3A 3DM9B 3LEOA 2P7VA 1D0ZA 5JUAA 4C7OB 1C03A 5A6BA 3NMKA 4MVMA 2YLDA 4BJTA 3GM1A 2QE9A 3L0IA 1PCXA 1O3UA 2UUIA 3TJ6A 1A0BA 3T9OA 1NBBA 1XZQA 3RFYA 5FCLA 2DYSC 3DAGA 4LDRA 3DXJF 2A0UA 2GDCA 4DJ9A 4JKVA 1Y6DA 4PJJA 3U8VA 2Q00A 5BQGA 3GORA 3RQGA 5L0IA 1ZYRF 4CDVA 2J0XA 1JAFA 3O39A 4OIQF 3ZQVA 1BBHA 3ZWIA 5BQHA 1LI5A 1YA9A 3LS0A 2NUTA 3ZC4A 1AVOB 4NC3A 2R05A 3GWNA 1M2VB 2A1DD 1LE4A 4D4NA 1BZ4A 3I5PA 1MMGA 4JTDB 4PK4A 2VCBA 4J7YA 2XLVA 4YJWA 2YVKA 4FAPB 4NTAA 1DOVA 1JPJA 2OJED 2J0WA 2PX3A 4LDQA 2UUHA 1Q0FA 2AWCA 2XM4A 1OW7A 3CZ6A 1U6HA 5B1AC 3A11A 1H6GA 5E33A 4BJ6A 4GYTA 1BDJB 5JRAA 1V55C 3W2WA 1ZHYA 4MTFA 3U2LA 1YDIA 3NMJA 1EQ1A 2CNWA 3BEHA 5JP7A 3RF3A 1OKKA 3FMSA 5COFA 2PX0A 2L6FA 2O9XA 3EHMA 2IXMA 3LS1A 3Q6MA 4U5EE 1MMDA 3FDQA 5DS5A 4BJ6C 3Q7LA 1FTSA 3S9OA 3UGPA 4QI2A 1O5HA 1D0YA 2OG2A 4MTOA 2R7TA 4JVSA 1BR2A 3F47A 3AG2C 1MMAA 3K33A 4WJ0A 3SEOA 3HTKC 4MVZA 5L0HA 4EBJA 2R7SA 5A6BD 4LACB 2D4UA 3EGXB 5DLJA 2GA0A 4X0RA 3O10A 3DKAA 3EH2A 3QZCA 2IYLD 2J45A 3VRCA 1KNYA 2X51A 3C8ZA 4IJJA 3U0CA 1FMWA 2Q9BA 2OJQA 3JZ0A 1YJGA 2XL8A 3IEEA 3EHNA
chains in the Genus database with same CATH topology
4EBKA 1JOGA 2LK4A 3TULA 2Q00A 1V4AA 2L6HA 3C8GA 3C8GD 3RQGA 4NQFA 3C18A 1WTYA 2JX0A 3AJMA 3B71A 1WOLA 2L6FA 2L6GA 1K40A 3GM2A 1QVXA 3MFNA 3RQFA 3S9OA 3U3FA 1K05A 2KK1A 3C8GB 4R32A 4XEKA 1KTMA 4XEVA 3GM3A 2HSBA 1ZZPA 4EBJA 1OW8A 1OW6A 1PV3A 1WWPA 3K7DA 1UFBA 3GM1A 3JYYA 3L8IA 4XEFA 3O10A 3L8JA 3RQEA 1O3UA 3BRJA 1OW7A 2PBEA 1KNYA 3U0CA 2YWAA 2JPUA 3JZ0A 1K04A 5F28E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EBK A;  1JOG A;  2LK4 A;  3TUL A;  2Q00 A;  1V4A A;  2L6H A;  3C8G A;  3C8G D;  3RQG A;  4NQF A;  3C18 A;  1WTY A;  2JX0 A;  3AJM A;  3B71 A;  1WOL A;  2L6F A;  2L6G A;  1K40 A;  3GM2 A;  1QVX A;  3MFN A;  3RQF A;  3S9O A;  3U3F A;  1K05 A;  2KK1 A;  3C8G B;  4R32 A;  4XEK A;  1KTM A;  4XEV A;  3GM3 A;  2HSB A;  1ZZP A;  4EBJ A;  1OW8 A;  1OW6 A;  1PV3 A;  1WWP A;  3K7D A;  1UFB A;  3GM1 A;  3JYY A;  3L8I A;  4XEF A;  3O10 A;  3L8J A;  3RQE A;  1O3U A;  3BRJ A;  1OW7 A;  2PBE A;  1KNY A;  3U0C A;  2YWA A;  2JPU A;  3JZ0 A;  1K04 A;  5F28 E; 
#chains in the Genus database with same CATH topology
 1CGN A;  4U9D A;  4DOZ A;  3TUL A;  4PJL A;  4W8P A;  2CNW D;  4DVZ A;  1E2X A;  1S05 A;  1FMV A;  2DB4 A;  2Q3T A;  4CDY A;  1Q0D A;  1WTY A;  1ZHZ A;  5A69 A;  1C02 A;  1YVI A;  2C03 A;  3UMH A;  3U8P A;  1WN0 A;  4FX5 A;  4O79 A;  4JJF A;  3TQO A;  3KKB A;  3LLI A;  1MQV A;  2NG1 A;  2WB7 A;  3WAQ A;  2NUP A;  2WL8 A;  5D92 A;  1NSG B;  4IB4 A;  3ZG1 A;  5JS5 A;  1J8Y F;  1OW6 A;  2NPU A;  4CS8 C;  5A6K A;  3MBG A;  1M57 C;  1M2O A;  4I3M A;  1XZP A;  4EUK B;  3HNJ A;  2XLW A;  1AEP A;  1Q0G A;  3POV A;  3E9V A;  1TFK B;  2ASR A;  4JTA B;  3ASN C;  3SNH A;  3VAY A;  2EPM X;  3M4C A;  2BE5 F;  2Y3G A;  2HMZ A;  4CX9 A;  2J9U A;  3M79 A;  5KYW B;  1IZM A;  1N1C A;  3Q6N A;  4YT4 A;  4KNW A;  1EKY A;  5CI9 A;  1QLE C;  3G4X A;  1RJ9 A;  1H9G A;  2Q7R A;  3O6X A;  4JZA A;  1R5I D;  3KH2 A;  1QZX A;  1U0B B;  4PJN A;  4DRI B;  2HMQ A;  1ZW2 A;  4NY3 A;  4Z9H A;  2VCA A;  3W8I A;  3SYN A;  5E2Q A;  3EH1 A;  1K05 A;  2KSF A;  1Z6A A;  3DZA A;  3JT1 A;  3NYJ A;  3LUT B;  4N4W A;  4UDV A;  3UNG C;  3WG7 C;  2WZL A;  2CYD A;  3K7D A;  1UG7 A;  2F22 A;  3DMD A;  4J7T A;  3PMR A;  1LIH A;  4MQ9 F;  4CJO A;  1ZVZ A;  4LER A;  3SXZ A;  1DOW A;  3G4Z A;  4O7G A;  4O6M A;  3V5X A;  2B0J A;  4IAR A;  3VYW A;  4C3B A;  3JTL O;  3HNL A;  4G7Z F;  3Q7G A;  3U9J A;  1NU7 D;  1HE9 A;  2FGY A;  1LM3 B;  2QNL A;  3QVZ A;  3HKK A;  4KNV A;  3NMI A;  2LQG A;  3W4Y A;  5E3A A;  1YA7 O;  2L9J A;  5BUO A;  3MLG A;  3B29 A;  3H2U A;  1G5Z A;  4G7O F;  4H4K C;  5EHH A;  5K0I A;  1SMY F;  1OR2 A;  4MVU A;  2VAS A;  1ST6 A;  4E17 A;  3VF0 A;  2RSE B;  2V26 A;  2WVN A;  3EGD B;  4DBR A;  5F5H A;  2MHR A;  4I1O B;  2LP4 A;  3TOM A;  2L7A A;  3HNI A;  1GS9 A;  2YL1 A;  1YLM A;  1SF8 A;  1S7Z A;  1UFB A;  2KGO A;  2KQ9 A;  1Z7Q c;  2YQY A;  5JT4 A;  3ZDL A;  3C62 A;  3M15 A;  2VB6 A;  2XLE A;  1NU9 C;  4XWJ A;  4MTG A;  3VM6 A;  2OQM A;  4CS7 A;  2Q9A A;  2XLH A;  3ZIB A;  1NFO A;  4JCZ A;  4LLE A;  3I5Q A;  2EIN C;  2R25 A;  2Y3D A;  4G78 A;  2R7X A;  1MND A;  4CJG A;  1OR3 A;  1JOG A;  2OU6 A;  1NG1 A;  1V4A A;  2L6H A;  2ZXW C;  3T4R A;  1CGM E;  2P0N A;  2JX0 A;  3AJM A;  3EPV A;  4JC7 A;  3GEE A;  1HE1 A;  3GAN A;  4H54 A;  1LVK A;  4DXW A;  2MWQ A;  4K1O A;  1D1B A;  5B1B C;  5HSW A;  2HJ3 A;  1LS4 A;  2HZ8 A;  3EJN A;  4B6I A;  4E18 A;  5DS4 A;  1OW8 A;  1EI7 A;  1VK5 A;  2ZXR A;  3QW0 A;  4KBL A;  3H2V A;  3L8I A;  2AU5 A;  2AP3 A;  4KI2 A;  2GWW A;  4YL3 A;  4IAO A;  2PBE A;  3X2Q C;  1Z23 A;  2PP4 A;  4MS2 A;  1FNT c;  4W8K A;  2DGJ A;  3NYL A;  3RVY A;  2OCC C;  1D1C A;  3NRH A;  4NTB A;  4F4B A;  3AG4 C;  3C18 A;  4MW3 A;  1QKR A;  2IM8 A;  1LI7 A;  4PFP A;  1U89 A;  2Y69 C;  3KYI A;  1VLS A;  4U5H A;  5KYN A;  4LLC A;  4AE4 A;  2H7B A;  3EFO A;  3GEH A;  3UMK A;  1AUE A;  3NKE A;  1QPU A;  4BEM J;  2CW0 F;  2R9R B;  1LKX A;  2Y3B A;  3AG3 C;  3DI5 A;  3CSK A;  1RXQ A;  3IHU A;  2I8B A;  3IPM O;  3MX3 A;  3V5Z A;  3S90 A;  3EGX A;  1OCZ C;  1TFO B;  2R7O A;  2LFF A;  3C63 A;  1WWP A;  1M2V A;  4N6C A;  3EGD A;  2IBF A;  4YWQ A;  2WZG A;  2JD3 A;  2HV7 A;  4CSA A;  1TWG A;  2NUT B;  3J06 A;  1HY5 A;  4MVS A;  3BRJ A;  4WGY A;  5COM A;  2A6E F;  1ZU4 A;  2HSQ A;  3LNR A;  3QTH A;  3RIP A;  1ZHT A;  3DE9 A;  3B0U X;  1I4Z A;  2QUP A;  1V54 C;  2D5R B;  2HJM A;  3ZVR A;  4CIH A;  4JUR I;  5GPG B;  2WVQ A;  4BG0 A;  3TJ5 A;  2AVK A;  3FXH A;  2J7P D;  3LJB A;  1NZE A;  1WOL A;  4Q5S F;  4C3D A;  3EZI A;  4K7B A;  2C04 A;  5JVE A;  1A7V A;  3PHF 2;  3ZQY A;  4XPW A;  1LPE A;  1E85 A;  4I1M A;  4YL1 A;  2EPN A;  4AK9 A;  4PJM A;  4OIO F;  4ZLD A;  2J8W A;  3C7J A;  4P9F A;  3A9C A;  3HNK A;  5TJ5 E;  2P61 A;  2XXA A;  4JJG A;  4OIR F;  1G8X A;  4U5C E;  3OA1 A;  1PV3 A;  4P9T A;  1L3P A;  2HFI A;  4ANJ A;  3UMI A;  4YK5 A;  4D4X A;  4EIY A;  5A6A A;  4MND A;  2R7R A;  3IQ6 A;  3DAF A;  3PDM P;  4J30 B;  2YRF A;  5COG A;  3N0T A;  4Q4Z F;  2R7V A;  2IXN A;  4RDA A;  1APC A;  2G3V A;  2R02 A;  4HEA J;  2Q4F A;  2YKZ A;  1VMA A;  3KPH A;  2OEX A;  4U9E A;  5D91 A;  1A7D A;  4FWV A;  1Z63 A;  4OD4 A;  2V3C C;  2LD6 A;  3PCV A;  4J32 B;  4RBN A;  3N24 A;  1XWJ A;  4Q7C A;  2AWY A;  2YLI A;  3EQL F;  1OQC A;  3QMK A;  4JW1 A;  3SP1 A;  1SZI A;  2KK1 A;  5CIV A;  5A6J A;  1ZHX A;  4XEV A;  2HKV A;  3LNM B;  1HMD A;  2LFD A;  3K1H A;  3TD7 A;  5L0C A;  2YHS A;  2P1A A;  1D0X A;  4N06 A;  4U5F E;  4YT2 A;  4XEF A;  1VLT A;  1FFT C;  1WGW A;  4JCH A;  2HV6 A;  3M4B A;  3F46 A;  4AL1 A;  4JEA A;  4MVR A;  1FAP B;  4PR9 A;  3DJN B;  1TWA A;  2YL3 A;  3T6B A;  4CBE A;  4CDA A;  1K04 A;  3HLZ A;  4JRZ A;  4G7H F;  3EG9 B;  3C8G A;  3RKO F;  1BR1 A;  2KJG A;  1H9T A;  2E87 A;  4K0D A;  3W8H A;  1YZC A;  1OXK A;  4IGG A;  4CS9 A;  1MMN A;  5T1D B;  2CDQ A;  3U9M A;  4BJ5 C;  4E0H A;  1RMV A;  1WAT A;  1RJ9 B;  3AOU A;  2TMV P;  1FFH A;  5L3V A;  4JE9 A;  4P6I C;  3L1M A;  3MYI A;  5AC4 A;  1KTM A;  2R7Q A;  3AQC A;  4N6H A;  4YT5 A;  5DQT A;  2I15 A;  3R2P A;  2Z15 A;  1J8M F;  4KC9 A;  3SXK A;  4ER9 A;  4QDL A;  4IAQ A;  4CS8 A;  4OD5 A;  3ABL C;  1OXB A;  2FAP B;  1L7C A;  3JYY A;  4EBB A;  5FZT A;  5BQI A;  4E7Z A;  4IWB A;  3GEI A;  3S27 A;  3B0V C;  1G4W R;  4XTK A;  3SXM A;  4ONS A;  1E84 A;  5T3T A;  2Q9C A;  3K1I C;  4GQH A;  3NYM A;  3GOD A;  3B0P A;  3S28 A;  2GFH A;  4L6R A;  2BC5 A;  2XM0 A;  3B71 A;  4WGZ A;  3ZSU A;  2EIM C;  1SR2 A;  1ZW3 A;  2ICW G;  4QI0 A;  1K40 A;  2W4M A;  2WZF A;  3K1I A;  4ULW A;  1ORJ A;  5CI8 A;  4EWC A;  1RCP A;  3JRM O;  4R32 A;  2ZD9 A;  4O6Y A;  3G50 A;  3U3B A;  1YZA A;  1ZZP A;  3AG1 C;  3FOO A;  1JMW A;  2J9B A;  2KC3 A;  4U5B E;  3RH3 A;  3V5Y A;  4BPM A;  2G62 A;  2M4E A;  4DRJ B;  1Z5Z A;  3OWT A;  4JTC B;  3LAY A;  3JSE O;  3L8J A;  3U2M A;  5T3W A;  3ZTZ A;  2EPK X;  3FAP B;  1M6T A;  4ULV A;  1I5N A;  2FFH A;  4I44 A;  2VCC A;  1WAS A;  3RVZ A;  1F1M A;  5L3Q A;  5KYU A;  3US6 A;  2J9W A;  4AE4 B;  2J7P A;  3ZTM A;  3HJC A;  4BJ1 A;  3LLK A;  1TQG A;  3C8G D;  4U5G A;  1D1A A;  2J46 A;  3LEV A;  4NQF A;  1QSP A;  2EPO A;  2Y3H A;  2IXP A;  2WVO A;  4CS9 C;  2H8A A;  3LES A;  2GAQ A;  1TWC A;  3T6G B;  2KW3 C;  2W45 A;  3EZH A;  2X0C A;  2W4B A;  1CPQ A;  1ORY A;  2DYR C;  2PF4 E;  2OEV A;  1GQA A;  1ORS C;  2NUP B;  2XL6 A;  2A69 F;  3ATP A;  3C8G B;  3DM5 A;  3FVY A;  4Z9J A;  2HSB A;  2YEV A;  1TKN A;  1BR4 A;  4HFK B;  1LS1 A;  2PFD A;  2B0H A;  3JYH A;  2QY9 A;  4C7O A;  5AC5 A;  2G3K A;  2P6V A;  4E7S A;  2NSG A;  2OOC A;  1E86 A;  1JRA A;  4PAC A;  1V74 B;  4JEB A;  2XS8 A;  3WHN A;  1ZHW A;  1YYX A;  3MYF A;  3AQB A;  4XLP F;  2YWA A;  3NG1 A;  2JPU A;  5L0J A;  3KMI A;  1OCC C;  2DI3 A;  3DD7 A;  3ECS A;  2PNO A;  3NKD A;  2J9V A;  2LK4 A;  2M64 A;  4DVY P;  4CIP A;  1VTM P;  1GM5 A;  3AGU A;  2BL2 A;  2HUJ A;  4RD9 A;  3S29 A;  2H7O A;  1TWH A;  5IY5 C;  3GM2 A;  4GEH A;  3O55 A;  1W2W A;  1HMO A;  2KNH A;  3U3F A;  1NLX A;  4EKW A;  5JLI A;  5L0G A;  2EIK C;  1JR8 A;  1RKE B;  3IQT A;  4XLN F;  2XSE A;  5JSL A;  1T9K A;  3IQ5 A;  2XXA B;  4C3E A;  4XPY A;  1T6U A;  3U5S A;  3RYL A;  3QW1 A;  1B68 A;  1Q0K A;  1GGQ A;  3M1C B;  2ETS A;  3AGT A;  2YL0 A;  2XS1 A;  3KYJ A;  1VB5 A;  1OCR C;  3E70 C;  3SZR A;  1T6I A;  3ABM C;  3RW0 A;  1PD1 A;  3UR3 C;  1A7E A;  2EIL C;  4AL0 A;  5DVW A;  3CQZ A;  3FAJ A;  3IQC A;  2A68 F;  2H7V C;  3DJU B;  2A0B A;  4WAB A;  5EK0 A;  3TK0 A;  2XL4 A;  5E3C A;  4BJ5 A;  2RD9 A;  4AX2 A;  2Y39 A;  3JRT A;  3MFN A;  4XQ1 A;  3S84 A;  1R4T A;  2ZXP A;  4Z9I A;  3V7O A;  3R7C A;  5AGF A;  1SYQ A;  1Q0M A;  2CGE A;  4YN0 B;  4HFF B;  4YT8 A;  2HS5 A;  1T5O A;  2EIJ C;  1VYK A;  2YLG A;  2L81 A;  5KYU B;  3T6J A;  2CCY A;  1CGO A;  3JSZ A;  3K6B A;  5B3I A;  4IRU A;  3FHD A;  1T01 A;  4CSA C;  2W9Y A;  5L0F A;  2A6H F;  2LSE A;  1IW7 F;  1RKE A;  2KYH A;  2QTV A;  3B9Q A;  4OIN F;  3TOL A;  4A2N B;  2R7U A;  5DS6 A;  1O87 A;  1PD0 A;  1EA8 A;  3OEO A;  2YZS A;  1JPN A;  3KL4 A;  5F28 E;  1CPR A;  3EG9 A;  3N2Z B;  4NTF A;  1QQ3 A;  2ZPA A;  1Z3I X;  4PFO A;  3NDB B;  1YYJ A;  4ZLC A;  3DE8 A;  2MYS A;  5KYX A;  2OKU A;  1VOM A;  1MNE A;  2IXO A;  3GWL A;  3K66 A;  5DQZ A;  2L6G A;  1LE2 A;  1ZU5 A;  5L0D A;  5KYX B;  4G0H A;  4BEJ A;  3ASO C;  3RQF A;  2R7W A;  4MW8 A;  1I4Y A;  1OKK D;  2QLA A;  3L34 A;  4HE8 D;  3DWW A;  1E83 A;  2LCH A;  2R03 A;  2XRH A;  1KU2 A;  3FOP A;  1T6Q A;  4DBQ A;  2EPL X;  2NSF A;  5B3S C;  4U5D E;  3RQE A;  1G4U S;  4LDK A;  3QVY A;  3JCU Q;  4JIO A;  3SXY A;  3WOD F;  4A4A A;  4MVQ A;  1YAU O;  1H7I A;  2VH3 A;  2ZXO A;  5HV9 A;  3UGO A;  3ITF A;  1M56 C;  3EFO B;  1FR0 A;  2XLD A;  1VYI A;  1Y4C A;  1TR2 A;  3CEX A;  4MVO A;  4EBK A;  1RKC A;  3ABK C;  4XPX A;  1HW1 A;  5KYY B;  1NFN A;  4FES A;  2XLO A;  3I4U A;  5F5F A;  2XLM A;  1YAR O;  1C17 M;  2YL7 A;  5KYY A;  5KYW A;  1OCO C;  2IOQ A;  4YL0 A;  3W2V A;  3X1O A;  1QVX A;  2LIG A;  5EGY A;  4NCQ A;  2VC9 A;  4E0I A;  3H65 A;  1HW2 A;  1A41 A;  4O6N A;  4XEK A;  3S0X A;  256B A;  4OIP F;  3CAX A;  4M63 A;  4DRH B;  4EHP A;  3GM3 A;  3DM9 B;  3LEO A;  2P7V A;  1D0Z A;  5JUA A;  4C7O B;  1C03 A;  5A6B A;  3NMK A;  4MVM A;  2YLD A;  4BJT A;  3GM1 A;  2QE9 A;  3L0I A;  1PCX A;  1O3U A;  2UUI A;  3TJ6 A;  1A0B A;  3T9O A;  1NBB A;  1XZQ A;  3RFY A;  5FCL A;  2DYS C;  3DAG A;  4LDR A;  3DXJ F;  2A0U A;  2GDC A;  4DJ9 A;  4JKV A;  1Y6D A;  4PJJ A;  3U8V A;  2Q00 A;  5BQG A;  3GOR A;  3RQG A;  5L0I A;  1ZYR F;  4CDV A;  2J0X A;  1JAF A;  3O39 A;  4OIQ F;  3ZQV A;  1BBH A;  3ZWI A;  5BQH A;  1LI5 A;  1YA9 A;  3LS0 A;  2NUT A;  3ZC4 A;  1AVO B;  4NC3 A;  2R05 A;  3GWN A;  1M2V B;  2A1D D;  1LE4 A;  4D4N A;  1BZ4 A;  3I5P A;  1MMG A;  4JTD B;  4PK4 A;  2VCB A;  4J7Y A;  2XLV A;  4YJW A;  2YVK A;  4FAP B;  4NTA A;  1DOV A;  1JPJ A;  2OJE D;  2J0W A;  2PX3 A;  4LDQ A;  2UUH A;  1Q0F A;  2AWC A;  2XM4 A;  1OW7 A;  3CZ6 A;  1U6H A;  5B1A C;  3A11 A;  1H6G A;  5E33 A;  4BJ6 A;  4GYT A;  1BDJ B;  5JRA A;  1V55 C;  3W2W A;  1ZHY A;  4MTF A;  3U2L A;  1YDI A;  3NMJ A;  1EQ1 A;  2CNW A;  3BEH A;  5JP7 A;  3RF3 A;  1OKK A;  3FMS A;  5COF A;  2PX0 A;  2L6F A;  2O9X A;  3EHM A;  2IXM A;  3LS1 A;  3Q6M A;  4U5E E;  1MMD A;  3FDQ A;  5DS5 A;  4BJ6 C;  3Q7L A;  1FTS A;  3S9O A;  3UGP A;  4QI2 A;  1O5H A;  1D0Y A;  2OG2 A;  4MTO A;  2R7T A;  4JVS A;  1BR2 A;  3F47 A;  3AG2 C;  1MMA A;  3K33 A;  4WJ0 A;  3SEO A;  3HTK C;  4MVZ A;  5L0H A;  4EBJ A;  2R7S A;  5A6B D;  4LAC B;  2D4U A;  3EGX B;  5DLJ A;  2GA0 A;  4X0R A;  3O10 A;  3DKA A;  3EH2 A;  3QZC A;  2IYL D;  2J45 A;  3VRC A;  1KNY A;  2X51 A;  3C8Z A;  4IJJ A;  3U0C A;  1FMW A;  2Q9B A;  2OJQ A;  3JZ0 A;  1YJG A;  2XL8 A;  3IEE A;  3EHN A; 
#chains in the Genus database with same CATH homology
 4EBK A;  1JOG A;  2LK4 A;  3TUL A;  2Q00 A;  1V4A A;  2L6H A;  3C8G A;  3C8G D;  3RQG A;  4NQF A;  3C18 A;  1WTY A;  2JX0 A;  3AJM A;  3B71 A;  1WOL A;  2L6F A;  2L6G A;  1K40 A;  3GM2 A;  1QVX A;  3MFN A;  3RQF A;  3S9O A;  3U3F A;  1K05 A;  2KK1 A;  3C8G B;  4R32 A;  4XEK A;  1KTM A;  4XEV A;  3GM3 A;  2HSB A;  1ZZP A;  4EBJ A;  1OW8 A;  1OW6 A;  1PV3 A;  1WWP A;  3K7D A;  1UFB A;  3GM1 A;  3JYY A;  3L8I A;  4XEF A;  3O10 A;  3L8J A;  3RQE A;  1O3U A;  3BRJ A;  1OW7 A;  2PBE A;  1KNY A;  3U0C A;  2YWA A;  2JPU A;  3JZ0 A;  1K04 A;  5F28 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...