2LK4A

Structural and mechanistic insights into the interaction between pat pyk2 and paxillin ld motif
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
135
structure length
135
Chain Sequence
ANLDRTDDLVYLNVMELVRAVLELKNELSQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEEAKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein-tyrosine kinase 2-beta
publication title Structural and Mechanistic Insights into the Interaction between Pyk2 and Paxillin LD Motifs.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 135
sequence length 135
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 2lk4A00
2HSBA 3BRJA 2JPUA 1OW6A 3C8GA 1PV3A 3GM1A 3L8IA 3S9OA 3B71A 3TULA 1JOGA 3RQEA 3RQFA 3RQGA 1K04A 4EBKA 4XEVA 4XEKA 2L6HA 3AJMA 4EBJA 3JZ0A 4R32A 4XEFA 3MFNA 3U0CA 1QVXA 1V4AA 1WWPA 2Q00A 1ZZPA 1KNYA 3C8GD 1KTMA 2L6FA 5F28E 2PBEA 2YWAA 1OW7A 2LK4A 3C18A 4NQFA 3U3FA 3GM2A 1UFBA 1OW8A 1K40A 3JYYA 3O10A 1WOLA 2KK1A 3GM3A 1O3UA 3K7DA 2L6GA 3L8JA 2JX0A 3C8GB 1WTYA 1K05A
chains in the Genus database with same CATH superfamily
3NRHA 5JVEA 2IXNA 1ZHXA 2BE5F 2MYSA 1RMVA 3S9OA 4JCZA 4EUKB 5BUOA 1RXQA 4DRHB 2PX0A 1TWAA 4Z9JA 1Z63A 2HMZA 3UR3C 4ONSA 2H8AA 1CGNA 2ZXRA 3AJMA 4A2NB 3RIPA 3DAFA 2EINC 4WABA 2YEVA 2OCCC 2Q00A 3NG1A 3HLZA 1MQVA 4W8PA 2VCCA 1AVOB 4YT8A 3EGXA 2W4MA 2XM4A 3C63A 4GQHA 3M1CB 1G8XA 1WGWA 2J45A 1HW1A 1A7VA 4NTAA 2TMVP 2XS8A 4QI0A 2AWCA 2A69F 1WN0A 3GWLA 4DRIB 1NFOA 1A7DA 1Z3IX 2KW3C 2D5RB 3L8IA 4CS8A 2WVOA 2G3VA 2A1DD 3EH1A 1ORYA 3H2UA 4ULWA 1TFOB 3ZQYA 4G7OF 4MVUA 4XEKA 4AE4B 3T6JA 4G78A 2FAPB 1YZAA 1ZYRF 3MYFA 3EFOB 3CEXA 5L0CA 4XEFA 4BJ6A 3MFNA 2XLEA 1V4AA 3DJUB 1WWPA 1OCZC 2HSQA 2OEXA 5L0GA 4HFKB 3VYWA 3AG1C 2UUHA 3B0UX 2LQGA 4NTBA 3SXKA 3U3FA 5KYUB 5L0HA 1VMAA 3ZIBA 3HNLA 1Q0FA 1T6IA 1SMYF 2J9WA 1YYXA 3NMKA 4J7YA 1WOLA 3NYLA 1E86A 3K7DA 2KYHA 3TK0A 3FDQA 2KNHA 2WZGA 1QSPA 1LM3B 3CZ6A 4DRJB 1D1AA 4G0HA 256BA 3N2ZB 1R4TA 1OKKD 1XZQA 2EPOA 4N6CA 3TJ5A 2JPUA 3O6XA 2YHSA 3C8GA 5T1DB 2GA0A 1J8MF 2G3KA 4LERA 4LLEA 2W4BA 2XRHA 3F46A 1U89A 3A11A 4CS9C 4IAQA 2XLWA 2YLDA 4YK5A 4MTOA 4NC3A 2ZXOA 1OCOC 4U5DE 3JZ0A 2LP4A 3DMDA 1CGOA 1QVXA 5JLIA 1D0YA 1O87A 1I4YA 1NU9C 1TKNA 2IYLD 2KQ9A 1AEPA 2L6FA 3WG7C 2YLGA 1JRAA 2W45A 2FFHA 1O5HA 1LI5A 3DXJF 5A6BA 3ITFA 1U0BB 5B3SC 1O3UA 3ECSA 4J30B 2NUTB 1G4WR 3M4BA 2LIGA 2NG1A 3VM6A 1ZW2A 5KYXB 1Q0MA 2QTVA 2J46A 2AU5A 5TJ5E 2VB6A 3QTHA 1BR2A 1QLEC 3DD7A 3ZC4A 2NUPA 1BR4A 2AVKA 2LSEA 3DI5A 3EH2A 4CBEA 4N4WA 3RQGA 2Q4FA 1H9TA 1LIHA 4ANJA 4MTGA 2GDCA 1TR2A 4LDRA 1XWJA 5L0JA 4I1OB 4Z9IA 4R32A 5COGA 1LI7A 2HUJA 4I44A 2WL8A 1ORSC 3T4RA 5A6KA 4D4XA 2F22A 2YL7A 2A6EF 3L1MA 4YT4A 1WATA 3SZRA 1F1MA 2DYSC 2O9XA 4OIOF 3EHMA 1YA9A 5EK0A 4U5HA 3FOPA 2ZXWC 2EIKC 4IRUA 5A69A 2XS1A 1YLMA 4X0RA 5L0DA 1ORJA 2BL2A 3SP1A 1K05A 5BQIA 3SEOA 3BRJA 5L0FA 2R25A 1IW7F 1PD0A 4WGZA 1CGME 4CIHA 4JKVA 5COMA 4C3EA 4E0HA 3H65A 3UGPA 1Y4CA 3ASNC 2Q9CA 2XLDA 3E9VA 4IB4A 3V5YA 2XLMA 3ZQVA 3G4XA 1TQGA 5COFA 1YZCA 2Q9AA 2A6HF 4EWCA 3T6GB 1OCCC 3EFOA 4XQ1A 4O6YA 3AG4C 2HV7A 3LS0A 1KU2A 3JYYA 3PDMP 4XLPF 1Z23A 2YVKA 2LFFA 1TFKB 1H9GA 1VYKA 2XLOA 4M63A 5DQZA 4BJ1A 4ZLDA 3LAYA 3K1IA 5KYUA 3U8PA 2B0HA 2P1AA 2EIJC 2VH3A 2A0UA 4U5EE 5DVWA 4BJ5C 2H7OA 5JSLA 1M2OA 1T6UA 4JJGA 4OIQF 5FZTA 3UMHA 2OG2A 3B29A 5D92A 2WB7A 2QY9A 1YVIA 3EZHA 5DS4A 1NFNA 3HJCA 4XEVA 3U3BA 4CDVA 3AOUA 3GORA 3LESA 2LCHA 4FESA 3V5ZA 4JZAA 5KYYB 1LS1A 1LKXA 1NSGB 1XZPA 4QI2A 2H7BA 4HEAJ 2R7TA 1HE9A 2YKZA 3TD7A 4XTKA 1YDIA 2XL8A 1J8YF 2M4EA 4J32B 3FAJA 4Q7CA 3R7CA 2QUPA 1I5NA 5JUAA 2R7WA 4HFFB 1OKKA 4XPYA 4P9TA 4U9DA 4BPMA 4RBNA 3BEHA 3ZVRA 4BG0A 3POVA 4AL1A 1DOWA 3NKDA 3G4ZA 3ZSUA 3EPVA 4JURI 5JS5A 2HFIA 2JX0A 2L81A 2L6GA 3LJBA 1RKCA 3EGDB 1FMVA 4KNVA 3SYNA 2KC3A 2ZXPA 2NUTA 4ZLCA 3LNMB 4PK4A 4KC9A 5KYXA 4FWVA 3OA1A 1K04A 2Y69C 3K1HA 1TWGA 3G50A 3W8HA 4JVSA 1HMDA 3X1OA 3ZWIA 4OD5A 3QW1A 1U6HA 1EQ1A 3RKOF 1ZVZA 2XSEA 1HMOA 4DJ9A 1FTSA 3SXMA 4MVRA 2YZSA 1KNYA 4XPXA 1OQCA 5BQHA 1T5OA 3IQTA 1OW7A 5F5FA 1NU7D 3QMKA 1T9KA 5D91A 2R05A 3I5QA 3GEEA 1L3PA 3JT1A 3M15A 1OR2A 4NTFA 2R03A 1BBHA 5T3TA 3UNGC 3S84A 1RKEB 3Q6NA 3M79A 5E2QA 5F28E 2J0XA 2R7UA 2HSBA 3QVYA 4E18A 3ZTMA 2Q7RA 2RD9A 2C04A 2MWQA 4NY3A 3EHNA 3H2VA 3U2MA 2ZPAA 1G4US 2DB4A 4L6RA 2DGJA 3C62A 4N6HA 4CS9A 2L6HA 1E2XA 2OJQA 4EKWA 1E83A 3ABKC 4FAPB 2J7PD 3FOOA 3DAGA 1A7EA 4J7TA 2RSEB 4BEMJ 2CNWD 1I4ZA 3VRCA 3U9MA 2PBEA 3W2VA 3DJNB 4IGGA 1H7IA 2NPUA 1FR0A 2EPNA 1LVKA 4JTCB 2HZ8A 5DS5A 1Z5ZA 5FCLA 5AC4A 1IZMA 2DYRC 4EHPA 1WTYA 3LS1A 2Q9BA 4C3DA 4MVZA 2QE9A 2OKUA 2OOCA 1MNDA 1FAPB 3WHNA 4G7HF 5HSWA 3HNJA 4H4KC 3EJNA 1T6QA 3MLGA 4IARA 4MW3A 3IEEA 1NBBA 3AQBA 2YQYA 3KMIA 4E7SA 1Q0KA 3IQ5A 5BQGA 2BC5A 2M64A 3JRTA 3ASOC 3UMKA 1PCXA 1YJGA 2J9BA 2Y3GA 1ZZPA 3LUTB 1DOVA 3VAYA 4O79A 5KYYA 4UDVA 1R5ID 2VCAA 1VLSA 2OEVA 3T9OA 1W2WA 2P0NA 5F5HA 2AP3A 3AGUA 5A6AA 1SR2A 2KK1A 4ULVA 3DZAA 4Q5SF 1QQ3A 3O39A 3WAQA 5KYWB 1ZHZA 1LE2A 4OIRF 1UG7A 3LEVA 1V54C 1YARO 3TOMA 2GWWA 2WZFA 2X51A 4YT2A 1VTMP 1M56C 2OQMA 3HTKC 2Y3HA 3Q7GA 4K7BA 3B71A 3EGDA 3HKKA 4U5CE 3TULA 3RQFA 2VCBA 2AWYA 3Q6MA 3K33A 3LEOA 1EA8A 4MQ9F 4CJOA 5CI9A 5AC5A 1A41A 2PP4A 3VF0A 1CPQA 4PFPA 3EZIA 5B1BC 4YL1A 4PJNA 3W8IA 3N0TA 2R7RA 3NMJA 2CGEA 3W2WA 2G62A 2XL4A 2PX3A 4PACA 3RF3A 2P7VA 4JTDB 3DE9A 2C03A 2LK4A 2R7OA 3C18A 3JSZA 4K0DA 3IQ6A 3N24A 3AG3C 1GQAA 3S29A 4PFOA 4A4AA 2J9UA 2P6VA 3L0IA 4YT5A 3GWNA 3L8JA 4JC7A 3OWTA 4IJJA 3JTLO 5L3QA 3IPMO 3F47A 3RVZA 4HE8D 4MW8A 2R7SA 4N06A 2XLVA 4JRZA 1BDJB 1OR3A 1RKEA 1VLTA 1TWCA 2PNOA 2P61A 3GM1A 4BJ5A 4YWQA 3U2LA 1M2VB 5L0IA 4EIYA 1V74B 1ZHWA 1HY5A 1OCRC 2ETSA 2R7XA 2B0JA 3RW0A 2A68F 1NZEA 2R7VA 4EBJA 3U8VA 5IY5C 4G7ZF 3LLKA 2IXMA 1D0ZA 4Z9HA 5T3WA 4AL0A 4U5FE 5DLJA 2R9RB 2LD6A 4CSAC 5HV9A 4LACB 2YWAA 1ZHTA 4I3MA 3B0PA 3SXZA 4LLCA 1UFBA 2DI3A 3RH3A 3K66A 1ST6A 4MVQA 2GFHA 3NKEA 2NSGA 4OD4A 1C17M 1TWHA 1A0BA 3X2QC 1MMGA 2EILC 3CAXA 3PHF2 2J7PA 1Z6AA 3FHDA 4IAOA 5JRAA 2CNWA 3DE8A 5JT4A 2HMQA 4O7GA 2NSFA 3M4CA 1JOGA 2X0CA 3KYJA 1GS9A 3LLIA 4P9FA 4CJGA 1RJ9B 2JD3A 2EPLX 3C7JA 3IHUA 4E0IA 4EBKA 2XXAB 3PMRA 4IWBA 4WJ0A 2KSFA 4JW1A 5K0IA 4DVZA 5E3AA 1NG1A 1RCPA 4AX2A 2I8BA 1S7ZA 1T01A 4FX5A 3T6BA 1E84A 1PD1A 1ZU5A 2Y3BA 3ATPA 4LDKA 5GPGB 3TOLA 4DOZA 1G5ZA 2EPKX 3I4UA 1OW8A 1K40A 2HJMA 4MTFA 3A9CA 1V55C 4I1MA 3US6A 4PJLA 5JP7A 2VC9A 2WVNA 3FAPB 1L7CA 2IBFA 4XPWA 3C8ZA 2WVQA 3S90A 4O6NA 2J9VA 4LDQA 3DM9B 4RDAA 3JYHA 1EI7A 1BZ4A 4PR9A 2IM8A 5A6JA 4CS8C 3MX3A 1OW6A 3JSEO 3GANA 5E33A 3DKAA 5KYWA 4U5GA 3WODF 4KI2A 1D1CA 4CS7A 4OIPF 1LPEA 3LNRA 4C7OB 3RFYA 2D4UA 1C03A 1HW2A 3EG9B 1ZW3A 4BJ6C 2XL6A 1E85A 1QZXA 2UUIA 1MMNA 1MMDA 3U0CA 1Z7Qc 2I15A 3GODA 2YL1A 3AGTA 3KL4A 3Q7LA 2WZLA 2HV6A 3TJ6A 5KYNA 1H6GA 4OINF 4AK9A 3W4YA 4B6IA 2R7QA 1JAFA 1ZHYA 2XM0A 4JJFA 4CX9A 3CSKA 1LE4A 1FMWA 2IXPA 3NYMA 2OU6A 4K1OA 4MVOA 4YN0B 2LFDA 3I5PA 4KNWA 2IOQA 1CPRA 2CW0F 4JEBA 3ABLC 1JPJA 3FMSA 3JCUQ 2A0BA 2HS5A 4JCHA 4DXWA 1YYJA 2ICWG 1YA7O 4JTAB 5B1AC 4DVYP 1JR8A 3DM5A 3AQCA 4U5BE 5CIVA 3S0XA 1QPUA 2EIMC 2L9JA 1LS4A 4KBLA 4U9EA 4DBRA 3TQOA 3V7OA 4NCQA 1GGQA 1AUEA 1JMWA 1M2VA 2YRFA 2E87A 4JIOA 3PCVA 3EGXB 4W8KA 2KGOA 3KPHA 4D4NA 2V26A 3UGOA 2EPMX 4MVMA 3SXYA 1M6TA 1VK5A 3U5SA 2PFDA 4JE9A 2PF4E 1VB5A 3GM3A 4XWJA 3S27A 4PJMA 2CYDA 1SZIA 1Q0DA 2FGYA 1S05A 2HJ3A 4XLNF 1Y6DA 3ZTZA 5EHHA 4YL3A 1ZU4A 1OXKA 2CDQA 2QLAA 2CCYA 3RVYA 1MMAA 1VYIA 2L7AA 2V3CC 3K6BA 4QDLA 4GYTA 1PV3A 3KKBA 1D0XA 2YL3A 3KYIA 3NYJA 4YJWA 3RQEA 3V5XA 4BJTA 3B0VC 4ER9A 4RD9A 4H54A 2Z15A 1C02A 1D1BA 2J0WA 2Q3TA 3ABMC 4Q4ZF 5DS6A 4MS2A 3ZG1A 1SF8A 4PJJA 1FNTc 2VASA 1OXBA 4JEAA 1FFTC 1RJ9A 4E17A 2ZD9A 3L34A 3HNIA 3C8GD 4CIPA 1KTMA 2XLHA 5B3IA 2XXAA 3GEIA 2J8WA 4O6MA 1HE1A 3GM2A 1JPNA 1MNEA 3MBGA 1FFHA 3NDBB 1NLXA 3O10A 1B68A 1WASA 2MHRA 3AG2C 2YLIA 1YAUO 3C8GB 3GEHA 3E70C 4GEHA 2OJED 1QKRA 4CDAA 1VOMA 3S28A 4CDYA 5EGYA 2H7VC 1Q0GA 3ZDLA 5A6BD 4YL0A 2IXOA 3B9QA 5AGFA 3DWWA 1BR1A 3QW0A 2ASRA 4BEJA 3QVZA 1EKYA 5L3VA 3NMIA 2HKVA 4AE4A 4DBQA 4C7OA 3FXHA 2QNLA 1SYQA 2YL0A 4WGYA 3SNHA 3R2PA 3EG9A 3KH2A 4E7ZA 1GM5A 4CSAA 3HNKA 3O55A 3IQCA 3JRMO 2KJGA 4MVSA 4NQFA 3MYIA 3RYLA 3U9JA 4F4BA 1N1CA 3UMIA 2R02A 3EQLF 3OEOA 3K1IC 2GAQA 4P6IC 4C3BA 2W9YA 4EBBA 3FVYA 5DQTA 5CI8A 3J06A 1M57C 3CQZA 2Y39A 4MNDA 5E3CA 2NUPB 2Y3DA 3QZCA 1APCA
chains in the Genus database with same CATH topology
2HSBA 3BRJA 2JPUA 1OW6A 3C8GA 1PV3A 3GM1A 3L8IA 3S9OA 3B71A 3TULA 1JOGA 3RQEA 3RQFA 3RQGA 1K04A 4EBKA 4XEVA 4XEKA 2L6HA 3AJMA 4EBJA 3JZ0A 4R32A 4XEFA 3MFNA 3U0CA 1QVXA 1V4AA 1WWPA 2Q00A 1ZZPA 1KNYA 3C8GD 1KTMA 2L6FA 5F28E 2PBEA 2YWAA 1OW7A 2LK4A 3C18A 4NQFA 3U3FA 3GM2A 1UFBA 1OW8A 1K40A 3JYYA 3O10A 1WOLA 2KK1A 3GM3A 1O3UA 3K7DA 2L6GA 3L8JA 2JX0A 3C8GB 1WTYA 1K05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HSB A;  3BRJ A;  2JPU A;  1OW6 A;  3C8G A;  1PV3 A;  3GM1 A;  3L8I A;  3S9O A;  3B71 A;  3TUL A;  1JOG A;  3RQE A;  3RQF A;  3RQG A;  1K04 A;  4EBK A;  4XEV A;  4XEK A;  2L6H A;  3AJM A;  4EBJ A;  3JZ0 A;  4R32 A;  4XEF A;  3MFN A;  3U0C A;  1QVX A;  1V4A A;  1WWP A;  2Q00 A;  1ZZP A;  1KNY A;  3C8G D;  1KTM A;  2L6F A;  5F28 E;  2PBE A;  2YWA A;  1OW7 A;  2LK4 A;  3C18 A;  4NQF A;  3U3F A;  3GM2 A;  1UFB A;  1OW8 A;  1K40 A;  3JYY A;  3O10 A;  1WOL A;  2KK1 A;  3GM3 A;  1O3U A;  3K7D A;  2L6G A;  3L8J A;  2JX0 A;  3C8G B;  1WTY A;  1K05 A; 
#chains in the Genus database with same CATH topology
 3NRH A;  5JVE A;  2IXN A;  1ZHX A;  2BE5 F;  2MYS A;  1RMV A;  3S9O A;  4JCZ A;  4EUK B;  5BUO A;  1RXQ A;  4DRH B;  2PX0 A;  1TWA A;  4Z9J A;  1Z63 A;  2HMZ A;  3UR3 C;  4ONS A;  2H8A A;  1CGN A;  2ZXR A;  3AJM A;  4A2N B;  3RIP A;  3DAF A;  2EIN C;  4WAB A;  2YEV A;  2OCC C;  2Q00 A;  3NG1 A;  3HLZ A;  1MQV A;  4W8P A;  2VCC A;  1AVO B;  4YT8 A;  3EGX A;  2W4M A;  2XM4 A;  3C63 A;  4GQH A;  3M1C B;  1G8X A;  1WGW A;  2J45 A;  1HW1 A;  1A7V A;  4NTA A;  2TMV P;  2XS8 A;  4QI0 A;  2AWC A;  2A69 F;  1WN0 A;  3GWL A;  4DRI B;  1NFO A;  1A7D A;  1Z3I X;  2KW3 C;  2D5R B;  3L8I A;  4CS8 A;  2WVO A;  2G3V A;  2A1D D;  3EH1 A;  1ORY A;  3H2U A;  4ULW A;  1TFO B;  3ZQY A;  4G7O F;  4MVU A;  4XEK A;  4AE4 B;  3T6J A;  4G78 A;  2FAP B;  1YZA A;  1ZYR F;  3MYF A;  3EFO B;  3CEX A;  5L0C A;  4XEF A;  4BJ6 A;  3MFN A;  2XLE A;  1V4A A;  3DJU B;  1WWP A;  1OCZ C;  2HSQ A;  2OEX A;  5L0G A;  4HFK B;  3VYW A;  3AG1 C;  2UUH A;  3B0U X;  2LQG A;  4NTB A;  3SXK A;  3U3F A;  5KYU B;  5L0H A;  1VMA A;  3ZIB A;  3HNL A;  1Q0F A;  1T6I A;  1SMY F;  2J9W A;  1YYX A;  3NMK A;  4J7Y A;  1WOL A;  3NYL A;  1E86 A;  3K7D A;  2KYH A;  3TK0 A;  3FDQ A;  2KNH A;  2WZG A;  1QSP A;  1LM3 B;  3CZ6 A;  4DRJ B;  1D1A A;  4G0H A;  256B A;  3N2Z B;  1R4T A;  1OKK D;  1XZQ A;  2EPO A;  4N6C A;  3TJ5 A;  2JPU A;  3O6X A;  2YHS A;  3C8G A;  5T1D B;  2GA0 A;  1J8M F;  2G3K A;  4LER A;  4LLE A;  2W4B A;  2XRH A;  3F46 A;  1U89 A;  3A11 A;  4CS9 C;  4IAQ A;  2XLW A;  2YLD A;  4YK5 A;  4MTO A;  4NC3 A;  2ZXO A;  1OCO C;  4U5D E;  3JZ0 A;  2LP4 A;  3DMD A;  1CGO A;  1QVX A;  5JLI A;  1D0Y A;  1O87 A;  1I4Y A;  1NU9 C;  1TKN A;  2IYL D;  2KQ9 A;  1AEP A;  2L6F A;  3WG7 C;  2YLG A;  1JRA A;  2W45 A;  2FFH A;  1O5H A;  1LI5 A;  3DXJ F;  5A6B A;  3ITF A;  1U0B B;  5B3S C;  1O3U A;  3ECS A;  4J30 B;  2NUT B;  1G4W R;  3M4B A;  2LIG A;  2NG1 A;  3VM6 A;  1ZW2 A;  5KYX B;  1Q0M A;  2QTV A;  2J46 A;  2AU5 A;  5TJ5 E;  2VB6 A;  3QTH A;  1BR2 A;  1QLE C;  3DD7 A;  3ZC4 A;  2NUP A;  1BR4 A;  2AVK A;  2LSE A;  3DI5 A;  3EH2 A;  4CBE A;  4N4W A;  3RQG A;  2Q4F A;  1H9T A;  1LIH A;  4ANJ A;  4MTG A;  2GDC A;  1TR2 A;  4LDR A;  1XWJ A;  5L0J A;  4I1O B;  4Z9I A;  4R32 A;  5COG A;  1LI7 A;  2HUJ A;  4I44 A;  2WL8 A;  1ORS C;  3T4R A;  5A6K A;  4D4X A;  2F22 A;  2YL7 A;  2A6E F;  3L1M A;  4YT4 A;  1WAT A;  3SZR A;  1F1M A;  2DYS C;  2O9X A;  4OIO F;  3EHM A;  1YA9 A;  5EK0 A;  4U5H A;  3FOP A;  2ZXW C;  2EIK C;  4IRU A;  5A69 A;  2XS1 A;  1YLM A;  4X0R A;  5L0D A;  1ORJ A;  2BL2 A;  3SP1 A;  1K05 A;  5BQI A;  3SEO A;  3BRJ A;  5L0F A;  2R25 A;  1IW7 F;  1PD0 A;  4WGZ A;  1CGM E;  4CIH A;  4JKV A;  5COM A;  4C3E A;  4E0H A;  3H65 A;  3UGP A;  1Y4C A;  3ASN C;  2Q9C A;  2XLD A;  3E9V A;  4IB4 A;  3V5Y A;  2XLM A;  3ZQV A;  3G4X A;  1TQG A;  5COF A;  1YZC A;  2Q9A A;  2A6H F;  4EWC A;  3T6G B;  1OCC C;  3EFO A;  4XQ1 A;  4O6Y A;  3AG4 C;  2HV7 A;  3LS0 A;  1KU2 A;  3JYY A;  3PDM P;  4XLP F;  1Z23 A;  2YVK A;  2LFF A;  1TFK B;  1H9G A;  1VYK A;  2XLO A;  4M63 A;  5DQZ A;  4BJ1 A;  4ZLD A;  3LAY A;  3K1I A;  5KYU A;  3U8P A;  2B0H A;  2P1A A;  2EIJ C;  2VH3 A;  2A0U A;  4U5E E;  5DVW A;  4BJ5 C;  2H7O A;  5JSL A;  1M2O A;  1T6U A;  4JJG A;  4OIQ F;  5FZT A;  3UMH A;  2OG2 A;  3B29 A;  5D92 A;  2WB7 A;  2QY9 A;  1YVI A;  3EZH A;  5DS4 A;  1NFN A;  3HJC A;  4XEV A;  3U3B A;  4CDV A;  3AOU A;  3GOR A;  3LES A;  2LCH A;  4FES A;  3V5Z A;  4JZA A;  5KYY B;  1LS1 A;  1LKX A;  1NSG B;  1XZP A;  4QI2 A;  2H7B A;  4HEA J;  2R7T A;  1HE9 A;  2YKZ A;  3TD7 A;  4XTK A;  1YDI A;  2XL8 A;  1J8Y F;  2M4E A;  4J32 B;  3FAJ A;  4Q7C A;  3R7C A;  2QUP A;  1I5N A;  5JUA A;  2R7W A;  4HFF B;  1OKK A;  4XPY A;  4P9T A;  4U9D A;  4BPM A;  4RBN A;  3BEH A;  3ZVR A;  4BG0 A;  3POV A;  4AL1 A;  1DOW A;  3NKD A;  3G4Z A;  3ZSU A;  3EPV A;  4JUR I;  5JS5 A;  2HFI A;  2JX0 A;  2L81 A;  2L6G A;  3LJB A;  1RKC A;  3EGD B;  1FMV A;  4KNV A;  3SYN A;  2KC3 A;  2ZXP A;  2NUT A;  4ZLC A;  3LNM B;  4PK4 A;  4KC9 A;  5KYX A;  4FWV A;  3OA1 A;  1K04 A;  2Y69 C;  3K1H A;  1TWG A;  3G50 A;  3W8H A;  4JVS A;  1HMD A;  3X1O A;  3ZWI A;  4OD5 A;  3QW1 A;  1U6H A;  1EQ1 A;  3RKO F;  1ZVZ A;  2XSE A;  1HMO A;  4DJ9 A;  1FTS A;  3SXM A;  4MVR A;  2YZS A;  1KNY A;  4XPX A;  1OQC A;  5BQH A;  1T5O A;  3IQT A;  1OW7 A;  5F5F A;  1NU7 D;  3QMK A;  1T9K A;  5D91 A;  2R05 A;  3I5Q A;  3GEE A;  1L3P A;  3JT1 A;  3M15 A;  1OR2 A;  4NTF A;  2R03 A;  1BBH A;  5T3T A;  3UNG C;  3S84 A;  1RKE B;  3Q6N A;  3M79 A;  5E2Q A;  5F28 E;  2J0X A;  2R7U A;  2HSB A;  3QVY A;  4E18 A;  3ZTM A;  2Q7R A;  2RD9 A;  2C04 A;  2MWQ A;  4NY3 A;  3EHN A;  3H2V A;  3U2M A;  2ZPA A;  1G4U S;  2DB4 A;  4L6R A;  2DGJ A;  3C62 A;  4N6H A;  4CS9 A;  2L6H A;  1E2X A;  2OJQ A;  4EKW A;  1E83 A;  3ABK C;  4FAP B;  2J7P D;  3FOO A;  3DAG A;  1A7E A;  4J7T A;  2RSE B;  4BEM J;  2CNW D;  1I4Z A;  3VRC A;  3U9M A;  2PBE A;  3W2V A;  3DJN B;  4IGG A;  1H7I A;  2NPU A;  1FR0 A;  2EPN A;  1LVK A;  4JTC B;  2HZ8 A;  5DS5 A;  1Z5Z A;  5FCL A;  5AC4 A;  1IZM A;  2DYR C;  4EHP A;  1WTY A;  3LS1 A;  2Q9B A;  4C3D A;  4MVZ A;  2QE9 A;  2OKU A;  2OOC A;  1MND A;  1FAP B;  3WHN A;  4G7H F;  5HSW A;  3HNJ A;  4H4K C;  3EJN A;  1T6Q A;  3MLG A;  4IAR A;  4MW3 A;  3IEE A;  1NBB A;  3AQB A;  2YQY A;  3KMI A;  4E7S A;  1Q0K A;  3IQ5 A;  5BQG A;  2BC5 A;  2M64 A;  3JRT A;  3ASO C;  3UMK A;  1PCX A;  1YJG A;  2J9B A;  2Y3G A;  1ZZP A;  3LUT B;  1DOV A;  3VAY A;  4O79 A;  5KYY A;  4UDV A;  1R5I D;  2VCA A;  1VLS A;  2OEV A;  3T9O A;  1W2W A;  2P0N A;  5F5H A;  2AP3 A;  3AGU A;  5A6A A;  1SR2 A;  2KK1 A;  4ULV A;  3DZA A;  4Q5S F;  1QQ3 A;  3O39 A;  3WAQ A;  5KYW B;  1ZHZ A;  1LE2 A;  4OIR F;  1UG7 A;  3LEV A;  1V54 C;  1YAR O;  3TOM A;  2GWW A;  2WZF A;  2X51 A;  4YT2 A;  1VTM P;  1M56 C;  2OQM A;  3HTK C;  2Y3H A;  3Q7G A;  4K7B A;  3B71 A;  3EGD A;  3HKK A;  4U5C E;  3TUL A;  3RQF A;  2VCB A;  2AWY A;  3Q6M A;  3K33 A;  3LEO A;  1EA8 A;  4MQ9 F;  4CJO A;  5CI9 A;  5AC5 A;  1A41 A;  2PP4 A;  3VF0 A;  1CPQ A;  4PFP A;  3EZI A;  5B1B C;  4YL1 A;  4PJN A;  3W8I A;  3N0T A;  2R7R A;  3NMJ A;  2CGE A;  3W2W A;  2G62 A;  2XL4 A;  2PX3 A;  4PAC A;  3RF3 A;  2P7V A;  4JTD B;  3DE9 A;  2C03 A;  2LK4 A;  2R7O A;  3C18 A;  3JSZ A;  4K0D A;  3IQ6 A;  3N24 A;  3AG3 C;  1GQA A;  3S29 A;  4PFO A;  4A4A A;  2J9U A;  2P6V A;  3L0I A;  4YT5 A;  3GWN A;  3L8J A;  4JC7 A;  3OWT A;  4IJJ A;  3JTL O;  5L3Q A;  3IPM O;  3F47 A;  3RVZ A;  4HE8 D;  4MW8 A;  2R7S A;  4N06 A;  2XLV A;  4JRZ A;  1BDJ B;  1OR3 A;  1RKE A;  1VLT A;  1TWC A;  2PNO A;  2P61 A;  3GM1 A;  4BJ5 A;  4YWQ A;  3U2L A;  1M2V B;  5L0I A;  4EIY A;  1V74 B;  1ZHW A;  1HY5 A;  1OCR C;  2ETS A;  2R7X A;  2B0J A;  3RW0 A;  2A68 F;  1NZE A;  2R7V A;  4EBJ A;  3U8V A;  5IY5 C;  4G7Z F;  3LLK A;  2IXM A;  1D0Z A;  4Z9H A;  5T3W A;  4AL0 A;  4U5F E;  5DLJ A;  2R9R B;  2LD6 A;  4CSA C;  5HV9 A;  4LAC B;  2YWA A;  1ZHT A;  4I3M A;  3B0P A;  3SXZ A;  4LLC A;  1UFB A;  2DI3 A;  3RH3 A;  3K66 A;  1ST6 A;  4MVQ A;  2GFH A;  3NKE A;  2NSG A;  4OD4 A;  1C17 M;  1TWH A;  1A0B A;  3X2Q C;  1MMG A;  2EIL C;  3CAX A;  3PHF 2;  2J7P A;  1Z6A A;  3FHD A;  4IAO A;  5JRA A;  2CNW A;  3DE8 A;  5JT4 A;  2HMQ A;  4O7G A;  2NSF A;  3M4C A;  1JOG A;  2X0C A;  3KYJ A;  1GS9 A;  3LLI A;  4P9F A;  4CJG A;  1RJ9 B;  2JD3 A;  2EPL X;  3C7J A;  3IHU A;  4E0I A;  4EBK A;  2XXA B;  3PMR A;  4IWB A;  4WJ0 A;  2KSF A;  4JW1 A;  5K0I A;  4DVZ A;  5E3A A;  1NG1 A;  1RCP A;  4AX2 A;  2I8B A;  1S7Z A;  1T01 A;  4FX5 A;  3T6B A;  1E84 A;  1PD1 A;  1ZU5 A;  2Y3B A;  3ATP A;  4LDK A;  5GPG B;  3TOL A;  4DOZ A;  1G5Z A;  2EPK X;  3I4U A;  1OW8 A;  1K40 A;  2HJM A;  4MTF A;  3A9C A;  1V55 C;  4I1M A;  3US6 A;  4PJL A;  5JP7 A;  2VC9 A;  2WVN A;  3FAP B;  1L7C A;  2IBF A;  4XPW A;  3C8Z A;  2WVQ A;  3S90 A;  4O6N A;  2J9V A;  4LDQ A;  3DM9 B;  4RDA A;  3JYH A;  1EI7 A;  1BZ4 A;  4PR9 A;  2IM8 A;  5A6J A;  4CS8 C;  3MX3 A;  1OW6 A;  3JSE O;  3GAN A;  5E33 A;  3DKA A;  5KYW A;  4U5G A;  3WOD F;  4KI2 A;  1D1C A;  4CS7 A;  4OIP F;  1LPE A;  3LNR A;  4C7O B;  3RFY A;  2D4U A;  1C03 A;  1HW2 A;  3EG9 B;  1ZW3 A;  4BJ6 C;  2XL6 A;  1E85 A;  1QZX A;  2UUI A;  1MMN A;  1MMD A;  3U0C A;  1Z7Q c;  2I15 A;  3GOD A;  2YL1 A;  3AGT A;  3KL4 A;  3Q7L A;  2WZL A;  2HV6 A;  3TJ6 A;  5KYN A;  1H6G A;  4OIN F;  4AK9 A;  3W4Y A;  4B6I A;  2R7Q A;  1JAF A;  1ZHY A;  2XM0 A;  4JJF A;  4CX9 A;  3CSK A;  1LE4 A;  1FMW A;  2IXP A;  3NYM A;  2OU6 A;  4K1O A;  4MVO A;  4YN0 B;  2LFD A;  3I5P A;  4KNW A;  2IOQ A;  1CPR A;  2CW0 F;  4JEB A;  3ABL C;  1JPJ A;  3FMS A;  3JCU Q;  2A0B A;  2HS5 A;  4JCH A;  4DXW A;  1YYJ A;  2ICW G;  1YA7 O;  4JTA B;  5B1A C;  4DVY P;  1JR8 A;  3DM5 A;  3AQC A;  4U5B E;  5CIV A;  3S0X A;  1QPU A;  2EIM C;  2L9J A;  1LS4 A;  4KBL A;  4U9E A;  4DBR A;  3TQO A;  3V7O A;  4NCQ A;  1GGQ A;  1AUE A;  1JMW A;  1M2V A;  2YRF A;  2E87 A;  4JIO A;  3PCV A;  3EGX B;  4W8K A;  2KGO A;  3KPH A;  4D4N A;  2V26 A;  3UGO A;  2EPM X;  4MVM A;  3SXY A;  1M6T A;  1VK5 A;  3U5S A;  2PFD A;  4JE9 A;  2PF4 E;  1VB5 A;  3GM3 A;  4XWJ A;  3S27 A;  4PJM A;  2CYD A;  1SZI A;  1Q0D A;  2FGY A;  1S05 A;  2HJ3 A;  4XLN F;  1Y6D A;  3ZTZ A;  5EHH A;  4YL3 A;  1ZU4 A;  1OXK A;  2CDQ A;  2QLA A;  2CCY A;  3RVY A;  1MMA A;  1VYI A;  2L7A A;  2V3C C;  3K6B A;  4QDL A;  4GYT A;  1PV3 A;  3KKB A;  1D0X A;  2YL3 A;  3KYI A;  3NYJ A;  4YJW A;  3RQE A;  3V5X A;  4BJT A;  3B0V C;  4ER9 A;  4RD9 A;  4H54 A;  2Z15 A;  1C02 A;  1D1B A;  2J0W A;  2Q3T A;  3ABM C;  4Q4Z F;  5DS6 A;  4MS2 A;  3ZG1 A;  1SF8 A;  4PJJ A;  1FNT c;  2VAS A;  1OXB A;  4JEA A;  1FFT C;  1RJ9 A;  4E17 A;  2ZD9 A;  3L34 A;  3HNI A;  3C8G D;  4CIP A;  1KTM A;  2XLH A;  5B3I A;  2XXA A;  3GEI A;  2J8W A;  4O6M A;  1HE1 A;  3GM2 A;  1JPN A;  1MNE A;  3MBG A;  1FFH A;  3NDB B;  1NLX A;  3O10 A;  1B68 A;  1WAS A;  2MHR A;  3AG2 C;  2YLI A;  1YAU O;  3C8G B;  3GEH A;  3E70 C;  4GEH A;  2OJE D;  1QKR A;  4CDA A;  1VOM A;  3S28 A;  4CDY A;  5EGY A;  2H7V C;  1Q0G A;  3ZDL A;  5A6B D;  4YL0 A;  2IXO A;  3B9Q A;  5AGF A;  3DWW A;  1BR1 A;  3QW0 A;  2ASR A;  4BEJ A;  3QVZ A;  1EKY A;  5L3V A;  3NMI A;  2HKV A;  4AE4 A;  4DBQ A;  4C7O A;  3FXH A;  2QNL A;  1SYQ A;  2YL0 A;  4WGY A;  3SNH A;  3R2P A;  3EG9 A;  3KH2 A;  4E7Z A;  1GM5 A;  4CSA A;  3HNK A;  3O55 A;  3IQC A;  3JRM O;  2KJG A;  4MVS A;  4NQF A;  3MYI A;  3RYL A;  3U9J A;  4F4B A;  1N1C A;  3UMI A;  2R02 A;  3EQL F;  3OEO A;  3K1I C;  2GAQ A;  4P6I C;  4C3B A;  2W9Y A;  4EBB A;  3FVY A;  5DQT A;  5CI8 A;  3J06 A;  1M57 C;  3CQZ A;  2Y39 A;  4MND A;  5E3C A;  2NUP B;  2Y3D A;  3QZC A;  1APC A; 
#chains in the Genus database with same CATH homology
 2HSB A;  3BRJ A;  2JPU A;  1OW6 A;  3C8G A;  1PV3 A;  3GM1 A;  3L8I A;  3S9O A;  3B71 A;  3TUL A;  1JOG A;  3RQE A;  3RQF A;  3RQG A;  1K04 A;  4EBK A;  4XEV A;  4XEK A;  2L6H A;  3AJM A;  4EBJ A;  3JZ0 A;  4R32 A;  4XEF A;  3MFN A;  3U0C A;  1QVX A;  1V4A A;  1WWP A;  2Q00 A;  1ZZP A;  1KNY A;  3C8G D;  1KTM A;  2L6F A;  5F28 E;  2PBE A;  2YWA A;  1OW7 A;  2LK4 A;  3C18 A;  4NQF A;  3U3F A;  3GM2 A;  1UFB A;  1OW8 A;  1K40 A;  3JYY A;  3O10 A;  1WOL A;  2KK1 A;  3GM3 A;  1O3U A;  3K7D A;  2L6G A;  3L8J A;  2JX0 A;  3C8G B;  1WTY A;  1K05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...