2LK4A

Structural and mechanistic insights into the interaction between pat pyk2 and paxillin ld motif
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
135
structure length
135
Chain Sequence
b'ANLDRTDDLVYLNVMELVRAVLELKNELSQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEEAKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein-tyrosine kinase 2-beta
publication title Structural and Mechanistic Insights into the Interaction between Pyk2 and Paxillin LD Motifs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 26
structure length 135
sequence length 135
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 2lk4A00
3B71A 3C8GB 2L6GA 1JOGA 2LK4A 3GM2A 3U3FA 1KNYA 1KTMA 2HSBA 1V4AA 2JPUA 4XEKA 1O3UA 1K05A 1OW6A 3RQGA 2L6FA 1WWPA 3S9OA 3U0CA 4EBKA 2PBEA 3AJMA 2Q00A 1WTYA 1K04A 3RQFA 3GM3A 3C18A 4EBJA 3JZ0A 5F28E 1OW8A 3GM1A 3BRJA 4XEVA 1PV3A 4NQFA 4R32A 1K40A 4XEFA 3C8GD 3TULA 2KK1A 1ZZPA 2L6HA 1OW7A 3MFNA 3C8GA 3RQEA 1UFBA 2YWAA 1WOLA 3JYYA 3O10A 3L8JA 2JX0A 3L8IA 1QVXA 3K7DA
chains in the Genus database with same CATH superfamily
3ABMC 3MYFA 1U0BB 5JP7A 1HE1A 2R25A 1JOGA 2A69F 2OOCA 3IPMO 3LAYA 3SXMA 1Q0FA 2EPOA 4MVSA 3MX3A 3V7OA 4WJ0A 1ORJA 3KMIA 4GEHA 3R2PA 3DMDA 4I1OB 1G5ZA 3NMKA 4CSAA 1YZCA 2A0UA 4QI0A 5D91A 1FNTc 1WTYA 1APCA 1O5HA 2CYDA 3R7CA 1FFTC 3ZIBA 2Y3BA 1M6TA 1YJGA 2AVKA 2Y69C 3C62A 3IQCA 4JJFA 4PACA 3UNGC 4Q5SF 3BRJA 2FGYA 2ZPAA 3C63A 4J7TA 2KQ9A 2OKUA 4XLPF 1NFNA 3I5PA 4RDAA 3FXHA 3EFOA 3EPVA 4JURI 1Z3IX 2CDQA 2D4UA 3SXZA 1D0XA 4BJ5C 5E3CA 3TJ6A 1D0ZA 3K7DA 2W4MA 3T6GB 3FAJA 1VOMA 1TWGA 4DRJB 4J7YA 1PCXA 2WB7A 1T5OA 1NBBA 1Z23A 4NY3A 2IBFA 3ZVRA 5A6JA 2EILC 2IXMA 1KTMA 4OINF 3N0TA 1HY5A 5EK0A 2DGJA 1TWAA 2MHRA 3SZRA 2CNWD 3JT1A 2HMQA 4PJMA 4XTKA 4EBKA 2GDCA 3NRHA 4MQ9F 4NTBA 3B0UX 2BL2A 4I44A 1OXBA 2AWCA 1YVIA 3MLGA 4K1OA 5CIVA 2Y3HA 2F22A 3WODF 1VK5A 2W9YA 2HFIA 2L9JA 2Q9CA 4FX5A 3QZCA 1RKEB 4PFPA 1DOVA 1M57C 1FMWA 3NKDA 3WHNA 1OR3A 1UG7A 3FOPA 4LACB 1ZW3A 4EKWA 1E84A 3ABKC 5KYUB 4ONSA 1H6GA 4O79A 1JPNA 1G4US 3RQGA 3T4RA 2WVNA 2R7OA 3DKAA 1E85A 3AOUA 2FAPB 3B71A 3NYLA 5JRAA 1HW2A 3K1HA 3Q6NA 3K33A 1ZHYA 1T6IA 3JRTA 2JPUA 3EGXA 4BJ1A 2E87A 1JPJA 1B68A 4AL0A 1XZPA 2VCCA 3QTHA 3FDQA 1ZVZA 1ZU5A 2J0XA 4RD9A 4CDAA 2CNWA 4QI2A 3C18A 3C7JA 3L0IA 2J9WA 2KGOA 5DS5A 1IW7F 1E86A 4JC7A 1Y6DA 4DBRA 4E7SA 4P6IC 2XLOA 3G4XA 4JCHA 3DJUB 3T6JA 3C8GD 2EPLX 3EHNA 4IAOA 4U5DE 4YT4A 3ATPA 1VB5A 4AX2A 4Q7CA 1A7EA 1WOLA 4PJLA 4U9EA 2BC5A 1OCCC 4LLEA 4ULVA 1TFOB 4YK5A 1L7CA 4BEJA 2XL6A 3RKOF 4CS9A 1M2VA 2Q4FA 3HLZA 1ORSC 2PFDA 3HNIA 2P1AA 3B29A 1D1BA 5B3IA 1S7ZA 3QVYA 3ZTZA 2R7VA 1OCRC 3VYWA 4W8PA 1O3UA 2XLVA 3KL4A 2QTVA 1YDIA 1EA8A 3TQOA 1M56C 1U6HA 3S90A 4ULWA 1FFHA 5T3TA 3GM3A 4HEAJ 2B0HA 3US6A 3AG3C 2ZXPA 5DQZA 1YLMA 4OD4A 2UUIA 4JRZA 2ZXRA 4U9DA 4OIOF 5COMA 2L81A 2LFDA 2R03A 3ZQYA 5KYXB 1BR2A 4JTDB 1YAUO 2VCAA 4JKVA 5KYYA 4U5HA 1TQGA 3C8GA 3EGDB 4I1MA 1E83A 4OIPF 1NLXA 2NUPA 5L0JA 2CGEA 1ZHZA 3X1OA 3AGTA 2NSGA 2C03A 3SEOA 4CX9A 1YA7O 5D92A 1FMVA 3JRMO 1RKCA 1MNDA 2A68F 3X2QC 1T01A 4CDVA 2TMVP 1M2VB 2HJ3A 4G7ZF 4XPYA 3LLIA 4DRHB 4LERA 2ZXOA 4K7BA 4AE4A 4CDYA 4CS8A 4D4XA 2M64A 2DYRC 3U0CA 3U9JA 3RF3A 4JE9A 1G8XA 1NG1A 2VC9A 4O6YA 3T9OA 4KC9A 3S0XA 4MVOA 2X51A 2AU5A 4E18A 4UDVA 4CSAC 4WGZA 2Q9BA 2XLEA 1LPEA 4P9TA 4XEFA 5EGYA 1QSPA 1TWCA 1OW7A 2J46A 5E3AA 2LCHA 2Y39A 3ECSA 1Z63A 4LDQA 3GANA 4F4BA 2YL0A 1D1CA 2XXAA 3B0PA 3CQZA 4U5EE 2LSEA 5TJ5E 2ASRA 2IOQA 3L34A 3GWLA 2V26A 4MVMA 3OEOA 1V4AA 2XLHA 1SMYF 1CGOA 2WVQA 3CAXA 5BQGA 4EUKB 3S9OA 3GORA 2PBEA 3M4BA 2CCYA 3AJMA 3DD7A 4K0DA 1FAPB 1CPQA 4M63A 1TR2A 2MWQA 4GYTA 3NKEA 2LD6A 5AC4A 2H7OA 1C02A 1H9GA 2R05A 3V5XA 2NG1A 3I5QA 1TFKB 1PV3A 3CEXA 1LVKA 3VRCA 4MVRA 5B1BC 3TULA 2R7RA 1MMAA 5A6BD 2NUTA 3U3BA 2J45A 2W45A 2R7QA 3ASNC 5JVEA 1CPRA 2IM8A 1JRAA 3EG9A 2J9VA 1LM3B 5COGA 5F5HA 3VAYA 2R7UA 1VMAA 5CI9A 2WZLA 3U8PA 4J30B 1O87A 4JEAA 4JTAB 3PHF2 3U5SA 2Y3GA 1E2XA 1D1AA 2IYLD 3AGUA 3HKKA 2XXAB 2WZGA 3M15A 2KW3C 2PF4E 1I5NA 4U5GA 1K05A 4YJWA 4XWJA 5KYWA 2HZ8A 3GODA 2V3CC 2H7VC 3GEIA 3UGOA 2QE9A 1RJ9A 3FVYA 2J0WA 3O39A 4DOZA 3LEOA 4JIOA 3QW0A 1Z7Qc 2YEVA 3ASOC 2YLDA 3LESA 2LQGA 4O7GA 5JT4A 3MBGA 2J9UA 3EJNA 3ZSUA 3K6BA 2AWYA 2QY9A 2YL1A 3S27A 4BJ6A 4KBLA 3IQ6A 3WG7C 2WZFA 4N06A 3U8VA 2KC3A 4CIPA 3ZWIA 4AL1A 5A6BA 5L0FA 4YL0A 1EQ1A 2EPKX 3EFOB 2I15A 1R5ID 1FTSA 4E7ZA 1F1MA 3NDBB 1HE9A 2Q3TA 3B0VC 2KJGA 4CS9C 1C17M 1W2WA 3UMIA 3LEVA 4YT2A 3FHDA 4AK9A 1ZYRF 5B3SC 3OA1A 1C03A 2QLAA 1AVOB 1QPUA 2J7PD 3LS1A 3RQFA 5KYWB 2R9RB 4LLCA 2HKVA 5JS5A 1QLEC 2PP4A 2R7TA 3CZ6A 4NTFA 3JZ0A 1OW8A 4C7OA 3QVZA 4H54A 3UMHA 5L3VA 2MYSA 1WN0A 3N2ZB 1LS4A 1DOWA 1ORYA 2EPMX 1MQVA 2XLMA 4J32B 4P9FA 1PD0A 3S84A 2DB4A 3FAPB 1ZZPA 2OQMA 3RW0A 1VYIA 1EKYA 3TOMA 4EWCA 4XLNF 3JYHA 3L8IA 1ZU4A 1Q0GA 3W8IA 3TJ5A 1JMWA 3VM6A 3GEHA 3U3FA 1T6UA 4OIQF 2PX0A 1V54C 3E9VA 2HS5A 2DYSC 2ETSA 2OG2A 2XM0A 2NPUA 4IWBA 4MVUA 4YT8A 4MS2A 3V5YA 3EGXB 2AP3A 2J9BA 3DAGA 3DM5A 1AEPA 1ST6A 3EH1A 2EIKC 3AG4C 1HW1A 1OKKD 2J7PA 3HNLA 3V5ZA 5BQIA 3QW1A 1MNEA 4R32A 5IY5C 3EQLF 2YQYA 3VF0A 3T6BA 2HV7A 1A7VA 2P0NA 2KK1A 4WGYA 4YL1A 4C7OB 2IXOA 3KH2A 4JCZA 2H7BA 2WVOA 2R7XA 1CGME 3AG1C 3GEEA 1SF8A 1KU2A 5DVWA 3RYLA 1QVXA 2GWWA 4CIHA 2QUPA 1WGWA 3IHUA 1OR2A 3AQBA 1SR2A 3U2LA 5KYNA 3U2MA 4PR9A 1Q0DA 3H2VA 2XLDA 3C8ZA 4NCQA 3SXKA 2KYHA 1OW6A 1LE2A 3W2VA 3ZG1A 1S05A 3ZC4A 2Q7RA 2DI3A 2G62A 5A6AA 1T9KA 4IAQA 4YT5A 5F28E 1BR4A 3WAQA 4CBEA 4ZLDA 4G0HA 3DZAA 3NYJA 4L6RA 1OKKA 1RCPA 2XL8A 2GFHA 4U5BE 1H9TA 1VYKA 3NYMA 1OCOC 2L6HA 1ZHXA 2RD9A 2VCBA 1ZW2A 2EIMC 2XRHA 3JYYA 1TKNA 5JLIA 2PX3A 3LUTB 1HMOA 3K1IA 2YL7A 2FFHA 1A7DA 2QNLA 4N6HA 5KYYB 3C8GB 1NSGB 4JJGA 2ZXWC 4O6MA 2NUPB 3KYIA 2OJED 3DAFA 4U5FE 4YN0B 1KNYA 2ZD9A 4C3DA 3JSEO 3Q6MA 1Y4CA 3E70C 1WASA 3S29A 2R7WA 3N24A 1LI5A 1BBHA 5L0HA 1BR1A 2HJMA 3AQCA 4JZAA 4AE4B 4EHPA 5CI8A 1VTMP 4N6CA 1SYQA 1T6QA 5T3WA 2YLIA 3QMKA 2R7SA 2WL8A 4IB4A 1XZQA 4NQFA 3GWNA 5K0IA 1PD1A 5AC5A 3BEHA 1FR0A 4XPWA 4ANJA 4X0RA 2YWAA 3EHMA 2OEXA 2XM4A 2JX0A 5JUAA 3S28A 1QKRA 1NU9C 4BG0A 4BJ6C 1D0YA 4JEBA 2D5RB 4MTGA 4FAPB 4JVSA 2L6GA 2EINC 2LP4A 3JSZA 3SP1A 2YL3A 3H2UA 3GM2A 4WABA 4BPMA 4A4AA 4G7HF 1VLSA 4HE8D 3SYNA 3DE8A 3HTKC 5BUOA 1SZIA 5HSWA 1OQCA 4CS7A 5DLJA 4I3MA 1RKEA 2YRFA 3RFYA 2A6HF 5COFA 4G78A 2Q9AA 4MVQA 4OIRF 4EBJA 1MMDA 5E33A 3EZHA 4MTOA 4RBNA 3ZTMA 4E0HA 2IXPA 5KYUA 3U9MA 4G7OF 1YA9A 4CS8C 2XLWA 1I4ZA 3TD7A 4KI2A 5FCLA 5L0CA 3B9QA 4EBBA 3IQTA 3RQEA 1LIHA 2P7VA 3DXJF 3O6XA 2H8AA 4IGGA 4DXWA 2NUTB 3DJNB 3DWWA 3LNRA 3LJBA 1V55C 2VASA 3ABLC 2A6EF 2B0JA 3EG9B 3TK0A 2EIJC 4JW1A 1GQAA 1EI7A 1NU7D 3EZIA 1H7IA 4NC3A 3SNHA 3W4YA 3IQ5A 4B6IA 5DS4A 3NG1A 1J8YF 4C3BA 4LDRA 3EH2A 4PK4A 1CGNA 3HNKA 2Q00A 3KYJA 1JR8A 1G4WR 4DRIB 4KNWA 2P61A 3G50A 5HV9A 2O9XA 2OU6A 3F46A 4FWVA 2YZSA 2HV6A 1RMVA 1RJ9B 4BJTA 2KNHA 2OCCC 1V74B 3CSKA 4ZLCA 4BJ5A 1K40A 3UMKA 3DM9B 4Z9IA 4E0IA 5AGFA 4Q4ZF 3F47A 2NSFA 1ZHTA 3O10A 2A0BA 3Q7GA 2CW0F 4DVZA 2EPNA 3H65A 2OJQA 5B1AC 3G4ZA 1MMNA 2OEVA 3JCUQ 4KNVA 1YARO 4IRUA 3ITFA 1I4YA 3OWTA 4YL3A 3A9CA 4C3EA 4Z9JA 4XEKA 5DQTA 4JTCB 1OXKA 3IEEA 3HJCA 1U89A 2G3KA 3RVYA 4PJNA 3TOLA 3UGPA 4MW3A 3M4CA 4W8KA 4A2NB 1LS1A 2IXNA 2XS1A 2Z15A 1Q0KA 2HUJA 3FMSA 4Z9HA 1LKXA 2M4EA 4MTFA 5T1DB 4CJGA 5A6KA 5BQHA 2PNOA 1LI7A 3AG2C 3NMJA 5KYXA 3EGDA 3NMIA 4MVZA 3FOOA 4YWQA 2HSQA 4N4WA 2G3VA 4H4KC 2UUHA 1GGQA 1UFBA 5GPGB 2RSEB 2W4BA 3RVZA 2VB6A 1Q0MA 3HNJA 4IJJA 4IARA 3DE9A 1TWHA 2J8WA 4BEMJ 1J8MF 1OCZC 2R02A 1YYXA 1WATA 2LK4A 3K1IC 3I4UA 5A69A 1QQ3A 5L0DA 4PJJA 2C04A 2GA0A 4LDKA 4O6NA 2HMZA 1XWJA 3LS0A 1RXQA 2VH3A 1VLTA 2L6FA 2X0CA 3ZQVA 5EHHA 4D4NA 1NZEA 4CJOA 4EIYA 2BE5F 3J06A 3M79A 4XQ1A 2YVKA 4MNDA 3KKBA 4PFOA 3RH3A 2LFFA 3MFNA 1A41A 2LIGA 4DJ9A 2JD3A 3A11A 3W8HA 5DS6A 3Q7LA 3PMRA 3POVA 1HMDA 3SXYA 2XSEA 3LNMB 3JTLO 4MW8A 1Z6AA 3K66A 1M2OA 1YYJA 3PDMP 3LLKA 3M1CB 1LE4A 5JSLA 3UR3C 1R4TA 3DI5A 4XPXA 5F5FA 2Y3DA 1N1CA 2XS8A 4FESA 2HSBA 1BZ4A 4NTAA 1BDJB 2GAQA 5E2QA 4DVYP 1WWPA 1NFOA 5FZTA 1AUEA 1L3PA 2YKZA 4U5CE 4OD5A 3ZDLA 3O55A 1QZXA 5L0GA 1K04A 1IZMA 2A1DD 3KPHA 2P6VA 2L7AA 2YHSA 2YLGA 3MYIA 4QDLA 4DBQA 2ICWG 1A0BA 256BA 1YZAA 3PCVA 4HFFB 5L3QA 3GM1A 4XEVA 1JAFA 1Z5ZA 5L0IA 3L1MA 4GQHA 4HFKB 2KSFA 3RIPA 4ER9A 4E17A 1GS9A 3W2WA 2XL4A 1MMGA 2I8BA 1GM5A 1ZHWA 3L8JA
chains in the Genus database with same CATH topology
3B71A 3C8GB 2L6GA 1JOGA 2LK4A 3GM2A 3U3FA 1KNYA 1KTMA 2HSBA 1V4AA 2JPUA 4XEKA 1O3UA 1K05A 1OW6A 3RQGA 2L6FA 1WWPA 3S9OA 3U0CA 4EBKA 2PBEA 3AJMA 2Q00A 1WTYA 1K04A 3RQFA 3GM3A 3C18A 4EBJA 3JZ0A 5F28E 1OW8A 3GM1A 3BRJA 4XEVA 1PV3A 4NQFA 4R32A 1K40A 4XEFA 3C8GD 3TULA 2KK1A 1ZZPA 2L6HA 1OW7A 3MFNA 3C8GA 3RQEA 1UFBA 2YWAA 1WOLA 3JYYA 3O10A 3L8JA 2JX0A 3L8IA 1QVXA 3K7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B71 A;  3C8G B;  2L6G A;  1JOG A;  2LK4 A;  3GM2 A;  3U3F A;  1KNY A;  1KTM A;  2HSB A;  1V4A A;  2JPU A;  4XEK A;  1O3U A;  1K05 A;  1OW6 A;  3RQG A;  2L6F A;  1WWP A;  3S9O A;  3U0C A;  4EBK A;  2PBE A;  3AJM A;  2Q00 A;  1WTY A;  1K04 A;  3RQF A;  3GM3 A;  3C18 A;  4EBJ A;  3JZ0 A;  5F28 E;  1OW8 A;  3GM1 A;  3BRJ A;  4XEV A;  1PV3 A;  4NQF A;  4R32 A;  1K40 A;  4XEF A;  3C8G D;  3TUL A;  2KK1 A;  1ZZP A;  2L6H A;  1OW7 A;  3MFN A;  3C8G A;  3RQE A;  1UFB A;  2YWA A;  1WOL A;  3JYY A;  3O10 A;  3L8J A;  2JX0 A;  3L8I A;  1QVX A;  3K7D A; 
#chains in the Genus database with same CATH topology
 3ABM C;  3MYF A;  1U0B B;  5JP7 A;  1HE1 A;  2R25 A;  1JOG A;  2A69 F;  2OOC A;  3IPM O;  3LAY A;  3SXM A;  1Q0F A;  2EPO A;  4MVS A;  3MX3 A;  3V7O A;  4WJ0 A;  1ORJ A;  3KMI A;  4GEH A;  3R2P A;  3DMD A;  4I1O B;  1G5Z A;  3NMK A;  4CSA A;  1YZC A;  2A0U A;  4QI0 A;  5D91 A;  1FNT c;  1WTY A;  1APC A;  1O5H A;  2CYD A;  3R7C A;  1FFT C;  3ZIB A;  2Y3B A;  1M6T A;  1YJG A;  2AVK A;  2Y69 C;  3C62 A;  3IQC A;  4JJF A;  4PAC A;  3UNG C;  4Q5S F;  3BRJ A;  2FGY A;  2ZPA A;  3C63 A;  4J7T A;  2KQ9 A;  2OKU A;  4XLP F;  1NFN A;  3I5P A;  4RDA A;  3FXH A;  3EFO A;  3EPV A;  4JUR I;  1Z3I X;  2CDQ A;  2D4U A;  3SXZ A;  1D0X A;  4BJ5 C;  5E3C A;  3TJ6 A;  1D0Z A;  3K7D A;  2W4M A;  3T6G B;  3FAJ A;  1VOM A;  1TWG A;  4DRJ B;  4J7Y A;  1PCX A;  2WB7 A;  1T5O A;  1NBB A;  1Z23 A;  4NY3 A;  2IBF A;  3ZVR A;  5A6J A;  2EIL C;  2IXM A;  1KTM A;  4OIN F;  3N0T A;  1HY5 A;  5EK0 A;  2DGJ A;  1TWA A;  2MHR A;  3SZR A;  2CNW D;  3JT1 A;  2HMQ A;  4PJM A;  4XTK A;  4EBK A;  2GDC A;  3NRH A;  4MQ9 F;  4NTB A;  3B0U X;  2BL2 A;  4I44 A;  1OXB A;  2AWC A;  1YVI A;  3MLG A;  4K1O A;  5CIV A;  2Y3H A;  2F22 A;  3WOD F;  1VK5 A;  2W9Y A;  2HFI A;  2L9J A;  2Q9C A;  4FX5 A;  3QZC A;  1RKE B;  4PFP A;  1DOV A;  1M57 C;  1FMW A;  3NKD A;  3WHN A;  1OR3 A;  1UG7 A;  3FOP A;  4LAC B;  1ZW3 A;  4EKW A;  1E84 A;  3ABK C;  5KYU B;  4ONS A;  1H6G A;  4O79 A;  1JPN A;  1G4U S;  3RQG A;  3T4R A;  2WVN A;  2R7O A;  3DKA A;  1E85 A;  3AOU A;  2FAP B;  3B71 A;  3NYL A;  5JRA A;  1HW2 A;  3K1H A;  3Q6N A;  3K33 A;  1ZHY A;  1T6I A;  3JRT A;  2JPU A;  3EGX A;  4BJ1 A;  2E87 A;  1JPJ A;  1B68 A;  4AL0 A;  1XZP A;  2VCC A;  3QTH A;  3FDQ A;  1ZVZ A;  1ZU5 A;  2J0X A;  4RD9 A;  4CDA A;  2CNW A;  4QI2 A;  3C18 A;  3C7J A;  3L0I A;  2J9W A;  2KGO A;  5DS5 A;  1IW7 F;  1E86 A;  4JC7 A;  1Y6D A;  4DBR A;  4E7S A;  4P6I C;  2XLO A;  3G4X A;  4JCH A;  3DJU B;  3T6J A;  3C8G D;  2EPL X;  3EHN A;  4IAO A;  4U5D E;  4YT4 A;  3ATP A;  1VB5 A;  4AX2 A;  4Q7C A;  1A7E A;  1WOL A;  4PJL A;  4U9E A;  2BC5 A;  1OCC C;  4LLE A;  4ULV A;  1TFO B;  4YK5 A;  1L7C A;  4BEJ A;  2XL6 A;  3RKO F;  4CS9 A;  1M2V A;  2Q4F A;  3HLZ A;  1ORS C;  2PFD A;  3HNI A;  2P1A A;  3B29 A;  1D1B A;  5B3I A;  1S7Z A;  3QVY A;  3ZTZ A;  2R7V A;  1OCR C;  3VYW A;  4W8P A;  1O3U A;  2XLV A;  3KL4 A;  2QTV A;  1YDI A;  1EA8 A;  3TQO A;  1M56 C;  1U6H A;  3S90 A;  4ULW A;  1FFH A;  5T3T A;  3GM3 A;  4HEA J;  2B0H A;  3US6 A;  3AG3 C;  2ZXP A;  5DQZ A;  1YLM A;  4OD4 A;  2UUI A;  4JRZ A;  2ZXR A;  4U9D A;  4OIO F;  5COM A;  2L81 A;  2LFD A;  2R03 A;  3ZQY A;  5KYX B;  1BR2 A;  4JTD B;  1YAU O;  2VCA A;  4JKV A;  5KYY A;  4U5H A;  1TQG A;  3C8G A;  3EGD B;  4I1M A;  1E83 A;  4OIP F;  1NLX A;  2NUP A;  5L0J A;  2CGE A;  1ZHZ A;  3X1O A;  3AGT A;  2NSG A;  2C03 A;  3SEO A;  4CX9 A;  1YA7 O;  5D92 A;  1FMV A;  3JRM O;  1RKC A;  1MND A;  2A68 F;  3X2Q C;  1T01 A;  4CDV A;  2TMV P;  1M2V B;  2HJ3 A;  4G7Z F;  4XPY A;  3LLI A;  4DRH B;  4LER A;  2ZXO A;  4K7B A;  4AE4 A;  4CDY A;  4CS8 A;  4D4X A;  2M64 A;  2DYR C;  3U0C A;  3U9J A;  3RF3 A;  4JE9 A;  1G8X A;  1NG1 A;  2VC9 A;  4O6Y A;  3T9O A;  4KC9 A;  3S0X A;  4MVO A;  2X51 A;  2AU5 A;  4E18 A;  4UDV A;  4CSA C;  4WGZ A;  2Q9B A;  2XLE A;  1LPE A;  4P9T A;  4XEF A;  5EGY A;  1QSP A;  1TWC A;  1OW7 A;  2J46 A;  5E3A A;  2LCH A;  2Y39 A;  3ECS A;  1Z63 A;  4LDQ A;  3GAN A;  4F4B A;  2YL0 A;  1D1C A;  2XXA A;  3B0P A;  3CQZ A;  4U5E E;  2LSE A;  5TJ5 E;  2ASR A;  2IOQ A;  3L34 A;  3GWL A;  2V26 A;  4MVM A;  3OEO A;  1V4A A;  2XLH A;  1SMY F;  1CGO A;  2WVQ A;  3CAX A;  5BQG A;  4EUK B;  3S9O A;  3GOR A;  2PBE A;  3M4B A;  2CCY A;  3AJM A;  3DD7 A;  4K0D A;  1FAP B;  1CPQ A;  4M63 A;  1TR2 A;  2MWQ A;  4GYT A;  3NKE A;  2LD6 A;  5AC4 A;  2H7O A;  1C02 A;  1H9G A;  2R05 A;  3V5X A;  2NG1 A;  3I5Q A;  1TFK B;  1PV3 A;  3CEX A;  1LVK A;  3VRC A;  4MVR A;  5B1B C;  3TUL A;  2R7R A;  1MMA A;  5A6B D;  2NUT A;  3U3B A;  2J45 A;  2W45 A;  2R7Q A;  3ASN C;  5JVE A;  1CPR A;  2IM8 A;  1JRA A;  3EG9 A;  2J9V A;  1LM3 B;  5COG A;  5F5H A;  3VAY A;  2R7U A;  1VMA A;  5CI9 A;  2WZL A;  3U8P A;  4J30 B;  1O87 A;  4JEA A;  4JTA B;  3PHF 2;  3U5S A;  2Y3G A;  1E2X A;  1D1A A;  2IYL D;  3AGU A;  3HKK A;  2XXA B;  2WZG A;  3M15 A;  2KW3 C;  2PF4 E;  1I5N A;  4U5G A;  1K05 A;  4YJW A;  4XWJ A;  5KYW A;  2HZ8 A;  3GOD A;  2V3C C;  2H7V C;  3GEI A;  3UGO A;  2QE9 A;  1RJ9 A;  3FVY A;  2J0W A;  3O39 A;  4DOZ A;  3LEO A;  4JIO A;  3QW0 A;  1Z7Q c;  2YEV A;  3ASO C;  2YLD A;  3LES A;  2LQG A;  4O7G A;  5JT4 A;  3MBG A;  2J9U A;  3EJN A;  3ZSU A;  3K6B A;  2AWY A;  2QY9 A;  2YL1 A;  3S27 A;  4BJ6 A;  4KBL A;  3IQ6 A;  3WG7 C;  2WZF A;  4N06 A;  3U8V A;  2KC3 A;  4CIP A;  3ZWI A;  4AL1 A;  5A6B A;  5L0F A;  4YL0 A;  1EQ1 A;  2EPK X;  3EFO B;  2I15 A;  1R5I D;  1FTS A;  4E7Z A;  1F1M A;  3NDB B;  1HE9 A;  2Q3T A;  3B0V C;  2KJG A;  4CS9 C;  1C17 M;  1W2W A;  3UMI A;  3LEV A;  4YT2 A;  3FHD A;  4AK9 A;  1ZYR F;  5B3S C;  3OA1 A;  1C03 A;  2QLA A;  1AVO B;  1QPU A;  2J7P D;  3LS1 A;  3RQF A;  5KYW B;  2R9R B;  4LLC A;  2HKV A;  5JS5 A;  1QLE C;  2PP4 A;  2R7T A;  3CZ6 A;  4NTF A;  3JZ0 A;  1OW8 A;  4C7O A;  3QVZ A;  4H54 A;  3UMH A;  5L3V A;  2MYS A;  1WN0 A;  3N2Z B;  1LS4 A;  1DOW A;  1ORY A;  2EPM X;  1MQV A;  2XLM A;  4J32 B;  4P9F A;  1PD0 A;  3S84 A;  2DB4 A;  3FAP B;  1ZZP A;  2OQM A;  3RW0 A;  1VYI A;  1EKY A;  3TOM A;  4EWC A;  4XLN F;  3JYH A;  3L8I A;  1ZU4 A;  1Q0G A;  3W8I A;  3TJ5 A;  1JMW A;  3VM6 A;  3GEH A;  3U3F A;  1T6U A;  4OIQ F;  2PX0 A;  1V54 C;  3E9V A;  2HS5 A;  2DYS C;  2ETS A;  2OG2 A;  2XM0 A;  2NPU A;  4IWB A;  4MVU A;  4YT8 A;  4MS2 A;  3V5Y A;  3EGX B;  2AP3 A;  2J9B A;  3DAG A;  3DM5 A;  1AEP A;  1ST6 A;  3EH1 A;  2EIK C;  3AG4 C;  1HW1 A;  1OKK D;  2J7P A;  3HNL A;  3V5Z A;  5BQI A;  3QW1 A;  1MNE A;  4R32 A;  5IY5 C;  3EQL F;  2YQY A;  3VF0 A;  3T6B A;  2HV7 A;  1A7V A;  2P0N A;  2KK1 A;  4WGY A;  4YL1 A;  4C7O B;  2IXO A;  3KH2 A;  4JCZ A;  2H7B A;  2WVO A;  2R7X A;  1CGM E;  3AG1 C;  3GEE A;  1SF8 A;  1KU2 A;  5DVW A;  3RYL A;  1QVX A;  2GWW A;  4CIH A;  2QUP A;  1WGW A;  3IHU A;  1OR2 A;  3AQB A;  1SR2 A;  3U2L A;  5KYN A;  3U2M A;  4PR9 A;  1Q0D A;  3H2V A;  2XLD A;  3C8Z A;  4NCQ A;  3SXK A;  2KYH A;  1OW6 A;  1LE2 A;  3W2V A;  3ZG1 A;  1S05 A;  3ZC4 A;  2Q7R A;  2DI3 A;  2G62 A;  5A6A A;  1T9K A;  4IAQ A;  4YT5 A;  5F28 E;  1BR4 A;  3WAQ A;  4CBE A;  4ZLD A;  4G0H A;  3DZA A;  3NYJ A;  4L6R A;  1OKK A;  1RCP A;  2XL8 A;  2GFH A;  4U5B E;  1H9T A;  1VYK A;  3NYM A;  1OCO C;  2L6H A;  1ZHX A;  2RD9 A;  2VCB A;  1ZW2 A;  2EIM C;  2XRH A;  3JYY A;  1TKN A;  5JLI A;  2PX3 A;  3LUT B;  1HMO A;  3K1I A;  2YL7 A;  2FFH A;  1A7D A;  2QNL A;  4N6H A;  5KYY B;  3C8G B;  1NSG B;  4JJG A;  2ZXW C;  4O6M A;  2NUP B;  3KYI A;  2OJE D;  3DAF A;  4U5F E;  4YN0 B;  1KNY A;  2ZD9 A;  4C3D A;  3JSE O;  3Q6M A;  1Y4C A;  3E70 C;  1WAS A;  3S29 A;  2R7W A;  3N24 A;  1LI5 A;  1BBH A;  5L0H A;  1BR1 A;  2HJM A;  3AQC A;  4JZA A;  4AE4 B;  4EHP A;  5CI8 A;  1VTM P;  4N6C A;  1SYQ A;  1T6Q A;  5T3W A;  2YLI A;  3QMK A;  2R7S A;  2WL8 A;  4IB4 A;  1XZQ A;  4NQF A;  3GWN A;  5K0I A;  1PD1 A;  5AC5 A;  3BEH A;  1FR0 A;  4XPW A;  4ANJ A;  4X0R A;  2YWA A;  3EHM A;  2OEX A;  2XM4 A;  2JX0 A;  5JUA A;  3S28 A;  1QKR A;  1NU9 C;  4BG0 A;  4BJ6 C;  1D0Y A;  4JEB A;  2D5R B;  4MTG A;  4FAP B;  4JVS A;  2L6G A;  2EIN C;  2LP4 A;  3JSZ A;  3SP1 A;  2YL3 A;  3H2U A;  3GM2 A;  4WAB A;  4BPM A;  4A4A A;  4G7H F;  1VLS A;  4HE8 D;  3SYN A;  3DE8 A;  3HTK C;  5BUO A;  1SZI A;  5HSW A;  1OQC A;  4CS7 A;  5DLJ A;  4I3M A;  1RKE A;  2YRF A;  3RFY A;  2A6H F;  5COF A;  4G78 A;  2Q9A A;  4MVQ A;  4OIR F;  4EBJ A;  1MMD A;  5E33 A;  3EZH A;  4MTO A;  4RBN A;  3ZTM A;  4E0H A;  2IXP A;  5KYU A;  3U9M A;  4G7O F;  1YA9 A;  4CS8 C;  2XLW A;  1I4Z A;  3TD7 A;  4KI2 A;  5FCL A;  5L0C A;  3B9Q A;  4EBB A;  3IQT A;  3RQE A;  1LIH A;  2P7V A;  3DXJ F;  3O6X A;  2H8A A;  4IGG A;  4DXW A;  2NUT B;  3DJN B;  3DWW A;  3LNR A;  3LJB A;  1V55 C;  2VAS A;  3ABL C;  2A6E F;  2B0J A;  3EG9 B;  3TK0 A;  2EIJ C;  4JW1 A;  1GQA A;  1EI7 A;  1NU7 D;  3EZI A;  1H7I A;  4NC3 A;  3SNH A;  3W4Y A;  3IQ5 A;  4B6I A;  5DS4 A;  3NG1 A;  1J8Y F;  4C3B A;  4LDR A;  3EH2 A;  4PK4 A;  1CGN A;  3HNK A;  2Q00 A;  3KYJ A;  1JR8 A;  1G4W R;  4DRI B;  4KNW A;  2P61 A;  3G50 A;  5HV9 A;  2O9X A;  2OU6 A;  3F46 A;  4FWV A;  2YZS A;  2HV6 A;  1RMV A;  1RJ9 B;  4BJT A;  2KNH A;  2OCC C;  1V74 B;  3CSK A;  4ZLC A;  4BJ5 A;  1K40 A;  3UMK A;  3DM9 B;  4Z9I A;  4E0I A;  5AGF A;  4Q4Z F;  3F47 A;  2NSF A;  1ZHT A;  3O10 A;  2A0B A;  3Q7G A;  2CW0 F;  4DVZ A;  2EPN A;  3H65 A;  2OJQ A;  5B1A C;  3G4Z A;  1MMN A;  2OEV A;  3JCU Q;  4KNV A;  1YAR O;  4IRU A;  3ITF A;  1I4Y A;  3OWT A;  4YL3 A;  3A9C A;  4C3E A;  4Z9J A;  4XEK A;  5DQT A;  4JTC B;  1OXK A;  3IEE A;  3HJC A;  1U89 A;  2G3K A;  3RVY A;  4PJN A;  3TOL A;  3UGP A;  4MW3 A;  3M4C A;  4W8K A;  4A2N B;  1LS1 A;  2IXN A;  2XS1 A;  2Z15 A;  1Q0K A;  2HUJ A;  3FMS A;  4Z9H A;  1LKX A;  2M4E A;  4MTF A;  5T1D B;  4CJG A;  5A6K A;  5BQH A;  2PNO A;  1LI7 A;  3AG2 C;  3NMJ A;  5KYX A;  3EGD A;  3NMI A;  4MVZ A;  3FOO A;  4YWQ A;  2HSQ A;  4N4W A;  2G3V A;  4H4K C;  2UUH A;  1GGQ A;  1UFB A;  5GPG B;  2RSE B;  2W4B A;  3RVZ A;  2VB6 A;  1Q0M A;  3HNJ A;  4IJJ A;  4IAR A;  3DE9 A;  1TWH A;  2J8W A;  4BEM J;  1J8M F;  1OCZ C;  2R02 A;  1YYX A;  1WAT A;  2LK4 A;  3K1I C;  3I4U A;  5A69 A;  1QQ3 A;  5L0D A;  4PJJ A;  2C04 A;  2GA0 A;  4LDK A;  4O6N A;  2HMZ A;  1XWJ A;  3LS0 A;  1RXQ A;  2VH3 A;  1VLT A;  2L6F A;  2X0C A;  3ZQV A;  5EHH A;  4D4N A;  1NZE A;  4CJO A;  4EIY A;  2BE5 F;  3J06 A;  3M79 A;  4XQ1 A;  2YVK A;  4MND A;  3KKB A;  4PFO A;  3RH3 A;  2LFF A;  3MFN A;  1A41 A;  2LIG A;  4DJ9 A;  2JD3 A;  3A11 A;  3W8H A;  5DS6 A;  3Q7L A;  3PMR A;  3POV A;  1HMD A;  3SXY A;  2XSE A;  3LNM B;  3JTL O;  4MW8 A;  1Z6A A;  3K66 A;  1M2O A;  1YYJ A;  3PDM P;  3LLK A;  3M1C B;  1LE4 A;  5JSL A;  3UR3 C;  1R4T A;  3DI5 A;  4XPX A;  5F5F A;  2Y3D A;  1N1C A;  2XS8 A;  4FES A;  2HSB A;  1BZ4 A;  4NTA A;  1BDJ B;  2GAQ A;  5E2Q A;  4DVY P;  1WWP A;  1NFO A;  5FZT A;  1AUE A;  1L3P A;  2YKZ A;  4U5C E;  4OD5 A;  3ZDL A;  3O55 A;  1QZX A;  5L0G A;  1K04 A;  1IZM A;  2A1D D;  3KPH A;  2P6V A;  2L7A A;  2YHS A;  2YLG A;  3MYI A;  4QDL A;  4DBQ A;  2ICW G;  1A0B A;  256B A;  1YZA A;  3PCV A;  4HFF B;  5L3Q A;  3GM1 A;  4XEV A;  1JAF A;  1Z5Z A;  5L0I A;  3L1M A;  4GQH A;  4HFK B;  2KSF A;  3RIP A;  4ER9 A;  4E17 A;  1GS9 A;  3W2W A;  2XL4 A;  1MMG A;  2I8B A;  1GM5 A;  1ZHW A;  3L8J A; 
#chains in the Genus database with same CATH homology
 3B71 A;  3C8G B;  2L6G A;  1JOG A;  2LK4 A;  3GM2 A;  3U3F A;  1KNY A;  1KTM A;  2HSB A;  1V4A A;  2JPU A;  4XEK A;  1O3U A;  1K05 A;  1OW6 A;  3RQG A;  2L6F A;  1WWP A;  3S9O A;  3U0C A;  4EBK A;  2PBE A;  3AJM A;  2Q00 A;  1WTY A;  1K04 A;  3RQF A;  3GM3 A;  3C18 A;  4EBJ A;  3JZ0 A;  5F28 E;  1OW8 A;  3GM1 A;  3BRJ A;  4XEV A;  1PV3 A;  4NQF A;  4R32 A;  1K40 A;  4XEF A;  3C8G D;  3TUL A;  2KK1 A;  1ZZP A;  2L6H A;  1OW7 A;  3MFN A;  3C8G A;  3RQE A;  1UFB A;  2YWA A;  1WOL A;  3JYY A;  3O10 A;  3L8J A;  2JX0 A;  3L8I A;  1QVX A;  3K7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...