2LK4A

Structural and mechanistic insights into the interaction between pat pyk2 and paxillin ld motif
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
135
structure length
135
Chain Sequence
ANLDRTDDLVYLNVMELVRAVLELKNELSQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEEAKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein-tyrosine kinase 2-beta
publication title Structural and Mechanistic Insights into the Interaction between Pyk2 and Paxillin LD Motifs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 26
structure length 135
sequence length 135
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 2lk4A00
4XEKA 4EBKA 4R32A 1KNYA 4EBJA 2KK1A 1UFBA 1WOLA 1O3UA 1OW6A 2PBEA 3C8GB 1OW8A 1QVXA 3GM2A 3U0CA 3AJMA 1PV3A 3L8JA 5F28E 1WWPA 2JPUA 1OW7A 3MFNA 2YWAA 1JOGA 2JX0A 1K40A 3JYYA 1K04A 2L6GA 3RQEA 3GM3A 3S9OA 3TULA 2L6FA 2Q00A 3C8GD 3C18A 3C8GA 3L8IA 2HSBA 4NQFA 3B71A 3U3FA 1V4AA 2LK4A 3K7DA 1KTMA 3JZ0A 4XEVA 3RQFA 3RQGA 3O10A 2L6HA 4XEFA 1K05A 1ZZPA 1WTYA 3BRJA 3GM1A
chains in the Genus database with same CATH superfamily
4CIHA 2J0XA 5A6AA 2OEXA 1NFOA 4U5FE 4JTAB 5CI9A 3JCUQ 1BR4A 1OW6A 2DYRC 4JIOA 2JD3A 2J46A 5DS6A 4LDRA 1H6GA 3VM6A 5B1BC 2EIMC 1OW7A 4XLPF 2AU5A 1VLTA 1EA8A 3H2UA 3LUTB 5K0IA 2R7UA 2MWQA 4ULVA 5E3CA 2R9RB 2Q4FA 3I5QA 1YYXA 3VYWA 1TWGA 2XLWA 4HEAJ 5COGA 3F47A 3SXYA 4ULWA 1Y6DA 2J0WA 4XPYA 2YLGA 5AGFA 2LK4A 4K1OA 1MMNA 1C03A 1TFOB 4AX2A 1G8XA 2PF4E 4XEFA 4DVYP 4JC7A 3BRJA 4XEKA 2A1DD 4GYTA 2J9VA 2LIGA 2VCAA 2ZD9A 3DJUB 2LFDA 4G78A 3AG2C 3W2VA 4XPWA 4IARA 3C8GB 4AK9A 4G7OF 1RCPA 4MW3A 2W45A 3U0CA 3AG4C 2F22A 2HJMA 3DAFA 5BQHA 3ZTMA 4CS8A 1HE1A 3G4ZA 1M2VA 3GANA 1V55C 4RD9A 1LS1A 3EG9B 2R7TA 1GGQA 3DM5A 3JYYA 2J45A 1ORYA 1ZU5A 3IQ6A 2D5RB 4JJGA 3ITFA 3JSZA 3L8IA 4U9DA 3GEIA 2G62A 3S28A 3B71A 3DM9B 4E0IA 2YL0A 2OKUA 4XEVA 3A9CA 2NSGA 2YRFA 3B9QA 3X1OA 1AVOB 1JAFA 1NU9C 2LP4A 3S90A 2Y3GA 1NU7D 1SYQA 3Q7GA 3RQEA 2MYSA 2OG2A 1IW7F 2R7QA 4BJTA 4EBKA 5B3SC 3AQBA 1FNTc 4OIQF 2WL8A 3DJNB 3EZHA 3IQ5A 3VRCA 1L3PA 2HS5A 3POVA 2I8BA 3EQLF 1G5ZA 4JEAA 1DOVA 2R02A 5COMA 3RF3A 3T4RA 3US6A 4CS8C 2AWCA 4CX9A 5A6KA 1PV3A 4U5DE 1ZHWA 2OEVA 2EIKC 3V7OA 2QY9A 2WZFA 2HKVA 3KMIA 2ETSA 3LJBA 4HE8D 1I5NA 4NY3A 2EINC 1SZIA 2M64A 1BBHA 2H7OA 1LE4A 5E2QA 4AL1A 5DS5A 3RVZA 3C63A 4MVQA 4JE9A 4N6HA 3U9MA 4ER9A 5BUOA 4BJ5A 5DVWA 4ONSA 2W9YA 5E33A 5KYWA 1QKRA 1QQ3A 3EGXA 3G4XA 4EHPA 2GFHA 2P7VA 1M56C 4IWBA 3JYHA 1UFBA 3JSEO 3FVYA 4NTFA 4U5EE 1T01A 2PBEA 1D1CA 4FESA 1QVXA 1VMAA 4J7TA 4JVSA 4E7ZA 2TMVP 4I3MA 4A4AA 4C3EA 3RH3A 4LERA 2PP4A 3MFNA 4PJJA 4PJMA 2XXAA 1QPUA 2NUPB 5HSWA 2UUIA 4MVZA 4YK5A 3T6GB 3TOLA 5A6BD 2OU6A 2C04A 2G3KA 2EPMX 4NQFA 2BL2A 1QZXA 1JPNA 3F46A 4YT5A 2EPLX 3FHDA 4OD5A 4Q7CA 3SNHA 2L81A 4RBNA 3EG9A 4BJ5C 4Q5SF 3TOMA 2Y3BA 3L1MA 1A7VA 2Q9AA 3HJCA 4P6IC 1K05A 4I44A 4CSAA 1VOMA 1D0ZA 2P1AA 2V26A 4JEBA 4XPXA 2R7RA 1CPRA 3S84A 1RKEB 1H9GA 1OR3A 2KK1A 4CBEA 1S7ZA 4QDLA 3TJ6A 2CGEA 3CZ6A 1KU2A 4OD4A 2W4MA 2FAPB 4XQ1A 3V5YA 2HUJA 4QI0A 3ASNC 1GQAA 4LLEA 1YYJA 3RFYA 1TWHA 4CS9C 4NTBA 5DS4A 2X51A 3EGDB 2Y3HA 1SR2A 3UMHA 1K04A 1V54C 4G0HA 4JKVA 2KQ9A 3FXHA 1HY5A 2PNOA 5L3VA 3DZAA 1C02A 2L7AA 3KL4A 2DGJA 3B0PA 3NYLA 3AGTA 4PK4A 3HNKA 1Q0GA 1T9KA 3IPMO 1LPEA 2GAQA 1H7IA 3K1HA 2PFDA 4OINF 5COFA 3SP1A 1WTYA 4MTFA 4BJ6C 2NG1A 1OCZC 3U5SA 1LKXA 2YL1A 2H8AA 1U89A 1WN0A 1LS4A 3LESA 2LSEA 3LLKA 4U5GA 5KYYB 1E85A 2V3CC 4LDKA 5IY5C 4MVOA 4MTGA 1EI7A 3HTKC 1YLMA 3MX3A 1JMWA 1LI5A 2ASRA 4IB4A 2DYSC 4MVSA 1R4TA 1J8MF 3DKAA 3M4BA 4PJLA 4KNVA 3UNGC 4DBQA 2HMZA 4EBBA 2NSFA 1NFNA 2ICWG 2VASA 2FGYA 1K40A 4MVRA 1E2XA 1W2WA 2R7WA 2B0HA 3K1IA 1OCOC 2AP3A 4HFKB 3JRMO 3NMKA 4AE4B 2YQYA 3TJ5A 3U2LA 5KYNA 2R7SA 1M6TA 1BR1A 1O87A 1UG7A 1Z7Qc 2DB4A 3QW0A 4UDVA 2G3VA 3JTLO 3AOUA 1YDIA 1Z63A 2EPKX 2DI3A 2NUPA 2YZSA 1VYIA 3GEEA 4DRJB 1NBBA 2IBFA 2XLVA 5L0CA 3IQTA 1RJ9A 2WB7A 1MMAA 2BE5F 2XLOA 4G7HF 1QLEC 1VLSA 1LM3B 4MNDA 3L0IA 4GQHA 4EKWA 1RMVA 4ANJA 2ZXWC 4PFOA 3B29A 1Q0DA 2VCCA 3DMDA 4DJ9A 2JPUA 2Q9BA 3EFOB 2YWAA 3EPVA 3NYMA 3NKEA 3J06A 4WGYA 1OXBA 1ZVZA 4BG0A 2KSFA 2A0BA 2RD9A 3NRHA 3FAPB 1JPJA 3OWTA 4LACB 4X0RA 4LLCA 3U2MA 5DQZA 5FCLA 4A2NB 1T6UA 3Q6NA 2A69F 3QMKA 3QZCA 1JR8A 1T6IA 1Q0MA 2QE9A 1G4US 3OA1A 5L0DA 1T6QA 3K7DA 4CJOA 4D4XA 3JZ0A 2XM0A 2AVKA 5DLJA 4JW1A 3M1CB 2WVQA 3JRTA 3N2ZB 3G50A 3W8HA 1MMDA 3ECSA 3GM1A 4BPMA 4MVUA 2IXNA 1JRAA 2IXOA 2XLHA 3H65A 5CI8A 4ZLDA 2PX3A 4YL0A 5A69A 1BZ4A 2CDQA 4BJ1A 1WATA 3PMRA 2CCYA 3WG7C 1RKCA 1Q0KA 1A7EA 3RIPA 2IYLD 2CNWA 3IEEA 4H54A 2R7VA 2KYHA 2YL7A 2UUHA 1V74B 4JCZA 3NMJA 2OCCC 3PHF2 3CEXA 3R2PA 4JJFA 1FMWA 2J9WA 3C18A 4P9FA 4IJJA 4Z9HA 2Y69C 3ZVRA 3OEOA 3HNIA 2WZLA 3U3FA 2AWYA 4BEMJ 1OQCA 3T6JA 1YA7O 1ST6A 3RQFA 2ZXOA 4AE4A 3E9VA 5KYXB 4IRUA 4K7BA 1AEPA 3RVYA 3S29A 2XL6A 1GM5A 1WGWA 4JZAA 3KPHA 4IAOA 1ZYRF 3ZG1A 2HV7A 3PCVA 4MS2A 3RYLA 1XZQA 1ZU4A 3AJMA 1FFHA 5JUAA 1PD0A 1WWPA 2HMQA 2HV6A 5TJ5E 256BA 3I5PA 3LNMB 1HMDA 5D92A 2Q00A 5KYUB 3C8GA 2FFHA 2YLIA 3N24A 4JURI 2IOQA 3LEVA 4J30B 2GDCA 5A6JA 4DBRA 4KI2A 1D1AA 2QUPA 3AQCA 1CGNA 3QW1A 3GWNA 3ZQVA 1VTMP 5D91A 1SF8A 1ZW3A 2KGOA 1OCRC 3MYFA 4J32B 1HW1A 1XWJA 1CGOA 4KC9A 4O6NA 5AC4A 3SXMA 5EHHA 1I4ZA 5L0JA 1WOLA 2EILC 2J7PA 3AGUA 1PD1A 3M15A 3HKKA 5FZTA 4C7OB 3FAJA 3ASOC 5EK0A 3GM2A 5T3WA 3DE8A 4KNWA 5BQGA 2R05A 3L8JA 1RXQA 3GORA 2D4UA 2XLDA 2ZXRA 3SZRA 2XL4A 2XLMA 4W8PA 3NMIA 4YWQA 2A6HF 3SXKA 1A41A 2Y3DA 1HE9A 4MQ9F 2KW3C 1HW2A 2L6FA 1NG1A 2ZPAA 4RDAA 1NZEA 3NG1A 2VC9A 3EHNA 3U8PA 4P9TA 4JTDB 3SXZA 1EQ1A 2YVKA 4E18A 4B6IA 4CSAC 4E17A 4JRZA 2A68F 3LNRA 3B0UX 3R7CA 1ZHZA 1A0BA 3QVZA 1M2VB 3O39A 3U3BA 4N06A 2X0CA 1MNDA 5L0GA 3LLIA 5F5HA 3HNLA 1NSGB 5HV9A 3ABLC 4U5HA 2GWWA 3K66A 3TQOA 1PCXA 4YL1A 3IQCA 1OKKA 2CW0F 2YEVA 3FOOA 1D0YA 1FMVA 4L6RA 3WAQA 4YL3A 4DRHB 4YT4A 4DVZA 3W4YA 4YT2A 3LEOA 3GM3A 3TULA 1OCCC 3ZIBA 3S0XA 3LS0A 4KBLA 4XLNF 2QNLA 1VB5A 2HSBA 3FDQA 3ZWIA 1YA9A 3CSKA 3I4UA 2YLDA 3UR3C 4C3BA 1I4YA 5L0IA 3QVYA 4HFFB 2ZXPA 3ZQYA 4XWJA 3TK0A 1M57C 3IHUA 2P0NA 2Q9CA 1TFKB 3NKDA 4N6CA 1B68A 4PACA 5KYUA 1E86A 4J7YA 2GA0A 3GODA 3B0VC 4CDAA 2VB6A 3KH2A 3NDBB 1YARO 2YKZA 4U5CE 4O79A 4GEHA 1OR2A 2LCHA 2B0JA 2PX0A 3W2WA 1CPQA 5JP7A 2WVOA 5JLIA 3W8IA 2BC5A 4U5BE 1JOGA 3K1IC 1RKEA 4XTKA 2E87A 5BQIA 2A6EF 5KYWB 3ABKC 2Z15A 4C7OA 3EGXB 3GWLA 4M63A 5T3TA 3N0TA 2IM8A 4NTAA 1XZPA 1U0BB 3WODF 3MBGA 3DI5A 2NUTB 4WJ0A 5B1AC 2P61A 4OIOF 2L9JA 3EGDA 1Z6AA 3K6BA 4IAQA 2P6VA 3EJNA 3RQGA 1SMYF 3BEHA 1E83A 5GPGB 4O7GA 3AG1C 3O6XA 2XXAB 4R32A 2WVNA 2LD6A 2XS1A 3ATPA 5EGYA 2IXPA 3ZDLA 1YAUO 1MNEA 4C3DA 5L0FA 1ZHYA 2OJQA 3CQZA 1J8YF 4NCQA 3T9OA 1OW8A 2XS8A 4BEJA 2YHSA 4JTCB 5JVEA 2OQMA 3DAGA 2CNWD 1F1MA 1MQVA 3FMSA 3ZC4A 5B3IA 1ORSC 2Q7RA 3QTHA 5T1DB 5KYYA 2KC3A 1FFTC 1L7CA 2KNHA 4CJGA 4MW8A 3S9OA 4D4NA 3LAYA 2Q3TA 3AG3C 2OOCA 1APCA 1Q0FA 2XL8A 2EIJC 1FR0A 2NPUA 1TKNA 4K0DA 1TR2A 4EIYA 3DWWA 3VF0A 1LVKA 1WASA 3UGOA 3MYIA 2XRHA 3DXJF 3C8ZA 1TWCA 3KYIA 3FOPA 4IGGA 3CAXA 4NC3A 3RW0A 2XLEA 3S27A 4F4BA 3M79A 3DD7A 3V5ZA 4YJWA 1C17M 3WHNA 3V5XA 4DOZA 3PDMP 1TQGA 4Z9IA 2J9BA 2R25A 2C03A 3RKOF 4OIPF 4N4WA 1FTSA 1FAPB 1ZW2A 3TD7A 5AC5A 2J9UA 2CYDA 3KYJA 3SYNA 3Q7LA 4EWCA 3C62A 1ORJA 3EH2A 4I1OB 3SEOA 2EPNA 4CS7A 1LI7A 1BR2A 3GEHA 4E7SA 3ABMC 2M4EA 3C8GD 3JT1A 1D1BA 2H7BA 3HNJA 4E0HA 3L34A 4U9EA 1BDJB 1V4AA 2A0UA 4CDYA 2R03A 2KJGA 3T6BA 4DXWA 1KTMA 1NLXA 5L3QA 3UMKA 2R7XA 3EFOA 2L6HA 3O10A 2WZGA 1QSPA 1ZZPA 4QI2A 1EKYA 5DQTA 1OXKA 1H9TA 3ZSUA 2QLAA 1R5ID 2NUTA 3U8VA 5JRAA 2J7PD 1O3UA 3O55A 1YZCA 4JCHA 4PJNA 1Z3IX 4WGZA 1N1CA 1VK5A 4DRIB 4OIRF 1D0XA 1TWAA 1YJGA 4LDQA 4MTOA 1U6HA 2IXMA 2JX0A 4PFPA 4CS9A 2L6GA 3EH1A 4YN0B 2XM4A 3H2VA 2YL3A 3M4CA 1HMOA 3UMIA 5A6BA 2HJ3A 1ZHXA 1RJ9B 4MVMA 3MLGA 1AUEA 3LS1A 3Q6MA 4YT8A 1S05A 1IZMA 1YVIA 3KKBA 1YZAA 4BJ6A 5JS5A 1KNYA 3K33A 4I1MA 1T5OA 5E3AA 2RSEB 2QTVA 4EBJA 4ZLCA 3EHMA 4FX5A 2HFIA 2LFFA 2LQGA 2W4BA 2XSEA 2MHRA 4O6YA 2VCBA 1OKKD 4AL0A 1LE2A 2H7VC 2J8WA 2HZ8A 2R7OA 3EZIA 5F28E 4CDVA 2OJED 3HLZA 3C7JA 3UGPA 5KYXA 1A7DA 1MMGA 1VYKA 2O9XA 2VH3A 1O5HA 1LIHA 5CIVA 4CIPA 3U9JA 3E70C 1Z5ZA 3ZTZA 1G4WR 5L0HA 4G7ZF 5F5FA 1ZHTA 5JT4A 3A11A 4H4KC 1E84A 3NYJA 4FWVA 1GS9A 1M2OA 4O6MA 4PR9A 3VAYA 3X2QC 4FAPB 1CGME 2I15A 1Y4CA 1DOWA 1Z23A 3DE9A 5JSLA 4EUKB 2Y39A 4W8KA 2HSQA 4WABA 4Q4ZF 4Z9JA 2EPOA
chains in the Genus database with same CATH topology
4XEKA 4EBKA 4R32A 1KNYA 4EBJA 2KK1A 1UFBA 1WOLA 1O3UA 1OW6A 2PBEA 3C8GB 1OW8A 1QVXA 3GM2A 3U0CA 3AJMA 1PV3A 3L8JA 5F28E 1WWPA 2JPUA 1OW7A 3MFNA 2YWAA 1JOGA 2JX0A 1K40A 3JYYA 1K04A 2L6GA 3RQEA 3GM3A 3S9OA 3TULA 2L6FA 2Q00A 3C8GD 3C18A 3C8GA 3L8IA 2HSBA 4NQFA 3B71A 3U3FA 1V4AA 2LK4A 3K7DA 1KTMA 3JZ0A 4XEVA 3RQFA 3RQGA 3O10A 2L6HA 4XEFA 1K05A 1ZZPA 1WTYA 3BRJA 3GM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XEK A;  4EBK A;  4R32 A;  1KNY A;  4EBJ A;  2KK1 A;  1UFB A;  1WOL A;  1O3U A;  1OW6 A;  2PBE A;  3C8G B;  1OW8 A;  1QVX A;  3GM2 A;  3U0C A;  3AJM A;  1PV3 A;  3L8J A;  5F28 E;  1WWP A;  2JPU A;  1OW7 A;  3MFN A;  2YWA A;  1JOG A;  2JX0 A;  1K40 A;  3JYY A;  1K04 A;  2L6G A;  3RQE A;  3GM3 A;  3S9O A;  3TUL A;  2L6F A;  2Q00 A;  3C8G D;  3C18 A;  3C8G A;  3L8I A;  2HSB A;  4NQF A;  3B71 A;  3U3F A;  1V4A A;  2LK4 A;  3K7D A;  1KTM A;  3JZ0 A;  4XEV A;  3RQF A;  3RQG A;  3O10 A;  2L6H A;  4XEF A;  1K05 A;  1ZZP A;  1WTY A;  3BRJ A;  3GM1 A; 
#chains in the Genus database with same CATH topology
 4CIH A;  2J0X A;  5A6A A;  2OEX A;  1NFO A;  4U5F E;  4JTA B;  5CI9 A;  3JCU Q;  1BR4 A;  1OW6 A;  2DYR C;  4JIO A;  2JD3 A;  2J46 A;  5DS6 A;  4LDR A;  1H6G A;  3VM6 A;  5B1B C;  2EIM C;  1OW7 A;  4XLP F;  2AU5 A;  1VLT A;  1EA8 A;  3H2U A;  3LUT B;  5K0I A;  2R7U A;  2MWQ A;  4ULV A;  5E3C A;  2R9R B;  2Q4F A;  3I5Q A;  1YYX A;  3VYW A;  1TWG A;  2XLW A;  4HEA J;  5COG A;  3F47 A;  3SXY A;  4ULW A;  1Y6D A;  2J0W A;  4XPY A;  2YLG A;  5AGF A;  2LK4 A;  4K1O A;  1MMN A;  1C03 A;  1TFO B;  4AX2 A;  1G8X A;  2PF4 E;  4XEF A;  4DVY P;  4JC7 A;  3BRJ A;  4XEK A;  2A1D D;  4GYT A;  2J9V A;  2LIG A;  2VCA A;  2ZD9 A;  3DJU B;  2LFD A;  4G78 A;  3AG2 C;  3W2V A;  4XPW A;  4IAR A;  3C8G B;  4AK9 A;  4G7O F;  1RCP A;  4MW3 A;  2W45 A;  3U0C A;  3AG4 C;  2F22 A;  2HJM A;  3DAF A;  5BQH A;  3ZTM A;  4CS8 A;  1HE1 A;  3G4Z A;  1M2V A;  3GAN A;  1V55 C;  4RD9 A;  1LS1 A;  3EG9 B;  2R7T A;  1GGQ A;  3DM5 A;  3JYY A;  2J45 A;  1ORY A;  1ZU5 A;  3IQ6 A;  2D5R B;  4JJG A;  3ITF A;  3JSZ A;  3L8I A;  4U9D A;  3GEI A;  2G62 A;  3S28 A;  3B71 A;  3DM9 B;  4E0I A;  2YL0 A;  2OKU A;  4XEV A;  3A9C A;  2NSG A;  2YRF A;  3B9Q A;  3X1O A;  1AVO B;  1JAF A;  1NU9 C;  2LP4 A;  3S90 A;  2Y3G A;  1NU7 D;  1SYQ A;  3Q7G A;  3RQE A;  2MYS A;  2OG2 A;  1IW7 F;  2R7Q A;  4BJT A;  4EBK A;  5B3S C;  3AQB A;  1FNT c;  4OIQ F;  2WL8 A;  3DJN B;  3EZH A;  3IQ5 A;  3VRC A;  1L3P A;  2HS5 A;  3POV A;  2I8B A;  3EQL F;  1G5Z A;  4JEA A;  1DOV A;  2R02 A;  5COM A;  3RF3 A;  3T4R A;  3US6 A;  4CS8 C;  2AWC A;  4CX9 A;  5A6K A;  1PV3 A;  4U5D E;  1ZHW A;  2OEV A;  2EIK C;  3V7O A;  2QY9 A;  2WZF A;  2HKV A;  3KMI A;  2ETS A;  3LJB A;  4HE8 D;  1I5N A;  4NY3 A;  2EIN C;  1SZI A;  2M64 A;  1BBH A;  2H7O A;  1LE4 A;  5E2Q A;  4AL1 A;  5DS5 A;  3RVZ A;  3C63 A;  4MVQ A;  4JE9 A;  4N6H A;  3U9M A;  4ER9 A;  5BUO A;  4BJ5 A;  5DVW A;  4ONS A;  2W9Y A;  5E33 A;  5KYW A;  1QKR A;  1QQ3 A;  3EGX A;  3G4X A;  4EHP A;  2GFH A;  2P7V A;  1M56 C;  4IWB A;  3JYH A;  1UFB A;  3JSE O;  3FVY A;  4NTF A;  4U5E E;  1T01 A;  2PBE A;  1D1C A;  4FES A;  1QVX A;  1VMA A;  4J7T A;  4JVS A;  4E7Z A;  2TMV P;  4I3M A;  4A4A A;  4C3E A;  3RH3 A;  4LER A;  2PP4 A;  3MFN A;  4PJJ A;  4PJM A;  2XXA A;  1QPU A;  2NUP B;  5HSW A;  2UUI A;  4MVZ A;  4YK5 A;  3T6G B;  3TOL A;  5A6B D;  2OU6 A;  2C04 A;  2G3K A;  2EPM X;  4NQF A;  2BL2 A;  1QZX A;  1JPN A;  3F46 A;  4YT5 A;  2EPL X;  3FHD A;  4OD5 A;  4Q7C A;  3SNH A;  2L81 A;  4RBN A;  3EG9 A;  4BJ5 C;  4Q5S F;  3TOM A;  2Y3B A;  3L1M A;  1A7V A;  2Q9A A;  3HJC A;  4P6I C;  1K05 A;  4I44 A;  4CSA A;  1VOM A;  1D0Z A;  2P1A A;  2V26 A;  4JEB A;  4XPX A;  2R7R A;  1CPR A;  3S84 A;  1RKE B;  1H9G A;  1OR3 A;  2KK1 A;  4CBE A;  1S7Z A;  4QDL A;  3TJ6 A;  2CGE A;  3CZ6 A;  1KU2 A;  4OD4 A;  2W4M A;  2FAP B;  4XQ1 A;  3V5Y A;  2HUJ A;  4QI0 A;  3ASN C;  1GQA A;  4LLE A;  1YYJ A;  3RFY A;  1TWH A;  4CS9 C;  4NTB A;  5DS4 A;  2X51 A;  3EGD B;  2Y3H A;  1SR2 A;  3UMH A;  1K04 A;  1V54 C;  4G0H A;  4JKV A;  2KQ9 A;  3FXH A;  1HY5 A;  2PNO A;  5L3V A;  3DZA A;  1C02 A;  2L7A A;  3KL4 A;  2DGJ A;  3B0P A;  3NYL A;  3AGT A;  4PK4 A;  3HNK A;  1Q0G A;  1T9K A;  3IPM O;  1LPE A;  2GAQ A;  1H7I A;  3K1H A;  2PFD A;  4OIN F;  5COF A;  3SP1 A;  1WTY A;  4MTF A;  4BJ6 C;  2NG1 A;  1OCZ C;  3U5S A;  1LKX A;  2YL1 A;  2H8A A;  1U89 A;  1WN0 A;  1LS4 A;  3LES A;  2LSE A;  3LLK A;  4U5G A;  5KYY B;  1E85 A;  2V3C C;  4LDK A;  5IY5 C;  4MVO A;  4MTG A;  1EI7 A;  3HTK C;  1YLM A;  3MX3 A;  1JMW A;  1LI5 A;  2ASR A;  4IB4 A;  2DYS C;  4MVS A;  1R4T A;  1J8M F;  3DKA A;  3M4B A;  4PJL A;  4KNV A;  3UNG C;  4DBQ A;  2HMZ A;  4EBB A;  2NSF A;  1NFN A;  2ICW G;  2VAS A;  2FGY A;  1K40 A;  4MVR A;  1E2X A;  1W2W A;  2R7W A;  2B0H A;  3K1I A;  1OCO C;  2AP3 A;  4HFK B;  3JRM O;  3NMK A;  4AE4 B;  2YQY A;  3TJ5 A;  3U2L A;  5KYN A;  2R7S A;  1M6T A;  1BR1 A;  1O87 A;  1UG7 A;  1Z7Q c;  2DB4 A;  3QW0 A;  4UDV A;  2G3V A;  3JTL O;  3AOU A;  1YDI A;  1Z63 A;  2EPK X;  2DI3 A;  2NUP A;  2YZS A;  1VYI A;  3GEE A;  4DRJ B;  1NBB A;  2IBF A;  2XLV A;  5L0C A;  3IQT A;  1RJ9 A;  2WB7 A;  1MMA A;  2BE5 F;  2XLO A;  4G7H F;  1QLE C;  1VLS A;  1LM3 B;  4MND A;  3L0I A;  4GQH A;  4EKW A;  1RMV A;  4ANJ A;  2ZXW C;  4PFO A;  3B29 A;  1Q0D A;  2VCC A;  3DMD A;  4DJ9 A;  2JPU A;  2Q9B A;  3EFO B;  2YWA A;  3EPV A;  3NYM A;  3NKE A;  3J06 A;  4WGY A;  1OXB A;  1ZVZ A;  4BG0 A;  2KSF A;  2A0B A;  2RD9 A;  3NRH A;  3FAP B;  1JPJ A;  3OWT A;  4LAC B;  4X0R A;  4LLC A;  3U2M A;  5DQZ A;  5FCL A;  4A2N B;  1T6U A;  3Q6N A;  2A69 F;  3QMK A;  3QZC A;  1JR8 A;  1T6I A;  1Q0M A;  2QE9 A;  1G4U S;  3OA1 A;  5L0D A;  1T6Q A;  3K7D A;  4CJO A;  4D4X A;  3JZ0 A;  2XM0 A;  2AVK A;  5DLJ A;  4JW1 A;  3M1C B;  2WVQ A;  3JRT A;  3N2Z B;  3G50 A;  3W8H A;  1MMD A;  3ECS A;  3GM1 A;  4BPM A;  4MVU A;  2IXN A;  1JRA A;  2IXO A;  2XLH A;  3H65 A;  5CI8 A;  4ZLD A;  2PX3 A;  4YL0 A;  5A69 A;  1BZ4 A;  2CDQ A;  4BJ1 A;  1WAT A;  3PMR A;  2CCY A;  3WG7 C;  1RKC A;  1Q0K A;  1A7E A;  3RIP A;  2IYL D;  2CNW A;  3IEE A;  4H54 A;  2R7V A;  2KYH A;  2YL7 A;  2UUH A;  1V74 B;  4JCZ A;  3NMJ A;  2OCC C;  3PHF 2;  3CEX A;  3R2P A;  4JJF A;  1FMW A;  2J9W A;  3C18 A;  4P9F A;  4IJJ A;  4Z9H A;  2Y69 C;  3ZVR A;  3OEO A;  3HNI A;  2WZL A;  3U3F A;  2AWY A;  4BEM J;  1OQC A;  3T6J A;  1YA7 O;  1ST6 A;  3RQF A;  2ZXO A;  4AE4 A;  3E9V A;  5KYX B;  4IRU A;  4K7B A;  1AEP A;  3RVY A;  3S29 A;  2XL6 A;  1GM5 A;  1WGW A;  4JZA A;  3KPH A;  4IAO A;  1ZYR F;  3ZG1 A;  2HV7 A;  3PCV A;  4MS2 A;  3RYL A;  1XZQ A;  1ZU4 A;  3AJM A;  1FFH A;  5JUA A;  1PD0 A;  1WWP A;  2HMQ A;  2HV6 A;  5TJ5 E;  256B A;  3I5P A;  3LNM B;  1HMD A;  5D92 A;  2Q00 A;  5KYU B;  3C8G A;  2FFH A;  2YLI A;  3N24 A;  4JUR I;  2IOQ A;  3LEV A;  4J30 B;  2GDC A;  5A6J A;  4DBR A;  4KI2 A;  1D1A A;  2QUP A;  3AQC A;  1CGN A;  3QW1 A;  3GWN A;  3ZQV A;  1VTM P;  5D91 A;  1SF8 A;  1ZW3 A;  2KGO A;  1OCR C;  3MYF A;  4J32 B;  1HW1 A;  1XWJ A;  1CGO A;  4KC9 A;  4O6N A;  5AC4 A;  3SXM A;  5EHH A;  1I4Z A;  5L0J A;  1WOL A;  2EIL C;  2J7P A;  3AGU A;  1PD1 A;  3M15 A;  3HKK A;  5FZT A;  4C7O B;  3FAJ A;  3ASO C;  5EK0 A;  3GM2 A;  5T3W A;  3DE8 A;  4KNW A;  5BQG A;  2R05 A;  3L8J A;  1RXQ A;  3GOR A;  2D4U A;  2XLD A;  2ZXR A;  3SZR A;  2XL4 A;  2XLM A;  4W8P A;  3NMI A;  4YWQ A;  2A6H F;  3SXK A;  1A41 A;  2Y3D A;  1HE9 A;  4MQ9 F;  2KW3 C;  1HW2 A;  2L6F A;  1NG1 A;  2ZPA A;  4RDA A;  1NZE A;  3NG1 A;  2VC9 A;  3EHN A;  3U8P A;  4P9T A;  4JTD B;  3SXZ A;  1EQ1 A;  2YVK A;  4E18 A;  4B6I A;  4CSA C;  4E17 A;  4JRZ A;  2A68 F;  3LNR A;  3B0U X;  3R7C A;  1ZHZ A;  1A0B A;  3QVZ A;  1M2V B;  3O39 A;  3U3B A;  4N06 A;  2X0C A;  1MND A;  5L0G A;  3LLI A;  5F5H A;  3HNL A;  1NSG B;  5HV9 A;  3ABL C;  4U5H A;  2GWW A;  3K66 A;  3TQO A;  1PCX A;  4YL1 A;  3IQC A;  1OKK A;  2CW0 F;  2YEV A;  3FOO A;  1D0Y A;  1FMV A;  4L6R A;  3WAQ A;  4YL3 A;  4DRH B;  4YT4 A;  4DVZ A;  3W4Y A;  4YT2 A;  3LEO A;  3GM3 A;  3TUL A;  1OCC C;  3ZIB A;  3S0X A;  3LS0 A;  4KBL A;  4XLN F;  2QNL A;  1VB5 A;  2HSB A;  3FDQ A;  3ZWI A;  1YA9 A;  3CSK A;  3I4U A;  2YLD A;  3UR3 C;  4C3B A;  1I4Y A;  5L0I A;  3QVY A;  4HFF B;  2ZXP A;  3ZQY A;  4XWJ A;  3TK0 A;  1M57 C;  3IHU A;  2P0N A;  2Q9C A;  1TFK B;  3NKD A;  4N6C A;  1B68 A;  4PAC A;  5KYU A;  1E86 A;  4J7Y A;  2GA0 A;  3GOD A;  3B0V C;  4CDA A;  2VB6 A;  3KH2 A;  3NDB B;  1YAR O;  2YKZ A;  4U5C E;  4O79 A;  4GEH A;  1OR2 A;  2LCH A;  2B0J A;  2PX0 A;  3W2W A;  1CPQ A;  5JP7 A;  2WVO A;  5JLI A;  3W8I A;  2BC5 A;  4U5B E;  1JOG A;  3K1I C;  1RKE A;  4XTK A;  2E87 A;  5BQI A;  2A6E F;  5KYW B;  3ABK C;  2Z15 A;  4C7O A;  3EGX B;  3GWL A;  4M63 A;  5T3T A;  3N0T A;  2IM8 A;  4NTA A;  1XZP A;  1U0B B;  3WOD F;  3MBG A;  3DI5 A;  2NUT B;  4WJ0 A;  5B1A C;  2P61 A;  4OIO F;  2L9J A;  3EGD A;  1Z6A A;  3K6B A;  4IAQ A;  2P6V A;  3EJN A;  3RQG A;  1SMY F;  3BEH A;  1E83 A;  5GPG B;  4O7G A;  3AG1 C;  3O6X A;  2XXA B;  4R32 A;  2WVN A;  2LD6 A;  2XS1 A;  3ATP A;  5EGY A;  2IXP A;  3ZDL A;  1YAU O;  1MNE A;  4C3D A;  5L0F A;  1ZHY A;  2OJQ A;  3CQZ A;  1J8Y F;  4NCQ A;  3T9O A;  1OW8 A;  2XS8 A;  4BEJ A;  2YHS A;  4JTC B;  5JVE A;  2OQM A;  3DAG A;  2CNW D;  1F1M A;  1MQV A;  3FMS A;  3ZC4 A;  5B3I A;  1ORS C;  2Q7R A;  3QTH A;  5T1D B;  5KYY A;  2KC3 A;  1FFT C;  1L7C A;  2KNH A;  4CJG A;  4MW8 A;  3S9O A;  4D4N A;  3LAY A;  2Q3T A;  3AG3 C;  2OOC A;  1APC A;  1Q0F A;  2XL8 A;  2EIJ C;  1FR0 A;  2NPU A;  1TKN A;  4K0D A;  1TR2 A;  4EIY A;  3DWW A;  3VF0 A;  1LVK A;  1WAS A;  3UGO A;  3MYI A;  2XRH A;  3DXJ F;  3C8Z A;  1TWC A;  3KYI A;  3FOP A;  4IGG A;  3CAX A;  4NC3 A;  3RW0 A;  2XLE A;  3S27 A;  4F4B A;  3M79 A;  3DD7 A;  3V5Z A;  4YJW A;  1C17 M;  3WHN A;  3V5X A;  4DOZ A;  3PDM P;  1TQG A;  4Z9I A;  2J9B A;  2R25 A;  2C03 A;  3RKO F;  4OIP F;  4N4W A;  1FTS A;  1FAP B;  1ZW2 A;  3TD7 A;  5AC5 A;  2J9U A;  2CYD A;  3KYJ A;  3SYN A;  3Q7L A;  4EWC A;  3C62 A;  1ORJ A;  3EH2 A;  4I1O B;  3SEO A;  2EPN A;  4CS7 A;  1LI7 A;  1BR2 A;  3GEH A;  4E7S A;  3ABM C;  2M4E A;  3C8G D;  3JT1 A;  1D1B A;  2H7B A;  3HNJ A;  4E0H A;  3L34 A;  4U9E A;  1BDJ B;  1V4A A;  2A0U A;  4CDY A;  2R03 A;  2KJG A;  3T6B A;  4DXW A;  1KTM A;  1NLX A;  5L3Q A;  3UMK A;  2R7X A;  3EFO A;  2L6H A;  3O10 A;  2WZG A;  1QSP A;  1ZZP A;  4QI2 A;  1EKY A;  5DQT A;  1OXK A;  1H9T A;  3ZSU A;  2QLA A;  1R5I D;  2NUT A;  3U8V A;  5JRA A;  2J7P D;  1O3U A;  3O55 A;  1YZC A;  4JCH A;  4PJN A;  1Z3I X;  4WGZ A;  1N1C A;  1VK5 A;  4DRI B;  4OIR F;  1D0X A;  1TWA A;  1YJG A;  4LDQ A;  4MTO A;  1U6H A;  2IXM A;  2JX0 A;  4PFP A;  4CS9 A;  2L6G A;  3EH1 A;  4YN0 B;  2XM4 A;  3H2V A;  2YL3 A;  3M4C A;  1HMO A;  3UMI A;  5A6B A;  2HJ3 A;  1ZHX A;  1RJ9 B;  4MVM A;  3MLG A;  1AUE A;  3LS1 A;  3Q6M A;  4YT8 A;  1S05 A;  1IZM A;  1YVI A;  3KKB A;  1YZA A;  4BJ6 A;  5JS5 A;  1KNY A;  3K33 A;  4I1M A;  1T5O A;  5E3A A;  2RSE B;  2QTV A;  4EBJ A;  4ZLC A;  3EHM A;  4FX5 A;  2HFI A;  2LFF A;  2LQG A;  2W4B A;  2XSE A;  2MHR A;  4O6Y A;  2VCB A;  1OKK D;  4AL0 A;  1LE2 A;  2H7V C;  2J8W A;  2HZ8 A;  2R7O A;  3EZI A;  5F28 E;  4CDV A;  2OJE D;  3HLZ A;  3C7J A;  3UGP A;  5KYX A;  1A7D A;  1MMG A;  1VYK A;  2O9X A;  2VH3 A;  1O5H A;  1LIH A;  5CIV A;  4CIP A;  3U9J A;  3E70 C;  1Z5Z A;  3ZTZ A;  1G4W R;  5L0H A;  4G7Z F;  5F5F A;  1ZHT A;  5JT4 A;  3A11 A;  4H4K C;  1E84 A;  3NYJ A;  4FWV A;  1GS9 A;  1M2O A;  4O6M A;  4PR9 A;  3VAY A;  3X2Q C;  4FAP B;  1CGM E;  2I15 A;  1Y4C A;  1DOW A;  1Z23 A;  3DE9 A;  5JSL A;  4EUK B;  2Y39 A;  4W8K A;  2HSQ A;  4WAB A;  4Q4Z F;  4Z9J A;  2EPO A; 
#chains in the Genus database with same CATH homology
 4XEK A;  4EBK A;  4R32 A;  1KNY A;  4EBJ A;  2KK1 A;  1UFB A;  1WOL A;  1O3U A;  1OW6 A;  2PBE A;  3C8G B;  1OW8 A;  1QVX A;  3GM2 A;  3U0C A;  3AJM A;  1PV3 A;  3L8J A;  5F28 E;  1WWP A;  2JPU A;  1OW7 A;  3MFN A;  2YWA A;  1JOG A;  2JX0 A;  1K40 A;  3JYY A;  1K04 A;  2L6G A;  3RQE A;  3GM3 A;  3S9O A;  3TUL A;  2L6F A;  2Q00 A;  3C8G D;  3C18 A;  3C8G A;  3L8I A;  2HSB A;  4NQF A;  3B71 A;  3U3F A;  1V4A A;  2LK4 A;  3K7D A;  1KTM A;  3JZ0 A;  4XEV A;  3RQF A;  3RQG A;  3O10 A;  2L6H A;  4XEF A;  1K05 A;  1ZZP A;  1WTY A;  3BRJ A;  3GM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...