2YL3A

Cytochrome c prime from alcaligenes xylosoxidans: carbon monooxide bound l16g variant at 1.04 a resolution - restraint refined
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSAGTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CYTOCHROME C'
publication title Carbon Monoxide Poisoning is Prevented by the Energy Costs of Conformational Changes in Gas- Binding Haemproteins.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
total genus 51
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2011-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2yl3A00
2XLDA 3L1MA 1E84A 3ZTMA 4EIYA 2YLDA 4CDVA 4CIPA 3M4CA 2XL6A 4D4XA 1MQVA 4U9EA 2XLOA 1YYJA 1YYXA 4CDAA 3ZQYA 5AGFA 2XM4A 4CJGA 4IB4A 3FOPA 4U9DA 4D4NA 2YL3A 5JVEA 256BA 2YL0A 1YZAA 2XLEA 4ULVA 4JKVA 3ZQVA 4CJOA 1E85A 3HNLA 1EKYA 4N4WA 1BBHA 2J8WA 5JUAA 3QW0A 2YL7A 1E83A 5JSLA 2XLMA 3ZWIA 3C62A 1CPRA 5JLIA 1NBBA 2XLVA 4CX9A 1E86A 3M15A 3QW1A 2YL1A 3M4BA 4IAQA 4WGZA 4CDYA 3NMJA 2YLIA 4JE9A 3TOMA 4N6HA 3C63A 1LM3B 5JRAA 2XLHA 4L6RA 1QPUA 3TOLA 5JS5A 1JAFA 2YLGA 5JT4A 3NMKA 2YKZA 3VRCA 4IARA 1QQ3A 4ER9A 1A7VA 1S05A 1CGOA 3U8PA 4JEBA 1CPQA 3IQ6A 3DE9A 1M6TA 3IQ5A 3QVZA 2QLAA 1YZCA 3NMIA 3HNJA 3HNKA 3QVYA 3ZTZA 4NC3A 3FOOA 1GQAA 1APCA 2BC5A 1CGNA 4WGYA 4JEAA 2J9BA 3M79A 1RCPA 5B3IA 3DE8A 5JP7A 2XM0A 3HNIA 2XL8A 2CCYA 2XLWA
chains in the Genus database with same CATH superfamily
2CGEA 4O6MA 2XLDA 4X0RA 1E84A 3FMSA 3U0CA 3GWNA 1TQGA 1ZU4A 1SMYF 2O9XA 3B0PA 3JYYA 5B1AC 2ZXWC 4JZAA 1T5OA 5F5HA 4CDVA 4CIPA 3M4CA 1MMNA 2G62A 2HKVA 2XL6A 2XSEA 3SXZA 2R7WA 1MQVA 3AOUA 4FAPB 5K0IA 3AG3C 3ZQYA 1K04A 1OR3A 3RFYA 2OKUA 3CZ6A 1ZVZA 1HMDA 3MLGA 1IW7F 3AGTA 1D0YA 1G4US 3MYIA 4IB4A 3QZCA 3FXHA 4DOZA 3FOPA 3LUTB 3RH3A 3TQOA 2OOCA 4D4NA 3IQTA 1VLSA 3DJUB 2ETSA 3EJNA 1YZAA 1QKRA 1OCRC 2E87A 1A7EA 3ASNC 5KYNA 2J9UA 1BR2A 1D1AA 2R7VA 2IXOA 3LESA 4CJOA 3KYIA 3OA1A 2OCCC 4XPYA 5L3VA 1M2OA 3DZAA 3HNLA 4AL0A 4PFOA 5HSWA 1FFHA 1NZEA 1V55C 2J7PD 1OKKD 3GODA 2W4BA 5T3TA 3UMHA 2VCCA 4B6IA 2ZXOA 1FMWA 4CS8A 4JJGA 3AJMA 4LLEA 5EGYA 1HY5A 5DQTA 4Q5SF 2CNWD 1NBBA 4LDRA 2XLVA 3HKKA 1QSPA 4RD9A 3PCVA 3RF3A 3NG1A 1HW1A 1N1CA 2H7VC 3EQLF 4KNVA 1XZQA 3UMKA 3W2WA 1V74B 3KYJA 2DYRC 3NRHA 1UG7A 5KYUA 1TKNA 2HMQA 2YLIA 2Y3DA 2TMVP 1YVIA 1R5ID 2A0UA 1M57C 3KL4A 4AE4B 1V4AA 3ATPA 2YZSA 3LLIA 1FAPB 1LI5A 4JCHA 5GPGB 1LM3B 3K1IA 4HE8D 3SXKA 3SXMA 1AUEA 2XLHA 3L34A 2Q7RA 1MMGA 2Q4FA 3TOLA 1HE1A 5F5FA 1D0XA 4NY3A 3K1HA 3PHF2 2VB6A 3PMRA 4MS2A 5JS5A 4OIQF 5CI8A 4E7ZA 1VK5A 2BL2A 3SEOA 3V5YA 4JCZA 4GYTA 3H2UA 1ORYA 2CW0F 3G4XA 3EG9A 1UFBA 2YKZA 3AQCA 5CI9A 1LPEA 1M2VB 4CSAA 2P1AA 5E33A 3C8ZA 2R7OA 3C7JA 1EI7A 1KNYA 4BEMJ 3GANA 4ER9A 2A1DD 2DYSC 1ZHWA 1LI7A 2WZLA 3CAXA 3N0TA 3ZVRA 5L3QA 3AG1C 4NTAA 4AK9A 4P6IC 4Z9IA 1I4YA 5AC5A 2KC3A 4BG0A 2Q00A 4MTGA 1DOWA 1SR2A 3NKEA 2AWYA 3ECSA 4P9TA 4YK5A 5HV9A 1LIHA 2QNLA 3IQ6A 4U5FE 3GORA 1O3UA 1O87A 3T9OA 5L0JA 2CDQA 4DRHB 2R02A 1YZCA 2LFFA 4JTDB 2B0JA 2NUPA 1V54C 2L6GA 4FESA 4KC9A 4JC7A 3EGDB 3HTKC 4RBNA 3UMIA 3WG7C 2I8BA 4EHPA 1FR0A 4ZLDA 1VYKA 1BR4A 1H9GA 3FOOA 3RQEA 3IHUA 3WAQA 4MVUA 3A11A 4WGYA 4OIOF 3LNMB 3AQBA 2NUTA 3RYLA 1ZHZA 2KSFA 4J7YA 5BUOA 3S84A 4O6YA 3EHMA 1JMWA 3EH1A 3M79A 3O6XA 5DVWA 3V7OA 2A6HF 3G50A 3U3BA 5B3IA 3GM2A 3RVZA 5E2QA 3BRJA 3CQZA 3HNIA 3US6A 2CCYA 3FVYA 3DMDA 3OEOA 2J45A 2G3VA 2V3CC 1I4ZA 3OWTA 2GDCA 2I15A 5IY5C 3JSZA 3KPHA 4XLNF 1LS1A 3E70C 1FTSA 4CBEA 5COFA 4IRUA 4I3MA 4U5GA 3S29A 3ZIBA 1ZU5A 3JRMO 1LE4A 4U9EA 1Z3IX 3ABLC 4YL3A 1YYXA 3JZ0A 1IZMA 2Y3HA 3AGUA 3KH2A 2R7QA 3JSEO 3NYMA 3U3FA 1LVKA 2IYLD 1JR8A 3B0UX 4E0HA 4YT8A 1OXBA 3HLZA 5A6AA 3SP1A 1C02A 1WTYA 1OKKA 2J7PA 1LE2A 3I5QA 3N2ZB 3TK0A 5JVEA 1FFTC 1MNDA 3Q7GA 2YL0A 4Q7CA 3DD7A 4YT2A 4JKVA 3DWWA 5DLJA 1TWCA 1YJGA 2QUPA 2CNWA 2P0NA 2RSEB 1Z23A 3LEOA 4PACA 4YT5A 2HV6A 3ZC4A 1E85A 1EKYA 2EPMX 2OU6A 2HV7A 2J0XA 1B68A 1BBHA 2JPUA 3NKDA 4MVRA 4N4WA 3CEXA 3RQGA 4YWQA 3MBGA 3GM1A 5CIVA 5T1DB 3W8HA 4CS8C 3UGOA 2YL7A 1E83A 3S9OA 4BJTA 5DQZA 4EKWA 4K0DA 1ORJA 2XLMA 3C62A 3ZWIA 4BJ6A 5JLIA 3DAFA 3NYJA 2OJQA 4LLCA 4PFPA 5TJ5E 3U9MA 1HE9A 4K1OA 2MHRA 1E86A 3EFOB 3C18A 2YL1A 1A7DA 1TWHA 3LAYA 3GEEA 3SZRA 2A0BA 1PV3A 4IAQA 4A4AA 2ZD9A 3RW0A 5EHHA 2EIMC 3K1IC 4Q4ZF 4N6HA 3L8JA 1J8YF 3EGXA 3U2LA 1VTMP 1OW6A 2LIGA 4QI0A 4XPXA 1NLXA 3JT1A 2VASA 2OEVA 2UUIA 2VC9A 4KNWA 1HMOA 1OXKA 1PD1A 1QLEC 4O6NA 4IGGA 3X2QC 5KYYB 2WZGA 4BJ5A 3I5PA 4DXWA 1SF8A 1R4TA 4RDAA 2YEVA 2PFDA 1NSGB 3FAPB 3VYWA 5L0FA 4CSAC 2V26A 2R25A 3RVYA 4BEJA 5DS5A 3NDBB 1ST6A 1KTMA 2IXNA 4NTFA 1Q0KA 1E2XA 1Z63A 1CGME 4BJ1A 2X0CA 4U5EE 1BDJB 4PJMA 2XL4A 5COMA 2EPKX 1VYIA 2EIKC 4JTAB 1O5HA 4E17A 1CGOA 4MQ9F 3TJ6A 4CIHA 3V5ZA 1KU2A 4JRZA 1CPQA 4JEBA 1YA7O 4MVOA 2MYSA 5B1BC 4HFFB 2HSBA 1VOMA 3K33A 1ORSC 3IQ5A 4KBLA 1U89A 5L0IA 1G5ZA 2Q9CA 2QLAA 3NMIA 3O55A 1VMAA 3BEHA 2YQYA 3EHNA 2IXPA 3HNJA 1Q0MA 3O39A 4WJ0A 3G4ZA 5BQIA 3POVA 1Q0GA 1K40A 2Y39A 1QVXA 4DBRA 1RXQA 1LKXA 2L7AA 2WB7A 2LD6A 5A6KA 1D0ZA 1RKEA 3MYFA 2KK1A 1YARO 4YN0B 5BQHA 5L0GA 5KYWA 1RMVA 2KNHA 4IWBA 2J9BA 3C8GB 4XWJA 4E7SA 3R7CA 4UDVA 5DS6A 3AG2C 1RCPA 1GM5A 1W2WA 1ZW3A 2AWCA 2J0WA 3IPMO 1OW8A 3DE8A 1JRAA 1ZHTA 5JUAA 3S0XA 1Z6AA 1I5NA 5A6BD 2XL8A 2XLWA 2Y3BA 1OW7A 2YWAA 4I44A 4IAOA 2GWWA 2KW3C 3MX3A 4E18A 2R7RA 2P6VA 4O7GA 3LLKA 4LDKA 1TFKB 1MNEA 1NFOA 5D92A 3Q7LA 5F28E 4ZLCA 5L0HA 2B0HA 4NCQA 3PDMP 2L9JA 3TULA 2YLDA 1L3PA 3FDQA 2IBFA 4W8PA 3ASOC 1T6IA 2CYDA 4EBBA 2YRFA 1RKCA 2J46A 4D4XA 2IM8A 2XLOA 3U2MA 2IXMA 1YYJA 2Q9AA 3H65A 3S28A 2OJED 2EILC 3EPVA 4PR9A 4C3DA 4I1OB 4LERA 5AGFA 1MMAA 3ITFA 2EIJC 4CJGA 5KYYA 4N06A 2KYHA 3K66A 5DS4A 2D5RB 2HJ3A 2XS1A 2XLEA 4ULVA 2ASRA 4EUKB 3LNRA 4ONSA 3CSKA 3FHDA 2HFIA 3U5SA 3UNGC 1NU9C 3VF0A 3ZQVA 1U0BB 1JPJA 1RJ9B 1D1CA 3S90A 1Y6DA 2NSFA 2J8WA 1S7ZA 2VH3A 3DM9B 1AEPA 2C03A 2ZPAA 3ZG1A 2J9WA 2M4EA 3I4UA 4BJ6C 5JSLA 2DB4A 3LJBA 2X51A 5T3WA 1CPRA 3K7DA 1VB5A 1U6HA 1Q0FA 4GQHA 4JW1A 4AE4A 1HW2A 4MW8A 3O10A 3SNHA 3M15A 2GAQA 4CS9A 3QW1A 5L0DA 1H9TA 3JTLO 3B9QA 4YJWA 2A69F 4WGZA 2HS5A 4CDYA 2OQMA 3B29A 4J30B 4JE9A 3ABKC 4Z9JA 4U5HA 3TOMA 2DI3A 4J32B 1Z7Qc 3ZDLA 1M2VA 3Q6NA 1YDIA 2KJGA 3B71A 2FGYA 3H2VA 2H8AA 2G3KA 2VCBA 4PJLA 2P61A 2ZXRA 5A6JA 5E3CA 4BPMA 1PD0A 2PBEA 1JAFA 4G78A 4BJ5C 4JIOA 3TD7A 4GEHA 2W4MA 4NTBA 5COGA 1WGWA 4CS7A 1G8XA 1JPNA 3NMKA 5JT4A 2A6EF 2YVKA 5KYUB 4XLPF 4MVMA 1A41A 3TJ5A 2YHSA 2GA0A 1JOGA 2WVOA 2NSGA 4PJNA 2DGJA 4I1MA 2A68F 1F1MA 2H7OA 2KGOA 1Q0DA 2Z15A 3RIPA 1FMVA 4HEAJ 3L0IA 2L6HA 2R7UA 3EG9B 2IOQA 2JD3A 4MW3A 3EGDA 1S05A 2JX0A 2Q9BA 4M63A 3W8IA 3U8PA 4OIPF 3MFNA 3QMKA 4WABA 2HZ8A 1ZW2A 2J9VA 2LQGA 4FWVA 4YL0A 3JRTA 4C3BA 1G4WR 3K6BA 3A9CA 3QVZA 4LDQA 4ULWA 3M1CB 2OEXA 3QVYA 5A69A 1AVOB 3JYHA 4JJFA 4XEVA 1DOVA 2R7SA 3EZIA 4OD5A 1NFNA 1GQAA 4KI2A 1T6UA 4MVSA 4DVZA 2BC5A 5A6BA 3C8GD 2H7BA 5BQGA 2LK4A 1RJ9A 2R05A 2NUPB 1A0BA 3HJCA 2Y3GA 4EWCA 2XS8A 4H54A 1T01A 4XQ1A 2VCAA 3U9JA 4MTFA 2FFHA 2Y69C 4U5DE 2EINC 5L0CA 2XM0A 1WWPA 1XZPA 2NUTB 3S27A 3WODF 3ZSUA 3R2PA 4AL1A 4MVQA 2WVQA 4EBJA 3L1MA 1TFOB 5FZTA 1VLTA 3RQFA 3RKOF 2PF4E 2HJMA 1EA8A 2PX0A 3ZTMA 4EIYA 4JURI 4IJJA 4XEKA 2W9YA 2HMZA 4QDLA 4DBQA 4C7OB 1SYQA 2XXAA 4JTCB 2F22A 4Z9HA 3UR3C 2LCHA 3GEIA 4CDAA 1OQCA 4XTKA 1NG1A 2UUHA 3FAJA 1WOLA 2NPUA 2XM4A 2R7XA 2KQ9A 3U8VA 1M56C 1OR2A 4U5CE 1OCOC 4U9DA 3T6BA 2HUJA 1H6GA 2WL8A 3T6JA 1H7IA 3UGPA 2YL3A 5KYXB 256BA 1YA9A 2M64A 2R03A 5B3SC 1J8MF 1FNTc 4PJJA 3N24A 2AU5A 2GFHA 3EFOA 1QZXA 3QW0A 2WVNA 1BR1A 2QY9A 4H4KC 3EZHA 3V5XA 3GM3A 2P7VA 4YT4A 2BE5F 4FX5A 2XRHA 1OCCC 4O79A 3DKAA 4EBKA 2AVKA 2XXAB 4CX9A 3NYLA 1TWAA 1C17M 4MTOA 4CS9C 1WATA 4JVSA 1Y4CA 4MNDA 1NU7D 1D1BA 3M4BA 4G7ZF 3T4RA 4AX2A 3IQCA 3NMJA 4XEFA 4E0IA 5EK0A 2PX3A 2EPOA 2RD9A 4U5BE 1T6QA 1ZYRF 4G0HA 2HSQA 3JCUQ 1MMDA 3C63A 5JRAA 1ZHXA 4J7TA 4L6RA 3B0VC 3GEHA 1QPUA 4NQFA 5D91A 4DRJB 4G7HF 1GS9A 1PCXA 3L8IA 3AG4C 2YLGA 4R32A 4QI2A 3J06A 3EGXB 3KMIA 4DVYP 3VRCA 3KKBA 4IARA 3QTHA 2QTVA 1YAUO 3DXJF 1K05A 2EPNA 1QQ3A 1YLMA 1Z5ZA 2LFDA 1T9KA 4OD4A 3SXYA 3LS1A 1SZIA 3DAGA 4LACB 3VAYA 4A2NB 2L6FA 3SYNA 4C7OA 1A7VA 2Q3TA 4F4BA 4ANJA 2PP4A 5FCLA 2LP4A 3DI5A 1GGQA 4C3EA 1LS4A 1BZ4A 2NG1A 2PNOA 4MVZA 2L81A 2FAPB 3DE9A 2D4UA 2ICWG 3DJNB 3DM5A 3F46A 1M6TA 5E3AA 3C8GA 1L7CA 2C04A 4K7BA 2WZFA 1WN0A 2R9RB 4P9FA 4DJ9A 3HNKA 4DRIB 3LS0A 3E9VA 3GWLA 3ZTZA 3LEVA 2W45A 1OCZC 2ZXPA 3EH2A 4NC3A 4OINF 5AC4A 5KYXA 2AP3A 3IEEA 1TR2A 1ZHYA 1APCA 3F47A 1WASA 2OG2A 1XWJA 3ABMC 1CGNA 2LSEA 4G7OF 2R7TA 4JEAA 3W4YA 1TWGA 3Q6MA 4OIRF 3W2VA 1EQ1A 2MWQA 5JP7A 4N6CA 4XPWA 4YL1A 3T6GB 4HFKB 3VM6A 3X1OA 1C03A 2QE9A 1RKEB 4PK4A 5KYWB 3WHNA 4W8KA 1ZZPA 2EPLX
chains in the Genus database with same CATH topology
2XLDA 3L1MA 1E84A 3ZTMA 4EIYA 2YLDA 4CDVA 4CIPA 3M4CA 2XL6A 4D4XA 1MQVA 4U9EA 2XLOA 1YYJA 1YYXA 4CDAA 3ZQYA 5AGFA 2XM4A 4CJGA 4IB4A 3FOPA 4U9DA 4D4NA 2YL3A 5JVEA 256BA 2YL0A 1YZAA 2XLEA 4ULVA 4JKVA 3ZQVA 4CJOA 1E85A 3HNLA 1EKYA 4N4WA 1BBHA 2J8WA 5JUAA 3QW0A 2YL7A 1E83A 5JSLA 2XLMA 3ZWIA 3C62A 1CPRA 5JLIA 1NBBA 2XLVA 4CX9A 1E86A 3M15A 3QW1A 2YL1A 3M4BA 4IAQA 4WGZA 4CDYA 3NMJA 2YLIA 4JE9A 3TOMA 4N6HA 3C63A 1LM3B 5JRAA 2XLHA 4L6RA 1QPUA 3TOLA 5JS5A 1JAFA 2YLGA 5JT4A 3NMKA 2YKZA 3VRCA 4IARA 1QQ3A 4ER9A 1A7VA 1S05A 1CGOA 3U8PA 4JEBA 1CPQA 3IQ6A 3DE9A 1M6TA 3IQ5A 3QVZA 2QLAA 1YZCA 3NMIA 3HNJA 3HNKA 3QVYA 3ZTZA 4NC3A 3FOOA 1GQAA 1APCA 2BC5A 1CGNA 4WGYA 4JEAA 2J9BA 3M79A 1RCPA 5B3IA 3DE8A 5JP7A 2XM0A 3HNIA 2XL8A 2CCYA 2XLWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XLD A;  3L1M A;  1E84 A;  3ZTM A;  4EIY A;  2YLD A;  4CDV A;  4CIP A;  3M4C A;  2XL6 A;  4D4X A;  1MQV A;  4U9E A;  2XLO A;  1YYJ A;  1YYX A;  4CDA A;  3ZQY A;  5AGF A;  2XM4 A;  4CJG A;  4IB4 A;  3FOP A;  4U9D A;  4D4N A;  2YL3 A;  5JVE A;  256B A;  2YL0 A;  1YZA A;  2XLE A;  4ULV A;  4JKV A;  3ZQV A;  4CJO A;  1E85 A;  3HNL A;  1EKY A;  4N4W A;  1BBH A;  2J8W A;  5JUA A;  3QW0 A;  2YL7 A;  1E83 A;  5JSL A;  2XLM A;  3ZWI A;  3C62 A;  1CPR A;  5JLI A;  1NBB A;  2XLV A;  4CX9 A;  1E86 A;  3M15 A;  3QW1 A;  2YL1 A;  3M4B A;  4IAQ A;  4WGZ A;  4CDY A;  3NMJ A;  2YLI A;  4JE9 A;  3TOM A;  4N6H A;  3C63 A;  1LM3 B;  5JRA A;  2XLH A;  4L6R A;  1QPU A;  3TOL A;  5JS5 A;  1JAF A;  2YLG A;  5JT4 A;  3NMK A;  2YKZ A;  3VRC A;  4IAR A;  1QQ3 A;  4ER9 A;  1A7V A;  1S05 A;  1CGO A;  3U8P A;  4JEB A;  1CPQ A;  3IQ6 A;  3DE9 A;  1M6T A;  3IQ5 A;  3QVZ A;  2QLA A;  1YZC A;  3NMI A;  3HNJ A;  3HNK A;  3QVY A;  3ZTZ A;  4NC3 A;  3FOO A;  1GQA A;  1APC A;  2BC5 A;  1CGN A;  4WGY A;  4JEA A;  2J9B A;  3M79 A;  1RCP A;  5B3I A;  3DE8 A;  5JP7 A;  2XM0 A;  3HNI A;  2XL8 A;  2CCY A;  2XLW A; 
#chains in the Genus database with same CATH topology
 2CGE A;  4O6M A;  2XLD A;  4X0R A;  1E84 A;  3FMS A;  3U0C A;  3GWN A;  1TQG A;  1ZU4 A;  1SMY F;  2O9X A;  3B0P A;  3JYY A;  5B1A C;  2ZXW C;  4JZA A;  1T5O A;  5F5H A;  4CDV A;  4CIP A;  3M4C A;  1MMN A;  2G62 A;  2HKV A;  2XL6 A;  2XSE A;  3SXZ A;  2R7W A;  1MQV A;  3AOU A;  4FAP B;  5K0I A;  3AG3 C;  3ZQY A;  1K04 A;  1OR3 A;  3RFY A;  2OKU A;  3CZ6 A;  1ZVZ A;  1HMD A;  3MLG A;  1IW7 F;  3AGT A;  1D0Y A;  1G4U S;  3MYI A;  4IB4 A;  3QZC A;  3FXH A;  4DOZ A;  3FOP A;  3LUT B;  3RH3 A;  3TQO A;  2OOC A;  4D4N A;  3IQT A;  1VLS A;  3DJU B;  2ETS A;  3EJN A;  1YZA A;  1QKR A;  1OCR C;  2E87 A;  1A7E A;  3ASN C;  5KYN A;  2J9U A;  1BR2 A;  1D1A A;  2R7V A;  2IXO A;  3LES A;  4CJO A;  3KYI A;  3OA1 A;  2OCC C;  4XPY A;  5L3V A;  1M2O A;  3DZA A;  3HNL A;  4AL0 A;  4PFO A;  5HSW A;  1FFH A;  1NZE A;  1V55 C;  2J7P D;  1OKK D;  3GOD A;  2W4B A;  5T3T A;  3UMH A;  2VCC A;  4B6I A;  2ZXO A;  1FMW A;  4CS8 A;  4JJG A;  3AJM A;  4LLE A;  5EGY A;  1HY5 A;  5DQT A;  4Q5S F;  2CNW D;  1NBB A;  4LDR A;  2XLV A;  3HKK A;  1QSP A;  4RD9 A;  3PCV A;  3RF3 A;  3NG1 A;  1HW1 A;  1N1C A;  2H7V C;  3EQL F;  4KNV A;  1XZQ A;  3UMK A;  3W2W A;  1V74 B;  3KYJ A;  2DYR C;  3NRH A;  1UG7 A;  5KYU A;  1TKN A;  2HMQ A;  2YLI A;  2Y3D A;  2TMV P;  1YVI A;  1R5I D;  2A0U A;  1M57 C;  3KL4 A;  4AE4 B;  1V4A A;  3ATP A;  2YZS A;  3LLI A;  1FAP B;  1LI5 A;  4JCH A;  5GPG B;  1LM3 B;  3K1I A;  4HE8 D;  3SXK A;  3SXM A;  1AUE A;  2XLH A;  3L34 A;  2Q7R A;  1MMG A;  2Q4F A;  3TOL A;  1HE1 A;  5F5F A;  1D0X A;  4NY3 A;  3K1H A;  3PHF 2;  2VB6 A;  3PMR A;  4MS2 A;  5JS5 A;  4OIQ F;  5CI8 A;  4E7Z A;  1VK5 A;  2BL2 A;  3SEO A;  3V5Y A;  4JCZ A;  4GYT A;  3H2U A;  1ORY A;  2CW0 F;  3G4X A;  3EG9 A;  1UFB A;  2YKZ A;  3AQC A;  5CI9 A;  1LPE A;  1M2V B;  4CSA A;  2P1A A;  5E33 A;  3C8Z A;  2R7O A;  3C7J A;  1EI7 A;  1KNY A;  4BEM J;  3GAN A;  4ER9 A;  2A1D D;  2DYS C;  1ZHW A;  1LI7 A;  2WZL A;  3CAX A;  3N0T A;  3ZVR A;  5L3Q A;  3AG1 C;  4NTA A;  4AK9 A;  4P6I C;  4Z9I A;  1I4Y A;  5AC5 A;  2KC3 A;  4BG0 A;  2Q00 A;  4MTG A;  1DOW A;  1SR2 A;  3NKE A;  2AWY A;  3ECS A;  4P9T A;  4YK5 A;  5HV9 A;  1LIH A;  2QNL A;  3IQ6 A;  4U5F E;  3GOR A;  1O3U A;  1O87 A;  3T9O A;  5L0J A;  2CDQ A;  4DRH B;  2R02 A;  1YZC A;  2LFF A;  4JTD B;  2B0J A;  2NUP A;  1V54 C;  2L6G A;  4FES A;  4KC9 A;  4JC7 A;  3EGD B;  3HTK C;  4RBN A;  3UMI A;  3WG7 C;  2I8B A;  4EHP A;  1FR0 A;  4ZLD A;  1VYK A;  1BR4 A;  1H9G A;  3FOO A;  3RQE A;  3IHU A;  3WAQ A;  4MVU A;  3A11 A;  4WGY A;  4OIO F;  3LNM B;  3AQB A;  2NUT A;  3RYL A;  1ZHZ A;  2KSF A;  4J7Y A;  5BUO A;  3S84 A;  4O6Y A;  3EHM A;  1JMW A;  3EH1 A;  3M79 A;  3O6X A;  5DVW A;  3V7O A;  2A6H F;  3G50 A;  3U3B A;  5B3I A;  3GM2 A;  3RVZ A;  5E2Q A;  3BRJ A;  3CQZ A;  3HNI A;  3US6 A;  2CCY A;  3FVY A;  3DMD A;  3OEO A;  2J45 A;  2G3V A;  2V3C C;  1I4Z A;  3OWT A;  2GDC A;  2I15 A;  5IY5 C;  3JSZ A;  3KPH A;  4XLN F;  1LS1 A;  3E70 C;  1FTS A;  4CBE A;  5COF A;  4IRU A;  4I3M A;  4U5G A;  3S29 A;  3ZIB A;  1ZU5 A;  3JRM O;  1LE4 A;  4U9E A;  1Z3I X;  3ABL C;  4YL3 A;  1YYX A;  3JZ0 A;  1IZM A;  2Y3H A;  3AGU A;  3KH2 A;  2R7Q A;  3JSE O;  3NYM A;  3U3F A;  1LVK A;  2IYL D;  1JR8 A;  3B0U X;  4E0H A;  4YT8 A;  1OXB A;  3HLZ A;  5A6A A;  3SP1 A;  1C02 A;  1WTY A;  1OKK A;  2J7P A;  1LE2 A;  3I5Q A;  3N2Z B;  3TK0 A;  5JVE A;  1FFT C;  1MND A;  3Q7G A;  2YL0 A;  4Q7C A;  3DD7 A;  4YT2 A;  4JKV A;  3DWW A;  5DLJ A;  1TWC A;  1YJG A;  2QUP A;  2CNW A;  2P0N A;  2RSE B;  1Z23 A;  3LEO A;  4PAC A;  4YT5 A;  2HV6 A;  3ZC4 A;  1E85 A;  1EKY A;  2EPM X;  2OU6 A;  2HV7 A;  2J0X A;  1B68 A;  1BBH A;  2JPU A;  3NKD A;  4MVR A;  4N4W A;  3CEX A;  3RQG A;  4YWQ A;  3MBG A;  3GM1 A;  5CIV A;  5T1D B;  3W8H A;  4CS8 C;  3UGO A;  2YL7 A;  1E83 A;  3S9O A;  4BJT A;  5DQZ A;  4EKW A;  4K0D A;  1ORJ A;  2XLM A;  3C62 A;  3ZWI A;  4BJ6 A;  5JLI A;  3DAF A;  3NYJ A;  2OJQ A;  4LLC A;  4PFP A;  5TJ5 E;  3U9M A;  1HE9 A;  4K1O A;  2MHR A;  1E86 A;  3EFO B;  3C18 A;  2YL1 A;  1A7D A;  1TWH A;  3LAY A;  3GEE A;  3SZR A;  2A0B A;  1PV3 A;  4IAQ A;  4A4A A;  2ZD9 A;  3RW0 A;  5EHH A;  2EIM C;  3K1I C;  4Q4Z F;  4N6H A;  3L8J A;  1J8Y F;  3EGX A;  3U2L A;  1VTM P;  1OW6 A;  2LIG A;  4QI0 A;  4XPX A;  1NLX A;  3JT1 A;  2VAS A;  2OEV A;  2UUI A;  2VC9 A;  4KNW A;  1HMO A;  1OXK A;  1PD1 A;  1QLE C;  4O6N A;  4IGG A;  3X2Q C;  5KYY B;  2WZG A;  4BJ5 A;  3I5P A;  4DXW A;  1SF8 A;  1R4T A;  4RDA A;  2YEV A;  2PFD A;  1NSG B;  3FAP B;  3VYW A;  5L0F A;  4CSA C;  2V26 A;  2R25 A;  3RVY A;  4BEJ A;  5DS5 A;  3NDB B;  1ST6 A;  1KTM A;  2IXN A;  4NTF A;  1Q0K A;  1E2X A;  1Z63 A;  1CGM E;  4BJ1 A;  2X0C A;  4U5E E;  1BDJ B;  4PJM A;  2XL4 A;  5COM A;  2EPK X;  1VYI A;  2EIK C;  4JTA B;  1O5H A;  4E17 A;  1CGO A;  4MQ9 F;  3TJ6 A;  4CIH A;  3V5Z A;  1KU2 A;  4JRZ A;  1CPQ A;  4JEB A;  1YA7 O;  4MVO A;  2MYS A;  5B1B C;  4HFF B;  2HSB A;  1VOM A;  3K33 A;  1ORS C;  3IQ5 A;  4KBL A;  1U89 A;  5L0I A;  1G5Z A;  2Q9C A;  2QLA A;  3NMI A;  3O55 A;  1VMA A;  3BEH A;  2YQY A;  3EHN A;  2IXP A;  3HNJ A;  1Q0M A;  3O39 A;  4WJ0 A;  3G4Z A;  5BQI A;  3POV A;  1Q0G A;  1K40 A;  2Y39 A;  1QVX A;  4DBR A;  1RXQ A;  1LKX A;  2L7A A;  2WB7 A;  2LD6 A;  5A6K A;  1D0Z A;  1RKE A;  3MYF A;  2KK1 A;  1YAR O;  4YN0 B;  5BQH A;  5L0G A;  5KYW A;  1RMV A;  2KNH A;  4IWB A;  2J9B A;  3C8G B;  4XWJ A;  4E7S A;  3R7C A;  4UDV A;  5DS6 A;  3AG2 C;  1RCP A;  1GM5 A;  1W2W A;  1ZW3 A;  2AWC A;  2J0W A;  3IPM O;  1OW8 A;  3DE8 A;  1JRA A;  1ZHT A;  5JUA A;  3S0X A;  1Z6A A;  1I5N A;  5A6B D;  2XL8 A;  2XLW A;  2Y3B A;  1OW7 A;  2YWA A;  4I44 A;  4IAO A;  2GWW A;  2KW3 C;  3MX3 A;  4E18 A;  2R7R A;  2P6V A;  4O7G A;  3LLK A;  4LDK A;  1TFK B;  1MNE A;  1NFO A;  5D92 A;  3Q7L A;  5F28 E;  4ZLC A;  5L0H A;  2B0H A;  4NCQ A;  3PDM P;  2L9J A;  3TUL A;  2YLD A;  1L3P A;  3FDQ A;  2IBF A;  4W8P A;  3ASO C;  1T6I A;  2CYD A;  4EBB A;  2YRF A;  1RKC A;  2J46 A;  4D4X A;  2IM8 A;  2XLO A;  3U2M A;  2IXM A;  1YYJ A;  2Q9A A;  3H65 A;  3S28 A;  2OJE D;  2EIL C;  3EPV A;  4PR9 A;  4C3D A;  4I1O B;  4LER A;  5AGF A;  1MMA A;  3ITF A;  2EIJ C;  4CJG A;  5KYY A;  4N06 A;  2KYH A;  3K66 A;  5DS4 A;  2D5R B;  2HJ3 A;  2XS1 A;  2XLE A;  4ULV A;  2ASR A;  4EUK B;  3LNR A;  4ONS A;  3CSK A;  3FHD A;  2HFI A;  3U5S A;  3UNG C;  1NU9 C;  3VF0 A;  3ZQV A;  1U0B B;  1JPJ A;  1RJ9 B;  1D1C A;  3S90 A;  1Y6D A;  2NSF A;  2J8W A;  1S7Z A;  2VH3 A;  3DM9 B;  1AEP A;  2C03 A;  2ZPA A;  3ZG1 A;  2J9W A;  2M4E A;  3I4U A;  4BJ6 C;  5JSL A;  2DB4 A;  3LJB A;  2X51 A;  5T3W A;  1CPR A;  3K7D A;  1VB5 A;  1U6H A;  1Q0F A;  4GQH A;  4JW1 A;  4AE4 A;  1HW2 A;  4MW8 A;  3O10 A;  3SNH A;  3M15 A;  2GAQ A;  4CS9 A;  3QW1 A;  5L0D A;  1H9T A;  3JTL O;  3B9Q A;  4YJW A;  2A69 F;  4WGZ A;  2HS5 A;  4CDY A;  2OQM A;  3B29 A;  4J30 B;  4JE9 A;  3ABK C;  4Z9J A;  4U5H A;  3TOM A;  2DI3 A;  4J32 B;  1Z7Q c;  3ZDL A;  1M2V A;  3Q6N A;  1YDI A;  2KJG A;  3B71 A;  2FGY A;  3H2V A;  2H8A A;  2G3K A;  2VCB A;  4PJL A;  2P61 A;  2ZXR A;  5A6J A;  5E3C A;  4BPM A;  1PD0 A;  2PBE A;  1JAF A;  4G78 A;  4BJ5 C;  4JIO A;  3TD7 A;  4GEH A;  2W4M A;  4NTB A;  5COG A;  1WGW A;  4CS7 A;  1G8X A;  1JPN A;  3NMK A;  5JT4 A;  2A6E F;  2YVK A;  5KYU B;  4XLP F;  4MVM A;  1A41 A;  3TJ5 A;  2YHS A;  2GA0 A;  1JOG A;  2WVO A;  2NSG A;  4PJN A;  2DGJ A;  4I1M A;  2A68 F;  1F1M A;  2H7O A;  2KGO A;  1Q0D A;  2Z15 A;  3RIP A;  1FMV A;  4HEA J;  3L0I A;  2L6H A;  2R7U A;  3EG9 B;  2IOQ A;  2JD3 A;  4MW3 A;  3EGD A;  1S05 A;  2JX0 A;  2Q9B A;  4M63 A;  3W8I A;  3U8P A;  4OIP F;  3MFN A;  3QMK A;  4WAB A;  2HZ8 A;  1ZW2 A;  2J9V A;  2LQG A;  4FWV A;  4YL0 A;  3JRT A;  4C3B A;  1G4W R;  3K6B A;  3A9C A;  3QVZ A;  4LDQ A;  4ULW A;  3M1C B;  2OEX A;  3QVY A;  5A69 A;  1AVO B;  3JYH A;  4JJF A;  4XEV A;  1DOV A;  2R7S A;  3EZI A;  4OD5 A;  1NFN A;  1GQA A;  4KI2 A;  1T6U A;  4MVS A;  4DVZ A;  2BC5 A;  5A6B A;  3C8G D;  2H7B A;  5BQG A;  2LK4 A;  1RJ9 A;  2R05 A;  2NUP B;  1A0B A;  3HJC A;  2Y3G A;  4EWC A;  2XS8 A;  4H54 A;  1T01 A;  4XQ1 A;  2VCA A;  3U9J A;  4MTF A;  2FFH A;  2Y69 C;  4U5D E;  2EIN C;  5L0C A;  2XM0 A;  1WWP A;  1XZP A;  2NUT B;  3S27 A;  3WOD F;  3ZSU A;  3R2P A;  4AL1 A;  4MVQ A;  2WVQ A;  4EBJ A;  3L1M A;  1TFO B;  5FZT A;  1VLT A;  3RQF A;  3RKO F;  2PF4 E;  2HJM A;  1EA8 A;  2PX0 A;  3ZTM A;  4EIY A;  4JUR I;  4IJJ A;  4XEK A;  2W9Y A;  2HMZ A;  4QDL A;  4DBQ A;  4C7O B;  1SYQ A;  2XXA A;  4JTC B;  2F22 A;  4Z9H A;  3UR3 C;  2LCH A;  3GEI A;  4CDA A;  1OQC A;  4XTK A;  1NG1 A;  2UUH A;  3FAJ A;  1WOL A;  2NPU A;  2XM4 A;  2R7X A;  2KQ9 A;  3U8V A;  1M56 C;  1OR2 A;  4U5C E;  1OCO C;  4U9D A;  3T6B A;  2HUJ A;  1H6G A;  2WL8 A;  3T6J A;  1H7I A;  3UGP A;  2YL3 A;  5KYX B;  256B A;  1YA9 A;  2M64 A;  2R03 A;  5B3S C;  1J8M F;  1FNT c;  4PJJ A;  3N24 A;  2AU5 A;  2GFH A;  3EFO A;  1QZX A;  3QW0 A;  2WVN A;  1BR1 A;  2QY9 A;  4H4K C;  3EZH A;  3V5X A;  3GM3 A;  2P7V A;  4YT4 A;  2BE5 F;  4FX5 A;  2XRH A;  1OCC C;  4O79 A;  3DKA A;  4EBK A;  2AVK A;  2XXA B;  4CX9 A;  3NYL A;  1TWA A;  1C17 M;  4MTO A;  4CS9 C;  1WAT A;  4JVS A;  1Y4C A;  4MND A;  1NU7 D;  1D1B A;  3M4B A;  4G7Z F;  3T4R A;  4AX2 A;  3IQC A;  3NMJ A;  4XEF A;  4E0I A;  5EK0 A;  2PX3 A;  2EPO A;  2RD9 A;  4U5B E;  1T6Q A;  1ZYR F;  4G0H A;  2HSQ A;  3JCU Q;  1MMD A;  3C63 A;  5JRA A;  1ZHX A;  4J7T A;  4L6R A;  3B0V C;  3GEH A;  1QPU A;  4NQF A;  5D91 A;  4DRJ B;  4G7H F;  1GS9 A;  1PCX A;  3L8I A;  3AG4 C;  2YLG A;  4R32 A;  4QI2 A;  3J06 A;  3EGX B;  3KMI A;  4DVY P;  3VRC A;  3KKB A;  4IAR A;  3QTH A;  2QTV A;  1YAU O;  3DXJ F;  1K05 A;  2EPN A;  1QQ3 A;  1YLM A;  1Z5Z A;  2LFD A;  1T9K A;  4OD4 A;  3SXY A;  3LS1 A;  1SZI A;  3DAG A;  4LAC B;  3VAY A;  4A2N B;  2L6F A;  3SYN A;  4C7O A;  1A7V A;  2Q3T A;  4F4B A;  4ANJ A;  2PP4 A;  5FCL A;  2LP4 A;  3DI5 A;  1GGQ A;  4C3E A;  1LS4 A;  1BZ4 A;  2NG1 A;  2PNO A;  4MVZ A;  2L81 A;  2FAP B;  3DE9 A;  2D4U A;  2ICW G;  3DJN B;  3DM5 A;  3F46 A;  1M6T A;  5E3A A;  3C8G A;  1L7C A;  2C04 A;  4K7B A;  2WZF A;  1WN0 A;  2R9R B;  4P9F A;  4DJ9 A;  3HNK A;  4DRI B;  3LS0 A;  3E9V A;  3GWL A;  3ZTZ A;  3LEV A;  2W45 A;  1OCZ C;  2ZXP A;  3EH2 A;  4NC3 A;  4OIN F;  5AC4 A;  5KYX A;  2AP3 A;  3IEE A;  1TR2 A;  1ZHY A;  1APC A;  3F47 A;  1WAS A;  2OG2 A;  1XWJ A;  3ABM C;  1CGN A;  2LSE A;  4G7O F;  2R7T A;  4JEA A;  3W4Y A;  1TWG A;  3Q6M A;  4OIR F;  3W2V A;  1EQ1 A;  2MWQ A;  5JP7 A;  4N6C A;  4XPW A;  4YL1 A;  3T6G B;  4HFK B;  3VM6 A;  3X1O A;  1C03 A;  2QE9 A;  1RKE B;  4PK4 A;  5KYW B;  3WHN A;  4W8K A;  1ZZP A;  2EPL X; 
#chains in the Genus database with same CATH homology
 2XLD A;  3L1M A;  1E84 A;  3ZTM A;  4EIY A;  2YLD A;  4CDV A;  4CIP A;  3M4C A;  2XL6 A;  4D4X A;  1MQV A;  4U9E A;  2XLO A;  1YYJ A;  1YYX A;  4CDA A;  3ZQY A;  5AGF A;  2XM4 A;  4CJG A;  4IB4 A;  3FOP A;  4U9D A;  4D4N A;  2YL3 A;  5JVE A;  256B A;  2YL0 A;  1YZA A;  2XLE A;  4ULV A;  4JKV A;  3ZQV A;  4CJO A;  1E85 A;  3HNL A;  1EKY A;  4N4W A;  1BBH A;  2J8W A;  5JUA A;  3QW0 A;  2YL7 A;  1E83 A;  5JSL A;  2XLM A;  3ZWI A;  3C62 A;  1CPR A;  5JLI A;  1NBB A;  2XLV A;  4CX9 A;  1E86 A;  3M15 A;  3QW1 A;  2YL1 A;  3M4B A;  4IAQ A;  4WGZ A;  4CDY A;  3NMJ A;  2YLI A;  4JE9 A;  3TOM A;  4N6H A;  3C63 A;  1LM3 B;  5JRA A;  2XLH A;  4L6R A;  1QPU A;  3TOL A;  5JS5 A;  1JAF A;  2YLG A;  5JT4 A;  3NMK A;  2YKZ A;  3VRC A;  4IAR A;  1QQ3 A;  4ER9 A;  1A7V A;  1S05 A;  1CGO A;  3U8P A;  4JEB A;  1CPQ A;  3IQ6 A;  3DE9 A;  1M6T A;  3IQ5 A;  3QVZ A;  2QLA A;  1YZC A;  3NMI A;  3HNJ A;  3HNK A;  3QVY A;  3ZTZ A;  4NC3 A;  3FOO A;  1GQA A;  1APC A;  2BC5 A;  1CGN A;  4WGY A;  4JEA A;  2J9B A;  3M79 A;  1RCP A;  5B3I A;  3DE8 A;  5JP7 A;  2XM0 A;  3HNI A;  2XL8 A;  2CCY A;  2XLW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...