2YL3A

Cytochrome c prime from alcaligenes xylosoxidans: carbon monooxide bound l16g variant at 1.04 a resolution - restraint refined
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSAGTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Carbon Monoxide Poisoning is Prevented by the Energy Costs of Conformational Changes in Gas- Binding Haemproteins.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
molecule keywords CYTOCHROME C'
total genus 51
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2011-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2yl3A00
1YZAA 3QVZA 3L1MA 2XL6A 4ULVA 1CPRA 5B3IA 3IQ6A 3TOMA 2XLVA 2XM4A 4IAQA 4IARA 3ZQVA 256BA 4CDVA 3QW0A 4U9DA 1GQAA 3ZQYA 2XLWA 1CGNA 2YKZA 1M6TA 2CCYA 1QPUA 3VRCA 3ZTZA 1MQVA 3ZWIA 1CGOA 1NBBA 4CDAA 2YL1A 5JSLA 4D4XA 5JUAA 1EKYA 5JS5A 4WGZA 4U9EA 3QVYA 2YL7A 4JKVA 4NC3A 2XL8A 1RCPA 3U8PA 3QW1A 4JE9A 5JRAA 1E83A 4IB4A 3C63A 2YL3A 4WGYA 1E86A 4JEAA 3ZTMA 3C62A 2YLIA 5AGFA 4CJGA 4CJOA 3HNKA 5JP7A 4CDYA 3NMKA 3FOPA 3M4BA 1E84A 3NMIA 3NMJA 3HNIA 3HNJA 3M4CA 3TOLA 2XLEA 3HNLA 2XLMA 4JEBA 2XM0A 1A7VA 3DE8A 1BBHA 2XLOA 4N6HA 4CIPA 5JT4A 4EIYA 2YL0A 1JAFA 1LM3B 4D4NA 1S05A 3FOOA 2YLDA 2XLDA 2XLHA 1APCA 1E85A 1CPQA 4CX9A 4L6RA 5JLIA 3M79A 2YLGA 2J9BA 1QQ3A 4N4WA 1YZCA 3DE9A 3M15A 2J8WA 2QLAA 4ER9A 3IQ5A 1YYJA 1YYXA 2BC5A 5JVEA
chains in the Genus database with same CATH superfamily
1YZAA 2PF4E 3CAXA 5HV9A 3KL4A 2NPUA 5KYWA 2Q4FA 3WG7C 4E0IA 1CPRA 3NKEA 5T3TA 3DKAA 5KYUB 1TQGA 3EG9B 3I4UA 1Z7Qc 4BJTA 3LUTB 4HFFB 4ULWA 3FDQA 5KYYA 1BR4A 2XLVA 4MVUA 4JTDB 2KYHA 2J0XA 1I4YA 3RQGA 2HFIA 1VB5A 4AE4A 1A7DA 1S7ZA 1JMWA 4CDVA 2R7XA 2Y69C 3QW0A 2AWYA 4JJFA 4MVSA 4DOZA 5KYXA 4EKWA 1LE4A 1C02A 3NYLA 3DMDA 1VLTA 3TULA 3J06A 5DS5A 5L0GA 1KU2A 4I44A 4G7HF 4PJJA 1M6TA 2KK1A 2WB7A 4P9FA 1WGWA 3IQCA 3NG1A 3ZTZA 1WN0A 5E33A 4K7BA 4EUKB 2M64A 4NTAA 2YZSA 1JPJA 1VYKA 3JSZA 3ZWIA 2KQ9A 4O6MA 3W2VA 1CGOA 4EBKA 4M63A 4BJ6C 3PHF2 2A0UA 4HEAJ 2VCBA 3DJUB 4D4XA 2WZFA 3S9OA 2B0HA 3SEOA 2R02A 3LS0A 4I1MA 3U9JA 4O6YA 4WGZA 3T6GB 2R7RA 1A7EA 3QVYA 3SXYA 2H7VC 3SNHA 4NC3A 3QZCA 4CS9C 3U9MA 2R05A 1V55C 4JURI 4RBNA 4BJ6A 3UR3C 2L6HA 3JZ0A 3GWLA 1RCPA 4I1OB 3QW1A 4AL1A 5JRAA 2HS5A 4IB4A 2A69F 3GM1A 4MTOA 1NU7D 2YEVA 3RVYA 1Q0DA 1QVXA 5KYUA 2YLIA 2W9YA 1FFHA 3DAFA 1Q0FA 1Q0KA 2J45A 3GEHA 2G3VA 4U5EE 1T6QA 3GM2A 2P7VA 1G4WR 4LDQA 1YDIA 3NMKA 2EINC 4IJJA 1NLXA 4XPYA 3SYNA 4IRUA 4K0DA 2OKUA 2DI3A 2OQMA 1ZW3A 4LDRA 3AGUA 5L0CA 3ZDLA 3CZ6A 3ZC4A 1SYQA 1YAUO 3DM5A 3HNIA 3HNJA 3JSEO 2PFDA 3L8IA 3NYMA 4MTGA 3UNGC 4JC7A 2CW0F 2YVKA 1TR2A 2FAPB 3DD7A 4ONSA 2EIJC 3K33A 4YL0A 1SZIA 3LLIA 3ZSUA 1H9TA 4R32A 1NFNA 1Z3IX 1ZU4A 3WODF 1I5NA 2XLOA 3OEOA 4N6HA 2EPOA 1R4TA 2YL0A 2XSEA 2IOQA 1DOVA 4Z9JA 1D1CA 4H54A 3EQLF 3U8VA 4CS8C 2D5RB 4F4BA 2NUTA 1T6IA 4BG0A 1T5OA 1DOWA 3JT1A 1ORYA 4MVRA 5JVEA 1APCA 1E85A 1RKCA 3GORA 3W4YA 4A2NB 3QMKA 3SXKA 3HKKA 1YJGA 4RDAA 4ZLCA 3ATPA 1IW7F 4L6RA 5T1DB 1U0BB 2HSBA 1O5HA 3H2VA 4MQ9F 3KPHA 2I8BA 3UMHA 2DYRC 2H7OA 4ANJA 4QI2A 3LEOA 2QTVA 2BE5F 4YT5A 3GEEA 3EZIA 3DI5A 3Q7GA 1QZXA 1JPNA 1T9KA 3O10A 1MNDA 4G78A 4YT2A 1SF8A 1OKKD 4DRHB 2IYLD 3PMRA 1HMDA 3B29A 4MNDA 3R7CA 4XQ1A 1ZU5A 3DE9A 5K0IA 1JOGA 3N24A 4AK9A 2EPLX 2KC3A 1ZZPA 5BQHA 1ORSC 1AEPA 1K04A 3IQ5A 3K7DA 4E17A 1D0ZA 3V5XA 4YJWA 1OKKA 3Q6NA 1LIHA 1Z63A 4MW8A 3QVZA 1ZW2A 4KNVA 2B0JA 3N0TA 2XL6A 2Q3TA 5L3VA 3EGXB 2PP4A 2HKVA 1QKRA 1HE1A 2MWQA 3Q6MA 1AUEA 4PACA 2YWAA 1OW7A 1ZVZA 3TOMA 2XM4A 5L0HA 4IAQA 1SR2A 1TKNA 2JD3A 4PK4A 4OIRF 3IQTA 3GODA 4C3DA 1YA7O 3AJMA 2Y3GA 4QI0A 3ZQYA 4DBRA 3WAQA 2R9RB 4PJLA 3C8GB 3K1IC 1CGNA 1Q0MA 1LS1A 3KKBA 2AVKA 2VH3A 4LLEA 1EA8A 2GFHA 2G3KA 1MQVA 3Q7LA 5BUOA 4FWVA 2Z15A 4CS9A 5DVWA 3LLKA 2MHRA 4EBJA 2J0WA 3KYJA 2HSQA 2HJ3A 4XEKA 3W8HA 2AP3A 1XZPA 1Y6DA 1ZHWA 5KYYB 4FESA 2A6EF 3PCVA 1M2VA 2Q00A 3MFNA 2H7BA 1O3UA 1HY5A 2NSGA 4U9EA 4BJ5A 1OXKA 2QUPA 4JKVA 4O7GA 1F1MA 3T6JA 3MYIA 4OD4A 1SMYF 1VOMA 2P61A 1IZMA 3HLZA 1XWJA 2HMQA 3BEHA 1NZEA 5EK0A 2PNOA 2XL4A 4HFKB 4MVZA 1E83A 2ZXRA 2L9JA 3C63A 3S29A 4CBEA 4WGYA 2OG2A 3C62A 4GYTA 4J7YA 1OCCC 3ZG1A 2EIKC 3LS1A 4Z9IA 2XRHA 4XPXA 3VAYA 2IXNA 4C7OB 5JP7A 2DGJA 4XEFA 2LK4A 5F28E 2GA0A 3U3FA 3FOPA 4JCZA 2X51A 2L7AA 2IBFA 2M4EA 5IY5C 1V74B 5A69A 1J8YF 1ZHZA 2GAQA 3NMJA 4IAOA 5DLJA 4CSAA 2IXPA 3M4CA 2HUJA 3HTKC 3TOLA 3HNLA 1J8MF 3TD7A 1OQCA 4O6NA 1OCRC 1E2XA 1L7CA 2XM0A 2J46A 1A7VA 5B3SC 1ZYRF 2R7QA 1VMAA 3AG4C 4W8KA 2HMZA 2KW3C 5AC5A 1BR1A 2P1AA 3LNMB 4AX2A 1M2VB 1OW6A 1NU9C 1JAFA 1C17M 4A4AA 2EPMX 5KYWB 2LFFA 3FAPB 3ABKC 3FOOA 5A6BD 5L0FA 1VYIA 3EG9A 2MYSA 2EPKX 2R7SA 2NG1A 3ITFA 1FR0A 1JR8A 2A6HF 4CX9A 3CQZA 1RKEB 2J9UA 2FGYA 2O9XA 3UGPA 4U5FE 1TWAA 1ST6A 4KNWA 1PD1A 3JYHA 1HW1A 1M2OA 4NTFA 2NSFA 3NYJA 4Q7CA 3RIPA 3SZRA 5JLIA 4PJMA 2G62A 5E3AA 3EFOB 4E7SA 1OR3A 1M57C 1GM5A 1K40A 4I3MA 3DWWA 2EPNA 3U5SA 4YWQA 1D1AA 1YZCA 3C8GD 3KYIA 5AC4A 1C03A 1A41A 3K1IA 4MVQA 3U2LA 5L3QA 4G7ZF 3M15A 2V3CC 2A68F 3JRMO 1H7IA 2XXAB 2C04A 3MYFA 5L0DA 3E9VA 1D1BA 4U5GA 3V5YA 1UFBA 1YYXA 3M1CB 1HMOA 5D92A 3RH3A 3K66A 1NG1A 2DB4A 3OWTA 5DQTA 1PD0A 3EHMA 4PR9A 3IQ6A 4YT8A 2P0NA 1G4US 2L81A 3QTHA 3ZQVA 1EQ1A 3EH1A 1LVKA 2OJQA 3S27A 2NUPA 3DAGA 4KC9A 5COMA 4CIHA 1MMNA 1KTMA 1GQAA 1BR2A 2PBEA 1LPEA 1U89A 5A6BA 1RMVA 2XLWA 2V26A 1XZQA 3RW0A 1HW2A 3ZVRA 5KYNA 4E7ZA 2ETSA 3VYWA 3I5PA 3VM6A 3ABMC 3BRJA 1RKEA 2D4UA 2ZXWC 4IWBA 1V54C 1QPUA 1Z5ZA 2JX0A 4U5CE 3H65A 3RFYA 3POVA 1OR2A 4E0HA 4LACB 3HJCA 1YVIA 2CNWD 2YL1A 4G0HA 3FHDA 5JUAA 3C18A 1WWPA 4CSAC 3KMIA 5COFA 5CI9A 2UUIA 5COGA 2OJED 3S28A 1K05A 5A6AA 1LS4A 4OIPF 4J32B 3B0UX 1YA9A 2QE9A 2AWCA 2YL7A 4HE8D 5F5HA 4BJ5C 3JTLO 1RJ9A 3R2PA 3T9OA 3U0CA 2XL8A 3RQEA 2BL2A 3TK0A 3FVYA 2TMVP 5CI8A 1FNTc 4W8PA 2ASRA 4MVMA 3EHNA 2Y3HA 3F46A 1D0XA 2NUPB 3I5QA 2DYSC 3C8ZA 3V5ZA 4B6IA 2CDQA 3DJNB 3IEEA 4OIQF 5D91A 1GS9A 4CJGA 2Q9BA 3AOUA 1NFOA 3HNKA 4NTBA 4AE4B 3JCUQ 1QLEC 2IXMA 1QSPA 5CIVA 5B1AC 1E84A 4U5DE 4U5BE 3TQOA 3EZHA 2VCCA 3E70C 5KYXB 1WATA 2KGOA 2ZD9A 4JRZA 3T6BA 3F47A 4P6IC 4JJGA 1LI5A 4JEBA 4J30B 5BQIA 3K1HA 1AVOB 1OW8A 4DVZA 5FZTA 1RXQA 5DS6A 1BBHA 4PFOA 4YL3A 2R03A 3O6XA 1NSGB 4EIYA 2NUTB 3B9QA 4DRIB 4D4NA 3LESA 2EILC 3O55A 1S05A 1LE2A 2AU5A 2CGEA 2L6FA 1ZHYA 2UUHA 3ABLC 2P6VA 3LAYA 4MVOA 4WJ0A 2I15A 3SP1A 5L0IA 2GWWA 2XLHA 2J9WA 4JCHA 3RQFA 2QNLA 1MMAA 1CPQA 4YT4A 2LQGA 2WVNA 3LNRA 4GEHA 2KNHA 4EWCA 1KNYA 3B0VC 1OXBA 4KI2A 1Z23A 3L0IA 1VLSA 3ASOC 3M79A 3NDBB 2YLGA 5A6KA 4DJ9A 2R7TA 2WVQA 1MNEA 4NQFA 2EIMC 2OU6A 2J9BA 2RSEB 4IGGA 3AGTA 1I4ZA 3DXJF 2W4MA 2R7UA 1WOLA 3CEXA 4MW3A 1U6HA 2F22A 4Q4ZF 4Q5SF 3EGDB 4KBLA 2A1DD 3S84A 4O79A 1GGQA 2X0CA 4Z9HA 2QY9A 4AL0A 2LD6A 3N2ZB 2E87A 1FMWA 3X1OA 4J7TA 1CGME 2CYDA 2W45A 3L1MA 1WTYA 1EI7A 2LIGA 2RD9A 3UMIA 2R7VA 4ULVA 1VTMP 2Q9CA 2R7OA 4E18A 3H2UA 3A11A 5B3IA 1LI7A 2WZLA 2J7PD 2OOCA 3EPVA 3GM3A 4CS8A 5A6JA 3JRTA 3AQBA 4LERA 1D0YA 4EHPA 2ZXPA 3B0PA 4XLNF 2OEVA 4K1OA 1TFKB 4IARA 1BDJB 2PX0A 256BA 2Q7RA 3W8IA 4BEJA 3ASNC 4LDKA 1PV3A 4U9DA 4C3BA 4BEMJ 3T4RA 3LEVA 2KSFA 4ZLDA 1FAPB 1BZ4A 4EBBA 2LSEA 2HJMA 1G5ZA 1TWCA 1OCOC 2WVOA 2YKZA 4PJNA 2CCYA 2C03A 4JTAB 2W4BA 2Q9AA 3G4XA 4XWJA 3VRCA 1G8XA 3S90A 4DBQA 1M56C 4MTFA 2LCHA 2IM8A 4C3EA 1NBBA 3G4ZA 4YK5A 4CDAA 4MS2A 5EHHA 2XS8A 1VK5A 1V4AA 2WL8A 5JSLA 1JRAA 1EKYA 5JS5A 1WASA 2A0BA 1B68A 2HZ8A 2OEXA 4OD5A 1FMVA 3V7OA 3EGDA 3JYYA 3L8JA 5E2QA 2ICWG 1MMDA 3U8PA 3VF0A 4JE9A 4OIOF 4GQHA 4JVSA 1TWGA 4QDLA 5T3WA 2PX3A 2YL3A 4YN0B 1N1CA 1E86A 4JEAA 3ZTMA 4G7OF 1ORJA 3EGXA 2L6GA 3DZAA 2GDCA 3MBGA 3O39A 5AGFA 3AG2C 5E3CA 4JTCB 3RVZA 3RYLA 4CJOA 4CDYA 1T6UA 2LP4A 2LFDA 3EFOA 2VASA 5FCLA 1W2WA 3M4BA 3B71A 4JZAA 2R7WA 3NMIA 2XXAA 1UG7A 3L34A 1YLMA 5BQGA 4YL1A 1TWHA 4FX5A 3IHUA 1T01A 2VB6A 3SXZA 2XLEA 4XPWA 2VCAA 2XLMA 3C7JA 3ECSA 3UMKA 2CNWA 4DVYP 1FTSA 1PCXA 3DE8A 1R5ID 3OA1A 3AQCA 4H4KC 4RD9A 3MX3A 5JT4A 1TFOB 4CIPA 4PFPA 3UGOA 3EJNA 3KH2A 1LM3B 2Y3BA 3FMSA 3AG1C 3CSKA 3A9CA 2R25A 4U5HA 4UDVA 1A0BA 1YARO 2OCCC 3WHNA 4JW1A 4BJ1A 4DXWA 4WABA 2YLDA 2XLDA 3FAJA 3U2MA 5B1BC 1Q0GA 3TJ6A 4LLCA 2H8AA 1H9GA 3AG3C 1ZHXA 2WZGA 4DRJB 2ZPAA 4X0RA 3EH2A 3RF3A 3LJBA 3FXHA 3X2QC 2VC9A 4XTKA 1H6GA 4N6CA 5HSWA 5F5FA 3GEIA 1Y4CA 3GWNA 2HV6A 2J7PA 3TJ5A 3U3BA 3NKDA 2YHSA 3ZIBA 2Y39A 3DM9B 1ZHTA 3GANA 2XS1A 1OCZC 1L3PA 4XEVA 2JPUA 5GPGB 3US6A 4FAPB 3S0XA 4N06A 3G50A 1QQ3A 3MLGA 4N4WA 4P9TA 2FFHA 4CS7A 5DS4A 4C7OA 4NCQA 1O87A 1MMGA 5L0JA 4JIOA 2J9VA 2KJGA 4NY3A 2ZXOA 5EGYA 2J8WA 1LKXA 3W2WA 2QLAA 1RJ9B 3K6BA 2YQYA 2YRFA 1HE9A 3NRHA 4ER9A 3PDMP 2HV7A 1FFTC 1YYJA 3C8GA 2IXOA 2Y3DA 1Z6AA 5TJ5E 5DQZA 4XLPF 4OINF 3IPMO 3SXMA 4BPMA 2BC5A 3RKOF
chains in the Genus database with same CATH topology
1YZAA 3QVZA 3L1MA 2XL6A 4ULVA 1CPRA 5B3IA 3IQ6A 3TOMA 2XLVA 2XM4A 4IAQA 4IARA 3ZQVA 256BA 4CDVA 3QW0A 4U9DA 1GQAA 3ZQYA 2XLWA 1CGNA 2YKZA 1M6TA 2CCYA 1QPUA 3VRCA 3ZTZA 1MQVA 3ZWIA 1CGOA 1NBBA 4CDAA 2YL1A 5JSLA 4D4XA 5JUAA 1EKYA 5JS5A 4WGZA 4U9EA 3QVYA 2YL7A 4JKVA 4NC3A 2XL8A 1RCPA 3U8PA 3QW1A 4JE9A 5JRAA 1E83A 4IB4A 3C63A 2YL3A 4WGYA 1E86A 4JEAA 3ZTMA 3C62A 2YLIA 5AGFA 4CJGA 4CJOA 3HNKA 5JP7A 4CDYA 3NMKA 3FOPA 3M4BA 1E84A 3NMIA 3NMJA 3HNIA 3HNJA 3M4CA 3TOLA 2XLEA 3HNLA 2XLMA 4JEBA 2XM0A 1A7VA 3DE8A 1BBHA 2XLOA 4N6HA 4CIPA 5JT4A 4EIYA 2YL0A 1JAFA 1LM3B 4D4NA 1S05A 3FOOA 2YLDA 2XLDA 2XLHA 1APCA 1E85A 1CPQA 4CX9A 4L6RA 5JLIA 3M79A 2YLGA 2J9BA 1QQ3A 4N4WA 1YZCA 3DE9A 3M15A 2J8WA 2QLAA 4ER9A 3IQ5A 1YYJA 1YYXA 2BC5A 5JVEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YZA A;  3QVZ A;  3L1M A;  2XL6 A;  4ULV A;  1CPR A;  5B3I A;  3IQ6 A;  3TOM A;  2XLV A;  2XM4 A;  4IAQ A;  4IAR A;  3ZQV A;  256B A;  4CDV A;  3QW0 A;  4U9D A;  1GQA A;  3ZQY A;  2XLW A;  1CGN A;  2YKZ A;  1M6T A;  2CCY A;  1QPU A;  3VRC A;  3ZTZ A;  1MQV A;  3ZWI A;  1CGO A;  1NBB A;  4CDA A;  2YL1 A;  5JSL A;  4D4X A;  5JUA A;  1EKY A;  5JS5 A;  4WGZ A;  4U9E A;  3QVY A;  2YL7 A;  4JKV A;  4NC3 A;  2XL8 A;  1RCP A;  3U8P A;  3QW1 A;  4JE9 A;  5JRA A;  1E83 A;  4IB4 A;  3C63 A;  2YL3 A;  4WGY A;  1E86 A;  4JEA A;  3ZTM A;  3C62 A;  2YLI A;  5AGF A;  4CJG A;  4CJO A;  3HNK A;  5JP7 A;  4CDY A;  3NMK A;  3FOP A;  3M4B A;  1E84 A;  3NMI A;  3NMJ A;  3HNI A;  3HNJ A;  3M4C A;  3TOL A;  2XLE A;  3HNL A;  2XLM A;  4JEB A;  2XM0 A;  1A7V A;  3DE8 A;  1BBH A;  2XLO A;  4N6H A;  4CIP A;  5JT4 A;  4EIY A;  2YL0 A;  1JAF A;  1LM3 B;  4D4N A;  1S05 A;  3FOO A;  2YLD A;  2XLD A;  2XLH A;  1APC A;  1E85 A;  1CPQ A;  4CX9 A;  4L6R A;  5JLI A;  3M79 A;  2YLG A;  2J9B A;  1QQ3 A;  4N4W A;  1YZC A;  3DE9 A;  3M15 A;  2J8W A;  2QLA A;  4ER9 A;  3IQ5 A;  1YYJ A;  1YYX A;  2BC5 A;  5JVE A; 
#chains in the Genus database with same CATH topology
 1YZA A;  2PF4 E;  3CAX A;  5HV9 A;  3KL4 A;  2NPU A;  5KYW A;  2Q4F A;  3WG7 C;  4E0I A;  1CPR A;  3NKE A;  5T3T A;  3DKA A;  5KYU B;  1TQG A;  3EG9 B;  3I4U A;  1Z7Q c;  4BJT A;  3LUT B;  4HFF B;  4ULW A;  3FDQ A;  5KYY A;  1BR4 A;  2XLV A;  4MVU A;  4JTD B;  2KYH A;  2J0X A;  1I4Y A;  3RQG A;  2HFI A;  1VB5 A;  4AE4 A;  1A7D A;  1S7Z A;  1JMW A;  4CDV A;  2R7X A;  2Y69 C;  3QW0 A;  2AWY A;  4JJF A;  4MVS A;  4DOZ A;  5KYX A;  4EKW A;  1LE4 A;  1C02 A;  3NYL A;  3DMD A;  1VLT A;  3TUL A;  3J06 A;  5DS5 A;  5L0G A;  1KU2 A;  4I44 A;  4G7H F;  4PJJ A;  1M6T A;  2KK1 A;  2WB7 A;  4P9F A;  1WGW A;  3IQC A;  3NG1 A;  3ZTZ A;  1WN0 A;  5E33 A;  4K7B A;  4EUK B;  2M64 A;  4NTA A;  2YZS A;  1JPJ A;  1VYK A;  3JSZ A;  3ZWI A;  2KQ9 A;  4O6M A;  3W2V A;  1CGO A;  4EBK A;  4M63 A;  4BJ6 C;  3PHF 2;  2A0U A;  4HEA J;  2VCB A;  3DJU B;  4D4X A;  2WZF A;  3S9O A;  2B0H A;  3SEO A;  2R02 A;  3LS0 A;  4I1M A;  3U9J A;  4O6Y A;  4WGZ A;  3T6G B;  2R7R A;  1A7E A;  3QVY A;  3SXY A;  2H7V C;  3SNH A;  4NC3 A;  3QZC A;  4CS9 C;  3U9M A;  2R05 A;  1V55 C;  4JUR I;  4RBN A;  4BJ6 A;  3UR3 C;  2L6H A;  3JZ0 A;  3GWL A;  1RCP A;  4I1O B;  3QW1 A;  4AL1 A;  5JRA A;  2HS5 A;  4IB4 A;  2A69 F;  3GM1 A;  4MTO A;  1NU7 D;  2YEV A;  3RVY A;  1Q0D A;  1QVX A;  5KYU A;  2YLI A;  2W9Y A;  1FFH A;  3DAF A;  1Q0F A;  1Q0K A;  2J45 A;  3GEH A;  2G3V A;  4U5E E;  1T6Q A;  3GM2 A;  2P7V A;  1G4W R;  4LDQ A;  1YDI A;  3NMK A;  2EIN C;  4IJJ A;  1NLX A;  4XPY A;  3SYN A;  4IRU A;  4K0D A;  2OKU A;  2DI3 A;  2OQM A;  1ZW3 A;  4LDR A;  3AGU A;  5L0C A;  3ZDL A;  3CZ6 A;  3ZC4 A;  1SYQ A;  1YAU O;  3DM5 A;  3HNI A;  3HNJ A;  3JSE O;  2PFD A;  3L8I A;  3NYM A;  4MTG A;  3UNG C;  4JC7 A;  2CW0 F;  2YVK A;  1TR2 A;  2FAP B;  3DD7 A;  4ONS A;  2EIJ C;  3K33 A;  4YL0 A;  1SZI A;  3LLI A;  3ZSU A;  1H9T A;  4R32 A;  1NFN A;  1Z3I X;  1ZU4 A;  3WOD F;  1I5N A;  2XLO A;  3OEO A;  4N6H A;  2EPO A;  1R4T A;  2YL0 A;  2XSE A;  2IOQ A;  1DOV A;  4Z9J A;  1D1C A;  4H54 A;  3EQL F;  3U8V A;  4CS8 C;  2D5R B;  4F4B A;  2NUT A;  1T6I A;  4BG0 A;  1T5O A;  1DOW A;  3JT1 A;  1ORY A;  4MVR A;  5JVE A;  1APC A;  1E85 A;  1RKC A;  3GOR A;  3W4Y A;  4A2N B;  3QMK A;  3SXK A;  3HKK A;  1YJG A;  4RDA A;  4ZLC A;  3ATP A;  1IW7 F;  4L6R A;  5T1D B;  1U0B B;  2HSB A;  1O5H A;  3H2V A;  4MQ9 F;  3KPH A;  2I8B A;  3UMH A;  2DYR C;  2H7O A;  4ANJ A;  4QI2 A;  3LEO A;  2QTV A;  2BE5 F;  4YT5 A;  3GEE A;  3EZI A;  3DI5 A;  3Q7G A;  1QZX A;  1JPN A;  1T9K A;  3O10 A;  1MND A;  4G78 A;  4YT2 A;  1SF8 A;  1OKK D;  4DRH B;  2IYL D;  3PMR A;  1HMD A;  3B29 A;  4MND A;  3R7C A;  4XQ1 A;  1ZU5 A;  3DE9 A;  5K0I A;  1JOG A;  3N24 A;  4AK9 A;  2EPL X;  2KC3 A;  1ZZP A;  5BQH A;  1ORS C;  1AEP A;  1K04 A;  3IQ5 A;  3K7D A;  4E17 A;  1D0Z A;  3V5X A;  4YJW A;  1OKK A;  3Q6N A;  1LIH A;  1Z63 A;  4MW8 A;  3QVZ A;  1ZW2 A;  4KNV A;  2B0J A;  3N0T A;  2XL6 A;  2Q3T A;  5L3V A;  3EGX B;  2PP4 A;  2HKV A;  1QKR A;  1HE1 A;  2MWQ A;  3Q6M A;  1AUE A;  4PAC A;  2YWA A;  1OW7 A;  1ZVZ A;  3TOM A;  2XM4 A;  5L0H A;  4IAQ A;  1SR2 A;  1TKN A;  2JD3 A;  4PK4 A;  4OIR F;  3IQT A;  3GOD A;  4C3D A;  1YA7 O;  3AJM A;  2Y3G A;  4QI0 A;  3ZQY A;  4DBR A;  3WAQ A;  2R9R B;  4PJL A;  3C8G B;  3K1I C;  1CGN A;  1Q0M A;  1LS1 A;  3KKB A;  2AVK A;  2VH3 A;  4LLE A;  1EA8 A;  2GFH A;  2G3K A;  1MQV A;  3Q7L A;  5BUO A;  4FWV A;  2Z15 A;  4CS9 A;  5DVW A;  3LLK A;  2MHR A;  4EBJ A;  2J0W A;  3KYJ A;  2HSQ A;  2HJ3 A;  4XEK A;  3W8H A;  2AP3 A;  1XZP A;  1Y6D A;  1ZHW A;  5KYY B;  4FES A;  2A6E F;  3PCV A;  1M2V A;  2Q00 A;  3MFN A;  2H7B A;  1O3U A;  1HY5 A;  2NSG A;  4U9E A;  4BJ5 A;  1OXK A;  2QUP A;  4JKV A;  4O7G A;  1F1M A;  3T6J A;  3MYI A;  4OD4 A;  1SMY F;  1VOM A;  2P61 A;  1IZM A;  3HLZ A;  1XWJ A;  2HMQ A;  3BEH A;  1NZE A;  5EK0 A;  2PNO A;  2XL4 A;  4HFK B;  4MVZ A;  1E83 A;  2ZXR A;  2L9J A;  3C63 A;  3S29 A;  4CBE A;  4WGY A;  2OG2 A;  3C62 A;  4GYT A;  4J7Y A;  1OCC C;  3ZG1 A;  2EIK C;  3LS1 A;  4Z9I A;  2XRH A;  4XPX A;  3VAY A;  2IXN A;  4C7O B;  5JP7 A;  2DGJ A;  4XEF A;  2LK4 A;  5F28 E;  2GA0 A;  3U3F A;  3FOP A;  4JCZ A;  2X51 A;  2L7A A;  2IBF A;  2M4E A;  5IY5 C;  1V74 B;  5A69 A;  1J8Y F;  1ZHZ A;  2GAQ A;  3NMJ A;  4IAO A;  5DLJ A;  4CSA A;  2IXP A;  3M4C A;  2HUJ A;  3HTK C;  3TOL A;  3HNL A;  1J8M F;  3TD7 A;  1OQC A;  4O6N A;  1OCR C;  1E2X A;  1L7C A;  2XM0 A;  2J46 A;  1A7V A;  5B3S C;  1ZYR F;  2R7Q A;  1VMA A;  3AG4 C;  4W8K A;  2HMZ A;  2KW3 C;  5AC5 A;  1BR1 A;  2P1A A;  3LNM B;  4AX2 A;  1M2V B;  1OW6 A;  1NU9 C;  1JAF A;  1C17 M;  4A4A A;  2EPM X;  5KYW B;  2LFF A;  3FAP B;  3ABK C;  3FOO A;  5A6B D;  5L0F A;  1VYI A;  3EG9 A;  2MYS A;  2EPK X;  2R7S A;  2NG1 A;  3ITF A;  1FR0 A;  1JR8 A;  2A6H F;  4CX9 A;  3CQZ A;  1RKE B;  2J9U A;  2FGY A;  2O9X A;  3UGP A;  4U5F E;  1TWA A;  1ST6 A;  4KNW A;  1PD1 A;  3JYH A;  1HW1 A;  1M2O A;  4NTF A;  2NSF A;  3NYJ A;  4Q7C A;  3RIP A;  3SZR A;  5JLI A;  4PJM A;  2G62 A;  5E3A A;  3EFO B;  4E7S A;  1OR3 A;  1M57 C;  1GM5 A;  1K40 A;  4I3M A;  3DWW A;  2EPN A;  3U5S A;  4YWQ A;  1D1A A;  1YZC A;  3C8G D;  3KYI A;  5AC4 A;  1C03 A;  1A41 A;  3K1I A;  4MVQ A;  3U2L A;  5L3Q A;  4G7Z F;  3M15 A;  2V3C C;  2A68 F;  3JRM O;  1H7I A;  2XXA B;  2C04 A;  3MYF A;  5L0D A;  3E9V A;  1D1B A;  4U5G A;  3V5Y A;  1UFB A;  1YYX A;  3M1C B;  1HMO A;  5D92 A;  3RH3 A;  3K66 A;  1NG1 A;  2DB4 A;  3OWT A;  5DQT A;  1PD0 A;  3EHM A;  4PR9 A;  3IQ6 A;  4YT8 A;  2P0N A;  1G4U S;  2L81 A;  3QTH A;  3ZQV A;  1EQ1 A;  3EH1 A;  1LVK A;  2OJQ A;  3S27 A;  2NUP A;  3DAG A;  4KC9 A;  5COM A;  4CIH A;  1MMN A;  1KTM A;  1GQA A;  1BR2 A;  2PBE A;  1LPE A;  1U89 A;  5A6B A;  1RMV A;  2XLW A;  2V26 A;  1XZQ A;  3RW0 A;  1HW2 A;  3ZVR A;  5KYN A;  4E7Z A;  2ETS A;  3VYW A;  3I5P A;  3VM6 A;  3ABM C;  3BRJ A;  1RKE A;  2D4U A;  2ZXW C;  4IWB A;  1V54 C;  1QPU A;  1Z5Z A;  2JX0 A;  4U5C E;  3H65 A;  3RFY A;  3POV A;  1OR2 A;  4E0H A;  4LAC B;  3HJC A;  1YVI A;  2CNW D;  2YL1 A;  4G0H A;  3FHD A;  5JUA A;  3C18 A;  1WWP A;  4CSA C;  3KMI A;  5COF A;  5CI9 A;  2UUI A;  5COG A;  2OJE D;  3S28 A;  1K05 A;  5A6A A;  1LS4 A;  4OIP F;  4J32 B;  3B0U X;  1YA9 A;  2QE9 A;  2AWC A;  2YL7 A;  4HE8 D;  5F5H A;  4BJ5 C;  3JTL O;  1RJ9 A;  3R2P A;  3T9O A;  3U0C A;  2XL8 A;  3RQE A;  2BL2 A;  3TK0 A;  3FVY A;  2TMV P;  5CI8 A;  1FNT c;  4W8P A;  2ASR A;  4MVM A;  3EHN A;  2Y3H A;  3F46 A;  1D0X A;  2NUP B;  3I5Q A;  2DYS C;  3C8Z A;  3V5Z A;  4B6I A;  2CDQ A;  3DJN B;  3IEE A;  4OIQ F;  5D91 A;  1GS9 A;  4CJG A;  2Q9B A;  3AOU A;  1NFO A;  3HNK A;  4NTB A;  4AE4 B;  3JCU Q;  1QLE C;  2IXM A;  1QSP A;  5CIV A;  5B1A C;  1E84 A;  4U5D E;  4U5B E;  3TQO A;  3EZH A;  2VCC A;  3E70 C;  5KYX B;  1WAT A;  2KGO A;  2ZD9 A;  4JRZ A;  3T6B A;  3F47 A;  4P6I C;  4JJG A;  1LI5 A;  4JEB A;  4J30 B;  5BQI A;  3K1H A;  1AVO B;  1OW8 A;  4DVZ A;  5FZT A;  1RXQ A;  5DS6 A;  1BBH A;  4PFO A;  4YL3 A;  2R03 A;  3O6X A;  1NSG B;  4EIY A;  2NUT B;  3B9Q A;  4DRI B;  4D4N A;  3LES A;  2EIL C;  3O55 A;  1S05 A;  1LE2 A;  2AU5 A;  2CGE A;  2L6F A;  1ZHY A;  2UUH A;  3ABL C;  2P6V A;  3LAY A;  4MVO A;  4WJ0 A;  2I15 A;  3SP1 A;  5L0I A;  2GWW A;  2XLH A;  2J9W A;  4JCH A;  3RQF A;  2QNL A;  1MMA A;  1CPQ A;  4YT4 A;  2LQG A;  2WVN A;  3LNR A;  4GEH A;  2KNH A;  4EWC A;  1KNY A;  3B0V C;  1OXB A;  4KI2 A;  1Z23 A;  3L0I A;  1VLS A;  3ASO C;  3M79 A;  3NDB B;  2YLG A;  5A6K A;  4DJ9 A;  2R7T A;  2WVQ A;  1MNE A;  4NQF A;  2EIM C;  2OU6 A;  2J9B A;  2RSE B;  4IGG A;  3AGT A;  1I4Z A;  3DXJ F;  2W4M A;  2R7U A;  1WOL A;  3CEX A;  4MW3 A;  1U6H A;  2F22 A;  4Q4Z F;  4Q5S F;  3EGD B;  4KBL A;  2A1D D;  3S84 A;  4O79 A;  1GGQ A;  2X0C A;  4Z9H A;  2QY9 A;  4AL0 A;  2LD6 A;  3N2Z B;  2E87 A;  1FMW A;  3X1O A;  4J7T A;  1CGM E;  2CYD A;  2W45 A;  3L1M A;  1WTY A;  1EI7 A;  2LIG A;  2RD9 A;  3UMI A;  2R7V A;  4ULV A;  1VTM P;  2Q9C A;  2R7O A;  4E18 A;  3H2U A;  3A11 A;  5B3I A;  1LI7 A;  2WZL A;  2J7P D;  2OOC A;  3EPV A;  3GM3 A;  4CS8 A;  5A6J A;  3JRT A;  3AQB A;  4LER A;  1D0Y A;  4EHP A;  2ZXP A;  3B0P A;  4XLN F;  2OEV A;  4K1O A;  1TFK B;  4IAR A;  1BDJ B;  2PX0 A;  256B A;  2Q7R A;  3W8I A;  4BEJ A;  3ASN C;  4LDK A;  1PV3 A;  4U9D A;  4C3B A;  4BEM J;  3T4R A;  3LEV A;  2KSF A;  4ZLD A;  1FAP B;  1BZ4 A;  4EBB A;  2LSE A;  2HJM A;  1G5Z A;  1TWC A;  1OCO C;  2WVO A;  2YKZ A;  4PJN A;  2CCY A;  2C03 A;  4JTA B;  2W4B A;  2Q9A A;  3G4X A;  4XWJ A;  3VRC A;  1G8X A;  3S90 A;  4DBQ A;  1M56 C;  4MTF A;  2LCH A;  2IM8 A;  4C3E A;  1NBB A;  3G4Z A;  4YK5 A;  4CDA A;  4MS2 A;  5EHH A;  2XS8 A;  1VK5 A;  1V4A A;  2WL8 A;  5JSL A;  1JRA A;  1EKY A;  5JS5 A;  1WAS A;  2A0B A;  1B68 A;  2HZ8 A;  2OEX A;  4OD5 A;  1FMV A;  3V7O A;  3EGD A;  3JYY A;  3L8J A;  5E2Q A;  2ICW G;  1MMD A;  3U8P A;  3VF0 A;  4JE9 A;  4OIO F;  4GQH A;  4JVS A;  1TWG A;  4QDL A;  5T3W A;  2PX3 A;  2YL3 A;  4YN0 B;  1N1C A;  1E86 A;  4JEA A;  3ZTM A;  4G7O F;  1ORJ A;  3EGX A;  2L6G A;  3DZA A;  2GDC A;  3MBG A;  3O39 A;  5AGF A;  3AG2 C;  5E3C A;  4JTC B;  3RVZ A;  3RYL A;  4CJO A;  4CDY A;  1T6U A;  2LP4 A;  2LFD A;  3EFO A;  2VAS A;  5FCL A;  1W2W A;  3M4B A;  3B71 A;  4JZA A;  2R7W A;  3NMI A;  2XXA A;  1UG7 A;  3L34 A;  1YLM A;  5BQG A;  4YL1 A;  1TWH A;  4FX5 A;  3IHU A;  1T01 A;  2VB6 A;  3SXZ A;  2XLE A;  4XPW A;  2VCA A;  2XLM A;  3C7J A;  3ECS A;  3UMK A;  2CNW A;  4DVY P;  1FTS A;  1PCX A;  3DE8 A;  1R5I D;  3OA1 A;  3AQC A;  4H4K C;  4RD9 A;  3MX3 A;  5JT4 A;  1TFO B;  4CIP A;  4PFP A;  3UGO A;  3EJN A;  3KH2 A;  1LM3 B;  2Y3B A;  3FMS A;  3AG1 C;  3CSK A;  3A9C A;  2R25 A;  4U5H A;  4UDV A;  1A0B A;  1YAR O;  2OCC C;  3WHN A;  4JW1 A;  4BJ1 A;  4DXW A;  4WAB A;  2YLD A;  2XLD A;  3FAJ A;  3U2M A;  5B1B C;  1Q0G A;  3TJ6 A;  4LLC A;  2H8A A;  1H9G A;  3AG3 C;  1ZHX A;  2WZG A;  4DRJ B;  2ZPA A;  4X0R A;  3EH2 A;  3RF3 A;  3LJB A;  3FXH A;  3X2Q C;  2VC9 A;  4XTK A;  1H6G A;  4N6C A;  5HSW A;  5F5F A;  3GEI A;  1Y4C A;  3GWN A;  2HV6 A;  2J7P A;  3TJ5 A;  3U3B A;  3NKD A;  2YHS A;  3ZIB A;  2Y39 A;  3DM9 B;  1ZHT A;  3GAN A;  2XS1 A;  1OCZ C;  1L3P A;  4XEV A;  2JPU A;  5GPG B;  3US6 A;  4FAP B;  3S0X A;  4N06 A;  3G50 A;  1QQ3 A;  3MLG A;  4N4W A;  4P9T A;  2FFH A;  4CS7 A;  5DS4 A;  4C7O A;  4NCQ A;  1O87 A;  1MMG A;  5L0J A;  4JIO A;  2J9V A;  2KJG A;  4NY3 A;  2ZXO A;  5EGY A;  2J8W A;  1LKX A;  3W2W A;  2QLA A;  1RJ9 B;  3K6B A;  2YQY A;  2YRF A;  1HE9 A;  3NRH A;  4ER9 A;  3PDM P;  2HV7 A;  1FFT C;  1YYJ A;  3C8G A;  2IXO A;  2Y3D A;  1Z6A A;  5TJ5 E;  5DQZ A;  4XLP F;  4OIN F;  3IPM O;  3SXM A;  4BPM A;  2BC5 A;  3RKO F; 
#chains in the Genus database with same CATH homology
 1YZA A;  3QVZ A;  3L1M A;  2XL6 A;  4ULV A;  1CPR A;  5B3I A;  3IQ6 A;  3TOM A;  2XLV A;  2XM4 A;  4IAQ A;  4IAR A;  3ZQV A;  256B A;  4CDV A;  3QW0 A;  4U9D A;  1GQA A;  3ZQY A;  2XLW A;  1CGN A;  2YKZ A;  1M6T A;  2CCY A;  1QPU A;  3VRC A;  3ZTZ A;  1MQV A;  3ZWI A;  1CGO A;  1NBB A;  4CDA A;  2YL1 A;  5JSL A;  4D4X A;  5JUA A;  1EKY A;  5JS5 A;  4WGZ A;  4U9E A;  3QVY A;  2YL7 A;  4JKV A;  4NC3 A;  2XL8 A;  1RCP A;  3U8P A;  3QW1 A;  4JE9 A;  5JRA A;  1E83 A;  4IB4 A;  3C63 A;  2YL3 A;  4WGY A;  1E86 A;  4JEA A;  3ZTM A;  3C62 A;  2YLI A;  5AGF A;  4CJG A;  4CJO A;  3HNK A;  5JP7 A;  4CDY A;  3NMK A;  3FOP A;  3M4B A;  1E84 A;  3NMI A;  3NMJ A;  3HNI A;  3HNJ A;  3M4C A;  3TOL A;  2XLE A;  3HNL A;  2XLM A;  4JEB A;  2XM0 A;  1A7V A;  3DE8 A;  1BBH A;  2XLO A;  4N6H A;  4CIP A;  5JT4 A;  4EIY A;  2YL0 A;  1JAF A;  1LM3 B;  4D4N A;  1S05 A;  3FOO A;  2YLD A;  2XLD A;  2XLH A;  1APC A;  1E85 A;  1CPQ A;  4CX9 A;  4L6R A;  5JLI A;  3M79 A;  2YLG A;  2J9B A;  1QQ3 A;  4N4W A;  1YZC A;  3DE9 A;  3M15 A;  2J8W A;  2QLA A;  4ER9 A;  3IQ5 A;  1YYJ A;  1YYX A;  2BC5 A;  5JVE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...