2YL3A

Cytochrome c prime from alcaligenes xylosoxidans: carbon monooxide bound l16g variant at 1.04 a resolution - restraint refined
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSAGTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Carbon Monoxide Poisoning is Prevented by the Energy Costs of Conformational Changes in Gas- Binding Haemproteins.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
molecule keywords CYTOCHROME C'
total genus 51
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2011-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2yl3A00
1JAFA 3HNKA 4CJGA 3HNIA 4NC3A 1CPRA 2XLMA 4EIYA 4JKVA 3DE9A 4L6RA 4CX9A 2XL8A 3ZQVA 2BC5A 4CDVA 4U9DA 2QLAA 3ZWIA 1EKYA 1QQ3A 5JVEA 1E84A 1YYXA 3DE8A 3QW0A 3HNLA 4WGZA 4D4XA 5JT4A 3NMKA 1S05A 4CIPA 2XLDA 4CJOA 1MQVA 3IQ5A 2J8WA 5JS5A 256BA 1CGOA 2YL3A 3FOPA 2YLDA 3IQ6A 2XLVA 2YL1A 4ULVA 4CDAA 1NBBA 3TOLA 3M4CA 3ZQYA 2YKZA 3C62A 3U8PA 1E86A 1RCPA 1A7VA 4N4WA 1YZCA 1APCA 3ZTMA 4IAQA 1QPUA 3L1MA 1CGNA 3M4BA 3NMIA 5AGFA 2CCYA 3NMJA 4ER9A 3TOMA 2YL7A 4JEBA 5B3IA 4JEAA 1E83A 4D4NA 2YL0A 2XLEA 5JUAA 3ZTZA 1M6TA 2YLIA 1YZAA 2YLGA 2J9BA 3M15A 2XM4A 3M79A 4IB4A 2XL6A 4CDYA 5JLIA 3QW1A 1GQAA 1LM3B 2XLWA 5JRAA 1YYJA 2XLOA 2XLHA 3C63A 4IARA 4JE9A 4U9EA 3HNJA 4WGYA 3FOOA 1E85A 5JP7A 3QVYA 1BBHA 3VRCA 2XM0A 4N6HA 3QVZA 5JSLA 1CPQA
chains in the Genus database with same CATH superfamily
3EJNA 1KTMA 2NUTB 3MFNA 3Q7GA 4HEAJ 3SEOA 4MW8A 5F28E 5A6BD 3DE9A 4W8PA 4RD9A 1OXBA 1O3UA 4AE4B 1CGME 3E70C 1OKKD 1Q0DA 4OIQF 3E9VA 2XS1A 4IGGA 5E3AA 4YL0A 3R7CA 2Q00A 3ZWIA 5DS5A 4P9TA 2J7PA 5KYYA 2DYRC 1W2WA 1HMOA 3CSKA 4MVRA 1RKEB 1Y4CA 2C04A 3B9QA 3JRMO 4RDAA 4U5DE 1R5ID 5CI8A 5JVEA 2HJMA 3JRTA 4NQFA 5A69A 2B0HA 4YT4A 1Z7Qc 1U89A 4YJWA 5HV9A 4C7OB 3HNLA 4C3EA 2P1AA 3AJMA 2W9YA 4E0HA 2EIKC 1H6GA 2VC9A 3L34A 1T01A 1YJGA 3CAXA 3DXJF 3QMKA 2EILC 1ORJA 2Q9AA 2IXOA 1MNDA 4DRIB 4MVMA 5L3VA 1BR4A 2XLDA 4P9FA 3S27A 1ZHZA 2YQYA 1U0BB 2NUPB 1LS4A 2H8AA 4IWBA 2NG1A 1D0ZA 1HW2A 4CS8C 3LLKA 5T3TA 3SXZA 2OEXA 2OJQA 4YK5A 5BQGA 3ASOC 4J7YA 3ZG1A 1LI5A 2MWQA 5L0IA 3EFOB 4GEHA 3TJ5A 2Y3DA 4JCZA 4JJFA 4OD5A 3ATPA 4PACA 1OW6A 2WVOA 3FVYA 1ST6A 1JOGA 4ULVA 4WJ0A 3U3BA 3RKOF 4ANJA 3TOLA 2HV6A 4IAOA 2Q3TA 1VLSA 2OOCA 2YKZA 3C62A 1NZEA 1PCXA 3K7DA 3O39A 4G0HA 2VH3A 5COGA 1WGWA 2OU6A 3FAPB 4N6CA 3U5SA 4CS7A 2NUTA 4E0IA 3ABKC 2LCHA 1LS1A 3VAYA 3US6A 5TJ5E 1H7IA 1APCA 3ZTMA 2R03A 3KYIA 2IBFA 3RH3A 5L0HA 4XPWA 1SYQA 3T6BA 1L3PA 1QPUA 2LSEA 1D1AA 4O7GA 3NRHA 1VTMP 2EPOA 1JRAA 3B29A 4JURI 4B6IA 5EGYA 4P6IC 5AGFA 3HLZA 3EG9B 1PD0A 4E7SA 2JPUA 5B1AC 2YZSA 5DS4A 3W8IA 2R7UA 2J0WA 3LNRA 5D91A 2BL2A 2GA0A 4JEAA 3JSZA 3OWTA 5F5FA 3H2UA 1MNEA 3Q6MA 2ZXRA 3RQFA 3ABMC 2XLEA 1LE4A 2HSBA 1VK5A 4J32B 3ZTZA 3KYJA 2YLIA 1WWPA 4MTFA 1YZAA 4FWVA 2J9BA 3LESA 3AOUA 3M79A 2HV7A 3J06A 1YARO 1G8XA 4LDQA 3K1IA 4CDYA 4BJ6C 4CS9C 3IEEA 2V26A 2AWYA 2L9JA 2RSEB 3JTLO 3WAQA 1A7DA 3DJUB 3U3FA 4YWQA 5L0GA 3MYIA 4Z9JA 4W8KA 4MNDA 3POVA 4EBJA 4JJGA 1TFKB 3VM6A 4G7ZF 4IARA 3K66A 2E87A 1DOVA 4NY3A 4WABA 3U0CA 2XXAA 3GM3A 5GPGB 2H7OA 1U6HA 2EIJC 2R25A 4C3BA 1TWHA 4K1OA 3IQCA 2ZXPA 5KYYB 1WN0A 3EHMA 3U8VA 2CDQA 3PMRA 4LLCA 1S7ZA 1RKCA 4KNVA 4JC7A 5JP7A 1LI7A 3QVYA 2LIGA 4N6HA 3QVZA 4DRHB 1CPQA 3GM2A 1VMAA 3H65A 3HNKA 3EZIA 4YL1A 3SXMA 3HNIA 1G4WR 2P6VA 1Q0KA 4CJGA 3ZDLA 3TQOA 1CPRA 2XLMA 5KYNA 3LAYA 2Y3BA 2R7QA 4CX9A 4ONSA 2G3VA 3I5QA 2XL8A 3Q6NA 3ZQVA 1G4US 1V54C 1JPNA 4PJJA 4CDVA 1FFTC 3GWNA 1SR2A 4MQ9F 4KNWA 1QQ3A 4DOZA 3W8HA 1MMAA 3EQLF 4N06A 1C02A 4EKWA 1M2VA 4ZLDA 2R7OA 3UMHA 5L0JA 3CZ6A 4YN0B 1YYXA 3JYYA 3GEHA 3U9MA 3BRJA 4EUKB 3QW0A 2KQ9A 4MW3A 4G7HF 2HMQA 4U5FE 2OCCC 2ZXWC 2FFHA 2GWWA 3RQEA 1KU2A 3RW0A 4LERA 3NYMA 3SP1A 4G7OF 1BR2A 3NYJA 5E33A 5L3QA 1JMWA 3NMKA 2UUIA 5IY5C 3FXHA 3GM1A 4CIPA 2HUJA 4DRJB 2R7RA 2M4EA 1MQVA 2X0CA 2KGOA 2WVNA 2OEVA 3KMIA 1NU9C 1ZU5A 2YL3A 2Q7RA 5A6BA 1H9TA 1GGQA 3IPMO 4NCQA 4O79A 3B0PA 1SZIA 2WL8A 3QZCA 3UR3C 4AL0A 3VYWA 1T6UA 5A6KA 3WG7C 2YL1A 4PJNA 4NTAA 5T1DB 4JW1A 4U5HA 2KK1A 2PF4E 4PR9A 3PCVA 1NBBA 2A0UA 2IM8A 4U5GA 3C18A 3ZQYA 3K33A 1D1BA 2HZ8A 3MX3A 1UG7A 4QDLA 2YVKA 3GWLA 4XQ1A 5DLJA 1JPJA 1T6IA 4GQHA 1E86A 4IRUA 4RBNA 1FAPB 4PFOA 1XZQA 1RCPA 1A7VA 5KYWB 3AG3C 2CYDA 1ZHWA 3TD7A 2HS5A 4EBBA 3SXYA 3BEHA 3EGDA 3AQBA 1QKRA 1KNYA 3AGTA 5L0DA 1I4YA 4OD4A 3U9JA 2MYSA 5KYWA 4QI0A 4XLNF 4OIRF 2CCYA 3NMJA 2H7VC 4ER9A 2AP3A 4XEKA 2EPMX 3WHNA 1J8MF 1O5HA 1AEPA 2L6HA 1FFHA 2L81A 3L8JA 4KC9A 3B0UX 1NG1A 2DYSC 3L8IA 3NKDA 2R7SA 3C8ZA 1ORYA 4D4NA 1J8YF 2YL0A 1ZZPA 3LS1A 2LFDA 2WZLA 4J30B 5KYXA 2J46A 2IXNA 2GFHA 3O6XA 2ZD9A 1C17M 5KYUA 4A2NB 4CIHA 3K1HA 2OKUA 2XL6A 4Q4ZF 2XRHA 3EHNA 3TJ6A 1OR3A 1FNTc 1FTSA 4O6NA 1GQAA 4ZLCA 1LM3B 1YVIA 1T6QA 3C7JA 5JRAA 1MMDA 2IXMA 2R9RB 1FR0A 3GODA 2XLOA 4MS2A 1EQ1A 4MVZA 2KYHA 2KSFA 3DI5A 4XPXA 5CIVA 1BZ4A 3CEXA 4BJTA 1LVKA 3PHF2 1VLTA 3OEOA 3T4RA 4U9EA 2L6FA 1OW8A 1WASA 4Q5SF 1M2VB 2QE9A 4AL1A 4KI2A 4PJMA 4DJ9A 4A4AA 4WGYA 4E17A 2L6GA 3LEOA 1B68A 1OQCA 1ZHTA 1Z3IX 1XZPA 4ULWA 1BBHA 5A6AA 2J7PD 2IOQA 1ZU4A 1V74B 1NFOA 1ORSC 3DMDA 3IQTA 1ZVZA 4Z9IA 1JAFA 4YT8A 2A1DD 1OCOC 1OKKA 3G4XA 2H7BA 4E7ZA 4F4BA 1D1CA 3EZHA 4NC3A 1V55C 2J0XA 3B71A 2VCBA 3JSEO 4JKVA 4L6RA 1K40A 3DM5A 4MVUA 4BEJA 3NYLA 2ICWG 5EHHA 1GM5A 4O6YA 3EGXB 1VYKA 2VCCA 1RMVA 1WTYA 4DVZA 3Q7LA 1YLMA 1NLXA 5F5HA 2PP4A 3JYHA 4LLEA 2NPUA 4U5EE 5COFA 2W4BA 3F46A 5BQIA 1E84A 3I5PA 1AUEA 1RKEA 3LUTB 3V5YA 1TKNA 3S90A 3LNMB 2R7TA 4DBQA 4WGZA 3T6JA 4NTFA 5KYUB 3ZSUA 2CGEA 1G5ZA 4H4KC 2I8BA 5JT4A 2GDCA 4XEVA 2OJED 4MVOA 4Z9HA 2HKVA 2PX0A 4AE4A 3OA1A 3LJBA 3EG9A 4CJOA 3IQ5A 4EHPA 2J8WA 5JS5A 256BA 4FX5A 1VYIA 1K05A 3FOPA 1YA7O 2YLDA 4KBLA 1M2OA 2XS8A 4U5BE 3IQ6A 3UMKA 3RQGA 2EINC 2XLVA 3DAFA 3RYLA 1V4AA 3ZVRA 3EH1A 3S84A 3DJNB 4BJ5A 1A41A 3GEEA 1ZHYA 2EPNA 5K0IA 4CDAA 1Z5ZA 2QNLA 1OW7A 1Q0GA 4PJLA 5KYXB 3W2VA 4CBEA 4R32A 4HFKB 4XLPF 3U8PA 2JX0A 4BJ5C 4DXWA 2PFDA 2J9UA 1JR8A 1LE2A 1NSGB 1Z23A 4N4WA 4O6MA 2Y3HA 1QZXA 3O55A 2XSEA 2DI3A 1O87A 4EBKA 3L1MA 1I4ZA 1CGNA 3JCUQ 3AG2C 3NMIA 4I1MA 2I15A 1OXKA 4MVSA 2FGYA 3EH2A 2ZXOA 3R2PA 2OG2A 2ETSA 1TR2A 2M64A 3TOMA 3W2WA 2EPLX 2A6HF 2LK4A 2YL7A 3C8GD 4I44A 1NFNA 2AVKA 5CI9A 1NU7D 2W4MA 4JTCB 3HJCA 3M1CB 2RD9A 4JZAA 1DOWA 1E83A 1BR1A 2QUPA 3C8GA 5DQZA 1M6TA 1I5NA 3ECSA 1Q0MA 2G62A 3N2ZB 4G78A 3V7OA 1SF8A 2YLGA 1E2XA 4IB4A 2AWCA 3HTKC 3EGXA 3S29A 4BG0A 3S0XA 3G4ZA 2P7VA 3N0TA 3EPVA 4J7TA 1XWJA 3EGDB 3K1IC 4YL3A 5D92A 3SZRA 2AU5A 2YHSA 2O9XA 4BPMA 1YYJA 2IXPA 2XLHA 4C7OA 2J45A 3L0IA 2F22A 1SMYF 1OR2A 2NSGA 4JRZA 4XEFA 3V5ZA 2P61A 1Z63A 1VB5A 2A68F 4XTKA 1TFOB 1IW7F 1TWAA 1QLEC 4U5CE 2YEVA 2TMVP 3HNJA 2YRFA 1FMWA 3LS0A 4H54A 2DB4A 3AQCA 3KKBA 4JVSA 1E85A 1A7EA 2JD3A 2WVQA 2Y69C 3VRCA 2XM0A 4AX2A 3KPHA 2KJGA 2B0JA 2OQMA 3VF0A 2FAPB 3MLGA 3ZIBA 2Q9CA 3TK0A 2R02A 2L7AA 3RVYA 1LPEA 3UGOA 1R4TA 1F1MA 2QY9A 4EWCA 1HE9A 3A9CA 4X0RA 4XWJA 1LIHA 3ABLC 4Q7CA 3X2QC 1ZW3A 4DVYP 2BC5A 1RXQA 3KH2A 4K0DA 4U9DA 2QLAA 2EIMC 1Q0FA 2NUPA 1EKYA 3JT1A 1OCCC 2ZPAA 1PD1A 4LACB 3SYNA 4CSAC 5BUOA 4OINF 3H2VA 3SXKA 3KL4A 1OCZC 3DE8A 3T6GB 2R7VA 4BJ6A 4CS9A 4FESA 1MMNA 4QI2A 5COMA 1D0YA 1ZHXA 3AG4C 3LLIA 4HE8D 3T9OA 4D4XA 4EIYA 5A6JA 5L0CA 4UDVA 2BE5F 3FHDA 2PNOA 1TWGA 5DVWA 3AG1C 4DBRA 1S05A 2P0NA 4YT2A 2WZFA 3DKAA 2KNHA 1CGOA 2C03A 2CW0F 3NG1A 1D0XA 1EI7A 2LFFA 5E2QA 2VB6A 1L7CA 2J9VA 2Y39A 1GS9A 1UFBA 3O10A 3RF3A 4JTAB 4IJJA 4C3DA 3S9OA 1T5OA 3B0VC 2D5RB 2CNWA 2J9WA 3SNHA 4I1OB 3GORA 3DAGA 1RJ9A 5AC5A 3FDQA 3DWWA 2HFIA 1N1CA 3RIPA 4K7BA 2Y3GA 4JCHA 2PBEA 3M4CA 3X1OA 3C8GB 2PX3A 3DZAA 2XXAB 1YA9A 2R05A 2MHRA 3S28A 5FCLA 3LEVA 3RFYA 2UUHA 3K6BA 2LD6A 3MYFA 4MVQA 4JIOA 3DM9B 4AK9A 1IZMA 2D4UA 1YZCA 1WOLA 4MTGA 3ITFA 2XL4A 4IAQA 3JZ0A 1QVXA 1HE1A 2KW3C 1TWCA 2LP4A 3GANA 3N24A 3G50A 3U2LA 4NTBA 4CS8A 4CSAA 2WZGA 3M4BA 3F47A 2IYLD 3GEIA 4M63A 1M56C 1HY5A 5BQHA 4BJ1A 3FAJA 4PK4A 4MTOA 4OIPF 2HJ3A 2G3KA 1EA8A 3UGPA 1ZYRF 2ASRA 4JEBA 3IHUA 5B3IA 2X51A 1MMGA 1Y6DA 4I3MA 3WODF 2A6EF 2Z15A 2R7WA 1H9GA 2QTVA 1QSPA 2GAQA 4HFFB 2A69F 1K04A 4LDKA 5JUAA 1Z6AA 5T3WA 3TULA 3W4YA 2DGJA 5B1BC 1AVOB 1BDJB 3V5XA 2XM4A 1HW1A 3A11A 3M15A 3UMIA 4LDRA 4PFPA 1ZW2A 1C03A 2NSFA 2Q4FA 3U2MA 3NKEA 5JLIA 5DS6A 3AGUA 4OIOF 3CQZA 1VOMA 3QW1A 1PV3A 4E18A 5DQTA 5FZTA 2R7XA 5EK0A 3DD7A 3ZC4A 2A0BA 3PDMP 3HKKA 3UNGC 2XLWA 1YDIA 4FAPB 1M57C 2VASA 1T9KA 3I4UA 1HMDA 2WB7A 1RJ9B 3C63A 3RVZA 3FMSA 3NDBB 2HSQA 4GYTA 4JE9A 4BEMJ 4XPYA 2KC3A 1FMVA 2VCAA 3ASNC 2HMZA 5HSWA 2CNWD 4YT5A 2EPKX 1YAUO 2Q9BA 1LKXA 3FOOA 1A0BA 2YWAA 3EFOA 5E3CA 5AC4A 3MBGA 2V3CC 5L0FA 3QTHA 1OCRC 5B3SC 4JTDB 5JSLA 2W45A 1TQGA 2LQGA 1WATA
chains in the Genus database with same CATH topology
1JAFA 3HNKA 4CJGA 3HNIA 4NC3A 1CPRA 2XLMA 4EIYA 4JKVA 3DE9A 4L6RA 4CX9A 2XL8A 3ZQVA 2BC5A 4CDVA 4U9DA 2QLAA 3ZWIA 1EKYA 1QQ3A 5JVEA 1E84A 1YYXA 3DE8A 3QW0A 3HNLA 4WGZA 4D4XA 5JT4A 3NMKA 1S05A 4CIPA 2XLDA 4CJOA 1MQVA 3IQ5A 2J8WA 5JS5A 256BA 1CGOA 2YL3A 3FOPA 2YLDA 3IQ6A 2XLVA 2YL1A 4ULVA 4CDAA 1NBBA 3TOLA 3M4CA 3ZQYA 2YKZA 3C62A 3U8PA 1E86A 1RCPA 1A7VA 4N4WA 1YZCA 1APCA 3ZTMA 4IAQA 1QPUA 3L1MA 1CGNA 3M4BA 3NMIA 5AGFA 2CCYA 3NMJA 4ER9A 3TOMA 2YL7A 4JEBA 5B3IA 4JEAA 1E83A 4D4NA 2YL0A 2XLEA 5JUAA 3ZTZA 1M6TA 2YLIA 1YZAA 2YLGA 2J9BA 3M15A 2XM4A 3M79A 4IB4A 2XL6A 4CDYA 5JLIA 3QW1A 1GQAA 1LM3B 2XLWA 5JRAA 1YYJA 2XLOA 2XLHA 3C63A 4IARA 4JE9A 4U9EA 3HNJA 4WGYA 3FOOA 1E85A 5JP7A 3QVYA 1BBHA 3VRCA 2XM0A 4N6HA 3QVZA 5JSLA 1CPQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JAF A;  3HNK A;  4CJG A;  3HNI A;  4NC3 A;  1CPR A;  2XLM A;  4EIY A;  4JKV A;  3DE9 A;  4L6R A;  4CX9 A;  2XL8 A;  3ZQV A;  2BC5 A;  4CDV A;  4U9D A;  2QLA A;  3ZWI A;  1EKY A;  1QQ3 A;  5JVE A;  1E84 A;  1YYX A;  3DE8 A;  3QW0 A;  3HNL A;  4WGZ A;  4D4X A;  5JT4 A;  3NMK A;  1S05 A;  4CIP A;  2XLD A;  4CJO A;  1MQV A;  3IQ5 A;  2J8W A;  5JS5 A;  256B A;  1CGO A;  2YL3 A;  3FOP A;  2YLD A;  3IQ6 A;  2XLV A;  2YL1 A;  4ULV A;  4CDA A;  1NBB A;  3TOL A;  3M4C A;  3ZQY A;  2YKZ A;  3C62 A;  3U8P A;  1E86 A;  1RCP A;  1A7V A;  4N4W A;  1YZC A;  1APC A;  3ZTM A;  4IAQ A;  1QPU A;  3L1M A;  1CGN A;  3M4B A;  3NMI A;  5AGF A;  2CCY A;  3NMJ A;  4ER9 A;  3TOM A;  2YL7 A;  4JEB A;  5B3I A;  4JEA A;  1E83 A;  4D4N A;  2YL0 A;  2XLE A;  5JUA A;  3ZTZ A;  1M6T A;  2YLI A;  1YZA A;  2YLG A;  2J9B A;  3M15 A;  2XM4 A;  3M79 A;  4IB4 A;  2XL6 A;  4CDY A;  5JLI A;  3QW1 A;  1GQA A;  1LM3 B;  2XLW A;  5JRA A;  1YYJ A;  2XLO A;  2XLH A;  3C63 A;  4IAR A;  4JE9 A;  4U9E A;  3HNJ A;  4WGY A;  3FOO A;  1E85 A;  5JP7 A;  3QVY A;  1BBH A;  3VRC A;  2XM0 A;  4N6H A;  3QVZ A;  5JSL A;  1CPQ A; 
#chains in the Genus database with same CATH topology
 3EJN A;  1KTM A;  2NUT B;  3MFN A;  3Q7G A;  4HEA J;  3SEO A;  4MW8 A;  5F28 E;  5A6B D;  3DE9 A;  4W8P A;  4RD9 A;  1OXB A;  1O3U A;  4AE4 B;  1CGM E;  3E70 C;  1OKK D;  1Q0D A;  4OIQ F;  3E9V A;  2XS1 A;  4IGG A;  5E3A A;  4YL0 A;  3R7C A;  2Q00 A;  3ZWI A;  5DS5 A;  4P9T A;  2J7P A;  5KYY A;  2DYR C;  1W2W A;  1HMO A;  3CSK A;  4MVR A;  1RKE B;  1Y4C A;  2C04 A;  3B9Q A;  3JRM O;  4RDA A;  4U5D E;  1R5I D;  5CI8 A;  5JVE A;  2HJM A;  3JRT A;  4NQF A;  5A69 A;  2B0H A;  4YT4 A;  1Z7Q c;  1U89 A;  4YJW A;  5HV9 A;  4C7O B;  3HNL A;  4C3E A;  2P1A A;  3AJM A;  2W9Y A;  4E0H A;  2EIK C;  1H6G A;  2VC9 A;  3L34 A;  1T01 A;  1YJG A;  3CAX A;  3DXJ F;  3QMK A;  2EIL C;  1ORJ A;  2Q9A A;  2IXO A;  1MND A;  4DRI B;  4MVM A;  5L3V A;  1BR4 A;  2XLD A;  4P9F A;  3S27 A;  1ZHZ A;  2YQY A;  1U0B B;  2NUP B;  1LS4 A;  2H8A A;  4IWB A;  2NG1 A;  1D0Z A;  1HW2 A;  4CS8 C;  3LLK A;  5T3T A;  3SXZ A;  2OEX A;  2OJQ A;  4YK5 A;  5BQG A;  3ASO C;  4J7Y A;  3ZG1 A;  1LI5 A;  2MWQ A;  5L0I A;  3EFO B;  4GEH A;  3TJ5 A;  2Y3D A;  4JCZ A;  4JJF A;  4OD5 A;  3ATP A;  4PAC A;  1OW6 A;  2WVO A;  3FVY A;  1ST6 A;  1JOG A;  4ULV A;  4WJ0 A;  3U3B A;  3RKO F;  4ANJ A;  3TOL A;  2HV6 A;  4IAO A;  2Q3T A;  1VLS A;  2OOC A;  2YKZ A;  3C62 A;  1NZE A;  1PCX A;  3K7D A;  3O39 A;  4G0H A;  2VH3 A;  5COG A;  1WGW A;  2OU6 A;  3FAP B;  4N6C A;  3U5S A;  4CS7 A;  2NUT A;  4E0I A;  3ABK C;  2LCH A;  1LS1 A;  3VAY A;  3US6 A;  5TJ5 E;  1H7I A;  1APC A;  3ZTM A;  2R03 A;  3KYI A;  2IBF A;  3RH3 A;  5L0H A;  4XPW A;  1SYQ A;  3T6B A;  1L3P A;  1QPU A;  2LSE A;  1D1A A;  4O7G A;  3NRH A;  1VTM P;  2EPO A;  1JRA A;  3B29 A;  4JUR I;  4B6I A;  5EGY A;  4P6I C;  5AGF A;  3HLZ A;  3EG9 B;  1PD0 A;  4E7S A;  2JPU A;  5B1A C;  2YZS A;  5DS4 A;  3W8I A;  2R7U A;  2J0W A;  3LNR A;  5D91 A;  2BL2 A;  2GA0 A;  4JEA A;  3JSZ A;  3OWT A;  5F5F A;  3H2U A;  1MNE A;  3Q6M A;  2ZXR A;  3RQF A;  3ABM C;  2XLE A;  1LE4 A;  2HSB A;  1VK5 A;  4J32 B;  3ZTZ A;  3KYJ A;  2YLI A;  1WWP A;  4MTF A;  1YZA A;  4FWV A;  2J9B A;  3LES A;  3AOU A;  3M79 A;  2HV7 A;  3J06 A;  1YAR O;  1G8X A;  4LDQ A;  3K1I A;  4CDY A;  4BJ6 C;  4CS9 C;  3IEE A;  2V26 A;  2AWY A;  2L9J A;  2RSE B;  3JTL O;  3WAQ A;  1A7D A;  3DJU B;  3U3F A;  4YWQ A;  5L0G A;  3MYI A;  4Z9J A;  4W8K A;  4MND A;  3POV A;  4EBJ A;  4JJG A;  1TFK B;  3VM6 A;  4G7Z F;  4IAR A;  3K66 A;  2E87 A;  1DOV A;  4NY3 A;  4WAB A;  3U0C A;  2XXA A;  3GM3 A;  5GPG B;  2H7O A;  1U6H A;  2EIJ C;  2R25 A;  4C3B A;  1TWH A;  4K1O A;  3IQC A;  2ZXP A;  5KYY B;  1WN0 A;  3EHM A;  3U8V A;  2CDQ A;  3PMR A;  4LLC A;  1S7Z A;  1RKC A;  4KNV A;  4JC7 A;  5JP7 A;  1LI7 A;  3QVY A;  2LIG A;  4N6H A;  3QVZ A;  4DRH B;  1CPQ A;  3GM2 A;  1VMA A;  3H65 A;  3HNK A;  3EZI A;  4YL1 A;  3SXM A;  3HNI A;  1G4W R;  2P6V A;  1Q0K A;  4CJG A;  3ZDL A;  3TQO A;  1CPR A;  2XLM A;  5KYN A;  3LAY A;  2Y3B A;  2R7Q A;  4CX9 A;  4ONS A;  2G3V A;  3I5Q A;  2XL8 A;  3Q6N A;  3ZQV A;  1G4U S;  1V54 C;  1JPN A;  4PJJ A;  4CDV A;  1FFT C;  3GWN A;  1SR2 A;  4MQ9 F;  4KNW A;  1QQ3 A;  4DOZ A;  3W8H A;  1MMA A;  3EQL F;  4N06 A;  1C02 A;  4EKW A;  1M2V A;  4ZLD A;  2R7O A;  3UMH A;  5L0J A;  3CZ6 A;  4YN0 B;  1YYX A;  3JYY A;  3GEH A;  3U9M A;  3BRJ A;  4EUK B;  3QW0 A;  2KQ9 A;  4MW3 A;  4G7H F;  2HMQ A;  4U5F E;  2OCC C;  2ZXW C;  2FFH A;  2GWW A;  3RQE A;  1KU2 A;  3RW0 A;  4LER A;  3NYM A;  3SP1 A;  4G7O F;  1BR2 A;  3NYJ A;  5E33 A;  5L3Q A;  1JMW A;  3NMK A;  2UUI A;  5IY5 C;  3FXH A;  3GM1 A;  4CIP A;  2HUJ A;  4DRJ B;  2R7R A;  2M4E A;  1MQV A;  2X0C A;  2KGO A;  2WVN A;  2OEV A;  3KMI A;  1NU9 C;  1ZU5 A;  2YL3 A;  2Q7R A;  5A6B A;  1H9T A;  1GGQ A;  3IPM O;  4NCQ A;  4O79 A;  3B0P A;  1SZI A;  2WL8 A;  3QZC A;  3UR3 C;  4AL0 A;  3VYW A;  1T6U A;  5A6K A;  3WG7 C;  2YL1 A;  4PJN A;  4NTA A;  5T1D B;  4JW1 A;  4U5H A;  2KK1 A;  2PF4 E;  4PR9 A;  3PCV A;  1NBB A;  2A0U A;  2IM8 A;  4U5G A;  3C18 A;  3ZQY A;  3K33 A;  1D1B A;  2HZ8 A;  3MX3 A;  1UG7 A;  4QDL A;  2YVK A;  3GWL A;  4XQ1 A;  5DLJ A;  1JPJ A;  1T6I A;  4GQH A;  1E86 A;  4IRU A;  4RBN A;  1FAP B;  4PFO A;  1XZQ A;  1RCP A;  1A7V A;  5KYW B;  3AG3 C;  2CYD A;  1ZHW A;  3TD7 A;  2HS5 A;  4EBB A;  3SXY A;  3BEH A;  3EGD A;  3AQB A;  1QKR A;  1KNY A;  3AGT A;  5L0D A;  1I4Y A;  4OD4 A;  3U9J A;  2MYS A;  5KYW A;  4QI0 A;  4XLN F;  4OIR F;  2CCY A;  3NMJ A;  2H7V C;  4ER9 A;  2AP3 A;  4XEK A;  2EPM X;  3WHN A;  1J8M F;  1O5H A;  1AEP A;  2L6H A;  1FFH A;  2L81 A;  3L8J A;  4KC9 A;  3B0U X;  1NG1 A;  2DYS C;  3L8I A;  3NKD A;  2R7S A;  3C8Z A;  1ORY A;  4D4N A;  1J8Y F;  2YL0 A;  1ZZP A;  3LS1 A;  2LFD A;  2WZL A;  4J30 B;  5KYX A;  2J46 A;  2IXN A;  2GFH A;  3O6X A;  2ZD9 A;  1C17 M;  5KYU A;  4A2N B;  4CIH A;  3K1H A;  2OKU A;  2XL6 A;  4Q4Z F;  2XRH A;  3EHN A;  3TJ6 A;  1OR3 A;  1FNT c;  1FTS A;  4O6N A;  1GQA A;  4ZLC A;  1LM3 B;  1YVI A;  1T6Q A;  3C7J A;  5JRA A;  1MMD A;  2IXM A;  2R9R B;  1FR0 A;  3GOD A;  2XLO A;  4MS2 A;  1EQ1 A;  4MVZ A;  2KYH A;  2KSF A;  3DI5 A;  4XPX A;  5CIV A;  1BZ4 A;  3CEX A;  4BJT A;  1LVK A;  3PHF 2;  1VLT A;  3OEO A;  3T4R A;  4U9E A;  2L6F A;  1OW8 A;  1WAS A;  4Q5S F;  1M2V B;  2QE9 A;  4AL1 A;  4KI2 A;  4PJM A;  4DJ9 A;  4A4A A;  4WGY A;  4E17 A;  2L6G A;  3LEO A;  1B68 A;  1OQC A;  1ZHT A;  1Z3I X;  1XZP A;  4ULW A;  1BBH A;  5A6A A;  2J7P D;  2IOQ A;  1ZU4 A;  1V74 B;  1NFO A;  1ORS C;  3DMD A;  3IQT A;  1ZVZ A;  4Z9I A;  1JAF A;  4YT8 A;  2A1D D;  1OCO C;  1OKK A;  3G4X A;  2H7B A;  4E7Z A;  4F4B A;  1D1C A;  3EZH A;  4NC3 A;  1V55 C;  2J0X A;  3B71 A;  2VCB A;  3JSE O;  4JKV A;  4L6R A;  1K40 A;  3DM5 A;  4MVU A;  4BEJ A;  3NYL A;  2ICW G;  5EHH A;  1GM5 A;  4O6Y A;  3EGX B;  1VYK A;  2VCC A;  1RMV A;  1WTY A;  4DVZ A;  3Q7L A;  1YLM A;  1NLX A;  5F5H A;  2PP4 A;  3JYH A;  4LLE A;  2NPU A;  4U5E E;  5COF A;  2W4B A;  3F46 A;  5BQI A;  1E84 A;  3I5P A;  1AUE A;  1RKE A;  3LUT B;  3V5Y A;  1TKN A;  3S90 A;  3LNM B;  2R7T A;  4DBQ A;  4WGZ A;  3T6J A;  4NTF A;  5KYU B;  3ZSU A;  2CGE A;  1G5Z A;  4H4K C;  2I8B A;  5JT4 A;  2GDC A;  4XEV A;  2OJE D;  4MVO A;  4Z9H A;  2HKV A;  2PX0 A;  4AE4 A;  3OA1 A;  3LJB A;  3EG9 A;  4CJO A;  3IQ5 A;  4EHP A;  2J8W A;  5JS5 A;  256B A;  4FX5 A;  1VYI A;  1K05 A;  3FOP A;  1YA7 O;  2YLD A;  4KBL A;  1M2O A;  2XS8 A;  4U5B E;  3IQ6 A;  3UMK A;  3RQG A;  2EIN C;  2XLV A;  3DAF A;  3RYL A;  1V4A A;  3ZVR A;  3EH1 A;  3S84 A;  3DJN B;  4BJ5 A;  1A41 A;  3GEE A;  1ZHY A;  2EPN A;  5K0I A;  4CDA A;  1Z5Z A;  2QNL A;  1OW7 A;  1Q0G A;  4PJL A;  5KYX B;  3W2V A;  4CBE A;  4R32 A;  4HFK B;  4XLP F;  3U8P A;  2JX0 A;  4BJ5 C;  4DXW A;  2PFD A;  2J9U A;  1JR8 A;  1LE2 A;  1NSG B;  1Z23 A;  4N4W A;  4O6M A;  2Y3H A;  1QZX A;  3O55 A;  2XSE A;  2DI3 A;  1O87 A;  4EBK A;  3L1M A;  1I4Z A;  1CGN A;  3JCU Q;  3AG2 C;  3NMI A;  4I1M A;  2I15 A;  1OXK A;  4MVS A;  2FGY A;  3EH2 A;  2ZXO A;  3R2P A;  2OG2 A;  2ETS A;  1TR2 A;  2M64 A;  3TOM A;  3W2W A;  2EPL X;  2A6H F;  2LK4 A;  2YL7 A;  3C8G D;  4I44 A;  1NFN A;  2AVK A;  5CI9 A;  1NU7 D;  2W4M A;  4JTC B;  3HJC A;  3M1C B;  2RD9 A;  4JZA A;  1DOW A;  1E83 A;  1BR1 A;  2QUP A;  3C8G A;  5DQZ A;  1M6T A;  1I5N A;  3ECS A;  1Q0M A;  2G62 A;  3N2Z B;  4G78 A;  3V7O A;  1SF8 A;  2YLG A;  1E2X A;  4IB4 A;  2AWC A;  3HTK C;  3EGX A;  3S29 A;  4BG0 A;  3S0X A;  3G4Z A;  2P7V A;  3N0T A;  3EPV A;  4J7T A;  1XWJ A;  3EGD B;  3K1I C;  4YL3 A;  5D92 A;  3SZR A;  2AU5 A;  2YHS A;  2O9X A;  4BPM A;  1YYJ A;  2IXP A;  2XLH A;  4C7O A;  2J45 A;  3L0I A;  2F22 A;  1SMY F;  1OR2 A;  2NSG A;  4JRZ A;  4XEF A;  3V5Z A;  2P61 A;  1Z63 A;  1VB5 A;  2A68 F;  4XTK A;  1TFO B;  1IW7 F;  1TWA A;  1QLE C;  4U5C E;  2YEV A;  2TMV P;  3HNJ A;  2YRF A;  1FMW A;  3LS0 A;  4H54 A;  2DB4 A;  3AQC A;  3KKB A;  4JVS A;  1E85 A;  1A7E A;  2JD3 A;  2WVQ A;  2Y69 C;  3VRC A;  2XM0 A;  4AX2 A;  3KPH A;  2KJG A;  2B0J A;  2OQM A;  3VF0 A;  2FAP B;  3MLG A;  3ZIB A;  2Q9C A;  3TK0 A;  2R02 A;  2L7A A;  3RVY A;  1LPE A;  3UGO A;  1R4T A;  1F1M A;  2QY9 A;  4EWC A;  1HE9 A;  3A9C A;  4X0R A;  4XWJ A;  1LIH A;  3ABL C;  4Q7C A;  3X2Q C;  1ZW3 A;  4DVY P;  2BC5 A;  1RXQ A;  3KH2 A;  4K0D A;  4U9D A;  2QLA A;  2EIM C;  1Q0F A;  2NUP A;  1EKY A;  3JT1 A;  1OCC C;  2ZPA A;  1PD1 A;  4LAC B;  3SYN A;  4CSA C;  5BUO A;  4OIN F;  3H2V A;  3SXK A;  3KL4 A;  1OCZ C;  3DE8 A;  3T6G B;  2R7V A;  4BJ6 A;  4CS9 A;  4FES A;  1MMN A;  4QI2 A;  5COM A;  1D0Y A;  1ZHX A;  3AG4 C;  3LLI A;  4HE8 D;  3T9O A;  4D4X A;  4EIY A;  5A6J A;  5L0C A;  4UDV A;  2BE5 F;  3FHD A;  2PNO A;  1TWG A;  5DVW A;  3AG1 C;  4DBR A;  1S05 A;  2P0N A;  4YT2 A;  2WZF A;  3DKA A;  2KNH A;  1CGO A;  2C03 A;  2CW0 F;  3NG1 A;  1D0X A;  1EI7 A;  2LFF A;  5E2Q A;  2VB6 A;  1L7C A;  2J9V A;  2Y39 A;  1GS9 A;  1UFB A;  3O10 A;  3RF3 A;  4JTA B;  4IJJ A;  4C3D A;  3S9O A;  1T5O A;  3B0V C;  2D5R B;  2CNW A;  2J9W A;  3SNH A;  4I1O B;  3GOR A;  3DAG A;  1RJ9 A;  5AC5 A;  3FDQ A;  3DWW A;  2HFI A;  1N1C A;  3RIP A;  4K7B A;  2Y3G A;  4JCH A;  2PBE A;  3M4C A;  3X1O A;  3C8G B;  2PX3 A;  3DZA A;  2XXA B;  1YA9 A;  2R05 A;  2MHR A;  3S28 A;  5FCL A;  3LEV A;  3RFY A;  2UUH A;  3K6B A;  2LD6 A;  3MYF A;  4MVQ A;  4JIO A;  3DM9 B;  4AK9 A;  1IZM A;  2D4U A;  1YZC A;  1WOL A;  4MTG A;  3ITF A;  2XL4 A;  4IAQ A;  3JZ0 A;  1QVX A;  1HE1 A;  2KW3 C;  1TWC A;  2LP4 A;  3GAN A;  3N24 A;  3G50 A;  3U2L A;  4NTB A;  4CS8 A;  4CSA A;  2WZG A;  3M4B A;  3F47 A;  2IYL D;  3GEI A;  4M63 A;  1M56 C;  1HY5 A;  5BQH A;  4BJ1 A;  3FAJ A;  4PK4 A;  4MTO A;  4OIP F;  2HJ3 A;  2G3K A;  1EA8 A;  3UGP A;  1ZYR F;  2ASR A;  4JEB A;  3IHU A;  5B3I A;  2X51 A;  1MMG A;  1Y6D A;  4I3M A;  3WOD F;  2A6E F;  2Z15 A;  2R7W A;  1H9G A;  2QTV A;  1QSP A;  2GAQ A;  4HFF B;  2A69 F;  1K04 A;  4LDK A;  5JUA A;  1Z6A A;  5T3W A;  3TUL A;  3W4Y A;  2DGJ A;  5B1B C;  1AVO B;  1BDJ B;  3V5X A;  2XM4 A;  1HW1 A;  3A11 A;  3M15 A;  3UMI A;  4LDR A;  4PFP A;  1ZW2 A;  1C03 A;  2NSF A;  2Q4F A;  3U2M A;  3NKE A;  5JLI A;  5DS6 A;  3AGU A;  4OIO F;  3CQZ A;  1VOM A;  3QW1 A;  1PV3 A;  4E18 A;  5DQT A;  5FZT A;  2R7X A;  5EK0 A;  3DD7 A;  3ZC4 A;  2A0B A;  3PDM P;  3HKK A;  3UNG C;  2XLW A;  1YDI A;  4FAP B;  1M57 C;  2VAS A;  1T9K A;  3I4U A;  1HMD A;  2WB7 A;  1RJ9 B;  3C63 A;  3RVZ A;  3FMS A;  3NDB B;  2HSQ A;  4GYT A;  4JE9 A;  4BEM J;  4XPY A;  2KC3 A;  1FMV A;  2VCA A;  3ASN C;  2HMZ A;  5HSW A;  2CNW D;  4YT5 A;  2EPK X;  1YAU O;  2Q9B A;  1LKX A;  3FOO A;  1A0B A;  2YWA A;  3EFO A;  5E3C A;  5AC4 A;  3MBG A;  2V3C C;  5L0F A;  3QTH A;  1OCR C;  5B3S C;  4JTD B;  5JSL A;  2W45 A;  1TQG A;  2LQG A;  1WAT A; 
#chains in the Genus database with same CATH homology
 1JAF A;  3HNK A;  4CJG A;  3HNI A;  4NC3 A;  1CPR A;  2XLM A;  4EIY A;  4JKV A;  3DE9 A;  4L6R A;  4CX9 A;  2XL8 A;  3ZQV A;  2BC5 A;  4CDV A;  4U9D A;  2QLA A;  3ZWI A;  1EKY A;  1QQ3 A;  5JVE A;  1E84 A;  1YYX A;  3DE8 A;  3QW0 A;  3HNL A;  4WGZ A;  4D4X A;  5JT4 A;  3NMK A;  1S05 A;  4CIP A;  2XLD A;  4CJO A;  1MQV A;  3IQ5 A;  2J8W A;  5JS5 A;  256B A;  1CGO A;  2YL3 A;  3FOP A;  2YLD A;  3IQ6 A;  2XLV A;  2YL1 A;  4ULV A;  4CDA A;  1NBB A;  3TOL A;  3M4C A;  3ZQY A;  2YKZ A;  3C62 A;  3U8P A;  1E86 A;  1RCP A;  1A7V A;  4N4W A;  1YZC A;  1APC A;  3ZTM A;  4IAQ A;  1QPU A;  3L1M A;  1CGN A;  3M4B A;  3NMI A;  5AGF A;  2CCY A;  3NMJ A;  4ER9 A;  3TOM A;  2YL7 A;  4JEB A;  5B3I A;  4JEA A;  1E83 A;  4D4N A;  2YL0 A;  2XLE A;  5JUA A;  3ZTZ A;  1M6T A;  2YLI A;  1YZA A;  2YLG A;  2J9B A;  3M15 A;  2XM4 A;  3M79 A;  4IB4 A;  2XL6 A;  4CDY A;  5JLI A;  3QW1 A;  1GQA A;  1LM3 B;  2XLW A;  5JRA A;  1YYJ A;  2XLO A;  2XLH A;  3C63 A;  4IAR A;  4JE9 A;  4U9E A;  3HNJ A;  4WGY A;  3FOO A;  1E85 A;  5JP7 A;  3QVY A;  1BBH A;  3VRC A;  2XM0 A;  4N6H A;  3QVZ A;  5JSL A;  1CPQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...