2YL3A

Cytochrome c prime from alcaligenes xylosoxidans: carbon monooxide bound l16g variant at 1.04 a resolution - restraint refined
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSAGTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Carbon Monoxide Poisoning is Prevented by the Energy Costs of Conformational Changes in Gas- Binding Haemproteins.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
total genus 51
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2011-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2yl3A00
1E83A 4JE9A 4ULVA 1EKYA 3FOPA 1QPUA 2YL7A 2XM0A 4IARA 2XLEA 3NMKA 4L6RA 2XLHA 4D4NA 2YL1A 1LM3B 3NMIA 2YKZA 1CPRA 3HNKA 2YL0A 1E86A 1CGOA 5AGFA 1A7VA 1JAFA 3HNIA 2XLDA 1CPQA 2XM4A 1E84A 5JRAA 3M4CA 3NMJA 3ZQVA 5JLIA 3FOOA 2XLVA 5B3IA 3HNLA 3TOMA 4EIYA 5JS5A 5JP7A 2YLDA 3M79A 4CJOA 1BBHA 2XLWA 1GQAA 1YYXA 1S05A 3C63A 3IQ6A 4CJGA 2YLGA 4WGZA 4U9EA 2BC5A 3TOLA 4D4XA 4ER9A 5JUAA 4IAQA 3DE8A 3VRCA 1YZAA 3ZQYA 2XLMA 3QVZA 4CDYA 3U8PA 4JKVA 3ZTMA 2CCYA 4CX9A 1M6TA 3L1MA 3QVYA 256BA 5JVEA 4JEBA 2XL6A 4U9DA 2QLAA 3HNJA 2XL8A 4CDVA 3C62A 2J9BA 1APCA 1QQ3A 4JEAA 4WGYA 4CIPA 4CDAA 1YYJA 1MQVA 1NBBA 3M15A 3M4BA 3QW0A 3QW1A 4N6HA 4NC3A 3ZWIA 1CGNA 1YZCA 3DE9A 5JT4A 2YL3A 3IQ5A 1RCPA 2YLIA 1E85A 3ZTZA 5JSLA 2XLOA 4IB4A 4N4WA 2J8WA
chains in the Genus database with same CATH superfamily
4MVOA 1TFKB 3MFNA 2RSEB 2YHSA 3B0UX 4JE9A 1HE1A 3NYJA 3KPHA 4ULVA 1QPUA 2PFDA 3DKAA 3U3BA 5A6JA 3I5QA 1EA8A 3W8HA 1GGQA 3JCUQ 2J0WA 2Q7RA 4BJ1A 3EZHA 3SYNA 2D4UA 2XLEA 1ZHZA 5T3TA 1HW1A 1G5ZA 4CS9A 2R7SA 4MVMA 3UR3C 3C8GD 4H54A 4MVSA 1A0BA 5DQTA 2W9YA 3NRHA 5TJ5E 3AQBA 3JZ0A 4EBBA 2DYRC 4JJGA 2B0HA 3K1HA 3EQLF 1D1CA 4YT5A 1ZVZA 3DM5A 4LACB 4NTFA 1L7CA 5CI8A 4G7ZF 2B0JA 3RKOF 1A7EA 1KTMA 1JR8A 3GWNA 3U9MA 5L0CA 3FDQA 4BEMJ 2Q9AA 1T01A 3VF0A 1D1AA 1U0BB 5B1BC 1E2XA 1E84A 4Z9HA 1TWCA 4G0HA 3M4CA 3ZQVA 2YQYA 5JLIA 5KYUB 2XXAA 4N06A 1QZXA 4Q5SF 2V26A 3I5PA 5D92A 3GEEA 2L7AA 2Q00A 3S28A 3LLKA 2YLDA 1BR1A 1ZU5A 2XRHA 5IY5C 2EPOA 3CSKA 2C03A 3LS1A 3KKBA 4CJOA 1BBHA 1M2VB 2E87A 4U5GA 5BQIA 3O39A 4C7OA 1ZHTA 4MNDA 1PCXA 4EBKA 2ZXRA 1VYKA 4PJMA 4CJGA 2YLGA 3X1OA 3Q6MA 4ULWA 2KYHA 1R4TA 4OD5A 4D4XA 3RQGA 4JCZA 4MVRA 3VYWA 3E9VA 2LK4A 2R02A 2I15A 3AOUA 4XPWA 4EWCA 3TULA 5L0HA 2EINC 3ZQYA 4YL3A 4DRJB 2QNLA 1Z63A 1B68A 2OU6A 5GPGB 4YN0B 2ETSA 2ICWG 2OQMA 3U8VA 3EHMA 1U89A 2OJED 2ZXOA 3MYIA 4CDYA 2XS8A 2ZD9A 1XZPA 1H6GA 2PX0A 2WL8A 5EHHA 1G4WR 3IEEA 4K7BA 1Z23A 4U5EE 3OEOA 2J9UA 4YT8A 3UGOA 1OKKD 1D0ZA 2A6EF 1OR3A 3QVYA 3V5ZA 5KYYA 2IXPA 2P0NA 4CSAC 2YZSA 3BRJA 1G4US 1V4AA 4U9DA 3A9CA 2HSBA 2NUTA 4K0DA 1Z6AA 1UFBA 1Q0DA 4U5CE 3DJNB 1JMWA 2R7XA 3GEHA 1APCA 1QQ3A 3ASNC 3N24A 4GEHA 3EGDA 1JPNA 3UNGC 4CIPA 2AVKA 2GAQA 2XS1A 3U5SA 2NSFA 4YWQA 4PJJA 2WB7A 1MQVA 2Q3TA 3L8IA 4BJ6C 2LSEA 5DVWA 2G3VA 4MW8A 3U3FA 4E17A 1KNYA 1T6QA 2OEVA 3GM1A 1ZW2A 2LFFA 2IXNA 3M15A 4N6HA 4Z9IA 1PD1A 2HS5A 2A6HF 3K66A 4G7OF 3C7JA 2EPLX 1ORJA 2AU5A 4JTDB 3SXMA 2ZPAA 3ABKC 3B71A 3JYYA 2PF4E 3UMHA 2YL3A 3IQ5A 3W8IA 2P61A 2YLIA 1OCCC 2IXMA 2J45A 2MWQA 4W8PA 4FAPB 1WATA 1GS9A 1TWGA 2Y3HA 5FCLA 1ZYRF 4YT2A 1HMDA 1I5NA 4IB4A 5F28E 1OCRC 4ZLCA 5A6AA 2KW3C 2R7TA 1ORSC 1MNEA 2J8WA 4I1OB 4GQHA 3EG9A 2HMZA 3GM2A 4E7ZA 5L3VA 3EH2A 4J30B 3EFOA 3DM9B 2LCHA 3DXJF 4G78A 3EGXB 3FOPA 3J06A 5EK0A 2XM0A 4XTKA 2DYSC 2WVOA 4I3MA 2HFIA 4I44A 1VB5A 2L6HA 3NMKA 1ORYA 2XLHA 1T9KA 4D4NA 1SZIA 3R7CA 3TJ6A 1H9TA 2PNOA 2YL1A 1OCZC 1T5OA 2HUJA 2F22A 3HNKA 3R2PA 4CSAA 2HJ3A 1O5HA 3EJNA 4JW1A 2AP3A 4ZLDA 3SZRA 5A6BA 1RXQA 3MX3A 4CBEA 4AL0A 1JAFA 4H4KC 1NFOA 2R7OA 4LLCA 1NZEA 4EHPA 3C8ZA 2IXOA 4P9FA 4Q7CA 1BR4A 2A0BA 1CPQA 2KGOA 5KYUA 5E33A 1DOVA 4DBRA 2V3CC 5F5FA 1SMYF 5B3SC 3ASOC 4NTAA 2G3KA 5JRAA 2BL2A 4BJ6A 4PJLA 1OW8A 3V5YA 2CYDA 2QE9A 3FOOA 2XLVA 4PFPA 3SNHA 3HNLA 4PK4A 3T9OA 1M2VA 1XWJA 4G7HF 2VASA 2TMVP 2CNWA 1MMDA 3FVYA 2CGEA 2P7VA 4XPXA 3DJUB 2L9JA 3ZIBA 2R7RA 2VB6A 3RF3A 3T6BA 4MTGA 4B6IA 2BE5F 1Q0FA 3NYLA 3MYFA 2VCCA 3C63A 4DRIB 3RVYA 3IQ6A 5E2QA 2LFDA 3ATPA 1WN0A 4E7SA 4U9EA 4ER9A 3AG4C 3LEOA 4OD4A 1I4ZA 3VRCA 2LIGA 3LESA 3M1CB 4FWVA 2P1AA 1V74B 4HE8D 4JZAA 5F5HA 4A4AA 1OCOC 2A1DD 4MTOA 3TJ5A 3ZC4A 4OIPF 4Z9JA 3AG2C 2J7PA 3B29A 3LEVA 3QMKA 4QI0A 1WTYA 1FMVA 2JX0A 1U6HA 2XSEA 3S27A 3PMRA 4WABA 4C3EA 3E70C 4PFOA 2J9WA 1TQGA 3JRTA 2L81A 1OW7A 1UG7A 4UDVA 3PDMP 4DBQA 2KK1A 2HJMA 3FAJA 3KYIA 2D5RB 2XL8A 3C62A 2J9BA 3ECSA 2LQGA 3UMIA 4XQ1A 4YL1A 3V5XA 1KU2A 5CIVA 1ZHYA 3K1IC 3JSZA 1QVXA 2FAPB 3NYMA 3WHNA 3FHDA 4FESA 3QTHA 3EZIA 5A69A 2KQ9A 1YDIA 2MHRA 2ZXWC 4NQFA 2OKUA 1OXKA 4AK9A 4NC3A 3S84A 3ABMC 1YZCA 4R32A 3H2UA 3TD7A 1YAUO 4CS7A 3KL4A 3B0PA 4E0HA 1FFTC 1JOGA 2Y39A 4YT4A 4W8KA 1LPEA 5JT4A 5BQGA 1ZHXA 4MTFA 3BEHA 1TKNA 5L0DA 3SP1A 1VK5A 4OIQF 3MBGA 1TWHA 4HFFB 3ABLC 5JSLA 3GM3A 2ZXPA 5L0FA 2J9VA 2XLOA 2R05A 1OW6A 2PBEA 1Y4CA 3EGXA 1FTSA 2HMQA 1BZ4A 1OQCA 3GWLA 3KH2A 3AJMA 3CAXA 1HE9A 4C3BA 1E83A 4M63A 4FX5A 1EKYA 3RIPA 2LD6A 1V54C 2L6GA 2W45A 2IYLD 4KNWA 3AGUA 4AE4B 3ZSUA 3MLGA 2PP4A 1G8XA 3GEIA 2QTVA 3IHUA 4NY3A 3HTKC 4YJWA 3GORA 3RH3A 4L6RA 4U5BE 2NUPB 4DXWA 2WVNA 4K1OA 2P6VA 5L0JA 1LM3B 3N0TA 2I8BA 5D91A 3NMIA 2YKZA 2X0CA 3T6JA 5A6BD 2YL0A 1M2OA 3ZVRA 3UGPA 1E86A 2CW0F 4P9TA 5T3WA 1AEPA 3C8GB 2H7OA 2HV6A 2Z15A 4C7OB 4LLEA 4MVUA 4J7TA 1D1BA 1NSGB 2XLDA 2W4MA 1WWPA 3G4ZA 3K1IA 4MVQA 3S9OA 2XM4A 3UMKA 3S0XA 3LS0A 1HW2A 3H65A 3T4RA 1TWAA 1WOLA 2IBFA 1W2WA 4KC9A 4QDLA 3NMJA 3WG7C 2VH3A 2CNWD 3AG1C 4PJNA 2NG1A 3W4YA 4XWJA 4EIYA 2AWYA 2KJGA 3JSEO 5JP7A 5DS4A 2GDCA 3DI5A 2OJQA 3DD7A 1YA9A 2XLWA 3NG1A 1GQAA 1YYXA 4QI2A 2XXAB 1S05A 2Q9BA 1D0XA 1OKKA 2NSGA 3F46A 2OCCC 4IRUA 2YRFA 2GA0A 4JRZA 4RDAA 3L0IA 1QKRA 2BC5A 2NUTB 3TOLA 5JUAA 3S90A 2EPNA 5T1DB 5L3QA 1FMWA 1NFNA 1S7ZA 2QY9A 3ITFA 1M57C 1ZU4A 1J8MF 1LS1A 3JYHA 2XLMA 3G50A 4DVZA 1H7IA 5COGA 3HLZA 2DB4A 2KC3A 4BJ5C 3PHF2 4CS8C 1FFHA 1R5ID 2A69F 1PD0A 4PACA 3T6GB 3L8JA 1YVIA 2OOCA 4O7GA 2DI3A 2C04A 2YVKA 4ANJA 2R7VA 1NU9C 3Q7GA 4CX9A 1M6TA 1QSPA 5KYXB 1NLXA 2LP4A 256BA 5JVEA 3IPMO 1K04A 4XPYA 3US6A 3LAYA 2HZ8A 2XL6A 2DGJA 3U2MA 2YWAA 3DMDA 1D0YA 1HY5A 3ZG1A 5KYWA 1RJ9B 2QLAA 2VC9A 3I4UA 3TK0A 3HNJA 3HJCA 4JTAB 4I1MA 1ZW3A 1PV3A 4NTBA 4MS2A 1MMAA 1RKEB 5B1AC 5DS6A 3U0CA 4JCHA 4WGYA 2AWCA 4CDAA 1K40A 4U5FE 3LNMB 1I4YA 3PCVA 1TR2A 3EG9B 1YYJA 2CDQA 1LI5A 4C3DA 3EFOB 2IOQA 3GANA 4LDRA 1QLEC 1NBBA 3U9JA 2OEXA 2Y3GA 3SXZA 2R7UA 2W4BA 3SEOA 3GODA 2Q9CA 1A7DA 3EH1A 3RW0A 3DE9A 4BEJA 2UUHA 5AC5A 2EIJC 3O6XA 4XEVA 2R7QA 4OIRF 2PX3A 3O10A 3VAYA 1RCPA 4U5DE 1GM5A 1E85A 3AQCA 3ZTZA 3LJBA 2M4EA 4IGGA 4GYTA 2WZLA 4O6MA 4E18A 4ONSA 5A6KA 1AUEA 1BR2A 3NDBB 2ASRA 3S29A 1Y6DA 3EPVA 3V7OA 1NG1A 4AE4A 1YARO 5CI9A 3OA1A 1M56C 4OIOF 3ZDLA 1T6UA 1WGWA 2YL7A 4EKWA 3RFYA 1MMNA 4U5HA 5DS5A 4IARA 1HMOA 1K05A 2NUPA 4N6CA 1F1MA 3JRMO 3AGTA 2Y3DA 2EIMC 1L3PA 2KNHA 4JJFA 4BJ5A 1LE2A 4CS8A 4RD9A 1O3UA 4O6NA 1YLMA 3W2VA 1C03A 2A0UA 2EIKC 2GFHA 4LDKA 3JTLO 3O55A 2NPUA 3C8GA 1CPRA 4LERA 3RQFA 2UUIA 1JPJA 1LVKA 2HSQA 3QZCA 1CGOA 1A41A 2R25A 3RVZA 1LS4A 1XZQA 3B9QA 5AGFA 5DQZA 1A7VA 1Q0GA 3K6BA 3VM6A 1Q0MA 4A2NB 1AVOB 3NKEA 1SF8A 4BG0A 3HNIA 4XEFA 2H7VC 4MVZA 3EHNA 2YEVA 1DOWA 3LLIA 3FAPB 4WJ0A 2JPUA 4KBLA 1J8YF 1LKXA 5KYWB 3G4XA 3DAFA 3DZAA 4IWBA 4DJ9A 5B3IA 2OG2A 2Y69C 3TOMA 5JS5A 1IW7F 1ZZPA 4KNVA 2VCAA 3M79A 1SR2A 2VCBA 5L0GA 5COFA 2HV7A 1IZMA 1LI7A 1N1CA 1ST6A 1MNDA 3FXHA 1SYQA 3OWTA 2HKVA 5E3AA 2WZGA 2H8AA 4Q4ZF 1VTMP 3DAGA 4PR9A 3KMIA 2EILC 3B0VC 4WGZA 1V55C 4O79A 4NCQA 4XEKA 4AL1A 1C02A 1BDJB 1WASA 4IAQA 2FFHA 3DE8A 4P6IC 1VLTA 2A68F 1YZAA 1Z5ZA 5AC4A 3KYJA 3TQOA 1C17M 4CIHA 5L0IA 1FNTc 5HSWA 3RYLA 3K33A 3H2VA 2WZFA 4CS9C 3QVZA 1VMAA 3U8PA 4IJJA 1LE4A 4IAOA 4YL0A 5KYXA 4JKVA 3ZTMA 5KYNA 1O87A 3F47A 1NU7D 1YA7O 4DRHB 4XLNF 2Q4FA 2CCYA 4EBJA 1Z7Qc 4EUKB 3SXYA 4OINF 3U2LA 1RKCA 4O6YA 3L1MA 4DVYP 5BUOA 4KI2A 3C18A 1RJ9A 5HV9A 2JD3A 4JEBA 2EPKX 3RQEA 1FAPB 2IM8A 1RKEA 4DOZA 3POVA 4JTCB 3WAQA 5KYYB 2Y3BA 5COMA 1EI7A 1OR2A 3A11A 1JRAA 2EPMX 5E3CA 3IQTA 3X2QC 4AX2A 2FGYA 4CDVA 1FR0A 2H7BA 2R7WA 4BJTA 5FZTA 4JEAA 3W2WA 2L6FA 1TFOB 2R03A 1VOMA 1ZHWA 3N2ZB 1VLSA 5DLJA 2KSFA 3Q7LA 3LUTB 4E0IA 1YJGA 2XL4A 3CZ6A 3EGDB 4RBNA 1CGME 3IQCA 3K7DA 4JIOA 2J7PD 3WODF 4BPMA 1Q0KA 4F4BA 3CQZA 1OXBA 1Z3IX 1LIHA 2O9XA 1H9GA 2QUPA 3M4BA 3NKDA 3QW1A 3HKKA 3QW0A 4JVSA 1CGNA 4LDQA 4MQ9F 3SXKA 3ZWIA 4XLPF 4X0RA 2GWWA 4HFKB 3AG3C 2G62A 4HEAJ 4JC7A 4MW3A 2J0XA 3FMSA 5EGYA 3L34A 5K0IA 5BQHA 3Q6NA 1VYIA 4J7YA 2R9RB 3DWWA 2J46A 2RD9A 1MMGA 2M64A 2WVQA 1T6IA 3JT1A 3LNRA 4N4WA 2X51A 4JURI 4YK5A 1RMVA 1EQ1A 4J32B 2MYSA 3CEXA
chains in the Genus database with same CATH topology
1E83A 4JE9A 4ULVA 1EKYA 3FOPA 1QPUA 2YL7A 2XM0A 4IARA 2XLEA 3NMKA 4L6RA 2XLHA 4D4NA 2YL1A 1LM3B 3NMIA 2YKZA 1CPRA 3HNKA 2YL0A 1E86A 1CGOA 5AGFA 1A7VA 1JAFA 3HNIA 2XLDA 1CPQA 2XM4A 1E84A 5JRAA 3M4CA 3NMJA 3ZQVA 5JLIA 3FOOA 2XLVA 5B3IA 3HNLA 3TOMA 4EIYA 5JS5A 5JP7A 2YLDA 3M79A 4CJOA 1BBHA 2XLWA 1GQAA 1YYXA 1S05A 3C63A 3IQ6A 4CJGA 2YLGA 4WGZA 4U9EA 2BC5A 3TOLA 4D4XA 4ER9A 5JUAA 4IAQA 3DE8A 3VRCA 1YZAA 3ZQYA 2XLMA 3QVZA 4CDYA 3U8PA 4JKVA 3ZTMA 2CCYA 4CX9A 1M6TA 3L1MA 3QVYA 256BA 5JVEA 4JEBA 2XL6A 4U9DA 2QLAA 3HNJA 2XL8A 4CDVA 3C62A 2J9BA 1APCA 1QQ3A 4JEAA 4WGYA 4CIPA 4CDAA 1YYJA 1MQVA 1NBBA 3M15A 3M4BA 3QW0A 3QW1A 4N6HA 4NC3A 3ZWIA 1CGNA 1YZCA 3DE9A 5JT4A 2YL3A 3IQ5A 1RCPA 2YLIA 1E85A 3ZTZA 5JSLA 2XLOA 4IB4A 4N4WA 2J8WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E83 A;  4JE9 A;  4ULV A;  1EKY A;  3FOP A;  1QPU A;  2YL7 A;  2XM0 A;  4IAR A;  2XLE A;  3NMK A;  4L6R A;  2XLH A;  4D4N A;  2YL1 A;  1LM3 B;  3NMI A;  2YKZ A;  1CPR A;  3HNK A;  2YL0 A;  1E86 A;  1CGO A;  5AGF A;  1A7V A;  1JAF A;  3HNI A;  2XLD A;  1CPQ A;  2XM4 A;  1E84 A;  5JRA A;  3M4C A;  3NMJ A;  3ZQV A;  5JLI A;  3FOO A;  2XLV A;  5B3I A;  3HNL A;  3TOM A;  4EIY A;  5JS5 A;  5JP7 A;  2YLD A;  3M79 A;  4CJO A;  1BBH A;  2XLW A;  1GQA A;  1YYX A;  1S05 A;  3C63 A;  3IQ6 A;  4CJG A;  2YLG A;  4WGZ A;  4U9E A;  2BC5 A;  3TOL A;  4D4X A;  4ER9 A;  5JUA A;  4IAQ A;  3DE8 A;  3VRC A;  1YZA A;  3ZQY A;  2XLM A;  3QVZ A;  4CDY A;  3U8P A;  4JKV A;  3ZTM A;  2CCY A;  4CX9 A;  1M6T A;  3L1M A;  3QVY A;  256B A;  5JVE A;  4JEB A;  2XL6 A;  4U9D A;  2QLA A;  3HNJ A;  2XL8 A;  4CDV A;  3C62 A;  2J9B A;  1APC A;  1QQ3 A;  4JEA A;  4WGY A;  4CIP A;  4CDA A;  1YYJ A;  1MQV A;  1NBB A;  3M15 A;  3M4B A;  3QW0 A;  3QW1 A;  4N6H A;  4NC3 A;  3ZWI A;  1CGN A;  1YZC A;  3DE9 A;  5JT4 A;  2YL3 A;  3IQ5 A;  1RCP A;  2YLI A;  1E85 A;  3ZTZ A;  5JSL A;  2XLO A;  4IB4 A;  4N4W A;  2J8W A; 
#chains in the Genus database with same CATH topology
 4MVO A;  1TFK B;  3MFN A;  2RSE B;  2YHS A;  3B0U X;  4JE9 A;  1HE1 A;  3NYJ A;  3KPH A;  4ULV A;  1QPU A;  2PFD A;  3DKA A;  3U3B A;  5A6J A;  3I5Q A;  1EA8 A;  3W8H A;  1GGQ A;  3JCU Q;  2J0W A;  2Q7R A;  4BJ1 A;  3EZH A;  3SYN A;  2D4U A;  2XLE A;  1ZHZ A;  5T3T A;  1HW1 A;  1G5Z A;  4CS9 A;  2R7S A;  4MVM A;  3UR3 C;  3C8G D;  4H54 A;  4MVS A;  1A0B A;  5DQT A;  2W9Y A;  3NRH A;  5TJ5 E;  3AQB A;  3JZ0 A;  4EBB A;  2DYR C;  4JJG A;  2B0H A;  3K1H A;  3EQL F;  1D1C A;  4YT5 A;  1ZVZ A;  3DM5 A;  4LAC B;  4NTF A;  1L7C A;  5CI8 A;  4G7Z F;  2B0J A;  3RKO F;  1A7E A;  1KTM A;  1JR8 A;  3GWN A;  3U9M A;  5L0C A;  3FDQ A;  4BEM J;  2Q9A A;  1T01 A;  3VF0 A;  1D1A A;  1U0B B;  5B1B C;  1E2X A;  1E84 A;  4Z9H A;  1TWC A;  4G0H A;  3M4C A;  3ZQV A;  2YQY A;  5JLI A;  5KYU B;  2XXA A;  4N06 A;  1QZX A;  4Q5S F;  2V26 A;  3I5P A;  5D92 A;  3GEE A;  2L7A A;  2Q00 A;  3S28 A;  3LLK A;  2YLD A;  1BR1 A;  1ZU5 A;  2XRH A;  5IY5 C;  2EPO A;  3CSK A;  2C03 A;  3LS1 A;  3KKB A;  4CJO A;  1BBH A;  1M2V B;  2E87 A;  4U5G A;  5BQI A;  3O39 A;  4C7O A;  1ZHT A;  4MND A;  1PCX A;  4EBK A;  2ZXR A;  1VYK A;  4PJM A;  4CJG A;  2YLG A;  3X1O A;  3Q6M A;  4ULW A;  2KYH A;  1R4T A;  4OD5 A;  4D4X A;  3RQG A;  4JCZ A;  4MVR A;  3VYW A;  3E9V A;  2LK4 A;  2R02 A;  2I15 A;  3AOU A;  4XPW A;  4EWC A;  3TUL A;  5L0H A;  2EIN C;  3ZQY A;  4YL3 A;  4DRJ B;  2QNL A;  1Z63 A;  1B68 A;  2OU6 A;  5GPG B;  4YN0 B;  2ETS A;  2ICW G;  2OQM A;  3U8V A;  3EHM A;  1U89 A;  2OJE D;  2ZXO A;  3MYI A;  4CDY A;  2XS8 A;  2ZD9 A;  1XZP A;  1H6G A;  2PX0 A;  2WL8 A;  5EHH A;  1G4W R;  3IEE A;  4K7B A;  1Z23 A;  4U5E E;  3OEO A;  2J9U A;  4YT8 A;  3UGO A;  1OKK D;  1D0Z A;  2A6E F;  1OR3 A;  3QVY A;  3V5Z A;  5KYY A;  2IXP A;  2P0N A;  4CSA C;  2YZS A;  3BRJ A;  1G4U S;  1V4A A;  4U9D A;  3A9C A;  2HSB A;  2NUT A;  4K0D A;  1Z6A A;  1UFB A;  1Q0D A;  4U5C E;  3DJN B;  1JMW A;  2R7X A;  3GEH A;  1APC A;  1QQ3 A;  3ASN C;  3N24 A;  4GEH A;  3EGD A;  1JPN A;  3UNG C;  4CIP A;  2AVK A;  2GAQ A;  2XS1 A;  3U5S A;  2NSF A;  4YWQ A;  4PJJ A;  2WB7 A;  1MQV A;  2Q3T A;  3L8I A;  4BJ6 C;  2LSE A;  5DVW A;  2G3V A;  4MW8 A;  3U3F A;  4E17 A;  1KNY A;  1T6Q A;  2OEV A;  3GM1 A;  1ZW2 A;  2LFF A;  2IXN A;  3M15 A;  4N6H A;  4Z9I A;  1PD1 A;  2HS5 A;  2A6H F;  3K66 A;  4G7O F;  3C7J A;  2EPL X;  1ORJ A;  2AU5 A;  4JTD B;  3SXM A;  2ZPA A;  3ABK C;  3B71 A;  3JYY A;  2PF4 E;  3UMH A;  2YL3 A;  3IQ5 A;  3W8I A;  2P61 A;  2YLI A;  1OCC C;  2IXM A;  2J45 A;  2MWQ A;  4W8P A;  4FAP B;  1WAT A;  1GS9 A;  1TWG A;  2Y3H A;  5FCL A;  1ZYR F;  4YT2 A;  1HMD A;  1I5N A;  4IB4 A;  5F28 E;  1OCR C;  4ZLC A;  5A6A A;  2KW3 C;  2R7T A;  1ORS C;  1MNE A;  2J8W A;  4I1O B;  4GQH A;  3EG9 A;  2HMZ A;  3GM2 A;  4E7Z A;  5L3V A;  3EH2 A;  4J30 B;  3EFO A;  3DM9 B;  2LCH A;  3DXJ F;  4G78 A;  3EGX B;  3FOP A;  3J06 A;  5EK0 A;  2XM0 A;  4XTK A;  2DYS C;  2WVO A;  4I3M A;  2HFI A;  4I44 A;  1VB5 A;  2L6H A;  3NMK A;  1ORY A;  2XLH A;  1T9K A;  4D4N A;  1SZI A;  3R7C A;  3TJ6 A;  1H9T A;  2PNO A;  2YL1 A;  1OCZ C;  1T5O A;  2HUJ A;  2F22 A;  3HNK A;  3R2P A;  4CSA A;  2HJ3 A;  1O5H A;  3EJN A;  4JW1 A;  2AP3 A;  4ZLD A;  3SZR A;  5A6B A;  1RXQ A;  3MX3 A;  4CBE A;  4AL0 A;  1JAF A;  4H4K C;  1NFO A;  2R7O A;  4LLC A;  1NZE A;  4EHP A;  3C8Z A;  2IXO A;  4P9F A;  4Q7C A;  1BR4 A;  2A0B A;  1CPQ A;  2KGO A;  5KYU A;  5E33 A;  1DOV A;  4DBR A;  2V3C C;  5F5F A;  1SMY F;  5B3S C;  3ASO C;  4NTA A;  2G3K A;  5JRA A;  2BL2 A;  4BJ6 A;  4PJL A;  1OW8 A;  3V5Y A;  2CYD A;  2QE9 A;  3FOO A;  2XLV A;  4PFP A;  3SNH A;  3HNL A;  4PK4 A;  3T9O A;  1M2V A;  1XWJ A;  4G7H F;  2VAS A;  2TMV P;  2CNW A;  1MMD A;  3FVY A;  2CGE A;  2P7V A;  4XPX A;  3DJU B;  2L9J A;  3ZIB A;  2R7R A;  2VB6 A;  3RF3 A;  3T6B A;  4MTG A;  4B6I A;  2BE5 F;  1Q0F A;  3NYL A;  3MYF A;  2VCC A;  3C63 A;  4DRI B;  3RVY A;  3IQ6 A;  5E2Q A;  2LFD A;  3ATP A;  1WN0 A;  4E7S A;  4U9E A;  4ER9 A;  3AG4 C;  3LEO A;  4OD4 A;  1I4Z A;  3VRC A;  2LIG A;  3LES A;  3M1C B;  4FWV A;  2P1A A;  1V74 B;  4HE8 D;  4JZA A;  5F5H A;  4A4A A;  1OCO C;  2A1D D;  4MTO A;  3TJ5 A;  3ZC4 A;  4OIP F;  4Z9J A;  3AG2 C;  2J7P A;  3B29 A;  3LEV A;  3QMK A;  4QI0 A;  1WTY A;  1FMV A;  2JX0 A;  1U6H A;  2XSE A;  3S27 A;  3PMR A;  4WAB A;  4C3E A;  3E70 C;  4PFO A;  2J9W A;  1TQG A;  3JRT A;  2L81 A;  1OW7 A;  1UG7 A;  4UDV A;  3PDM P;  4DBQ A;  2KK1 A;  2HJM A;  3FAJ A;  3KYI A;  2D5R B;  2XL8 A;  3C62 A;  2J9B A;  3ECS A;  2LQG A;  3UMI A;  4XQ1 A;  4YL1 A;  3V5X A;  1KU2 A;  5CIV A;  1ZHY A;  3K1I C;  3JSZ A;  1QVX A;  2FAP B;  3NYM A;  3WHN A;  3FHD A;  4FES A;  3QTH A;  3EZI A;  5A69 A;  2KQ9 A;  1YDI A;  2MHR A;  2ZXW C;  4NQF A;  2OKU A;  1OXK A;  4AK9 A;  4NC3 A;  3S84 A;  3ABM C;  1YZC A;  4R32 A;  3H2U A;  3TD7 A;  1YAU O;  4CS7 A;  3KL4 A;  3B0P A;  4E0H A;  1FFT C;  1JOG A;  2Y39 A;  4YT4 A;  4W8K A;  1LPE A;  5JT4 A;  5BQG A;  1ZHX A;  4MTF A;  3BEH A;  1TKN A;  5L0D A;  3SP1 A;  1VK5 A;  4OIQ F;  3MBG A;  1TWH A;  4HFF B;  3ABL C;  5JSL A;  3GM3 A;  2ZXP A;  5L0F A;  2J9V A;  2XLO A;  2R05 A;  1OW6 A;  2PBE A;  1Y4C A;  3EGX A;  1FTS A;  2HMQ A;  1BZ4 A;  1OQC A;  3GWL A;  3KH2 A;  3AJM A;  3CAX A;  1HE9 A;  4C3B A;  1E83 A;  4M63 A;  4FX5 A;  1EKY A;  3RIP A;  2LD6 A;  1V54 C;  2L6G A;  2W45 A;  2IYL D;  4KNW A;  3AGU A;  4AE4 B;  3ZSU A;  3MLG A;  2PP4 A;  1G8X A;  3GEI A;  2QTV A;  3IHU A;  4NY3 A;  3HTK C;  4YJW A;  3GOR A;  3RH3 A;  4L6R A;  4U5B E;  2NUP B;  4DXW A;  2WVN A;  4K1O A;  2P6V A;  5L0J A;  1LM3 B;  3N0T A;  2I8B A;  5D91 A;  3NMI A;  2YKZ A;  2X0C A;  3T6J A;  5A6B D;  2YL0 A;  1M2O A;  3ZVR A;  3UGP A;  1E86 A;  2CW0 F;  4P9T A;  5T3W A;  1AEP A;  3C8G B;  2H7O A;  2HV6 A;  2Z15 A;  4C7O B;  4LLE A;  4MVU A;  4J7T A;  1D1B A;  1NSG B;  2XLD A;  2W4M A;  1WWP A;  3G4Z A;  3K1I A;  4MVQ A;  3S9O A;  2XM4 A;  3UMK A;  3S0X A;  3LS0 A;  1HW2 A;  3H65 A;  3T4R A;  1TWA A;  1WOL A;  2IBF A;  1W2W A;  4KC9 A;  4QDL A;  3NMJ A;  3WG7 C;  2VH3 A;  2CNW D;  3AG1 C;  4PJN A;  2NG1 A;  3W4Y A;  4XWJ A;  4EIY A;  2AWY A;  2KJG A;  3JSE O;  5JP7 A;  5DS4 A;  2GDC A;  3DI5 A;  2OJQ A;  3DD7 A;  1YA9 A;  2XLW A;  3NG1 A;  1GQA A;  1YYX A;  4QI2 A;  2XXA B;  1S05 A;  2Q9B A;  1D0X A;  1OKK A;  2NSG A;  3F46 A;  2OCC C;  4IRU A;  2YRF A;  2GA0 A;  4JRZ A;  4RDA A;  3L0I A;  1QKR A;  2BC5 A;  2NUT B;  3TOL A;  5JUA A;  3S90 A;  2EPN A;  5T1D B;  5L3Q A;  1FMW A;  1NFN A;  1S7Z A;  2QY9 A;  3ITF A;  1M57 C;  1ZU4 A;  1J8M F;  1LS1 A;  3JYH A;  2XLM A;  3G50 A;  4DVZ A;  1H7I A;  5COG A;  3HLZ A;  2DB4 A;  2KC3 A;  4BJ5 C;  3PHF 2;  4CS8 C;  1FFH A;  1R5I D;  2A69 F;  1PD0 A;  4PAC A;  3T6G B;  3L8J A;  1YVI A;  2OOC A;  4O7G A;  2DI3 A;  2C04 A;  2YVK A;  4ANJ A;  2R7V A;  1NU9 C;  3Q7G A;  4CX9 A;  1M6T A;  1QSP A;  5KYX B;  1NLX A;  2LP4 A;  256B A;  5JVE A;  3IPM O;  1K04 A;  4XPY A;  3US6 A;  3LAY A;  2HZ8 A;  2XL6 A;  2DGJ A;  3U2M A;  2YWA A;  3DMD A;  1D0Y A;  1HY5 A;  3ZG1 A;  5KYW A;  1RJ9 B;  2QLA A;  2VC9 A;  3I4U A;  3TK0 A;  3HNJ A;  3HJC A;  4JTA B;  4I1M A;  1ZW3 A;  1PV3 A;  4NTB A;  4MS2 A;  1MMA A;  1RKE B;  5B1A C;  5DS6 A;  3U0C A;  4JCH A;  4WGY A;  2AWC A;  4CDA A;  1K40 A;  4U5F E;  3LNM B;  1I4Y A;  3PCV A;  1TR2 A;  3EG9 B;  1YYJ A;  2CDQ A;  1LI5 A;  4C3D A;  3EFO B;  2IOQ A;  3GAN A;  4LDR A;  1QLE C;  1NBB A;  3U9J A;  2OEX A;  2Y3G A;  3SXZ A;  2R7U A;  2W4B A;  3SEO A;  3GOD A;  2Q9C A;  1A7D A;  3EH1 A;  3RW0 A;  3DE9 A;  4BEJ A;  2UUH A;  5AC5 A;  2EIJ C;  3O6X A;  4XEV A;  2R7Q A;  4OIR F;  2PX3 A;  3O10 A;  3VAY A;  1RCP A;  4U5D E;  1GM5 A;  1E85 A;  3AQC A;  3ZTZ A;  3LJB A;  2M4E A;  4IGG A;  4GYT A;  2WZL A;  4O6M A;  4E18 A;  4ONS A;  5A6K A;  1AUE A;  1BR2 A;  3NDB B;  2ASR A;  3S29 A;  1Y6D A;  3EPV A;  3V7O A;  1NG1 A;  4AE4 A;  1YAR O;  5CI9 A;  3OA1 A;  1M56 C;  4OIO F;  3ZDL A;  1T6U A;  1WGW A;  2YL7 A;  4EKW A;  3RFY A;  1MMN A;  4U5H A;  5DS5 A;  4IAR A;  1HMO A;  1K05 A;  2NUP A;  4N6C A;  1F1M A;  3JRM O;  3AGT A;  2Y3D A;  2EIM C;  1L3P A;  2KNH A;  4JJF A;  4BJ5 A;  1LE2 A;  4CS8 A;  4RD9 A;  1O3U A;  4O6N A;  1YLM A;  3W2V A;  1C03 A;  2A0U A;  2EIK C;  2GFH A;  4LDK A;  3JTL O;  3O55 A;  2NPU A;  3C8G A;  1CPR A;  4LER A;  3RQF A;  2UUI A;  1JPJ A;  1LVK A;  2HSQ A;  3QZC A;  1CGO A;  1A41 A;  2R25 A;  3RVZ A;  1LS4 A;  1XZQ A;  3B9Q A;  5AGF A;  5DQZ A;  1A7V A;  1Q0G A;  3K6B A;  3VM6 A;  1Q0M A;  4A2N B;  1AVO B;  3NKE A;  1SF8 A;  4BG0 A;  3HNI A;  4XEF A;  2H7V C;  4MVZ A;  3EHN A;  2YEV A;  1DOW A;  3LLI A;  3FAP B;  4WJ0 A;  2JPU A;  4KBL A;  1J8Y F;  1LKX A;  5KYW B;  3G4X A;  3DAF A;  3DZA A;  4IWB A;  4DJ9 A;  5B3I A;  2OG2 A;  2Y69 C;  3TOM A;  5JS5 A;  1IW7 F;  1ZZP A;  4KNV A;  2VCA A;  3M79 A;  1SR2 A;  2VCB A;  5L0G A;  5COF A;  2HV7 A;  1IZM A;  1LI7 A;  1N1C A;  1ST6 A;  1MND A;  3FXH A;  1SYQ A;  3OWT A;  2HKV A;  5E3A A;  2WZG A;  2H8A A;  4Q4Z F;  1VTM P;  3DAG A;  4PR9 A;  3KMI A;  2EIL C;  3B0V C;  4WGZ A;  1V55 C;  4O79 A;  4NCQ A;  4XEK A;  4AL1 A;  1C02 A;  1BDJ B;  1WAS A;  4IAQ A;  2FFH A;  3DE8 A;  4P6I C;  1VLT A;  2A68 F;  1YZA A;  1Z5Z A;  5AC4 A;  3KYJ A;  3TQO A;  1C17 M;  4CIH A;  5L0I A;  1FNT c;  5HSW A;  3RYL A;  3K33 A;  3H2V A;  2WZF A;  4CS9 C;  3QVZ A;  1VMA A;  3U8P A;  4IJJ A;  1LE4 A;  4IAO A;  4YL0 A;  5KYX A;  4JKV A;  3ZTM A;  5KYN A;  1O87 A;  3F47 A;  1NU7 D;  1YA7 O;  4DRH B;  4XLN F;  2Q4F A;  2CCY A;  4EBJ A;  1Z7Q c;  4EUK B;  3SXY A;  4OIN F;  3U2L A;  1RKC A;  4O6Y A;  3L1M A;  4DVY P;  5BUO A;  4KI2 A;  3C18 A;  1RJ9 A;  5HV9 A;  2JD3 A;  4JEB A;  2EPK X;  3RQE A;  1FAP B;  2IM8 A;  1RKE A;  4DOZ A;  3POV A;  4JTC B;  3WAQ A;  5KYY B;  2Y3B A;  5COM A;  1EI7 A;  1OR2 A;  3A11 A;  1JRA A;  2EPM X;  5E3C A;  3IQT A;  3X2Q C;  4AX2 A;  2FGY A;  4CDV A;  1FR0 A;  2H7B A;  2R7W A;  4BJT A;  5FZT A;  4JEA A;  3W2W A;  2L6F A;  1TFO B;  2R03 A;  1VOM A;  1ZHW A;  3N2Z B;  1VLS A;  5DLJ A;  2KSF A;  3Q7L A;  3LUT B;  4E0I A;  1YJG A;  2XL4 A;  3CZ6 A;  3EGD B;  4RBN A;  1CGM E;  3IQC A;  3K7D A;  4JIO A;  2J7P D;  3WOD F;  4BPM A;  1Q0K A;  4F4B A;  3CQZ A;  1OXB A;  1Z3I X;  1LIH A;  2O9X A;  1H9G A;  2QUP A;  3M4B A;  3NKD A;  3QW1 A;  3HKK A;  3QW0 A;  4JVS A;  1CGN A;  4LDQ A;  4MQ9 F;  3SXK A;  3ZWI A;  4XLP F;  4X0R A;  2GWW A;  4HFK B;  3AG3 C;  2G62 A;  4HEA J;  4JC7 A;  4MW3 A;  2J0X A;  3FMS A;  5EGY A;  3L34 A;  5K0I A;  5BQH A;  3Q6N A;  1VYI A;  4J7Y A;  2R9R B;  3DWW A;  2J46 A;  2RD9 A;  1MMG A;  2M64 A;  2WVQ A;  1T6I A;  3JT1 A;  3LNR A;  4N4W A;  2X51 A;  4JUR I;  4YK5 A;  1RMV A;  1EQ1 A;  4J32 B;  2MYS A;  3CEX A; 
#chains in the Genus database with same CATH homology
 1E83 A;  4JE9 A;  4ULV A;  1EKY A;  3FOP A;  1QPU A;  2YL7 A;  2XM0 A;  4IAR A;  2XLE A;  3NMK A;  4L6R A;  2XLH A;  4D4N A;  2YL1 A;  1LM3 B;  3NMI A;  2YKZ A;  1CPR A;  3HNK A;  2YL0 A;  1E86 A;  1CGO A;  5AGF A;  1A7V A;  1JAF A;  3HNI A;  2XLD A;  1CPQ A;  2XM4 A;  1E84 A;  5JRA A;  3M4C A;  3NMJ A;  3ZQV A;  5JLI A;  3FOO A;  2XLV A;  5B3I A;  3HNL A;  3TOM A;  4EIY A;  5JS5 A;  5JP7 A;  2YLD A;  3M79 A;  4CJO A;  1BBH A;  2XLW A;  1GQA A;  1YYX A;  1S05 A;  3C63 A;  3IQ6 A;  4CJG A;  2YLG A;  4WGZ A;  4U9E A;  2BC5 A;  3TOL A;  4D4X A;  4ER9 A;  5JUA A;  4IAQ A;  3DE8 A;  3VRC A;  1YZA A;  3ZQY A;  2XLM A;  3QVZ A;  4CDY A;  3U8P A;  4JKV A;  3ZTM A;  2CCY A;  4CX9 A;  1M6T A;  3L1M A;  3QVY A;  256B A;  5JVE A;  4JEB A;  2XL6 A;  4U9D A;  2QLA A;  3HNJ A;  2XL8 A;  4CDV A;  3C62 A;  2J9B A;  1APC A;  1QQ3 A;  4JEA A;  4WGY A;  4CIP A;  4CDA A;  1YYJ A;  1MQV A;  1NBB A;  3M15 A;  3M4B A;  3QW0 A;  3QW1 A;  4N6H A;  4NC3 A;  3ZWI A;  1CGN A;  1YZC A;  3DE9 A;  5JT4 A;  2YL3 A;  3IQ5 A;  1RCP A;  2YLI A;  1E85 A;  3ZTZ A;  5JSL A;  2XLO A;  4IB4 A;  4N4W A;  2J8W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...