2YL3A

Cytochrome c prime from alcaligenes xylosoxidans: carbon monooxide bound l16g variant at 1.04 a resolution - restraint refined
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
126
structure length
126
Chain Sequence
b'EFAKPEDAVKYRQSAGTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Carbon Monoxide Poisoning is Prevented by the Energy Costs of Conformational Changes in Gas- Binding Haemproteins.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
total genus 51
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2011-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2yl3A00
3C62A 4IARA 5JSLA 4CIPA 1E85A 2XLEA 2YL1A 3TOLA 3M4CA 4U9DA 3M15A 2XL8A 2YL7A 1A7VA 3NMJA 1QQ3A 1GQAA 2YLIA 3ZQVA 3TOMA 4EIYA 2XLOA 3DE9A 5JLIA 2BC5A 5AGFA 2XLWA 3ZWIA 5JRAA 3HNLA 4ER9A 1JAFA 4ULVA 4NC3A 3IQ6A 4WGZA 3HNKA 1YZAA 4CDYA 3HNJA 4JEAA 4U9EA 2YLGA 5JT4A 5JS5A 4N6HA 4WGYA 2XLHA 2J9BA 1MQVA 1E86A 3FOOA 4JEBA 1RCPA 4JKVA 3IQ5A 3ZQYA 2QLAA 3QW0A 4IB4A 3M79A 1E83A 4IAQA 256BA 1S05A 1LM3B 2XM0A 3VRCA 1CPQA 5JUAA 2YKZA 3NMIA 1CGNA 2XL6A 3QW1A 4CDVA 4CJGA 4CX9A 1CGOA 3ZTZA 1BBHA 4CDAA 3FOPA 1YZCA 3U8PA 2YLDA 1M6TA 3QVZA 2YL0A 2XLVA 4L6RA 5B3IA 1E84A 2CCYA 1YYXA 3ZTMA 3C63A 3L1MA 4D4XA 4D4NA 3DE8A 3HNIA 1YYJA 1APCA 3QVYA 2XM4A 1CPRA 1NBBA 2YL3A 4CJOA 2XLDA 4JE9A 5JP7A 1QPUA 1EKYA 2J8WA 4N4WA 3NMKA 3M4BA 5JVEA 2XLMA
chains in the Genus database with same CATH superfamily
1T6QA 5DS6A 3N0TA 4EBJA 4CS7A 2HS5A 3U8VA 4CIPA 4MVUA 1ZHWA 1EI7A 1U0BB 4U9DA 1SYQA 1PD1A 3RFYA 3A9CA 1VMAA 1Z7Qc 4U5HA 2QE9A 1A7VA 2IM8A 3CAXA 3EG9B 3NMJA 4O7GA 1TWHA 3JZ0A 1T5OA 1ZU5A 1V74B 2X51A 2OQMA 4MW3A 1QQ3A 1M2OA 4XWJA 5KYXA 2R7XA 4EIYA 1J8MF 5HSWA 2G3KA 5JLIA 1L3PA 1ZU4A 3LNRA 3S29A 4W8PA 3EGXA 4U5DE 5KYUB 4PJLA 1JAFA 3JYYA 3JT1A 2NSFA 1M2VB 4WGZA 2LCHA 3HNKA 4YK5A 4CS9A 1Q0KA 4YT2A 3X1OA 1FMWA 3ABKC 3B0UX 1LS4A 4H54A 3ATPA 3ZSUA 1FNTc 2R25A 2L81A 2Q9BA 1WWPA 2A6EF 4ULWA 1UG7A 2W45A 4IWBA 1EQ1A 4JEAA 4C7OB 4IGGA 2JX0A 2AU5A 4N6HA 1QVXA 2UUHA 2XLHA 3CZ6A 4YJWA 5E2QA 1U6HA 4C3BA 2L6GA 1E86A 2IXPA 3VYWA 5A69A 1Z6AA 4JKVA 4JW1A 2HJMA 3EHMA 2OJED 3G50A 2EIMC 1WGWA 2J9VA 3MYIA 1V54C 2LD6A 3OEOA 1V55C 4DVZA 4E0IA 1IZMA 256BA 2KW3C 2HSBA 1S05A 3K1IA 4I3MA 4DOZA 4F4BA 4G7OF 2R05A 3S0XA 1RMVA 2KQ9A 3S9OA 1JR8A 2LIGA 2XM0A 3AG4C 5L0GA 1CPQA 1HE1A 2L9JA 2M4EA 3X2QC 2YKZA 3NMIA 1PCXA 2LK4A 2YQYA 4YL3A 3DMDA 1OW8A 1TWGA 3SP1A 3POVA 3O10A 2NUPB 4IRUA 3G4XA 3DJUB 4LDKA 1JPNA 1BBHA 4MTFA 3V5YA 2ZXPA 4R32A 4WABA 2AVKA 1HE9A 3DJNB 4JJFA 1MMAA 3FOPA 3W4YA 3KH2A 1DOWA 2Y39A 3EPVA 2VCBA 2GDCA 2ZXWC 4PR9A 2CYDA 2R7SA 1C03A 2VB6A 2VCAA 2OOCA 1E2XA 2J9UA 2KNHA 1HW2A 2EPKX 1SMYF 4KNVA 2YL0A 3UGPA 4L6RA 2CNWA 3LLIA 1E84A 5DS5A 2CCYA 2GA0A 2AP3A 1K04A 1ZHTA 1RJ9B 2Z15A 2QNLA 2O9XA 4BJ5C 1WN0A 5FZTA 3U0CA 2P1AA 3DD7A 3GEEA 2ASRA 1NU9C 4MVZA 4AX2A 3DZAA 1PV3A 1Q0MA 3DAFA 2XM4A 3KL4A 1CPRA 4MVMA 3EHNA 2KK1A 5D92A 3H65A 2Y3BA 2R7QA 2WVNA 2XLDA 4QDLA 5L3VA 3W2WA 4E7ZA 1AEPA 1QPUA 4YL0A 4OINF 4KI2A 4Z9IA 3MX3A 4NTFA 1WATA 3WG7C 2TMVP 1JPJA 3ABMC 3CQZA 2J8WA 2CGEA 2LSEA 2ZPAA 3C8ZA 3NMKA 4LDRA 4N4WA 4RBNA 3KYJA 5JVEA 1JRAA 2NUTA 1XWJA 3U9MA 2GAQA 4DJ9A 2QY9A 3FAPB 1KU2A 3EQLF 4KBLA 4IAOA 5D91A 5EGYA 2PX3A 1YAUO 5EHHA 2BL2A 4DRIB 1D0YA 4LDQA 4QI0A 3W8HA 4AK9A 1A7EA 3EGDA 4PJMA 1ZZPA 4NQFA 4AL1A 3M15A 4M63A 2YL7A 1NSGB 2XS8A 1YLMA 3EZIA 2YRFA 3FHDA 1ZW2A 4OIRF 1MMGA 1T9KA 4XLNF 4MNDA 4CS8C 5F5FA 2NG1A 2EPLX 2Q4FA 3F46A 4BEJA 3CSKA 4IJJA 4ZLCA 1GQAA 5KYWB 1RKEB 3AGTA 3DE9A 5DQZA 2R7WA 2BC5A 1VLSA 1YA7O 1VB5A 1YA9A 2I8BA 2XLWA 2W4MA 3C18A 3C7JA 3IEEA 4NTAA 3ZWIA 4EWCA 4ER9A 1MMNA 3SNHA 5DS4A 5IY5C 3GORA 1VYIA 3GEIA 4NC3A 5KYYA 1JOGA 4E17A 4JIOA 4FWVA 4JCHA 3B71A 2PX0A 1T6UA 1SF8A 4U5GA 4E0HA 4ANJA 2A6HF 2A68F 3EFOA 3EGXB 1H9GA 1I5NA 1YDIA 1F1MA 3AOUA 3O6XA 5JT4A 2CNWD 5A6KA 3UR3C 1ORYA 4RDAA 3AG3C 1U89A 3L8IA 4YT4A 3GWLA 1ZHZA 4JRZA 4Q7CA 3T6GB 4A2NB 1QZXA 5AC5A 3C8GB 4Q5SF 4G7HF 2J9BA 3FAJA 4BJ6C 2EPNA 4MVQA 4A4AA 3RH3A 1JMWA 3I4UA 5EK0A 2CW0F 1VK5A 3Q6NA 2ICWG 2JPUA 3FXHA 3GM2A 3LAYA 3RIPA 5BQGA 1GGQA 4MQ9F 1S7ZA 2EPMX 3ABLC 4OIPF 2XXAB 2Y3HA 2P7VA 5B1BC 4N6CA 2P6VA 4LERA 3UGOA 2VH3A 3ZG1A 1BR1A 1LI7A 2H7VC 2PP4A 3AQBA 2NSGA 2WZGA 4NTBA 1LIHA 2DYRC 3U2MA 1KNYA 3U3FA 1Q0DA 3BEHA 3ZIBA 5L0FA 2R7TA 3IQCA 4XPWA 2XL6A 3T6BA 3E70C 2J0XA 4CX9A 1VTMP 1TFKB 2A69F 3ASOC 1BDJB 4QI2A 1D0ZA 1T6IA 1G4WR 1D1CA 2QUPA 4LLEA 4P6IC 1TR2A 3RQEA 4EUKB 1YZCA 3AQCA 3BRJA 4G0HA 4FAPB 1NU7D 4C3DA 1OXKA 3L8JA 5FCLA 2PBEA 4AE4B 2YLDA 3LJBA 4K7BA 1R5ID 3EG9A 1M6TA 3QVZA 1PD0A 3QZCA 2GFHA 2YEVA 4ONSA 2E87A 5B3IA 2OCCC 3VM6A 1VYKA 5E3AA 3W2VA 3C63A 4D4XA 2DB4A 4J32B 3DE8A 4CIHA 2MHRA 1QSPA 2EINC 2OEVA 2VASA 2J7PA 2PNOA 2XS1A 1T01A 3IQTA 1APCA 1YYJA 5KYUA 1M2VA 1J8YF 3RQGA 1SZIA 2HFIA 1TWCA 2PF4E 5AC4A 4OIQF 5COMA 1C02A 1BR2A 1H9TA 1EKYA 3JTLO 3CEXA 2L7AA 2J46A 4MTGA 4U5CE 1RXQA 4H4KC 4GYTA 4DVYP 5F28E 4Z9JA 4EBKA 4YWQA 4CSAA 3C62A 3PCVA 4IARA 1N1CA 2V26A 1NZEA 5BQIA 5JSLA 2JD3A 4P9TA 1KTMA 1BZ4A 1H6GA 5CI8A 1UFBA 3LEOA 2DGJA 3M4CA 3GANA 3TOLA 3S84A 2R7RA 2AWCA 2XL8A 3GM1A 4YL1A 2G3VA 4XEFA 2IBFA 3T6JA 4DXWA 1I4YA 4XEKA 5L0CA 3WAQA 1WOLA 1Z5ZA 2KSFA 2LQGA 3Q7GA 3VAYA 1CGME 2YLIA 2BE5F 4YT8A 1OW7A 3MFNA 2YWAA 2EIJC 3EGDB 2YVKA 1TWAA 2XLOA 4NY3A 2IYLD 2WZLA 3IHUA 4J7YA 3AG1C 4HFFB 2HV6A 1OKKA 2KC3A 3K6BA 1ST6A 5COGA 3B29A 4BPMA 4DRJB 3HNLA 2Y3GA 4PK4A 3SYNA 1SR2A 4JZAA 2H8AA 2OKUA 3SZRA 2WZFA 4ZLDA 5A6JA 4CS9C 4RD9A 3NKEA 3IPMO 4K1OA 1WASA 4I1OB 2D5RB 3H2VA 4WJ0A 1OCZC 4CDYA 3E9VA 1LPEA 1LVKA 4EBBA 5CI9A 3U9JA 3HNJA 1AUEA 3RF3A 4DBQA 2OU6A 3ZDLA 5JS5A 4FESA 4JC7A 2R7OA 1V4AA 4UDVA 4WGYA 1A0BA 2DI3A 5DLJA 3ZVRA 3O55A 1MNDA 2F22A 2J7PD 1MQVA 3GWNA 1K40A 2RD9A 3FMSA 1RCPA 3NDBB 1LE2A 3IQ5A 1RKCA 2QLAA 2VC9A 2ZD9A 3A11A 2A0BA 2LFDA 3DWWA 3M79A 4IB4A 3S27A 5HV9A 1Y6DA 2FFHA 1QLEC 4U5FE 3RVYA 5A6AA 1D1BA 4W8KA 5L0IA 4IAQA 3K1IC 2L6FA 2DYSC 2VCCA 3RVZA 5KYXB 2HKVA 1TFOB 2Q00A 2WVOA 3TJ6A 4BEMJ 5GPGB 2IXMA 5K0IA 3B0PA 4XLPF 3VRCA 4BJTA 1MMDA 1LS1A 1Y4CA 4G78A 1K05A 4YN0B 5L0DA 4MVOA 3LS1A 5E3CA 3T9OA 4CDVA 4CJGA 3RYLA 5L3QA 3TULA 3AG2C 1AVOB 1G4US 3PDMP 1NLXA 3NG1A 2HZ8A 4I44A 4O6YA 3TJ5A 5DVWA 4Q4ZF 3EZHA 5F5HA 4DBRA 3US6A 2YZSA 2YHSA 1FFTC 4PACA 3L0IA 3KPHA 2H7OA 1VOMA 2W9YA 4FX5A 3JRTA 3H2UA 3UNGC 1R4TA 3NYJA 5A6BD 3UMKA 1Z23A 1OKKD 2UUIA 3ZC4A 3S90A 4O6NA 1FMVA 4NCQA 1LKXA 5KYWA 1YARO 2I15A 2WL8A 2HMZA 1RKEA 3DM9B 3ZTMA 1B68A 2Q3TA 5BQHA 3L1MA 4XTKA 4BJ5A 2HV7A 2KYHA 2V3CC 4HE8D 4U5BE 5COFA 4PJJA 3HNIA 3W8IA 2EPOA 4O6MA 5T3TA 4HEAJ 4E18A 3R2PA 3TK0A 3EH2A 4DRHB 3QVYA 3KKBA 3S28A 2EIKC 2W4BA 2YL3A 4JTDB 4CJOA 3T4RA 2R7VA 2J9WA 4C7OA 4YT5A 3LEVA 4JE9A 4MVRA 5JP7A 3PMRA 1ZYRF 1M57C 2FAPB 4LACB 4XEVA 3TQOA 4PJNA 2Y69C 1HW1A 2ETSA 2IXOA 3M4BA 3LESA 2XLMA 4J7TA 1MNEA 2HMQA 1ZW3A 3DAGA 1IW7F 4K0DA 1VLTA 3V5ZA 3C8GA 1E85A 1NG1A 1XZPA 2XLEA 2YL1A 1O87A 4GQHA 1ORSC 3K1HA 4C3EA 5B1AC 1OW6A 3HJCA 1BR4A 1TKNA 2HJ3A 2L6HA 2Q9AA 4JURI 4MVSA 2HSQA 3EJNA 3GODA 5BUOA 1QKRA 5CIVA 1ZHXA 2WB7A 1LI5A 1YVIA 2KJGA 2RSEB 4CS8A 1A41A 1WTYA 3SXMA 3ZQVA 4MTOA 3TOMA 4OIOF 2XXAA 1H7IA 1W2WA 1NFNA 2B0JA 1Q0GA 5AGFA 3F47A 3UMIA 1GM5A 5JRAA 1EA8A 4P9FA 5T1DB 4ULVA 3PHF2 2B0HA 1D0XA 2CDQA 3IQ6A 3SEOA 1DOVA 3MYFA 3I5PA 1TQGA 3LS0A 5TJ5E 4G7ZF 3K33A 4CBEA 1HY5A 3G4ZA 1YZAA 2R02A 3K7DA 2KGOA 3AJMA 3LNMB 2J0WA 4E7SA 4OD4A 2R03A 3WODF 1OR3A 4MS2A 4J30B 2P0NA 2YLGA 4U9EA 4N06A 3JYHA 2NUTB 2A0UA 4AL0A 3B9QA 3HTKC 3Q6MA 3U3BA 4AE4A 2Y3DA 3QMKA 5DQTA 3DKAA 4BG0A 3JSZA 1HMOA 2M64A 2H7BA 3VF0A 2EILC 2Q9CA 3J06A 1G5ZA 1M56C 1O3UA 3FOOA 4BJ6A 4JEBA 4MW8A 1HMDA 4KNWA 2IOQA 3GEHA 5A6BA 2ZXRA 3V5XA 5L0JA 3ZQYA 2GWWA 3HKKA 3NYLA 3QW0A 3FDQA 1Z63A 2OJQA 1E83A 2XL4A 2HUJA 3ECSA 4JJGA 4PFPA 2MWQA 4XQ1A 2OG2A 3U2LA 1O5HA 2NUPA 1LM3B 3I5QA 3FVYA 3DM5A 3Q7LA 1ORJA 1FFHA 3SXZA 1ZVZA 1OXBA 3UMHA 4BJ1A 3NKDA 4XPXA 5JUAA 3C8GD 1CGNA 3GM3A 3R7CA 5KYYB 3L34A 1OCRC 2NPUA 3QW1A 3SXKA 1A7DA 1FR0A 1C17M 4Z9HA 3DXJF 1XZQA 2OEXA 2QTVA 1CGOA 3ZTZA 2R7UA 1OQCA 3QTHA 3EH1A 3M1CB 4EHPA 1G8XA 3KMIA 4CDAA 3EFOB 1YJGA 2LFFA 3JSEO 5T3WA 3NYMA 3TD7A 2X0CA 5L0HA 5KYNA 3NRHA 1OCCC 2Q7RA 1RJ9A 3JRMO 3K66A 4JTAB 3RW0A 4JTCB 1OR2A 3U8PA 2XRHA 4EKWA 3RQFA 3SXYA 3B0VC 2XLVA 4LLCA 3N24A 1FTSA 2C04A 2ZXOA 1YYXA 3WHNA 3RKOF 4U5EE 3HLZA 3ASNC 3DI5A 1I4ZA 2D4UA 4O79A 4OD5A 2PFDA 4XPYA 1GS9A 1LE4A 2IXNA 2XSEA 4B6IA 4D4NA 4GEHA 4HFKB 2WVQA 2G62A 4X0RA 3KYIA 2AWYA 3LUTB 3AGUA 3U5SA 5B3SC 1ZHYA 3OWTA 3MBGA 1NBBA 4I1MA 4JCZA 1D1AA 3ITFA 3LLKA 2P61A 4KC9A 3MLGA 4PFOA 3OA1A 3JCUQ 4JVSA 1Q0FA 2LP4A 3O39A 5E33A 2FGYA 3V7OA 3N2ZB 1NFOA 2J45A 1Z3IX 1OCOC 2MYSA 2R9RB 1FAPB 2C03A 4CSAC 1L7CA 2A1DD
chains in the Genus database with same CATH topology
3C62A 4IARA 5JSLA 4CIPA 1E85A 2XLEA 2YL1A 3TOLA 3M4CA 4U9DA 3M15A 2XL8A 2YL7A 1A7VA 3NMJA 1QQ3A 1GQAA 2YLIA 3ZQVA 3TOMA 4EIYA 2XLOA 3DE9A 5JLIA 2BC5A 5AGFA 2XLWA 3ZWIA 5JRAA 3HNLA 4ER9A 1JAFA 4ULVA 4NC3A 3IQ6A 4WGZA 3HNKA 1YZAA 4CDYA 3HNJA 4JEAA 4U9EA 2YLGA 5JT4A 5JS5A 4N6HA 4WGYA 2XLHA 2J9BA 1MQVA 1E86A 3FOOA 4JEBA 1RCPA 4JKVA 3IQ5A 3ZQYA 2QLAA 3QW0A 4IB4A 3M79A 1E83A 4IAQA 256BA 1S05A 1LM3B 2XM0A 3VRCA 1CPQA 5JUAA 2YKZA 3NMIA 1CGNA 2XL6A 3QW1A 4CDVA 4CJGA 4CX9A 1CGOA 3ZTZA 1BBHA 4CDAA 3FOPA 1YZCA 3U8PA 2YLDA 1M6TA 3QVZA 2YL0A 2XLVA 4L6RA 5B3IA 1E84A 2CCYA 1YYXA 3ZTMA 3C63A 3L1MA 4D4XA 4D4NA 3DE8A 3HNIA 1YYJA 1APCA 3QVYA 2XM4A 1CPRA 1NBBA 2YL3A 4CJOA 2XLDA 4JE9A 5JP7A 1QPUA 1EKYA 2J8WA 4N4WA 3NMKA 3M4BA 5JVEA 2XLMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C62 A;  4IAR A;  5JSL A;  4CIP A;  1E85 A;  2XLE A;  2YL1 A;  3TOL A;  3M4C A;  4U9D A;  3M15 A;  2XL8 A;  2YL7 A;  1A7V A;  3NMJ A;  1QQ3 A;  1GQA A;  2YLI A;  3ZQV A;  3TOM A;  4EIY A;  2XLO A;  3DE9 A;  5JLI A;  2BC5 A;  5AGF A;  2XLW A;  3ZWI A;  5JRA A;  3HNL A;  4ER9 A;  1JAF A;  4ULV A;  4NC3 A;  3IQ6 A;  4WGZ A;  3HNK A;  1YZA A;  4CDY A;  3HNJ A;  4JEA A;  4U9E A;  2YLG A;  5JT4 A;  5JS5 A;  4N6H A;  4WGY A;  2XLH A;  2J9B A;  1MQV A;  1E86 A;  3FOO A;  4JEB A;  1RCP A;  4JKV A;  3IQ5 A;  3ZQY A;  2QLA A;  3QW0 A;  4IB4 A;  3M79 A;  1E83 A;  4IAQ A;  256B A;  1S05 A;  1LM3 B;  2XM0 A;  3VRC A;  1CPQ A;  5JUA A;  2YKZ A;  3NMI A;  1CGN A;  2XL6 A;  3QW1 A;  4CDV A;  4CJG A;  4CX9 A;  1CGO A;  3ZTZ A;  1BBH A;  4CDA A;  3FOP A;  1YZC A;  3U8P A;  2YLD A;  1M6T A;  3QVZ A;  2YL0 A;  2XLV A;  4L6R A;  5B3I A;  1E84 A;  2CCY A;  1YYX A;  3ZTM A;  3C63 A;  3L1M A;  4D4X A;  4D4N A;  3DE8 A;  3HNI A;  1YYJ A;  1APC A;  3QVY A;  2XM4 A;  1CPR A;  1NBB A;  2YL3 A;  4CJO A;  2XLD A;  4JE9 A;  5JP7 A;  1QPU A;  1EKY A;  2J8W A;  4N4W A;  3NMK A;  3M4B A;  5JVE A;  2XLM A; 
#chains in the Genus database with same CATH topology
 1T6Q A;  5DS6 A;  3N0T A;  4EBJ A;  4CS7 A;  2HS5 A;  3U8V A;  4CIP A;  4MVU A;  1ZHW A;  1EI7 A;  1U0B B;  4U9D A;  1SYQ A;  1PD1 A;  3RFY A;  3A9C A;  1VMA A;  1Z7Q c;  4U5H A;  2QE9 A;  1A7V A;  2IM8 A;  3CAX A;  3EG9 B;  3NMJ A;  4O7G A;  1TWH A;  3JZ0 A;  1T5O A;  1ZU5 A;  1V74 B;  2X51 A;  2OQM A;  4MW3 A;  1QQ3 A;  1M2O A;  4XWJ A;  5KYX A;  2R7X A;  4EIY A;  1J8M F;  5HSW A;  2G3K A;  5JLI A;  1L3P A;  1ZU4 A;  3LNR A;  3S29 A;  4W8P A;  3EGX A;  4U5D E;  5KYU B;  4PJL A;  1JAF A;  3JYY A;  3JT1 A;  2NSF A;  1M2V B;  4WGZ A;  2LCH A;  3HNK A;  4YK5 A;  4CS9 A;  1Q0K A;  4YT2 A;  3X1O A;  1FMW A;  3ABK C;  3B0U X;  1LS4 A;  4H54 A;  3ATP A;  3ZSU A;  1FNT c;  2R25 A;  2L81 A;  2Q9B A;  1WWP A;  2A6E F;  4ULW A;  1UG7 A;  2W45 A;  4IWB A;  1EQ1 A;  4JEA A;  4C7O B;  4IGG A;  2JX0 A;  2AU5 A;  4N6H A;  1QVX A;  2UUH A;  2XLH A;  3CZ6 A;  4YJW A;  5E2Q A;  1U6H A;  4C3B A;  2L6G A;  1E86 A;  2IXP A;  3VYW A;  5A69 A;  1Z6A A;  4JKV A;  4JW1 A;  2HJM A;  3EHM A;  2OJE D;  3G50 A;  2EIM C;  1WGW A;  2J9V A;  3MYI A;  1V54 C;  2LD6 A;  3OEO A;  1V55 C;  4DVZ A;  4E0I A;  1IZM A;  256B A;  2KW3 C;  2HSB A;  1S05 A;  3K1I A;  4I3M A;  4DOZ A;  4F4B A;  4G7O F;  2R05 A;  3S0X A;  1RMV A;  2KQ9 A;  3S9O A;  1JR8 A;  2LIG A;  2XM0 A;  3AG4 C;  5L0G A;  1CPQ A;  1HE1 A;  2L9J A;  2M4E A;  3X2Q C;  2YKZ A;  3NMI A;  1PCX A;  2LK4 A;  2YQY A;  4YL3 A;  3DMD A;  1OW8 A;  1TWG A;  3SP1 A;  3POV A;  3O10 A;  2NUP B;  4IRU A;  3G4X A;  3DJU B;  4LDK A;  1JPN A;  1BBH A;  4MTF A;  3V5Y A;  2ZXP A;  4R32 A;  4WAB A;  2AVK A;  1HE9 A;  3DJN B;  4JJF A;  1MMA A;  3FOP A;  3W4Y A;  3KH2 A;  1DOW A;  2Y39 A;  3EPV A;  2VCB A;  2GDC A;  2ZXW C;  4PR9 A;  2CYD A;  2R7S A;  1C03 A;  2VB6 A;  2VCA A;  2OOC A;  1E2X A;  2J9U A;  2KNH A;  1HW2 A;  2EPK X;  1SMY F;  4KNV A;  2YL0 A;  3UGP A;  4L6R A;  2CNW A;  3LLI A;  1E84 A;  5DS5 A;  2CCY A;  2GA0 A;  2AP3 A;  1K04 A;  1ZHT A;  1RJ9 B;  2Z15 A;  2QNL A;  2O9X A;  4BJ5 C;  1WN0 A;  5FZT A;  3U0C A;  2P1A A;  3DD7 A;  3GEE A;  2ASR A;  1NU9 C;  4MVZ A;  4AX2 A;  3DZA A;  1PV3 A;  1Q0M A;  3DAF A;  2XM4 A;  3KL4 A;  1CPR A;  4MVM A;  3EHN A;  2KK1 A;  5D92 A;  3H65 A;  2Y3B A;  2R7Q A;  2WVN A;  2XLD A;  4QDL A;  5L3V A;  3W2W A;  4E7Z A;  1AEP A;  1QPU A;  4YL0 A;  4OIN F;  4KI2 A;  4Z9I A;  3MX3 A;  4NTF A;  1WAT A;  3WG7 C;  2TMV P;  1JPJ A;  3ABM C;  3CQZ A;  2J8W A;  2CGE A;  2LSE A;  2ZPA A;  3C8Z A;  3NMK A;  4LDR A;  4N4W A;  4RBN A;  3KYJ A;  5JVE A;  1JRA A;  2NUT A;  1XWJ A;  3U9M A;  2GAQ A;  4DJ9 A;  2QY9 A;  3FAP B;  1KU2 A;  3EQL F;  4KBL A;  4IAO A;  5D91 A;  5EGY A;  2PX3 A;  1YAU O;  5EHH A;  2BL2 A;  4DRI B;  1D0Y A;  4LDQ A;  4QI0 A;  3W8H A;  4AK9 A;  1A7E A;  3EGD A;  4PJM A;  1ZZP A;  4NQF A;  4AL1 A;  3M15 A;  4M63 A;  2YL7 A;  1NSG B;  2XS8 A;  1YLM A;  3EZI A;  2YRF A;  3FHD A;  1ZW2 A;  4OIR F;  1MMG A;  1T9K A;  4XLN F;  4MND A;  4CS8 C;  5F5F A;  2NG1 A;  2EPL X;  2Q4F A;  3F46 A;  4BEJ A;  3CSK A;  4IJJ A;  4ZLC A;  1GQA A;  5KYW B;  1RKE B;  3AGT A;  3DE9 A;  5DQZ A;  2R7W A;  2BC5 A;  1VLS A;  1YA7 O;  1VB5 A;  1YA9 A;  2I8B A;  2XLW A;  2W4M A;  3C18 A;  3C7J A;  3IEE A;  4NTA A;  3ZWI A;  4EWC A;  4ER9 A;  1MMN A;  3SNH A;  5DS4 A;  5IY5 C;  3GOR A;  1VYI A;  3GEI A;  4NC3 A;  5KYY A;  1JOG A;  4E17 A;  4JIO A;  4FWV A;  4JCH A;  3B71 A;  2PX0 A;  1T6U A;  1SF8 A;  4U5G A;  4E0H A;  4ANJ A;  2A6H F;  2A68 F;  3EFO A;  3EGX B;  1H9G A;  1I5N A;  1YDI A;  1F1M A;  3AOU A;  3O6X A;  5JT4 A;  2CNW D;  5A6K A;  3UR3 C;  1ORY A;  4RDA A;  3AG3 C;  1U89 A;  3L8I A;  4YT4 A;  3GWL A;  1ZHZ A;  4JRZ A;  4Q7C A;  3T6G B;  4A2N B;  1QZX A;  5AC5 A;  3C8G B;  4Q5S F;  4G7H F;  2J9B A;  3FAJ A;  4BJ6 C;  2EPN A;  4MVQ A;  4A4A A;  3RH3 A;  1JMW A;  3I4U A;  5EK0 A;  2CW0 F;  1VK5 A;  3Q6N A;  2ICW G;  2JPU A;  3FXH A;  3GM2 A;  3LAY A;  3RIP A;  5BQG A;  1GGQ A;  4MQ9 F;  1S7Z A;  2EPM X;  3ABL C;  4OIP F;  2XXA B;  2Y3H A;  2P7V A;  5B1B C;  4N6C A;  2P6V A;  4LER A;  3UGO A;  2VH3 A;  3ZG1 A;  1BR1 A;  1LI7 A;  2H7V C;  2PP4 A;  3AQB A;  2NSG A;  2WZG A;  4NTB A;  1LIH A;  2DYR C;  3U2M A;  1KNY A;  3U3F A;  1Q0D A;  3BEH A;  3ZIB A;  5L0F A;  2R7T A;  3IQC A;  4XPW A;  2XL6 A;  3T6B A;  3E70 C;  2J0X A;  4CX9 A;  1VTM P;  1TFK B;  2A69 F;  3ASO C;  1BDJ B;  4QI2 A;  1D0Z A;  1T6I A;  1G4W R;  1D1C A;  2QUP A;  4LLE A;  4P6I C;  1TR2 A;  3RQE A;  4EUK B;  1YZC A;  3AQC A;  3BRJ A;  4G0H A;  4FAP B;  1NU7 D;  4C3D A;  1OXK A;  3L8J A;  5FCL A;  2PBE A;  4AE4 B;  2YLD A;  3LJB A;  4K7B A;  1R5I D;  3EG9 A;  1M6T A;  3QVZ A;  1PD0 A;  3QZC A;  2GFH A;  2YEV A;  4ONS A;  2E87 A;  5B3I A;  2OCC C;  3VM6 A;  1VYK A;  5E3A A;  3W2V A;  3C63 A;  4D4X A;  2DB4 A;  4J32 B;  3DE8 A;  4CIH A;  2MHR A;  1QSP A;  2EIN C;  2OEV A;  2VAS A;  2J7P A;  2PNO A;  2XS1 A;  1T01 A;  3IQT A;  1APC A;  1YYJ A;  5KYU A;  1M2V A;  1J8Y F;  3RQG A;  1SZI A;  2HFI A;  1TWC A;  2PF4 E;  5AC4 A;  4OIQ F;  5COM A;  1C02 A;  1BR2 A;  1H9T A;  1EKY A;  3JTL O;  3CEX A;  2L7A A;  2J46 A;  4MTG A;  4U5C E;  1RXQ A;  4H4K C;  4GYT A;  4DVY P;  5F28 E;  4Z9J A;  4EBK A;  4YWQ A;  4CSA A;  3C62 A;  3PCV A;  4IAR A;  1N1C A;  2V26 A;  1NZE A;  5BQI A;  5JSL A;  2JD3 A;  4P9T A;  1KTM A;  1BZ4 A;  1H6G A;  5CI8 A;  1UFB A;  3LEO A;  2DGJ A;  3M4C A;  3GAN A;  3TOL A;  3S84 A;  2R7R A;  2AWC A;  2XL8 A;  3GM1 A;  4YL1 A;  2G3V A;  4XEF A;  2IBF A;  3T6J A;  4DXW A;  1I4Y A;  4XEK A;  5L0C A;  3WAQ A;  1WOL A;  1Z5Z A;  2KSF A;  2LQG A;  3Q7G A;  3VAY A;  1CGM E;  2YLI A;  2BE5 F;  4YT8 A;  1OW7 A;  3MFN A;  2YWA A;  2EIJ C;  3EGD B;  2YVK A;  1TWA A;  2XLO A;  4NY3 A;  2IYL D;  2WZL A;  3IHU A;  4J7Y A;  3AG1 C;  4HFF B;  2HV6 A;  1OKK A;  2KC3 A;  3K6B A;  1ST6 A;  5COG A;  3B29 A;  4BPM A;  4DRJ B;  3HNL A;  2Y3G A;  4PK4 A;  3SYN A;  1SR2 A;  4JZA A;  2H8A A;  2OKU A;  3SZR A;  2WZF A;  4ZLD A;  5A6J A;  4CS9 C;  4RD9 A;  3NKE A;  3IPM O;  4K1O A;  1WAS A;  4I1O B;  2D5R B;  3H2V A;  4WJ0 A;  1OCZ C;  4CDY A;  3E9V A;  1LPE A;  1LVK A;  4EBB A;  5CI9 A;  3U9J A;  3HNJ A;  1AUE A;  3RF3 A;  4DBQ A;  2OU6 A;  3ZDL A;  5JS5 A;  4FES A;  4JC7 A;  2R7O A;  1V4A A;  4UDV A;  4WGY A;  1A0B A;  2DI3 A;  5DLJ A;  3ZVR A;  3O55 A;  1MND A;  2F22 A;  2J7P D;  1MQV A;  3GWN A;  1K40 A;  2RD9 A;  3FMS A;  1RCP A;  3NDB B;  1LE2 A;  3IQ5 A;  1RKC A;  2QLA A;  2VC9 A;  2ZD9 A;  3A11 A;  2A0B A;  2LFD A;  3DWW A;  3M79 A;  4IB4 A;  3S27 A;  5HV9 A;  1Y6D A;  2FFH A;  1QLE C;  4U5F E;  3RVY A;  5A6A A;  1D1B A;  4W8K A;  5L0I A;  4IAQ A;  3K1I C;  2L6F A;  2DYS C;  2VCC A;  3RVZ A;  5KYX B;  2HKV A;  1TFO B;  2Q00 A;  2WVO A;  3TJ6 A;  4BEM J;  5GPG B;  2IXM A;  5K0I A;  3B0P A;  4XLP F;  3VRC A;  4BJT A;  1MMD A;  1LS1 A;  1Y4C A;  4G78 A;  1K05 A;  4YN0 B;  5L0D A;  4MVO A;  3LS1 A;  5E3C A;  3T9O A;  4CDV A;  4CJG A;  3RYL A;  5L3Q A;  3TUL A;  3AG2 C;  1AVO B;  1G4U S;  3PDM P;  1NLX A;  3NG1 A;  2HZ8 A;  4I44 A;  4O6Y A;  3TJ5 A;  5DVW A;  4Q4Z F;  3EZH A;  5F5H A;  4DBR A;  3US6 A;  2YZS A;  2YHS A;  1FFT C;  4PAC A;  3L0I A;  3KPH A;  2H7O A;  1VOM A;  2W9Y A;  4FX5 A;  3JRT A;  3H2U A;  3UNG C;  1R4T A;  3NYJ A;  5A6B D;  3UMK A;  1Z23 A;  1OKK D;  2UUI A;  3ZC4 A;  3S90 A;  4O6N A;  1FMV A;  4NCQ A;  1LKX A;  5KYW A;  1YAR O;  2I15 A;  2WL8 A;  2HMZ A;  1RKE A;  3DM9 B;  3ZTM A;  1B68 A;  2Q3T A;  5BQH A;  3L1M A;  4XTK A;  4BJ5 A;  2HV7 A;  2KYH A;  2V3C C;  4HE8 D;  4U5B E;  5COF A;  4PJJ A;  3HNI A;  3W8I A;  2EPO A;  4O6M A;  5T3T A;  4HEA J;  4E18 A;  3R2P A;  3TK0 A;  3EH2 A;  4DRH B;  3QVY A;  3KKB A;  3S28 A;  2EIK C;  2W4B A;  2YL3 A;  4JTD B;  4CJO A;  3T4R A;  2R7V A;  2J9W A;  4C7O A;  4YT5 A;  3LEV A;  4JE9 A;  4MVR A;  5JP7 A;  3PMR A;  1ZYR F;  1M57 C;  2FAP B;  4LAC B;  4XEV A;  3TQO A;  4PJN A;  2Y69 C;  1HW1 A;  2ETS A;  2IXO A;  3M4B A;  3LES A;  2XLM A;  4J7T A;  1MNE A;  2HMQ A;  1ZW3 A;  3DAG A;  1IW7 F;  4K0D A;  1VLT A;  3V5Z A;  3C8G A;  1E85 A;  1NG1 A;  1XZP A;  2XLE A;  2YL1 A;  1O87 A;  4GQH A;  1ORS C;  3K1H A;  4C3E A;  5B1A C;  1OW6 A;  3HJC A;  1BR4 A;  1TKN A;  2HJ3 A;  2L6H A;  2Q9A A;  4JUR I;  4MVS A;  2HSQ A;  3EJN A;  3GOD A;  5BUO A;  1QKR A;  5CIV A;  1ZHX A;  2WB7 A;  1LI5 A;  1YVI A;  2KJG A;  2RSE B;  4CS8 A;  1A41 A;  1WTY A;  3SXM A;  3ZQV A;  4MTO A;  3TOM A;  4OIO F;  2XXA A;  1H7I A;  1W2W A;  1NFN A;  2B0J A;  1Q0G A;  5AGF A;  3F47 A;  3UMI A;  1GM5 A;  5JRA A;  1EA8 A;  4P9F A;  5T1D B;  4ULV A;  3PHF 2;  2B0H A;  1D0X A;  2CDQ A;  3IQ6 A;  3SEO A;  1DOV A;  3MYF A;  3I5P A;  1TQG A;  3LS0 A;  5TJ5 E;  4G7Z F;  3K33 A;  4CBE A;  1HY5 A;  3G4Z A;  1YZA A;  2R02 A;  3K7D A;  2KGO A;  3AJM A;  3LNM B;  2J0W A;  4E7S A;  4OD4 A;  2R03 A;  3WOD F;  1OR3 A;  4MS2 A;  4J30 B;  2P0N A;  2YLG A;  4U9E A;  4N06 A;  3JYH A;  2NUT B;  2A0U A;  4AL0 A;  3B9Q A;  3HTK C;  3Q6M A;  3U3B A;  4AE4 A;  2Y3D A;  3QMK A;  5DQT A;  3DKA A;  4BG0 A;  3JSZ A;  1HMO A;  2M64 A;  2H7B A;  3VF0 A;  2EIL C;  2Q9C A;  3J06 A;  1G5Z A;  1M56 C;  1O3U A;  3FOO A;  4BJ6 A;  4JEB A;  4MW8 A;  1HMD A;  4KNW A;  2IOQ A;  3GEH A;  5A6B A;  2ZXR A;  3V5X A;  5L0J A;  3ZQY A;  2GWW A;  3HKK A;  3NYL A;  3QW0 A;  3FDQ A;  1Z63 A;  2OJQ A;  1E83 A;  2XL4 A;  2HUJ A;  3ECS A;  4JJG A;  4PFP A;  2MWQ A;  4XQ1 A;  2OG2 A;  3U2L A;  1O5H A;  2NUP A;  1LM3 B;  3I5Q A;  3FVY A;  3DM5 A;  3Q7L A;  1ORJ A;  1FFH A;  3SXZ A;  1ZVZ A;  1OXB A;  3UMH A;  4BJ1 A;  3NKD A;  4XPX A;  5JUA A;  3C8G D;  1CGN A;  3GM3 A;  3R7C A;  5KYY B;  3L34 A;  1OCR C;  2NPU A;  3QW1 A;  3SXK A;  1A7D A;  1FR0 A;  1C17 M;  4Z9H A;  3DXJ F;  1XZQ A;  2OEX A;  2QTV A;  1CGO A;  3ZTZ A;  2R7U A;  1OQC A;  3QTH A;  3EH1 A;  3M1C B;  4EHP A;  1G8X A;  3KMI A;  4CDA A;  3EFO B;  1YJG A;  2LFF A;  3JSE O;  5T3W A;  3NYM A;  3TD7 A;  2X0C A;  5L0H A;  5KYN A;  3NRH A;  1OCC C;  2Q7R A;  1RJ9 A;  3JRM O;  3K66 A;  4JTA B;  3RW0 A;  4JTC B;  1OR2 A;  3U8P A;  2XRH A;  4EKW A;  3RQF A;  3SXY A;  3B0V C;  2XLV A;  4LLC A;  3N24 A;  1FTS A;  2C04 A;  2ZXO A;  1YYX A;  3WHN A;  3RKO F;  4U5E E;  3HLZ A;  3ASN C;  3DI5 A;  1I4Z A;  2D4U A;  4O79 A;  4OD5 A;  2PFD A;  4XPY A;  1GS9 A;  1LE4 A;  2IXN A;  2XSE A;  4B6I A;  4D4N A;  4GEH A;  4HFK B;  2WVQ A;  2G62 A;  4X0R A;  3KYI A;  2AWY A;  3LUT B;  3AGU A;  3U5S A;  5B3S C;  1ZHY A;  3OWT A;  3MBG A;  1NBB A;  4I1M A;  4JCZ A;  1D1A A;  3ITF A;  3LLK A;  2P61 A;  4KC9 A;  3MLG A;  4PFO A;  3OA1 A;  3JCU Q;  4JVS A;  1Q0F A;  2LP4 A;  3O39 A;  5E33 A;  2FGY A;  3V7O A;  3N2Z B;  1NFO A;  2J45 A;  1Z3I X;  1OCO C;  2MYS A;  2R9R B;  1FAP B;  2C03 A;  4CSA C;  1L7C A;  2A1D D; 
#chains in the Genus database with same CATH homology
 3C62 A;  4IAR A;  5JSL A;  4CIP A;  1E85 A;  2XLE A;  2YL1 A;  3TOL A;  3M4C A;  4U9D A;  3M15 A;  2XL8 A;  2YL7 A;  1A7V A;  3NMJ A;  1QQ3 A;  1GQA A;  2YLI A;  3ZQV A;  3TOM A;  4EIY A;  2XLO A;  3DE9 A;  5JLI A;  2BC5 A;  5AGF A;  2XLW A;  3ZWI A;  5JRA A;  3HNL A;  4ER9 A;  1JAF A;  4ULV A;  4NC3 A;  3IQ6 A;  4WGZ A;  3HNK A;  1YZA A;  4CDY A;  3HNJ A;  4JEA A;  4U9E A;  2YLG A;  5JT4 A;  5JS5 A;  4N6H A;  4WGY A;  2XLH A;  2J9B A;  1MQV A;  1E86 A;  3FOO A;  4JEB A;  1RCP A;  4JKV A;  3IQ5 A;  3ZQY A;  2QLA A;  3QW0 A;  4IB4 A;  3M79 A;  1E83 A;  4IAQ A;  256B A;  1S05 A;  1LM3 B;  2XM0 A;  3VRC A;  1CPQ A;  5JUA A;  2YKZ A;  3NMI A;  1CGN A;  2XL6 A;  3QW1 A;  4CDV A;  4CJG A;  4CX9 A;  1CGO A;  3ZTZ A;  1BBH A;  4CDA A;  3FOP A;  1YZC A;  3U8P A;  2YLD A;  1M6T A;  3QVZ A;  2YL0 A;  2XLV A;  4L6R A;  5B3I A;  1E84 A;  2CCY A;  1YYX A;  3ZTM A;  3C63 A;  3L1M A;  4D4X A;  4D4N A;  3DE8 A;  3HNI A;  1YYJ A;  1APC A;  3QVY A;  2XM4 A;  1CPR A;  1NBB A;  2YL3 A;  4CJO A;  2XLD A;  4JE9 A;  5JP7 A;  1QPU A;  1EKY A;  2J8W A;  4N4W A;  3NMK A;  3M4B A;  5JVE A;  2XLM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...