2YL3A

Cytochrome c prime from alcaligenes xylosoxidans: carbon monooxide bound l16g variant at 1.04 a resolution - restraint refined
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
126
structure length
126
Chain Sequence
b'EFAKPEDAVKYRQSAGTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
molecule tags Electron transport
source organism Achromobacter xylosoxidans
publication title Carbon Monoxide Poisoning is Prevented by the Energy Costs of Conformational Changes in Gas- Binding Haemproteins.
pubmed doi rcsb
total genus 51
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2011-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2yl3A00
4CDVA 2YLIA 5B3IA 3ZTMA 5JT4A 2YL7A 2XLMA 3L1MA 3C62A 2XL6A 1GQAA 3C63A 3FOOA 2XL8A 4IARA 2BC5A 1JAFA 2YLDA 3HNIA 1E84A 3ZWIA 4N4WA 1YZCA 3QW1A 1YYXA 2CCYA 2QLAA 4U9DA 2YL0A 1CPQA 5JRAA 1A7VA 3QW0A 4EIYA 3M79A 3HNKA 3NMKA 4JKVA 1MQVA 1YZAA 4CJOA 1NBBA 2J9BA 3ZQVA 1E85A 4WGZA 3M15A 3QVZA 3ZQYA 3HNLA 3IQ5A 2XLWA 1BBHA 1S05A 4CJGA 1E86A 4IAQA 4CIPA 4ULVA 3DE8A 4D4XA 5JVEA 4CX9A 2XM4A 2XLOA 2YL3A 3NMJA 1CGOA 1QPUA 4ER9A 2XLEA 2XLDA 5JS5A 4D4NA 3VRCA 1CPRA 1YYJA 3IQ6A 1EKYA 3FOPA 3U8PA 1M6TA 3TOMA 5JUAA 3DE9A 4JE9A 2XM0A 2YL1A 2YLGA 3M4BA 1LM3B 4JEBA 2J8WA 5JP7A 4JEAA 2YKZA 5JLIA 4N6HA 3TOLA 1APCA 3M4CA 4CDAA 1RCPA 5JSLA 3HNJA 4WGYA 1E83A 4CDYA 2XLHA 4L6RA 5AGFA 4NC3A 4U9EA 1QQ3A 1CGNA 3QVYA 3ZTZA 2XLVA 4IB4A 3NMIA 256BA
chains in the Genus database with same CATH superfamily
2YLIA 1Z23A 2HV6A 2B0JA 4NCQA 4DJ9A 1VMAA 4XQ1A 1SF8A 4JRZA 1MMNA 2KJGA 3L1MA 1W2WA 3SNHA 4E17A 2XL6A 4OIRF 2IXMA 2LP4A 1O5HA 4MVMA 4LACB 3SXYA 1Q0DA 2PX0A 3JT1A 3MFNA 5T3WA 2DI3A 3QMKA 1JMWA 5BUOA 3DD7A 4IARA 2D4UA 1QVXA 2NUTA 2EINC 1NU7D 2NG1A 3U5SA 3VM6A 3ZWIA 1TWGA 3CEXA 3I4UA 4N4WA 4XPXA 3I5QA 4CSAA 5AC5A 4FAPB 2LFFA 4ULWA 5B1BC 4JC7A 3PCVA 2KGOA 4U5CE 2X0CA 3U2MA 5A6BA 1LE4A 1LPEA 4HE8D 3LLIA 1FFHA 3NKEA 1CGME 2HMZA 5DS5A 2ETSA 5L0JA 2JX0A 4JTAB 1A7VA 3NYLA 2JD3A 4I44A 4EIYA 1Y4CA 3S29A 1TFOB 4JTCB 3PMRA 3GEIA 4CS8A 2AWYA 1FNTc 1MQVA 2R7WA 2HSQA 3JCUQ 2HS5A 2Y3DA 1E85A 3V5ZA 3JSZA 2J9UA 1OR3A 1QSPA 2A0UA 4JZAA 2W4BA 3KMIA 4NTBA 3B9QA 2WVNA 2Y69C 4WGZA 4KBLA 3K1IA 5E3CA 3OEOA 3G4ZA 5B1AC 1VYIA 1LS1A 2YHSA 3HNLA 4I1OB 3IQ5A 2NPUA 1GM5A 1E86A 4N06A 4Q5SF 3DE8A 1MNDA 4FX5A 3MX3A 3OWTA 1TKNA 4H4KC 4YT2A 2XM4A 1PV3A 3U9MA 3K7DA 1G5ZA 1N1CA 2P61A 2YL3A 3MBGA 4AE4A 3DWWA 2EPNA 1PCXA 3G4XA 4BJ6C 1G4WR 3K1HA 1T6QA 1NLXA 1MMAA 2Q9BA 2A1DD 2XLDA 1AEPA 3ZDLA 2O9XA 3DJNB 5CI9A 1FR0A 3FAPB 3EJNA 3JZ0A 3VF0A 1Z63A 4O6YA 1FFTC 3EG9A 3O10A 3NDBB 3X2QC 3AQCA 4DBRA 4XLPF 3ABMC 3GM3A 2LCHA 1ST6A 2ZXOA 2QNLA 4DBQA 5L0GA 1DOVA 3TQOA 5EHHA 1K05A 1TWAA 2C04A 5JUAA 3RF3A 3T6GB 4DRIB 4DXWA 4LERA 3IHUA 4Z9JA 2EIKC 4PJMA 1ZHWA 5KYUA 3ZG1A 5KYXB 1QLEC 3RQGA 3M4BA 1LS4A 4JJFA 3W4YA 5KYYB 3ITFA 2IM8A 1VLSA 3EG9B 4OINF 4LLEA 3DKAA 1D1AA 3S9OA 2WZGA 2YKZA 4JW1A 4Z9HA 5KYNA 5A69A 3B0PA 2GAQA 4U5EE 1Q0KA 1APCA 3ABKC 1O87A 1H9TA 2CYDA 1B68A 4WJ0A 3V7OA 4N6CA 1J8MF 2VCAA 1A7EA 5L0CA 2W9YA 3ASNC 5KYXA 3S28A 1LI5A 1ZW2A 4MVOA 4DOZA 4A4AA 5KYYA 1Z7Qc 1ZHZA 2R05A 1HE1A 2HV7A 1RXQA 2WL8A 3LEOA 4Q7CA 5E3AA 1U89A 3UMHA 2KNHA 4W8KA 2Q7RA 4IB4A 4P9FA 4CIHA 3LNMB 2RSEB 3GWNA 4E7SA 2GDCA 4PR9A 4CS9C 2HKVA 2NSGA 2P6VA 1TFKB 3KPHA 3S84A 5B3IA 2OCCC 2PP4A 4BEJA 1HE9A 3CSKA 1JR8A 2UUHA 1EA8A 2XLMA 3GEEA 2AP3A 3AJMA 1OCRC 4YT4A 1EI7A 5L3VA 1H6GA 4XEVA 4XEFA 3RIPA 3K1IC 1V54C 3FOOA 4U5BE 4H54A 4K7BA 1KU2A 1WATA 1H7IA 2VCCA 4JIOA 3DI5A 2E87A 2Y3HA 1BR4A 2A69F 2YQYA 3C18A 3HNIA 1D1BA 4CS8C 2LIGA 2Q00A 2ZD9A 1BR2A 1NG1A 1HW1A 2LD6A 4NTFA 4MW8A 2CCYA 2QLAA 4IAOA 2P1AA 2LFDA 2XL4A 5A6KA 2ZXWC 3H2UA 2XS8A 3TD7A 2QTVA 1E2XA 3BRJA 3M1CB 1XZQA 2YL0A 4BJ6A 3EGDB 3TJ5A 2BL2A 2PFDA 1VYKA 3S27A 4U5FE 4G7OF 1JRAA 1TWHA 2IXPA 2Z15A 1Z6AA 3ASOC 3GORA 4MQ9F 3UR3C 1RKEA 2OJQA 3M79A 2MYSA 4O7GA 5DS4A 3NRHA 4ZLDA 3HNKA 4JKVA 2J46A 1NBBA 2H7BA 2J9BA 2YEVA 4FWVA 4K1OA 2PBEA 2ZPAA 4ANJA 2EPLX 5F5HA 3ECSA 4CBEA 1A41A 3DMDA 5KYWA 2QUPA 4MVZA 4G78A 5A6JA 1VK5A 2KK1A 3CAXA 1ZU4A 4XEKA 5D92A 3ZQYA 3TK0A 1T9KA 2J7PA 3C8GD 3FVYA 3KH2A 1OXBA 1HMOA 2FGYA 1JOGA 3RVYA 1EQ1A 2XRHA 1DOWA 4C3EA 4BJ1A 3TULA 2R7QA 1RKCA 2XLOA 2C03A 2OOCA 4OD5A 1A7DA 1R5ID 2NUPA 4X0RA 4YT8A 4IWBA 1WTYA 4ER9A 3I5PA 1SZIA 2P0NA 5KYWB 4BG0A 4RD9A 5COGA 1K40A 4DRJB 2EPOA 2KSFA 2XLEA 3WG7C 3GODA 4PJNA 2I15A 4QDLA 1PD0A 1Q0GA 2H7VC 2OQMA 5K0IA 4JVSA 2L6HA 4I1MA 4MTOA 3T4RA 3RQFA 2WZLA 1D1CA 1PD1A 4I3MA 3HKKA 4PJJA 5DLJA 1O3UA 3FHDA 2XXAB 1EKYA 3IPMO 2ASRA 3UGPA 1LE2A 1RJ9B 1T6IA 4J30B 4ONSA 4KI2A 1M56C 3QZCA 5D91A 3U9JA 1ZYRF 4XLNF 3TOMA 2QE9A 3NKDA 1OCCC 4PJLA 2R25A 1OKKA 2Q4FA 4JE9A 3LS0A 3OA1A 3GM1A 3RFYA 2YWAA 5EGYA 3L34A 1G4US 4BPMA 5L0DA 2XXAA 4C3BA 2IOQA 2R7TA 4MTFA 3U3FA 1U6HA 3JYYA 3POVA 1KTMA 2NUTB 3ABLC 2J8WA 1SMYF 3EH1A 4PK4A 4RBNA 5E33A 1WASA 3K6BA 5JP7A 4OIOF 1FTSA 3KYJA 1BR1A 5FCLA 2FFHA 1LKXA 2A6EF 2WZFA 4P9TA 2DB4A 3TOLA 4C3DA 3M4CA 4K0DA 1UFBA 4MNDA 4JCZA 1AUEA 3HNJA 3MYIA 1E83A 2CDQA 2R03A 4IRUA 1M2VB 3N24A 2XLHA 5GPGB 2L7AA 4CDYA 4B6IA 4YJWA 4KNWA 2V26A 1KNYA 5T1DB 1BZ4A 4BJ5C 4FESA 4U9EA 2V3CC 4YL3A 1D0XA 2R02A 2A6HF 2YZSA 2WVQA 3Q7GA 3FXHA 2G62A 2NSFA 1GGQA 4U5DE 4NY3A 5JRAA 3B0UX 2HSBA 4CDVA 1G8XA 2M64A 1OQCA 1OR2A 2H8AA 1SR2A 1C03A 3LEVA 3NYJA 2R7RA 3C8GB 3L0IA 1M2VA 3DM5A 3UMKA 4OIPF 2OJED 3W2WA 3C62A 1YA7O 3EFOB 4HFKB 3N0TA 3C63A 3WODF 5COMA 3V5YA 4DVYP 4C7OA 5BQIA 2RD9A 2XL8A 4EBBA 2IXNA 3LJBA 3W8HA 3U0CA 1WWPA 1YARO 2YLDA 3CZ6A 3EPVA 3Q6MA 2P7VA 2J9VA 4AE4B 1IW7F 1E84A 3VYWA 3QW1A 3AQBA 4W8PA 3JRMO 5A6AA 3EGXA 1OW6A 2PX3A 4E7ZA 1H9GA 2A68F 4YWQA 2CW0F 3C8GA 3S0XA 1JPNA 3AG1C 2Y3BA 3W8IA 3FAJA 1Y6DA 2GWWA 2VC9A 3K33A 3UNGC 2D5RB 3KYIA 4UDVA 1M57C 2OEVA 1OCZC 3GWLA 4C7OB 3EHNA 2Q9AA 3QW0A 1WGWA 4A2NB 1FMWA 3E9VA 3HTKC 1AVOB 1NFNA 3DAFA 3MLGA 3W2VA 1Z3IX 4CJOA 1YZAA 2KYHA 3A11A 1TWCA 1JPJA 1T5OA 2J45A 2M4EA 4JURI 2VCBA 4QI0A 2JPUA 2KC3A 1NSGB 2HZ8A 2OKUA 1YDIA 3M15A 4CS7A 3LS1A 3QVZA 3ZC4A 3SEOA 4XWJA 2HJMA 4G0HA 2B0HA 2XLWA 1BBHA 1S05A 2LQGA 4EWCA 4CIPA 2EIJC 4EBKA 2R7XA 1RMVA 4D4XA 4GQHA 4CX9A 4G7ZF 3JSEO 2OEXA 3V5XA 2PF4E 2GFHA 4PACA 2A0BA 2XS1A 1FAPB 1VB5A 4WABA 1MNEA 1QPUA 1YAUO 1V55C 2J7PD 3US6A 2VH3A 2CGEA 3EZHA 3U3BA 4GYTA 5F5FA 2I8BA 3G50A 3T9OA 1YVIA 1OCOC 4J7TA 1NU9C 3LNRA 3C8ZA 4IGGA 4LLCA 2R7UA 1OW8A 2LK4A 4RDAA 1M2OA 2MHRA 2J0XA 5AC4A 5DQZA 2L9JA 1OW7A 3H2VA 3EH2A 2EIMC 4XPYA 3IQ6A 3IEEA 3QTHA 3SXZA 4LDQA 4MW3A 4GEHA 3SXMA 3PDMP 2OU6A 2AU5A 2Y39A 4O79A 3O39A 1M6TA 3KL4A 3BEHA 2XSEA 4MVQA 3DE9A 2XM0A 5F28E 2J0WA 4XTKA 2UUIA 2TMVP 2YL1A 2CNWA 5BQHA 1T01A 4EUKB 2DGJA 3SYNA 2CNWD 4DVZA 1V4AA 1LM3B 1ZW3A 1MMDA 3WAQA 4AX2A 1YLMA 3LAYA 4OIQF 2Q9CA 4LDKA 4QI2A 2KW3C 3EQLF 3SXKA 5DS6A 1I4ZA 1RCPA 2R9RB 3GANA 4MVRA 3TJ6A 1MMGA 4Q4ZF 3UGOA 4WGYA 4DRHB 2YRFA 3EGDA 2J9WA 3EHMA 4U5HA 3DM9B 4OD4A 5CIVA 3F46A 5AGFA 4NC3A 1NZEA 3GEHA 4E0HA 1Q0FA 1A0BA 1Z5ZA 1RKEB 5HV9A 4CSAC 1LIHA 3GM2A 3T6BA 3IQTA 5CI8A 3NMIA 256BA 1YZCA 5B3SC 3AG4C 2OG2A 1VTMP 1XZPA 2KQ9A 4YL1A 1C17M 4PFPA 3AGTA 3ZIBA 3ZTMA 5JT4A 3ZSUA 2YL7A 2BE5F 3NG1A 5KYUB 4JJGA 4AL1A 1GQAA 3AOUA 2Y3GA 1K04A 1HY5A 4MVUA 1ZVZA 2W45A 4YN0B 3U2LA 5L0IA 3KKBA 1WN0A 3O6XA 4AK9A 2ICWG 2HMQA 2L6GA 1I4YA 1QZXA 3LESA 3ZVRA 3LUTB 1BDJB 3H65A 3RW0A 3RH3A 2BC5A 1JAFA 5L3QA 2NUPB 1YA9A 1IZMA 5FZTA 3FDQA 2EPKX 3RQEA 4O6NA 1YYXA 2F22A 2LSEA 2X51A 3S90A 1L7CA 4U9DA 4CS9A 2WB7A 4EHPA 1R4TA 1T6UA 1XWJA 2GA0A 3ATPA 3JYHA 3VAYA 1ZHTA 1CPQA 1SYQA 2PNOA 4BJTA 3SZRA 5DQTA 2IYLD 1ZHYA 1ORJA 2R7OA 4JCHA 4O6MA 4XPWA 1ZZPA 1QKRA 1LVKA 3R7CA 1J8YF 3PHF2 2MWQA 3NMKA 3DXJF 3ZQVA 1TQGA 1VOMA 4AL0A 4YT5A 1NFOA 1D0ZA 2WVOA 4NQFA 3DAGA 4MVSA 1L3PA 3Q7LA 4YL0A 3JRTA 2R7VA 4CJGA 1LI7A 2G3KA 2VB6A 1F1MA 2IBFA 1GS9A 3HJCA 4IAQA 4KNVA 4R32A 4ULVA 5EK0A 5JVEA 3AG3C 2FAPB 1ORSC 2AWCA 3B71A 5IY5C 3R2PA 2H7OA 3O55A 4JTDB 2L6FA 3A9CA 3B29A 5L0FA 3NMJA 1HMDA 1ZU5A 1I5NA 1CGOA 1FMVA 4EBJA 4ZLCA 4KC9A 1ORYA 1UG7A 1TR2A 5DVWA 4E18A 4M63A 3K66A 5JS5A 1YJGA 4BEMJ 3VRCA 4LDRA 1CPRA 1YYJA 3SP1A 1C02A 2QY9A 3EZIA 3RVZA 3U8VA 3FOPA 3U8PA 3X1OA 1U0BB 3L8JA 1WOLA 3HLZA 4MTGA 4HFFB 3AG2C 5HSWA 5COFA 4NTAA 5A6BD 3IQCA 4U5GA 1S7ZA 4BJ5A 2ZXPA 3Q6NA 3T6JA 3EFOA 4F4BA 3F47A 2Q3TA 2L81A 2W4MA 2YLGA 2VASA 3DJUB 4J32B 4Z9IA 3DZAA 5E2QA 1D0YA 4PFOA 1OKKD 3MYFA 3NYMA 4YK5A 5T3TA 4JEBA 1ZHXA 2HFIA 3UMIA 4JEAA 5JLIA 2AVKA 2HUJA 4MS2A 4N6HA 2DYSC 3EGXB 2EPMX 1VLTA 3L8IA 3WHNA 4E0IA 3N2ZB 4CDAA 4G7HF 4P6IC 2EILC 5JSLA 4EKWA 3CQZA 3JTLO 3RYLA 4IJJA 3B0VC 2ZXRA 3RKOF 3C7JA 4L6RA 1Q0MA 5TJ5E 1V74B 2HJ3A 4D4NA 5BQGA 4HEAJ 1CGNA 1QQ3A 2IXOA 3QVYA 3ZTZA 3AGUA 2XLVA 3E70C 2G3VA 4J7YA 1RJ9A 5L0HA 1OXKA 2DYRC 2YVKA 3LLKA 3FMSA 1HW2A 3J06A 2R7SA
chains in the Genus database with same CATH topology
4CDVA 2YLIA 5B3IA 3ZTMA 5JT4A 2YL7A 2XLMA 3L1MA 3C62A 2XL6A 1GQAA 3C63A 3FOOA 2XL8A 4IARA 2BC5A 1JAFA 2YLDA 3HNIA 1E84A 3ZWIA 4N4WA 1YZCA 3QW1A 1YYXA 2CCYA 2QLAA 4U9DA 2YL0A 1CPQA 5JRAA 1A7VA 3QW0A 4EIYA 3M79A 3HNKA 3NMKA 4JKVA 1MQVA 1YZAA 4CJOA 1NBBA 2J9BA 3ZQVA 1E85A 4WGZA 3M15A 3QVZA 3ZQYA 3HNLA 3IQ5A 2XLWA 1BBHA 1S05A 4CJGA 1E86A 4IAQA 4CIPA 4ULVA 3DE8A 4D4XA 5JVEA 4CX9A 2XM4A 2XLOA 2YL3A 3NMJA 1CGOA 1QPUA 4ER9A 2XLEA 2XLDA 5JS5A 4D4NA 3VRCA 1CPRA 1YYJA 3IQ6A 1EKYA 3FOPA 3U8PA 1M6TA 3TOMA 5JUAA 3DE9A 4JE9A 2XM0A 2YL1A 2YLGA 3M4BA 1LM3B 4JEBA 2J8WA 5JP7A 4JEAA 2YKZA 5JLIA 4N6HA 3TOLA 1APCA 3M4CA 4CDAA 1RCPA 5JSLA 3HNJA 4WGYA 1E83A 4CDYA 2XLHA 4L6RA 5AGFA 4NC3A 4U9EA 1QQ3A 1CGNA 3QVYA 3ZTZA 2XLVA 4IB4A 3NMIA 256BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CDV A;  2YLI A;  5B3I A;  3ZTM A;  5JT4 A;  2YL7 A;  2XLM A;  3L1M A;  3C62 A;  2XL6 A;  1GQA A;  3C63 A;  3FOO A;  2XL8 A;  4IAR A;  2BC5 A;  1JAF A;  2YLD A;  3HNI A;  1E84 A;  3ZWI A;  4N4W A;  1YZC A;  3QW1 A;  1YYX A;  2CCY A;  2QLA A;  4U9D A;  2YL0 A;  1CPQ A;  5JRA A;  1A7V A;  3QW0 A;  4EIY A;  3M79 A;  3HNK A;  3NMK A;  4JKV A;  1MQV A;  1YZA A;  4CJO A;  1NBB A;  2J9B A;  3ZQV A;  1E85 A;  4WGZ A;  3M15 A;  3QVZ A;  3ZQY A;  3HNL A;  3IQ5 A;  2XLW A;  1BBH A;  1S05 A;  4CJG A;  1E86 A;  4IAQ A;  4CIP A;  4ULV A;  3DE8 A;  4D4X A;  5JVE A;  4CX9 A;  2XM4 A;  2XLO A;  2YL3 A;  3NMJ A;  1CGO A;  1QPU A;  4ER9 A;  2XLE A;  2XLD A;  5JS5 A;  4D4N A;  3VRC A;  1CPR A;  1YYJ A;  3IQ6 A;  1EKY A;  3FOP A;  3U8P A;  1M6T A;  3TOM A;  5JUA A;  3DE9 A;  4JE9 A;  2XM0 A;  2YL1 A;  2YLG A;  3M4B A;  1LM3 B;  4JEB A;  2J8W A;  5JP7 A;  4JEA A;  2YKZ A;  5JLI A;  4N6H A;  3TOL A;  1APC A;  3M4C A;  4CDA A;  1RCP A;  5JSL A;  3HNJ A;  4WGY A;  1E83 A;  4CDY A;  2XLH A;  4L6R A;  5AGF A;  4NC3 A;  4U9E A;  1QQ3 A;  1CGN A;  3QVY A;  3ZTZ A;  2XLV A;  4IB4 A;  3NMI A;  256B A; 
#chains in the Genus database with same CATH topology
 2YLI A;  1Z23 A;  2HV6 A;  2B0J A;  4NCQ A;  4DJ9 A;  1VMA A;  4XQ1 A;  1SF8 A;  4JRZ A;  1MMN A;  2KJG A;  3L1M A;  1W2W A;  3SNH A;  4E17 A;  2XL6 A;  4OIR F;  2IXM A;  2LP4 A;  1O5H A;  4MVM A;  4LAC B;  3SXY A;  1Q0D A;  2PX0 A;  3JT1 A;  3MFN A;  5T3W A;  2DI3 A;  3QMK A;  1JMW A;  5BUO A;  3DD7 A;  4IAR A;  2D4U A;  1QVX A;  2NUT A;  2EIN C;  1NU7 D;  2NG1 A;  3U5S A;  3VM6 A;  3ZWI A;  1TWG A;  3CEX A;  3I4U A;  4N4W A;  4XPX A;  3I5Q A;  4CSA A;  5AC5 A;  4FAP B;  2LFF A;  4ULW A;  5B1B C;  4JC7 A;  3PCV A;  2KGO A;  4U5C E;  2X0C A;  3U2M A;  5A6B A;  1LE4 A;  1LPE A;  4HE8 D;  3LLI A;  1FFH A;  3NKE A;  1CGM E;  2HMZ A;  5DS5 A;  2ETS A;  5L0J A;  2JX0 A;  4JTA B;  1A7V A;  3NYL A;  2JD3 A;  4I44 A;  4EIY A;  1Y4C A;  3S29 A;  1TFO B;  4JTC B;  3PMR A;  3GEI A;  4CS8 A;  2AWY A;  1FNT c;  1MQV A;  2R7W A;  2HSQ A;  3JCU Q;  2HS5 A;  2Y3D A;  1E85 A;  3V5Z A;  3JSZ A;  2J9U A;  1OR3 A;  1QSP A;  2A0U A;  4JZA A;  2W4B A;  3KMI A;  4NTB A;  3B9Q A;  2WVN A;  2Y69 C;  4WGZ A;  4KBL A;  3K1I A;  5E3C A;  3OEO A;  3G4Z A;  5B1A C;  1VYI A;  1LS1 A;  2YHS A;  3HNL A;  4I1O B;  3IQ5 A;  2NPU A;  1GM5 A;  1E86 A;  4N06 A;  4Q5S F;  3DE8 A;  1MND A;  4FX5 A;  3MX3 A;  3OWT A;  1TKN A;  4H4K C;  4YT2 A;  2XM4 A;  1PV3 A;  3U9M A;  3K7D A;  1G5Z A;  1N1C A;  2P61 A;  2YL3 A;  3MBG A;  4AE4 A;  3DWW A;  2EPN A;  1PCX A;  3G4X A;  4BJ6 C;  1G4W R;  3K1H A;  1T6Q A;  1NLX A;  1MMA A;  2Q9B A;  2A1D D;  2XLD A;  1AEP A;  3ZDL A;  2O9X A;  3DJN B;  5CI9 A;  1FR0 A;  3FAP B;  3EJN A;  3JZ0 A;  3VF0 A;  1Z63 A;  4O6Y A;  1FFT C;  3EG9 A;  3O10 A;  3NDB B;  3X2Q C;  3AQC A;  4DBR A;  4XLP F;  3ABM C;  3GM3 A;  2LCH A;  1ST6 A;  2ZXO A;  2QNL A;  4DBQ A;  5L0G A;  1DOV A;  3TQO A;  5EHH A;  1K05 A;  1TWA A;  2C04 A;  5JUA A;  3RF3 A;  3T6G B;  4DRI B;  4DXW A;  4LER A;  3IHU A;  4Z9J A;  2EIK C;  4PJM A;  1ZHW A;  5KYU A;  3ZG1 A;  5KYX B;  1QLE C;  3RQG A;  3M4B A;  1LS4 A;  4JJF A;  3W4Y A;  5KYY B;  3ITF A;  2IM8 A;  1VLS A;  3EG9 B;  4OIN F;  4LLE A;  3DKA A;  1D1A A;  3S9O A;  2WZG A;  2YKZ A;  4JW1 A;  4Z9H A;  5KYN A;  5A69 A;  3B0P A;  2GAQ A;  4U5E E;  1Q0K A;  1APC A;  3ABK C;  1O87 A;  1H9T A;  2CYD A;  1B68 A;  4WJ0 A;  3V7O A;  4N6C A;  1J8M F;  2VCA A;  1A7E A;  5L0C A;  2W9Y A;  3ASN C;  5KYX A;  3S28 A;  1LI5 A;  1ZW2 A;  4MVO A;  4DOZ A;  4A4A A;  5KYY A;  1Z7Q c;  1ZHZ A;  2R05 A;  1HE1 A;  2HV7 A;  1RXQ A;  2WL8 A;  3LEO A;  4Q7C A;  5E3A A;  1U89 A;  3UMH A;  2KNH A;  4W8K A;  2Q7R A;  4IB4 A;  4P9F A;  4CIH A;  3LNM B;  2RSE B;  3GWN A;  4E7S A;  2GDC A;  4PR9 A;  4CS9 C;  2HKV A;  2NSG A;  2P6V A;  1TFK B;  3KPH A;  3S84 A;  5B3I A;  2OCC C;  2PP4 A;  4BEJ A;  1HE9 A;  3CSK A;  1JR8 A;  2UUH A;  1EA8 A;  2XLM A;  3GEE A;  2AP3 A;  3AJM A;  1OCR C;  4YT4 A;  1EI7 A;  5L3V A;  1H6G A;  4XEV A;  4XEF A;  3RIP A;  3K1I C;  1V54 C;  3FOO A;  4U5B E;  4H54 A;  4K7B A;  1KU2 A;  1WAT A;  1H7I A;  2VCC A;  4JIO A;  3DI5 A;  2E87 A;  2Y3H A;  1BR4 A;  2A69 F;  2YQY A;  3C18 A;  3HNI A;  1D1B A;  4CS8 C;  2LIG A;  2Q00 A;  2ZD9 A;  1BR2 A;  1NG1 A;  1HW1 A;  2LD6 A;  4NTF A;  4MW8 A;  2CCY A;  2QLA A;  4IAO A;  2P1A A;  2LFD A;  2XL4 A;  5A6K A;  2ZXW C;  3H2U A;  2XS8 A;  3TD7 A;  2QTV A;  1E2X A;  3BRJ A;  3M1C B;  1XZQ A;  2YL0 A;  4BJ6 A;  3EGD B;  3TJ5 A;  2BL2 A;  2PFD A;  1VYK A;  3S27 A;  4U5F E;  4G7O F;  1JRA A;  1TWH A;  2IXP A;  2Z15 A;  1Z6A A;  3ASO C;  3GOR A;  4MQ9 F;  3UR3 C;  1RKE A;  2OJQ A;  3M79 A;  2MYS A;  4O7G A;  5DS4 A;  3NRH A;  4ZLD A;  3HNK A;  4JKV A;  2J46 A;  1NBB A;  2H7B A;  2J9B A;  2YEV A;  4FWV A;  4K1O A;  2PBE A;  2ZPA A;  4ANJ A;  2EPL X;  5F5H A;  3ECS A;  4CBE A;  1A41 A;  3DMD A;  5KYW A;  2QUP A;  4MVZ A;  4G78 A;  5A6J A;  1VK5 A;  2KK1 A;  3CAX A;  1ZU4 A;  4XEK A;  5D92 A;  3ZQY A;  3TK0 A;  1T9K A;  2J7P A;  3C8G D;  3FVY A;  3KH2 A;  1OXB A;  1HMO A;  2FGY A;  1JOG A;  3RVY A;  1EQ1 A;  2XRH A;  1DOW A;  4C3E A;  4BJ1 A;  3TUL A;  2R7Q A;  1RKC A;  2XLO A;  2C03 A;  2OOC A;  4OD5 A;  1A7D A;  1R5I D;  2NUP A;  4X0R A;  4YT8 A;  4IWB A;  1WTY A;  4ER9 A;  3I5P A;  1SZI A;  2P0N A;  5KYW B;  4BG0 A;  4RD9 A;  5COG A;  1K40 A;  4DRJ B;  2EPO A;  2KSF A;  2XLE A;  3WG7 C;  3GOD A;  4PJN A;  2I15 A;  4QDL A;  1PD0 A;  1Q0G A;  2H7V C;  2OQM A;  5K0I A;  4JVS A;  2L6H A;  4I1M A;  4MTO A;  3T4R A;  3RQF A;  2WZL A;  1D1C A;  1PD1 A;  4I3M A;  3HKK A;  4PJJ A;  5DLJ A;  1O3U A;  3FHD A;  2XXA B;  1EKY A;  3IPM O;  2ASR A;  3UGP A;  1LE2 A;  1RJ9 B;  1T6I A;  4J30 B;  4ONS A;  4KI2 A;  1M56 C;  3QZC A;  5D91 A;  3U9J A;  1ZYR F;  4XLN F;  3TOM A;  2QE9 A;  3NKD A;  1OCC C;  4PJL A;  2R25 A;  1OKK A;  2Q4F A;  4JE9 A;  3LS0 A;  3OA1 A;  3GM1 A;  3RFY A;  2YWA A;  5EGY A;  3L34 A;  1G4U S;  4BPM A;  5L0D A;  2XXA A;  4C3B A;  2IOQ A;  2R7T A;  4MTF A;  3U3F A;  1U6H A;  3JYY A;  3POV A;  1KTM A;  2NUT B;  3ABL C;  2J8W A;  1SMY F;  3EH1 A;  4PK4 A;  4RBN A;  5E33 A;  1WAS A;  3K6B A;  5JP7 A;  4OIO F;  1FTS A;  3KYJ A;  1BR1 A;  5FCL A;  2FFH A;  1LKX A;  2A6E F;  2WZF A;  4P9T A;  2DB4 A;  3TOL A;  4C3D A;  3M4C A;  4K0D A;  1UFB A;  4MND A;  4JCZ A;  1AUE A;  3HNJ A;  3MYI A;  1E83 A;  2CDQ A;  2R03 A;  4IRU A;  1M2V B;  3N24 A;  2XLH A;  5GPG B;  2L7A A;  4CDY A;  4B6I A;  4YJW A;  4KNW A;  2V26 A;  1KNY A;  5T1D B;  1BZ4 A;  4BJ5 C;  4FES A;  4U9E A;  2V3C C;  4YL3 A;  1D0X A;  2R02 A;  2A6H F;  2YZS A;  2WVQ A;  3Q7G A;  3FXH A;  2G62 A;  2NSF A;  1GGQ A;  4U5D E;  4NY3 A;  5JRA A;  3B0U X;  2HSB A;  4CDV A;  1G8X A;  2M64 A;  1OQC A;  1OR2 A;  2H8A A;  1SR2 A;  1C03 A;  3LEV A;  3NYJ A;  2R7R A;  3C8G B;  3L0I A;  1M2V A;  3DM5 A;  3UMK A;  4OIP F;  2OJE D;  3W2W A;  3C62 A;  1YA7 O;  3EFO B;  4HFK B;  3N0T A;  3C63 A;  3WOD F;  5COM A;  3V5Y A;  4DVY P;  4C7O A;  5BQI A;  2RD9 A;  2XL8 A;  4EBB A;  2IXN A;  3LJB A;  3W8H A;  3U0C A;  1WWP A;  1YAR O;  2YLD A;  3CZ6 A;  3EPV A;  3Q6M A;  2P7V A;  2J9V A;  4AE4 B;  1IW7 F;  1E84 A;  3VYW A;  3QW1 A;  3AQB A;  4W8P A;  3JRM O;  5A6A A;  3EGX A;  1OW6 A;  2PX3 A;  4E7Z A;  1H9G A;  2A68 F;  4YWQ A;  2CW0 F;  3C8G A;  3S0X A;  1JPN A;  3AG1 C;  2Y3B A;  3W8I A;  3FAJ A;  1Y6D A;  2GWW A;  2VC9 A;  3K33 A;  3UNG C;  2D5R B;  3KYI A;  4UDV A;  1M57 C;  2OEV A;  1OCZ C;  3GWL A;  4C7O B;  3EHN A;  2Q9A A;  3QW0 A;  1WGW A;  4A2N B;  1FMW A;  3E9V A;  3HTK C;  1AVO B;  1NFN A;  3DAF A;  3MLG A;  3W2V A;  1Z3I X;  4CJO A;  1YZA A;  2KYH A;  3A11 A;  1TWC A;  1JPJ A;  1T5O A;  2J45 A;  2M4E A;  4JUR I;  2VCB A;  4QI0 A;  2JPU A;  2KC3 A;  1NSG B;  2HZ8 A;  2OKU A;  1YDI A;  3M15 A;  4CS7 A;  3LS1 A;  3QVZ A;  3ZC4 A;  3SEO A;  4XWJ A;  2HJM A;  4G0H A;  2B0H A;  2XLW A;  1BBH A;  1S05 A;  2LQG A;  4EWC A;  4CIP A;  2EIJ C;  4EBK A;  2R7X A;  1RMV A;  4D4X A;  4GQH A;  4CX9 A;  4G7Z F;  3JSE O;  2OEX A;  3V5X A;  2PF4 E;  2GFH A;  4PAC A;  2A0B A;  2XS1 A;  1FAP B;  1VB5 A;  4WAB A;  1MNE A;  1QPU A;  1YAU O;  1V55 C;  2J7P D;  3US6 A;  2VH3 A;  2CGE A;  3EZH A;  3U3B A;  4GYT A;  5F5F A;  2I8B A;  3G50 A;  3T9O A;  1YVI A;  1OCO C;  4J7T A;  1NU9 C;  3LNR A;  3C8Z A;  4IGG A;  4LLC A;  2R7U A;  1OW8 A;  2LK4 A;  4RDA A;  1M2O A;  2MHR A;  2J0X A;  5AC4 A;  5DQZ A;  2L9J A;  1OW7 A;  3H2V A;  3EH2 A;  2EIM C;  4XPY A;  3IQ6 A;  3IEE A;  3QTH A;  3SXZ A;  4LDQ A;  4MW3 A;  4GEH A;  3SXM A;  3PDM P;  2OU6 A;  2AU5 A;  2Y39 A;  4O79 A;  3O39 A;  1M6T A;  3KL4 A;  3BEH A;  2XSE A;  4MVQ A;  3DE9 A;  2XM0 A;  5F28 E;  2J0W A;  4XTK A;  2UUI A;  2TMV P;  2YL1 A;  2CNW A;  5BQH A;  1T01 A;  4EUK B;  2DGJ A;  3SYN A;  2CNW D;  4DVZ A;  1V4A A;  1LM3 B;  1ZW3 A;  1MMD A;  3WAQ A;  4AX2 A;  1YLM A;  3LAY A;  4OIQ F;  2Q9C A;  4LDK A;  4QI2 A;  2KW3 C;  3EQL F;  3SXK A;  5DS6 A;  1I4Z A;  1RCP A;  2R9R B;  3GAN A;  4MVR A;  3TJ6 A;  1MMG A;  4Q4Z F;  3UGO A;  4WGY A;  4DRH B;  2YRF A;  3EGD A;  2J9W A;  3EHM A;  4U5H A;  3DM9 B;  4OD4 A;  5CIV A;  3F46 A;  5AGF A;  4NC3 A;  1NZE A;  3GEH A;  4E0H A;  1Q0F A;  1A0B A;  1Z5Z A;  1RKE B;  5HV9 A;  4CSA C;  1LIH A;  3GM2 A;  3T6B A;  3IQT A;  5CI8 A;  3NMI A;  256B A;  1YZC A;  5B3S C;  3AG4 C;  2OG2 A;  1VTM P;  1XZP A;  2KQ9 A;  4YL1 A;  1C17 M;  4PFP A;  3AGT A;  3ZIB A;  3ZTM A;  5JT4 A;  3ZSU A;  2YL7 A;  2BE5 F;  3NG1 A;  5KYU B;  4JJG A;  4AL1 A;  1GQA A;  3AOU A;  2Y3G A;  1K04 A;  1HY5 A;  4MVU A;  1ZVZ A;  2W45 A;  4YN0 B;  3U2L A;  5L0I A;  3KKB A;  1WN0 A;  3O6X A;  4AK9 A;  2ICW G;  2HMQ A;  2L6G A;  1I4Y A;  1QZX A;  3LES A;  3ZVR A;  3LUT B;  1BDJ B;  3H65 A;  3RW0 A;  3RH3 A;  2BC5 A;  1JAF A;  5L3Q A;  2NUP B;  1YA9 A;  1IZM A;  5FZT A;  3FDQ A;  2EPK X;  3RQE A;  4O6N A;  1YYX A;  2F22 A;  2LSE A;  2X51 A;  3S90 A;  1L7C A;  4U9D A;  4CS9 A;  2WB7 A;  4EHP A;  1R4T A;  1T6U A;  1XWJ A;  2GA0 A;  3ATP A;  3JYH A;  3VAY A;  1ZHT A;  1CPQ A;  1SYQ A;  2PNO A;  4BJT A;  3SZR A;  5DQT A;  2IYL D;  1ZHY A;  1ORJ A;  2R7O A;  4JCH A;  4O6M A;  4XPW A;  1ZZP A;  1QKR A;  1LVK A;  3R7C A;  1J8Y F;  3PHF 2;  2MWQ A;  3NMK A;  3DXJ F;  3ZQV A;  1TQG A;  1VOM A;  4AL0 A;  4YT5 A;  1NFO A;  1D0Z A;  2WVO A;  4NQF A;  3DAG A;  4MVS A;  1L3P A;  3Q7L A;  4YL0 A;  3JRT A;  2R7V A;  4CJG A;  1LI7 A;  2G3K A;  2VB6 A;  1F1M A;  2IBF A;  1GS9 A;  3HJC A;  4IAQ A;  4KNV A;  4R32 A;  4ULV A;  5EK0 A;  5JVE A;  3AG3 C;  2FAP B;  1ORS C;  2AWC A;  3B71 A;  5IY5 C;  3R2P A;  2H7O A;  3O55 A;  4JTD B;  2L6F A;  3A9C A;  3B29 A;  5L0F A;  3NMJ A;  1HMD A;  1ZU5 A;  1I5N A;  1CGO A;  1FMV A;  4EBJ A;  4ZLC A;  4KC9 A;  1ORY A;  1UG7 A;  1TR2 A;  5DVW A;  4E18 A;  4M63 A;  3K66 A;  5JS5 A;  1YJG A;  4BEM J;  3VRC A;  4LDR A;  1CPR A;  1YYJ A;  3SP1 A;  1C02 A;  2QY9 A;  3EZI A;  3RVZ A;  3U8V A;  3FOP A;  3U8P A;  3X1O A;  1U0B B;  3L8J A;  1WOL A;  3HLZ A;  4MTG A;  4HFF B;  3AG2 C;  5HSW A;  5COF A;  4NTA A;  5A6B D;  3IQC A;  4U5G A;  1S7Z A;  4BJ5 A;  2ZXP A;  3Q6N A;  3T6J A;  3EFO A;  4F4B A;  3F47 A;  2Q3T A;  2L81 A;  2W4M A;  2YLG A;  2VAS A;  3DJU B;  4J32 B;  4Z9I A;  3DZA A;  5E2Q A;  1D0Y A;  4PFO A;  1OKK D;  3MYF A;  3NYM A;  4YK5 A;  5T3T A;  4JEB A;  1ZHX A;  2HFI A;  3UMI A;  4JEA A;  5JLI A;  2AVK A;  2HUJ A;  4MS2 A;  4N6H A;  2DYS C;  3EGX B;  2EPM X;  1VLT A;  3L8I A;  3WHN A;  4E0I A;  3N2Z B;  4CDA A;  4G7H F;  4P6I C;  2EIL C;  5JSL A;  4EKW A;  3CQZ A;  3JTL O;  3RYL A;  4IJJ A;  3B0V C;  2ZXR A;  3RKO F;  3C7J A;  4L6R A;  1Q0M A;  5TJ5 E;  1V74 B;  2HJ3 A;  4D4N A;  5BQG A;  4HEA J;  1CGN A;  1QQ3 A;  2IXO A;  3QVY A;  3ZTZ A;  3AGU A;  2XLV A;  3E70 C;  2G3V A;  4J7Y A;  1RJ9 A;  5L0H A;  1OXK A;  2DYR C;  2YVK A;  3LLK A;  3FMS A;  1HW2 A;  3J06 A;  2R7S A; 
#chains in the Genus database with same CATH homology
 4CDV A;  2YLI A;  5B3I A;  3ZTM A;  5JT4 A;  2YL7 A;  2XLM A;  3L1M A;  3C62 A;  2XL6 A;  1GQA A;  3C63 A;  3FOO A;  2XL8 A;  4IAR A;  2BC5 A;  1JAF A;  2YLD A;  3HNI A;  1E84 A;  3ZWI A;  4N4W A;  1YZC A;  3QW1 A;  1YYX A;  2CCY A;  2QLA A;  4U9D A;  2YL0 A;  1CPQ A;  5JRA A;  1A7V A;  3QW0 A;  4EIY A;  3M79 A;  3HNK A;  3NMK A;  4JKV A;  1MQV A;  1YZA A;  4CJO A;  1NBB A;  2J9B A;  3ZQV A;  1E85 A;  4WGZ A;  3M15 A;  3QVZ A;  3ZQY A;  3HNL A;  3IQ5 A;  2XLW A;  1BBH A;  1S05 A;  4CJG A;  1E86 A;  4IAQ A;  4CIP A;  4ULV A;  3DE8 A;  4D4X A;  5JVE A;  4CX9 A;  2XM4 A;  2XLO A;  2YL3 A;  3NMJ A;  1CGO A;  1QPU A;  4ER9 A;  2XLE A;  2XLD A;  5JS5 A;  4D4N A;  3VRC A;  1CPR A;  1YYJ A;  3IQ6 A;  1EKY A;  3FOP A;  3U8P A;  1M6T A;  3TOM A;  5JUA A;  3DE9 A;  4JE9 A;  2XM0 A;  2YL1 A;  2YLG A;  3M4B A;  1LM3 B;  4JEB A;  2J8W A;  5JP7 A;  4JEA A;  2YKZ A;  5JLI A;  4N6H A;  3TOL A;  1APC A;  3M4C A;  4CDA A;  1RCP A;  5JSL A;  3HNJ A;  4WGY A;  1E83 A;  4CDY A;  2XLH A;  4L6R A;  5AGF A;  4NC3 A;  4U9E A;  1QQ3 A;  1CGN A;  3QVY A;  3ZTZ A;  2XLV A;  4IB4 A;  3NMI A;  256B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...