4U5CE

Crystal structure of glua2, con-ikot-ikot snail toxin, partial agonist fw and postitive modulator (r,r)-2b complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
85
structure length
85
Chain Sequence
b'GPADCCRMKECCTDRVNECLQRYSGREDKFVSFCYQEATVTCGSFNEIVGCCYGYQMCMIRVVKPNSLSGAHEACKTVSCGNPCA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamate receptor 2
molecule tags Transport protein/toxin
source organism Rattus norvegicus
publication title X-ray structures of AMPA receptor-cone snail toxin complexes illuminate activation mechanism.
pubmed doi rcsb
total genus 28
structure length 85
sequence length 85
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1800 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4u5cE00
4U5EE 4U5GA 4U5CE 4U5DE 4U5HA 4U5FE 4U5BE
chains in the Genus database with same CATH superfamily
1LI5A 2R25A 2CYDA 1VK5A 3GEHA 3SZRA 1OCOC 2HS5A 5A6KA 1OKKA 3AGUA 3RVZA 1K05A 3I5PA 1ZHWA 4MVMA 2HJ3A 1KU2A 1GGQA 1T01A 2YL1A 4DJ9A 2CDQA 4XPXA 1G4US 1RMVA 4Q5SF 3MYIA 2EPKX 4YL0A 2WVOA 3ZSUA 2HFIA 5E2QA 256BA 3DD7A 1GQAA 1PCXA 2ETSA 1B68A 4U5CE 4F4BA 5KYUB 1Z3IX 3UGPA 2XLDA 4G78A 3SYNA 2J8WA 4A4AA 1QLEC 3AGTA 3OA1A 3WG7C 3RH3A 2R7VA 3ZQVA 5DQZA 5CIVA 5KYYB 3B0UX 2CGEA 4AX2A 4ER9A 3NMIA 1OCRC 2X0CA 1U0BB 2ZXWC 2YEVA 4I3MA 4QI2A 3POVA 1ZU4A 2KW3C 4JTCB 2QTVA 4J7TA 2A6EF 3BEHA 3Q6NA 4MNDA 3S29A 2V26A 1L7CA 3JYYA 2EPNA 4KNVA 1Y6DA 1F1MA 5B3SC 2A69F 1D1AA 4JEAA 3NYJA 5F28E 4JVSA 3M15A 3EGXB 4H54A 4CX9A 5L0FA 3ZDLA 3JRMO 4MTOA 3H2VA 5L3QA 1OW8A 3MBGA 4E0HA 4YT5A 3K1IA 3S90A 2BC5A 3EPVA 1FMVA 1YYJA 3JTLO 3K6BA 4EBKA 5KYNA 2Q7RA 2L81A 3PMRA 2A0UA 5KYUA 1OKKD 3C62A 4KC9A 4U5BE 1E86A 1FFHA 1H6GA 1NLXA 5DVWA 3GORA 1D0XA 3U2MA 2I15A 3EJNA 3SXZA 1TKNA 5JSLA 4FWVA 3NYMA 4NTAA 5JS5A 1TWGA 2P1AA 4HE8D 3ZC4A 5KYXA 2ZXOA 1UFBA 2NUPA 4E17A 1Q0FA 2VCAA 2C03A 3K1HA 4J32B 3W8HA 3U8PA 3SXMA 2D5RB 3TJ5A 1I5NA 2M4EA 3HJCA 1OXKA 1RKEB 2BE5F 1A7VA 5HV9A 2GFHA 2FFHA 4XTKA 2XL4A 1VTMP 2R7SA 2HSQA 3FOPA 3E9VA 3EGDB 4RD9A 4XLNF 1PD1A 3DE8A 3RW0A 3U9MA 1A0BA 2XL6A 2XL8A 4FAPB 1ZHTA 4P6IC 2GWWA 2IYLD 3EH2A 1MMGA 2NSGA 4DRHB 1JPJA 1MMAA 1FAPB 1LPEA 2IOQA 4GQHA 4KBLA 3T6BA 2NUTA 4WGZA 2ZD9A 4NTBA 5EHHA 4MTFA 2HKVA 1SF8A 2YZSA 2Q00A 3SXYA 1OQCA 2X51A 4LLEA 3ZG1A 2VB6A 4O7GA 4WGYA 1MNDA 4U5EE 3SNHA 2PNOA 3MYFA 3O6XA 1M6TA 2J7PA 4U9EA 1NZEA 2B0JA 2YLIA 4I1OB 1J8YF 2OOCA 4U5HA 3UGOA 3T4RA 4BEMJ 2YKZA 2HV6A 4GYTA 4CDAA 1HW1A 4XEVA 2IM8A 4CJGA 2QY9A 3SP1A 3KPHA 4PJNA 2R05A 2MHRA 3ASNC 1HE1A 1OCZC 2HMQA 4N06A 4BPMA 2G3VA 2HSBA 1ORSC 4CS9A 3V7OA 4EBJA 1PV3A 2L6GA 4XLPF 2L9JA 2QUPA 2H7BA 3DM9B 1G5ZA 1ORJA 2FGYA 2A1DD 1QZXA 2NPUA 3IQ6A 3KH2A 3BRJA 4H4KC 2GAQA 5B1BC 4D4NA 1ZU5A 3KMIA 5A6AA 5KYXB 4UDVA 3UMHA 4M63A 3EGXA 4ANJA 2WZLA 4PR9A 1E84A 3C8GB 3ZTZA 2EINC 3AQCA 3FHDA 2LFDA 3TK0A 1CGOA 3CZ6A 4B6IA 2W45A 3TD7A 3ECSA 5KYWA 1ST6A 4YK5A 4IJJA 3G50A 5B1AC 1I4YA 4MVSA 3TJ6A 5KYYA 2Y3HA 2I8BA 4CS9C 1OR3A 4PJJA 3K7DA 1NU7D 1RKEA 2QNLA 4YN0B 4IRUA 1YA9A 2WZGA 2JPUA 2MYSA 1YAUO 2LCHA 3AG2C 3HLZA 4JIOA 1UG7A 3SEOA 4XPWA 5HSWA 5AGFA 5JVEA 4L6RA 1W2WA 3C8ZA 3G4ZA 4JCHA 4EWCA 1D0YA 2W9YA 3EG9A 1YJGA 4K1OA 2LP4A 3DI5A 4NQFA 3X1OA 3JRTA 1YARO 2EIMC 2Y69C 1T6UA 3ATPA 1RXQA 3IQ5A 3VM6A 3JSEO 2R7WA 4P9TA 2XLWA 1FNTc 2R7TA 1QPUA 3EG9B 1DOVA 3M4BA 1ORYA 4PACA 3DWWA 1V74B 2XLHA 3R7CA 1IW7F 1VYKA 2L6HA 2OEXA 3LLIA 1QKRA 1G4WR 2B0HA 2ICWG 3Q7GA 2KC3A 3U8VA 3GWNA 4AL0A 1JRAA 3I4UA 1O5HA 1WGWA 4QDLA 3SXKA 3EHNA 3L8JA 1E83A 1YZCA 5L0IA 1CGME 3FDQA 2KNHA 4IWBA 2L6FA 3UMIA 1HE9A 1VB5A 3JSZA 2VC9A 4XEFA 3VRCA 1R5ID 4PJMA 3KKBA 4YT2A 4O6YA 2RD9A 2IXPA 2ZPAA 3MFNA 1G8XA 2KGOA 4PJLA 4Z9HA 1BBHA 1OW6A 2G62A 3LNMB 3WODF 4JCZA 5EGYA 4G7ZF 2R03A 3NG1A 2HZ8A 2P7VA 2R7UA 2YL0A 3EGDA 4EIYA 5IY5C 3C8GA 1RKCA 3ZTMA 3DZAA 3FAJA 3ITFA 2DYSC 2KJGA 3UR3C 2VCCA 4CBEA 2J46A 2EPLX 3LLKA 3WHNA 2OCCC 3ABKC 3ABMC 4I44A 4BJ5C 1Z23A 2YL7A 2YHSA 5COFA 1YA7O 3T6JA 2LK4A 3U0CA 2TMVP 2IBFA 2H7OA 4U5FE 3AQBA 1TQGA 5CI8A 3GEEA 1TR2A 3AOUA 3HNLA 3OWTA 1T9KA 1TWAA 4XQ1A 1BZ4A 4J7YA 3S27A 2J9VA 4CSAC 3C7JA 3AG3C 4MS2A 2PP4A 1ZHYA 1M57C 4D4XA 4KI2A 3EH1A 5A6BA 4E0IA 4IGGA 3S0XA 5BQGA 4O6MA 1OR2A 1LE2A 1VMAA 5FCLA 1A7DA 1C03A 1LVKA 3RYLA 2NUPB 1BR2A 1K40A 4LACB 1EKYA 2GDCA 4K7BA 4XWJA 4JKVA 1KTMA 1C17M 2JD3A 4ULWA 4DVYP 1D1CA 3L8IA 2CNWA 2Q4FA 4EUKB 3FOOA 1APCA 1Q0MA 2HJMA 2OQMA 3F46A 1JR8A 3KL4A 2Q9AA 4G0HA 3LUTB 4NTFA 2EPMX 4NCQA 4NC3A 3NYLA 4FESA 4I1MA 1YDIA 4FX5A 4AE4B 1AUEA 1MQVA 4LDRA 4QI0A 5E3CA 4OIRF 2XSEA 5T3TA 1RJ9A 1XZQA 3CQZA 4DXWA 4OIPF 3UMKA 2BL2A 4OIOF 3GM2A 1XZPA 4BJTA 1LS1A 4OIQF 5GPGB 2NG1A 5F5FA 1N1CA 2AWCA 2OG2A 1TWCA 2AU5A 3A11A 3V5XA 1YZAA 2IXMA 3Q7LA 3QZCA 3RF3A 1WN0A 1HMDA 2KK1A 2XM4A 3DAGA 2HV7A 3I5QA 2UUIA 1I4ZA 4MVZA 1V4AA 1NFNA 2M64A 4U9DA 1H9TA 1TFOB 2GA0A 1ZW2A 2AP3A 2IXNA 4WABA 1LE4A 2OJED 5DS6A 3AG1C 2WL8A 1Q0KA 2Y3BA 4E18A 2A0BA 3ABLC 1LKXA 2JX0A 1BDJB 4LLCA 1A41A 5COMA 1O87A 2J9UA 3VF0A 4JC7A 1NG1A 3VAYA 2A68F 4ZLCA 3Q6MA 2QE9A 3NDBB 4P9FA 1WATA 3TOMA 2YQYA 3LNRA 4C3EA 4IB4A 2MWQA 4HFFB 4MQ9F 3ZVRA 5D92A 1Z63A 3EHMA 3IHUA 5TJ5E 3EZIA 1ZW3A 2RSEB 2EIJC 3B9QA 2L7AA 4PFPA 1GM5A 4CIHA 4BJ6C 2LFFA 4HEAJ 4MVUA 4BJ5A 4GEHA 2Q9BA 1DOWA 4XEKA 3K1IC 3T6GB 5JLIA 3C63A 3JCUQ 3K66A 4KNWA 4MW8A 1J8MF 2A6HF 2Y39A 4ONSA 1ZHZA 2YRFA 5F5HA 4AE4A 4DVZA 2XRHA 4N4WA 4YL1A 5A6JA 1IZMA 2R02A 1NBBA 2P61A 3PDMP 1U89A 1O3UA 3RQGA 4CIPA 4PK4A 2R7QA 3LS0A 4LERA 5K0IA 1BR1A 3EFOB 2XS8A 5E3AA 1GS9A 3M4CA 2E87A 2R7RA 1NFOA 1M2VB 2OEVA 4O79A 2DYRC 4OINF 1RJ9B 4BEJA 1ZVZA 1QVXA 3EQLF 5DLJA 1VYIA 1EQ1A 2V3CC 2UUHA 3ASOC 3CSKA 4CJOA 4DOZA 3FVYA 4JEBA 1Z6AA 1CPQA 2OKUA 1HW2A 1YLMA 2AVKA 4Z9IA 3JYHA 4EBBA 3HNKA 2YWAA 3NKEA 3N0TA 4HFKB 1FTSA 2J9BA 3W2WA 1WTYA 4AL1A 3S84A 1T6IA 3LESA 1LM3B 2XXAA 2G3KA 2XLEA 1YYXA 1WWPA 4CS7A 4E7SA 3W4YA 3DJUB 2XLVA 2HUJA 2WZFA 5EK0A 4YT4A 1KNYA 3DM5A 2Q3TA 2IXOA 5L0GA 1V54C 2DB4A 2XLMA 4R32A 3GM3A 2J0WA 2Y3DA 3ZIBA 3ZWIA 2XXAB 1HY5A 5DQTA 5L0HA 3EFOA 1D0ZA 1H7IA 2Z15A 3LJBA 2OU6A 4JJGA 1ZYRF 3FAPB 4LDQA 5A69A 4JJFA 4G7OF 3U3FA 3CEXA 5BQHA 3K33A 3KYIA 1AEPA 1Z5ZA 3IQCA 1PD0A 2P6VA 1Z7Qc 3LEVA 3TQOA 3O55A 1JOGA 1OXBA 3NMJA 4IAQA 4CDVA 3RKOF 3ZQYA 5JUAA 3DAFA 4RDAA 2LQGA 3KYJA 1WOLA 1M56C 2H7VC 1JAFA 3HTKC 1M2OA 3A9CA 4CDYA 3UNGC 5B3IA 4Q4ZF 1MMNA 1LIHA 2EPOA 4DBRA 3W2VA 5FZTA 1ZHXA 2VASA 1MMDA 3TOLA 4BG0A 2PF4E 3QMKA 2P0NA 2J45A 5AC5A 3F47A 3NKDA 2FAPB 2KYHA 4JTDB 1JMWA 2YL3A 4Q7CA 4DBQA 2NUTB 2R7OA 3V5ZA 4JE9A 1SMYF 1RCPA 2XS1A 1TWHA 1Q0DA 2PBEA 2PX0A 2H8AA 3E70C 4K0DA 3H65A 1Q0GA 1TFKB 3GEIA 1QQ3A 3GWLA 4EKWA 1E2XA 2OJQA 3MLGA 1YVIA 2NSFA 3LS1A 4IAOA 3RIPA 3U2LA 3M79A 4BJ1A 2KQ9A 1EI7A 4X0RA 4JRZA 4O6NA 1Y4CA 4G7HF 1OCCC 3W8IA 3L34A 4OD4A 3NRHA 3R2PA 4LDKA 3QTHA 2QLAA 4CSAA 4ULVA 5L3VA 1FR0A 1HMOA 2KSFA 3HNJA 1M2VA 1OW7A 3QVZA 3MX3A 2J0XA 1U6HA 3GANA 1D1BA 5L0CA 1CPRA 2DI3A 2D4UA 1AVOB 3B0PA 3OEOA 3DMDA 3QW0A 4JTAB 4MVRA 5COGA 2C04A 3WAQA 1BR4A 2YLGA 2XM0A 3JZ0A 3GM1A 5AC4A 3N24A 1WASA 3O10A 1SZIA 4RBNA 3B29A 3HKKA 2ZXRA 3HNIA 4YL3A 5E33A 5T3WA 5DS5A 4DRJB 2LD6A 3IPMO 2ASRA 3PCVA 4MTGA 4E7ZA 3V5YA 4A2NB 3DE9A 4NY3A 2LSEA 5T1DB 1VLTA 2W4BA 4AK9A 3B71A 2DGJA 4IARA 1E85A 4YJWA 4J30B 4MVOA 2R9RB 3L0IA 4CS8C 3QW1A 2J9WA 4YWQA 3S28A 2VH3A 1S7ZA 1SYQA 5JP7A 1FFTC 5L0JA 3DKAA 4JURI 4CS8A 3VYWA 2VCBA 4MVQA 3TULA 5JT4A 3C8GD 4XPYA 2WB7A 4MW3A 1FMWA 3NMKA 3B0VC 2EILC 1T6QA 4ZLDA 3CAXA 3RVYA 3AG4C 1L3PA 2J7PD 1S05A 2WVQA 3G4XA 1CGNA 3LAYA 3RFYA 3S9OA 1NU9C 4Z9JA 4EHPA 3QVYA 3RQFA 3US6A 4OD5A 3U5SA 1VLSA 2ZXPA 4JW1A 3EZHA 3O39A 4U5DE 3GODA 1V55C 3U9JA 4C7OA 2O9XA 1K04A 1QSPA 4C3DA 5DS4A 3IQTA 3M1CB 1A7EA 3FXHA 4C3BA 1MNEA 2PX3A 2AWYA 3L1MA 1T5OA 1XWJA 5KYWB 2EIKC 2CW0F 5D91A 1H9GA 3X2QC 2Y3GA 3FMSA 1JPNA 4C7OB 1R4TA 2CCYA 2W4MA 4N6CA 3H2UA 4W8KA 4U5GA 3T9OA 4YT8A 5JRAA 3J06A 3C18A 3LEOA 2XLOA 1VOMA 2HMZA 1LS4A 1NSGB 4BJ6A 4JZAA 1LI7A 2CNWD 1SR2A 4WJ0A 2YLDA 2PFDA 3RQEA 3U3BA 2F22A 5CI9A 5BUOA 3PHF2 4PFOA 3DJNB 3IEEA 3JT1A 4DRIB 4W8PA 1C02A 2R7XA 5BQIA 3N2ZB 2Q9CA 2LIGA 1EA8A 2WVNA 4N6HA 5L0DA 2YVKA 3DXJF 1ZZPA 5A6BD 3AJMA
chains in the Genus database with same CATH topology
1VK5A 3SZRA 1OCOC 1OKKA 3I5PA 1ZHWA 1KU2A 4Q5SF 2CDQA 2WVOA 3ZSUA 5E2QA 3DD7A 1PCXA 4U5CE 5KYUB 4F4BA 1Z3IX 3UGPA 3SYNA 1QLEC 3OA1A 3WG7C 3RH3A 2R7VA 5DQZA 5KYYB 3B0UX 2CGEA 4AX2A 1OCRC 2ZXWC 2YEVA 4I3MA 4QI2A 3POVA 1ZU4A 2KW3C 2QTVA 3S29A 2A6EF 3Q6NA 4MNDA 2V26A 4KNVA 5B3SC 2A69F 1D1AA 3NYJA 4JVSA 3EGXB 5L3QA 4YT5A 3EPVA 1FMVA 3K6BA 5KYNA 2L81A 3PMRA 5KYUA 1OKKD 4KC9A 4U5BE 1FFHA 5DVWA 1D0XA 3EJNA 1TKNA 4FWVA 3NYMA 1TWGA 4HE8D 3ZC4A 5KYXA 2ZXOA 2NUPA 2C03A 3K1HA 4J32B 3W8HA 2D5RB 2M4EA 3HJCA 2BE5F 2R7SA 2GFHA 2FFHA 4XTKA 2XL4A 3E9VA 3EGDB 4RD9A 4XLNF 1PD1A 1ZHTA 4P6IC 2IYLD 3EH2A 1MMGA 1JPJA 1MMAA 2IOQA 3T6BA 4KBLA 2NUTA 5EHHA 1SF8A 2YZSA 2X51A 4LLEA 3ZG1A 2VB6A 4O7GA 1MNDA 4U5EE 3SNHA 3O6XA 2J7PA 3UGOA 1NZEA 2B0JA 4U5HA 4I1OB 1J8YF 3T4RA 2HV6A 4GYTA 2QY9A 3SP1A 4PJNA 3ASNC 1OCZC 4N06A 2G3VA 4CS9A 3V7OA 4XLPF 2L9JA 2H7BA 3DM9B 2FGYA 3KH2A 2A1DD 1QZXA 4H4KC 5B1BC 5KYXB 1ZU5A 3KMIA 3UMHA 4M63A 3EGXA 4ANJA 2WZLA 2EINC 3AQCA 3FHDA 3CZ6A 4B6IA 2W45A 3TD7A 3ECSA 5KYWA 1ST6A 4IJJA 5B1AC 5KYYA 2Y3HA 2I8BA 4CS9C 4PJJA 3K7DA 1NU7D 4YN0B 4CS8C 4IRUA 2WZGA 3AG2C 2MYSA 3HLZA 5HSWA 1W2WA 4JCHA 4EWCA 1D0YA 2W9YA 3EG9A 3X1OA 3JRTA 2Y69C 2EIMC 2R7WA 2R7TA 3EG9B 1IW7F 1VYKA 3LLIA 3Q7GA 3I4UA 1O5HA 1WGWA 4QDLA 3EHNA 3FDQA 2KNHA 4IWBA 3UMIA 3JSZA 4YT2A 4PJMA 3KKBA 4O6YA 2IXPA 2ZPAA 4PJLA 1G8XA 2KGOA 3WODF 5EGYA 2G62A 4G7ZF 3NG1A 2P7VA 2R7UA 5IY5C 3EGDA 3DZAA 3FAJA 3ITFA 2DYSC 2KJGA 3UR3C 4CBEA 2J46A 3LLKA 2OCCC 3ABKC 3ABMC 4I44A 4BJ5C 1Z23A 2YHSA 3T6JA 2H7OA 4U5FE 3AQBA 5CI8A 1TR2A 3OWTA 1TWAA 3S27A 4CSAC 2J9VA 3AG3C 2PP4A 1ZHYA 1M57C 4KI2A 3EH1A 3S0XA 4O6MA 1VMAA 1LVKA 3RYLA 2NUPB 1BR2A 4LACB 4K7BA 4XWJA 2JD3A 4ULWA 4DVYP 1D1CA 2CNWA 3F46A 3KL4A 4G0HA 2Q9AA 3NYLA 4FESA 4I1MA 4FX5A 4AE4B 4QI0A 5E3CA 4OIRF 2XSEA 4OIPF 1RJ9A 3CQZA 3UMKA 4OIOF 4BJTA 1LS1A 4OIQF 2NG1A 5F5FA 1N1CA 2OG2A 1TWCA 2IXMA 3QZCA 3Q7LA 3DAGA 5T3TA 3I5QA 2HV7A 2IXNA 5DS6A 3AG1C 2WL8A 2Y3BA 3ABLC 1LKXA 4LLCA 1O87A 2J9UA 3VAYA 1NG1A 2A68F 4ZLCA 3Q6MA 3NDBB 3LNRA 4C3EA 2MWQA 4HFFB 4MQ9F 3ZVRA 5D92A 1Z63A 3EHMA 3EZIA 2EIJC 3B9QA 4PFPA 4CIHA 4BJ6C 4BJ5A 4HEAJ 4GEHA 2Q9BA 3K1IC 3JCUQ 3K66A 4KNWA 4AE4A 1J8MF 2A6HF 2Y39A 4DVZA 1ZHZA 5F5HA 2XRHA 1IZMA 4PK4A 2R7QA 3LS0A 4LERA 1BR1A 3EFOB 5E3AA 2E87A 2R7RA 1M2VB 4O79A 4OINF 2DYRC 1RJ9B 4BEJA 3EQLF 5DLJA 1VYIA 2V3CC 3ASOC 3CSKA 3FVYA 1Z6AA 3JYHA 4EBBA 3NKEA 3N0TA 4HFKB 1FTSA 3W2WA 3LESA 2XXAA 2G3KA 4CS7A 4E7SA 3DJUB 2WZFA 4YT4A 3DM5A 2Q3TA 2IXOA 1V54C 3ZIBA 2J0WA 2Y3DA 2XXAB 5DQTA 3EFOA 1D0ZA 2Z15A 3LJBA 4JJGA 1ZYRF 4JJFA 4G7OF 3K33A 1Z5ZA 1PD0A 2P6VA 3LEVA 3DAFA 4RDAA 1M56C 2H7VC 3HTKC 1M2OA 3UNGC 4Q4ZF 1MMNA 4DBRA 3W2VA 1ZHXA 2VASA 1MMDA 4BG0A 2PF4E 3QMKA 2J45A 3F47A 3NKDA 4Q7CA 4DBQA 2NUTB 2R7OA 1SMYF 1TWHA 2PX0A 3E70C 4K0DA 3H65A 3MLGA 3LS1A 4IAOA 3RIPA 4BJ1A 2KQ9A 4X0RA 4O6NA 4G7HF 1OCCC 3W8IA 3L34A 4OD4A 3NRHA 4CSAA 5L3VA 1M2VA 3MX3A 2J0XA 3GANA 1D1BA 3SEOA 3B0PA 3OEOA 3DMDA 4DOZA 2C04A 1BR4A 5FCLA 3N24A 3RKOF 4RBNA 1SZIA 5E33A 2ZXRA 5T3WA 5DS5A 4E7ZA 4A2NB 4NY3A 2LSEA 5T1DB 2W4BA 4AK9A 2DGJA 4YJWA 4J30B 3L0IA 4YWQA 2J9WA 3S28A 2VH3A 1S7ZA 1FFTC 4JURI 4CS8A 3VYWA 2WB7A 1FMWA 3B0VC 2EILC 4ZLDA 3AG4C 2J7PD 2WVQA 3LAYA 3RFYA 1NU9C 4OD5A 2ZXPA 4JW1A 3EZHA 3O39A 4U5DE 3GODA 1V55C 4C7OA 2O9XA 4C3DA 5DS4A 3M1CB 4C3BA 1MNEA 2PX3A 5KYWB 2EIKC 2CW0F 5D91A 3X2QC 2Y3GA 1JPNA 4C7OB 2W4MA 4W8KA 4YT8A 4U5GA 1VOMA 4BJ6A 4JZAA 2CNWD 4WJ0A 2PFDA 5CI9A 5BUOA 3PHF2 4PFOA 3DJNB 3IEEA 3JT1A 2R7XA 3N2ZB 2Q9CA 2WVNA 3DXJF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U5E E;  4U5G A;  4U5C E;  4U5D E;  4U5H A;  4U5F E;  4U5B E; 
#chains in the Genus database with same CATH topology
 1LI5 A;  2R25 A;  2CYD A;  1VK5 A;  3GEH A;  3SZR A;  1OCO C;  2HS5 A;  5A6K A;  1OKK A;  3AGU A;  3RVZ A;  1K05 A;  3I5P A;  1ZHW A;  4MVM A;  2HJ3 A;  1KU2 A;  1GGQ A;  1T01 A;  2YL1 A;  4DJ9 A;  2CDQ A;  4XPX A;  1G4U S;  1RMV A;  4Q5S F;  3MYI A;  2EPK X;  4YL0 A;  2WVO A;  3ZSU A;  2HFI A;  5E2Q A;  256B A;  3DD7 A;  1GQA A;  1PCX A;  2ETS A;  1B68 A;  4U5C E;  4F4B A;  5KYU B;  1Z3I X;  3UGP A;  2XLD A;  4G78 A;  3SYN A;  2J8W A;  4A4A A;  1QLE C;  3AGT A;  3OA1 A;  3WG7 C;  3RH3 A;  2R7V A;  3ZQV A;  5DQZ A;  5CIV A;  5KYY B;  3B0U X;  2CGE A;  4AX2 A;  4ER9 A;  3NMI A;  1OCR C;  2X0C A;  1U0B B;  2ZXW C;  2YEV A;  4I3M A;  4QI2 A;  3POV A;  1ZU4 A;  2KW3 C;  4JTC B;  2QTV A;  4J7T A;  2A6E F;  3BEH A;  3Q6N A;  4MND A;  3S29 A;  2V26 A;  1L7C A;  3JYY A;  2EPN A;  4KNV A;  1Y6D A;  1F1M A;  5B3S C;  2A69 F;  1D1A A;  4JEA A;  3NYJ A;  5F28 E;  4JVS A;  3M15 A;  3EGX B;  4H54 A;  4CX9 A;  5L0F A;  3ZDL A;  3JRM O;  4MTO A;  3H2V A;  5L3Q A;  1OW8 A;  3MBG A;  4E0H A;  4YT5 A;  3K1I A;  3S90 A;  2BC5 A;  3EPV A;  1FMV A;  1YYJ A;  3JTL O;  3K6B A;  4EBK A;  5KYN A;  2Q7R A;  2L81 A;  3PMR A;  2A0U A;  5KYU A;  1OKK D;  3C62 A;  4KC9 A;  4U5B E;  1E86 A;  1FFH A;  1H6G A;  1NLX A;  5DVW A;  3GOR A;  1D0X A;  3U2M A;  2I15 A;  3EJN A;  3SXZ A;  1TKN A;  5JSL A;  4FWV A;  3NYM A;  4NTA A;  5JS5 A;  1TWG A;  2P1A A;  4HE8 D;  3ZC4 A;  5KYX A;  2ZXO A;  1UFB A;  2NUP A;  4E17 A;  1Q0F A;  2VCA A;  2C03 A;  3K1H A;  4J32 B;  3W8H A;  3U8P A;  3SXM A;  2D5R B;  3TJ5 A;  1I5N A;  2M4E A;  3HJC A;  1OXK A;  1RKE B;  2BE5 F;  1A7V A;  5HV9 A;  2GFH A;  2FFH A;  4XTK A;  2XL4 A;  1VTM P;  2R7S A;  2HSQ A;  3FOP A;  3E9V A;  3EGD B;  4RD9 A;  4XLN F;  1PD1 A;  3DE8 A;  3RW0 A;  3U9M A;  1A0B A;  2XL6 A;  2XL8 A;  4FAP B;  1ZHT A;  4P6I C;  2GWW A;  2IYL D;  3EH2 A;  1MMG A;  2NSG A;  4DRH B;  1JPJ A;  1MMA A;  1FAP B;  1LPE A;  2IOQ A;  4GQH A;  4KBL A;  3T6B A;  2NUT A;  4WGZ A;  2ZD9 A;  4NTB A;  5EHH A;  4MTF A;  2HKV A;  1SF8 A;  2YZS A;  2Q00 A;  3SXY A;  1OQC A;  2X51 A;  4LLE A;  3ZG1 A;  2VB6 A;  4O7G A;  4WGY A;  1MND A;  4U5E E;  3SNH A;  2PNO A;  3MYF A;  3O6X A;  1M6T A;  2J7P A;  4U9E A;  1NZE A;  2B0J A;  2YLI A;  4I1O B;  1J8Y F;  2OOC A;  4U5H A;  3UGO A;  3T4R A;  4BEM J;  2YKZ A;  2HV6 A;  4GYT A;  4CDA A;  1HW1 A;  4XEV A;  2IM8 A;  4CJG A;  2QY9 A;  3SP1 A;  3KPH A;  4PJN A;  2R05 A;  2MHR A;  3ASN C;  1HE1 A;  1OCZ C;  2HMQ A;  4N06 A;  4BPM A;  2G3V A;  2HSB A;  1ORS C;  4CS9 A;  3V7O A;  4EBJ A;  1PV3 A;  2L6G A;  4XLP F;  2L9J A;  2QUP A;  2H7B A;  3DM9 B;  1G5Z A;  1ORJ A;  2FGY A;  2A1D D;  1QZX A;  2NPU A;  3IQ6 A;  3KH2 A;  3BRJ A;  4H4K C;  2GAQ A;  5B1B C;  4D4N A;  1ZU5 A;  3KMI A;  5A6A A;  5KYX B;  4UDV A;  3UMH A;  4M63 A;  3EGX A;  4ANJ A;  2WZL A;  4PR9 A;  1E84 A;  3C8G B;  3ZTZ A;  2EIN C;  3AQC A;  3FHD A;  2LFD A;  3TK0 A;  1CGO A;  3CZ6 A;  4B6I A;  2W45 A;  3TD7 A;  3ECS A;  5KYW A;  1ST6 A;  4YK5 A;  4IJJ A;  3G50 A;  5B1A C;  1I4Y A;  4MVS A;  3TJ6 A;  5KYY A;  2Y3H A;  2I8B A;  4CS9 C;  1OR3 A;  4PJJ A;  3K7D A;  1NU7 D;  1RKE A;  2QNL A;  4YN0 B;  4IRU A;  1YA9 A;  2WZG A;  2JPU A;  2MYS A;  1YAU O;  2LCH A;  3AG2 C;  3HLZ A;  4JIO A;  1UG7 A;  3SEO A;  4XPW A;  5HSW A;  5AGF A;  5JVE A;  4L6R A;  1W2W A;  3C8Z A;  3G4Z A;  4JCH A;  4EWC A;  1D0Y A;  2W9Y A;  3EG9 A;  1YJG A;  4K1O A;  2LP4 A;  3DI5 A;  4NQF A;  3X1O A;  3JRT A;  1YAR O;  2EIM C;  2Y69 C;  1T6U A;  3ATP A;  1RXQ A;  3IQ5 A;  3VM6 A;  3JSE O;  2R7W A;  4P9T A;  2XLW A;  1FNT c;  2R7T A;  1QPU A;  3EG9 B;  1DOV A;  3M4B A;  1ORY A;  4PAC A;  3DWW A;  1V74 B;  2XLH A;  3R7C A;  1IW7 F;  1VYK A;  2L6H A;  2OEX A;  3LLI A;  1QKR A;  1G4W R;  2B0H A;  2ICW G;  3Q7G A;  2KC3 A;  3U8V A;  3GWN A;  4AL0 A;  1JRA A;  3I4U A;  1O5H A;  1WGW A;  4QDL A;  3SXK A;  3EHN A;  3L8J A;  1E83 A;  1YZC A;  5L0I A;  1CGM E;  3FDQ A;  2KNH A;  4IWB A;  2L6F A;  3UMI A;  1HE9 A;  1VB5 A;  3JSZ A;  2VC9 A;  4XEF A;  3VRC A;  1R5I D;  4PJM A;  3KKB A;  4YT2 A;  4O6Y A;  2RD9 A;  2IXP A;  2ZPA A;  3MFN A;  1G8X A;  2KGO A;  4PJL A;  4Z9H A;  1BBH A;  1OW6 A;  2G62 A;  3LNM B;  3WOD F;  4JCZ A;  5EGY A;  4G7Z F;  2R03 A;  3NG1 A;  2HZ8 A;  2P7V A;  2R7U A;  2YL0 A;  3EGD A;  4EIY A;  5IY5 C;  3C8G A;  1RKC A;  3ZTM A;  3DZA A;  3FAJ A;  3ITF A;  2DYS C;  2KJG A;  3UR3 C;  2VCC A;  4CBE A;  2J46 A;  2EPL X;  3LLK A;  3WHN A;  2OCC C;  3ABK C;  3ABM C;  4I44 A;  4BJ5 C;  1Z23 A;  2YL7 A;  2YHS A;  5COF A;  1YA7 O;  3T6J A;  2LK4 A;  3U0C A;  2TMV P;  2IBF A;  2H7O A;  4U5F E;  3AQB A;  1TQG A;  5CI8 A;  3GEE A;  1TR2 A;  3AOU A;  3HNL A;  3OWT A;  1T9K A;  1TWA A;  4XQ1 A;  1BZ4 A;  4J7Y A;  3S27 A;  2J9V A;  4CSA C;  3C7J A;  3AG3 C;  4MS2 A;  2PP4 A;  1ZHY A;  1M57 C;  4D4X A;  4KI2 A;  3EH1 A;  5A6B A;  4E0I A;  4IGG A;  3S0X A;  5BQG A;  4O6M A;  1OR2 A;  1LE2 A;  1VMA A;  5FCL A;  1A7D A;  1C03 A;  1LVK A;  3RYL A;  2NUP B;  1BR2 A;  1K40 A;  4LAC B;  1EKY A;  2GDC A;  4K7B A;  4XWJ A;  4JKV A;  1KTM A;  1C17 M;  2JD3 A;  4ULW A;  4DVY P;  1D1C A;  3L8I A;  2CNW A;  2Q4F A;  4EUK B;  3FOO A;  1APC A;  1Q0M A;  2HJM A;  2OQM A;  3F46 A;  1JR8 A;  3KL4 A;  2Q9A A;  4G0H A;  3LUT B;  4NTF A;  2EPM X;  4NCQ A;  4NC3 A;  3NYL A;  4FES A;  4I1M A;  1YDI A;  4FX5 A;  4AE4 B;  1AUE A;  1MQV A;  4LDR A;  4QI0 A;  5E3C A;  4OIR F;  2XSE A;  5T3T A;  1RJ9 A;  1XZQ A;  3CQZ A;  4DXW A;  4OIP F;  3UMK A;  2BL2 A;  4OIO F;  3GM2 A;  1XZP A;  4BJT A;  1LS1 A;  4OIQ F;  5GPG B;  2NG1 A;  5F5F A;  1N1C A;  2AWC A;  2OG2 A;  1TWC A;  2AU5 A;  3A11 A;  3V5X A;  1YZA A;  2IXM A;  3Q7L A;  3QZC A;  3RF3 A;  1WN0 A;  1HMD A;  2KK1 A;  2XM4 A;  3DAG A;  2HV7 A;  3I5Q A;  2UUI A;  1I4Z A;  4MVZ A;  1V4A A;  1NFN A;  2M64 A;  4U9D A;  1H9T A;  1TFO B;  2GA0 A;  1ZW2 A;  2AP3 A;  2IXN A;  4WAB A;  1LE4 A;  2OJE D;  5DS6 A;  3AG1 C;  2WL8 A;  1Q0K A;  2Y3B A;  4E18 A;  2A0B A;  3ABL C;  1LKX A;  2JX0 A;  1BDJ B;  4LLC A;  1A41 A;  5COM A;  1O87 A;  2J9U A;  3VF0 A;  4JC7 A;  1NG1 A;  3VAY A;  2A68 F;  4ZLC A;  3Q6M A;  2QE9 A;  3NDB B;  4P9F A;  1WAT A;  3TOM A;  2YQY A;  3LNR A;  4C3E A;  4IB4 A;  2MWQ A;  4HFF B;  4MQ9 F;  3ZVR A;  5D92 A;  1Z63 A;  3EHM A;  3IHU A;  5TJ5 E;  3EZI A;  1ZW3 A;  2RSE B;  2EIJ C;  3B9Q A;  2L7A A;  4PFP A;  1GM5 A;  4CIH A;  4BJ6 C;  2LFF A;  4HEA J;  4MVU A;  4BJ5 A;  4GEH A;  2Q9B A;  1DOW A;  4XEK A;  3K1I C;  3T6G B;  5JLI A;  3C63 A;  3JCU Q;  3K66 A;  4KNW A;  4MW8 A;  1J8M F;  2A6H F;  2Y39 A;  4ONS A;  1ZHZ A;  2YRF A;  5F5H A;  4AE4 A;  4DVZ A;  2XRH A;  4N4W A;  4YL1 A;  5A6J A;  1IZM A;  2R02 A;  1NBB A;  2P61 A;  3PDM P;  1U89 A;  1O3U A;  3RQG A;  4CIP A;  4PK4 A;  2R7Q A;  3LS0 A;  4LER A;  5K0I A;  1BR1 A;  3EFO B;  2XS8 A;  5E3A A;  1GS9 A;  3M4C A;  2E87 A;  2R7R A;  1NFO A;  1M2V B;  2OEV A;  4O79 A;  2DYR C;  4OIN F;  1RJ9 B;  4BEJ A;  1ZVZ A;  1QVX A;  3EQL F;  5DLJ A;  1VYI A;  1EQ1 A;  2V3C C;  2UUH A;  3ASO C;  3CSK A;  4CJO A;  4DOZ A;  3FVY A;  4JEB A;  1Z6A A;  1CPQ A;  2OKU A;  1HW2 A;  1YLM A;  2AVK A;  4Z9I A;  3JYH A;  4EBB A;  3HNK A;  2YWA A;  3NKE A;  3N0T A;  4HFK B;  1FTS A;  2J9B A;  3W2W A;  1WTY A;  4AL1 A;  3S84 A;  1T6I A;  3LES A;  1LM3 B;  2XXA A;  2G3K A;  2XLE A;  1YYX A;  1WWP A;  4CS7 A;  4E7S A;  3W4Y A;  3DJU B;  2XLV A;  2HUJ A;  2WZF A;  5EK0 A;  4YT4 A;  1KNY A;  3DM5 A;  2Q3T A;  2IXO A;  5L0G A;  1V54 C;  2DB4 A;  2XLM A;  4R32 A;  3GM3 A;  2J0W A;  2Y3D A;  3ZIB A;  3ZWI A;  2XXA B;  1HY5 A;  5DQT A;  5L0H A;  3EFO A;  1D0Z A;  1H7I A;  2Z15 A;  3LJB A;  2OU6 A;  4JJG A;  1ZYR F;  3FAP B;  4LDQ A;  5A69 A;  4JJF A;  4G7O F;  3U3F A;  3CEX A;  5BQH A;  3K33 A;  3KYI A;  1AEP A;  1Z5Z A;  3IQC A;  1PD0 A;  2P6V A;  1Z7Q c;  3LEV A;  3TQO A;  3O55 A;  1JOG A;  1OXB A;  3NMJ A;  4IAQ A;  4CDV A;  3RKO F;  3ZQY A;  5JUA A;  3DAF A;  4RDA A;  2LQG A;  3KYJ A;  1WOL A;  1M56 C;  2H7V C;  1JAF A;  3HTK C;  1M2O A;  3A9C A;  4CDY A;  3UNG C;  5B3I A;  4Q4Z F;  1MMN A;  1LIH A;  2EPO A;  4DBR A;  3W2V A;  5FZT A;  1ZHX A;  2VAS A;  1MMD A;  3TOL A;  4BG0 A;  2PF4 E;  3QMK A;  2P0N A;  2J45 A;  5AC5 A;  3F47 A;  3NKD A;  2FAP B;  2KYH A;  4JTD B;  1JMW A;  2YL3 A;  4Q7C A;  4DBQ A;  2NUT B;  2R7O A;  3V5Z A;  4JE9 A;  1SMY F;  1RCP A;  2XS1 A;  1TWH A;  1Q0D A;  2PBE A;  2PX0 A;  2H8A A;  3E70 C;  4K0D A;  3H65 A;  1Q0G A;  1TFK B;  3GEI A;  1QQ3 A;  3GWL A;  4EKW A;  1E2X A;  2OJQ A;  3MLG A;  1YVI A;  2NSF A;  3LS1 A;  4IAO A;  3RIP A;  3U2L A;  3M79 A;  4BJ1 A;  2KQ9 A;  1EI7 A;  4X0R A;  4JRZ A;  4O6N A;  1Y4C A;  4G7H F;  1OCC C;  3W8I A;  3L34 A;  4OD4 A;  3NRH A;  3R2P A;  4LDK A;  3QTH A;  2QLA A;  4CSA A;  4ULV A;  5L3V A;  1FR0 A;  1HMO A;  2KSF A;  3HNJ A;  1M2V A;  1OW7 A;  3QVZ A;  3MX3 A;  2J0X A;  1U6H A;  3GAN A;  1D1B A;  5L0C A;  1CPR A;  2DI3 A;  2D4U A;  1AVO B;  3B0P A;  3OEO A;  3DMD A;  3QW0 A;  4JTA B;  4MVR A;  5COG A;  2C04 A;  3WAQ A;  1BR4 A;  2YLG A;  2XM0 A;  3JZ0 A;  3GM1 A;  5AC4 A;  3N24 A;  1WAS A;  3O10 A;  1SZI A;  4RBN A;  3B29 A;  3HKK A;  2ZXR A;  3HNI A;  4YL3 A;  5E33 A;  5T3W A;  5DS5 A;  4DRJ B;  2LD6 A;  3IPM O;  2ASR A;  3PCV A;  4MTG A;  4E7Z A;  3V5Y A;  4A2N B;  3DE9 A;  4NY3 A;  2LSE A;  5T1D B;  1VLT A;  2W4B A;  4AK9 A;  3B71 A;  2DGJ A;  4IAR A;  1E85 A;  4YJW A;  4J30 B;  4MVO A;  2R9R B;  3L0I A;  4CS8 C;  3QW1 A;  2J9W A;  4YWQ A;  3S28 A;  2VH3 A;  1S7Z A;  1SYQ A;  5JP7 A;  1FFT C;  5L0J A;  3DKA A;  4JUR I;  4CS8 A;  3VYW A;  2VCB A;  4MVQ A;  3TUL A;  5JT4 A;  3C8G D;  4XPY A;  2WB7 A;  4MW3 A;  1FMW A;  3NMK A;  3B0V C;  2EIL C;  1T6Q A;  4ZLD A;  3CAX A;  3RVY A;  3AG4 C;  1L3P A;  2J7P D;  1S05 A;  2WVQ A;  3G4X A;  1CGN A;  3LAY A;  3RFY A;  3S9O A;  1NU9 C;  4Z9J A;  4EHP A;  3QVY A;  3RQF A;  3US6 A;  4OD5 A;  3U5S A;  1VLS A;  2ZXP A;  4JW1 A;  3EZH A;  3O39 A;  4U5D E;  3GOD A;  1V55 C;  3U9J A;  4C7O A;  2O9X A;  1K04 A;  1QSP A;  4C3D A;  5DS4 A;  3IQT A;  3M1C B;  1A7E A;  3FXH A;  4C3B A;  1MNE A;  2PX3 A;  2AWY A;  3L1M A;  1T5O A;  1XWJ A;  5KYW B;  2EIK C;  2CW0 F;  5D91 A;  1H9G A;  3X2Q C;  2Y3G A;  3FMS A;  1JPN A;  4C7O B;  1R4T A;  2CCY A;  2W4M A;  4N6C A;  3H2U A;  4W8K A;  4U5G A;  3T9O A;  4YT8 A;  5JRA A;  3J06 A;  3C18 A;  3LEO A;  2XLO A;  1VOM A;  2HMZ A;  1LS4 A;  1NSG B;  4BJ6 A;  4JZA A;  1LI7 A;  2CNW D;  1SR2 A;  4WJ0 A;  2YLD A;  2PFD A;  3RQE A;  3U3B A;  2F22 A;  5CI9 A;  5BUO A;  3PHF 2;  4PFO A;  3DJN B;  3IEE A;  3JT1 A;  4DRI B;  4W8P A;  1C02 A;  2R7X A;  5BQI A;  3N2Z B;  2Q9C A;  2LIG A;  1EA8 A;  2WVN A;  4N6H A;  5L0D A;  2YVK A;  3DXJ F;  1ZZP A;  5A6B D;  3AJM A; 
#chains in the Genus database with same CATH homology
 1VK5 A;  3SZR A;  1OCO C;  1OKK A;  3I5P A;  1ZHW A;  1KU2 A;  4Q5S F;  2CDQ A;  2WVO A;  3ZSU A;  5E2Q A;  3DD7 A;  1PCX A;  4U5C E;  5KYU B;  4F4B A;  1Z3I X;  3UGP A;  3SYN A;  1QLE C;  3OA1 A;  3WG7 C;  3RH3 A;  2R7V A;  5DQZ A;  5KYY B;  3B0U X;  2CGE A;  4AX2 A;  1OCR C;  2ZXW C;  2YEV A;  4I3M A;  4QI2 A;  3POV A;  1ZU4 A;  2KW3 C;  2QTV A;  3S29 A;  2A6E F;  3Q6N A;  4MND A;  2V26 A;  4KNV A;  5B3S C;  2A69 F;  1D1A A;  3NYJ A;  4JVS A;  3EGX B;  5L3Q A;  4YT5 A;  3EPV A;  1FMV A;  3K6B A;  5KYN A;  2L81 A;  3PMR A;  5KYU A;  1OKK D;  4KC9 A;  4U5B E;  1FFH A;  5DVW A;  1D0X A;  3EJN A;  1TKN A;  4FWV A;  3NYM A;  1TWG A;  4HE8 D;  3ZC4 A;  5KYX A;  2ZXO A;  2NUP A;  2C03 A;  3K1H A;  4J32 B;  3W8H A;  2D5R B;  2M4E A;  3HJC A;  2BE5 F;  2R7S A;  2GFH A;  2FFH A;  4XTK A;  2XL4 A;  3E9V A;  3EGD B;  4RD9 A;  4XLN F;  1PD1 A;  1ZHT A;  4P6I C;  2IYL D;  3EH2 A;  1MMG A;  1JPJ A;  1MMA A;  2IOQ A;  3T6B A;  4KBL A;  2NUT A;  5EHH A;  1SF8 A;  2YZS A;  2X51 A;  4LLE A;  3ZG1 A;  2VB6 A;  4O7G A;  1MND A;  4U5E E;  3SNH A;  3O6X A;  2J7P A;  3UGO A;  1NZE A;  2B0J A;  4U5H A;  4I1O B;  1J8Y F;  3T4R A;  2HV6 A;  4GYT A;  2QY9 A;  3SP1 A;  4PJN A;  3ASN C;  1OCZ C;  4N06 A;  2G3V A;  4CS9 A;  3V7O A;  4XLP F;  2L9J A;  2H7B A;  3DM9 B;  2FGY A;  3KH2 A;  2A1D D;  1QZX A;  4H4K C;  5B1B C;  5KYX B;  1ZU5 A;  3KMI A;  3UMH A;  4M63 A;  3EGX A;  4ANJ A;  2WZL A;  2EIN C;  3AQC A;  3FHD A;  3CZ6 A;  4B6I A;  2W45 A;  3TD7 A;  3ECS A;  5KYW A;  1ST6 A;  4IJJ A;  5B1A C;  5KYY A;  2Y3H A;  2I8B A;  4CS9 C;  4PJJ A;  3K7D A;  1NU7 D;  4YN0 B;  4CS8 C;  4IRU A;  2WZG A;  3AG2 C;  2MYS A;  3HLZ A;  5HSW A;  1W2W A;  4JCH A;  4EWC A;  1D0Y A;  2W9Y A;  3EG9 A;  3X1O A;  3JRT A;  2Y69 C;  2EIM C;  2R7W A;  2R7T A;  3EG9 B;  1IW7 F;  1VYK A;  3LLI A;  3Q7G A;  3I4U A;  1O5H A;  1WGW A;  4QDL A;  3EHN A;  3FDQ A;  2KNH A;  4IWB A;  3UMI A;  3JSZ A;  4YT2 A;  4PJM A;  3KKB A;  4O6Y A;  2IXP A;  2ZPA A;  4PJL A;  1G8X A;  2KGO A;  3WOD F;  5EGY A;  2G62 A;  4G7Z F;  3NG1 A;  2P7V A;  2R7U A;  5IY5 C;  3EGD A;  3DZA A;  3FAJ A;  3ITF A;  2DYS C;  2KJG A;  3UR3 C;  4CBE A;  2J46 A;  3LLK A;  2OCC C;  3ABK C;  3ABM C;  4I44 A;  4BJ5 C;  1Z23 A;  2YHS A;  3T6J A;  2H7O A;  4U5F E;  3AQB A;  5CI8 A;  1TR2 A;  3OWT A;  1TWA A;  3S27 A;  4CSA C;  2J9V A;  3AG3 C;  2PP4 A;  1ZHY A;  1M57 C;  4KI2 A;  3EH1 A;  3S0X A;  4O6M A;  1VMA A;  1LVK A;  3RYL A;  2NUP B;  1BR2 A;  4LAC B;  4K7B A;  4XWJ A;  2JD3 A;  4ULW A;  4DVY P;  1D1C A;  2CNW A;  3F46 A;  3KL4 A;  4G0H A;  2Q9A A;  3NYL A;  4FES A;  4I1M A;  4FX5 A;  4AE4 B;  4QI0 A;  5E3C A;  4OIR F;  2XSE A;  4OIP F;  1RJ9 A;  3CQZ A;  3UMK A;  4OIO F;  4BJT A;  1LS1 A;  4OIQ F;  2NG1 A;  5F5F A;  1N1C A;  2OG2 A;  1TWC A;  2IXM A;  3QZC A;  3Q7L A;  3DAG A;  5T3T A;  3I5Q A;  2HV7 A;  2IXN A;  5DS6 A;  3AG1 C;  2WL8 A;  2Y3B A;  3ABL C;  1LKX A;  4LLC A;  1O87 A;  2J9U A;  3VAY A;  1NG1 A;  2A68 F;  4ZLC A;  3Q6M A;  3NDB B;  3LNR A;  4C3E A;  2MWQ A;  4HFF B;  4MQ9 F;  3ZVR A;  5D92 A;  1Z63 A;  3EHM A;  3EZI A;  2EIJ C;  3B9Q A;  4PFP A;  4CIH A;  4BJ6 C;  4BJ5 A;  4HEA J;  4GEH A;  2Q9B A;  3K1I C;  3JCU Q;  3K66 A;  4KNW A;  4AE4 A;  1J8M F;  2A6H F;  2Y39 A;  4DVZ A;  1ZHZ A;  5F5H A;  2XRH A;  1IZM A;  4PK4 A;  2R7Q A;  3LS0 A;  4LER A;  1BR1 A;  3EFO B;  5E3A A;  2E87 A;  2R7R A;  1M2V B;  4O79 A;  4OIN F;  2DYR C;  1RJ9 B;  4BEJ A;  3EQL F;  5DLJ A;  1VYI A;  2V3C C;  3ASO C;  3CSK A;  3FVY A;  1Z6A A;  3JYH A;  4EBB A;  3NKE A;  3N0T A;  4HFK B;  1FTS A;  3W2W A;  3LES A;  2XXA A;  2G3K A;  4CS7 A;  4E7S A;  3DJU B;  2WZF A;  4YT4 A;  3DM5 A;  2Q3T A;  2IXO A;  1V54 C;  3ZIB A;  2J0W A;  2Y3D A;  2XXA B;  5DQT A;  3EFO A;  1D0Z A;  2Z15 A;  3LJB A;  4JJG A;  1ZYR F;  4JJF A;  4G7O F;  3K33 A;  1Z5Z A;  1PD0 A;  2P6V A;  3LEV A;  3DAF A;  4RDA A;  1M56 C;  2H7V C;  3HTK C;  1M2O A;  3UNG C;  4Q4Z F;  1MMN A;  4DBR A;  3W2V A;  1ZHX A;  2VAS A;  1MMD A;  4BG0 A;  2PF4 E;  3QMK A;  2J45 A;  3F47 A;  3NKD A;  4Q7C A;  4DBQ A;  2NUT B;  2R7O A;  1SMY F;  1TWH A;  2PX0 A;  3E70 C;  4K0D A;  3H65 A;  3MLG A;  3LS1 A;  4IAO A;  3RIP A;  4BJ1 A;  2KQ9 A;  4X0R A;  4O6N A;  4G7H F;  1OCC C;  3W8I A;  3L34 A;  4OD4 A;  3NRH A;  4CSA A;  5L3V A;  1M2V A;  3MX3 A;  2J0X A;  3GAN A;  1D1B A;  3SEO A;  3B0P A;  3OEO A;  3DMD A;  4DOZ A;  2C04 A;  1BR4 A;  5FCL A;  3N24 A;  3RKO F;  4RBN A;  1SZI A;  5E33 A;  2ZXR A;  5T3W A;  5DS5 A;  4E7Z A;  4A2N B;  4NY3 A;  2LSE A;  5T1D B;  2W4B A;  4AK9 A;  2DGJ A;  4YJW A;  4J30 B;  3L0I A;  4YWQ A;  2J9W A;  3S28 A;  2VH3 A;  1S7Z A;  1FFT C;  4JUR I;  4CS8 A;  3VYW A;  2WB7 A;  1FMW A;  3B0V C;  2EIL C;  4ZLD A;  3AG4 C;  2J7P D;  2WVQ A;  3LAY A;  3RFY A;  1NU9 C;  4OD5 A;  2ZXP A;  4JW1 A;  3EZH A;  3O39 A;  4U5D E;  3GOD A;  1V55 C;  4C7O A;  2O9X A;  4C3D A;  5DS4 A;  3M1C B;  4C3B A;  1MNE A;  2PX3 A;  5KYW B;  2EIK C;  2CW0 F;  5D91 A;  3X2Q C;  2Y3G A;  1JPN A;  4C7O B;  2W4M A;  4W8K A;  4YT8 A;  4U5G A;  1VOM A;  4BJ6 A;  4JZA A;  2CNW D;  4WJ0 A;  2PFD A;  5CI9 A;  5BUO A;  3PHF 2;  4PFO A;  3DJN B;  3IEE A;  3JT1 A;  2R7X A;  3N2Z B;  2Q9C A;  2WVN A;  3DXJ F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...