4U5CE

Crystal structure of glua2, con-ikot-ikot snail toxin, partial agonist fw and postitive modulator (r,r)-2b complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
85
structure length
85
Chain Sequence
GPADCCRMKECCTDRVNECLQRYSGREDKFVSFCYQEATVTCGSFNEIVGCCYGYQMCMIRVVKPNSLSGAHEACKTVSCGNPCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamate receptor 2
publication title X-ray structures of AMPA receptor-cone snail toxin complexes illuminate activation mechanism.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein/toxin
total genus 28
structure length 85
sequence length 85
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1800 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4u5cE00
4U5BE 4U5FE 4U5EE 4U5HA 4U5GA 4U5CE 4U5DE
chains in the Genus database with same CATH superfamily
3FOPA 3M4CA 1Y6DA 3O10A 4MS2A 2UUIA 3TJ5A 3UNGC 3M15A 5KYXB 4HE8D 4U5CE 2IYLD 3MBGA 5BQGA 3US6A 5BQHA 3EFOB 1PCXA 2OJQA 3OWTA 1VTMP 1KU2A 3EGDB 3QTHA 3G4ZA 5HSWA 1OKKD 3LLIA 1QQ3A 3K66A 4H54A 3JTLO 5KYUA 2HSBA 1FFTC 2EPKX 2ZXWC 3ASNC 3FMSA 2PNOA 3U0CA 1RKEB 1B68A 4YT8A 3K1HA 1GGQA 1WOLA 4JVSA 3T4RA 5COFA 2V26A 3EG9A 3R7CA 1BR1A 3FAJA 2L6HA 2YLDA 1ZW3A 3LEVA 3V5YA 4P9FA 4MTGA 4FAPB 2YL7A 3O55A 3C18A 2NUPB 3KYIA 2EIJC 1G8XA 1QZXA 3W2VA 2YKZA 2WVNA 5EHHA 5L3VA 2H8AA 2KQ9A 1ZYRF 2HJMA 1TWAA 2PP4A 2VC9A 1C17M 2GFHA 256BA 2LIGA 1LE4A 4XWJA 3TOLA 4ZLCA 3HKKA 4CS7A 3VRCA 2IXMA 3X1OA 2HJ3A 3Q6MA 5A6JA 1YVIA 4G7OF 2XL4A 4FX5A 4J7TA 5JS5A 4LLEA 1J8YF 2XSEA 3RYLA 4YT4A 3NRHA 1VYIA 1G4WR 4CIHA 3FDQA 1TWHA 1F1MA 4JCHA 1HMOA 3FVYA 3GM3A 4N6HA 4XEFA 4YL3A 1LI7A 4JE9A 4Q7CA 1D1CA 1Q0GA 2WVOA 3B0UX 2AWYA 2IM8A 2KYHA 4NTBA 2FFHA 1TQGA 1YDIA 3DWWA 4CX9A 2YL1A 2CYDA 3MYIA 3CSKA 4U9EA 2ASRA 3L1MA 3ZDLA 2KNHA 5EGYA 2R9RB 2R7UA 3RQFA 4HEAJ 1V4AA 1T01A 3RVYA 3TK0A 4KNWA 3ZQVA 5KYYB 1MQVA 3FHDA 1SF8A 3C8GA 2JPUA 3EGXA 5DS5A 2R7WA 4BEMJ 1ZHWA 1ZHXA 3IPMO 1ZVZA 1HE1A 4G7HF 3S27A 4ANJA 3HNLA 3KPHA 2XLOA 2A68F 1M57C 3E70C 1YLMA 3NYMA 1K05A 1YA7O 2XLDA 2QUPA 4R32A 3VYWA 4AL0A 2H7BA 3HNJA 5DQTA 5GPGB 1M56C 5A6BA 2MWQA 4XLNF 1O3UA 2YLGA 5CI8A 1WWPA 3ABKC 1EQ1A 4YK5A 1K40A 1OW8A 3JSEO 4QDLA 2P61A 1OXKA 2AVKA 2TMVP 2HMZA 2PBEA 5B3IA 5JSLA 4YT2A 3SXKA 4B6IA 4Q4ZF 1BDJB 1NZEA 4FWVA 5B3SC 5DVWA 1OKKA 3H2VA 2NUTB 1CGNA 1LS4A 1ZZPA 4C7OB 5COGA 3U5SA 4JTCB 1NSGB 4MVQA 5F5HA 1HE9A 3O6XA 2Y3DA 1ZHYA 2XLHA 3AJMA 5T1DB 3U9JA 1IZMA 4N06A 1BR2A 2LFFA 4O79A 3SYNA 5COMA 5L0HA 3UMKA 1JR8A 3FAPB 2EIKC 3GM1A 3IQ5A 3TULA 4ER9A 1E83A 2OEXA 1PD0A 2NG1A 1D1AA 2G3VA 2A6HF 2X0CA 3J06A 3EZIA 3LAYA 2EINC 5D92A 4NTFA 4OIPF 5KYNA 5A6KA 1H7IA 2KK1A 2QTVA 2Y39A 1AUEA 3AGUA 3SXZA 2AWCA 2M4EA 1QLEC 4AE4A 4E18A 3U3BA 3RVZA 1Z6AA 4KI2A 1MMDA 1C03A 2YWAA 4FESA 1MMAA 3DKAA 4I3MA 4J30B 4XEKA 3X2QC 1GM5A 2E87A 4MVRA 2XXAA 5KYUB 4ULWA 1H9TA 3ZWIA 4AK9A 1Q0DA 4LLCA 2NPUA 2DI3A 2J9UA 2O9XA 4PJJA 1L7CA 5FZTA 2PF4E 3EG9B 3RKOF 2ZXPA 3QMKA 1ORJA 2VB6A 2XRHA 3C8GD 1T6IA 3W2WA 5HV9A 4G7ZF 2EPNA 1BBHA 1MNEA 2J8WA 2QLAA 3RQGA 2J9BA 3LESA 2RSEB 1AVOB 3L8JA 4JURI 1A7VA 2XS8A 1A7EA 3FOOA 2JX0A 3GODA 1QKRA 3AG1C 4O6YA 1S05A 4IJJA 4YT5A 1FMWA 5A6BD 4JRZA 4PACA 4CJOA 3S28A 2ETSA 2LSEA 4BJ6A 1APCA 2CW0F 2QY9A 3M1CB 4O7GA 3PHF2 2J0WA 1OCOC 3ZC4A 4RD9A 4EBBA 1JOGA 1NG1A 3IQCA 1LS1A 3LUTB 4YL0A 3ITFA 5EK0A 4DBRA 5JLIA 2L6GA 1OXBA 2WZFA 4PFOA 1O5HA 5AGFA 3NMJA 1K04A 4HFFB 3BEHA 4IAQA 1Z3IX 3K1IC 5L0JA 3EJNA 1E2XA 1ORSC 2YQYA 4NTAA 3M79A 2Q3TA 4U9DA 4HFKB 4YL1A 5K0IA 3UGOA 4GYTA 3C8GB 3EGXB 3W8HA 3EH1A 5B1AC 2Y3BA 1Q0MA 3JRTA 4U5GA 3PDMP 1I4ZA 4AL1A 3GWLA 2A6EF 5L3QA 3S90A 1A41A 1CGOA 3B71A 5BQIA 3FXHA 1VK5A 2R7QA 3GEEA 2YRFA 4D4NA 3G50A 4RDAA 4UDVA 4MVMA 5AC4A 2DYSC 2VH3A 3UR3C 1DOVA 3IEEA 4U5FE 2XL6A 2HS5A 1SZIA 3ZG1A 2QNLA 3JRMO 1RXQA 4IB4A 1I5NA 3Q7GA 4DXWA 5DS4A 3U3FA 3DE8A 3BRJA 2JD3A 3KH2A 4E0HA 5A69A 4E7ZA 2P6VA 1OCRC 4MQ9F 1JMWA 2ZD9A 2NSGA 2Y3GA 4ZLDA 1JPJA 1G4US 2EILC 5E3AA 2VASA 3WHNA 3QW1A 3TD7A 1A7DA 2OU6A 1WGWA 3UMIA 1R4TA 2VCAA 1NBBA 2HUJA 3ABMC 1ZU5A 3DZAA 3W8IA 2CGEA 2R05A 5DQZA 2Q7RA 3K1IA 2C04A 3ZQYA 1D0ZA 1MMGA 2DGJA 2XM0A 3HNIA 3OA1A 2GAQA 3LJBA 1YA9A 4DVZA 4JW1A 1H6GA 2GA0A 3RF3A 3C63A 4AE4B 1E85A 1Q0FA 3VM6A 4E17A 2R7XA 3HTKC 2CNWA 3K6BA 4XEVA 2YL0A 1NU9C 2RD9A 2Y69C 4JEAA 3EZHA 2ICWG 2J0XA 3ZTMA 2KSFA 2XXAB 3PMRA 1RCPA 3F47A 3VF0A 4BJ5C 2P0NA 1NLXA 1M2OA 2EIMC 4CSAC 1YYXA 4EWCA 2MHRA 4XPXA 3RH3A 3DJNB 3S9OA 4BJ6C 3ZSUA 1LKXA 3I5PA 5E3CA 2KJGA 2UUHA 5L0CA 3NMKA 1ZHTA 4MVUA 3V5ZA 2V3CC 3KKBA 2D5RB 2DB4A 3NKEA 3ATPA 3C7JA 4BJ1A 2WB7A 5JT4A 1C02A 3B0PA 1ZU4A 3NYLA 4K1OA 5L0IA 3ECSA 4OIQF 1RJ9A 3E9VA 2XL8A 4E7SA 4WJ0A 3CAXA 3S0XA 3UGPA 4IRUA 1HMDA 1ORYA 3I4UA 1CPQA 1EI7A 4WGYA 3VAYA 3G4XA 4NC3A 4CBEA 2J7PA 4O6MA 3N24A 4RBNA 3TQOA 3N0TA 4DJ9A 1TWGA 3K33A 5L0GA 2IXPA 4D4XA 5DS6A 3AQCA 1UG7A 4JC7A 4JEBA 5E2QA 2J46A 3KMIA 3T6GB 2R03A 4YJWA 3ZVRA 2FAPB 1GQAA 4JJFA 2AU5A 1WN0A 2L6FA 3RFYA 1QSPA 4BG0A 1O87A 1J8MF 1EKYA 3EHNA 4LDRA 4G0HA 4IAOA 3WG7C 4AX2A 2F22A 4P9TA 1U89A 3V5XA 1HY5A 3DAFA 4LDKA 4DOZA 1A0BA 3PCVA 3GEIA 4ULVA 2AP3A 2EPOA 1JAFA 1MMNA 2BL2A 5DLJA 1TR2A 2R7OA 4Z9JA 1M2VA 1VOMA 2L7AA 3EHMA 3SP1A 1H9GA 1RKCA 2EPMX 3S84A 1TFOB 4MW8A 1YJGA 4P6IC 2HMQA 1Z7Qc 3T9OA 4U5BE 2A0BA 3WAQA 4CS9C 2LD6A 4DRHB 3CEXA 4DRJB 4EBKA 1SYQA 5D91A 1FNTc 4I44A 1CPRA 3R2PA 2LFDA 3LLKA 2YHSA 3SNHA 1HW1A 1TWCA 2J9VA 4BJ5A 4DBQA 3DI5A 3AG3C 2ZXRA 4CSAA 4CDYA 1OW6A 4I1MA 4MVOA 4JJGA 3EPVA 1ST6A 3OEOA 2Q00A 1U6HA 2CNWD 4GQHA 3QW0A 1XWJA 4EBJA 1M6TA 1Z5ZA 2LK4A 3V7OA 1JPNA 4JTDB 2CDQA 1BZ4A 4O6NA 5A6AA 3JYHA 2R7SA 3B29A 5CIVA 4OIOF 2KGOA 2L9JA 2Q9AA 1IW7F 4IARA 1VMAA 3ABLC 4JCZA 2OEVA 3DM9B 3EH2A 3CQZA 2YZSA 4QI0A 1PD1A 4J32B 3U2LA 3TOMA 2I15A 4OINF 1TKNA 3RQEA 1S7ZA 1WASA 2PX3A 1OCZC 3T6JA 4CDAA 1T5OA 3U9MA 1RMVA 4M63A 3TJ6A 1XZQA 3ZTZA 1EA8A 1BR4A 1LIHA 2XLVA 2LP4A 1T6UA 2H7VC 1SR2A 3DD7A 3MYFA 1OR2A 3NKDA 4PJLA 4QI2A 4JKVA 2BC5A 1FFHA 1YARO 3DJUB 4YN0B 2B0JA 1VLSA 2YLIA 1TFKB 5JVEA 2J45A 2LQGA 2J7PD 3LEOA 3IQTA 4I1OB 1XZPA 2I8BA 3SXMA 2WL8A 2W4MA 4Q5SF 3GORA 2EPLX 3QZCA 4NCQA 4WGZA 4EKWA 3I5QA 1QVXA 4NY3A 4BEJA 4LDQA 4MNDA 2WZGA 4CS9A 3SEOA 2OCCC 4MVZA 1E84A 3MFNA 1VLTA 4CIPA 2ZPAA 1FMVA 3U2MA 4BJTA 2Y3HA 3LNMB 3C62A 3JZ0A 3Q7LA 5BUOA 1V55C 3S29A 3JCUQ 3K7DA 2IOQA 4XTKA 3JSZA 2XLEA 2XLWA 2ZXOA 3B9QA 1NFOA 3AOUA 1MNDA 3U8PA 3UMHA 1LE2A 2HSQA 1T9KA 5KYXA 3DM5A 4BPMA 3KYJA 1RJ9B 2HFIA 2NSFA 2YL3A 4ONSA 1L3PA 3EFOA 5F5FA 2IXOA 1Z63A 4F4BA 3EGDA 4U5EE 3JYYA 4JIOA 3C8ZA 3RW0A 3AG4C 3LS1A 2GDCA 1NFNA 4DVYP 2R7TA 1OR3A 2OQMA 3O39A 1KNYA 2A69F 1RKEA 2GWWA 4PJMA 4XQ1A 2YEVA 4N4WA 4C3EA 4A4AA 4CS8A 1VB5A 2OKUA 4CDVA 2Q9CA 5TJ5E 5KYWB 2B0HA 2VCBA 1AEPA 2G62A 4Z9HA 1GS9A 3AGTA 4W8KA 2CCYA 1VYKA 2LCHA 2NUPA 4OD4A 3F46A 1Y4CA 1YAUO 2IBFA 2IXNA 2A1DD 3DXJF 3NMIA 2BE5F 1YZCA 1M2VB 3AQBA 2XM4A 4LACB 1LVKA 4PJNA 3POVA 1N1CA 2R02A 3GM2A 1T6QA 1I4YA 4OIRF 2X51A 2XS1A 3A9CA 2A0UA 1V54C 3Q6NA 3HLZA 1W2WA 3QVZA 3DMDA 1D0YA 1D0XA 1QPUA 2P1AA 3JT1A 4KC9A 1JRAA 4X0RA 2PFDA 2Q9BA 4C3BA 1LM3B 4DRIB 1U0BB 4JTAB 2KC3A 4IWBA 1OQCA 4MVSA 2OJED 1ZHZA 5E33A 2Z15A 2W45A 3KL4A 1ZW2A 2HV7A 1OW7A 2HZ8A 3H2UA 3MX3A 3U8VA 4EIYA 4XPWA 2HV6A 1KTMA 4KBLA 2C03A 2G3KA 2H7OA 4U5HA 1SMYF 4EUKB 5KYYA 3L0IA 1FAPB 1V74B 4WABA 1R5ID 3AG2C 3LNRA 4U5DE 5KYWA 1E86A 2R7RA 2DYRC 2MYSA 4KNVA 3IHUA 4C3DA 1NU7D 1Q0KA 5CI9A 5T3TA 4E0IA 3ASOC 4XPYA 1UFBA 3DE9A 3CZ6A 1LI5A 3L34A 2W9YA 3L8IA 3M4BA 4K7BA 5B1BC 2WVQA 3GWNA 4H4KC 4JZAA 2QE9A 2W4BA 3A11A 2VCCA 1FTSA 2HKVA 2P7VA 4OD5A 2D4UA 3HJCA 5F28E 5FCLA 2L81A 4MTFA 2OG2A 2YVKA 4GEHA 5JP7A 4K0DA 2PX0A 1YYJA 4LERA 2KW3C 3NYJA 3GEHA 4W8PA 4PFPA 4PR9A 1WTYA 3DAGA 2NUTA 4L6RA 4NQFA 3W4YA 1CGME 1HW2A 2R25A 4PK4A 5JUAA 4C7OA 1WATA 1D1BA 4J7YA 2R7VA 4CJGA 3SZRA 3T6BA 5L0DA 1FR0A 3SXYA 4YWQA 3HNKA 4Z9IA 5JRAA 1YZAA 2Q4FA 3B0VC 3EQLF 3WODF 5L0FA 3LS0A 1Z23A 4IGGA 3MLGA 4XLPF 5T3WA 1DOWA 3H65A 2J9WA 2M64A 2WZLA 2XLMA 3IQ6A 3GANA 5IY5C 1OCCC 4A2NB 3ZIBA 4N6CA 1PV3A 4MTOA 3RIPA 4MW3A 1G5ZA 3NDBB 1LPEA 4G78A 4EHPA 2FGYA 4CS8C 3NG1A 5AC5A 2OOCA 3N2ZB 3QVYA
chains in the Genus database with same CATH topology
3UNGC 5KYXB 4HE8D 4U5CE 2IYLD 3EFOB 1PCXA 3OWTA 1KU2A 3EGDB 5HSWA 1OKKD 3LLIA 3K66A 5KYUA 1FFTC 2ZXWC 3ASNC 4YT8A 3K1HA 3T4RA 4JVSA 2V26A 3EG9A 1BR1A 3FAJA 3LEVA 2NUPB 3W2VA 2EIJC 1G8XA 1QZXA 5EHHA 5L3VA 2WVNA 2V3CC 2KQ9A 1ZYRF 2PP4A 1TWAA 4XWJA 3SNHA 2GFHA 4F4BA 4ZLCA 4CS7A 2IXMA 3X1OA 3Q6MA 4G7OF 2XL4A 4FX5A 4LLEA 1J8YF 2XSEA 3RYLA 4YT4A 3NRHA 1VYIA 4CIHA 3FDQA 1TWHA 4JCHA 3FVYA 4Q7CA 1D1CA 2WVOA 3B0UX 2FFHA 3CSKA 2KNHA 5EGYA 2R7UA 4HEAJ 5KYYB 4KNWA 3FHDA 1SF8A 3EGXA 5DS5A 2R7WA 1ZHWA 1ZHXA 4G7HF 3S27A 4ANJA 2A68F 1M57C 3E70C 3NYMA 3VYWA 2H7BA 5DQTA 1M56C 2MWQA 4XLNF 5CI8A 3ABKC 4QDLA 4YT2A 4B6IA 4Q4ZF 1NZEA 4FWVA 5B3SC 5DVWA 1OKKA 2NUTB 4C7OB 5F5HA 3O6XA 2Y3DA 1ZHYA 5T1DB 1IZMA 4N06A 1BR2A 4O79A 3SYNA 3UMKA 2EIKC 1PD0A 2NG1A 1D1AA 2G3VA 2A6HF 3EZIA 3LAYA 2EINC 5D92A 4OIPF 5KYNA 2QTVA 2Y39A 4AE4A 2M4EA 1QLEC 4KI2A 1Z6AA 1MMDA 4FESA 1MMAA 4I3MA 3X2QC 4J30B 2E87A 2XXAA 5KYUB 4ULWA 4AK9A 4LLCA 2J9UA 2O9XA 4PJJA 2PF4E 3EG9B 3RKOF 2ZXPA 3QMKA 2VB6A 2XRHA 3W2WA 4G7ZF 1MNEA 3LESA 4JURI 3GODA 3AG1C 4O6YA 4IJJA 4YT5A 1FMWA 3S28A 4BJ6A 2LSEA 2CW0F 3M1CB 2QY9A 4O7GA 3PHF2 2J0WA 1OCOC 3ZC4A 4RD9A 4EBBA 1NG1A 1LS1A 3ITFA 4DBRA 2WZFA 4PFOA 1O5HA 4HFFB 3K1IC 1Z3IX 3EJNA 2Q3TA 4HFKB 3UGOA 4GYTA 3EGXB 3W8HA 3EH1A 5B1AC 2Y3BA 3JRTA 4U5GA 2A6EF 5L3QA 1VK5A 2R7QA 4RDAA 2DYSC 2VH3A 3UR3C 3IEEA 4U5FE 1SZIA 3ZG1A 3Q7GA 5DS4A 2JD3A 3KH2A 4E7ZA 2P6VA 1OCRC 4MQ9F 2Y3GA 4ZLDA 1JPJA 2EILC 5E3AA 2VASA 3TD7A 1WGWA 3UMIA 3ABMC 1ZU5A 3DZAA 3W8IA 2CGEA 5DQZA 2C04A 1D0ZA 1MMGA 2DGJA 3OA1A 4DVZA 3LJBA 4JW1A 4AE4B 2R7XA 3HTKC 2CNWA 3K6BA 1NU9C 2Y69C 3EZHA 2J0XA 2XXAB 3PMRA 3F47A 4BJ5C 1M2OA 2EIMC 4CSAC 4EWCA 3RH3A 3DJNB 4BJ6C 3ZSUA 1LKXA 3I5PA 5E3CA 2KJGA 1ZHTA 3KKBA 2D5RB 3NKEA 4BJ1A 2WB7A 3B0PA 3NYLA 1ZU4A 4OIQF 3ECSA 1RJ9A 3E9VA 4E7SA 3S0XA 4WJ0A 3UGPA 4IRUA 3I4UA 3VAYA 4CBEA 2J7PA 4O6MA 3N24A 4RBNA 3N0TA 1TWGA 3K33A 2IXPA 5DS6A 3AQCA 5E2QA 2J46A 3KMIA 3ZVRA 4YJWA 4JJFA 4BG0A 3RFYA 1O87A 1J8MF 3EHNA 4G0HA 4IAOA 3WG7C 4AX2A 3DAFA 4DOZA 5DLJA 1MMNA 1TR2A 2R7OA 1M2VA 1VOMA 3EHMA 3SP1A 4P6IC 4U5BE 4CS9C 5D91A 4I44A 3LLKA 2YHSA 1TWCA 2J9VA 4BJ5A 4DBQA 3AG3C 2ZXRA 4CSAA 4I1MA 4JJGA 3EPVA 1ST6A 3OEOA 2CNWD 1Z5ZA 3V7OA 1JPNA 2CDQA 4O6NA 2R7SA 3JYHA 4OIOF 2KGOA 2L9JA 2Q9AA 1IW7F 1VMAA 3ABLC 3DM9B 3EH2A 3CQZA 2YZSA 4QI0A 1PD1A 4J32B 4OINF 1TKNA 1S7ZA 2PX3A 1OCZC 3T6JA 4M63A 1BR4A 2H7VC 3DD7A 4PJLA 3NKDA 4QI2A 1FFHA 4YN0B 3DJUB 2B0JA 2J45A 2J7PD 4I1OB 2I8BA 2WL8A 2W4MA 4Q5SF 3QZCA 3I5QA 4NY3A 4BEJA 4MNDA 2WZGA 4CS9A 3SEOA 2OCCC 2ZPAA 1FMVA 4BJTA 2Y3HA 5BUOA 3Q7LA 1V55C 3S29A 3JCUQ 3K7DA 2IOQA 4XTKA 3JSZA 2ZXOA 3B9QA 1MNDA 3UMHA 5KYXA 3DM5A 1RJ9B 3EFOA 5F5FA 2IXOA 1Z63A 3EGDA 4U5EE 3AG4C 3LS1A 4DVYP 2R7TA 3O39A 2A69F 4PJMA 4CS8A 2YEVA 4C3EA 2Q9CA 5KYWB 2G62A 4W8KA 1VYKA 2NUPA 4OD4A 3F46A 2IXNA 2A1DD 3DXJF 2BE5F 3AQBA 1M2VB 4LACB 4PJNA 3POVA 1LVKA 1N1CA 4OIRF 2X51A 1V54C 3Q6NA 3HLZA 1W2WA 3DMDA 1D0YA 1D0XA 3JT1A 4KC9A 4X0RA 2PFDA 2Q9BA 4C3BA 4IWBA 1ZHZA 5E33A 2Z15A 2W45A 3KL4A 2HV7A 3MX3A 2HV6A 4KBLA 2C03A 2G3KA 2H7OA 4U5HA 1SMYF 5KYYA 3L0IA 5KYWA 3AG2C 3LNRA 4U5DE 2R7RA 2DYRC 2MYSA 4KNVA 4C3DA 1NU7D 5CI9A 5T3TA 3ASOC 3CZ6A 3L34A 4K7BA 2W9YA 5B1BC 2WVQA 4H4KC 4JZAA 2W4BA 1FTSA 2P7VA 4OD5A 3HJCA 5FCLA 2L81A 2OG2A 4GEHA 4K0DA 2PX0A 4LERA 2KW3C 3NYJA 4PFPA 3DAGA 2NUTA 4PK4A 4C7OA 2R7VA 1D1BA 3SZRA 3T6BA 4YWQA 3B0VC 3EQLF 3WODF 3LS0A 1Z23A 4XLPF 3MLGA 5T3WA 3H65A 2J9WA 2WZLA 5IY5C 3GANA 1OCCC 4A2NB 3ZIBA 3RIPA 3NDBB 2FGYA 4CS8C 3NG1A 3N2ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U5B E;  4U5F E;  4U5E E;  4U5H A;  4U5G A;  4U5C E;  4U5D E; 
#chains in the Genus database with same CATH topology
 3FOP A;  3M4C A;  1Y6D A;  3O10 A;  4MS2 A;  2UUI A;  3TJ5 A;  3UNG C;  3M15 A;  5KYX B;  4HE8 D;  4U5C E;  2IYL D;  3MBG A;  5BQG A;  3US6 A;  5BQH A;  3EFO B;  1PCX A;  2OJQ A;  3OWT A;  1VTM P;  1KU2 A;  3EGD B;  3QTH A;  3G4Z A;  5HSW A;  1OKK D;  3LLI A;  1QQ3 A;  3K66 A;  4H54 A;  3JTL O;  5KYU A;  2HSB A;  1FFT C;  2EPK X;  2ZXW C;  3ASN C;  3FMS A;  2PNO A;  3U0C A;  1RKE B;  1B68 A;  4YT8 A;  3K1H A;  1GGQ A;  1WOL A;  4JVS A;  3T4R A;  5COF A;  2V26 A;  3EG9 A;  3R7C A;  1BR1 A;  3FAJ A;  2L6H A;  2YLD A;  1ZW3 A;  3LEV A;  3V5Y A;  4P9F A;  4MTG A;  4FAP B;  2YL7 A;  3O55 A;  3C18 A;  2NUP B;  3KYI A;  2EIJ C;  1G8X A;  1QZX A;  3W2V A;  2YKZ A;  2WVN A;  5EHH A;  5L3V A;  2H8A A;  2KQ9 A;  1ZYR F;  2HJM A;  1TWA A;  2PP4 A;  2VC9 A;  1C17 M;  2GFH A;  256B A;  2LIG A;  1LE4 A;  4XWJ A;  3TOL A;  4ZLC A;  3HKK A;  4CS7 A;  3VRC A;  2IXM A;  3X1O A;  2HJ3 A;  3Q6M A;  5A6J A;  1YVI A;  4G7O F;  2XL4 A;  4FX5 A;  4J7T A;  5JS5 A;  4LLE A;  1J8Y F;  2XSE A;  3RYL A;  4YT4 A;  3NRH A;  1VYI A;  1G4W R;  4CIH A;  3FDQ A;  1TWH A;  1F1M A;  4JCH A;  1HMO A;  3FVY A;  3GM3 A;  4N6H A;  4XEF A;  4YL3 A;  1LI7 A;  4JE9 A;  4Q7C A;  1D1C A;  1Q0G A;  2WVO A;  3B0U X;  2AWY A;  2IM8 A;  2KYH A;  4NTB A;  2FFH A;  1TQG A;  1YDI A;  3DWW A;  4CX9 A;  2YL1 A;  2CYD A;  3MYI A;  3CSK A;  4U9E A;  2ASR A;  3L1M A;  3ZDL A;  2KNH A;  5EGY A;  2R9R B;  2R7U A;  3RQF A;  4HEA J;  1V4A A;  1T01 A;  3RVY A;  3TK0 A;  4KNW A;  3ZQV A;  5KYY B;  1MQV A;  3FHD A;  1SF8 A;  3C8G A;  2JPU A;  3EGX A;  5DS5 A;  2R7W A;  4BEM J;  1ZHW A;  1ZHX A;  3IPM O;  1ZVZ A;  1HE1 A;  4G7H F;  3S27 A;  4ANJ A;  3HNL A;  3KPH A;  2XLO A;  2A68 F;  1M57 C;  3E70 C;  1YLM A;  3NYM A;  1K05 A;  1YA7 O;  2XLD A;  2QUP A;  4R32 A;  3VYW A;  4AL0 A;  2H7B A;  3HNJ A;  5DQT A;  5GPG B;  1M56 C;  5A6B A;  2MWQ A;  4XLN F;  1O3U A;  2YLG A;  5CI8 A;  1WWP A;  3ABK C;  1EQ1 A;  4YK5 A;  1K40 A;  1OW8 A;  3JSE O;  4QDL A;  2P61 A;  1OXK A;  2AVK A;  2TMV P;  2HMZ A;  2PBE A;  5B3I A;  5JSL A;  4YT2 A;  3SXK A;  4B6I A;  4Q4Z F;  1BDJ B;  1NZE A;  4FWV A;  5B3S C;  5DVW A;  1OKK A;  3H2V A;  2NUT B;  1CGN A;  1LS4 A;  1ZZP A;  4C7O B;  5COG A;  3U5S A;  4JTC B;  1NSG B;  4MVQ A;  5F5H A;  1HE9 A;  3O6X A;  2Y3D A;  1ZHY A;  2XLH A;  3AJM A;  5T1D B;  3U9J A;  1IZM A;  4N06 A;  1BR2 A;  2LFF A;  4O79 A;  3SYN A;  5COM A;  5L0H A;  3UMK A;  1JR8 A;  3FAP B;  2EIK C;  3GM1 A;  3IQ5 A;  3TUL A;  4ER9 A;  1E83 A;  2OEX A;  1PD0 A;  2NG1 A;  1D1A A;  2G3V A;  2A6H F;  2X0C A;  3J06 A;  3EZI A;  3LAY A;  2EIN C;  5D92 A;  4NTF A;  4OIP F;  5KYN A;  5A6K A;  1H7I A;  2KK1 A;  2QTV A;  2Y39 A;  1AUE A;  3AGU A;  3SXZ A;  2AWC A;  2M4E A;  1QLE C;  4AE4 A;  4E18 A;  3U3B A;  3RVZ A;  1Z6A A;  4KI2 A;  1MMD A;  1C03 A;  2YWA A;  4FES A;  1MMA A;  3DKA A;  4I3M A;  4J30 B;  4XEK A;  3X2Q C;  1GM5 A;  2E87 A;  4MVR A;  2XXA A;  5KYU B;  4ULW A;  1H9T A;  3ZWI A;  4AK9 A;  1Q0D A;  4LLC A;  2NPU A;  2DI3 A;  2J9U A;  2O9X A;  4PJJ A;  1L7C A;  5FZT A;  2PF4 E;  3EG9 B;  3RKO F;  2ZXP A;  3QMK A;  1ORJ A;  2VB6 A;  2XRH A;  3C8G D;  1T6I A;  3W2W A;  5HV9 A;  4G7Z F;  2EPN A;  1BBH A;  1MNE A;  2J8W A;  2QLA A;  3RQG A;  2J9B A;  3LES A;  2RSE B;  1AVO B;  3L8J A;  4JUR I;  1A7V A;  2XS8 A;  1A7E A;  3FOO A;  2JX0 A;  3GOD A;  1QKR A;  3AG1 C;  4O6Y A;  1S05 A;  4IJJ A;  4YT5 A;  1FMW A;  5A6B D;  4JRZ A;  4PAC A;  4CJO A;  3S28 A;  2ETS A;  2LSE A;  4BJ6 A;  1APC A;  2CW0 F;  2QY9 A;  3M1C B;  4O7G A;  3PHF 2;  2J0W A;  1OCO C;  3ZC4 A;  4RD9 A;  4EBB A;  1JOG A;  1NG1 A;  3IQC A;  1LS1 A;  3LUT B;  4YL0 A;  3ITF A;  5EK0 A;  4DBR A;  5JLI A;  2L6G A;  1OXB A;  2WZF A;  4PFO A;  1O5H A;  5AGF A;  3NMJ A;  1K04 A;  4HFF B;  3BEH A;  4IAQ A;  1Z3I X;  3K1I C;  5L0J A;  3EJN A;  1E2X A;  1ORS C;  2YQY A;  4NTA A;  3M79 A;  2Q3T A;  4U9D A;  4HFK B;  4YL1 A;  5K0I A;  3UGO A;  4GYT A;  3C8G B;  3EGX B;  3W8H A;  3EH1 A;  5B1A C;  2Y3B A;  1Q0M A;  3JRT A;  4U5G A;  3PDM P;  1I4Z A;  4AL1 A;  3GWL A;  2A6E F;  5L3Q A;  3S90 A;  1A41 A;  1CGO A;  3B71 A;  5BQI A;  3FXH A;  1VK5 A;  2R7Q A;  3GEE A;  2YRF A;  4D4N A;  3G50 A;  4RDA A;  4UDV A;  4MVM A;  5AC4 A;  2DYS C;  2VH3 A;  3UR3 C;  1DOV A;  3IEE A;  4U5F E;  2XL6 A;  2HS5 A;  1SZI A;  3ZG1 A;  2QNL A;  3JRM O;  1RXQ A;  4IB4 A;  1I5N A;  3Q7G A;  4DXW A;  5DS4 A;  3U3F A;  3DE8 A;  3BRJ A;  2JD3 A;  3KH2 A;  4E0H A;  5A69 A;  4E7Z A;  2P6V A;  1OCR C;  4MQ9 F;  1JMW A;  2ZD9 A;  2NSG A;  2Y3G A;  4ZLD A;  1JPJ A;  1G4U S;  2EIL C;  5E3A A;  2VAS A;  3WHN A;  3QW1 A;  3TD7 A;  1A7D A;  2OU6 A;  1WGW A;  3UMI A;  1R4T A;  2VCA A;  1NBB A;  2HUJ A;  3ABM C;  1ZU5 A;  3DZA A;  3W8I A;  2CGE A;  2R05 A;  5DQZ A;  2Q7R A;  3K1I A;  2C04 A;  3ZQY A;  1D0Z A;  1MMG A;  2DGJ A;  2XM0 A;  3HNI A;  3OA1 A;  2GAQ A;  3LJB A;  1YA9 A;  4DVZ A;  4JW1 A;  1H6G A;  2GA0 A;  3RF3 A;  3C63 A;  4AE4 B;  1E85 A;  1Q0F A;  3VM6 A;  4E17 A;  2R7X A;  3HTK C;  2CNW A;  3K6B A;  4XEV A;  2YL0 A;  1NU9 C;  2RD9 A;  2Y69 C;  4JEA A;  3EZH A;  2ICW G;  2J0X A;  3ZTM A;  2KSF A;  2XXA B;  3PMR A;  1RCP A;  3F47 A;  3VF0 A;  4BJ5 C;  2P0N A;  1NLX A;  1M2O A;  2EIM C;  4CSA C;  1YYX A;  4EWC A;  2MHR A;  4XPX A;  3RH3 A;  3DJN B;  3S9O A;  4BJ6 C;  3ZSU A;  1LKX A;  3I5P A;  5E3C A;  2KJG A;  2UUH A;  5L0C A;  3NMK A;  1ZHT A;  4MVU A;  3V5Z A;  2V3C C;  3KKB A;  2D5R B;  2DB4 A;  3NKE A;  3ATP A;  3C7J A;  4BJ1 A;  2WB7 A;  5JT4 A;  1C02 A;  3B0P A;  1ZU4 A;  3NYL A;  4K1O A;  5L0I A;  3ECS A;  4OIQ F;  1RJ9 A;  3E9V A;  2XL8 A;  4E7S A;  4WJ0 A;  3CAX A;  3S0X A;  3UGP A;  4IRU A;  1HMD A;  1ORY A;  3I4U A;  1CPQ A;  1EI7 A;  4WGY A;  3VAY A;  3G4X A;  4NC3 A;  4CBE A;  2J7P A;  4O6M A;  3N24 A;  4RBN A;  3TQO A;  3N0T A;  4DJ9 A;  1TWG A;  3K33 A;  5L0G A;  2IXP A;  4D4X A;  5DS6 A;  3AQC A;  1UG7 A;  4JC7 A;  4JEB A;  5E2Q A;  2J46 A;  3KMI A;  3T6G B;  2R03 A;  4YJW A;  3ZVR A;  2FAP B;  1GQA A;  4JJF A;  2AU5 A;  1WN0 A;  2L6F A;  3RFY A;  1QSP A;  4BG0 A;  1O87 A;  1J8M F;  1EKY A;  3EHN A;  4LDR A;  4G0H A;  4IAO A;  3WG7 C;  4AX2 A;  2F22 A;  4P9T A;  1U89 A;  3V5X A;  1HY5 A;  3DAF A;  4LDK A;  4DOZ A;  1A0B A;  3PCV A;  3GEI A;  4ULV A;  2AP3 A;  2EPO A;  1JAF A;  1MMN A;  2BL2 A;  5DLJ A;  1TR2 A;  2R7O A;  4Z9J A;  1M2V A;  1VOM A;  2L7A A;  3EHM A;  3SP1 A;  1H9G A;  1RKC A;  2EPM X;  3S84 A;  1TFO B;  4MW8 A;  1YJG A;  4P6I C;  2HMQ A;  1Z7Q c;  3T9O A;  4U5B E;  2A0B A;  3WAQ A;  4CS9 C;  2LD6 A;  4DRH B;  3CEX A;  4DRJ B;  4EBK A;  1SYQ A;  5D91 A;  1FNT c;  4I44 A;  1CPR A;  3R2P A;  2LFD A;  3LLK A;  2YHS A;  3SNH A;  1HW1 A;  1TWC A;  2J9V A;  4BJ5 A;  4DBQ A;  3DI5 A;  3AG3 C;  2ZXR A;  4CSA A;  4CDY A;  1OW6 A;  4I1M A;  4MVO A;  4JJG A;  3EPV A;  1ST6 A;  3OEO A;  2Q00 A;  1U6H A;  2CNW D;  4GQH A;  3QW0 A;  1XWJ A;  4EBJ A;  1M6T A;  1Z5Z A;  2LK4 A;  3V7O A;  1JPN A;  4JTD B;  2CDQ A;  1BZ4 A;  4O6N A;  5A6A A;  3JYH A;  2R7S A;  3B29 A;  5CIV A;  4OIO F;  2KGO A;  2L9J A;  2Q9A A;  1IW7 F;  4IAR A;  1VMA A;  3ABL C;  4JCZ A;  2OEV A;  3DM9 B;  3EH2 A;  3CQZ A;  2YZS A;  4QI0 A;  1PD1 A;  4J32 B;  3U2L A;  3TOM A;  2I15 A;  4OIN F;  1TKN A;  3RQE A;  1S7Z A;  1WAS A;  2PX3 A;  1OCZ C;  3T6J A;  4CDA A;  1T5O A;  3U9M A;  1RMV A;  4M63 A;  3TJ6 A;  1XZQ A;  3ZTZ A;  1EA8 A;  1BR4 A;  1LIH A;  2XLV A;  2LP4 A;  1T6U A;  2H7V C;  1SR2 A;  3DD7 A;  3MYF A;  1OR2 A;  3NKD A;  4PJL A;  4QI2 A;  4JKV A;  2BC5 A;  1FFH A;  1YAR O;  3DJU B;  4YN0 B;  2B0J A;  1VLS A;  2YLI A;  1TFK B;  5JVE A;  2J45 A;  2LQG A;  2J7P D;  3LEO A;  3IQT A;  4I1O B;  1XZP A;  2I8B A;  3SXM A;  2WL8 A;  2W4M A;  4Q5S F;  3GOR A;  2EPL X;  3QZC A;  4NCQ A;  4WGZ A;  4EKW A;  3I5Q A;  1QVX A;  4NY3 A;  4BEJ A;  4LDQ A;  4MND A;  2WZG A;  4CS9 A;  3SEO A;  2OCC C;  4MVZ A;  1E84 A;  3MFN A;  1VLT A;  4CIP A;  2ZPA A;  1FMV A;  3U2M A;  4BJT A;  2Y3H A;  3LNM B;  3C62 A;  3JZ0 A;  3Q7L A;  5BUO A;  1V55 C;  3S29 A;  3JCU Q;  3K7D A;  2IOQ A;  4XTK A;  3JSZ A;  2XLE A;  2XLW A;  2ZXO A;  3B9Q A;  1NFO A;  3AOU A;  1MND A;  3U8P A;  3UMH A;  1LE2 A;  2HSQ A;  1T9K A;  5KYX A;  3DM5 A;  4BPM A;  3KYJ A;  1RJ9 B;  2HFI A;  2NSF A;  2YL3 A;  4ONS A;  1L3P A;  3EFO A;  5F5F A;  2IXO A;  1Z63 A;  4F4B A;  3EGD A;  4U5E E;  3JYY A;  4JIO A;  3C8Z A;  3RW0 A;  3AG4 C;  3LS1 A;  2GDC A;  1NFN A;  4DVY P;  2R7T A;  1OR3 A;  2OQM A;  3O39 A;  1KNY A;  2A69 F;  1RKE A;  2GWW A;  4PJM A;  4XQ1 A;  2YEV A;  4N4W A;  4C3E A;  4A4A A;  4CS8 A;  1VB5 A;  2OKU A;  4CDV A;  2Q9C A;  5TJ5 E;  5KYW B;  2B0H A;  2VCB A;  1AEP A;  2G62 A;  4Z9H A;  1GS9 A;  3AGT A;  4W8K A;  2CCY A;  1VYK A;  2LCH A;  2NUP A;  4OD4 A;  3F46 A;  1Y4C A;  1YAU O;  2IBF A;  2IXN A;  2A1D D;  3DXJ F;  3NMI A;  2BE5 F;  1YZC A;  1M2V B;  3AQB A;  2XM4 A;  4LAC B;  1LVK A;  4PJN A;  3POV A;  1N1C A;  2R02 A;  3GM2 A;  1T6Q A;  1I4Y A;  4OIR F;  2X51 A;  2XS1 A;  3A9C A;  2A0U A;  1V54 C;  3Q6N A;  3HLZ A;  1W2W A;  3QVZ A;  3DMD A;  1D0Y A;  1D0X A;  1QPU A;  2P1A A;  3JT1 A;  4KC9 A;  1JRA A;  4X0R A;  2PFD A;  2Q9B A;  4C3B A;  1LM3 B;  4DRI B;  1U0B B;  4JTA B;  2KC3 A;  4IWB A;  1OQC A;  4MVS A;  2OJE D;  1ZHZ A;  5E33 A;  2Z15 A;  2W45 A;  3KL4 A;  1ZW2 A;  2HV7 A;  1OW7 A;  2HZ8 A;  3H2U A;  3MX3 A;  3U8V A;  4EIY A;  4XPW A;  2HV6 A;  1KTM A;  4KBL A;  2C03 A;  2G3K A;  2H7O A;  4U5H A;  1SMY F;  4EUK B;  5KYY A;  3L0I A;  1FAP B;  1V74 B;  4WAB A;  1R5I D;  3AG2 C;  3LNR A;  4U5D E;  5KYW A;  1E86 A;  2R7R A;  2DYR C;  2MYS A;  4KNV A;  3IHU A;  4C3D A;  1NU7 D;  1Q0K A;  5CI9 A;  5T3T A;  4E0I A;  3ASO C;  4XPY A;  1UFB A;  3DE9 A;  3CZ6 A;  1LI5 A;  3L34 A;  2W9Y A;  3L8I A;  3M4B A;  4K7B A;  5B1B C;  2WVQ A;  3GWN A;  4H4K C;  4JZA A;  2QE9 A;  2W4B A;  3A11 A;  2VCC A;  1FTS A;  2HKV A;  2P7V A;  4OD5 A;  2D4U A;  3HJC A;  5F28 E;  5FCL A;  2L81 A;  4MTF A;  2OG2 A;  2YVK A;  4GEH A;  5JP7 A;  4K0D A;  2PX0 A;  1YYJ A;  4LER A;  2KW3 C;  3NYJ A;  3GEH A;  4W8P A;  4PFP A;  4PR9 A;  1WTY A;  3DAG A;  2NUT A;  4L6R A;  4NQF A;  3W4Y A;  1CGM E;  1HW2 A;  2R25 A;  4PK4 A;  5JUA A;  4C7O A;  1WAT A;  1D1B A;  4J7Y A;  2R7V A;  4CJG A;  3SZR A;  3T6B A;  5L0D A;  1FR0 A;  3SXY A;  4YWQ A;  3HNK A;  4Z9I A;  5JRA A;  1YZA A;  2Q4F A;  3B0V C;  3EQL F;  3WOD F;  5L0F A;  3LS0 A;  1Z23 A;  4IGG A;  3MLG A;  4XLP F;  5T3W A;  1DOW A;  3H65 A;  2J9W A;  2M64 A;  2WZL A;  2XLM A;  3IQ6 A;  3GAN A;  5IY5 C;  1OCC C;  4A2N B;  3ZIB A;  4N6C A;  1PV3 A;  4MTO A;  3RIP A;  4MW3 A;  1G5Z A;  3NDB B;  1LPE A;  4G78 A;  4EHP A;  2FGY A;  4CS8 C;  3NG1 A;  5AC5 A;  2OOC A;  3N2Z B;  3QVY A; 
#chains in the Genus database with same CATH homology
 3UNG C;  5KYX B;  4HE8 D;  4U5C E;  2IYL D;  3EFO B;  1PCX A;  3OWT A;  1KU2 A;  3EGD B;  5HSW A;  1OKK D;  3LLI A;  3K66 A;  5KYU A;  1FFT C;  2ZXW C;  3ASN C;  4YT8 A;  3K1H A;  3T4R A;  4JVS A;  2V26 A;  3EG9 A;  1BR1 A;  3FAJ A;  3LEV A;  2NUP B;  3W2V A;  2EIJ C;  1G8X A;  1QZX A;  5EHH A;  5L3V A;  2WVN A;  2V3C C;  2KQ9 A;  1ZYR F;  2PP4 A;  1TWA A;  4XWJ A;  3SNH A;  2GFH A;  4F4B A;  4ZLC A;  4CS7 A;  2IXM A;  3X1O A;  3Q6M A;  4G7O F;  2XL4 A;  4FX5 A;  4LLE A;  1J8Y F;  2XSE A;  3RYL A;  4YT4 A;  3NRH A;  1VYI A;  4CIH A;  3FDQ A;  1TWH A;  4JCH A;  3FVY A;  4Q7C A;  1D1C A;  2WVO A;  3B0U X;  2FFH A;  3CSK A;  2KNH A;  5EGY A;  2R7U A;  4HEA J;  5KYY B;  4KNW A;  3FHD A;  1SF8 A;  3EGX A;  5DS5 A;  2R7W A;  1ZHW A;  1ZHX A;  4G7H F;  3S27 A;  4ANJ A;  2A68 F;  1M57 C;  3E70 C;  3NYM A;  3VYW A;  2H7B A;  5DQT A;  1M56 C;  2MWQ A;  4XLN F;  5CI8 A;  3ABK C;  4QDL A;  4YT2 A;  4B6I A;  4Q4Z F;  1NZE A;  4FWV A;  5B3S C;  5DVW A;  1OKK A;  2NUT B;  4C7O B;  5F5H A;  3O6X A;  2Y3D A;  1ZHY A;  5T1D B;  1IZM A;  4N06 A;  1BR2 A;  4O79 A;  3SYN A;  3UMK A;  2EIK C;  1PD0 A;  2NG1 A;  1D1A A;  2G3V A;  2A6H F;  3EZI A;  3LAY A;  2EIN C;  5D92 A;  4OIP F;  5KYN A;  2QTV A;  2Y39 A;  4AE4 A;  2M4E A;  1QLE C;  4KI2 A;  1Z6A A;  1MMD A;  4FES A;  1MMA A;  4I3M A;  3X2Q C;  4J30 B;  2E87 A;  2XXA A;  5KYU B;  4ULW A;  4AK9 A;  4LLC A;  2J9U A;  2O9X A;  4PJJ A;  2PF4 E;  3EG9 B;  3RKO F;  2ZXP A;  3QMK A;  2VB6 A;  2XRH A;  3W2W A;  4G7Z F;  1MNE A;  3LES A;  4JUR I;  3GOD A;  3AG1 C;  4O6Y A;  4IJJ A;  4YT5 A;  1FMW A;  3S28 A;  4BJ6 A;  2LSE A;  2CW0 F;  3M1C B;  2QY9 A;  4O7G A;  3PHF 2;  2J0W A;  1OCO C;  3ZC4 A;  4RD9 A;  4EBB A;  1NG1 A;  1LS1 A;  3ITF A;  4DBR A;  2WZF A;  4PFO A;  1O5H A;  4HFF B;  3K1I C;  1Z3I X;  3EJN A;  2Q3T A;  4HFK B;  3UGO A;  4GYT A;  3EGX B;  3W8H A;  3EH1 A;  5B1A C;  2Y3B A;  3JRT A;  4U5G A;  2A6E F;  5L3Q A;  1VK5 A;  2R7Q A;  4RDA A;  2DYS C;  2VH3 A;  3UR3 C;  3IEE A;  4U5F E;  1SZI A;  3ZG1 A;  3Q7G A;  5DS4 A;  2JD3 A;  3KH2 A;  4E7Z A;  2P6V A;  1OCR C;  4MQ9 F;  2Y3G A;  4ZLD A;  1JPJ A;  2EIL C;  5E3A A;  2VAS A;  3TD7 A;  1WGW A;  3UMI A;  3ABM C;  1ZU5 A;  3DZA A;  3W8I A;  2CGE A;  5DQZ A;  2C04 A;  1D0Z A;  1MMG A;  2DGJ A;  3OA1 A;  4DVZ A;  3LJB A;  4JW1 A;  4AE4 B;  2R7X A;  3HTK C;  2CNW A;  3K6B A;  1NU9 C;  2Y69 C;  3EZH A;  2J0X A;  2XXA B;  3PMR A;  3F47 A;  4BJ5 C;  1M2O A;  2EIM C;  4CSA C;  4EWC A;  3RH3 A;  3DJN B;  4BJ6 C;  3ZSU A;  1LKX A;  3I5P A;  5E3C A;  2KJG A;  1ZHT A;  3KKB A;  2D5R B;  3NKE A;  4BJ1 A;  2WB7 A;  3B0P A;  3NYL A;  1ZU4 A;  4OIQ F;  3ECS A;  1RJ9 A;  3E9V A;  4E7S A;  3S0X A;  4WJ0 A;  3UGP A;  4IRU A;  3I4U A;  3VAY A;  4CBE A;  2J7P A;  4O6M A;  3N24 A;  4RBN A;  3N0T A;  1TWG A;  3K33 A;  2IXP A;  5DS6 A;  3AQC A;  5E2Q A;  2J46 A;  3KMI A;  3ZVR A;  4YJW A;  4JJF A;  4BG0 A;  3RFY A;  1O87 A;  1J8M F;  3EHN A;  4G0H A;  4IAO A;  3WG7 C;  4AX2 A;  3DAF A;  4DOZ A;  5DLJ A;  1MMN A;  1TR2 A;  2R7O A;  1M2V A;  1VOM A;  3EHM A;  3SP1 A;  4P6I C;  4U5B E;  4CS9 C;  5D91 A;  4I44 A;  3LLK A;  2YHS A;  1TWC A;  2J9V A;  4BJ5 A;  4DBQ A;  3AG3 C;  2ZXR A;  4CSA A;  4I1M A;  4JJG A;  3EPV A;  1ST6 A;  3OEO A;  2CNW D;  1Z5Z A;  3V7O A;  1JPN A;  2CDQ A;  4O6N A;  2R7S A;  3JYH A;  4OIO F;  2KGO A;  2L9J A;  2Q9A A;  1IW7 F;  1VMA A;  3ABL C;  3DM9 B;  3EH2 A;  3CQZ A;  2YZS A;  4QI0 A;  1PD1 A;  4J32 B;  4OIN F;  1TKN A;  1S7Z A;  2PX3 A;  1OCZ C;  3T6J A;  4M63 A;  1BR4 A;  2H7V C;  3DD7 A;  4PJL A;  3NKD A;  4QI2 A;  1FFH A;  4YN0 B;  3DJU B;  2B0J A;  2J45 A;  2J7P D;  4I1O B;  2I8B A;  2WL8 A;  2W4M A;  4Q5S F;  3QZC A;  3I5Q A;  4NY3 A;  4BEJ A;  4MND A;  2WZG A;  4CS9 A;  3SEO A;  2OCC C;  2ZPA A;  1FMV A;  4BJT A;  2Y3H A;  5BUO A;  3Q7L A;  1V55 C;  3S29 A;  3JCU Q;  3K7D A;  2IOQ A;  4XTK A;  3JSZ A;  2ZXO A;  3B9Q A;  1MND A;  3UMH A;  5KYX A;  3DM5 A;  1RJ9 B;  3EFO A;  5F5F A;  2IXO A;  1Z63 A;  3EGD A;  4U5E E;  3AG4 C;  3LS1 A;  4DVY P;  2R7T A;  3O39 A;  2A69 F;  4PJM A;  4CS8 A;  2YEV A;  4C3E A;  2Q9C A;  5KYW B;  2G62 A;  4W8K A;  1VYK A;  2NUP A;  4OD4 A;  3F46 A;  2IXN A;  2A1D D;  3DXJ F;  2BE5 F;  3AQB A;  1M2V B;  4LAC B;  4PJN A;  3POV A;  1LVK A;  1N1C A;  4OIR F;  2X51 A;  1V54 C;  3Q6N A;  3HLZ A;  1W2W A;  3DMD A;  1D0Y A;  1D0X A;  3JT1 A;  4KC9 A;  4X0R A;  2PFD A;  2Q9B A;  4C3B A;  4IWB A;  1ZHZ A;  5E33 A;  2Z15 A;  2W45 A;  3KL4 A;  2HV7 A;  3MX3 A;  2HV6 A;  4KBL A;  2C03 A;  2G3K A;  2H7O A;  4U5H A;  1SMY F;  5KYY A;  3L0I A;  5KYW A;  3AG2 C;  3LNR A;  4U5D E;  2R7R A;  2DYR C;  2MYS A;  4KNV A;  4C3D A;  1NU7 D;  5CI9 A;  5T3T A;  3ASO C;  3CZ6 A;  3L34 A;  4K7B A;  2W9Y A;  5B1B C;  2WVQ A;  4H4K C;  4JZA A;  2W4B A;  1FTS A;  2P7V A;  4OD5 A;  3HJC A;  5FCL A;  2L81 A;  2OG2 A;  4GEH A;  4K0D A;  2PX0 A;  4LER A;  2KW3 C;  3NYJ A;  4PFP A;  3DAG A;  2NUT A;  4PK4 A;  4C7O A;  2R7V A;  1D1B A;  3SZR A;  3T6B A;  4YWQ A;  3B0V C;  3EQL F;  3WOD F;  3LS0 A;  1Z23 A;  4XLP F;  3MLG A;  5T3W A;  3H65 A;  2J9W A;  2WZL A;  5IY5 C;  3GAN A;  1OCC C;  4A2N B;  3ZIB A;  3RIP A;  3NDB B;  2FGY A;  4CS8 C;  3NG1 A;  3N2Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...