4U5CE

Crystal structure of glua2, con-ikot-ikot snail toxin, partial agonist fw and postitive modulator (r,r)-2b complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
85
structure length
85
Chain Sequence
GPADCCRMKECCTDRVNECLQRYSGREDKFVSFCYQEATVTCGSFNEIVGCCYGYQMCMIRVVKPNSLSGAHEACKTVSCGNPCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structures of AMPA receptor-cone snail toxin complexes illuminate activation mechanism.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein/toxin
molecule keywords Glutamate receptor 2
total genus 28
structure length 85
sequence length 85
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1800 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4u5cE00
4U5GA 4U5FE 4U5BE 4U5EE 4U5DE 4U5CE 4U5HA
chains in the Genus database with same CATH superfamily
1AUEA 5AGFA 2KYHA 2BE5F 3KKBA 1NBBA 1NU9C 2D5RB 2IM8A 2J7PD 3LAYA 2HUJA 1OCOC 2J8WA 4N6HA 2J9UA 3TK0A 1TWHA 2E87A 2WL8A 3E9VA 3M1CB 2Q7RA 4LACB 4E7SA 4MW3A 1BR4A 3RFYA 3TJ5A 5DS5A 3ECSA 2ICWG 2YLIA 3B0PA 1JMWA 1QLEC 3RIPA 5B3SC 3NMJA 2L6HA 4EHPA 3OEOA 1Q0FA 1Y4CA 1OCCC 1YARO 2ZXPA 4FAPB 5L0HA 5L0JA 3RW0A 4DBRA 1WN0A 4PFPA 5KYUB 1IW7F 2LD6A 2H7BA 2VC9A 2YL0A 2UUHA 4GQHA 1LE4A 4PACA 4AL0A 2J9BA 3JSZA 3L34A 3ZVRA 1AVOB 1UG7A 4IRUA 4JTAB 5KYYA 4XPXA 3B0VC 2X0CA 4EBJA 2NSFA 2Y3HA 2L81A 3DJUB 5JVEA 2XLOA 5BQIA 2UUIA 3IHUA 1VLSA 4Q4ZF 3WODF 3HKKA 1K04A 4ER9A 4BG0A 3U3BA 1J8YF 1V54C 2LP4A 3UGOA 1H9GA 1C03A 1PD0A 5KYXB 2MHRA 4XTKA 4PJJA 2KQ9A 4AL1A 4CBEA 1I4YA 1RKCA 5A6AA 4N06A 1AEPA 4GYTA 3VYWA 2GDCA 1OW7A 2JX0A 4GEHA 2ZPAA 1Y6DA 1F1MA 4P9TA 4BJ6C 2L6FA 3FOOA 3JT1A 5B3IA 1Q0MA 4XPYA 1KTMA 4DVYP 4I3MA 4Q7CA 4CS8C 3EQLF 3J06A 4U5EE 4WGYA 1DOWA 2M64A 2YVKA 3ITFA 2ZD9A 4MVUA 3SYNA 4EWCA 1FFHA 1D1AA 4G7OF 5DQTA 4YT8A 2GFHA 3E70C 5BUOA 2HJMA 2Y3DA 2L7AA 4N4WA 2PX0A 4XLPF 2W45A 5EK0A 1LI7A 2CNWA 4P9FA 2LFFA 1VTMP 2G62A 4YT2A 1FMWA 4MTGA 3IQ6A 3SZRA 2DYRC 3Q7GA 1B68A 3K66A 3W2VA 4BJ1A 4E18A 4YL3A 2XL4A 5L3QA 2L9JA 3QW0A 5KYUA 3MYFA 2Y3GA 2NPUA 2DYSC 1I5NA 4HFKB 3B0UX 2R7TA 2XL6A 4YL1A 3NKEA 4DVZA 3LUTB 2X51A 3POVA 3C8GA 4IB4A 4L6RA 1M56C 1WGWA 3EGDA 3GANA 5JUAA 2XXAB 4YK5A 3T4RA 1KU2A 2HS5A 3A9CA 3K7DA 3Q7LA 1BDJB 1A7VA 4Z9HA 2A6EF 4NQFA 3NMKA 1TFOB 4OD5A 4CDAA 5COFA 4I44A 4CDVA 2AWYA 5D92A 3VAYA 1R4TA 1ORJA 1ZHWA 1V4AA 5E33A 1FFTC 3TD7A 1OKKA 4KBLA 2R02A 4U5BE 2ETSA 4YWQA 3I5QA 2HKVA 5HSWA 3K1IC 1M2OA 4IAOA 3MLGA 2PBEA 3SEOA 3GEHA 1BZ4A 1TWGA 4WABA 3T6BA 2YL7A 5JP7A 4MTFA 1WWPA 3V5YA 4XPWA 3EGXB 4CS8A 4ZLDA 2CNWD 5JLIA 2QLAA 2EPKX 3HTKC 4BPMA 4U9DA 2O9XA 3EJNA 5L0FA 5E2QA 4CSAC 3AG2C 2OU6A 3DAFA 4U5GA 5DLJA 2MYSA 3GM1A 1VK5A 2R7WA 2NUTB 1OXBA 1ZHTA 2XL8A 3V5XA 1ZU5A 5A6BD 4MVRA 4XWJA 1UFBA 3MX3A 1GS9A 5T1DB 1VYIA 2R03A 1T01A 3NRHA 1H7IA 3C8GD 3GM3A 2R7OA 4K0DA 4KNWA 5F5FA 3DZAA 3FMSA 4DJ9A 2Y39A 3RQEA 5FZTA 2HFIA 3DXJF 3JRTA 5AC5A 2GWWA 4NTFA 3W2WA 3DE8A 4CIPA 3MYIA 3S29A 1NFOA 2NUPA 4J7TA 2XS8A 3LESA 3IEEA 4DBQA 1O5HA 3S90A 3SP1A 2XSEA 1MMNA 3FAPB 1XWJA 3U5SA 4A4AA 4E0IA 1TR2A 4G7ZF 3NYMA 5CIVA 3M4BA 3U2MA 3AQCA 2IYLD 4ULWA 3GM2A 2CGEA 3X2QC 4NY3A 4QI0A 4CS9C 5JT4A 4J7YA 4OINF 3LNRA 2OJQA 4ANJA 5A6JA 2YLDA 3G4XA 1YA9A 4PK4A 1HW2A 3R7CA 2LFDA 3DWWA 1ZHZA 1OW6A 1ORYA 3LS0A 2P6VA 4RD9A 3WAQA 3OWTA 4I1MA 5DQZA 3K1IA 5IY5C 5KYXA 1OQCA 3KL4A 1OR2A 2J7PA 3L0IA 3I5PA 1FAPB 4J32B 4H4KC 4JTDB 1QQ3A 4LLEA 4CX9A 2P7VA 1CPQA 2KNHA 4NTAA 1OCZC 2P1AA 2RSEB 5F5HA 1Z3IX 1FNTc 3EG9A 4N6CA 2XM0A 3QTHA 3OA1A 4JW1A 5K0IA 1U0BB 1V74B 3QMKA 1L3PA 2CCYA 2LSEA 3T9OA 4R32A 4W8KA 4C7OA 4BJ5A 4EIYA 4C3BA 3DMDA 1Q0KA 2LK4A 1VYKA 3W8HA 2R7VA 3SXZA 3A11A 2BC5A 3K33A 3ABLC 4PJMA 4KNVA 1SMYF 2W4MA 4M63A 4YT4A 1D1BA 1ZW3A 1OXKA 3JYHA 2DGJA 1D0YA 3S84A 1FTSA 3AG3C 2BL2A 4BEMJ 3HNLA 1HMDA 5COGA 3O10A 4MVOA 3HLZA 4FESA 4LERA 3QVYA 3ZTZA 1BBHA 3F47A 5COMA 1PCXA 2VCCA 3Q6MA 1ST6A 4ONSA 3UMKA 1YYJA 3C62A 3LNMB 2R9RB 3CQZA 2A0BA 4JKVA 1HE9A 1YJGA 2V26A 3VRCA 3CZ6A 3RVYA 1LM3B 5CI8A 4JE9A 1EKYA 3IQ5A 4C7OB 3QZCA 2AWCA 2R7RA 5B1AC 2WZLA 2XLVA 2HZ8A 3AG4C 3F46A 3U0CA 4Q5SF 3UMIA 1RKEA 1WASA 2NUPB 5BQGA 2OCCC 1SYQA 1H9TA 3RYLA 1R5ID 3H65A 4MNDA 1JPNA 1VB5A 1ZU4A 2G3KA 3CAXA 1G4WR 3AGUA 4RBNA 1NU7D 4JJFA 3EHNA 1RMVA 2OG2A 1A7EA 5EGYA 2CDQA 2YKZA 4FWVA 1YLMA 3DI5A 4O7GA 3TQOA 1WOLA 4D4XA 5AC4A 1HE1A 2WVQA 4QI2A 1ZW2A 3W4YA 2XLMA 5KYWB 5KYWA 4JTCB 2G3VA 4QDLA 1APCA 1Z63A 4CIHA 1A7DA 3ATPA 2H7OA 3IQTA 3B29A 2PX3A 3ZDLA 1IZMA 3VF0A 4DXWA 5T3WA 1OKKD 3QVZA 1E85A 1JOGA 2YQYA 4MTOA 1YVIA 1OCRC 1O87A 3DE9A 3MBGA 5DS6A 1YA7O 3DAGA 3KYIA 4WJ0A 3EHMA 1E86A 2NUTA 2A69F 4UDVA 2YLGA 3ZIBA 1M6TA 2WZGA 2HMQA 3L1MA 3MFNA 4NTBA 2AU5A 3AG1C 5F28E 4EKWA 4J30B 4EUKB 1C02A 2WB7A 3M4CA 3KMIA 2R05A 3GWLA 4JVSA 3FOPA 4KC9A 2F22A 1XZPA 1HW1A 4NCQA 2M4EA 4U5CE 3O6XA 1LVKA 4JC7A 4MQ9F 3ZQVA 4EBBA 4E7ZA 3O39A 4CSAA 2J9VA 3TJ6A 1T6IA 1DOVA 2Q9CA 4WGZA 3O55A 3DM9B 4P6IC 2EILC 4MS2A 1G8XA 4PFOA 3RKOF 3U3FA 4IARA 3RF3A 2ZXWC 3T6JA 2EIMC 3JTLO 3TULA 5DVWA 2EINC 3UR3C 5KYNA 1QZXA 2FGYA 3LLKA 2OOCA 3GWNA 3UGPA 2OEXA 2HV6A 3H2UA 1ZZPA 3ZTMA 1Q0DA 3U8VA 4C3EA 4AX2A 2A6HF 1K05A 1S05A 1GGQA 1LS4A 2PF4E 4U9EA 1OR3A 3RH3A 3FHDA 3K6BA 1JRAA 3C8GB 3CSKA 4LDRA 4MVZA 3RQFA 4AK9A 2XXAA 3SNHA 2GAQA 4X0RA 3DD7A 2QNLA 1RKEB 2W4BA 3R2PA 5TJ5E 4FX5A 1A41A 1NSGB 3LEVA 2QTVA 3C63A 1SR2A 4I1OB 2AP3A 2DI3A 3ASOC 3FDQA 4IJJA 1MQVA 2EPLX 1MMAA 3GEEA 3N24A 3DJNB 1D0ZA 1WATA 1EQ1A 4PR9A 3G50A 4A2NB 5L0GA 2R25A 3ZG1A 4BJ5C 3NG1A 1O3UA 3ABKC 3NYJA 2Y69C 1Z5ZA 4MVQA 3JZ0A 5E3AA 4IGGA 1LS1A 5A6KA 5FCLA 5L0CA 2YL1A 1U6HA 3ZQYA 1EA8A 1Z6AA 4JCHA 2H7VC 2P61A 2XLDA 3EGXA 4IAQA 3RVZA 1VMAA 1U89A 1ZHXA 3WG7C 4O6NA 1ZHYA 3NMIA 2IXNA 3DKAA 3TOLA 4D4NA 2W9YA 3K1HA 4OD4A 2XLWA 2XRHA 4JCZA 4O6YA 2VASA 3QW1A 4NC3A 4YL0A 1M2VA 4K7BA 3BRJA 4IWBA 3PCVA 3SXKA 3S28A 1NLXA 3ZWIA 1YYXA 5L0IA 1NFNA 2HV7A 2ZXOA 1PD1A 3U9JA 5DS4A 3NDBB 2PFDA 2J0XA 2Q3TA 4O6MA 3AGTA 4C3DA 4XEFA 2I8BA 4JJGA 4OIOF 1E2XA 3DM5A 2EIKC 4U5FE 2FFHA 3ZC4A 3GEIA 3SXMA 1XZQA 1ZYRF 2Q9AA 1MMDA 5D91A 1E83A 2JD3A 2PNOA 3EZIA 1GQAA 1LE2A 1TWCA 2PP4A 4PJNA 2J9WA 3ZSUA 4CDYA 1YZCA 2J0WA 3AOUA 3US6A 4B6IA 1MNEA 2A1DD 1FMVA 2HJ3A 4HE8D 1TWAA 3EZHA 2NSGA 2JPUA 2LCHA 3C18A 2IXPA 1HY5A 1G4US 2IXMA 2YEVA 1I4ZA 1CGNA 2KGOA 2RD9A 2Y3BA 3TOMA 4JURI 1T6UA 1RJ9A 1LPEA 3B9QA 5B1BC 3S27A 1HMOA 2KK1A 4CJOA 1J8MF 2MWQA 1JPJA 3KPHA 4G0HA 3CEXA 2WVNA 3FVYA 4E0HA 1T5OA 4K1OA 1PV3A 4LDKA 2C03A 5T3TA 3PHF2 4W8PA 2GA0A 1Z23A 3C8ZA 3EG9B 4HEAJ 3W8IA 3U9MA 3IPMO 3M15A 3EPVA 1TFKB 2P0NA 4OIPF 3UMHA 2KC3A 1JAFA 5E3CA 3JCUQ 4H54A 4BEJA 3AJMA 2I15A 3LJBA 3NYLA 1BR2A 2EPOA 2VH3A 2IBFA 2QE9A 2XLHA 3N0TA 1MNDA 4XLNF 1QSPA 1G5ZA 1V55C 3JRMO 4ULVA 3N2ZB 1E84A 4XEKA 4G78A 3FAJA 1FR0A 1TQGA 1RXQA 2J46A 1H6GA 4XEVA 2KW3C 2R7XA 3JSEO 4LDQA 2LQGA 2DB4A 4JEBA 5A6BA 2L6GA 1K40A 2YWAA 5GPGB 1QVXA 4JRZA 3PMRA 2OQMA 1S7ZA 2V3CC 1M57C 1MMGA 3HNKA 5L3VA 2Z15A 1OW8A 1YAUO 5EHHA 2XLEA 1TKNA 3U2LA 1SF8A 2YHSA 4XQ1A 1YZAA 3EH2A 1RJ9B 4JIOA 4DOZA 4YN0B 2Q4FA 4HFFB 1T9KA 1EI7A 4Z9JA 4CS9A 5CI9A 4MVSA 2ASRA 3Q6NA 2ZXRA 4DRIB 1LKXA 1BR1A 3C7JA 2XM4A 2D4UA 3GODA 1JR8A 1L7CA 3NKDA 3SXYA 3T6GB 4F4BA 4U5DE 2J45A 4KI2A 1WTYA 3KYJA 1CGME 4MVMA 2HMZA 4MW8A 1ZVZA 4Z9IA 2AVKA 1Q0GA 3LLIA 4O79A 4EBKA 2R7SA 2A68F 3U8PA 3S9OA 5JS5A 1KNYA 1RCPA 3FXHA 2NG1A 1NZEA 5A69A 2QUPA 2WVOA 4RDAA 1QPUA 1N1CA 1C17M 2CYDA 2YL3A 4CS7A 3JYYA 2IXOA 1LI5A 2Q00A 3LS1A 3PDMP 1M2VB 1ORSC 5JRAA 256BA 3RQGA 4BJTA 2TMVP 1T6QA 2R7UA 1W2WA 3VM6A 5L0DA 3ABMC 1LIHA 2EPMX 1QKRA 4BJ6A 3V7OA 2H8AA 3HNIA 1CPRA 3V5ZA 1A0BA 3S0XA 4LLCA 3KH2A 4JZAA 3ASNC 3EGDB 4U5HA 3H2VA 3BEHA 2HSBA 2VCAA 3M79A 4AE4A 2CW0F 4AE4B 2C04A 2R7QA 3L8JA 2VB6A 2A0UA 4PJLA 2IOQA 3L8IA 3B71A 3AQBA 4OIQF 2B0HA 2EPNA 4JEAA 5JSLA 2VCBA 3WHNA 4G7HF 2OJED 3HJCA 3HNJA 2QY9A 1VLTA 1D1CA 2FAPB 5KYYB 1GM5A 2OKUA 2WZFA 3LEOA 2LIGA 4YT5A 3UNGC 3IQCA 1VOMA 2XS1A 1D0XA 3EFOA 1CGOA 3EFOB 3I4UA 5HV9A 1NG1A 3X1OA 1Z7Qc 3GORA 4CJGA 4DRHB 2KJGA 1SZIA 2EIJC 4DRJB 2HSQA 2B0JA 4E17A 2Q9BA 1YDIA 2YRFA 2OEVA 3G4ZA 3EH1A 2YZSA 4OIRF 5BQHA 4YJWA 4ZLCA 2KSFA
chains in the Genus database with same CATH topology
2BE5F 3KKBA 2D5RB 1NU9C 2J7PD 3LAYA 1OCOC 2J9UA 1TWHA 2E87A 2WL8A 3E9VA 3M1CB 4E7SA 4LACB 1BR4A 3RFYA 5DS5A 3ECSA 3RIPA 3B0PA 5B3SC 1QLEC 3OEOA 2ZXPA 1OCCC 4DBRA 4PFPA 1IW7F 2H7BA 3JSZA 3L34A 3ZVRA 4IRUA 5KYYA 3B0VC 2Y3HA 2L81A 3DJUB 4Q4ZF 3WODF 4BG0A 3UGOA 1J8YF 1V54C 1PD0A 5KYXB 4XTKA 4PJJA 2KQ9A 4CBEA 4N06A 4GYTA 3VYWA 4GEHA 2ZPAA 4BJ6C 3JT1A 4DVYP 4I3MA 4Q7CA 4CS8C 3EQLF 4U5EE 3ITFA 4EWCA 3SYNA 1FFHA 1D1AA 4G7OF 5DQTA 4YT8A 2GFHA 3E70C 5BUOA 2Y3DA 2PX0A 4XLPF 2W45A 2CNWA 2G62A 4YT2A 1FMWA 3SZRA 2DYRC 3Q7GA 3K66A 3W2VA 4BJ1A 5L3QA 2XL4A 2L9JA 5KYUA 2Y3GA 2DYSC 4HFKB 3B0UX 2R7TA 3NKEA 4DVZA 2X51A 3POVA 1M56C 3GANA 1WGWA 3EGDA 2XXAB 3T4RA 1KU2A 3K7DA 3Q7LA 2A6EF 4OD5A 4I44A 5D92A 3VAYA 1ZHWA 5E33A 1FFTC 3TD7A 1OKKA 4KBLA 4U5BE 4YWQA 3I5QA 5HSWA 3K1IC 1M2OA 4IAOA 3MLGA 3SEOA 1TWGA 3T6BA 4CS8A 3EGXB 4ZLDA 2CNWD 3HTKC 2O9XA 3EJNA 4CSAC 5E2QA 3AG2C 3DAFA 4U5GA 5DLJA 2MYSA 1VK5A 2R7WA 2NUTB 1ZHTA 1ZU5A 4XWJA 3MX3A 5T1DB 1VYIA 4K0DA 3NRHA 4KNWA 5F5FA 2R7OA 3DZAA 2Y39A 3DXJF 3JRTA 3W2WA 3S29A 2NUPA 3LESA 3IEEA 4DBQA 1O5HA 3SP1A 2XSEA 1MMNA 4G7ZF 1TR2A 3NYMA 3AQCA 2IYLD 4ULWA 3X2QC 2CGEA 4NY3A 4QI0A 4CS9C 4OINF 3LNRA 4ANJA 4PK4A 1ZHZA 3LS0A 5IY5C 2P6VA 4RD9A 5DQZA 3OWTA 4I1MA 5KYXA 3KL4A 2J7PA 3L0IA 3I5PA 4J32B 4H4KC 4LLEA 2P7VA 2KNHA 1OCZC 5F5HA 1Z3IX 3EG9A 3OA1A 4JW1A 3QMKA 2LSEA 4W8KA 4C7OA 4BJ5A 4C3BA 3DMDA 1VYKA 3W8HA 2R7VA 3K33A 3ABLC 4PJMA 4KNVA 1SMYF 2W4MA 4M63A 4YT4A 1D1BA 3JYHA 1D0YA 2DGJA 1FTSA 3AG3C 3HLZA 4FESA 4LERA 3F47A 5KYUB 1PCXA 3Q6MA 3UMKA 1ST6A 3CQZA 2V26A 3CZ6A 5CI8A 3QZCA 2R7RA 5B1AC 2WZLA 3AG4C 3F46A 4Q5SF 3UMIA 2NUPB 2OCCC 3RYLA 3H65A 4MNDA 1JPNA 1ZU4A 2G3KA 4RBNA 1NU7D 4JJFA 3EHNA 2OG2A 5EGYA 2CDQA 4FWVA 4O7GA 2WVQA 4QI2A 5KYWB 5KYWA 2G3VA 4QDLA 1Z63A 4CIHA 2H7OA 2PX3A 1IZMA 5T3WA 1OKKD 1OCRC 1O87A 5DS6A 3DAGA 4WJ0A 3EHMA 2NUTA 2A69F 3ZIBA 2WZGA 3AG1C 4J30B 2WB7A 3KMIA 4JVSA 4KC9A 4U5CE 2M4EA 3O6XA 1LVKA 4MQ9F 4EBBA 4C7OB 4E7ZA 4CSAA 3O39A 2J9VA 2Q9CA 3DM9B 4P6IC 2EILC 3RKOF 1G8XA 4PFOA 2ZXWC 3T6JA 2EIMC 5DVWA 2EINC 3UR3C 5KYNA 1QZXA 2FGYA 3LLKA 3UGPA 2HV6A 4C3EA 4AX2A 2A6HF 2PF4E 3RH3A 3FHDA 3K6BA 3CSKA 4AK9A 2XXAA 3SNHA 4X0RA 3DD7A 2W4BA 4FX5A 3LEVA 2QTVA 4I1OB 3ASOC 3FDQA 4IJJA 1MMAA 3N24A 3DJNB 1D0ZA 4A2NB 3ZG1A 4BJ5C 3NG1A 3ABKC 3NYJA 2Y69C 1Z5ZA 5E3AA 1LS1A 5FCLA 1Z6AA 4JCHA 2H7VC 3EGXA 1ZHXA 1VMAA 3WG7C 4O6NA 1ZHYA 2IXNA 2W9YA 3K1HA 4OD4A 2XRHA 4O6YA 2VASA 1M2VA 4K7BA 4IWBA 3S28A 2HV7A 5DS4A 2ZXOA 1PD1A 3NDBB 2PFDA 2J0XA 2Q3TA 4O6MA 4C3DA 4OIOF 2I8BA 4JJGA 3DM5A 2EIKC 4U5FE 2FFHA 3ZC4A 1ZYRF 2Q9AA 1MMDA 5D91A 2JD3A 3EZIA 1TWCA 2PP4A 4PJNA 2J9WA 3ZSUA 2J0WA 4B6IA 1MNEA 2A1DD 1FMVA 4HE8D 1TWAA 3EZHA 2IXPA 2YEVA 2IXMA 2Y3BA 2KGOA 4JURI 1RJ9A 5B1BC 3B9QA 3S27A 1J8MF 2MWQA 1JPJA 4G0HA 2WVNA 3FVYA 2C03A 5T3TA 3PHF2 1Z23A 3EG9B 4HEAJ 3W8IA 3EPVA 4OIPF 3UMHA 5E3CA 3JCUQ 4BEJA 3LJBA 3NYLA 1BR2A 2VH3A 3N0TA 1MNDA 4XLNF 1V55C 3N2ZB 3FAJA 2J46A 2KW3C 2R7XA 3PMRA 1S7ZA 2V3CC 1M57C 1MMGA 5L3VA 2Z15A 5EHHA 1TKNA 1SF8A 2YHSA 3EH2A 1RJ9B 4DOZA 4YN0B 4HFFB 4CS9A 5CI9A 3Q6NA 2ZXRA 1LKXA 1BR1A 3GODA 3NKDA 4F4BA 4U5DE 2J45A 4KI2A 3LLIA 4O79A 2R7SA 2A68F 2NG1A 1NZEA 4RDAA 2WVOA 1N1CA 4CS7A 2IXOA 3LS1A 1M2VB 2R7UA 4BJTA 1W2WA 3ABMC 4BJ6A 3V7OA 3S0XA 4LLCA 3KH2A 4JZAA 3ASNC 3EGDB 4U5HA 4AE4A 2CW0F 4AE4B 2C04A 2R7QA 4PJLA 2VB6A 2IOQA 4OIQF 3AQBA 4G7HF 3HJCA 2QY9A 1D1CA 5KYYB 2WZFA 4YT5A 3UNGC 1VOMA 3EFOB 1D0XA 3EFOA 3I4UA 1NG1A 3X1OA 2KJGA 1SZIA 2EIJC 2B0JA 2Q9BA 3EH1A 2YZSA 4OIRF 4YJWA 4ZLCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U5G A;  4U5F E;  4U5B E;  4U5E E;  4U5D E;  4U5C E;  4U5H A; 
#chains in the Genus database with same CATH topology
 1AUE A;  5AGF A;  2KYH A;  2BE5 F;  3KKB A;  1NBB A;  1NU9 C;  2D5R B;  2IM8 A;  2J7P D;  3LAY A;  2HUJ A;  1OCO C;  2J8W A;  4N6H A;  2J9U A;  3TK0 A;  1TWH A;  2E87 A;  2WL8 A;  3E9V A;  3M1C B;  2Q7R A;  4LAC B;  4E7S A;  4MW3 A;  1BR4 A;  3RFY A;  3TJ5 A;  5DS5 A;  3ECS A;  2ICW G;  2YLI A;  3B0P A;  1JMW A;  1QLE C;  3RIP A;  5B3S C;  3NMJ A;  2L6H A;  4EHP A;  3OEO A;  1Q0F A;  1Y4C A;  1OCC C;  1YAR O;  2ZXP A;  4FAP B;  5L0H A;  5L0J A;  3RW0 A;  4DBR A;  1WN0 A;  4PFP A;  5KYU B;  1IW7 F;  2LD6 A;  2H7B A;  2VC9 A;  2YL0 A;  2UUH A;  4GQH A;  1LE4 A;  4PAC A;  4AL0 A;  2J9B A;  3JSZ A;  3L34 A;  3ZVR A;  1AVO B;  1UG7 A;  4IRU A;  4JTA B;  5KYY A;  4XPX A;  3B0V C;  2X0C A;  4EBJ A;  2NSF A;  2Y3H A;  2L81 A;  3DJU B;  5JVE A;  2XLO A;  5BQI A;  2UUI A;  3IHU A;  1VLS A;  4Q4Z F;  3WOD F;  3HKK A;  1K04 A;  4ER9 A;  4BG0 A;  3U3B A;  1J8Y F;  1V54 C;  2LP4 A;  3UGO A;  1H9G A;  1C03 A;  1PD0 A;  5KYX B;  2MHR A;  4XTK A;  4PJJ A;  2KQ9 A;  4AL1 A;  4CBE A;  1I4Y A;  1RKC A;  5A6A A;  4N06 A;  1AEP A;  4GYT A;  3VYW A;  2GDC A;  1OW7 A;  2JX0 A;  4GEH A;  2ZPA A;  1Y6D A;  1F1M A;  4P9T A;  4BJ6 C;  2L6F A;  3FOO A;  3JT1 A;  5B3I A;  1Q0M A;  4XPY A;  1KTM A;  4DVY P;  4I3M A;  4Q7C A;  4CS8 C;  3EQL F;  3J06 A;  4U5E E;  4WGY A;  1DOW A;  2M64 A;  2YVK A;  3ITF A;  2ZD9 A;  4MVU A;  3SYN A;  4EWC A;  1FFH A;  1D1A A;  4G7O F;  5DQT A;  4YT8 A;  2GFH A;  3E70 C;  5BUO A;  2HJM A;  2Y3D A;  2L7A A;  4N4W A;  2PX0 A;  4XLP F;  2W45 A;  5EK0 A;  1LI7 A;  2CNW A;  4P9F A;  2LFF A;  1VTM P;  2G62 A;  4YT2 A;  1FMW A;  4MTG A;  3IQ6 A;  3SZR A;  2DYR C;  3Q7G A;  1B68 A;  3K66 A;  3W2V A;  4BJ1 A;  4E18 A;  4YL3 A;  2XL4 A;  5L3Q A;  2L9J A;  3QW0 A;  5KYU A;  3MYF A;  2Y3G A;  2NPU A;  2DYS C;  1I5N A;  4HFK B;  3B0U X;  2R7T A;  2XL6 A;  4YL1 A;  3NKE A;  4DVZ A;  3LUT B;  2X51 A;  3POV A;  3C8G A;  4IB4 A;  4L6R A;  1M56 C;  1WGW A;  3EGD A;  3GAN A;  5JUA A;  2XXA B;  4YK5 A;  3T4R A;  1KU2 A;  2HS5 A;  3A9C A;  3K7D A;  3Q7L A;  1BDJ B;  1A7V A;  4Z9H A;  2A6E F;  4NQF A;  3NMK A;  1TFO B;  4OD5 A;  4CDA A;  5COF A;  4I44 A;  4CDV A;  2AWY A;  5D92 A;  3VAY A;  1R4T A;  1ORJ A;  1ZHW A;  1V4A A;  5E33 A;  1FFT C;  3TD7 A;  1OKK A;  4KBL A;  2R02 A;  4U5B E;  2ETS A;  4YWQ A;  3I5Q A;  2HKV A;  5HSW A;  3K1I C;  1M2O A;  4IAO A;  3MLG A;  2PBE A;  3SEO A;  3GEH A;  1BZ4 A;  1TWG A;  4WAB A;  3T6B A;  2YL7 A;  5JP7 A;  4MTF A;  1WWP A;  3V5Y A;  4XPW A;  3EGX B;  4CS8 A;  4ZLD A;  2CNW D;  5JLI A;  2QLA A;  2EPK X;  3HTK C;  4BPM A;  4U9D A;  2O9X A;  3EJN A;  5L0F A;  5E2Q A;  4CSA C;  3AG2 C;  2OU6 A;  3DAF A;  4U5G A;  5DLJ A;  2MYS A;  3GM1 A;  1VK5 A;  2R7W A;  2NUT B;  1OXB A;  1ZHT A;  2XL8 A;  3V5X A;  1ZU5 A;  5A6B D;  4MVR A;  4XWJ A;  1UFB A;  3MX3 A;  1GS9 A;  5T1D B;  1VYI A;  2R03 A;  1T01 A;  3NRH A;  1H7I A;  3C8G D;  3GM3 A;  2R7O A;  4K0D A;  4KNW A;  5F5F A;  3DZA A;  3FMS A;  4DJ9 A;  2Y39 A;  3RQE A;  5FZT A;  2HFI A;  3DXJ F;  3JRT A;  5AC5 A;  2GWW A;  4NTF A;  3W2W A;  3DE8 A;  4CIP A;  3MYI A;  3S29 A;  1NFO A;  2NUP A;  4J7T A;  2XS8 A;  3LES A;  3IEE A;  4DBQ A;  1O5H A;  3S90 A;  3SP1 A;  2XSE A;  1MMN A;  3FAP B;  1XWJ A;  3U5S A;  4A4A A;  4E0I A;  1TR2 A;  4G7Z F;  3NYM A;  5CIV A;  3M4B A;  3U2M A;  3AQC A;  2IYL D;  4ULW A;  3GM2 A;  2CGE A;  3X2Q C;  4NY3 A;  4QI0 A;  4CS9 C;  5JT4 A;  4J7Y A;  4OIN F;  3LNR A;  2OJQ A;  4ANJ A;  5A6J A;  2YLD A;  3G4X A;  1YA9 A;  4PK4 A;  1HW2 A;  3R7C A;  2LFD A;  3DWW A;  1ZHZ A;  1OW6 A;  1ORY A;  3LS0 A;  2P6V A;  4RD9 A;  3WAQ A;  3OWT A;  4I1M A;  5DQZ A;  3K1I A;  5IY5 C;  5KYX A;  1OQC A;  3KL4 A;  1OR2 A;  2J7P A;  3L0I A;  3I5P A;  1FAP B;  4J32 B;  4H4K C;  4JTD B;  1QQ3 A;  4LLE A;  4CX9 A;  2P7V A;  1CPQ A;  2KNH A;  4NTA A;  1OCZ C;  2P1A A;  2RSE B;  5F5H A;  1Z3I X;  1FNT c;  3EG9 A;  4N6C A;  2XM0 A;  3QTH A;  3OA1 A;  4JW1 A;  5K0I A;  1U0B B;  1V74 B;  3QMK A;  1L3P A;  2CCY A;  2LSE A;  3T9O A;  4R32 A;  4W8K A;  4C7O A;  4BJ5 A;  4EIY A;  4C3B A;  3DMD A;  1Q0K A;  2LK4 A;  1VYK A;  3W8H A;  2R7V A;  3SXZ A;  3A11 A;  2BC5 A;  3K33 A;  3ABL C;  4PJM A;  4KNV A;  1SMY F;  2W4M A;  4M63 A;  4YT4 A;  1D1B A;  1ZW3 A;  1OXK A;  3JYH A;  2DGJ A;  1D0Y A;  3S84 A;  1FTS A;  3AG3 C;  2BL2 A;  4BEM J;  3HNL A;  1HMD A;  5COG A;  3O10 A;  4MVO A;  3HLZ A;  4FES A;  4LER A;  3QVY A;  3ZTZ A;  1BBH A;  3F47 A;  5COM A;  1PCX A;  2VCC A;  3Q6M A;  1ST6 A;  4ONS A;  3UMK A;  1YYJ A;  3C62 A;  3LNM B;  2R9R B;  3CQZ A;  2A0B A;  4JKV A;  1HE9 A;  1YJG A;  2V26 A;  3VRC A;  3CZ6 A;  3RVY A;  1LM3 B;  5CI8 A;  4JE9 A;  1EKY A;  3IQ5 A;  4C7O B;  3QZC A;  2AWC A;  2R7R A;  5B1A C;  2WZL A;  2XLV A;  2HZ8 A;  3AG4 C;  3F46 A;  3U0C A;  4Q5S F;  3UMI A;  1RKE A;  1WAS A;  2NUP B;  5BQG A;  2OCC C;  1SYQ A;  1H9T A;  3RYL A;  1R5I D;  3H65 A;  4MND A;  1JPN A;  1VB5 A;  1ZU4 A;  2G3K A;  3CAX A;  1G4W R;  3AGU A;  4RBN A;  1NU7 D;  4JJF A;  3EHN A;  1RMV A;  2OG2 A;  1A7E A;  5EGY A;  2CDQ A;  2YKZ A;  4FWV A;  1YLM A;  3DI5 A;  4O7G A;  3TQO A;  1WOL A;  4D4X A;  5AC4 A;  1HE1 A;  2WVQ A;  4QI2 A;  1ZW2 A;  3W4Y A;  2XLM A;  5KYW B;  5KYW A;  4JTC B;  2G3V A;  4QDL A;  1APC A;  1Z63 A;  4CIH A;  1A7D A;  3ATP A;  2H7O A;  3IQT A;  3B29 A;  2PX3 A;  3ZDL A;  1IZM A;  3VF0 A;  4DXW A;  5T3W A;  1OKK D;  3QVZ A;  1E85 A;  1JOG A;  2YQY A;  4MTO A;  1YVI A;  1OCR C;  1O87 A;  3DE9 A;  3MBG A;  5DS6 A;  1YA7 O;  3DAG A;  3KYI A;  4WJ0 A;  3EHM A;  1E86 A;  2NUT A;  2A69 F;  4UDV A;  2YLG A;  3ZIB A;  1M6T A;  2WZG A;  2HMQ A;  3L1M A;  3MFN A;  4NTB A;  2AU5 A;  3AG1 C;  5F28 E;  4EKW A;  4J30 B;  4EUK B;  1C02 A;  2WB7 A;  3M4C A;  3KMI A;  2R05 A;  3GWL A;  4JVS A;  3FOP A;  4KC9 A;  2F22 A;  1XZP A;  1HW1 A;  4NCQ A;  2M4E A;  4U5C E;  3O6X A;  1LVK A;  4JC7 A;  4MQ9 F;  3ZQV A;  4EBB A;  4E7Z A;  3O39 A;  4CSA A;  2J9V A;  3TJ6 A;  1T6I A;  1DOV A;  2Q9C A;  4WGZ A;  3O55 A;  3DM9 B;  4P6I C;  2EIL C;  4MS2 A;  1G8X A;  4PFO A;  3RKO F;  3U3F A;  4IAR A;  3RF3 A;  2ZXW C;  3T6J A;  2EIM C;  3JTL O;  3TUL A;  5DVW A;  2EIN C;  3UR3 C;  5KYN A;  1QZX A;  2FGY A;  3LLK A;  2OOC A;  3GWN A;  3UGP A;  2OEX A;  2HV6 A;  3H2U A;  1ZZP A;  3ZTM A;  1Q0D A;  3U8V A;  4C3E A;  4AX2 A;  2A6H F;  1K05 A;  1S05 A;  1GGQ A;  1LS4 A;  2PF4 E;  4U9E A;  1OR3 A;  3RH3 A;  3FHD A;  3K6B A;  1JRA A;  3C8G B;  3CSK A;  4LDR A;  4MVZ A;  3RQF A;  4AK9 A;  2XXA A;  3SNH A;  2GAQ A;  4X0R A;  3DD7 A;  2QNL A;  1RKE B;  2W4B A;  3R2P A;  5TJ5 E;  4FX5 A;  1A41 A;  1NSG B;  3LEV A;  2QTV A;  3C63 A;  1SR2 A;  4I1O B;  2AP3 A;  2DI3 A;  3ASO C;  3FDQ A;  4IJJ A;  1MQV A;  2EPL X;  1MMA A;  3GEE A;  3N24 A;  3DJN B;  1D0Z A;  1WAT A;  1EQ1 A;  4PR9 A;  3G50 A;  4A2N B;  5L0G A;  2R25 A;  3ZG1 A;  4BJ5 C;  3NG1 A;  1O3U A;  3ABK C;  3NYJ A;  2Y69 C;  1Z5Z A;  4MVQ A;  3JZ0 A;  5E3A A;  4IGG A;  1LS1 A;  5A6K A;  5FCL A;  5L0C A;  2YL1 A;  1U6H A;  3ZQY A;  1EA8 A;  1Z6A A;  4JCH A;  2H7V C;  2P61 A;  2XLD A;  3EGX A;  4IAQ A;  3RVZ A;  1VMA A;  1U89 A;  1ZHX A;  3WG7 C;  4O6N A;  1ZHY A;  3NMI A;  2IXN A;  3DKA A;  3TOL A;  4D4N A;  2W9Y A;  3K1H A;  4OD4 A;  2XLW A;  2XRH A;  4JCZ A;  4O6Y A;  2VAS A;  3QW1 A;  4NC3 A;  4YL0 A;  1M2V A;  4K7B A;  3BRJ A;  4IWB A;  3PCV A;  3SXK A;  3S28 A;  1NLX A;  3ZWI A;  1YYX A;  5L0I A;  1NFN A;  2HV7 A;  2ZXO A;  1PD1 A;  3U9J A;  5DS4 A;  3NDB B;  2PFD A;  2J0X A;  2Q3T A;  4O6M A;  3AGT A;  4C3D A;  4XEF A;  2I8B A;  4JJG A;  4OIO F;  1E2X A;  3DM5 A;  2EIK C;  4U5F E;  2FFH A;  3ZC4 A;  3GEI A;  3SXM A;  1XZQ A;  1ZYR F;  2Q9A A;  1MMD A;  5D91 A;  1E83 A;  2JD3 A;  2PNO A;  3EZI A;  1GQA A;  1LE2 A;  1TWC A;  2PP4 A;  4PJN A;  2J9W A;  3ZSU A;  4CDY A;  1YZC A;  2J0W A;  3AOU A;  3US6 A;  4B6I A;  1MNE A;  2A1D D;  1FMV A;  2HJ3 A;  4HE8 D;  1TWA A;  3EZH A;  2NSG A;  2JPU A;  2LCH A;  3C18 A;  2IXP A;  1HY5 A;  1G4U S;  2IXM A;  2YEV A;  1I4Z A;  1CGN A;  2KGO A;  2RD9 A;  2Y3B A;  3TOM A;  4JUR I;  1T6U A;  1RJ9 A;  1LPE A;  3B9Q A;  5B1B C;  3S27 A;  1HMO A;  2KK1 A;  4CJO A;  1J8M F;  2MWQ A;  1JPJ A;  3KPH A;  4G0H A;  3CEX A;  2WVN A;  3FVY A;  4E0H A;  1T5O A;  4K1O A;  1PV3 A;  4LDK A;  2C03 A;  5T3T A;  3PHF 2;  4W8P A;  2GA0 A;  1Z23 A;  3C8Z A;  3EG9 B;  4HEA J;  3W8I A;  3U9M A;  3IPM O;  3M15 A;  3EPV A;  1TFK B;  2P0N A;  4OIP F;  3UMH A;  2KC3 A;  1JAF A;  5E3C A;  3JCU Q;  4H54 A;  4BEJ A;  3AJM A;  2I15 A;  3LJB A;  3NYL A;  1BR2 A;  2EPO A;  2VH3 A;  2IBF A;  2QE9 A;  2XLH A;  3N0T A;  1MND A;  4XLN F;  1QSP A;  1G5Z A;  1V55 C;  3JRM O;  4ULV A;  3N2Z B;  1E84 A;  4XEK A;  4G78 A;  3FAJ A;  1FR0 A;  1TQG A;  1RXQ A;  2J46 A;  1H6G A;  4XEV A;  2KW3 C;  2R7X A;  3JSE O;  4LDQ A;  2LQG A;  2DB4 A;  4JEB A;  5A6B A;  2L6G A;  1K40 A;  2YWA A;  5GPG B;  1QVX A;  4JRZ A;  3PMR A;  2OQM A;  1S7Z A;  2V3C C;  1M57 C;  1MMG A;  3HNK A;  5L3V A;  2Z15 A;  1OW8 A;  1YAU O;  5EHH A;  2XLE A;  1TKN A;  3U2L A;  1SF8 A;  2YHS A;  4XQ1 A;  1YZA A;  3EH2 A;  1RJ9 B;  4JIO A;  4DOZ A;  4YN0 B;  2Q4F A;  4HFF B;  1T9K A;  1EI7 A;  4Z9J A;  4CS9 A;  5CI9 A;  4MVS A;  2ASR A;  3Q6N A;  2ZXR A;  4DRI B;  1LKX A;  1BR1 A;  3C7J A;  2XM4 A;  2D4U A;  3GOD A;  1JR8 A;  1L7C A;  3NKD A;  3SXY A;  3T6G B;  4F4B A;  4U5D E;  2J45 A;  4KI2 A;  1WTY A;  3KYJ A;  1CGM E;  4MVM A;  2HMZ A;  4MW8 A;  1ZVZ A;  4Z9I A;  2AVK A;  1Q0G A;  3LLI A;  4O79 A;  4EBK A;  2R7S A;  2A68 F;  3U8P A;  3S9O A;  5JS5 A;  1KNY A;  1RCP A;  3FXH A;  2NG1 A;  1NZE A;  5A69 A;  2QUP A;  2WVO A;  4RDA A;  1QPU A;  1N1C A;  1C17 M;  2CYD A;  2YL3 A;  4CS7 A;  3JYY A;  2IXO A;  1LI5 A;  2Q00 A;  3LS1 A;  3PDM P;  1M2V B;  1ORS C;  5JRA A;  256B A;  3RQG A;  4BJT A;  2TMV P;  1T6Q A;  2R7U A;  1W2W A;  3VM6 A;  5L0D A;  3ABM C;  1LIH A;  2EPM X;  1QKR A;  4BJ6 A;  3V7O A;  2H8A A;  3HNI A;  1CPR A;  3V5Z A;  1A0B A;  3S0X A;  4LLC A;  3KH2 A;  4JZA A;  3ASN C;  3EGD B;  4U5H A;  3H2V A;  3BEH A;  2HSB A;  2VCA A;  3M79 A;  4AE4 A;  2CW0 F;  4AE4 B;  2C04 A;  2R7Q A;  3L8J A;  2VB6 A;  2A0U A;  4PJL A;  2IOQ A;  3L8I A;  3B71 A;  3AQB A;  4OIQ F;  2B0H A;  2EPN A;  4JEA A;  5JSL A;  2VCB A;  3WHN A;  4G7H F;  2OJE D;  3HJC A;  3HNJ A;  2QY9 A;  1VLT A;  1D1C A;  2FAP B;  5KYY B;  1GM5 A;  2OKU A;  2WZF A;  3LEO A;  2LIG A;  4YT5 A;  3UNG C;  3IQC A;  1VOM A;  2XS1 A;  1D0X A;  3EFO A;  1CGO A;  3EFO B;  3I4U A;  5HV9 A;  1NG1 A;  3X1O A;  1Z7Q c;  3GOR A;  4CJG A;  4DRH B;  2KJG A;  1SZI A;  2EIJ C;  4DRJ B;  2HSQ A;  2B0J A;  4E17 A;  2Q9B A;  1YDI A;  2YRF A;  2OEV A;  3G4Z A;  3EH1 A;  2YZS A;  4OIR F;  5BQH A;  4YJW A;  4ZLC A;  2KSF A; 
#chains in the Genus database with same CATH homology
 2BE5 F;  3KKB A;  2D5R B;  1NU9 C;  2J7P D;  3LAY A;  1OCO C;  2J9U A;  1TWH A;  2E87 A;  2WL8 A;  3E9V A;  3M1C B;  4E7S A;  4LAC B;  1BR4 A;  3RFY A;  5DS5 A;  3ECS A;  3RIP A;  3B0P A;  5B3S C;  1QLE C;  3OEO A;  2ZXP A;  1OCC C;  4DBR A;  4PFP A;  1IW7 F;  2H7B A;  3JSZ A;  3L34 A;  3ZVR A;  4IRU A;  5KYY A;  3B0V C;  2Y3H A;  2L81 A;  3DJU B;  4Q4Z F;  3WOD F;  4BG0 A;  3UGO A;  1J8Y F;  1V54 C;  1PD0 A;  5KYX B;  4XTK A;  4PJJ A;  2KQ9 A;  4CBE A;  4N06 A;  4GYT A;  3VYW A;  4GEH A;  2ZPA A;  4BJ6 C;  3JT1 A;  4DVY P;  4I3M A;  4Q7C A;  4CS8 C;  3EQL F;  4U5E E;  3ITF A;  4EWC A;  3SYN A;  1FFH A;  1D1A A;  4G7O F;  5DQT A;  4YT8 A;  2GFH A;  3E70 C;  5BUO A;  2Y3D A;  2PX0 A;  4XLP F;  2W45 A;  2CNW A;  2G62 A;  4YT2 A;  1FMW A;  3SZR A;  2DYR C;  3Q7G A;  3K66 A;  3W2V A;  4BJ1 A;  5L3Q A;  2XL4 A;  2L9J A;  5KYU A;  2Y3G A;  2DYS C;  4HFK B;  3B0U X;  2R7T A;  3NKE A;  4DVZ A;  2X51 A;  3POV A;  1M56 C;  3GAN A;  1WGW A;  3EGD A;  2XXA B;  3T4R A;  1KU2 A;  3K7D A;  3Q7L A;  2A6E F;  4OD5 A;  4I44 A;  5D92 A;  3VAY A;  1ZHW A;  5E33 A;  1FFT C;  3TD7 A;  1OKK A;  4KBL A;  4U5B E;  4YWQ A;  3I5Q A;  5HSW A;  3K1I C;  1M2O A;  4IAO A;  3MLG A;  3SEO A;  1TWG A;  3T6B A;  4CS8 A;  3EGX B;  4ZLD A;  2CNW D;  3HTK C;  2O9X A;  3EJN A;  4CSA C;  5E2Q A;  3AG2 C;  3DAF A;  4U5G A;  5DLJ A;  2MYS A;  1VK5 A;  2R7W A;  2NUT B;  1ZHT A;  1ZU5 A;  4XWJ A;  3MX3 A;  5T1D B;  1VYI A;  4K0D A;  3NRH A;  4KNW A;  5F5F A;  2R7O A;  3DZA A;  2Y39 A;  3DXJ F;  3JRT A;  3W2W A;  3S29 A;  2NUP A;  3LES A;  3IEE A;  4DBQ A;  1O5H A;  3SP1 A;  2XSE A;  1MMN A;  4G7Z F;  1TR2 A;  3NYM A;  3AQC A;  2IYL D;  4ULW A;  3X2Q C;  2CGE A;  4NY3 A;  4QI0 A;  4CS9 C;  4OIN F;  3LNR A;  4ANJ A;  4PK4 A;  1ZHZ A;  3LS0 A;  5IY5 C;  2P6V A;  4RD9 A;  5DQZ A;  3OWT A;  4I1M A;  5KYX A;  3KL4 A;  2J7P A;  3L0I A;  3I5P A;  4J32 B;  4H4K C;  4LLE A;  2P7V A;  2KNH A;  1OCZ C;  5F5H A;  1Z3I X;  3EG9 A;  3OA1 A;  4JW1 A;  3QMK A;  2LSE A;  4W8K A;  4C7O A;  4BJ5 A;  4C3B A;  3DMD A;  1VYK A;  3W8H A;  2R7V A;  3K33 A;  3ABL C;  4PJM A;  4KNV A;  1SMY F;  2W4M A;  4M63 A;  4YT4 A;  1D1B A;  3JYH A;  1D0Y A;  2DGJ A;  1FTS A;  3AG3 C;  3HLZ A;  4FES A;  4LER A;  3F47 A;  5KYU B;  1PCX A;  3Q6M A;  3UMK A;  1ST6 A;  3CQZ A;  2V26 A;  3CZ6 A;  5CI8 A;  3QZC A;  2R7R A;  5B1A C;  2WZL A;  3AG4 C;  3F46 A;  4Q5S F;  3UMI A;  2NUP B;  2OCC C;  3RYL A;  3H65 A;  4MND A;  1JPN A;  1ZU4 A;  2G3K A;  4RBN A;  1NU7 D;  4JJF A;  3EHN A;  2OG2 A;  5EGY A;  2CDQ A;  4FWV A;  4O7G A;  2WVQ A;  4QI2 A;  5KYW B;  5KYW A;  2G3V A;  4QDL A;  1Z63 A;  4CIH A;  2H7O A;  2PX3 A;  1IZM A;  5T3W A;  1OKK D;  1OCR C;  1O87 A;  5DS6 A;  3DAG A;  4WJ0 A;  3EHM A;  2NUT A;  2A69 F;  3ZIB A;  2WZG A;  3AG1 C;  4J30 B;  2WB7 A;  3KMI A;  4JVS A;  4KC9 A;  4U5C E;  2M4E A;  3O6X A;  1LVK A;  4MQ9 F;  4EBB A;  4C7O B;  4E7Z A;  4CSA A;  3O39 A;  2J9V A;  2Q9C A;  3DM9 B;  4P6I C;  2EIL C;  3RKO F;  1G8X A;  4PFO A;  2ZXW C;  3T6J A;  2EIM C;  5DVW A;  2EIN C;  3UR3 C;  5KYN A;  1QZX A;  2FGY A;  3LLK A;  3UGP A;  2HV6 A;  4C3E A;  4AX2 A;  2A6H F;  2PF4 E;  3RH3 A;  3FHD A;  3K6B A;  3CSK A;  4AK9 A;  2XXA A;  3SNH A;  4X0R A;  3DD7 A;  2W4B A;  4FX5 A;  3LEV A;  2QTV A;  4I1O B;  3ASO C;  3FDQ A;  4IJJ A;  1MMA A;  3N24 A;  3DJN B;  1D0Z A;  4A2N B;  3ZG1 A;  4BJ5 C;  3NG1 A;  3ABK C;  3NYJ A;  2Y69 C;  1Z5Z A;  5E3A A;  1LS1 A;  5FCL A;  1Z6A A;  4JCH A;  2H7V C;  3EGX A;  1ZHX A;  1VMA A;  3WG7 C;  4O6N A;  1ZHY A;  2IXN A;  2W9Y A;  3K1H A;  4OD4 A;  2XRH A;  4O6Y A;  2VAS A;  1M2V A;  4K7B A;  4IWB A;  3S28 A;  2HV7 A;  5DS4 A;  2ZXO A;  1PD1 A;  3NDB B;  2PFD A;  2J0X A;  2Q3T A;  4O6M A;  4C3D A;  4OIO F;  2I8B A;  4JJG A;  3DM5 A;  2EIK C;  4U5F E;  2FFH A;  3ZC4 A;  1ZYR F;  2Q9A A;  1MMD A;  5D91 A;  2JD3 A;  3EZI A;  1TWC A;  2PP4 A;  4PJN A;  2J9W A;  3ZSU A;  2J0W A;  4B6I A;  1MNE A;  2A1D D;  1FMV A;  4HE8 D;  1TWA A;  3EZH A;  2IXP A;  2YEV A;  2IXM A;  2Y3B A;  2KGO A;  4JUR I;  1RJ9 A;  5B1B C;  3B9Q A;  3S27 A;  1J8M F;  2MWQ A;  1JPJ A;  4G0H A;  2WVN A;  3FVY A;  2C03 A;  5T3T A;  3PHF 2;  1Z23 A;  3EG9 B;  4HEA J;  3W8I A;  3EPV A;  4OIP F;  3UMH A;  5E3C A;  3JCU Q;  4BEJ A;  3LJB A;  3NYL A;  1BR2 A;  2VH3 A;  3N0T A;  1MND A;  4XLN F;  1V55 C;  3N2Z B;  3FAJ A;  2J46 A;  2KW3 C;  2R7X A;  3PMR A;  1S7Z A;  2V3C C;  1M57 C;  1MMG A;  5L3V A;  2Z15 A;  5EHH A;  1TKN A;  1SF8 A;  2YHS A;  3EH2 A;  1RJ9 B;  4DOZ A;  4YN0 B;  4HFF B;  4CS9 A;  5CI9 A;  3Q6N A;  2ZXR A;  1LKX A;  1BR1 A;  3GOD A;  3NKD A;  4F4B A;  4U5D E;  2J45 A;  4KI2 A;  3LLI A;  4O79 A;  2R7S A;  2A68 F;  2NG1 A;  1NZE A;  4RDA A;  2WVO A;  1N1C A;  4CS7 A;  2IXO A;  3LS1 A;  1M2V B;  2R7U A;  4BJT A;  1W2W A;  3ABM C;  4BJ6 A;  3V7O A;  3S0X A;  4LLC A;  3KH2 A;  4JZA A;  3ASN C;  3EGD B;  4U5H A;  4AE4 A;  2CW0 F;  4AE4 B;  2C04 A;  2R7Q A;  4PJL A;  2VB6 A;  2IOQ A;  4OIQ F;  3AQB A;  4G7H F;  3HJC A;  2QY9 A;  1D1C A;  5KYY B;  2WZF A;  4YT5 A;  3UNG C;  1VOM A;  3EFO B;  1D0X A;  3EFO A;  3I4U A;  1NG1 A;  3X1O A;  2KJG A;  1SZI A;  2EIJ C;  2B0J A;  2Q9B A;  3EH1 A;  2YZS A;  4OIR F;  4YJW A;  4ZLC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...