4U5CE

Crystal structure of glua2, con-ikot-ikot snail toxin, partial agonist fw and postitive modulator (r,r)-2b complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
85
structure length
85
Chain Sequence
b'GPADCCRMKECCTDRVNECLQRYSGREDKFVSFCYQEATVTCGSFNEIVGCCYGYQMCMIRVVKPNSLSGAHEACKTVSCGNPCA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamate receptor 2
publication title X-ray structures of AMPA receptor-cone snail toxin complexes illuminate activation mechanism.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein/toxin
total genus 28
structure length 85
sequence length 85
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1800 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4u5cE00
4U5BE 4U5EE 4U5CE 4U5HA 4U5FE 4U5GA 4U5DE
chains in the Genus database with same CATH superfamily
3U2MA 3EH2A 1MNDA 2WZLA 3ZDLA 3RH3A 1K05A 3DAGA 1ZU5A 3EFOB 3DE8A 3EH1A 2FGYA 4U5CE 4XWJA 2PF4E 4CS9A 4CS8A 3X2QC 1Z63A 1BDJB 1M2OA 3DAFA 1ZW3A 1FMVA 4GQHA 5B3SC 1LE2A 3UGPA 1ZHWA 1Q0GA 4H54A 4BJ6C 4J30B 1IZMA 2J9WA 5A6KA 4BJ5C 2IBFA 5JSLA 3EG9A 3O10A 1D0YA 1NG1A 4CDVA 2ICWG 3NKEA 1K04A 3HNKA 1EKYA 4WJ0A 5L3QA 3PDMP 3KPHA 1G8XA 3VYWA 5A69A 1BR4A 1I5NA 4UDVA 4Q7CA 3RQEA 4EWCA 2QY9A 3HLZA 3RYLA 1H7IA 1RJ9A 2J0XA 5T1DB 5CI9A 3SEOA 4JKVA 4MVMA 3CEXA 1GQAA 1M57C 3AGTA 5KYYA 4C3DA 3WAQA 1LI5A 1PD0A 3RW0A 4E7ZA 4NTBA 1OW8A 2M4EA 3L8IA 3FXHA 4ZLCA 5L0DA 2A1DD 1FMWA 3G4XA 3TOMA 2PFDA 3C8ZA 3K1HA 4PK4A 4YJWA 2TMVP 1ZHTA 3UNGC 4U5GA 1O5HA 4FWVA 1OQCA 2LK4A 4O6NA 1NLXA 2Q4FA 2WZGA 2W4BA 3C8GB 2HV6A 3EZHA 2VCCA 3T4RA 1Q0FA 3LAYA 2XLMA 4OINF 5JLIA 3IQ5A 4G7OF 4M63A 2KGOA 2YL0A 3O6XA 4N4WA 4U5BE 3PCVA 3C63A 1HW1A 4IB4A 4MNDA 1HE9A 5E33A 4QI0A 3EGDB 4E17A 2VCBA 1KTMA 2WVQA 1FFHA 3U8VA 2HS5A 1OCOC 2EPOA 3FAPB 2J45A 1XZPA 2L81A 3AG4C 3JYYA 3VRCA 3ZG1A 2MWQA 3VF0A 4AE4B 4DOZA 5E3AA 2W4MA 3WODF 5DQZA 4BJTA 2L9JA 2YL1A 2A0UA 5JUAA 1G5ZA 1UFBA 3W4YA 1BR1A 1QVXA 2GWWA 4BG0A 2YKZA 4XEFA 3UMHA 1D1AA 2DYRC 3DD7A 1YZCA 3A11A 1JAFA 3R2PA 4U5EE 1E86A 3W2VA 3EQLF 5KYXB 3K6BA 3QVZA 4JJGA 5F5FA 1ZHZA 5A6BD 4HE8D 2MHRA 1WN0A 3LEVA 4IAOA 4MQ9F 2YLIA 4JVSA 1C03A 1RKEA 1OR3A 4BJ1A 3LUTB 256BA 5JP7A 1JOGA 5FZTA 2R05A 3FDQA 4C7OA 1F1MA 1KNYA 1ZYRF 3EHNA 3GM1A 4Z9JA 1W2WA 3EGXA 3U8PA 4E0IA 2DI3A 2Y3HA 2XLDA 1OCZC 3L1MA 4JTAB 4Z9IA 2QNLA 1OKKA 1OW6A 1U89A 1TWCA 2LCHA 1SYQA 2LSEA 3AOUA 2EPKX 1LE4A 1M2VB 3TJ5A 4JW1A 3TQOA 1GS9A 2WVNA 1YAUO 1YVIA 4KBLA 4AX2A 4YT2A 5EHHA 2CNWA 2VB6A 1FFTC 5B1AC 1I4ZA 1Z7Qc 3IQ6A 4YL0A 1D1CA 3ECSA 4O6YA 2J9BA 3CZ6A 1Q0DA 2WB7A 1T5OA 2DYSC 3AG2C 3JRMO 2IXNA 3Q6MA 4GEHA 1WWPA 1NFOA 2J0WA 3C18A 1NSGB 3EHMA 1FNTc 2LP4A 1S7ZA 1RXQA 1NU9C 3HKKA 3LLIA 3T6BA 2R7UA 1CPQA 1TWAA 2B0JA 4P9FA 5BQIA 2OG2A 3FVYA 5KYUB 3DKAA 5DS5A 1C17M 1HY5A 3EZIA 3H2VA 4PFPA 3B9QA 4L6RA 3V5YA 1YYXA 1SF8A 3MLGA 1ZZPA 1ST6A 5AC5A 5A6JA 2R7RA 4IRUA 3DJNB 4WGYA 3MYIA 1TKNA 3KKBA 5B1BC 4OIOF 3V5XA 5KYWB 3U0CA 3W8HA 4EHPA 4LDQA 2R7TA 1M6TA 1S05A 3ABKC 4IGGA 4U9EA 1OXBA 2J46A 5COFA 2QUPA 5JRAA 4LLEA 4K1OA 2AVKA 3W2WA 3S84A 2XL4A 1FAPB 2OJED 5IY5C 1E85A 3QZCA 1QPUA 3IQTA 2WZFA 2OJQA 1TWHA 4JZAA 4XTKA 1ZU4A 4OIRF 3U5SA 4C3BA 4DJ9A 2A68F 5A6AA 2VH3A 5EGYA 5KYNA 4CS7A 1WATA 3ZQYA 5HSWA 2YQYA 3JRTA 2EPLX 1ORYA 4EUKB 1XZQA 3GWNA 2Y69C 3WG7C 4NQFA 4J7TA 3G50A 4E0HA 4D4NA 1VLTA 4N6HA 1HMOA 2ZXWC 2NUPA 1R4TA 1YYJA 3K1IA 2A69F 2AWCA 3N24A 3LS0A 5DVWA 5DLJA 3SXMA 4O79A 2Y3GA 4MTGA 3GEHA 4I1MA 4JC7A 1V4AA 3T6GB 1EI7A 3HNLA 1QKRA 5DQTA 4LDKA 1D0ZA 1A0BA 1Z23A 4JRZA 4HFKB 3S27A 2YHSA 2KYHA 2KK1A 4CSAC 2R7WA 3DE9A 4OIPF 1LKXA 3VAYA 4NTFA 4BEMJ 2LFDA 2R7QA 2XLWA 3ABMC 1MQVA 3MFNA 2GFHA 2EINC 1G4WR 1O87A 3RQGA 3EGDA 3IQCA 2W45A 1WOLA 1OCRC 4JCZA 1TR2A 4CX9A 1M56C 1YJGA 2KC3A 4EIYA 1Q0KA 2XRHA 4RD9A 4YT4A 4G78A 1CGOA 3KMIA 4AE4A 3LJBA 3SYNA 1ZHXA 2GA0A 3ATPA 3U9MA 3C8GD 4PR9A 2BE5F 3S29A 4QDLA 2R7VA 4YL3A 4HEAJ 2O9XA 1AEPA 2VASA 4MS2A 5A6BA 1SR2A 2NUTA 4XPYA 2ZD9A 3DJUB 5L3VA 2V3CC 2KW3C 2OU6A 1Y4CA 2EIKC 5DS4A 4CJGA 2HUJA 1E84A 2Q7RA 1CGME 4JE9A 4PJMA 2YVKA 3M1CB 2RD9A 5HV9A 1ZW2A 1CPRA 1A7EA 2JD3A 4I3MA 1VK5A 3AG1C 3L34A 1V74B 4Q5SF 5CI8A 1H9GA 2XLHA 1H6GA 3JSEO 2XXAA 2E87A 3CQZA 5AGFA 4OIQF 3TK0A 3J06A 2PNOA 2YEVA 1RMVA 3NMKA 2X0CA 3GEEA 4CSAA 1A41A 4PJLA 5JT4A 4HFFB 3SP1A 3IPMO 4RDAA 2AWYA 2GDCA 3OEOA 1V55C 2OOCA 3C7JA 3HTKC 3N2ZB 3GWLA 5BUOA 3N0TA 4YK5A 5JVEA 1T9KA 4YWQA 3ASNC 2AP3A 3ZQVA 1L3PA 4IJJA 5B3IA 3O55A 2KQ9A 2FAPB 4U5DE 4KI2A 5FCLA 4P6IC 4C3EA 4H4KC 3GM3A 5E2QA 1NBBA 2P7VA 4JURI 3ZIBA 3LNMB 5L0HA 2AU5A 1TQGA 2KJGA 2UUHA 1TFKB 3US6A 4MVQA 2ASRA 2L6GA 2HSBA 4XPXA 5JS5A 1R5ID 1A7DA 1PCXA 1PV3A 4ZLDA 1T01A 1LVKA 4LLCA 4PJJA 3ZSUA 2H7BA 3QW0A 3AG3C 2EIMC 5KYUA 2R9RB 1B68A 2L7AA 3NRHA 1WASA 2EILC 1TWGA 4I44A 4FX5A 2D4UA 3CSKA 2Y39A 4MVUA 4EKWA 5K0IA 2HZ8A 3DMDA 2ZXOA 1LM3B 3GM2A 3DI5A 4JTDB 4MVSA 1YA9A 3OWTA 3C62A 4PJNA 1NU7D 2NSFA 2PP4A 3GANA 3L8JA 3NDBB 5F28E 3E70C 3DM9B 1J8MF 3K1IC 4MW8A 1OW7A 1LI7A 4ULVA 1U6HA 3MBGA 1T6QA 2Y3BA 3DWWA 3ZC4A 1NZEA 1VYIA 2A6EF 3K33A 3ZVRA 5BQHA 1RKEB 3M15A 1MMDA 3FMSA 3I5QA 3LEOA 3M4BA 4QI2A 4YT8A 4C7OB 2H7OA 3BEHA 1LIHA 3FOOA 3EFOA 2EPNA 3NMIA 1Z3IX 4U5HA 4EBKA 5AC4A 1WTYA 2QE9A 2XM0A 1QSPA 3HNJA 2HFIA 4FESA 5T3WA 1YARO 4G7HF 3ITFA 1MNEA 2P0NA 2NPUA 3GEIA 1QZXA 3E9VA 3GODA 2HJ3A 4AL0A 3MX3A 2B0HA 1NFNA 1VB5A 2ETSA 3B0VC 3ABLC 3AQBA 3QMKA 1OR2A 1EQ1A 2P61A 4YN0B 4CDAA 4CIPA 2HMQA 1DOWA 3I4UA 5CIVA 1SMYF 1IW7F 2NUTB 4LDRA 1HE1A 2R03A 2RSEB 3HJCA 3B29A 3NYMA 4W8KA 3SXYA 1BZ4A 1Z5ZA 3SZRA 1UG7A 5EK0A 4MVOA 3TD7A 2D5RB 2I8BA 2Y3DA 3Q7GA 4NTAA 4XQ1A 3R7CA 3EPVA 3NMJA 1ZHYA 2Q9BA 5L0FA 4IWBA 2CDQA 1GM5A 1YDIA 1L7CA 2ZXPA 3KH2A 4OD4A 2XL6A 4EBJA 1Q0MA 2G3VA 2PBEA 4LERA 3TOLA 1AVOB 4CBEA 3S0XA 2H8AA 3B0PA 1YA7O 2V26A 3F47A 5L0GA 3WHNA 2Q00A 1RKCA 3JSZA 4O7GA 3C8GA 3NYJA 4R32A 4RBNA 1YZAA 4KNWA 2QLAA 3TJ6A 3UR3C 2PX3A 3B0UX 2VCAA 2EIJC 3I5PA 2XS1A 2YLGA 4PFOA 2X51A 3ASOC 3FHDA 4A2NB 4XLPF 1LS4A 1C02A 3FOPA 4JEBA 2R7XA 2J8WA 3NYLA 4I1OB 4JTCB 4NC3A 2H7VC 4X0RA 2Q3TA 2LD6A 4MW3A 3POVA 3K7DA 3JYHA 2J7PD 1HW2A 4N06A 3RQFA 3SNHA 1VLSA 1VTMP 3RIPA 4CIHA 4BEJA 3RKOF 1T6IA 2G3KA 2OCCC 3UMIA 2WL8A 1E2XA 3Q6NA 3W8IA 2J9VA 4J32B 1H9TA 2UUIA 2LQGA 1MMGA 2NUPB 1MMNA 2L6HA 3DM5A 1U0BB 5KYXA 3EG9B 4KNVA 3UMKA 2LIGA 1XWJA 4CDYA 2C04A 2XM4A 3T6JA 3EJNA 2WVOA 1DOVA 1OCCC 2R7OA 4JEAA 4FAPB 1FTSA 3BRJA 3IEEA 3O39A 4MVZA 1RJ9B 4OD5A 3KYIA 2XLEA 3AGUA 3OA1A 4N6CA 3UGOA 5TJ5E 2CGEA 2OEVA 1A7VA 1Z6AA 2HSQA 2BC5A 4LACB 2CYDA 2GAQA 2YL7A 5KYYB 4BJ6A 2IXOA 3K66A 1GGQA 1FR0A 3S28A 4BJ5A 4YT5A 1M2VA 3V7OA 3MYFA 4ONSA 1JR8A 4IARA 4NY3A 3HNIA 4W8PA 2NSGA 3RFYA 4DRHB 3JZ0A 1E83A 1JPNA 1WGWA 4CJOA 3PMRA 1HMDA 5F5HA 1VYKA 2XS8A 1LPEA 3U9JA 3LS1A 3V5ZA 5L0JA 3T9OA 1Y6DA 1I4YA 4IAQA 4AK9A 3NKDA 5BQGA 1JPJA 1AUEA 2M64A 2W9YA 2IOQA 4B6IA 4A4AA 4BPMA 5DS6A 3TULA 1T6UA 2XSEA 4XEVA 2J9UA 1ORSC 2DB4A 3H2UA 3AQCA 1VOMA 1V54C 3SXKA 4XLNF 1MMAA 1ZVZA 2YWAA 4DBRA 5L0CA 2HJMA 4ULWA 3RVYA 4JCHA 5COGA 4AL1A 4P9TA 3QW1A 3VM6A 1BBHA 4DRIB 4YL1A 3DXJF 5D92A 1PD1A 4DVYP 2R7SA 3JCUQ 2IXPA 2JX0A 2BL2A 3JTLO 2XXAB 3U2LA 3X1OA 2KSFA 2Q9CA 2YL3A 1TFOB 2MYSA 5COMA 4PACA 5KYWA 3F46A 4GYTA 3M79A 4G0HA 3CAXA 2CCYA 4K7BA 3U3BA 4G7ZF 3RF3A 4ER9A 4E7SA 2KNHA 4K0DA 2OQMA 4MVRA 4D4XA 2A0BA 2HV7A 1QQ3A 2VC9A 3NG1A 4WABA 4XEKA 5GPGB 1JMWA 3ZWIA 2PX0A 1LS1A 2QTVA 3L0IA 2YRFA 3LNRA 2EPMX 2IYLD 5D91A 1APCA 4O6MA 3QVYA 3QTHA 5T3TA 4MTFA 5E3CA 2ZPAA 3EGXB 3IHUA 4JJFA 4CS9C 4CS8C 4E18A 4Q4ZF 1JRAA 2F22A 3Q7LA 3GORA 4XPWA 2CW0F 1D0XA 2G62A 4DRJB 3U3FA 3FAJA 2A6HF 2I15A 2JPUA 2ZXRA 3KYJA 4Z9HA 1RCPA 3M4CA 2Z15A 2IM8A 2L6FA 1O3UA 2DGJA 1OKKD 2Q9AA 4WGZA 3RVZA 1EA8A 4NCQA 2P1AA 3ZTZA 1OXKA 1QLEC 1N1CA 3LLKA 1ORJA 2OKUA 3S9OA 4ANJA 1G4US 2FFHA 3H65A 2YLDA 2CNWD 1D1BA 2R25A 1YLMA 3B71A 3G4ZA 2P6VA 2IXMA 4U5FE 1J8YF 2HKVA 3KL4A 3A9CA 3DZAA 1VMAA 4F4BA 4KC9A 1BR2A 2R02A 4JIOA 4DVZA 3AJMA 1SZIA 3JT1A 3S90A 2LFFA 4MTOA 3SXZA 2J7PA 2NG1A 1KU2A 2HMZA 2C03A 4J7YA 4DXWA 4DBQA 5L0IA 1K40A 2XL8A 4U9DA 2OEXA 4EBBA 1CGNA 2XLOA 3LESA 2XLVA 2YZSA 3ZTMA 3PHF2
chains in the Genus database with same CATH topology
3EH2A 1MNDA 2WZLA 3RH3A 3DAGA 4XWJA 1ZU5A 3EFOB 3EH1A 4U5CE 2FGYA 2PF4E 4CS9A 4CS8A 3X2QC 1Z63A 1M2OA 3DAFA 5B3SC 3UGPA 1FMVA 1ZHWA 4BJ6C 4J30B 1IZMA 2J9WA 4BJ5C 3EG9A 1D0YA 1NG1A 3NKEA 4WJ0A 5L3QA 1G8XA 3VYWA 1BR4A 4Q7CA 4EWCA 2QY9A 3HLZA 3RYLA 1RJ9A 2J0XA 5T1DB 5CI9A 3SEOA 1M57C 5KYYA 4C3DA 1PD0A 4E7ZA 2M4EA 4ZLCA 2A1DD 1FMWA 2PFDA 3K1HA 4PK4A 4YJWA 1ZHTA 3UNGC 4U5GA 1O5HA 4FWVA 4O6NA 2WZGA 3EZHA 2W4BA 3T4RA 2HV6A 4G7OF 3LAYA 4OINF 4M63A 2KGOA 3O6XA 4U5BE 4MNDA 5E33A 4QI0A 3EGDB 2WVQA 1FFHA 1OCOC 2J45A 4DOZA 2L81A 3AG4C 3ZG1A 2MWQA 4AE4B 5E3AA 2W4MA 3WODF 5DQZA 4BJTA 2L9JA 4EBBA 1BR1A 4BG0A 3UMHA 1D1AA 2DYRC 3DD7A 4U5EE 3W2VA 3EQLF 5KYXB 3K6BA 5F5FA 4JJGA 1ZHZA 4HE8D 3LEVA 4IAOA 4MQ9F 4JVSA 4BJ1A 3FDQA 4C7OA 1ZYRF 3EHNA 1W2WA 3EGXA 2Y3HA 1OCZC 1OKKA 3S28A 1TWCA 2LSEA 1M2VB 4JW1A 2WVNA 4KBLA 4AX2A 4YT2A 5EHHA 2CNWA 2VB6A 1FFTC 5B1AC 1D1CA 3ECSA 4O6YA 3CZ6A 3Q6MA 3AG2C 2WB7A 2DYSC 4GEHA 2NUTA 2IXNA 2J0WA 3EHMA 1S7ZA 1NU9C 3LLIA 3T6BA 2R7UA 1TWAA 2B0JA 2OG2A 3FVYA 5KYUB 5DS5A 3EZIA 4PFPA 3B9QA 1SF8A 3MLGA 1ST6A 2R7RA 4IRUA 3DJNB 1TKNA 3KKBA 5B1BC 4OIOF 5KYWB 3W8HA 2R7TA 3ABKC 2J46A 4LLEA 3W2WA 2XL4A 5IY5C 3QZCA 4JZAA 2WZFA 4XTKA 1TWHA 4OIRF 1ZU4A 4C3BA 2A68F 2VH3A 5EGYA 5KYNA 4CS7A 5HSWA 3JRTA 3WG7C 2Y69C 2ZXWC 2NUPA 2A69F 3N24A 3LS0A 5DVWA 5DLJA 4O79A 2Y3GA 4I1MA 5DQTA 1D0ZA 1Z23A 4HFKB 3S27A 2YHSA 4CSAC 2R7WA 4OIPF 1LKXA 3VAYA 2R7QA 3ABMC 2GFHA 2EINC 1O87A 3EGDA 2W45A 1OCRC 1TR2A 1M56C 4YT4A 2XRHA 4RD9A 4AE4A 3KMIA 3LJBA 3SYNA 1ZHXA 2BE5F 3S29A 4QDLA 2R7VA 4HEAJ 2O9XA 2VASA 3DJUB 5L3VA 2V3CC 2KW3C 2EIKC 5DS4A 4PJMA 3M1CB 2JD3A 4I3MA 4Q5SF 1VK5A 3AG1C 3L34A 5CI8A 2XXAA 2E87A 3CQZA 4OIQF 2YEVA 4CSAA 4PJLA 4HFFB 3SP1A 4RDAA 3OEOA 1V55C 3HTKC 3N2ZB 5BUOA 3N0TA 4YWQA 3ASNC 4IJJA 2KQ9A 4U5DE 4KI2A 5FCLA 4P6IC 4C3EA 4H4KC 5E2QA 2P7VA 4JURI 3ZIBA 2KJGA 1PCXA 4ZLDA 1LVKA 4LLCA 4PJJA 3ZSUA 2H7BA 3AG3C 2EIMC 5KYUA 3NRHA 2EILC 1TWGA 4I44A 4FX5A 3CSKA 2Y39A 3DMDA 2ZXOA 4PJNA 3OWTA 1NU7D 2PP4A 3NDBB 3GANA 3E70C 3DM9B 1J8MF 3K1IC 2Y3BA 3ZC4A 1NZEA 1VYIA 2A6EF 3K33A 3ZVRA 1MMDA 3I5QA 4QI2A 4YT8A 4C7OB 2H7OA 3EFOA 1Z3IX 4U5HA 5T3WA 4FESA 4G7HF 3ITFA 1MNEA 1QZXA 3E9VA 3GODA 3MX3A 3B0VC 3ABLC 3AQBA 3QMKA 4YN0B 3I4UA 1SMYF 1IW7F 2NUTB 3UMIA 3HJCA 3NYMA 4W8KA 1Z5ZA 3SZRA 3TD7A 2D5RB 2I8BA 2Y3DA 3Q7GA 3EPVA 1ZHYA 2Q9BA 4IWBA 2CDQA 3KH2A 2ZXPA 4OD4A 2G3VA 4LERA 3S0XA 4CBEA 3B0PA 3F47A 2V26A 3JSZA 4O7GA 3NYJA 4RBNA 3UR3C 4KNWA 3B0UX 2PX3A 2EIJC 3I5PA 4PFOA 2X51A 3ASOC 3FHDA 4A2NB 4XLPF 2R7XA 3NYLA 4I1OB 2H7VC 4X0RA 2Q3TA 3POVA 3K7DA 3JYHA 2J7PD 4N06A 3SNHA 3RIPA 4CIHA 4BEJA 3RKOF 2G3KA 2OCCC 2WL8A 3Q6NA 3W8IA 2J9VA 4J32B 3DM5A 1MMGA 2NUPB 1MMNA 5KYXA 3EG9B 4KNVA 3UMKA 2C04A 3T6JA 3EJNA 2WVOA 1OCCC 2R7OA 1FTSA 3IEEA 3O39A 1RJ9B 4OD5A 3OA1A 3UGOA 2CGEA 1Z6AA 5KYYB 4LACB 4BJ6A 2IXOA 3K66A 4BJ5A 4YT5A 1M2VA 3V7OA 4NY3A 3RFYA 1JPNA 1WGWA 3PMRA 5F5HA 1VYKA 3LS1A 4AK9A 3NKDA 1JPJA 2W9YA 4B6IA 2IOQA 5DS6A 2XSEA 2J9UA 3AQCA 1VOMA 1V54C 4XLNF 1MMAA 4DBRA 4ULWA 4JCHA 3DXJF 5D92A 1PD1A 4DVYP 2R7SA 3JCUQ 2IXPA 2XXAB 3X1OA 2Q9CA 2MYSA 5KYWA 3F46A 4GYTA 4G0HA 4K7BA 4G7ZF 4E7SA 2KNHA 4K0DA 2HV7A 3NG1A 2PX0A 1LS1A 2QTVA 3L0IA 3LNRA 2IYLD 5D91A 4O6MA 5T3TA 5E3CA 2ZPAA 3EGXB 4CS9C 4JJFA 4CS8C 4Q4ZF 3Q7LA 2CW0F 1D0XA 2G62A 3FAJA 2A6HF 2ZXRA 2Z15A 2DGJA 1OKKD 2Q9AA 1QLEC 1N1CA 3LLKA 4ANJA 2FFHA 3H65A 2CNWD 1D1BA 2P6VA 2IXMA 4U5FE 1J8YF 3KL4A 3DZAA 1VMAA 4F4BA 4KC9A 1BR2A 4DVZA 1SZIA 3JT1A 2J7PA 2NG1A 1KU2A 2C03A 4DBQA 3LESA 2YZSA 3PHF2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U5B E;  4U5E E;  4U5C E;  4U5H A;  4U5F E;  4U5G A;  4U5D E; 
#chains in the Genus database with same CATH topology
 3U2M A;  3EH2 A;  1MND A;  2WZL A;  3ZDL A;  3RH3 A;  1K05 A;  3DAG A;  1ZU5 A;  3EFO B;  3DE8 A;  3EH1 A;  2FGY A;  4U5C E;  4XWJ A;  2PF4 E;  4CS9 A;  4CS8 A;  3X2Q C;  1Z63 A;  1BDJ B;  1M2O A;  3DAF A;  1ZW3 A;  1FMV A;  4GQH A;  5B3S C;  1LE2 A;  3UGP A;  1ZHW A;  1Q0G A;  4H54 A;  4BJ6 C;  4J30 B;  1IZM A;  2J9W A;  5A6K A;  4BJ5 C;  2IBF A;  5JSL A;  3EG9 A;  3O10 A;  1D0Y A;  1NG1 A;  4CDV A;  2ICW G;  3NKE A;  1K04 A;  3HNK A;  1EKY A;  4WJ0 A;  5L3Q A;  3PDM P;  3KPH A;  1G8X A;  3VYW A;  5A69 A;  1BR4 A;  1I5N A;  4UDV A;  4Q7C A;  3RQE A;  4EWC A;  2QY9 A;  3HLZ A;  3RYL A;  1H7I A;  1RJ9 A;  2J0X A;  5T1D B;  5CI9 A;  3SEO A;  4JKV A;  4MVM A;  3CEX A;  1GQA A;  1M57 C;  3AGT A;  5KYY A;  4C3D A;  3WAQ A;  1LI5 A;  1PD0 A;  3RW0 A;  4E7Z A;  4NTB A;  1OW8 A;  2M4E A;  3L8I A;  3FXH A;  4ZLC A;  5L0D A;  2A1D D;  1FMW A;  3G4X A;  3TOM A;  2PFD A;  3C8Z A;  3K1H A;  4PK4 A;  4YJW A;  2TMV P;  1ZHT A;  3UNG C;  4U5G A;  1O5H A;  4FWV A;  1OQC A;  2LK4 A;  4O6N A;  1NLX A;  2Q4F A;  2WZG A;  2W4B A;  3C8G B;  2HV6 A;  3EZH A;  2VCC A;  3T4R A;  1Q0F A;  3LAY A;  2XLM A;  4OIN F;  5JLI A;  3IQ5 A;  4G7O F;  4M63 A;  2KGO A;  2YL0 A;  3O6X A;  4N4W A;  4U5B E;  3PCV A;  3C63 A;  1HW1 A;  4IB4 A;  4MND A;  1HE9 A;  5E33 A;  4QI0 A;  3EGD B;  4E17 A;  2VCB A;  1KTM A;  2WVQ A;  1FFH A;  3U8V A;  2HS5 A;  1OCO C;  2EPO A;  3FAP B;  2J45 A;  1XZP A;  2L81 A;  3AG4 C;  3JYY A;  3VRC A;  3ZG1 A;  2MWQ A;  3VF0 A;  4AE4 B;  4DOZ A;  5E3A A;  2W4M A;  3WOD F;  5DQZ A;  4BJT A;  2L9J A;  2YL1 A;  2A0U A;  5JUA A;  1G5Z A;  1UFB A;  3W4Y A;  1BR1 A;  1QVX A;  2GWW A;  4BG0 A;  2YKZ A;  4XEF A;  3UMH A;  1D1A A;  2DYR C;  3DD7 A;  1YZC A;  3A11 A;  1JAF A;  3R2P A;  4U5E E;  1E86 A;  3W2V A;  3EQL F;  5KYX B;  3K6B A;  3QVZ A;  4JJG A;  5F5F A;  1ZHZ A;  5A6B D;  4HE8 D;  2MHR A;  1WN0 A;  3LEV A;  4IAO A;  4MQ9 F;  2YLI A;  4JVS A;  1C03 A;  1RKE A;  1OR3 A;  4BJ1 A;  3LUT B;  256B A;  5JP7 A;  1JOG A;  5FZT A;  2R05 A;  3FDQ A;  4C7O A;  1F1M A;  1KNY A;  1ZYR F;  3EHN A;  3GM1 A;  4Z9J A;  1W2W A;  3EGX A;  3U8P A;  4E0I A;  2DI3 A;  2Y3H A;  2XLD A;  1OCZ C;  3L1M A;  4JTA B;  4Z9I A;  2QNL A;  1OKK A;  1OW6 A;  1U89 A;  1TWC A;  2LCH A;  1SYQ A;  2LSE A;  3AOU A;  2EPK X;  1LE4 A;  1M2V B;  3TJ5 A;  4JW1 A;  3TQO A;  1GS9 A;  2WVN A;  1YAU O;  1YVI A;  4KBL A;  4AX2 A;  4YT2 A;  5EHH A;  2CNW A;  2VB6 A;  1FFT C;  5B1A C;  1I4Z A;  1Z7Q c;  3IQ6 A;  4YL0 A;  1D1C A;  3ECS A;  4O6Y A;  2J9B A;  3CZ6 A;  1Q0D A;  2WB7 A;  1T5O A;  2DYS C;  3AG2 C;  3JRM O;  2IXN A;  3Q6M A;  4GEH A;  1WWP A;  1NFO A;  2J0W A;  3C18 A;  1NSG B;  3EHM A;  1FNT c;  2LP4 A;  1S7Z A;  1RXQ A;  1NU9 C;  3HKK A;  3LLI A;  3T6B A;  2R7U A;  1CPQ A;  1TWA A;  2B0J A;  4P9F A;  5BQI A;  2OG2 A;  3FVY A;  5KYU B;  3DKA A;  5DS5 A;  1C17 M;  1HY5 A;  3EZI A;  3H2V A;  4PFP A;  3B9Q A;  4L6R A;  3V5Y A;  1YYX A;  1SF8 A;  3MLG A;  1ZZP A;  1ST6 A;  5AC5 A;  5A6J A;  2R7R A;  4IRU A;  3DJN B;  4WGY A;  3MYI A;  1TKN A;  3KKB A;  5B1B C;  4OIO F;  3V5X A;  5KYW B;  3U0C A;  3W8H A;  4EHP A;  4LDQ A;  2R7T A;  1M6T A;  1S05 A;  3ABK C;  4IGG A;  4U9E A;  1OXB A;  2J46 A;  5COF A;  2QUP A;  5JRA A;  4LLE A;  4K1O A;  2AVK A;  3W2W A;  3S84 A;  2XL4 A;  1FAP B;  2OJE D;  5IY5 C;  1E85 A;  3QZC A;  1QPU A;  3IQT A;  2WZF A;  2OJQ A;  1TWH A;  4JZA A;  4XTK A;  1ZU4 A;  4OIR F;  3U5S A;  4C3B A;  4DJ9 A;  2A68 F;  5A6A A;  2VH3 A;  5EGY A;  5KYN A;  4CS7 A;  1WAT A;  3ZQY A;  5HSW A;  2YQY A;  3JRT A;  2EPL X;  1ORY A;  4EUK B;  1XZQ A;  3GWN A;  2Y69 C;  3WG7 C;  4NQF A;  4J7T A;  3G50 A;  4E0H A;  4D4N A;  1VLT A;  4N6H A;  1HMO A;  2ZXW C;  2NUP A;  1R4T A;  1YYJ A;  3K1I A;  2A69 F;  2AWC A;  3N24 A;  3LS0 A;  5DVW A;  5DLJ A;  3SXM A;  4O79 A;  2Y3G A;  4MTG A;  3GEH A;  4I1M A;  4JC7 A;  1V4A A;  3T6G B;  1EI7 A;  3HNL A;  1QKR A;  5DQT A;  4LDK A;  1D0Z A;  1A0B A;  1Z23 A;  4JRZ A;  4HFK B;  3S27 A;  2YHS A;  2KYH A;  2KK1 A;  4CSA C;  2R7W A;  3DE9 A;  4OIP F;  1LKX A;  3VAY A;  4NTF A;  4BEM J;  2LFD A;  2R7Q A;  2XLW A;  3ABM C;  1MQV A;  3MFN A;  2GFH A;  2EIN C;  1G4W R;  1O87 A;  3RQG A;  3EGD A;  3IQC A;  2W45 A;  1WOL A;  1OCR C;  4JCZ A;  1TR2 A;  4CX9 A;  1M56 C;  1YJG A;  2KC3 A;  4EIY A;  1Q0K A;  2XRH A;  4RD9 A;  4YT4 A;  4G78 A;  1CGO A;  3KMI A;  4AE4 A;  3LJB A;  3SYN A;  1ZHX A;  2GA0 A;  3ATP A;  3U9M A;  3C8G D;  4PR9 A;  2BE5 F;  3S29 A;  4QDL A;  2R7V A;  4YL3 A;  4HEA J;  2O9X A;  1AEP A;  2VAS A;  4MS2 A;  5A6B A;  1SR2 A;  2NUT A;  4XPY A;  2ZD9 A;  3DJU B;  5L3V A;  2V3C C;  2KW3 C;  2OU6 A;  1Y4C A;  2EIK C;  5DS4 A;  4CJG A;  2HUJ A;  1E84 A;  2Q7R A;  1CGM E;  4JE9 A;  4PJM A;  2YVK A;  3M1C B;  2RD9 A;  5HV9 A;  1ZW2 A;  1CPR A;  1A7E A;  2JD3 A;  4I3M A;  1VK5 A;  3AG1 C;  3L34 A;  1V74 B;  4Q5S F;  5CI8 A;  1H9G A;  2XLH A;  1H6G A;  3JSE O;  2XXA A;  2E87 A;  3CQZ A;  5AGF A;  4OIQ F;  3TK0 A;  3J06 A;  2PNO A;  2YEV A;  1RMV A;  3NMK A;  2X0C A;  3GEE A;  4CSA A;  1A41 A;  4PJL A;  5JT4 A;  4HFF B;  3SP1 A;  3IPM O;  4RDA A;  2AWY A;  2GDC A;  3OEO A;  1V55 C;  2OOC A;  3C7J A;  3HTK C;  3N2Z B;  3GWL A;  5BUO A;  3N0T A;  4YK5 A;  5JVE A;  1T9K A;  4YWQ A;  3ASN C;  2AP3 A;  3ZQV A;  1L3P A;  4IJJ A;  5B3I A;  3O55 A;  2KQ9 A;  2FAP B;  4U5D E;  4KI2 A;  5FCL A;  4P6I C;  4C3E A;  4H4K C;  3GM3 A;  5E2Q A;  1NBB A;  2P7V A;  4JUR I;  3ZIB A;  3LNM B;  5L0H A;  2AU5 A;  1TQG A;  2KJG A;  2UUH A;  1TFK B;  3US6 A;  4MVQ A;  2ASR A;  2L6G A;  2HSB A;  4XPX A;  5JS5 A;  1R5I D;  1A7D A;  1PCX A;  1PV3 A;  4ZLD A;  1T01 A;  1LVK A;  4LLC A;  4PJJ A;  3ZSU A;  2H7B A;  3QW0 A;  3AG3 C;  2EIM C;  5KYU A;  2R9R B;  1B68 A;  2L7A A;  3NRH A;  1WAS A;  2EIL C;  1TWG A;  4I44 A;  4FX5 A;  2D4U A;  3CSK A;  2Y39 A;  4MVU A;  4EKW A;  5K0I A;  2HZ8 A;  3DMD A;  2ZXO A;  1LM3 B;  3GM2 A;  3DI5 A;  4JTD B;  4MVS A;  1YA9 A;  3OWT A;  3C62 A;  4PJN A;  1NU7 D;  2NSF A;  2PP4 A;  3GAN A;  3L8J A;  3NDB B;  5F28 E;  3E70 C;  3DM9 B;  1J8M F;  3K1I C;  4MW8 A;  1OW7 A;  1LI7 A;  4ULV A;  1U6H A;  3MBG A;  1T6Q A;  2Y3B A;  3DWW A;  3ZC4 A;  1NZE A;  1VYI A;  2A6E F;  3K33 A;  3ZVR A;  5BQH A;  1RKE B;  3M15 A;  1MMD A;  3FMS A;  3I5Q A;  3LEO A;  3M4B A;  4QI2 A;  4YT8 A;  4C7O B;  2H7O A;  3BEH A;  1LIH A;  3FOO A;  3EFO A;  2EPN A;  3NMI A;  1Z3I X;  4U5H A;  4EBK A;  5AC4 A;  1WTY A;  2QE9 A;  2XM0 A;  1QSP A;  3HNJ A;  2HFI A;  4FES A;  5T3W A;  1YAR O;  4G7H F;  3ITF A;  1MNE A;  2P0N A;  2NPU A;  3GEI A;  1QZX A;  3E9V A;  3GOD A;  2HJ3 A;  4AL0 A;  3MX3 A;  2B0H A;  1NFN A;  1VB5 A;  2ETS A;  3B0V C;  3ABL C;  3AQB A;  3QMK A;  1OR2 A;  1EQ1 A;  2P61 A;  4YN0 B;  4CDA A;  4CIP A;  2HMQ A;  1DOW A;  3I4U A;  5CIV A;  1SMY F;  1IW7 F;  2NUT B;  4LDR A;  1HE1 A;  2R03 A;  2RSE B;  3HJC A;  3B29 A;  3NYM A;  4W8K A;  3SXY A;  1BZ4 A;  1Z5Z A;  3SZR A;  1UG7 A;  5EK0 A;  4MVO A;  3TD7 A;  2D5R B;  2I8B A;  2Y3D A;  3Q7G A;  4NTA A;  4XQ1 A;  3R7C A;  3EPV A;  3NMJ A;  1ZHY A;  2Q9B A;  5L0F A;  4IWB A;  2CDQ A;  1GM5 A;  1YDI A;  1L7C A;  2ZXP A;  3KH2 A;  4OD4 A;  2XL6 A;  4EBJ A;  1Q0M A;  2G3V A;  2PBE A;  4LER A;  3TOL A;  1AVO B;  4CBE A;  3S0X A;  2H8A A;  3B0P A;  1YA7 O;  2V26 A;  3F47 A;  5L0G A;  3WHN A;  2Q00 A;  1RKC A;  3JSZ A;  4O7G A;  3C8G A;  3NYJ A;  4R32 A;  4RBN A;  1YZA A;  4KNW A;  2QLA A;  3TJ6 A;  3UR3 C;  2PX3 A;  3B0U X;  2VCA A;  2EIJ C;  3I5P A;  2XS1 A;  2YLG A;  4PFO A;  2X51 A;  3ASO C;  3FHD A;  4A2N B;  4XLP F;  1LS4 A;  1C02 A;  3FOP A;  4JEB A;  2R7X A;  2J8W A;  3NYL A;  4I1O B;  4JTC B;  4NC3 A;  2H7V C;  4X0R A;  2Q3T A;  2LD6 A;  4MW3 A;  3POV A;  3K7D A;  3JYH A;  2J7P D;  1HW2 A;  4N06 A;  3RQF A;  3SNH A;  1VLS A;  1VTM P;  3RIP A;  4CIH A;  4BEJ A;  3RKO F;  1T6I A;  2G3K A;  2OCC C;  3UMI A;  2WL8 A;  1E2X A;  3Q6N A;  3W8I A;  2J9V A;  4J32 B;  1H9T A;  2UUI A;  2LQG A;  1MMG A;  2NUP B;  1MMN A;  2L6H A;  3DM5 A;  1U0B B;  5KYX A;  3EG9 B;  4KNV A;  3UMK A;  2LIG A;  1XWJ A;  4CDY A;  2C04 A;  2XM4 A;  3T6J A;  3EJN A;  2WVO A;  1DOV A;  1OCC C;  2R7O A;  4JEA A;  4FAP B;  1FTS A;  3BRJ A;  3IEE A;  3O39 A;  4MVZ A;  1RJ9 B;  4OD5 A;  3KYI A;  2XLE A;  3AGU A;  3OA1 A;  4N6C A;  3UGO A;  5TJ5 E;  2CGE A;  2OEV A;  1A7V A;  1Z6A A;  2HSQ A;  2BC5 A;  4LAC B;  2CYD A;  2GAQ A;  2YL7 A;  5KYY B;  4BJ6 A;  2IXO A;  3K66 A;  1GGQ A;  1FR0 A;  3S28 A;  4BJ5 A;  4YT5 A;  1M2V A;  3V7O A;  3MYF A;  4ONS A;  1JR8 A;  4IAR A;  4NY3 A;  3HNI A;  4W8P A;  2NSG A;  3RFY A;  4DRH B;  3JZ0 A;  1E83 A;  1JPN A;  1WGW A;  4CJO A;  3PMR A;  1HMD A;  5F5H A;  1VYK A;  2XS8 A;  1LPE A;  3U9J A;  3LS1 A;  3V5Z A;  5L0J A;  3T9O A;  1Y6D A;  1I4Y A;  4IAQ A;  4AK9 A;  3NKD A;  5BQG A;  1JPJ A;  1AUE A;  2M64 A;  2W9Y A;  2IOQ A;  4B6I A;  4A4A A;  4BPM A;  5DS6 A;  3TUL A;  1T6U A;  2XSE A;  4XEV A;  2J9U A;  1ORS C;  2DB4 A;  3H2U A;  3AQC A;  1VOM A;  1V54 C;  3SXK A;  4XLN F;  1MMA A;  1ZVZ A;  2YWA A;  4DBR A;  5L0C A;  2HJM A;  4ULW A;  3RVY A;  4JCH A;  5COG A;  4AL1 A;  4P9T A;  3QW1 A;  3VM6 A;  1BBH A;  4DRI B;  4YL1 A;  3DXJ F;  5D92 A;  1PD1 A;  4DVY P;  2R7S A;  3JCU Q;  2IXP A;  2JX0 A;  2BL2 A;  3JTL O;  2XXA B;  3U2L A;  3X1O A;  2KSF A;  2Q9C A;  2YL3 A;  1TFO B;  2MYS A;  5COM A;  4PAC A;  5KYW A;  3F46 A;  4GYT A;  3M79 A;  4G0H A;  3CAX A;  2CCY A;  4K7B A;  3U3B A;  4G7Z F;  3RF3 A;  4ER9 A;  4E7S A;  2KNH A;  4K0D A;  2OQM A;  4MVR A;  4D4X A;  2A0B A;  2HV7 A;  1QQ3 A;  2VC9 A;  3NG1 A;  4WAB A;  4XEK A;  5GPG B;  1JMW A;  3ZWI A;  2PX0 A;  1LS1 A;  2QTV A;  3L0I A;  2YRF A;  3LNR A;  2EPM X;  2IYL D;  5D91 A;  1APC A;  4O6M A;  3QVY A;  3QTH A;  5T3T A;  4MTF A;  5E3C A;  2ZPA A;  3EGX B;  3IHU A;  4JJF A;  4CS9 C;  4CS8 C;  4E18 A;  4Q4Z F;  1JRA A;  2F22 A;  3Q7L A;  3GOR A;  4XPW A;  2CW0 F;  1D0X A;  2G62 A;  4DRJ B;  3U3F A;  3FAJ A;  2A6H F;  2I15 A;  2JPU A;  2ZXR A;  3KYJ A;  4Z9H A;  1RCP A;  3M4C A;  2Z15 A;  2IM8 A;  2L6F A;  1O3U A;  2DGJ A;  1OKK D;  2Q9A A;  4WGZ A;  3RVZ A;  1EA8 A;  4NCQ A;  2P1A A;  3ZTZ A;  1OXK A;  1QLE C;  1N1C A;  3LLK A;  1ORJ A;  2OKU A;  3S9O A;  4ANJ A;  1G4U S;  2FFH A;  3H65 A;  2YLD A;  2CNW D;  1D1B A;  2R25 A;  1YLM A;  3B71 A;  3G4Z A;  2P6V A;  2IXM A;  4U5F E;  1J8Y F;  2HKV A;  3KL4 A;  3A9C A;  3DZA A;  1VMA A;  4F4B A;  4KC9 A;  1BR2 A;  2R02 A;  4JIO A;  4DVZ A;  3AJM A;  1SZI A;  3JT1 A;  3S90 A;  2LFF A;  4MTO A;  3SXZ A;  2J7P A;  2NG1 A;  1KU2 A;  2HMZ A;  2C03 A;  4J7Y A;  4DXW A;  4DBQ A;  5L0I A;  1K40 A;  2XL8 A;  4U9D A;  2OEX A;  4EBB A;  1CGN A;  2XLO A;  3LES A;  2XLV A;  2YZS A;  3ZTM A;  3PHF 2; 
#chains in the Genus database with same CATH homology
 3EH2 A;  1MND A;  2WZL A;  3RH3 A;  3DAG A;  4XWJ A;  1ZU5 A;  3EFO B;  3EH1 A;  4U5C E;  2FGY A;  2PF4 E;  4CS9 A;  4CS8 A;  3X2Q C;  1Z63 A;  1M2O A;  3DAF A;  5B3S C;  3UGP A;  1FMV A;  1ZHW A;  4BJ6 C;  4J30 B;  1IZM A;  2J9W A;  4BJ5 C;  3EG9 A;  1D0Y A;  1NG1 A;  3NKE A;  4WJ0 A;  5L3Q A;  1G8X A;  3VYW A;  1BR4 A;  4Q7C A;  4EWC A;  2QY9 A;  3HLZ A;  3RYL A;  1RJ9 A;  2J0X A;  5T1D B;  5CI9 A;  3SEO A;  1M57 C;  5KYY A;  4C3D A;  1PD0 A;  4E7Z A;  2M4E A;  4ZLC A;  2A1D D;  1FMW A;  2PFD A;  3K1H A;  4PK4 A;  4YJW A;  1ZHT A;  3UNG C;  4U5G A;  1O5H A;  4FWV A;  4O6N A;  2WZG A;  3EZH A;  2W4B A;  3T4R A;  2HV6 A;  4G7O F;  3LAY A;  4OIN F;  4M63 A;  2KGO A;  3O6X A;  4U5B E;  4MND A;  5E33 A;  4QI0 A;  3EGD B;  2WVQ A;  1FFH A;  1OCO C;  2J45 A;  4DOZ A;  2L81 A;  3AG4 C;  3ZG1 A;  2MWQ A;  4AE4 B;  5E3A A;  2W4M A;  3WOD F;  5DQZ A;  4BJT A;  2L9J A;  4EBB A;  1BR1 A;  4BG0 A;  3UMH A;  1D1A A;  2DYR C;  3DD7 A;  4U5E E;  3W2V A;  3EQL F;  5KYX B;  3K6B A;  5F5F A;  4JJG A;  1ZHZ A;  4HE8 D;  3LEV A;  4IAO A;  4MQ9 F;  4JVS A;  4BJ1 A;  3FDQ A;  4C7O A;  1ZYR F;  3EHN A;  1W2W A;  3EGX A;  2Y3H A;  1OCZ C;  1OKK A;  3S28 A;  1TWC A;  2LSE A;  1M2V B;  4JW1 A;  2WVN A;  4KBL A;  4AX2 A;  4YT2 A;  5EHH A;  2CNW A;  2VB6 A;  1FFT C;  5B1A C;  1D1C A;  3ECS A;  4O6Y A;  3CZ6 A;  3Q6M A;  3AG2 C;  2WB7 A;  2DYS C;  4GEH A;  2NUT A;  2IXN A;  2J0W A;  3EHM A;  1S7Z A;  1NU9 C;  3LLI A;  3T6B A;  2R7U A;  1TWA A;  2B0J A;  2OG2 A;  3FVY A;  5KYU B;  5DS5 A;  3EZI A;  4PFP A;  3B9Q A;  1SF8 A;  3MLG A;  1ST6 A;  2R7R A;  4IRU A;  3DJN B;  1TKN A;  3KKB A;  5B1B C;  4OIO F;  5KYW B;  3W8H A;  2R7T A;  3ABK C;  2J46 A;  4LLE A;  3W2W A;  2XL4 A;  5IY5 C;  3QZC A;  4JZA A;  2WZF A;  4XTK A;  1TWH A;  4OIR F;  1ZU4 A;  4C3B A;  2A68 F;  2VH3 A;  5EGY A;  5KYN A;  4CS7 A;  5HSW A;  3JRT A;  3WG7 C;  2Y69 C;  2ZXW C;  2NUP A;  2A69 F;  3N24 A;  3LS0 A;  5DVW A;  5DLJ A;  4O79 A;  2Y3G A;  4I1M A;  5DQT A;  1D0Z A;  1Z23 A;  4HFK B;  3S27 A;  2YHS A;  4CSA C;  2R7W A;  4OIP F;  1LKX A;  3VAY A;  2R7Q A;  3ABM C;  2GFH A;  2EIN C;  1O87 A;  3EGD A;  2W45 A;  1OCR C;  1TR2 A;  1M56 C;  4YT4 A;  2XRH A;  4RD9 A;  4AE4 A;  3KMI A;  3LJB A;  3SYN A;  1ZHX A;  2BE5 F;  3S29 A;  4QDL A;  2R7V A;  4HEA J;  2O9X A;  2VAS A;  3DJU B;  5L3V A;  2V3C C;  2KW3 C;  2EIK C;  5DS4 A;  4PJM A;  3M1C B;  2JD3 A;  4I3M A;  4Q5S F;  1VK5 A;  3AG1 C;  3L34 A;  5CI8 A;  2XXA A;  2E87 A;  3CQZ A;  4OIQ F;  2YEV A;  4CSA A;  4PJL A;  4HFF B;  3SP1 A;  4RDA A;  3OEO A;  1V55 C;  3HTK C;  3N2Z B;  5BUO A;  3N0T A;  4YWQ A;  3ASN C;  4IJJ A;  2KQ9 A;  4U5D E;  4KI2 A;  5FCL A;  4P6I C;  4C3E A;  4H4K C;  5E2Q A;  2P7V A;  4JUR I;  3ZIB A;  2KJG A;  1PCX A;  4ZLD A;  1LVK A;  4LLC A;  4PJJ A;  3ZSU A;  2H7B A;  3AG3 C;  2EIM C;  5KYU A;  3NRH A;  2EIL C;  1TWG A;  4I44 A;  4FX5 A;  3CSK A;  2Y39 A;  3DMD A;  2ZXO A;  4PJN A;  3OWT A;  1NU7 D;  2PP4 A;  3NDB B;  3GAN A;  3E70 C;  3DM9 B;  1J8M F;  3K1I C;  2Y3B A;  3ZC4 A;  1NZE A;  1VYI A;  2A6E F;  3K33 A;  3ZVR A;  1MMD A;  3I5Q A;  4QI2 A;  4YT8 A;  4C7O B;  2H7O A;  3EFO A;  1Z3I X;  4U5H A;  5T3W A;  4FES A;  4G7H F;  3ITF A;  1MNE A;  1QZX A;  3E9V A;  3GOD A;  3MX3 A;  3B0V C;  3ABL C;  3AQB A;  3QMK A;  4YN0 B;  3I4U A;  1SMY F;  1IW7 F;  2NUT B;  3UMI A;  3HJC A;  3NYM A;  4W8K A;  1Z5Z A;  3SZR A;  3TD7 A;  2D5R B;  2I8B A;  2Y3D A;  3Q7G A;  3EPV A;  1ZHY A;  2Q9B A;  4IWB A;  2CDQ A;  3KH2 A;  2ZXP A;  4OD4 A;  2G3V A;  4LER A;  3S0X A;  4CBE A;  3B0P A;  3F47 A;  2V26 A;  3JSZ A;  4O7G A;  3NYJ A;  4RBN A;  3UR3 C;  4KNW A;  3B0U X;  2PX3 A;  2EIJ C;  3I5P A;  4PFO A;  2X51 A;  3ASO C;  3FHD A;  4A2N B;  4XLP F;  2R7X A;  3NYL A;  4I1O B;  2H7V C;  4X0R A;  2Q3T A;  3POV A;  3K7D A;  3JYH A;  2J7P D;  4N06 A;  3SNH A;  3RIP A;  4CIH A;  4BEJ A;  3RKO F;  2G3K A;  2OCC C;  2WL8 A;  3Q6N A;  3W8I A;  2J9V A;  4J32 B;  3DM5 A;  1MMG A;  2NUP B;  1MMN A;  5KYX A;  3EG9 B;  4KNV A;  3UMK A;  2C04 A;  3T6J A;  3EJN A;  2WVO A;  1OCC C;  2R7O A;  1FTS A;  3IEE A;  3O39 A;  1RJ9 B;  4OD5 A;  3OA1 A;  3UGO A;  2CGE A;  1Z6A A;  5KYY B;  4LAC B;  4BJ6 A;  2IXO A;  3K66 A;  4BJ5 A;  4YT5 A;  1M2V A;  3V7O A;  4NY3 A;  3RFY A;  1JPN A;  1WGW A;  3PMR A;  5F5H A;  1VYK A;  3LS1 A;  4AK9 A;  3NKD A;  1JPJ A;  2W9Y A;  4B6I A;  2IOQ A;  5DS6 A;  2XSE A;  2J9U A;  3AQC A;  1VOM A;  1V54 C;  4XLN F;  1MMA A;  4DBR A;  4ULW A;  4JCH A;  3DXJ F;  5D92 A;  1PD1 A;  4DVY P;  2R7S A;  3JCU Q;  2IXP A;  2XXA B;  3X1O A;  2Q9C A;  2MYS A;  5KYW A;  3F46 A;  4GYT A;  4G0H A;  4K7B A;  4G7Z F;  4E7S A;  2KNH A;  4K0D A;  2HV7 A;  3NG1 A;  2PX0 A;  1LS1 A;  2QTV A;  3L0I A;  3LNR A;  2IYL D;  5D91 A;  4O6M A;  5T3T A;  5E3C A;  2ZPA A;  3EGX B;  4CS9 C;  4JJF A;  4CS8 C;  4Q4Z F;  3Q7L A;  2CW0 F;  1D0X A;  2G62 A;  3FAJ A;  2A6H F;  2ZXR A;  2Z15 A;  2DGJ A;  1OKK D;  2Q9A A;  1QLE C;  1N1C A;  3LLK A;  4ANJ A;  2FFH A;  3H65 A;  2CNW D;  1D1B A;  2P6V A;  2IXM A;  4U5F E;  1J8Y F;  3KL4 A;  3DZA A;  1VMA A;  4F4B A;  4KC9 A;  1BR2 A;  4DVZ A;  1SZI A;  3JT1 A;  2J7P A;  2NG1 A;  1KU2 A;  2C03 A;  4DBQ A;  3LES A;  2YZS A;  3PHF 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...