4U5CE

Crystal structure of glua2, con-ikot-ikot snail toxin, partial agonist fw and postitive modulator (r,r)-2b complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
85
structure length
85
Chain Sequence
GPADCCRMKECCTDRVNECLQRYSGREDKFVSFCYQEATVTCGSFNEIVGCCYGYQMCMIRVVKPNSLSGAHEACKTVSCGNPCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structures of AMPA receptor-cone snail toxin complexes illuminate activation mechanism.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein/toxin
molecule keywords Glutamate receptor 2
total genus 28
structure length 85
sequence length 85
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1800 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4u5cE00
4U5DE 4U5CE 4U5FE 4U5HA 4U5BE 4U5EE 4U5GA
chains in the Genus database with same CATH superfamily
2HV6A 4G78A 3BRJA 4YT4A 1BDJB 3ATPA 3ZWIA 5DLJA 4BEJA 1LE2A 1VOMA 1EQ1A 2QNLA 1MNEA 2R7SA 1AEPA 3EQLF 1LS1A 4XPWA 1YARO 2QY9A 4ULWA 4JZAA 1ZU5A 4J7YA 3M79A 1VK5A 1Z3IX 5KYUA 2PFDA 3IQCA 3EH2A 1PV3A 2Q9BA 1H7IA 2XL6A 3NMKA 3PCVA 3ZIBA 4MVZA 3GEEA 3VAYA 3OEOA 3HLZA 3MFNA 2I15A 2XXAB 1K04A 4IAOA 4O6YA 1KNYA 2XLVA 1O87A 3JRMO 4CDYA 5KYWB 4MTFA 3HJCA 1TFKB 2L81A 1I5NA 1NBBA 1FFTC 1OCOC 3EJNA 4DJ9A 4EKWA 4JTCB 4L6RA 3GEHA 3W2VA 4GYTA 2IXNA 2NUTA 4D4NA 3B29A 4EWCA 5B3SC 3DXJF 3LNRA 4JC7A 3U3FA 3EZHA 4QDLA 3AG1C 1Z63A 3N0TA 4N6HA 2OKUA 2MWQA 1VLSA 4E18A 2LIGA 2D5RB 4DRIB 2NUPA 2GWWA 1BR2A 2OCCC 3LS0A 1OW8A 4HEAJ 3SXKA 1R5ID 1ZW2A 3CSKA 4NY3A 3C8ZA 5EHHA 2IBFA 4JTDB 4WGZA 3MX3A 3CAXA 2H7VC 4U5DE 4PFOA 1FMWA 1WASA 1SR2A 2IYLD 3JCUQ 2HKVA 4LERA 4C7OA 1EI7A 1YDIA 3E70C 3CZ6A 3K6BA 5DS4A 4AL0A 3RFYA 1MMAA 1OW7A 2F22A 4RDAA 4EHPA 2Q7RA 1NU9C 1M2OA 1T6QA 1CGME 1L7CA 4C3EA 3PMRA 3SXZA 3FAPB 1S7ZA 4OD4A 5K0IA 3L34A 3EFOA 4KNWA 1FNTc 1T6IA 4ONSA 3I5PA 1N1CA 3L1MA 3LLKA 3TQOA 1A0BA 1TWCA 2CNWD 3H65A 3ZC4A 4UDVA 5D91A 2YKZA 1ORYA 1PCXA 4MVOA 5TJ5E 3FHDA 1A41A 3SYNA 2V26A 3CQZA 2KQ9A 4O7GA 2ASRA 4Q4ZF 5AGFA 2RSEB 2ZXWC 1H9TA 1TWAA 3B9QA 4XEVA 1HE1A 4CS9A 3LJBA 4JJGA 2Y3HA 4G0HA 5KYUB 3QZCA 3EGXA 1YYJA 4JKVA 3SP1A 3IEEA 3ZVRA 3VRCA 3UNGC 2IOQA 3A9CA 1OW6A 1JPJA 1RKEB 2KC3A 3A11A 3U9MA 2V3CC 2Y3DA 3ASOC 1OCCC 1G4WR 4WGYA 2C04A 3B0PA 5BQHA 2ICWG 1QVXA 2J0WA 3W4YA 5JVEA 3ASNC 3IPMO 1HMOA 3ECSA 5L0JA 4XEKA 3GEIA 1A7DA 4CIHA 4OINF 3KPHA 2ETSA 3ZTZA 1V4AA 4XWJA 3S28A 4IARA 4HFFB 1FTSA 4XQ1A 4G7HF 2D4UA 2Y69C 3RVZA 2PX3A 5KYNA 1D0YA 3WODF 1RJ9A 1LE4A 1PD0A 3HNLA 3U9JA 3TULA 2NUTB 4KNVA 4YWQA 1H9GA 3NDBB 4JIOA 4WABA 1C03A 2AP3A 4HE8D 3R7CA 4PACA 4P9FA 3JSZA 3W8IA 4I44A 2KW3C 5A6BD 3WHNA 2KSFA 2WZGA 3AQBA 3K1HA 4BJ1A 1HW2A 3DMDA 1U0BB 5L0GA 4CS7A 2HZ8A 2IM8A 2X0CA 4ZLCA 1YA7O 5F5FA 2WVQA 1QQ3A 1G4US 2X51A 1WTYA 5JP7A 1VMAA 5JLIA 3UMHA 2ZXRA 3K1IA 1M56C 1Z23A 4MVRA 1TWHA 3NYLA 2JPUA 1HY5A 2OU6A 3NRHA 3ZQVA 5A6JA 4K7BA 5T3TA 1KTMA 4DRJB 3LUTB 5L0IA 4YK5A 2UUHA 2XRHA 2P1AA 3EG9A 4J7TA 1CGOA 4I1MA 1NSGB 1QLEC 2B0HA 2OOCA 3KYJA 4AL1A 1LIHA 2P0NA 4ULVA 2W45A 3HNIA 1TQGA 4JEBA 4JCZA 4CS9C 5L0FA 3E9VA 3ABLC 3FVYA 2M64A 5CI9A 1T5OA 5E3CA 3V5YA 3WAQA 4AX2A 3FOOA 4JTAB 3M1CB 1J8MF 2R9RB 1APCA 2KGOA 3EHMA 2L6GA 4FESA 3K7DA 2Q4FA 5BQIA 2QE9A 2YRFA 3O6XA 4JRZA 2WL8A 3W8HA 3WG7C 3DAGA 3LLIA 3QVYA 5COMA 1YLMA 2HJ3A 3EGXB 4DBQA 3S27A 2C03A 3T4RA 1GGQA 1JMWA 3M15A 4D4XA 3R2PA 3T6JA 5L0CA 2XL8A 1D1BA 1E84A 5HSWA 3T6BA 4XEFA 2XM4A 1OCZC 4X0RA 1JOGA 1F1MA 2VCAA 2DI3A 4MW3A 4B6IA 4CJGA 3MLGA 3RYLA 3GWNA 3HNKA 4WJ0A 1B68A 2YLGA 4Z9JA 3H2VA 2CNWA 2JD3A 3V5ZA 4DVZA 1G8XA 4XLPF 4NC3A 5FZTA 1QPUA 2VC9A 4I3MA 5A69A 4JVSA 3FAJA 1EKYA 3RH3A 4CJOA 2TMVP 1GS9A 2YZSA 3ZG1A 1Z5ZA 3JYHA 2G3KA 2R7OA 2XM0A 4U5CE 4NTBA 5L0HA 3L8IA 3VF0A 3V5XA 3US6A 2HMQA 4LDRA 1XZPA 2NSGA 3EPVA 3VM6A 2OEVA 4ZLDA 3B71A 3AJMA 5JS5A 2Q3TA 1XZQA 1YAUO 1NFOA 4P9TA 5JSLA 3AG4C 4N4WA 3S0XA 2QTVA 3RQFA 3TJ5A 3ABKC 1WWPA 1KU2A 3FOPA 4U9DA 4BJTA 2GA0A 3S84A 2HJMA 1OKKA 2KK1A 3O10A 5COFA 3ZTMA 4N6CA 3Q6NA 1E83A 5JUAA 1LI5A 2UUIA 1T6UA 3KH2A 2LD6A 4DXWA 4DBRA 1VTMP 2W4MA 2CYDA 4PK4A 2JX0A 4RBNA 3F47A 4AK9A 3RQGA 1LI7A 2NSFA 2XLHA 3QVZA 4MTOA 5B3IA 3H2UA 2R7RA 1TWGA 3JZ0A 1E85A 4G7OF 3Q7GA 2PF4E 1LM3B 2MHRA 2GFHA 4FWVA 1TFOB 4EUKB 5DS6A 4GEHA 4BPMA 4LDKA 4LDQA 3Q6MA 1EA8A 1YVIA 1VB5A 2PX0A 3RQEA 5L3QA 2HSBA 4C3BA 1IW7F 5COGA 4YL1A 4JJFA 2CW0F 3V7OA 4BJ6A 2Z15A 3JTLO 2FFHA 4IAQA 3U0CA 3GM1A 2FAPB 4YT8A 2L6FA 1M2VB 5A6AA 2QLAA 2H7OA 2PBEA 2HMZA 1G5ZA 2WB7A 3EG9B 4PR9A 4U5EE 4BJ5C 2L9JA 4YT2A 4MW8A 2IXMA 2H8AA 3EFOB 4P6IC 5D92A 1V55C 4C3DA 2PP4A 2ZXOA 1FMVA 1BR1A 3M4CA 3QW0A 5L3VA 1UG7A 3S9OA 2R7WA 4K1OA 4XTKA 2R7VA 1A7EA 5FCLA 1ZZPA 4OIRF 1ORSC 3DE8A 1WOLA 3M4BA 4IRUA 4MNDA 4FAPB 3SZRA 2IXPA 3GM3A 1D1CA 5HV9A 4Z9IA 3NYJA 3N2ZB 3DM9B 1SZIA 3LESA 5AC5A 3S29A 2YHSA 5CIVA 1OQCA 2WZLA 2J9BA 2KNHA 4IJJA 2G3VA 4EBBA 3KL4A 2WVNA 2NPUA 3T9OA 3ZQYA 1OKKD 2KJGA 2KYHA 1ZHZA 2HFIA 4MQ9F 2Q9AA 5E2QA 1Y6DA 5F28E 3O39A 5AC4A 1HE9A 5A6KA 3NKDA 4YJWA 4GQHA 5CI8A 1YYXA 3G50A 1J8YF 4QI0A 4QI2A 2R02A 2Q9CA 3AGUA 5DVWA 1QKRA 2HS5A 3PDMP 4IGGA 5T1DB 2XXAA 3DWWA 3GODA 2Y3BA 4J32B 2PNOA 2YL7A 3HNJA 1I4YA 3QTHA 2AWCA 5EK0A 2XL4A 1ORJA 2VB6A 3B0VC 1UFBA 3SEOA 1V54C 4YL3A 2P61A 4MVMA 3U8VA 3DI5A 5IY5C 2L7AA 4LLEA 3VYWA 2XLEA 4XPXA 3C7JA 3OA1A 4CDVA 3IQ6A 2DYSC 1QZXA 2ZPAA 3JSEO 2YL0A 1CPQA 1M6TA 1Q0MA 3LEOA 2HUJA 1OXBA 1MMDA 4O6MA 4JW1A 1T9KA 3Q7LA 4J30B 3GORA 5DQTA 4NTFA 1ST6A 5KYWA 4CS8A 4U5BE 5KYYB 3N24A 2NG1A 3F46A 5DS5A 3UMIA 2R7TA 3JT1A 1U89A 1RMVA 1Q0KA 2XLWA 2ZD9A 3PHF2 2EINC 2LK4A 3FDQA 1ZHTA 3C8GA 1Q0DA 3K33A 3UMKA 4ANJA 1VYIA 4JEAA 4Z9HA 1CGNA 2EPKX 1JAFA 3EH1A 2AWYA 2A6EF 2J7PD 2W4BA 3NG1A 4FX5A 4U9EA 4W8PA 3RKOF 5A6BA 3IHUA 3JYYA 4XLNF 1MMGA 4KI2A 2YQYA 3SXMA 2WVOA 4I1OB 4IB4A 1BZ4A 1U6HA 1ZW3A 2A68F 2VH3A 1RKEA 2MYSA 2YL3A 2YLDA 1DOVA 4A2NB 3SXYA 3J06A 3O55A 1QSPA 3DAFA 1SMYF 3G4XA 2J7PA 2J9VA 1Y4CA 1GQAA 1RXQA 5T3WA 3RF3A 2A6HF 3DD7A 3T6GB 2EIKC 3LNMB 2LFFA 3L0IA 2DYRC 2R7QA 3TOLA 4F4BA 1R4TA 4JCHA 2EILC 5L0DA 4Q5SF 3K66A 4W8KA 3DZAA 4RD9A 3U2LA 1FR0A 4DVYP 3S90A 2A0BA 1WATA 3LEVA 2FGYA 2BE5F 1JRAA 1YZAA 3DM5A 1LKXA 3TK0A 2LQGA 2R25A 3MYIA 1LPEA 2EIJC 2CCYA 4KC9A 3RVYA 2XS1A 4IWBA 3AG2C 4KBLA 1H6GA 1L3PA 2BC5A 3UR3C 4CBEA 1VLTA 2P7VA 2ZXPA 3AG3C 1PD1A 4LACB 4LLCA 3AOUA 2AVKA 3MBGA 4MTGA 4R32A 2VASA 1LS4A 1MNDA 2XLDA 1OR3A 4DOZA 2GAQA 5EGYA 2J9UA 4CSAC 5B1AC 4PJMA 3C18A 4K0DA 3QMKA 4PJLA 1D0XA 1D0ZA 2XLMA 2P6VA 3MYFA 3SNHA 4EIYA 2CGEA 2A0UA 2GDCA 1E86A 3B0UX 2WZFA 4CIPA 2R05A 2R7XA 4E0IA 3CEXA 3KYIA 4N06A 1FFHA 2L6HA 2J9WA 1V74B 5JT4A 3C62A 2OJED 2J0XA 1HW1A 1ZHYA 3I5QA 1D1AA 2YEVA 1M57C 1NZEA 1Q0GA 2LFDA 3DJNB 4E7SA 4OD5A 2XSEA 4ER9A 4OIPF 3X1OA 3RW0A 4H54A 4CSAA 1SF8A 2M4EA 2J45A 4OIOF 3BEHA 4MVQA 1RKCA 2DGJA 1YA9A 2Y3GA 2BL2A 2I8BA 3TOMA 3U2MA 3U5SA 1HMDA 5E3AA 3IQ5A 1AVOB 3KKBA 4YN0B 3C8GB 4U5HA 1ZVZA 5KYXA 3UGPA 2O9XA 1NFNA 3ZDLA 1XWJA 4G7ZF 1A7VA 3DJUB 5F5HA 2IXOA 3KMIA 4BEMJ 2AU5A 3NKEA 4NCQA 2HSQA 2YVKA 5E33A 1MMNA 3AQCA 4DRHB 2LP4A 1M2VA 3ZSUA 4H4KC 4U5FE 2EPLX 3C63A 1ZHWA 3ITFA 4NTAA 2YWAA 4BJ5A 4PJNA 4A4AA 3DE9A 2HV7A 1ZU4A 4MVUA 5BQGA 1YJGA 2EPNA 4O79A 3TJ6A 2R03A 2OJQA 1MQVA 4HFKB 3UGOA 1IZMA 1O5HA 1O3UA 2A69F 2VCCA 1W2WA 2Y39A 1BR4A 1TKNA 3C8GD 4BJ6C 2Q00A 3LS1A 1LVKA 5KYYA 4NQFA 3L8JA 4JURI 3I4UA 3OWTA 2OQMA 3EGDA 1K05A 4U5GA 3IQTA 1NU7D 3GWLA 3DKAA 4CDAA 1WN0A 2H7BA 3FXHA 3W2WA 4YL0A 3POVA 2XS8A 4Q7CA 5JRAA 1Q0FA 2J8WA 2LCHA 1FAPB 5B1BC 4E0HA 1WGWA 3GM2A 1JR8A 2NUPB 1S05A 1Z6AA 1VYKA 3HTKC 2A1DD 3NYMA 4CX9A 3ABMC 1C02A 3NMJA 2YL1A 2EPMX 1CPRA 1AUEA 3NMIA 3GANA 4C7OB 2CDQA 2DB4A 4OIQF 4E7ZA 3AGTA 2W9YA 1K40A 1YZCA 3K1IC 2EPOA 4AE4A 2QUPA 4AE4B 1NG1A 2VCBA 3FMSA 3QW1A 1BBHA 1T01A 4MVSA 1ZHXA 2EIMC 1C17M 1JPNA 4PFPA 1Z7Qc 4EBJA 5DQZA 2LSEA 4BG0A 4MS2A 2G62A 1OCRC 4PJJA 2OG2A 5BUOA 2XLOA 1GM5A 1RCPA 1OR2A 1SYQA 1E2XA 3RIPA 3X2QC 4CS8C 4JE9A 3U3BA 4E17A 2R7UA 1I4ZA 1NLXA 256BA 1TR2A 1RJ9B 4EBKA 2B0JA 2RD9A 3EGDB 3G4ZA 2YLIA 4XPYA 4YT5A 3TD7A 3EHNA 2OEXA 5GPGB 2J46A 4O6NA 3EZIA 3U8PA 5KYXB 3LAYA 1OXKA 4M63A 3HKKA 1DOWA 3JRTA 1ZYRF 2E87A
chains in the Genus database with same CATH topology
2HV6A 4YT4A 4BEJA 5DLJA 1VOMA 1MNEA 2R7SA 3EQLF 1LS1A 4ULWA 2QY9A 4JZAA 1ZU5A 1VK5A 1Z3IX 5KYUA 2PFDA 3EH2A 2Q9BA 3ZIBA 3VAYA 3OEOA 3HLZA 2XXAB 4IAOA 4O6YA 1O87A 5KYWB 3HJCA 2L81A 3EJNA 1OCOC 1FFTC 3W2VA 4GYTA 2IXNA 2NUTA 4EWCA 5B3SC 3DXJF 3LNRA 3EZHA 4QDLA 3AG1C 1Z63A 3N0TA 2MWQA 2D5RB 2NUPA 1BR2A 2OCCC 3LS0A 4HEAJ 3CSKA 4NY3A 5EHHA 3MX3A 4U5DE 2H7VC 4PFOA 1FMWA 3JCUQ 2IYLD 4LERA 4C7OA 3E70C 3CZ6A 3K6BA 5DS4A 3RFYA 1MMAA 4RDAA 1NU9C 1M2OA 4C3EA 3PMRA 1S7ZA 4OD4A 3L34A 3EFOA 4KNWA 3I5PA 1N1CA 3LLKA 1TWCA 2CNWD 3H65A 3ZC4A 5D91A 1PCXA 3FHDA 4Q4ZF 3SYNA 2V26A 3CQZA 2KQ9A 4O7GA 2ZXWC 1TWAA 3B9QA 4CS9A 3LJBA 4JJGA 2Y3HA 4G0HA 5KYUB 3EGXA 3SP1A 3ZVRA 3UNGC 2IOQA 2V3CC 1JPJA 2Y3DA 3ASOC 1OCCC 2C04A 3B0PA 2J0WA 3ASNC 3ECSA 4CIHA 4OINF 4XWJA 3S28A 4HFFB 1FTSA 4G7HF 2Y69C 2PX3A 5KYNA 1D0YA 3WODF 1RJ9A 1PD0A 2NUTB 4KNVA 4YWQA 3NDBB 4HE8D 3JSZA 3W8IA 4I44A 2KW3C 2WZGA 3AQBA 3K1HA 4BJ1A 3DMDA 4CS7A 4ZLCA 5F5FA 2WVQA 2X51A 1VMAA 3UMHA 2ZXRA 1M56C 1Z23A 1TWHA 3NYLA 3NRHA 4K7BA 5T3TA 2XRHA 3EG9A 4I1MA 1QLEC 2W45A 4CS9C 3E9VA 3ABLC 3FVYA 5E3CA 5CI9A 4AX2A 3M1CB 1J8MF 2KGOA 3EHMA 4FESA 3K7DA 3O6XA 3W8HA 2WL8A 3WG7C 3DAGA 3LLIA 3EGXB 4DBQA 3S27A 2C03A 3T4RA 3T6JA 5HSWA 1D1BA 3T6BA 1OCZC 4X0RA 4B6IA 3MLGA 3RYLA 4WJ0A 2CNWA 2JD3A 4DVZA 1G8XA 4XLPF 4I3MA 4JVSA 3FAJA 3RH3A 2YZSA 3ZG1A 1Z5ZA 3JYHA 2G3KA 2R7OA 4U5CE 3EPVA 4ZLDA 2Q3TA 3AG4C 3S0XA 2QTVA 3ABKC 1KU2A 4BJTA 1OKKA 3Q6NA 3KH2A 4DBRA 2W4MA 4PK4A 4RBNA 3F47A 4AK9A 2R7RA 1TWGA 4G7OF 3Q7GA 2PF4E 2GFHA 4FWVA 5DS6A 4GEHA 3Q6MA 2PX0A 5L3QA 4C3BA 1IW7F 4JJFA 2CW0F 3V7OA 4BJ6A 2Z15A 2FFHA 4YT8A 1M2VB 2WB7A 2H7OA 4U5EE 3EG9B 4BJ5C 4YT2A 2L9JA 2IXMA 3EFOB 4P6IC 5D92A 1V55C 4C3DA 2PP4A 2ZXOA 1FMVA 1BR1A 5L3VA 2R7WA 4XTKA 2R7VA 5FCLA 4OIRF 4IRUA 4MNDA 3SZRA 2IXPA 1D1CA 3NYJA 3N2ZB 3DM9B 1SZIA 3LESA 3S29A 2YHSA 2WZLA 2KNHA 4EBBA 4IJJA 2G3VA 3KL4A 2WVNA 1OKKD 2KJGA 1ZHZA 4MQ9F 2Q9AA 5E2QA 3O39A 3NKDA 4YJWA 5CI8A 1J8YF 4QI0A 4QI2A 5DVWA 2Q9CA 5T1DB 2XXAA 3GODA 2Y3BA 4J32B 2XL4A 2VB6A 3B0VC 3SEOA 1V54C 5IY5C 4LLEA 3VYWA 3OA1A 2DYSC 1QZXA 2ZPAA 4O6MA 1MMDA 4JW1A 3Q7LA 4J30B 5DQTA 1ST6A 5KYWA 4CS8A 4U5BE 5KYYB 3N24A 2NG1A 3F46A 5DS5A 3UMIA 2R7TA 3JT1A 3PHF2 2EINC 3FDQA 1ZHTA 3K33A 3UMKA 4ANJA 1VYIA 3EH1A 2A6EF 2J7PD 4FX5A 2W4BA 3NG1A 3RKOF 4XLNF 1MMGA 4KI2A 2WVOA 4I1OB 2VH3A 2A68F 2MYSA 4A2NB 2E87A 3DAFA 1SMYF 2J7PA 2J9VA 5T3WA 2A6HF 3DD7A 2EIKC 3L0IA 2DYRC 2R7QA 4F4BA 4Q5SF 4JCHA 2EILC 3K66A 4W8KA 3DZAA 4RD9A 4DVYP 3LEVA 2FGYA 2BE5F 1LKXA 4KC9A 2EIJC 4IWBA 3AG2C 4KBLA 3UR3C 4CBEA 2P7VA 2ZXPA 3AG3C 4LACB 1PD1A 4LLCA 2VASA 1MNDA 4DOZA 5EGYA 2J9UA 4CSAC 5B1AC 4PJMA 4K0DA 3QMKA 4PJLA 1D0XA 1D0ZA 2P6VA 3SNHA 2CGEA 3B0UX 2WZFA 2R7XA 4N06A 1FFHA 2J9WA 2J0XA 1ZHYA 3I5QA 1D1AA 2YEVA 1M57C 1NZEA 3DJNB 4E7SA 4OD5A 2XSEA 4OIPF 3X1OA 4CSAA 1SF8A 2M4EA 2J45A 4OIOF 2DGJA 2Y3GA 2I8BA 5E3AA 3KKBA 4YN0B 4U5HA 5KYXA 3UGPA 2O9XA 4G7ZF 3DJUB 5F5HA 2IXOA 3KMIA 3NKEA 5E33A 1MMNA 3AQCA 1M2VA 3ZSUA 4H4KC 4U5FE 1ZHWA 3ITFA 4BJ5A 4PJNA 2HV7A 1ZU4A 4O79A 4HFKB 3UGOA 1IZMA 1O5HA 2A69F 1W2WA 2Y39A 1BR4A 1TKNA 4BJ6C 3LS1A 1LVKA 5KYYA 4JURI 3I4UA 3OWTA 3EGDA 4U5GA 1NU7D 2H7BA 3W2WA 3POVA 4Q7CA 5B1BC 1WGWA 2NUPB 3NYMA 1Z6AA 1VYKA 2A1DD 3HTKC 3ABMC 3GANA 4C7OB 2CDQA 4OIQF 4E7ZA 4AE4A 2W9YA 3K1IC 4AE4B 1NG1A 1ZHXA 2EIMC 4PFPA 1JPNA 5DQZA 2LSEA 4BG0A 4PJJA 2G62A 1OCRC 2OG2A 5BUOA 3RIPA 3X2QC 4CS8C 2R7UA 1TR2A 1RJ9B 2B0JA 3EGDB 3TD7A 4YT5A 3EHNA 5KYXB 2J46A 4O6NA 3EZIA 3LAYA 4M63A 3QZCA 3IEEA 3JRTA 1ZYRF 3DM5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U5D E;  4U5C E;  4U5F E;  4U5H A;  4U5B E;  4U5E E;  4U5G A; 
#chains in the Genus database with same CATH topology
 2HV6 A;  4G78 A;  3BRJ A;  4YT4 A;  1BDJ B;  3ATP A;  3ZWI A;  5DLJ A;  4BEJ A;  1LE2 A;  1VOM A;  1EQ1 A;  2QNL A;  1MNE A;  2R7S A;  1AEP A;  3EQL F;  1LS1 A;  4XPW A;  1YAR O;  2QY9 A;  4ULW A;  4JZA A;  1ZU5 A;  4J7Y A;  3M79 A;  1VK5 A;  1Z3I X;  5KYU A;  2PFD A;  3IQC A;  3EH2 A;  1PV3 A;  2Q9B A;  1H7I A;  2XL6 A;  3NMK A;  3PCV A;  3ZIB A;  4MVZ A;  3GEE A;  3VAY A;  3OEO A;  3HLZ A;  3MFN A;  2I15 A;  2XXA B;  1K04 A;  4IAO A;  4O6Y A;  1KNY A;  2XLV A;  1O87 A;  3JRM O;  4CDY A;  5KYW B;  4MTF A;  3HJC A;  1TFK B;  2L81 A;  1I5N A;  1NBB A;  1FFT C;  1OCO C;  3EJN A;  4DJ9 A;  4EKW A;  4JTC B;  4L6R A;  3GEH A;  3W2V A;  4GYT A;  2IXN A;  2NUT A;  4D4N A;  3B29 A;  4EWC A;  5B3S C;  3DXJ F;  3LNR A;  4JC7 A;  3U3F A;  3EZH A;  4QDL A;  3AG1 C;  1Z63 A;  3N0T A;  4N6H A;  2OKU A;  2MWQ A;  1VLS A;  4E18 A;  2LIG A;  2D5R B;  4DRI B;  2NUP A;  2GWW A;  1BR2 A;  2OCC C;  3LS0 A;  1OW8 A;  4HEA J;  3SXK A;  1R5I D;  1ZW2 A;  3CSK A;  4NY3 A;  3C8Z A;  5EHH A;  2IBF A;  4JTD B;  4WGZ A;  3MX3 A;  3CAX A;  2H7V C;  4U5D E;  4PFO A;  1FMW A;  1WAS A;  1SR2 A;  2IYL D;  3JCU Q;  2HKV A;  4LER A;  4C7O A;  1EI7 A;  1YDI A;  3E70 C;  3CZ6 A;  3K6B A;  5DS4 A;  4AL0 A;  3RFY A;  1MMA A;  1OW7 A;  2F22 A;  4RDA A;  4EHP A;  2Q7R A;  1NU9 C;  1M2O A;  1T6Q A;  1CGM E;  1L7C A;  4C3E A;  3PMR A;  3SXZ A;  3FAP B;  1S7Z A;  4OD4 A;  5K0I A;  3L34 A;  3EFO A;  4KNW A;  1FNT c;  1T6I A;  4ONS A;  3I5P A;  1N1C A;  3L1M A;  3LLK A;  3TQO A;  1A0B A;  1TWC A;  2CNW D;  3H65 A;  3ZC4 A;  4UDV A;  5D91 A;  2YKZ A;  1ORY A;  1PCX A;  4MVO A;  5TJ5 E;  3FHD A;  1A41 A;  3SYN A;  2V26 A;  3CQZ A;  2KQ9 A;  4O7G A;  2ASR A;  4Q4Z F;  5AGF A;  2RSE B;  2ZXW C;  1H9T A;  1TWA A;  3B9Q A;  4XEV A;  1HE1 A;  4CS9 A;  3LJB A;  4JJG A;  2Y3H A;  4G0H A;  5KYU B;  3QZC A;  3EGX A;  1YYJ A;  4JKV A;  3SP1 A;  3IEE A;  3ZVR A;  3VRC A;  3UNG C;  2IOQ A;  3A9C A;  1OW6 A;  1JPJ A;  1RKE B;  2KC3 A;  3A11 A;  3U9M A;  2V3C C;  2Y3D A;  3ASO C;  1OCC C;  1G4W R;  4WGY A;  2C04 A;  3B0P A;  5BQH A;  2ICW G;  1QVX A;  2J0W A;  3W4Y A;  5JVE A;  3ASN C;  3IPM O;  1HMO A;  3ECS A;  5L0J A;  4XEK A;  3GEI A;  1A7D A;  4CIH A;  4OIN F;  3KPH A;  2ETS A;  3ZTZ A;  1V4A A;  4XWJ A;  3S28 A;  4IAR A;  4HFF B;  1FTS A;  4XQ1 A;  4G7H F;  2D4U A;  2Y69 C;  3RVZ A;  2PX3 A;  5KYN A;  1D0Y A;  3WOD F;  1RJ9 A;  1LE4 A;  1PD0 A;  3HNL A;  3U9J A;  3TUL A;  2NUT B;  4KNV A;  4YWQ A;  1H9G A;  3NDB B;  4JIO A;  4WAB A;  1C03 A;  2AP3 A;  4HE8 D;  3R7C A;  4PAC A;  4P9F A;  3JSZ A;  3W8I A;  4I44 A;  2KW3 C;  5A6B D;  3WHN A;  2KSF A;  2WZG A;  3AQB A;  3K1H A;  4BJ1 A;  1HW2 A;  3DMD A;  1U0B B;  5L0G A;  4CS7 A;  2HZ8 A;  2IM8 A;  2X0C A;  4ZLC A;  1YA7 O;  5F5F A;  2WVQ A;  1QQ3 A;  1G4U S;  2X51 A;  1WTY A;  5JP7 A;  1VMA A;  5JLI A;  3UMH A;  2ZXR A;  3K1I A;  1M56 C;  1Z23 A;  4MVR A;  1TWH A;  3NYL A;  2JPU A;  1HY5 A;  2OU6 A;  3NRH A;  3ZQV A;  5A6J A;  4K7B A;  5T3T A;  1KTM A;  4DRJ B;  3LUT B;  5L0I A;  4YK5 A;  2UUH A;  2XRH A;  2P1A A;  3EG9 A;  4J7T A;  1CGO A;  4I1M A;  1NSG B;  1QLE C;  2B0H A;  2OOC A;  3KYJ A;  4AL1 A;  1LIH A;  2P0N A;  4ULV A;  2W45 A;  3HNI A;  1TQG A;  4JEB A;  4JCZ A;  4CS9 C;  5L0F A;  3E9V A;  3ABL C;  3FVY A;  2M64 A;  5CI9 A;  1T5O A;  5E3C A;  3V5Y A;  3WAQ A;  4AX2 A;  3FOO A;  4JTA B;  3M1C B;  1J8M F;  2R9R B;  1APC A;  2KGO A;  3EHM A;  2L6G A;  4FES A;  3K7D A;  2Q4F A;  5BQI A;  2QE9 A;  2YRF A;  3O6X A;  4JRZ A;  2WL8 A;  3W8H A;  3WG7 C;  3DAG A;  3LLI A;  3QVY A;  5COM A;  1YLM A;  2HJ3 A;  3EGX B;  4DBQ A;  3S27 A;  2C03 A;  3T4R A;  1GGQ A;  1JMW A;  3M15 A;  4D4X A;  3R2P A;  3T6J A;  5L0C A;  2XL8 A;  1D1B A;  1E84 A;  5HSW A;  3T6B A;  4XEF A;  2XM4 A;  1OCZ C;  4X0R A;  1JOG A;  1F1M A;  2VCA A;  2DI3 A;  4MW3 A;  4B6I A;  4CJG A;  3MLG A;  3RYL A;  3GWN A;  3HNK A;  4WJ0 A;  1B68 A;  2YLG A;  4Z9J A;  3H2V A;  2CNW A;  2JD3 A;  3V5Z A;  4DVZ A;  1G8X A;  4XLP F;  4NC3 A;  5FZT A;  1QPU A;  2VC9 A;  4I3M A;  5A69 A;  4JVS A;  3FAJ A;  1EKY A;  3RH3 A;  4CJO A;  2TMV P;  1GS9 A;  2YZS A;  3ZG1 A;  1Z5Z A;  3JYH A;  2G3K A;  2R7O A;  2XM0 A;  4U5C E;  4NTB A;  5L0H A;  3L8I A;  3VF0 A;  3V5X A;  3US6 A;  2HMQ A;  4LDR A;  1XZP A;  2NSG A;  3EPV A;  3VM6 A;  2OEV A;  4ZLD A;  3B71 A;  3AJM A;  5JS5 A;  2Q3T A;  1XZQ A;  1YAU O;  1NFO A;  4P9T A;  5JSL A;  3AG4 C;  4N4W A;  3S0X A;  2QTV A;  3RQF A;  3TJ5 A;  3ABK C;  1WWP A;  1KU2 A;  3FOP A;  4U9D A;  4BJT A;  2GA0 A;  3S84 A;  2HJM A;  1OKK A;  2KK1 A;  3O10 A;  5COF A;  3ZTM A;  4N6C A;  3Q6N A;  1E83 A;  5JUA A;  1LI5 A;  2UUI A;  1T6U A;  3KH2 A;  2LD6 A;  4DXW A;  4DBR A;  1VTM P;  2W4M A;  2CYD A;  4PK4 A;  2JX0 A;  4RBN A;  3F47 A;  4AK9 A;  3RQG A;  1LI7 A;  2NSF A;  2XLH A;  3QVZ A;  4MTO A;  5B3I A;  3H2U A;  2R7R A;  1TWG A;  3JZ0 A;  1E85 A;  4G7O F;  3Q7G A;  2PF4 E;  1LM3 B;  2MHR A;  2GFH A;  4FWV A;  1TFO B;  4EUK B;  5DS6 A;  4GEH A;  4BPM A;  4LDK A;  4LDQ A;  3Q6M A;  1EA8 A;  1YVI A;  1VB5 A;  2PX0 A;  3RQE A;  5L3Q A;  2HSB A;  4C3B A;  1IW7 F;  5COG A;  4YL1 A;  4JJF A;  2CW0 F;  3V7O A;  4BJ6 A;  2Z15 A;  3JTL O;  2FFH A;  4IAQ A;  3U0C A;  3GM1 A;  2FAP B;  4YT8 A;  2L6F A;  1M2V B;  5A6A A;  2QLA A;  2H7O A;  2PBE A;  2HMZ A;  1G5Z A;  2WB7 A;  3EG9 B;  4PR9 A;  4U5E E;  4BJ5 C;  2L9J A;  4YT2 A;  4MW8 A;  2IXM A;  2H8A A;  3EFO B;  4P6I C;  5D92 A;  1V55 C;  4C3D A;  2PP4 A;  2ZXO A;  1FMV A;  1BR1 A;  3M4C A;  3QW0 A;  5L3V A;  1UG7 A;  3S9O A;  2R7W A;  4K1O A;  4XTK A;  2R7V A;  1A7E A;  5FCL A;  1ZZP A;  4OIR F;  1ORS C;  3DE8 A;  1WOL A;  3M4B A;  4IRU A;  4MND A;  4FAP B;  3SZR A;  2IXP A;  3GM3 A;  1D1C A;  5HV9 A;  4Z9I A;  3NYJ A;  3N2Z B;  3DM9 B;  1SZI A;  3LES A;  5AC5 A;  3S29 A;  2YHS A;  5CIV A;  1OQC A;  2WZL A;  2J9B A;  2KNH A;  4IJJ A;  2G3V A;  4EBB A;  3KL4 A;  2WVN A;  2NPU A;  3T9O A;  3ZQY A;  1OKK D;  2KJG A;  2KYH A;  1ZHZ A;  2HFI A;  4MQ9 F;  2Q9A A;  5E2Q A;  1Y6D A;  5F28 E;  3O39 A;  5AC4 A;  1HE9 A;  5A6K A;  3NKD A;  4YJW A;  4GQH A;  5CI8 A;  1YYX A;  3G50 A;  1J8Y F;  4QI0 A;  4QI2 A;  2R02 A;  2Q9C A;  3AGU A;  5DVW A;  1QKR A;  2HS5 A;  3PDM P;  4IGG A;  5T1D B;  2XXA A;  3DWW A;  3GOD A;  2Y3B A;  4J32 B;  2PNO A;  2YL7 A;  3HNJ A;  1I4Y A;  3QTH A;  2AWC A;  5EK0 A;  2XL4 A;  1ORJ A;  2VB6 A;  3B0V C;  1UFB A;  3SEO A;  1V54 C;  4YL3 A;  2P61 A;  4MVM A;  3U8V A;  3DI5 A;  5IY5 C;  2L7A A;  4LLE A;  3VYW A;  2XLE A;  4XPX A;  3C7J A;  3OA1 A;  4CDV A;  3IQ6 A;  2DYS C;  1QZX A;  2ZPA A;  3JSE O;  2YL0 A;  1CPQ A;  1M6T A;  1Q0M A;  3LEO A;  2HUJ A;  1OXB A;  1MMD A;  4O6M A;  4JW1 A;  1T9K A;  3Q7L A;  4J30 B;  3GOR A;  5DQT A;  4NTF A;  1ST6 A;  5KYW A;  4CS8 A;  4U5B E;  5KYY B;  3N24 A;  2NG1 A;  3F46 A;  5DS5 A;  3UMI A;  2R7T A;  3JT1 A;  1U89 A;  1RMV A;  1Q0K A;  2XLW A;  2ZD9 A;  3PHF 2;  2EIN C;  2LK4 A;  3FDQ A;  1ZHT A;  3C8G A;  1Q0D A;  3K33 A;  3UMK A;  4ANJ A;  1VYI A;  4JEA A;  4Z9H A;  1CGN A;  2EPK X;  1JAF A;  3EH1 A;  2AWY A;  2A6E F;  2J7P D;  2W4B A;  3NG1 A;  4FX5 A;  4U9E A;  4W8P A;  3RKO F;  5A6B A;  3IHU A;  3JYY A;  4XLN F;  1MMG A;  4KI2 A;  2YQY A;  3SXM A;  2WVO A;  4I1O B;  4IB4 A;  1BZ4 A;  1U6H A;  1ZW3 A;  2A68 F;  2VH3 A;  1RKE A;  2MYS A;  2YL3 A;  2YLD A;  1DOV A;  4A2N B;  3SXY A;  3J06 A;  3O55 A;  1QSP A;  3DAF A;  1SMY F;  3G4X A;  2J7P A;  2J9V A;  1Y4C A;  1GQA A;  1RXQ A;  5T3W A;  3RF3 A;  2A6H F;  3DD7 A;  3T6G B;  2EIK C;  3LNM B;  2LFF A;  3L0I A;  2DYR C;  2R7Q A;  3TOL A;  4F4B A;  1R4T A;  4JCH A;  2EIL C;  5L0D A;  4Q5S F;  3K66 A;  4W8K A;  3DZA A;  4RD9 A;  3U2L A;  1FR0 A;  4DVY P;  3S90 A;  2A0B A;  1WAT A;  3LEV A;  2FGY A;  2BE5 F;  1JRA A;  1YZA A;  3DM5 A;  1LKX A;  3TK0 A;  2LQG A;  2R25 A;  3MYI A;  1LPE A;  2EIJ C;  2CCY A;  4KC9 A;  3RVY A;  2XS1 A;  4IWB A;  3AG2 C;  4KBL A;  1H6G A;  1L3P A;  2BC5 A;  3UR3 C;  4CBE A;  1VLT A;  2P7V A;  2ZXP A;  3AG3 C;  1PD1 A;  4LAC B;  4LLC A;  3AOU A;  2AVK A;  3MBG A;  4MTG A;  4R32 A;  2VAS A;  1LS4 A;  1MND A;  2XLD A;  1OR3 A;  4DOZ A;  2GAQ A;  5EGY A;  2J9U A;  4CSA C;  5B1A C;  4PJM A;  3C18 A;  4K0D A;  3QMK A;  4PJL A;  1D0X A;  1D0Z A;  2XLM A;  2P6V A;  3MYF A;  3SNH A;  4EIY A;  2CGE A;  2A0U A;  2GDC A;  1E86 A;  3B0U X;  2WZF A;  4CIP A;  2R05 A;  2R7X A;  4E0I A;  3CEX A;  3KYI A;  4N06 A;  1FFH A;  2L6H A;  2J9W A;  1V74 B;  5JT4 A;  3C62 A;  2OJE D;  2J0X A;  1HW1 A;  1ZHY A;  3I5Q A;  1D1A A;  2YEV A;  1M57 C;  1NZE A;  1Q0G A;  2LFD A;  3DJN B;  4E7S A;  4OD5 A;  2XSE A;  4ER9 A;  4OIP F;  3X1O A;  3RW0 A;  4H54 A;  4CSA A;  1SF8 A;  2M4E A;  2J45 A;  4OIO F;  3BEH A;  4MVQ A;  1RKC A;  2DGJ A;  1YA9 A;  2Y3G A;  2BL2 A;  2I8B A;  3TOM A;  3U2M A;  3U5S A;  1HMD A;  5E3A A;  3IQ5 A;  1AVO B;  3KKB A;  4YN0 B;  3C8G B;  4U5H A;  1ZVZ A;  5KYX A;  3UGP A;  2O9X A;  1NFN A;  3ZDL A;  1XWJ A;  4G7Z F;  1A7V A;  3DJU B;  5F5H A;  2IXO A;  3KMI A;  4BEM J;  2AU5 A;  3NKE A;  4NCQ A;  2HSQ A;  2YVK A;  5E33 A;  1MMN A;  3AQC A;  4DRH B;  2LP4 A;  1M2V A;  3ZSU A;  4H4K C;  4U5F E;  2EPL X;  3C63 A;  1ZHW A;  3ITF A;  4NTA A;  2YWA A;  4BJ5 A;  4PJN A;  4A4A A;  3DE9 A;  2HV7 A;  1ZU4 A;  4MVU A;  5BQG A;  1YJG A;  2EPN A;  4O79 A;  3TJ6 A;  2R03 A;  2OJQ A;  1MQV A;  4HFK B;  3UGO A;  1IZM A;  1O5H A;  1O3U A;  2A69 F;  2VCC A;  1W2W A;  2Y39 A;  1BR4 A;  1TKN A;  3C8G D;  4BJ6 C;  2Q00 A;  3LS1 A;  1LVK A;  5KYY A;  4NQF A;  3L8J A;  4JUR I;  3I4U A;  3OWT A;  2OQM A;  3EGD A;  1K05 A;  4U5G A;  3IQT A;  1NU7 D;  3GWL A;  3DKA A;  4CDA A;  1WN0 A;  2H7B A;  3FXH A;  3W2W A;  4YL0 A;  3POV A;  2XS8 A;  4Q7C A;  5JRA A;  1Q0F A;  2J8W A;  2LCH A;  1FAP B;  5B1B C;  4E0H A;  1WGW A;  3GM2 A;  1JR8 A;  2NUP B;  1S05 A;  1Z6A A;  1VYK A;  3HTK C;  2A1D D;  3NYM A;  4CX9 A;  3ABM C;  1C02 A;  3NMJ A;  2YL1 A;  2EPM X;  1CPR A;  1AUE A;  3NMI A;  3GAN A;  4C7O B;  2CDQ A;  2DB4 A;  4OIQ F;  4E7Z A;  3AGT A;  2W9Y A;  1K40 A;  1YZC A;  3K1I C;  2EPO A;  4AE4 A;  2QUP A;  4AE4 B;  1NG1 A;  2VCB A;  3FMS A;  3QW1 A;  1BBH A;  1T01 A;  4MVS A;  1ZHX A;  2EIM C;  1C17 M;  1JPN A;  4PFP A;  1Z7Q c;  4EBJ A;  5DQZ A;  2LSE A;  4BG0 A;  4MS2 A;  2G62 A;  1OCR C;  4PJJ A;  2OG2 A;  5BUO A;  2XLO A;  1GM5 A;  1RCP A;  1OR2 A;  1SYQ A;  1E2X A;  3RIP A;  3X2Q C;  4CS8 C;  4JE9 A;  3U3B A;  4E17 A;  2R7U A;  1I4Z A;  1NLX A;  256B A;  1TR2 A;  1RJ9 B;  4EBK A;  2B0J A;  2RD9 A;  3EGD B;  3G4Z A;  2YLI A;  4XPY A;  4YT5 A;  3TD7 A;  3EHN A;  2OEX A;  5GPG B;  2J46 A;  4O6N A;  3EZI A;  3U8P A;  5KYX B;  3LAY A;  1OXK A;  4M63 A;  3HKK A;  1DOW A;  3JRT A;  1ZYR F;  2E87 A; 
#chains in the Genus database with same CATH homology
 2HV6 A;  4YT4 A;  4BEJ A;  5DLJ A;  1VOM A;  1MNE A;  2R7S A;  3EQL F;  1LS1 A;  4ULW A;  2QY9 A;  4JZA A;  1ZU5 A;  1VK5 A;  1Z3I X;  5KYU A;  2PFD A;  3EH2 A;  2Q9B A;  3ZIB A;  3VAY A;  3OEO A;  3HLZ A;  2XXA B;  4IAO A;  4O6Y A;  1O87 A;  5KYW B;  3HJC A;  2L81 A;  3EJN A;  1OCO C;  1FFT C;  3W2V A;  4GYT A;  2IXN A;  2NUT A;  4EWC A;  5B3S C;  3DXJ F;  3LNR A;  3EZH A;  4QDL A;  3AG1 C;  1Z63 A;  3N0T A;  2MWQ A;  2D5R B;  2NUP A;  1BR2 A;  2OCC C;  3LS0 A;  4HEA J;  3CSK A;  4NY3 A;  5EHH A;  3MX3 A;  4U5D E;  2H7V C;  4PFO A;  1FMW A;  3JCU Q;  2IYL D;  4LER A;  4C7O A;  3E70 C;  3CZ6 A;  3K6B A;  5DS4 A;  3RFY A;  1MMA A;  4RDA A;  1NU9 C;  1M2O A;  4C3E A;  3PMR A;  1S7Z A;  4OD4 A;  3L34 A;  3EFO A;  4KNW A;  3I5P A;  1N1C A;  3LLK A;  1TWC A;  2CNW D;  3H65 A;  3ZC4 A;  5D91 A;  1PCX A;  3FHD A;  4Q4Z F;  3SYN A;  2V26 A;  3CQZ A;  2KQ9 A;  4O7G A;  2ZXW C;  1TWA A;  3B9Q A;  4CS9 A;  3LJB A;  4JJG A;  2Y3H A;  4G0H A;  5KYU B;  3EGX A;  3SP1 A;  3ZVR A;  3UNG C;  2IOQ A;  2V3C C;  1JPJ A;  2Y3D A;  3ASO C;  1OCC C;  2C04 A;  3B0P A;  2J0W A;  3ASN C;  3ECS A;  4CIH A;  4OIN F;  4XWJ A;  3S28 A;  4HFF B;  1FTS A;  4G7H F;  2Y69 C;  2PX3 A;  5KYN A;  1D0Y A;  3WOD F;  1RJ9 A;  1PD0 A;  2NUT B;  4KNV A;  4YWQ A;  3NDB B;  4HE8 D;  3JSZ A;  3W8I A;  4I44 A;  2KW3 C;  2WZG A;  3AQB A;  3K1H A;  4BJ1 A;  3DMD A;  4CS7 A;  4ZLC A;  5F5F A;  2WVQ A;  2X51 A;  1VMA A;  3UMH A;  2ZXR A;  1M56 C;  1Z23 A;  1TWH A;  3NYL A;  3NRH A;  4K7B A;  5T3T A;  2XRH A;  3EG9 A;  4I1M A;  1QLE C;  2W45 A;  4CS9 C;  3E9V A;  3ABL C;  3FVY A;  5E3C A;  5CI9 A;  4AX2 A;  3M1C B;  1J8M F;  2KGO A;  3EHM A;  4FES A;  3K7D A;  3O6X A;  3W8H A;  2WL8 A;  3WG7 C;  3DAG A;  3LLI A;  3EGX B;  4DBQ A;  3S27 A;  2C03 A;  3T4R A;  3T6J A;  5HSW A;  1D1B A;  3T6B A;  1OCZ C;  4X0R A;  4B6I A;  3MLG A;  3RYL A;  4WJ0 A;  2CNW A;  2JD3 A;  4DVZ A;  1G8X A;  4XLP F;  4I3M A;  4JVS A;  3FAJ A;  3RH3 A;  2YZS A;  3ZG1 A;  1Z5Z A;  3JYH A;  2G3K A;  2R7O A;  4U5C E;  3EPV A;  4ZLD A;  2Q3T A;  3AG4 C;  3S0X A;  2QTV A;  3ABK C;  1KU2 A;  4BJT A;  1OKK A;  3Q6N A;  3KH2 A;  4DBR A;  2W4M A;  4PK4 A;  4RBN A;  3F47 A;  4AK9 A;  2R7R A;  1TWG A;  4G7O F;  3Q7G A;  2PF4 E;  2GFH A;  4FWV A;  5DS6 A;  4GEH A;  3Q6M A;  2PX0 A;  5L3Q A;  4C3B A;  1IW7 F;  4JJF A;  2CW0 F;  3V7O A;  4BJ6 A;  2Z15 A;  2FFH A;  4YT8 A;  1M2V B;  2WB7 A;  2H7O A;  4U5E E;  3EG9 B;  4BJ5 C;  4YT2 A;  2L9J A;  2IXM A;  3EFO B;  4P6I C;  5D92 A;  1V55 C;  4C3D A;  2PP4 A;  2ZXO A;  1FMV A;  1BR1 A;  5L3V A;  2R7W A;  4XTK A;  2R7V A;  5FCL A;  4OIR F;  4IRU A;  4MND A;  3SZR A;  2IXP A;  1D1C A;  3NYJ A;  3N2Z B;  3DM9 B;  1SZI A;  3LES A;  3S29 A;  2YHS A;  2WZL A;  2KNH A;  4EBB A;  4IJJ A;  2G3V A;  3KL4 A;  2WVN A;  1OKK D;  2KJG A;  1ZHZ A;  4MQ9 F;  2Q9A A;  5E2Q A;  3O39 A;  3NKD A;  4YJW A;  5CI8 A;  1J8Y F;  4QI0 A;  4QI2 A;  5DVW A;  2Q9C A;  5T1D B;  2XXA A;  3GOD A;  2Y3B A;  4J32 B;  2XL4 A;  2VB6 A;  3B0V C;  3SEO A;  1V54 C;  5IY5 C;  4LLE A;  3VYW A;  3OA1 A;  2DYS C;  1QZX A;  2ZPA A;  4O6M A;  1MMD A;  4JW1 A;  3Q7L A;  4J30 B;  5DQT A;  1ST6 A;  5KYW A;  4CS8 A;  4U5B E;  5KYY B;  3N24 A;  2NG1 A;  3F46 A;  5DS5 A;  3UMI A;  2R7T A;  3JT1 A;  3PHF 2;  2EIN C;  3FDQ A;  1ZHT A;  3K33 A;  3UMK A;  4ANJ A;  1VYI A;  3EH1 A;  2A6E F;  2J7P D;  4FX5 A;  2W4B A;  3NG1 A;  3RKO F;  4XLN F;  1MMG A;  4KI2 A;  2WVO A;  4I1O B;  2VH3 A;  2A68 F;  2MYS A;  4A2N B;  2E87 A;  3DAF A;  1SMY F;  2J7P A;  2J9V A;  5T3W A;  2A6H F;  3DD7 A;  2EIK C;  3L0I A;  2DYR C;  2R7Q A;  4F4B A;  4Q5S F;  4JCH A;  2EIL C;  3K66 A;  4W8K A;  3DZA A;  4RD9 A;  4DVY P;  3LEV A;  2FGY A;  2BE5 F;  1LKX A;  4KC9 A;  2EIJ C;  4IWB A;  3AG2 C;  4KBL A;  3UR3 C;  4CBE A;  2P7V A;  2ZXP A;  3AG3 C;  4LAC B;  1PD1 A;  4LLC A;  2VAS A;  1MND A;  4DOZ A;  5EGY A;  2J9U A;  4CSA C;  5B1A C;  4PJM A;  4K0D A;  3QMK A;  4PJL A;  1D0X A;  1D0Z A;  2P6V A;  3SNH A;  2CGE A;  3B0U X;  2WZF A;  2R7X A;  4N06 A;  1FFH A;  2J9W A;  2J0X A;  1ZHY A;  3I5Q A;  1D1A A;  2YEV A;  1M57 C;  1NZE A;  3DJN B;  4E7S A;  4OD5 A;  2XSE A;  4OIP F;  3X1O A;  4CSA A;  1SF8 A;  2M4E A;  2J45 A;  4OIO F;  2DGJ A;  2Y3G A;  2I8B A;  5E3A A;  3KKB A;  4YN0 B;  4U5H A;  5KYX A;  3UGP A;  2O9X A;  4G7Z F;  3DJU B;  5F5H A;  2IXO A;  3KMI A;  3NKE A;  5E33 A;  1MMN A;  3AQC A;  1M2V A;  3ZSU A;  4H4K C;  4U5F E;  1ZHW A;  3ITF A;  4BJ5 A;  4PJN A;  2HV7 A;  1ZU4 A;  4O79 A;  4HFK B;  3UGO A;  1IZM A;  1O5H A;  2A69 F;  1W2W A;  2Y39 A;  1BR4 A;  1TKN A;  4BJ6 C;  3LS1 A;  1LVK A;  5KYY A;  4JUR I;  3I4U A;  3OWT A;  3EGD A;  4U5G A;  1NU7 D;  2H7B A;  3W2W A;  3POV A;  4Q7C A;  5B1B C;  1WGW A;  2NUP B;  3NYM A;  1Z6A A;  1VYK A;  2A1D D;  3HTK C;  3ABM C;  3GAN A;  4C7O B;  2CDQ A;  4OIQ F;  4E7Z A;  4AE4 A;  2W9Y A;  3K1I C;  4AE4 B;  1NG1 A;  1ZHX A;  2EIM C;  4PFP A;  1JPN A;  5DQZ A;  2LSE A;  4BG0 A;  4PJJ A;  2G62 A;  1OCR C;  2OG2 A;  5BUO A;  3RIP A;  3X2Q C;  4CS8 C;  2R7U A;  1TR2 A;  1RJ9 B;  2B0J A;  3EGD B;  3TD7 A;  4YT5 A;  3EHN A;  5KYX B;  2J46 A;  4O6N A;  3EZI A;  3LAY A;  4M63 A;  3QZC A;  3IEE A;  3JRT A;  1ZYR F;  3DM5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...