4U5CE

Crystal structure of glua2, con-ikot-ikot snail toxin, partial agonist fw and postitive modulator (r,r)-2b complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
85
structure length
85
Chain Sequence
GPADCCRMKECCTDRVNECLQRYSGREDKFVSFCYQEATVTCGSFNEIVGCCYGYQMCMIRVVKPNSLSGAHEACKTVSCGNPCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein/toxin
molecule keywords Glutamate receptor 2
publication title X-ray structures of AMPA receptor-cone snail toxin complexes illuminate activation mechanism.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 28
structure length 85
sequence length 85
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1800 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4u5cE00
4U5DE 4U5CE 4U5FE 4U5EE 4U5BE 4U5GA 4U5HA
chains in the Genus database with same CATH superfamily
4U5DE 3U2LA 2WVOA 3TOLA 2CNWA 2JX0A 2OEXA 5GPGB 5K0IA 3KMIA 1K05A 4JE9A 3TJ5A 2B0HA 2DB4A 1A7DA 5A6JA 1EKYA 1RKEB 3AG3C 4JRZA 3T6JA 1HE1A 1I5NA 2Q3TA 2XLVA 1HW1A 4EBBA 1BR1A 2VASA 1GQAA 1VLSA 3CSKA 3DJNB 2CGEA 2Y69C 3AOUA 3JYHA 3NG1A 4U5BE 3MLGA 3DJUB 3K1HA 4U9DA 1D1AA 3Q6MA 3T6BA 1D1CA 4PFOA 5KYUA 4EIYA 5KYNA 4ONSA 1RMVA 3ZSUA 1RKCA 4YT8A 4N6CA 1D0YA 5B1BC 3DAFA 1E86A 2R7TA 3W4YA 4JIOA 4J30B 2YZSA 1U6HA 1C03A 3RFYA 2IXOA 2KNHA 3E9VA 4I44A 1TKNA 2XLWA 5KYXA 4EKWA 2GA0A 3FDQA 1FTSA 3I5PA 4YT2A 3B71A 3ABMC 1SYQA 4K7BA 2G3VA 3JT1A 1OR3A 1NZEA 4WABA 1FFTC 1LIHA 5L0CA 5D91A 3WHNA 2NSGA 4CIPA 4O6NA 4QDLA 1HY5A 2IYLD 1YJGA 5JVEA 1O87A 4FWVA 1BZ4A 3EH1A 3OA1A 5AGFA 3VYWA 1NU9C 2R9RB 3UR3C 4E7ZA 3FOPA 5B3IA 4CDYA 2VC9A 4OD4A 1PD1A 5E3CA 3JSEO 2MWQA 3CEXA 1MMDA 2HS5A 3IQ5A 2W4BA 5AC4A 1K04A 4XPXA 1H9GA 2A68F 3DE9A 1YYJA 2YL7A 4O6MA 4ER9A 1ZU5A 4XEFA 1V54C 3EG9B 2H7VC 3IHUA 3NRHA 4DJ9A 4BEJA 4EBJA 3IQ6A 4DBRA 3W8HA 1VLTA 1RJ9A 1NSGB 2XS8A 1VYIA 4KBLA 3SYNA 4Q4ZF 4CSAA 5DQTA 3U9MA 3EJNA 4U5HA 5KYYB 5B1AC 5CI8A 4YL1A 3M79A 2HFIA 4C3BA 2R7XA 3HTKC 1JAFA 1OR2A 2EPMX 3MX3A 2AU5A 3NYMA 4C3DA 3MBGA 5BQHA 3K1IC 2HJMA 1I4YA 1ORJA 4XEVA 4MTGA 5COMA 5E33A 2V3CC 5IY5C 4PACA 1TWHA 2FGYA 2NUTB 3IQTA 3L8IA 2L81A 1LVKA 1LKXA 5JUAA 4KNWA 2D5RB 2NPUA 4Q7CA 4DXWA 1BBHA 3C8GB 3KKBA 3NMIA 2Y3BA 1OW8A 1QSPA 1NG1A 3TJ6A 1ZZPA 2J9BA 2J45A 2YWAA 3ATPA 3H65A 4MNDA 1CGME 3N2ZB 3NDBB 2Y39A 4GYTA 3FXHA 4CBEA 5L0DA 2A6EF 1TQGA 3ABKC 2CCYA 3BEHA 2AVKA 2R7WA 1GM5A 3AG4C 3G4ZA 1MMGA 1OKKD 5JP7A 4J7TA 3LS1A 2G3KA 4ZLCA 2J9WA 3LEVA 2GAQA 1ZW3A 2NUPA 2L6HA 3UGPA 2P1AA 3JYYA 3U8VA 1C17M 4FAPB 1M6TA 3RQFA 1JMWA 2X51A 5L0FA 2KYHA 3C8GD 2Q4FA 1Z5ZA 3AQBA 4XEKA 3S29A 3U3BA 3LS0A 3L0IA 4E0IA 1XWJA 2Q9AA 2PP4A 4D4NA 4NY3A 1A41A 1QLEC 4JZAA 2ZXPA 2AWCA 3UNGC 1FFHA 2PX0A 4CS9A 1E85A 1WWPA 3O6XA 1RXQA 3WG7C 1OW7A 1KNYA 1LE4A 2J7PD 3UMKA 3DI5A 1DOWA 2WVNA 2ZPAA 2UUHA 2IXMA 3GODA 4MVQA 3L34A 2NG1A 4K1OA 4NTAA 2OU6A 3W8IA 3KL4A 1F1MA 1Q0DA 1OCRC 1BR2A 3IPMO 1ZW2A 3NYLA 4IRUA 1O3UA 3HNJA 2KW3C 2Y3HA 3L1MA 1YZAA 4YT5A 2NSFA 4MS2A 3AG2C 1JPJA 4JTCB 2OJQA 3X2QC 2VB6A 2A0BA 2KC3A 2LFFA 1JR8A 3RQGA 4U5GA 1NFOA 2HV6A 2QY9A 2YQYA 4NC3A 4RD9A 2BC5A 3SP1A 1BDJB 2LSEA 3K1IA 4N06A 1DOVA 2XLOA 1QPUA 2L6FA 4LLEA 1W2WA 1K40A 2LK4A 4JEBA 1M56C 1AUEA 5JSLA 3AJMA 4MTOA 5A6BD 2ZD9A 3K66A 5EHHA 1Z23A 1PV3A 1VYKA 4WJ0A 3EGDB 2UUIA 2ICWG 3DM9B 4NCQA 5KYWB 3GM2A 3TQOA 3EFOB 3HNIA 1T5OA 1TFKB 3WAQA 1S7ZA 3VRCA 4IB4A 2Q7RA 2H8AA 4JJGA 3SXZA 5FZTA 4YL0A 1Z63A 5JS5A 3JRMO 1SMYF 1Z3IX 1Z6AA 3AQCA 3DM5A 1GGQA 3H2VA 3U2MA 4B6IA 1EQ1A 1LPEA 1WATA 2IM8A 1J8MF 3M15A 4OINF 2B0JA 2KGOA 3EGXB 2Q9CA 4R32A 3NMJA 2XLMA 3JTLO 4A2NB 4DVZA 2Y3DA 4X0RA 4EHPA 4Q5SF 2M4EA 4NQFA 3W2VA 1WTYA 1TWCA 2KQ9A 4JTDB 2XS1A 2IXPA 3DKAA 4FX5A 1M2VB 4CS8A 4XPYA 2CYDA 3M4BA 3Q6NA 3GM1A 2J0XA 4WGYA 3ZG1A 3TOMA 3ZTMA 1OCOC 1ZYRF 2Q00A 1S05A 4JCZA 3SEOA 4C3EA 3C62A 3ZWIA 1MMNA 4BJ5C 4U5EE 4JEAA 1SR2A 3RYLA 3S90A 4HFKB 3DMDA 1WN0A 4EBKA 3DWWA 4G7OF 1TWGA 2XLEA 1FNTc 2WZLA 4IJJA 1TWAA 1YZCA 3IEEA 4I1OB 2WZGA 3QVYA 3PDMP 1QKRA 3ASNC 2DI3A 5KYUB 5KYYA 3UGOA 1CPQA 2MHRA 2VCBA 1A7EA 3HNLA 4HE8D 3B0PA 4AL1A 2KK1A 3LNRA 2YLDA 4O6YA 2OOCA 2XL4A 4Z9HA 1D0XA 3QMKA 4MVMA 5KYXB 2OJED 1FAPB 4AX2A 2DYSC 2ZXOA 1YDIA 4MVSA 1NLXA 3KYJA 4J32B 2CNWD 1R5ID 4CX9A 1QZXA 3K6BA 4C7OB 3V5XA 2YLGA 4LACB 2HUJA 2RSEB 2ZXRA 5JLIA 2M64A 2QLAA 1B68A 3M1CB 3AG1C 4O79A 4O7GA 3ZIBA 1V74B 3S0XA 1LI7A 2J0WA 2A0UA 2DGJA 3B9QA 1HMDA 3MYFA 3OWTA 4MVOA 1LI5A 3SZRA 3UMHA 3EHNA 4LLCA 3A11A 1LE2A 3GWNA 3JSZA 4W8KA 3LESA 3A9CA 3FVYA 2HMQA 3V5ZA 4KI2A 2OQMA 2MYSA 2L6GA 2Q9BA 3MFNA 4KC9A 4UDVA 1IZMA 3M4CA 4LDRA 3QW0A 2H7OA 1H7IA 1A0BA 1NBBA 4ULVA 2EILC 1G4WR 2R7SA 2V26A 1YAUO 3NKEA 5D92A 4XLPF 3SXMA 4MTFA 4MVRA 4RDAA 2XSEA 3NKDA 1T6IA 2OCCC 1FMWA 3ASOC 4RBNA 4NTBA 4PJNA 1NU7D 2RD9A 5DLJA 1WGWA 2I15A 2IBFA 4DRIB 2LFDA 2E87A 1O5HA 3DE8A 4QI0A 5A6AA 5L3QA 2YL3A 2XRHA 1JOGA 2Y3GA 1PD0A 1OCCC 3CAXA 4ZLDA 1M57C 3NYJA 4IAOA 1CGOA 1R4TA 3FAPB 3RKOF 4E7SA 3RH3A 2XXAA 2PBEA 4YWQA 3O39A 1T01A 4P6IC 1JRAA 2X0CA 3S27A 4M63A 3MYIA 4CS7A 3RQEA 4G7ZF 3I5QA 1OXKA 1Q0GA 5FCLA 3GORA 3Q7GA 3SXKA 2W9YA 2BL2A 3GWLA 1RCPA 1HMOA 4OIPF 3V5YA 2AP3A 2EPLX 4KNVA 3O10A 5B3SC 1U89A 1VOMA 1A7VA 4P9FA 1ST6A 2EIMC 4AE4A 3LUTB 3GANA 3U8PA 2EPNA 2HJ3A 1Z7Qc 1PCXA 1KTMA 2A69F 4MW8A 3NMKA 4U5CE 5A6KA 1HE9A 3FAJA 2CDQA 2XLDA 1MMAA 4BG0A 3VF0A 2NUPB 2AWYA 1D1BA 5L0JA 2EIJC 2DYRC 2HZ8A 2R7QA 4N4WA 3T4RA 4PJJA 2PX3A 2YHSA 1WOLA 1RKEA 3EFOA 3CQZA 1EI7A 2H7BA 1ZHXA 4MVZA 3O55A 3ZC4A 2QE9A 3JCUQ 5JT4A 2G62A 4HFFB 1AVOB 5AC5A 4BEMJ 2CW0F 4L6RA 3AGTA 4MVUA 4D4XA 5CI9A 5L0HA 1TR2A 3DAGA 5DS5A 5L3VA 2Z15A 1H6GA 2QTVA 4BPMA 4GQHA 5EGYA 1Y4CA 3RF3A 1ZHTA 5HV9A 2WL8A 2J8WA 1TFOB 3B29A 1EA8A 4XTKA 4EUKB 1V4AA 2IXNA 2YVKA 3G4XA 4QI2A 1L3PA 1V55C 4G0HA 4XWJA 3ABLC 4PK4A 5E2QA 5T3WA 1ZHYA 3FOOA 3CZ6A 3R2PA 1KU2A 2R7OA 2W4MA 4CIHA 2TMVP 1T9KA 3ZDLA 3LEOA 1VTMP 2WZFA 3S84A 4AK9A 2J9VA 4LDKA 1OW6A 5DVWA 2FFHA 1LS4A 2HKVA 4A4AA 2R7RA 3F47A 1HW2A 1MQVA 1T6UA 1Q0KA 1Y6DA 2XL6A 3ZTZA 1ORSC 4XPWA 2WB7A 4E0HA 5HSWA 3RVZA 1UFBA 2C03A 4YL3A 2P6VA 2ASRA 2R25A 2VCCA 5E3AA 2HV7A 3QZCA 2JPUA 3EG9A 3KPHA 4AL0A 3EH2A 4FESA 4JTAB 3ITFA 1YA9A 2LP4A 1YA7O 2L9JA 3ECSA 2R02A 3F46A 3FMSA 4K0DA 3X1OA 1ZHWA 3R7CA 4CJGA 2HSBA 1QQ3A 5CIVA 1CGNA 1T6QA 2J9UA 4CJOA 4C7OA 4JVSA 1OKKA 2FAPB 4IGGA 4EWCA 4BJ1A 4IAQA 4ULWA 4W8PA 4MQ9F 2YKZA 4LDQA 3HJCA 2P7VA 4JCHA 2BE5F 5COGA 3ZQYA 2R05A 3B0UX 2ZXWC 1M2OA 3U9JA 2NUTA 2LD6A 4N6HA 4YT4A 3HLZA 1G5ZA 2P61A 2JD3A 3US6A 2WVQA 3HKKA 3V7OA 2EIKC 3C8GA 3GEIA 4JC7A 4CS9C 1IW7F 3QW1A 1OXBA 1VB5A 1XZPA 2KJGA 2QUPA 3TK0A 3DZAA 4CDVA 1D0ZA 4OIQF 3TD7A 5L0IA 5DS4A 4WGZA 1OCZC 2LQGA 1E84A 2R7VA 4BJ6C 4G7HF 2J7PA 4YJWA 5COFA 3KH2A 4HEAJ 2W45A 4IARA 1Q0FA 2YLIA 1GS9A 3AGUA 5TJ5E 3POVA 2O9XA 3EQLF 1ZU4A 1AEPA 1G8XA 4U9EA 4J7YA 3GEEA 3H2UA 3QVZA 2P0NA 1OQCA 1U0BB 2OEVA 4U5FE 1SZIA 4G78A 4PJLA 1RJ9B 2HMZA 3ZVRA 2YL0A 4OD5A 1QVXA 2A1DD 2EPOA 1ZHZA 1CPRA 2PF4E 2ETSA 2KSFA 4DVYP 3LLIA 4DOZA 3N24A 2A6HF 1YVIA 3KYIA 4BJ5A 4DBQA 3HNKA 1FMVA 5F5FA 1C02A 1BR4A 1MNEA 5A6BA 3SNHA 1XZQA 3E70C 3PMRA 4H4KC 4PR9A 3GM3A 4JJFA 2F22A 3QTHA 5L0GA 1YYXA 1G4US 2LIGA 2XLHA 3EPVA 1VMAA 3T6GB 4OIOF 3JRTA 3VAYA 4JKVA 4IWBA 3EHMA 4MW3A 5T3TA 4E18A 4GEHA 1YLMA 2D4UA 3C7JA 3VM6A 5BUOA 4F4BA 2VH3A 3TULA 1ORYA 3U0CA 5EK0A 2C04A 3EZIA 1YARO 3K7DA 2LCHA 4PFPA 2EPKX 2YEVA 3BRJA 3RVYA 3U5SA 5DQZA 2GWWA 2IOQA 2YRFA 3N0TA 4OIRF 4YN0B 2R03A 4XQ1A 2HSQA 2PNOA 4CDAA 3RIPA 3L8JA 3U3FA 4CS8C 1E83A 3PCVA 1MNDA 3C8ZA 4JURI 2XM4A 4I1MA 1NFNA 5A69A 3T9OA 1E2XA 2GFHA 3LAYA 2EINC 3EGDA 2OG2A 3FHDA 5KYWA 4H54A 2OKUA 2XXAB 5F28E 4DRJB 1FR0A 1VK5A 3EZHA 4XLNF 4E17A 5DS6A 3JZ0A 3IQCA 2XL8A 3S28A 3I4UA 3J06A 4JW1A 1LS1A 4DRHB 3GEHA 2J46A 1APCA 2XM0A 5BQGA 5T1DB 3ZQVA 4BJ6A 5JRAA 4NTFA 2I8BA 2GDCA 3UMIA 3Q7LA 3SXYA 1ZVZA 2PFDA 3LLKA 1J8YF 1JPNA 3DD7A 4I3MA 1N1CA 1UG7A 3C18A 4LERA 4Z9JA 4BJTA 3EGXA 4ANJA 4P9TA 3LJBA 5BQIA 1WASA 3DXJF 3B0VC 3PHF2 256BA 4Z9IA 4AE4B 4PJMA 3G50A 1L7CA 1H9TA 3WODF 3S9OA 2L7AA 2VCAA 3C63A 4YK5A 3OEOA 4CSAC 2QNLA 1M2VA 5F5HA 1LM3B 3K33A 3LNMB 1SF8A 2R7UA 1Q0MA 1I4ZA 2YL1A 3RW0A 3W2WA
chains in the Genus database with same CATH topology
4U5DE 2WVOA 2CNWA 3KMIA 3AG3C 3T6JA 2Q3TA 4EBBA 1BR1A 2VASA 3CSKA 3DJNB 3JYHA 2CGEA 2Y69C 3NG1A 4U5BE 3MLGA 3DJUB 3K1HA 1D1AA 3Q6MA 3T6BA 1D1CA 4PFOA 5KYUA 5KYNA 3ZSUA 4YT8A 1D0YA 5B1BC 3DAFA 2R7TA 4J30B 2YZSA 3RFYA 2IXOA 2KNHA 3E9VA 4I44A 1TKNA 5KYXA 3FDQA 1FTSA 3I5PA 4YT2A 3ABMC 4K7BA 2G3VA 3JT1A 1NZEA 1FFTC 5D91A 4O6NA 4QDLA 2IYLD 1O87A 4FWVA 3EH1A 3OA1A 3VYWA 1NU9C 3UR3C 4E7ZA 4OD4A 1PD1A 5E3CA 2MWQA 1MMDA 2W4BA 2A68F 4O6MA 1ZU5A 1V54C 3EG9B 2H7VC 3NRHA 4BEJA 4DBRA 3W8HA 1RJ9A 4CSAA 1VYIA 4KBLA 3SYNA 4Q4ZF 5DQTA 3EJNA 4U5HA 5KYYB 5B1AC 5CI8A 2R7XA 4C3BA 3HTKC 3NYMA 3MX3A 4C3DA 3K1IC 5E33A 2V3CC 5IY5C 1TWHA 2FGYA 2NUTB 2L81A 1LVKA 1LKXA 4KNWA 2D5RB 4Q7CA 3KKBA 2Y3BA 1NG1A 4MNDA 2J45A 3H65A 3NDBB 3N2ZB 2Y39A 4GYTA 4CBEA 2A6EF 3ABKC 2R7WA 3AG4C 1MMGA 1OKKD 3LS1A 2G3KA 4ZLCA 2J9WA 3LEVA 2NUPA 3UGPA 2X51A 1Z5ZA 3AQBA 3S29A 3LS0A 3L0IA 2Q9AA 2PP4A 4NY3A 1QLEC 4JZAA 2ZXPA 3UNGC 1FFHA 2PX0A 4CS9A 3O6XA 3WG7C 2J7PD 3UMKA 2WVNA 2ZPAA 3GODA 2IXMA 3L34A 2NG1A 3W8IA 3KL4A 1OCRC 1BR2A 4IRUA 3NYLA 2KW3C 2Y3HA 4YT5A 3AG2C 1JPJA 3X2QC 2VB6A 4U5GA 2HV6A 2QY9A 4RD9A 3SP1A 2LSEA 4N06A 4LLEA 1W2WA 1M56C 3K66A 5EHHA 1Z23A 1VYKA 4WJ0A 3EGDB 5KYWB 3DM9B 3EFOB 1S7ZA 4JJGA 1Z63A 1SMYF 1Z3IX 1Z6AA 3AQCA 3DM5A 4B6IA 1J8MF 4OINF 2B0JA 2KGOA 3EGXB 2Q9CA 4A2NB 4DVZA 2Y3DA 4X0RA 4Q5SF 2M4EA 3W2VA 1TWCA 2KQ9A 2IXPA 4FX5A 1M2VB 4CS8A 3Q6NA 2J0XA 3ZG1A 1OCOC 1ZYRF 3SEOA 4C3EA 1MMNA 4BJ5C 4U5EE 3RYLA 4HFKB 3DMDA 4G7OF 1TWGA 2WZLA 4IJJA 1TWAA 3IEEA 4I1OB 2WZGA 3ASNC 5KYUB 5KYYA 3UGOA 4HE8D 3B0PA 3LNRA 4O6YA 2XL4A 1D0XA 3QMKA 5KYXB 4AX2A 2DYSC 2ZXOA 4J32B 2CNWD 1QZXA 3K6BA 4C7OB 4LACB 2ZXRA 3M1CB 3AG1C 4O79A 4O7GA 3ZIBA 3S0XA 2J0WA 2DGJA 3B9QA 3UMHA 3OWTA 3SZRA 3EHNA 4LLCA 4W8KA 3JSZA 3LESA 3FVYA 4KI2A 2MYSA 2Q9BA 4KC9A 1IZMA 2H7OA 2EILC 2R7SA 2V26A 3NKEA 4XLPF 5D92A 4RDAA 2XSEA 3NKDA 2OCCC 1FMWA 3ASOC 4RBNA 4PJNA 1NU7D 5DLJA 1WGWA 2E87A 1O5HA 4QI0A 5L3QA 2XRHA 2Y3GA 1PD0A 1OCCC 4ZLDA 1M57C 3NYJA 4IAOA 3RKOF 4E7SA 2XXAA 3RH3A 4YWQA 3O39A 4P6IC 3S27A 4M63A 4CS7A 4G7ZF 3I5QA 5FCLA 3Q7GA 2W9YA 4OIPF 4KNVA 5B3SC 1VOMA 1ST6A 2EIMC 4AE4A 3GANA 1PCXA 2A69F 4U5CE 3FAJA 2CDQA 1MMAA 4BG0A 2NUPB 1D1BA 2EIJC 2DYRC 2R7QA 3T4RA 4PJJA 2PX3A 2YHSA 3EFOA 3CQZA 2H7BA 1ZHXA 3ZC4A 3JCUQ 2G62A 4HFFB 2CW0F 5CI9A 1TR2A 3DAGA 5DS5A 5L3VA 2Z15A 2QTVA 5EGYA 1ZHTA 2WL8A 4XTKA 2IXNA 4QI2A 1V55C 4G0HA 4XWJA 3ABLC 4PK4A 5E2QA 5T3WA 1ZHYA 3CZ6A 1KU2A 2R7OA 2W4MA 4CIHA 2WZFA 4AK9A 2J9VA 5DVWA 2FFHA 2R7RA 3F47A 2WB7A 5HSWA 2C03A 2P6VA 5E3AA 2HV7A 3QZCA 3EG9A 3EH2A 4FESA 3ITFA 3ECSA 2L9JA 3F46A 3X1OA 4K0DA 1ZHWA 4C7OA 2J9UA 4JVSA 1OKKA 4EWCA 4BJ1A 4ULWA 4MQ9F 3HJCA 2P7VA 4JCHA 2BE5F 3B0UX 2ZXWC 1M2OA 2NUTA 4YT4A 3HLZA 2JD3A 2WVQA 3V7OA 2EIKC 4CS9C 1IW7F 2KJGA 3DZAA 1D0ZA 4OIQF 3TD7A 5DS4A 1OCZC 2R7VA 4BJ6C 4G7HF 2J7PA 4YJWA 3KH2A 4HEAJ 2W45A 3POVA 2O9XA 3EQLF 1ZU4A 1G8XA 4U5FE 1SZIA 4PJLA 1RJ9B 3ZVRA 4OD5A 2A1DD 1ZHZA 2PF4E 4DVYP 3LLIA 4DOZA 3N24A 2A6HF 4BJ5A 4DBQA 1FMVA 5F5FA 1BR4A 1MNEA 3SNHA 4H4KC 3E70C 3PMRA 4JJFA 3EPVA 1VMAA 4OIOF 3JRTA 3VAYA 4IWBA 3EHMA 5T3TA 4GEHA 5BUOA 4F4BA 2VH3A 2C04A 3EZIA 3K7DA 4PFPA 5DQZA 2YEVA 2IOQA 3N0TA 4OIRF 4YN0B 3RIPA 4CS8C 1MNDA 4JURI 4I1MA 2GFHA 3LAYA 2EINC 3EGDA 2OG2A 3FHDA 5KYWA 2XXAB 1VK5A 3EZHA 4XLNF 5DS6A 3S28A 3I4UA 4JW1A 1LS1A 2J46A 5T1DB 4BJ6A 2I8BA 3UMIA 3Q7LA 3LLKA 2PFDA 1J8YF 1JPNA 3DD7A 4I3MA 1N1CA 4LERA 4ANJA 4BJTA 3B0VC 3EGXA 3LJBA 3DXJF 3PHF2 4AE4B 4PJMA 3WODF 4CSAC 3OEOA 1M2VA 5F5HA 3K33A 1SF8A 2R7UA 3W2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U5D E;  4U5C E;  4U5F E;  4U5E E;  4U5B E;  4U5G A;  4U5H A; 
#chains in the Genus database with same CATH topology
 4U5D E;  3U2L A;  2WVO A;  3TOL A;  2CNW A;  2JX0 A;  2OEX A;  5GPG B;  5K0I A;  3KMI A;  1K05 A;  4JE9 A;  3TJ5 A;  2B0H A;  2DB4 A;  1A7D A;  5A6J A;  1EKY A;  1RKE B;  3AG3 C;  4JRZ A;  3T6J A;  1HE1 A;  1I5N A;  2Q3T A;  2XLV A;  1HW1 A;  4EBB A;  1BR1 A;  2VAS A;  1GQA A;  1VLS A;  3CSK A;  3DJN B;  2CGE A;  2Y69 C;  3AOU A;  3JYH A;  3NG1 A;  4U5B E;  3MLG A;  3DJU B;  3K1H A;  4U9D A;  1D1A A;  3Q6M A;  3T6B A;  1D1C A;  4PFO A;  5KYU A;  4EIY A;  5KYN A;  4ONS A;  1RMV A;  3ZSU A;  1RKC A;  4YT8 A;  4N6C A;  1D0Y A;  5B1B C;  3DAF A;  1E86 A;  2R7T A;  3W4Y A;  4JIO A;  4J30 B;  2YZS A;  1U6H A;  1C03 A;  3RFY A;  2IXO A;  2KNH A;  3E9V A;  4I44 A;  1TKN A;  2XLW A;  5KYX A;  4EKW A;  2GA0 A;  3FDQ A;  1FTS A;  3I5P A;  4YT2 A;  3B71 A;  3ABM C;  1SYQ A;  4K7B A;  2G3V A;  3JT1 A;  1OR3 A;  1NZE A;  4WAB A;  1FFT C;  1LIH A;  5L0C A;  5D91 A;  3WHN A;  2NSG A;  4CIP A;  4O6N A;  4QDL A;  1HY5 A;  2IYL D;  1YJG A;  5JVE A;  1O87 A;  4FWV A;  1BZ4 A;  3EH1 A;  3OA1 A;  5AGF A;  3VYW A;  1NU9 C;  2R9R B;  3UR3 C;  4E7Z A;  3FOP A;  5B3I A;  4CDY A;  2VC9 A;  4OD4 A;  1PD1 A;  5E3C A;  3JSE O;  2MWQ A;  3CEX A;  1MMD A;  2HS5 A;  3IQ5 A;  2W4B A;  5AC4 A;  1K04 A;  4XPX A;  1H9G A;  2A68 F;  3DE9 A;  1YYJ A;  2YL7 A;  4O6M A;  4ER9 A;  1ZU5 A;  4XEF A;  1V54 C;  3EG9 B;  2H7V C;  3IHU A;  3NRH A;  4DJ9 A;  4BEJ A;  4EBJ A;  3IQ6 A;  4DBR A;  3W8H A;  1VLT A;  1RJ9 A;  1NSG B;  2XS8 A;  1VYI A;  4KBL A;  3SYN A;  4Q4Z F;  4CSA A;  5DQT A;  3U9M A;  3EJN A;  4U5H A;  5KYY B;  5B1A C;  5CI8 A;  4YL1 A;  3M79 A;  2HFI A;  4C3B A;  2R7X A;  3HTK C;  1JAF A;  1OR2 A;  2EPM X;  3MX3 A;  2AU5 A;  3NYM A;  4C3D A;  3MBG A;  5BQH A;  3K1I C;  2HJM A;  1I4Y A;  1ORJ A;  4XEV A;  4MTG A;  5COM A;  5E33 A;  2V3C C;  5IY5 C;  4PAC A;  1TWH A;  2FGY A;  2NUT B;  3IQT A;  3L8I A;  2L81 A;  1LVK A;  1LKX A;  5JUA A;  4KNW A;  2D5R B;  2NPU A;  4Q7C A;  4DXW A;  1BBH A;  3C8G B;  3KKB A;  3NMI A;  2Y3B A;  1OW8 A;  1QSP A;  1NG1 A;  3TJ6 A;  1ZZP A;  2J9B A;  2J45 A;  2YWA A;  3ATP A;  3H65 A;  4MND A;  1CGM E;  3N2Z B;  3NDB B;  2Y39 A;  4GYT A;  3FXH A;  4CBE A;  5L0D A;  2A6E F;  1TQG A;  3ABK C;  2CCY A;  3BEH A;  2AVK A;  2R7W A;  1GM5 A;  3AG4 C;  3G4Z A;  1MMG A;  1OKK D;  5JP7 A;  4J7T A;  3LS1 A;  2G3K A;  4ZLC A;  2J9W A;  3LEV A;  2GAQ A;  1ZW3 A;  2NUP A;  2L6H A;  3UGP A;  2P1A A;  3JYY A;  3U8V A;  1C17 M;  4FAP B;  1M6T A;  3RQF A;  1JMW A;  2X51 A;  5L0F A;  2KYH A;  3C8G D;  2Q4F A;  1Z5Z A;  3AQB A;  4XEK A;  3S29 A;  3U3B A;  3LS0 A;  3L0I A;  4E0I A;  1XWJ A;  2Q9A A;  2PP4 A;  4D4N A;  4NY3 A;  1A41 A;  1QLE C;  4JZA A;  2ZXP A;  2AWC A;  3UNG C;  1FFH A;  2PX0 A;  4CS9 A;  1E85 A;  1WWP A;  3O6X A;  1RXQ A;  3WG7 C;  1OW7 A;  1KNY A;  1LE4 A;  2J7P D;  3UMK A;  3DI5 A;  1DOW A;  2WVN A;  2ZPA A;  2UUH A;  2IXM A;  3GOD A;  4MVQ A;  3L34 A;  2NG1 A;  4K1O A;  4NTA A;  2OU6 A;  3W8I A;  3KL4 A;  1F1M A;  1Q0D A;  1OCR C;  1BR2 A;  3IPM O;  1ZW2 A;  3NYL A;  4IRU A;  1O3U A;  3HNJ A;  2KW3 C;  2Y3H A;  3L1M A;  1YZA A;  4YT5 A;  2NSF A;  4MS2 A;  3AG2 C;  1JPJ A;  4JTC B;  2OJQ A;  3X2Q C;  2VB6 A;  2A0B A;  2KC3 A;  2LFF A;  1JR8 A;  3RQG A;  4U5G A;  1NFO A;  2HV6 A;  2QY9 A;  2YQY A;  4NC3 A;  4RD9 A;  2BC5 A;  3SP1 A;  1BDJ B;  2LSE A;  3K1I A;  4N06 A;  1DOV A;  2XLO A;  1QPU A;  2L6F A;  4LLE A;  1W2W A;  1K40 A;  2LK4 A;  4JEB A;  1M56 C;  1AUE A;  5JSL A;  3AJM A;  4MTO A;  5A6B D;  2ZD9 A;  3K66 A;  5EHH A;  1Z23 A;  1PV3 A;  1VYK A;  4WJ0 A;  3EGD B;  2UUI A;  2ICW G;  3DM9 B;  4NCQ A;  5KYW B;  3GM2 A;  3TQO A;  3EFO B;  3HNI A;  1T5O A;  1TFK B;  3WAQ A;  1S7Z A;  3VRC A;  4IB4 A;  2Q7R A;  2H8A A;  4JJG A;  3SXZ A;  5FZT A;  4YL0 A;  1Z63 A;  5JS5 A;  3JRM O;  1SMY F;  1Z3I X;  1Z6A A;  3AQC A;  3DM5 A;  1GGQ A;  3H2V A;  3U2M A;  4B6I A;  1EQ1 A;  1LPE A;  1WAT A;  2IM8 A;  1J8M F;  3M15 A;  4OIN F;  2B0J A;  2KGO A;  3EGX B;  2Q9C A;  4R32 A;  3NMJ A;  2XLM A;  3JTL O;  4A2N B;  4DVZ A;  2Y3D A;  4X0R A;  4EHP A;  4Q5S F;  2M4E A;  4NQF A;  3W2V A;  1WTY A;  1TWC A;  2KQ9 A;  4JTD B;  2XS1 A;  2IXP A;  3DKA A;  4FX5 A;  1M2V B;  4CS8 A;  4XPY A;  2CYD A;  3M4B A;  3Q6N A;  3GM1 A;  2J0X A;  4WGY A;  3ZG1 A;  3TOM A;  3ZTM A;  1OCO C;  1ZYR F;  2Q00 A;  1S05 A;  4JCZ A;  3SEO A;  4C3E A;  3C62 A;  3ZWI A;  1MMN A;  4BJ5 C;  4U5E E;  4JEA A;  1SR2 A;  3RYL A;  3S90 A;  4HFK B;  3DMD A;  1WN0 A;  4EBK A;  3DWW A;  4G7O F;  1TWG A;  2XLE A;  1FNT c;  2WZL A;  4IJJ A;  1TWA A;  1YZC A;  3IEE A;  4I1O B;  2WZG A;  3QVY A;  3PDM P;  1QKR A;  3ASN C;  2DI3 A;  5KYU B;  5KYY A;  3UGO A;  1CPQ A;  2MHR A;  2VCB A;  1A7E A;  3HNL A;  4HE8 D;  3B0P A;  4AL1 A;  2KK1 A;  3LNR A;  2YLD A;  4O6Y A;  2OOC A;  2XL4 A;  4Z9H A;  1D0X A;  3QMK A;  4MVM A;  5KYX B;  2OJE D;  1FAP B;  4AX2 A;  2DYS C;  2ZXO A;  1YDI A;  4MVS A;  1NLX A;  3KYJ A;  4J32 B;  2CNW D;  1R5I D;  4CX9 A;  1QZX A;  3K6B A;  4C7O B;  3V5X A;  2YLG A;  4LAC B;  2HUJ A;  2RSE B;  2ZXR A;  5JLI A;  2M64 A;  2QLA A;  1B68 A;  3M1C B;  3AG1 C;  4O79 A;  4O7G A;  3ZIB A;  1V74 B;  3S0X A;  1LI7 A;  2J0W A;  2A0U A;  2DGJ A;  3B9Q A;  1HMD A;  3MYF A;  3OWT A;  4MVO A;  1LI5 A;  3SZR A;  3UMH A;  3EHN A;  4LLC A;  3A11 A;  1LE2 A;  3GWN A;  3JSZ A;  4W8K A;  3LES A;  3A9C A;  3FVY A;  2HMQ A;  3V5Z A;  4KI2 A;  2OQM A;  2MYS A;  2L6G A;  2Q9B A;  3MFN A;  4KC9 A;  4UDV A;  1IZM A;  3M4C A;  4LDR A;  3QW0 A;  2H7O A;  1H7I A;  1A0B A;  1NBB A;  4ULV A;  2EIL C;  1G4W R;  2R7S A;  2V26 A;  1YAU O;  3NKE A;  5D92 A;  4XLP F;  3SXM A;  4MTF A;  4MVR A;  4RDA A;  2XSE A;  3NKD A;  1T6I A;  2OCC C;  1FMW A;  3ASO C;  4RBN A;  4NTB A;  4PJN A;  1NU7 D;  2RD9 A;  5DLJ A;  1WGW A;  2I15 A;  2IBF A;  4DRI B;  2LFD A;  2E87 A;  1O5H A;  3DE8 A;  4QI0 A;  5A6A A;  5L3Q A;  2YL3 A;  2XRH A;  1JOG A;  2Y3G A;  1PD0 A;  1OCC C;  3CAX A;  4ZLD A;  1M57 C;  3NYJ A;  4IAO A;  1CGO A;  1R4T A;  3FAP B;  3RKO F;  4E7S A;  3RH3 A;  2XXA A;  2PBE A;  4YWQ A;  3O39 A;  1T01 A;  4P6I C;  1JRA A;  2X0C A;  3S27 A;  4M63 A;  3MYI A;  4CS7 A;  3RQE A;  4G7Z F;  3I5Q A;  1OXK A;  1Q0G A;  5FCL A;  3GOR A;  3Q7G A;  3SXK A;  2W9Y A;  2BL2 A;  3GWL A;  1RCP A;  1HMO A;  4OIP F;  3V5Y A;  2AP3 A;  2EPL X;  4KNV A;  3O10 A;  5B3S C;  1U89 A;  1VOM A;  1A7V A;  4P9F A;  1ST6 A;  2EIM C;  4AE4 A;  3LUT B;  3GAN A;  3U8P A;  2EPN A;  2HJ3 A;  1Z7Q c;  1PCX A;  1KTM A;  2A69 F;  4MW8 A;  3NMK A;  4U5C E;  5A6K A;  1HE9 A;  3FAJ A;  2CDQ A;  2XLD A;  1MMA A;  4BG0 A;  3VF0 A;  2NUP B;  2AWY A;  1D1B A;  5L0J A;  2EIJ C;  2DYR C;  2HZ8 A;  2R7Q A;  4N4W A;  3T4R A;  4PJJ A;  2PX3 A;  2YHS A;  1WOL A;  1RKE A;  3EFO A;  3CQZ A;  1EI7 A;  2H7B A;  1ZHX A;  4MVZ A;  3O55 A;  3ZC4 A;  2QE9 A;  3JCU Q;  5JT4 A;  2G62 A;  4HFF B;  1AVO B;  5AC5 A;  4BEM J;  2CW0 F;  4L6R A;  3AGT A;  4MVU A;  4D4X A;  5CI9 A;  5L0H A;  1TR2 A;  3DAG A;  5DS5 A;  5L3V A;  2Z15 A;  1H6G A;  2QTV A;  4BPM A;  4GQH A;  5EGY A;  1Y4C A;  3RF3 A;  1ZHT A;  5HV9 A;  2WL8 A;  2J8W A;  1TFO B;  3B29 A;  1EA8 A;  4XTK A;  4EUK B;  1V4A A;  2IXN A;  2YVK A;  3G4X A;  4QI2 A;  1L3P A;  1V55 C;  4G0H A;  4XWJ A;  3ABL C;  4PK4 A;  5E2Q A;  5T3W A;  1ZHY A;  3FOO A;  3CZ6 A;  3R2P A;  1KU2 A;  2R7O A;  2W4M A;  4CIH A;  2TMV P;  1T9K A;  3ZDL A;  3LEO A;  1VTM P;  2WZF A;  3S84 A;  4AK9 A;  2J9V A;  4LDK A;  1OW6 A;  5DVW A;  2FFH A;  1LS4 A;  2HKV A;  4A4A A;  2R7R A;  3F47 A;  1HW2 A;  1MQV A;  1T6U A;  1Q0K A;  1Y6D A;  2XL6 A;  3ZTZ A;  1ORS C;  4XPW A;  2WB7 A;  4E0H A;  5HSW A;  3RVZ A;  1UFB A;  2C03 A;  4YL3 A;  2P6V A;  2ASR A;  2R25 A;  2VCC A;  5E3A A;  2HV7 A;  3QZC A;  2JPU A;  3EG9 A;  3KPH A;  4AL0 A;  3EH2 A;  4FES A;  4JTA B;  3ITF A;  1YA9 A;  2LP4 A;  1YA7 O;  2L9J A;  3ECS A;  2R02 A;  3F46 A;  3FMS A;  4K0D A;  3X1O A;  1ZHW A;  3R7C A;  4CJG A;  2HSB A;  1QQ3 A;  5CIV A;  1CGN A;  1T6Q A;  2J9U A;  4CJO A;  4C7O A;  4JVS A;  1OKK A;  2FAP B;  4IGG A;  4EWC A;  4BJ1 A;  4IAQ A;  4ULW A;  4W8P A;  4MQ9 F;  2YKZ A;  4LDQ A;  3HJC A;  2P7V A;  4JCH A;  2BE5 F;  5COG A;  3ZQY A;  2R05 A;  3B0U X;  2ZXW C;  1M2O A;  3U9J A;  2NUT A;  2LD6 A;  4N6H A;  4YT4 A;  3HLZ A;  1G5Z A;  2P61 A;  2JD3 A;  3US6 A;  2WVQ A;  3HKK A;  3V7O A;  2EIK C;  3C8G A;  3GEI A;  4JC7 A;  4CS9 C;  1IW7 F;  3QW1 A;  1OXB A;  1VB5 A;  1XZP A;  2KJG A;  2QUP A;  3TK0 A;  3DZA A;  4CDV A;  1D0Z A;  4OIQ F;  3TD7 A;  5L0I A;  5DS4 A;  4WGZ A;  1OCZ C;  2LQG A;  1E84 A;  2R7V A;  4BJ6 C;  4G7H F;  2J7P A;  4YJW A;  5COF A;  3KH2 A;  4HEA J;  2W45 A;  4IAR A;  1Q0F A;  2YLI A;  1GS9 A;  3AGU A;  5TJ5 E;  3POV A;  2O9X A;  3EQL F;  1ZU4 A;  1AEP A;  1G8X A;  4U9E A;  4J7Y A;  3GEE A;  3H2U A;  3QVZ A;  2P0N A;  1OQC A;  1U0B B;  2OEV A;  4U5F E;  1SZI A;  4G78 A;  4PJL A;  1RJ9 B;  2HMZ A;  3ZVR A;  2YL0 A;  4OD5 A;  1QVX A;  2A1D D;  2EPO A;  1ZHZ A;  1CPR A;  2PF4 E;  2ETS A;  2KSF A;  4DVY P;  3LLI A;  4DOZ A;  3N24 A;  2A6H F;  1YVI A;  3KYI A;  4BJ5 A;  4DBQ A;  3HNK A;  1FMV A;  5F5F A;  1C02 A;  1BR4 A;  1MNE A;  5A6B A;  3SNH A;  1XZQ A;  3E70 C;  3PMR A;  4H4K C;  4PR9 A;  3GM3 A;  4JJF A;  2F22 A;  3QTH A;  5L0G A;  1YYX A;  1G4U S;  2LIG A;  2XLH A;  3EPV A;  1VMA A;  3T6G B;  4OIO F;  3JRT A;  3VAY A;  4JKV A;  4IWB A;  3EHM A;  4MW3 A;  5T3T A;  4E18 A;  4GEH A;  1YLM A;  2D4U A;  3C7J A;  3VM6 A;  5BUO A;  4F4B A;  2VH3 A;  3TUL A;  1ORY A;  3U0C A;  5EK0 A;  2C04 A;  3EZI A;  1YAR O;  3K7D A;  2LCH A;  4PFP A;  2EPK X;  2YEV A;  3BRJ A;  3RVY A;  3U5S A;  5DQZ A;  2GWW A;  2IOQ A;  2YRF A;  3N0T A;  4OIR F;  4YN0 B;  2R03 A;  4XQ1 A;  2HSQ A;  2PNO A;  4CDA A;  3RIP A;  3L8J A;  3U3F A;  4CS8 C;  1E83 A;  3PCV A;  1MND A;  3C8Z A;  4JUR I;  2XM4 A;  4I1M A;  1NFN A;  5A69 A;  3T9O A;  1E2X A;  2GFH A;  3LAY A;  2EIN C;  3EGD A;  2OG2 A;  3FHD A;  5KYW A;  4H54 A;  2OKU A;  2XXA B;  5F28 E;  4DRJ B;  1FR0 A;  1VK5 A;  3EZH A;  4XLN F;  4E17 A;  5DS6 A;  3JZ0 A;  3IQC A;  2XL8 A;  3S28 A;  3I4U A;  3J06 A;  4JW1 A;  1LS1 A;  4DRH B;  3GEH A;  2J46 A;  1APC A;  2XM0 A;  5BQG A;  5T1D B;  3ZQV A;  4BJ6 A;  5JRA A;  4NTF A;  2I8B A;  2GDC A;  3UMI A;  3Q7L A;  3SXY A;  1ZVZ A;  2PFD A;  3LLK A;  1J8Y F;  1JPN A;  3DD7 A;  4I3M A;  1N1C A;  1UG7 A;  3C18 A;  4LER A;  4Z9J A;  4BJT A;  3EGX A;  4ANJ A;  4P9T A;  3LJB A;  5BQI A;  1WAS A;  3DXJ F;  3B0V C;  3PHF 2;  256B A;  4Z9I A;  4AE4 B;  4PJM A;  3G50 A;  1L7C A;  1H9T A;  3WOD F;  3S9O A;  2L7A A;  2VCA A;  3C63 A;  4YK5 A;  3OEO A;  4CSA C;  2QNL A;  1M2V A;  5F5H A;  1LM3 B;  3K33 A;  3LNM B;  1SF8 A;  2R7U A;  1Q0M A;  1I4Z A;  2YL1 A;  3RW0 A;  3W2W A; 
#chains in the Genus database with same CATH homology
 4U5D E;  2WVO A;  2CNW A;  3KMI A;  3AG3 C;  3T6J A;  2Q3T A;  4EBB A;  1BR1 A;  2VAS A;  3CSK A;  3DJN B;  3JYH A;  2CGE A;  2Y69 C;  3NG1 A;  4U5B E;  3MLG A;  3DJU B;  3K1H A;  1D1A A;  3Q6M A;  3T6B A;  1D1C A;  4PFO A;  5KYU A;  5KYN A;  3ZSU A;  4YT8 A;  1D0Y A;  5B1B C;  3DAF A;  2R7T A;  4J30 B;  2YZS A;  3RFY A;  2IXO A;  2KNH A;  3E9V A;  4I44 A;  1TKN A;  5KYX A;  3FDQ A;  1FTS A;  3I5P A;  4YT2 A;  3ABM C;  4K7B A;  2G3V A;  3JT1 A;  1NZE A;  1FFT C;  5D91 A;  4O6N A;  4QDL A;  2IYL D;  1O87 A;  4FWV A;  3EH1 A;  3OA1 A;  3VYW A;  1NU9 C;  3UR3 C;  4E7Z A;  4OD4 A;  1PD1 A;  5E3C A;  2MWQ A;  1MMD A;  2W4B A;  2A68 F;  4O6M A;  1ZU5 A;  1V54 C;  3EG9 B;  2H7V C;  3NRH A;  4BEJ A;  4DBR A;  3W8H A;  1RJ9 A;  4CSA A;  1VYI A;  4KBL A;  3SYN A;  4Q4Z F;  5DQT A;  3EJN A;  4U5H A;  5KYY B;  5B1A C;  5CI8 A;  2R7X A;  4C3B A;  3HTK C;  3NYM A;  3MX3 A;  4C3D A;  3K1I C;  5E33 A;  2V3C C;  5IY5 C;  1TWH A;  2FGY A;  2NUT B;  2L81 A;  1LVK A;  1LKX A;  4KNW A;  2D5R B;  4Q7C A;  3KKB A;  2Y3B A;  1NG1 A;  4MND A;  2J45 A;  3H65 A;  3NDB B;  3N2Z B;  2Y39 A;  4GYT A;  4CBE A;  2A6E F;  3ABK C;  2R7W A;  3AG4 C;  1MMG A;  1OKK D;  3LS1 A;  2G3K A;  4ZLC A;  2J9W A;  3LEV A;  2NUP A;  3UGP A;  2X51 A;  1Z5Z A;  3AQB A;  3S29 A;  3LS0 A;  3L0I A;  2Q9A A;  2PP4 A;  4NY3 A;  1QLE C;  4JZA A;  2ZXP A;  3UNG C;  1FFH A;  2PX0 A;  4CS9 A;  3O6X A;  3WG7 C;  2J7P D;  3UMK A;  2WVN A;  2ZPA A;  3GOD A;  2IXM A;  3L34 A;  2NG1 A;  3W8I A;  3KL4 A;  1OCR C;  1BR2 A;  4IRU A;  3NYL A;  2KW3 C;  2Y3H A;  4YT5 A;  3AG2 C;  1JPJ A;  3X2Q C;  2VB6 A;  4U5G A;  2HV6 A;  2QY9 A;  4RD9 A;  3SP1 A;  2LSE A;  4N06 A;  4LLE A;  1W2W A;  1M56 C;  3K66 A;  5EHH A;  1Z23 A;  1VYK A;  4WJ0 A;  3EGD B;  5KYW B;  3DM9 B;  3EFO B;  1S7Z A;  4JJG A;  1Z63 A;  1SMY F;  1Z3I X;  1Z6A A;  3AQC A;  3DM5 A;  4B6I A;  1J8M F;  4OIN F;  2B0J A;  2KGO A;  3EGX B;  2Q9C A;  4A2N B;  4DVZ A;  2Y3D A;  4X0R A;  4Q5S F;  2M4E A;  3W2V A;  1TWC A;  2KQ9 A;  2IXP A;  4FX5 A;  1M2V B;  4CS8 A;  3Q6N A;  2J0X A;  3ZG1 A;  1OCO C;  1ZYR F;  3SEO A;  4C3E A;  1MMN A;  4BJ5 C;  4U5E E;  3RYL A;  4HFK B;  3DMD A;  4G7O F;  1TWG A;  2WZL A;  4IJJ A;  1TWA A;  3IEE A;  4I1O B;  2WZG A;  3ASN C;  5KYU B;  5KYY A;  3UGO A;  4HE8 D;  3B0P A;  3LNR A;  4O6Y A;  2XL4 A;  1D0X A;  3QMK A;  5KYX B;  4AX2 A;  2DYS C;  2ZXO A;  4J32 B;  2CNW D;  1QZX A;  3K6B A;  4C7O B;  4LAC B;  2ZXR A;  3M1C B;  3AG1 C;  4O79 A;  4O7G A;  3ZIB A;  3S0X A;  2J0W A;  2DGJ A;  3B9Q A;  3UMH A;  3OWT A;  3SZR A;  3EHN A;  4LLC A;  4W8K A;  3JSZ A;  3LES A;  3FVY A;  4KI2 A;  2MYS A;  2Q9B A;  4KC9 A;  1IZM A;  2H7O A;  2EIL C;  2R7S A;  2V26 A;  3NKE A;  4XLP F;  5D92 A;  4RDA A;  2XSE A;  3NKD A;  2OCC C;  1FMW A;  3ASO C;  4RBN A;  4PJN A;  1NU7 D;  5DLJ A;  1WGW A;  2E87 A;  1O5H A;  4QI0 A;  5L3Q A;  2XRH A;  2Y3G A;  1PD0 A;  1OCC C;  4ZLD A;  1M57 C;  3NYJ A;  4IAO A;  3RKO F;  4E7S A;  2XXA A;  3RH3 A;  4YWQ A;  3O39 A;  4P6I C;  3S27 A;  4M63 A;  4CS7 A;  4G7Z F;  3I5Q A;  5FCL A;  3Q7G A;  2W9Y A;  4OIP F;  4KNV A;  5B3S C;  1VOM A;  1ST6 A;  2EIM C;  4AE4 A;  3GAN A;  1PCX A;  2A69 F;  4U5C E;  3FAJ A;  2CDQ A;  1MMA A;  4BG0 A;  2NUP B;  1D1B A;  2EIJ C;  2DYR C;  2R7Q A;  3T4R A;  4PJJ A;  2PX3 A;  2YHS A;  3EFO A;  3CQZ A;  2H7B A;  1ZHX A;  3ZC4 A;  3JCU Q;  2G62 A;  4HFF B;  2CW0 F;  5CI9 A;  1TR2 A;  3DAG A;  5DS5 A;  5L3V A;  2Z15 A;  2QTV A;  5EGY A;  1ZHT A;  2WL8 A;  4XTK A;  2IXN A;  4QI2 A;  1V55 C;  4G0H A;  4XWJ A;  3ABL C;  4PK4 A;  5E2Q A;  5T3W A;  1ZHY A;  3CZ6 A;  1KU2 A;  2R7O A;  2W4M A;  4CIH A;  2WZF A;  4AK9 A;  2J9V A;  5DVW A;  2FFH A;  2R7R A;  3F47 A;  2WB7 A;  5HSW A;  2C03 A;  2P6V A;  5E3A A;  2HV7 A;  3QZC A;  3EG9 A;  3EH2 A;  4FES A;  3ITF A;  3ECS A;  2L9J A;  3F46 A;  3X1O A;  4K0D A;  1ZHW A;  4C7O A;  2J9U A;  4JVS A;  1OKK A;  4EWC A;  4BJ1 A;  4ULW A;  4MQ9 F;  3HJC A;  2P7V A;  4JCH A;  2BE5 F;  3B0U X;  2ZXW C;  1M2O A;  2NUT A;  4YT4 A;  3HLZ A;  2JD3 A;  2WVQ A;  3V7O A;  2EIK C;  4CS9 C;  1IW7 F;  2KJG A;  3DZA A;  1D0Z A;  4OIQ F;  3TD7 A;  5DS4 A;  1OCZ C;  2R7V A;  4BJ6 C;  4G7H F;  2J7P A;  4YJW A;  3KH2 A;  4HEA J;  2W45 A;  3POV A;  2O9X A;  3EQL F;  1ZU4 A;  1G8X A;  4U5F E;  1SZI A;  4PJL A;  1RJ9 B;  3ZVR A;  4OD5 A;  2A1D D;  1ZHZ A;  2PF4 E;  4DVY P;  3LLI A;  4DOZ A;  3N24 A;  2A6H F;  4BJ5 A;  4DBQ A;  1FMV A;  5F5F A;  1BR4 A;  1MNE A;  3SNH A;  4H4K C;  3E70 C;  3PMR A;  4JJF A;  3EPV A;  1VMA A;  4OIO F;  3JRT A;  3VAY A;  4IWB A;  3EHM A;  5T3T A;  4GEH A;  5BUO A;  4F4B A;  2VH3 A;  2C04 A;  3EZI A;  3K7D A;  4PFP A;  5DQZ A;  2YEV A;  2IOQ A;  3N0T A;  4OIR F;  4YN0 B;  3RIP A;  4CS8 C;  1MND A;  4JUR I;  4I1M A;  2GFH A;  3LAY A;  2EIN C;  3EGD A;  2OG2 A;  3FHD A;  5KYW A;  2XXA B;  1VK5 A;  3EZH A;  4XLN F;  5DS6 A;  3S28 A;  3I4U A;  4JW1 A;  1LS1 A;  2J46 A;  5T1D B;  4BJ6 A;  2I8B A;  3UMI A;  3Q7L A;  3LLK A;  2PFD A;  1J8Y F;  1JPN A;  3DD7 A;  4I3M A;  1N1C A;  4LER A;  4ANJ A;  4BJT A;  3B0V C;  3EGX A;  3LJB A;  3DXJ F;  3PHF 2;  4AE4 B;  4PJM A;  3WOD F;  4CSA C;  3OEO A;  1M2V A;  5F5H A;  3K33 A;  1SF8 A;  2R7U A;  3W2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...