3M79A

A tetrameric zn-bound cytochrome cb562 complex with covalently and non-covalently stabilized interfaces crystallized in the presence of cu(ii) and zn(ii)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHDALHLANEGKVKEAQAAAEQLKCTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Soluble cytochrome b562
publication title Evolution of metal selectivity in templated protein interfaces.
pubmed doi rcsb
source organism Escherichia coli
total genus 48
structure length 106
sequence length 106
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2010-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3m79A00
4CDAA 5JRAA 4WGZA 2YLDA 2XL8A 4D4XA 4IAQA 3QVYA 3HNIA 3FOPA 2J9BA 3QVZA 2XLMA 4L6RA 3DE8A 3DE9A 1YYXA 1E84A 1CPQA 2XM4A 1S05A 2YL3A 3QW1A 4JEAA 2YLGA 1A7VA 3C63A 4IB4A 2YKZA 4CX9A 4CIPA 1GQAA 3C62A 1YYJA 3ZTZA 1YZAA 3HNLA 4U9DA 3ZQVA 2XLOA 2YLIA 1MQVA 3M79A 1CGOA 1M6TA 1BBHA 1APCA 1CGNA 3QW0A 4U9EA 2YL0A 1CPRA 3ZQYA 4WGYA 3IQ5A 1LM3B 2XLDA 2YL1A 2XM0A 1NBBA 4CDYA 3HNKA 2XLVA 3NMIA 1E83A 3IQ6A 4CDVA 1YZCA 2J8WA 1QPUA 3L1MA 5AGFA 5JT4A 4JKVA 2QLAA 1E86A 3ZWIA 3M4BA 3VRCA 4JE9A 4D4NA 4ER9A 2XLEA 3M15A 1QQ3A 4ULVA 4N6HA 3HNJA 4N4WA 2BC5A 4CJOA 1RCPA 4CJGA 3NMKA 5B3IA 1EKYA 3U8PA 3M4CA 2CCYA 4NC3A 5JSLA 5JVEA 2XL6A 5JP7A 5JLIA 3NMJA 256BA 5JS5A 4IARA 4JEBA 3TOLA 3TOMA 3ZTMA 4EIYA 5JUAA 2YL7A 1E85A 3FOOA 1JAFA 2XLHA 2XLWA
chains in the Genus database with same CATH superfamily
1VYIA 3JYYA 1H9GA 2WL8A 1JOGA 2L6FA 1FMWA 4O7GA 2EIKC 2YLDA 1T6QA 2XL8A 4HFKB 1LPEA 1XWJA 3B29A 1MNDA 3JSZA 3Q6NA 3SZRA 4U5BE 4Z9IA 4DBRA 4XPWA 1LIHA 2KNHA 3LLKA 3MBGA 3FOPA 1Z23A 2OJED 4QI2A 4PJJA 4XEKA 2LIGA 4AE4A 4MVUA 4JJGA 4MS2A 4PFPA 3GM3A 2CNWA 2J9UA 4NY3A 1KNYA 4NCQA 1IZMA 1A7EA 2GDCA 5KYWB 1C17M 1CPQA 1LE4A 2XM4A 2LQGA 2R7VA 1ORYA 1S05A 1D1BA 3ASOC 4DXWA 2L6HA 3FDQA 1Z5ZA 2GWWA 3AQBA 4IB4A 4CS9C 4CIPA 3DM5A 1GQAA 4B6IA 1ZHZA 3C62A 2XRHA 3TQOA 1MMGA 1JRAA 4J7YA 2EPNA 1F1MA 1O87A 3GORA 1ZYRF 3CSKA 4YJWA 3ZSUA 1FMVA 2LFDA 2XLOA 2M4EA 2Q7RA 1AUEA 2YLIA 2J9WA 1YARO 4XPYA 1JPJA 1PD0A 3L34A 4KNWA 3AG2C 5BQIA 3KL4A 1V74B 4Q5SF 2AVKA 4GYTA 1M56C 2X51A 5D92A 3VF0A 1BBHA 5L0CA 4G78A 3RQFA 2R7RA 3EZHA 4A4AA 4CSAA 1KU2A 3LJBA 1CPRA 2M64A 3EHMA 3IQ5A 3ZC4A 2BL2A 1K04A 1BDJB 2KYHA 2XS8A 2RD9A 3AGUA 4YT8A 4OINF 1OR2A 3EHNA 5F5FA 2R03A 1E2XA 2Q00A 4OIOF 3EPVA 3I5PA 2F22A 2GA0A 4CDYA 4U5FE 1LI7A 2HV7A 2VC9A 2HMQA 1D1CA 2XLVA 1MMNA 3B0UX 2Y39A 3DJNB 1ZZPA 3IQ6A 4DBQA 2LSEA 2R05A 2DI3A 4UDVA 1ZHYA 4E0HA 2OJQA 1G4WR 1GS9A 2D5RB 3DM9B 3L8IA 3TD7A 3WAQA 5BUOA 2NSGA 3EQLF 2WZFA 3K6BA 4BJ5C 3ZIBA 1HW2A 2L9JA 5AGFA 5JT4A 1NLXA 1OCCC 2HS5A 3KPHA 5A6KA 1AVOB 2QLAA 1XZQA 2QY9A 4JTCB 5AC5A 4LDKA 3ECSA 2NSFA 3SXYA 3OA1A 4U5CE 4YT5A 3K7DA 3S90A 4C7OB 3M4BA 3M1CB 2UUIA 3U0CA 3VRCA 1K40A 3K33A 5KYXB 3U5SA 4Q4ZF 3ABLC 4D4NA 1YA7O 2HSQA 4JTDB 3JSEO 2PX0A 4JIOA 2A0UA 1OXBA 2AU5A 4HEAJ 3M15A 1LE2A 1T5OA 3ZG1A 2Y3GA 4IJJA 4CS7A 5IY5C 3EGXA 2CYDA 3B0PA 4N4WA 2BC5A 2ZXRA 4LERA 3LS0A 4IWBA 4YL0A 4YK5A 2O9XA 2XXAA 1EKYA 3B9QA 5DQTA 1DOWA 1ZHWA 2CCYA 1MMAA 2OEXA 3AJMA 4PJNA 1QLEC 1TFKB 1TR2A 2XL6A 2V26A 3H2UA 4QDLA 4XLNF 5DS4A 4PJLA 1O3UA 1HE1A 3T6GB 2NUTA 2L7AA 1I4YA 2P1AA 4U5HA 2ETSA 1JAFA 4KNVA 3UMKA 1BR2A 4ULWA 2PNOA 1OW6A 3DAFA 3MLGA 4CDAA 4EBKA 2FFHA 3H2VA 1EQ1A 2R25A 1ST6A 2EINC 1O5HA 3T6BA 3V7OA 4IAQA 5KYYB 4CS9A 3KYJA 2V3CC 2OOCA 4Z9HA 3SXKA 2IBFA 3TJ6A 1NSGB 1OR3A 2XLMA 1TKNA 3HJCA 3QVZA 4RD9A 1J8MF 4JRZA 3W8HA 2LCHA 2ASRA 4HFFB 3FAJA 1YYXA 1E84A 2H7OA 2FAPB 3QMKA 2NUPB 1AEPA 3MYIA 3NYMA 4MVZA 1ZU4A 1VLSA 1VOMA 5D91A 1UFBA 3DKAA 2QE9A 3N24A 3O10A 3Q6MA 3QW1A 4JEAA 4OD4A 4X0RA 2YLGA 2B0JA 4O6YA 2EPMX 2VB6A 1Q0KA 1G4US 1A0BA 1S7ZA 3A9CA 2HKVA 3L8JA 3RH3A 1FNTc 2WZGA 5E3CA 2TMVP 5KYNA 4NQFA 1YYJA 1QSPA 2XSEA 4IGGA 3U9JA 3W2VA 3S0XA 2PP4A 2A68F 4O79A 1Q0FA 2HV6A 4C3DA 4DOZA 4Q7CA 3AQCA 4HE8D 1D1AA 3I4UA 3IEEA 1T6IA 3EG9B 2IXNA 3GM1A 1QKRA 3TK0A 3S28A 2JPUA 2R7TA 3JRMO 3GEEA 4DJ9A 1Y4CA 2IXPA 4U5DE 1RKEB 1M6TA 5L3QA 3U3BA 4KBLA 1SMYF 5KYWA 2DGJA 1OQCA 2L6GA 4BJ5A 1FFHA 1APCA 3SP1A 4G0HA 4M63A 2W4MA 4O6MA 3UNGC 2YL0A 4DRIB 1NU7D 4WGYA 2EPLX 3MYFA 2XL4A 4U5EE 3V5YA 5L0FA 2R7WA 2XM0A 2VASA 3LEVA 4E7SA 4NTFA 1ZW2A 3LS1A 1T6UA 4RBNA 2R7QA 1NBBA 3S27A 2Y3DA 1EA8A 1OCRC 4LACB 5A6JA 1H9TA 3NMIA 5E2QA 2LD6A 1W2WA 1WN0A 3IQTA 4MW3A 3WODF 5CI9A 1MNEA 4AE4B 1TWAA 2LP4A 2RSEB 4RDAA 2G3VA 4H54A 1VK5A 4YL1A 3O39A 1YZCA 3O55A 4JC7A 3U8VA 5L0HA 1DOVA 4MTGA 4JURI 3GM2A 1QPUA 1M2VA 2H7BA 3RVYA 1NZEA 3RKOF 4JKVA 5T1DB 4BJ6C 4I3MA 4XEFA 3GWLA 1M57C 3QTHA 3ZWIA 5EHHA 3ZVRA 3DJUB 1Y6DA 2KJGA 4EKWA 2Z15A 5B1BC 2DYSC 3K1IC 3NYLA 1YLMA 1RJ9A 5E3AA 1WASA 4XTKA 2PBEA 3IPMO 1V55C 4DRJB 2P0NA 3IHUA 1ZHTA 1JR8A 4MVQA 3HNJA 4ZLDA 5L0DA 3PMRA 1R5ID 1U6HA 3JCUQ 2KGOA 4CJOA 1I5NA 4N6CA 4DVYP 3FMSA 3GANA 1TWCA 2KW3C 3OEOA 1HMOA 4IAOA 4AL0A 5L3VA 3NMKA 2JD3A 4G7OF 3NDBB 2G3KA 3GWNA 5KYUB 3B0VC 1N1CA 4NC3A 1FFTC 1L3PA 1RKCA 2UUHA 4KC9A 5JLIA 3RFYA 4R32A 4CS8C 4ZLCA 5JS5A 4WABA 4EIYA 4BPMA 3C18A 5JUAA 1ORSC 1PD1A 3NRHA 2R9RB 2B0HA 4C7OA 1OW7A 3FOOA 1VMAA 4EWCA 2HFIA 2KSFA 2CGEA 4MQ9F 2YRFA 5JRAA 3FAPB 4WGZA 2R02A 2A1DD 2Y69C 3KKBA 4LDQA 1A41A 2AP3A 2Q4FA 2HUJA 3LUTB 4D4XA 2WB7A 1Z3IX 1JPNA 2WVQA 3LEOA 5EGYA 3HNIA 1EI7A 2J9BA 2QNLA 4I44A 4A2NB 1SYQA 5A6BD 4L6RA 3G50A 4P9TA 4K0DA 4EUKB 3X2QC 3AOUA 3E9VA 2ZXWC 1U89A 3AG4C 3GEHA 1RMVA 4JW1A 2DB4A 1T9KA 3CEXA 3ITFA 1ORJA 4WJ0A 2OQMA 4CBEA 4OIRF 4GQHA 1J8YF 2CW0F 5HV9A 4U5GA 5L0GA 1C02A 5F28E 1Q0MA 3EFOB 2YKZA 5COMA 3VAYA 5DS5A 4MVMA 1NU9C 2WVNA 3EGXB 1YZAA 2AWCA 2J7PD 3N2ZB 3ASNC 4GEHA 3DI5A 3K1HA 4YT2A 2C03A 3Q7LA 5K0IA 3RYLA 3KH2A 2KK1A 4OD5A 3F47A 2XXAB 3AG1C 2Q9BA 3W8IA 3G4XA 4BEJA 2L81A 1H6GA 3C8GA 3NG1A 5TJ5E 2EPKX 3M79A 4BEMJ 1H7IA 2QUPA 4EBJA 2DYRC 4XPXA 1V4AA 3KMIA 3NYJA 2IOQA 4MW8A 3H65A 1CGNA 4FWVA 3QW0A 4E7ZA 4W8KA 4O6NA 1OW8A 4EBBA 4JZAA 5CIVA 4BJ6A 1G5ZA 1LM3B 1OKKD 1OXKA 2XLDA 4FX5A 1OCZC 1SR2A 4G7HF 1NFOA 2I15A 3V5ZA 3W2WA 3CQZA 2ICWG 2D4UA 3K1IA 4LDRA 2J46A 4JJFA 4BG0A 1SF8A 1E83A 1VTMP 3KYIA 2I8BA 4CDVA 2HJ3A 2R7SA 3RQGA 3FHDA 5GPGB 2IM8A 3TULA 3ZDLA 2J8WA 3JTLO 1TWHA 3EG9A 3MX3A 4FAPB 3T4RA 4YT4A 1Q0DA 3PCVA 2AWYA 3DAGA 3E70C 3L1MA 4I1OB 4PACA 2JX0A 3UR3C 1ZU5A 3DMDA 2HSBA 3S84A 1RKEA 2IXMA 2PF4E 3B71A 3EGDB 1E86A 2W4BA 2OKUA 2Y3BA 3LNRA 1Z63A 1YA9A 1D0ZA 3GEIA 4JE9A 5FZTA 1QZXA 2ZXPA 4ANJA 4CS8A 1VLTA 1Q0GA 2EIMC 2J0WA 2XLEA 1FAPB 3U9MA 3VYWA 3PHF2 2H8AA 1C03A 1ZVZA 3CAXA 4H4KC 4K7BA 4N6HA 1OCOC 3ABKC 2Q9AA 3RQEA 2ZPAA 3NKEA 4CIHA 4C3BA 1RCPA 3V5XA 2YHSA 4DRHB 1T01A 2GAQA 1YVIA 1K05A 2WVOA 5B3IA 2R7XA 3FXHA 1VYKA 2ZXOA 2E87A 3DWWA 3M4CA 4E17A 1GM5A 3HKKA 1BZ4A 5JSLA 5JVEA 1QVXA 2OU6A 4NTBA 5BQGA 3U2LA 2PFDA 3NMJA 1M2OA 5DLJA 2LFFA 2P6VA 1HE9A 3TOLA 2VCBA 3TOMA 1LS4A 2CNWD 3W4YA 3T6JA 4AX2A 3LESA 4JVSA 2YL7A 1XZPA 1BR1A 1LS1A 4BJ1A 2A0BA 2W45A 2X0CA 1B68A 3L0IA 1LVKA 2PX3A 4PR9A 1I4ZA 3SEOA 4BJTA 4PFOA 3Q7GA 4MVOA 3EZIA 3QZCA 1TQGA 3QVYA 4MNDA 2A69F 2MWQA 4K1OA 1L7CA 2HJMA 1M2VB 1YAUO 3RVZA 3A11A 3G4ZA 3R2PA 3DE8A 2MHRA 3SYNA 3DE9A 1WATA 3POVA 1CGME 1TFOB 4MTFA 3UMHA 4OIQF 5KYUA 5L0JA 1U0BB 2EIJC 4N06A 1PV3A 1HMDA 4YN0B 5DS6A 1UG7A 2YL3A 2G62A 2XLWA 3EJNA 1RJ9B 5CI8A 5F5HA 2QTVA 3F46A 4OIPF 1A7VA 4P9FA 2WZLA 3C63A 2VH3A 4JCZA 5COGA 4CX9A 2LK4A 3JT1A 5KYXA 2ZD9A 3WHNA 5COFA 2YEVA 4MVSA 1WWPA 1V54C 3ZTZA 5A6BA 4IRUA 3HNLA 3O6XA 5A69A 5A6AA 2Q9CA 4J30B 3T9OA 4U9DA 3ZQVA 4E18A 4MTOA 4XEVA 5HSWA 3HTKC 3N0TA 1FR0A 3EH2A 3FVYA 4QI0A 4KI2A 3TJ5A 4YL3A 1MQVA 3UGPA 1HY5A 3JRTA 5DQZA 5L0IA 2YVKA 3UMIA 4PJMA 3J06A 1RXQA 1CGOA 2R7UA 3LNMB 1ZHXA 1NFNA 5B1AC 4AK9A 2J0XA 2IYLD 4U9EA 5BQHA 4EHPA 2KQ9A 3ZQYA 3CZ6A 1A7DA 2J7PA 5E33A 2YL1A 2VCCA 2MYSA 4FESA 2P61A 3EFOA 2HMZA 2A6EF 3ATPA 2YWAA 5B3SC 3HNKA 3ABMC 3WG7C 2EILC 4XLPF 1HW1A 3GODA 1TWGA 3LAYA 2OG2A 2Y3HA 4XQ1A 3S9OA 5KYYA 2OCCC 3C8ZA 1MMDA 4J7TA 1LKXA 3U2MA 1Z6AA 5T3TA 2IXOA 3RF3A 4CSAC 2A6HF 4YWQA 3K66A 1IW7F 1D0YA 1OKKA 3U3FA 2HZ8A 3OWTA 4P6IC 2OEVA 2EPOA 2NUPA 2NUTB 3AGTA 4MVRA 1BR4A 4PK4A 2H7VC 1GGQA 4Z9JA 4LLEA 1YJGA 1YDIA 1WGWA 3C7JA 3SXZA 1KTMA 2GFHA 2NG1A 3R7CA 3US6A 5AC4A 3AG3C 1FTSA 1Z7Qc 4ER9A 2Q3TA 3I5QA 3DZAA 4JTAB 1QQ3A 4ULVA 4DVZA 3BEHA 4ONSA 2KC3A 2NPUA 1G8XA 3HLZA 3SNHA 1NG1A 4NTAA 1JMWA 3DXJF 1R4TA 1WTYA 2J9VA 2YQYA 3MFNA 2BE5F 1D0XA 4G7ZF 3RW0A 3C8GB 5EK0A 3VM6A 3DD7A 5T3WA 3S29A 2XS1A 4CJGA 3RIPA 5DVWA 3JYHA 4JCHA 2CDQA 3U8PA 3X1OA 3BRJA 2C04A 3PDMP 3EH1A 4E0IA 4W8PA 2P7VA 2W9YA 1VB5A 256BA 3C8GD 5JP7A 2YZSA 4LLCA 3NKDA 3EGDA 4IARA 4JEBA 3ZTMA 4F4BA 1ZW3A 1SZIA 2FGYA 1PCXA 1WOLA 3SXMA 2R7OA 3LLIA 4I1MA 4AL1A 4XWJA 3JZ0A 1E85A 3IQCA 2XLHA 4J32B 5FCLA 1LI5A 4C3EA 2J45A 3UGOA 2VCAA
chains in the Genus database with same CATH topology
4CDAA 5JRAA 4WGZA 2YLDA 2XL8A 4D4XA 4IAQA 3QVYA 3HNIA 3FOPA 2J9BA 3QVZA 2XLMA 4L6RA 3DE8A 3DE9A 1YYXA 1E84A 1CPQA 2XM4A 1S05A 2YL3A 3QW1A 4JEAA 2YLGA 1A7VA 3C63A 4IB4A 2YKZA 4CX9A 4CIPA 1GQAA 3C62A 1YYJA 3ZTZA 1YZAA 3HNLA 4U9DA 3ZQVA 2XLOA 2YLIA 1MQVA 3M79A 1CGOA 1M6TA 1BBHA 1APCA 1CGNA 3QW0A 4U9EA 2YL0A 1CPRA 3ZQYA 4WGYA 3IQ5A 1LM3B 2XLDA 2YL1A 2XM0A 1NBBA 4CDYA 3HNKA 2XLVA 3NMIA 1E83A 3IQ6A 4CDVA 1YZCA 2J8WA 1QPUA 3L1MA 5AGFA 5JT4A 4JKVA 2QLAA 1E86A 3ZWIA 3M4BA 3VRCA 4JE9A 4D4NA 4ER9A 2XLEA 3M15A 1QQ3A 4ULVA 4N6HA 3HNJA 4N4WA 2BC5A 4CJOA 1RCPA 4CJGA 3NMKA 5B3IA 1EKYA 3U8PA 3M4CA 2CCYA 4NC3A 5JSLA 5JVEA 2XL6A 5JP7A 5JLIA 3NMJA 256BA 5JS5A 4IARA 4JEBA 3TOLA 3TOMA 3ZTMA 4EIYA 5JUAA 2YL7A 1E85A 3FOOA 1JAFA 2XLHA 2XLWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CDA A;  5JRA A;  4WGZ A;  2YLD A;  2XL8 A;  4D4X A;  4IAQ A;  3QVY A;  3HNI A;  3FOP A;  2J9B A;  3QVZ A;  2XLM A;  4L6R A;  3DE8 A;  3DE9 A;  1YYX A;  1E84 A;  1CPQ A;  2XM4 A;  1S05 A;  2YL3 A;  3QW1 A;  4JEA A;  2YLG A;  1A7V A;  3C63 A;  4IB4 A;  2YKZ A;  4CX9 A;  4CIP A;  1GQA A;  3C62 A;  1YYJ A;  3ZTZ A;  1YZA A;  3HNL A;  4U9D A;  3ZQV A;  2XLO A;  2YLI A;  1MQV A;  3M79 A;  1CGO A;  1M6T A;  1BBH A;  1APC A;  1CGN A;  3QW0 A;  4U9E A;  2YL0 A;  1CPR A;  3ZQY A;  4WGY A;  3IQ5 A;  1LM3 B;  2XLD A;  2YL1 A;  2XM0 A;  1NBB A;  4CDY A;  3HNK A;  2XLV A;  3NMI A;  1E83 A;  3IQ6 A;  4CDV A;  1YZC A;  2J8W A;  1QPU A;  3L1M A;  5AGF A;  5JT4 A;  4JKV A;  2QLA A;  1E86 A;  3ZWI A;  3M4B A;  3VRC A;  4JE9 A;  4D4N A;  4ER9 A;  2XLE A;  3M15 A;  1QQ3 A;  4ULV A;  4N6H A;  3HNJ A;  4N4W A;  2BC5 A;  4CJO A;  1RCP A;  4CJG A;  3NMK A;  5B3I A;  1EKY A;  3U8P A;  3M4C A;  2CCY A;  4NC3 A;  5JSL A;  5JVE A;  2XL6 A;  5JP7 A;  5JLI A;  3NMJ A;  256B A;  5JS5 A;  4IAR A;  4JEB A;  3TOL A;  3TOM A;  3ZTM A;  4EIY A;  5JUA A;  2YL7 A;  1E85 A;  3FOO A;  1JAF A;  2XLH A;  2XLW A; 
#chains in the Genus database with same CATH topology
 1VYI A;  3JYY A;  1H9G A;  2WL8 A;  1JOG A;  2L6F A;  1FMW A;  4O7G A;  2EIK C;  2YLD A;  1T6Q A;  2XL8 A;  4HFK B;  1LPE A;  1XWJ A;  3B29 A;  1MND A;  3JSZ A;  3Q6N A;  3SZR A;  4U5B E;  4Z9I A;  4DBR A;  4XPW A;  1LIH A;  2KNH A;  3LLK A;  3MBG A;  3FOP A;  1Z23 A;  2OJE D;  4QI2 A;  4PJJ A;  4XEK A;  2LIG A;  4AE4 A;  4MVU A;  4JJG A;  4MS2 A;  4PFP A;  3GM3 A;  2CNW A;  2J9U A;  4NY3 A;  1KNY A;  4NCQ A;  1IZM A;  1A7E A;  2GDC A;  5KYW B;  1C17 M;  1CPQ A;  1LE4 A;  2XM4 A;  2LQG A;  2R7V A;  1ORY A;  1S05 A;  1D1B A;  3ASO C;  4DXW A;  2L6H A;  3FDQ A;  1Z5Z A;  2GWW A;  3AQB A;  4IB4 A;  4CS9 C;  4CIP A;  3DM5 A;  1GQA A;  4B6I A;  1ZHZ A;  3C62 A;  2XRH A;  3TQO A;  1MMG A;  1JRA A;  4J7Y A;  2EPN A;  1F1M A;  1O87 A;  3GOR A;  1ZYR F;  3CSK A;  4YJW A;  3ZSU A;  1FMV A;  2LFD A;  2XLO A;  2M4E A;  2Q7R A;  1AUE A;  2YLI A;  2J9W A;  1YAR O;  4XPY A;  1JPJ A;  1PD0 A;  3L34 A;  4KNW A;  3AG2 C;  5BQI A;  3KL4 A;  1V74 B;  4Q5S F;  2AVK A;  4GYT A;  1M56 C;  2X51 A;  5D92 A;  3VF0 A;  1BBH A;  5L0C A;  4G78 A;  3RQF A;  2R7R A;  3EZH A;  4A4A A;  4CSA A;  1KU2 A;  3LJB A;  1CPR A;  2M64 A;  3EHM A;  3IQ5 A;  3ZC4 A;  2BL2 A;  1K04 A;  1BDJ B;  2KYH A;  2XS8 A;  2RD9 A;  3AGU A;  4YT8 A;  4OIN F;  1OR2 A;  3EHN A;  5F5F A;  2R03 A;  1E2X A;  2Q00 A;  4OIO F;  3EPV A;  3I5P A;  2F22 A;  2GA0 A;  4CDY A;  4U5F E;  1LI7 A;  2HV7 A;  2VC9 A;  2HMQ A;  1D1C A;  2XLV A;  1MMN A;  3B0U X;  2Y39 A;  3DJN B;  1ZZP A;  3IQ6 A;  4DBQ A;  2LSE A;  2R05 A;  2DI3 A;  4UDV A;  1ZHY A;  4E0H A;  2OJQ A;  1G4W R;  1GS9 A;  2D5R B;  3DM9 B;  3L8I A;  3TD7 A;  3WAQ A;  5BUO A;  2NSG A;  3EQL F;  2WZF A;  3K6B A;  4BJ5 C;  3ZIB A;  1HW2 A;  2L9J A;  5AGF A;  5JT4 A;  1NLX A;  1OCC C;  2HS5 A;  3KPH A;  5A6K A;  1AVO B;  2QLA A;  1XZQ A;  2QY9 A;  4JTC B;  5AC5 A;  4LDK A;  3ECS A;  2NSF A;  3SXY A;  3OA1 A;  4U5C E;  4YT5 A;  3K7D A;  3S90 A;  4C7O B;  3M4B A;  3M1C B;  2UUI A;  3U0C A;  3VRC A;  1K40 A;  3K33 A;  5KYX B;  3U5S A;  4Q4Z F;  3ABL C;  4D4N A;  1YA7 O;  2HSQ A;  4JTD B;  3JSE O;  2PX0 A;  4JIO A;  2A0U A;  1OXB A;  2AU5 A;  4HEA J;  3M15 A;  1LE2 A;  1T5O A;  3ZG1 A;  2Y3G A;  4IJJ A;  4CS7 A;  5IY5 C;  3EGX A;  2CYD A;  3B0P A;  4N4W A;  2BC5 A;  2ZXR A;  4LER A;  3LS0 A;  4IWB A;  4YL0 A;  4YK5 A;  2O9X A;  2XXA A;  1EKY A;  3B9Q A;  5DQT A;  1DOW A;  1ZHW A;  2CCY A;  1MMA A;  2OEX A;  3AJM A;  4PJN A;  1QLE C;  1TFK B;  1TR2 A;  2XL6 A;  2V26 A;  3H2U A;  4QDL A;  4XLN F;  5DS4 A;  4PJL A;  1O3U A;  1HE1 A;  3T6G B;  2NUT A;  2L7A A;  1I4Y A;  2P1A A;  4U5H A;  2ETS A;  1JAF A;  4KNV A;  3UMK A;  1BR2 A;  4ULW A;  2PNO A;  1OW6 A;  3DAF A;  3MLG A;  4CDA A;  4EBK A;  2FFH A;  3H2V A;  1EQ1 A;  2R25 A;  1ST6 A;  2EIN C;  1O5H A;  3T6B A;  3V7O A;  4IAQ A;  5KYY B;  4CS9 A;  3KYJ A;  2V3C C;  2OOC A;  4Z9H A;  3SXK A;  2IBF A;  3TJ6 A;  1NSG B;  1OR3 A;  2XLM A;  1TKN A;  3HJC A;  3QVZ A;  4RD9 A;  1J8M F;  4JRZ A;  3W8H A;  2LCH A;  2ASR A;  4HFF B;  3FAJ A;  1YYX A;  1E84 A;  2H7O A;  2FAP B;  3QMK A;  2NUP B;  1AEP A;  3MYI A;  3NYM A;  4MVZ A;  1ZU4 A;  1VLS A;  1VOM A;  5D91 A;  1UFB A;  3DKA A;  2QE9 A;  3N24 A;  3O10 A;  3Q6M A;  3QW1 A;  4JEA A;  4OD4 A;  4X0R A;  2YLG A;  2B0J A;  4O6Y A;  2EPM X;  2VB6 A;  1Q0K A;  1G4U S;  1A0B A;  1S7Z A;  3A9C A;  2HKV A;  3L8J A;  3RH3 A;  1FNT c;  2WZG A;  5E3C A;  2TMV P;  5KYN A;  4NQF A;  1YYJ A;  1QSP A;  2XSE A;  4IGG A;  3U9J A;  3W2V A;  3S0X A;  2PP4 A;  2A68 F;  4O79 A;  1Q0F A;  2HV6 A;  4C3D A;  4DOZ A;  4Q7C A;  3AQC A;  4HE8 D;  1D1A A;  3I4U A;  3IEE A;  1T6I A;  3EG9 B;  2IXN A;  3GM1 A;  1QKR A;  3TK0 A;  3S28 A;  2JPU A;  2R7T A;  3JRM O;  3GEE A;  4DJ9 A;  1Y4C A;  2IXP A;  4U5D E;  1RKE B;  1M6T A;  5L3Q A;  3U3B A;  4KBL A;  1SMY F;  5KYW A;  2DGJ A;  1OQC A;  2L6G A;  4BJ5 A;  1FFH A;  1APC A;  3SP1 A;  4G0H A;  4M63 A;  2W4M A;  4O6M A;  3UNG C;  2YL0 A;  4DRI B;  1NU7 D;  4WGY A;  2EPL X;  3MYF A;  2XL4 A;  4U5E E;  3V5Y A;  5L0F A;  2R7W A;  2XM0 A;  2VAS A;  3LEV A;  4E7S A;  4NTF A;  1ZW2 A;  3LS1 A;  1T6U A;  4RBN A;  2R7Q A;  1NBB A;  3S27 A;  2Y3D A;  1EA8 A;  1OCR C;  4LAC B;  5A6J A;  1H9T A;  3NMI A;  5E2Q A;  2LD6 A;  1W2W A;  1WN0 A;  3IQT A;  4MW3 A;  3WOD F;  5CI9 A;  1MNE A;  4AE4 B;  1TWA A;  2LP4 A;  2RSE B;  4RDA A;  2G3V A;  4H54 A;  1VK5 A;  4YL1 A;  3O39 A;  1YZC A;  3O55 A;  4JC7 A;  3U8V A;  5L0H A;  1DOV A;  4MTG A;  4JUR I;  3GM2 A;  1QPU A;  1M2V A;  2H7B A;  3RVY A;  1NZE A;  3RKO F;  4JKV A;  5T1D B;  4BJ6 C;  4I3M A;  4XEF A;  3GWL A;  1M57 C;  3QTH A;  3ZWI A;  5EHH A;  3ZVR A;  3DJU B;  1Y6D A;  2KJG A;  4EKW A;  2Z15 A;  5B1B C;  2DYS C;  3K1I C;  3NYL A;  1YLM A;  1RJ9 A;  5E3A A;  1WAS A;  4XTK A;  2PBE A;  3IPM O;  1V55 C;  4DRJ B;  2P0N A;  3IHU A;  1ZHT A;  1JR8 A;  4MVQ A;  3HNJ A;  4ZLD A;  5L0D A;  3PMR A;  1R5I D;  1U6H A;  3JCU Q;  2KGO A;  4CJO A;  1I5N A;  4N6C A;  4DVY P;  3FMS A;  3GAN A;  1TWC A;  2KW3 C;  3OEO A;  1HMO A;  4IAO A;  4AL0 A;  5L3V A;  3NMK A;  2JD3 A;  4G7O F;  3NDB B;  2G3K A;  3GWN A;  5KYU B;  3B0V C;  1N1C A;  4NC3 A;  1FFT C;  1L3P A;  1RKC A;  2UUH A;  4KC9 A;  5JLI A;  3RFY A;  4R32 A;  4CS8 C;  4ZLC A;  5JS5 A;  4WAB A;  4EIY A;  4BPM A;  3C18 A;  5JUA A;  1ORS C;  1PD1 A;  3NRH A;  2R9R B;  2B0H A;  4C7O A;  1OW7 A;  3FOO A;  1VMA A;  4EWC A;  2HFI A;  2KSF A;  2CGE A;  4MQ9 F;  2YRF A;  5JRA A;  3FAP B;  4WGZ A;  2R02 A;  2A1D D;  2Y69 C;  3KKB A;  4LDQ A;  1A41 A;  2AP3 A;  2Q4F A;  2HUJ A;  3LUT B;  4D4X A;  2WB7 A;  1Z3I X;  1JPN A;  2WVQ A;  3LEO A;  5EGY A;  3HNI A;  1EI7 A;  2J9B A;  2QNL A;  4I44 A;  4A2N B;  1SYQ A;  5A6B D;  4L6R A;  3G50 A;  4P9T A;  4K0D A;  4EUK B;  3X2Q C;  3AOU A;  3E9V A;  2ZXW C;  1U89 A;  3AG4 C;  3GEH A;  1RMV A;  4JW1 A;  2DB4 A;  1T9K A;  3CEX A;  3ITF A;  1ORJ A;  4WJ0 A;  2OQM A;  4CBE A;  4OIR F;  4GQH A;  1J8Y F;  2CW0 F;  5HV9 A;  4U5G A;  5L0G A;  1C02 A;  5F28 E;  1Q0M A;  3EFO B;  2YKZ A;  5COM A;  3VAY A;  5DS5 A;  4MVM A;  1NU9 C;  2WVN A;  3EGX B;  1YZA A;  2AWC A;  2J7P D;  3N2Z B;  3ASN C;  4GEH A;  3DI5 A;  3K1H A;  4YT2 A;  2C03 A;  3Q7L A;  5K0I A;  3RYL A;  3KH2 A;  2KK1 A;  4OD5 A;  3F47 A;  2XXA B;  3AG1 C;  2Q9B A;  3W8I A;  3G4X A;  4BEJ A;  2L81 A;  1H6G A;  3C8G A;  3NG1 A;  5TJ5 E;  2EPK X;  3M79 A;  4BEM J;  1H7I A;  2QUP A;  4EBJ A;  2DYR C;  4XPX A;  1V4A A;  3KMI A;  3NYJ A;  2IOQ A;  4MW8 A;  3H65 A;  1CGN A;  4FWV A;  3QW0 A;  4E7Z A;  4W8K A;  4O6N A;  1OW8 A;  4EBB A;  4JZA A;  5CIV A;  4BJ6 A;  1G5Z A;  1LM3 B;  1OKK D;  1OXK A;  2XLD A;  4FX5 A;  1OCZ C;  1SR2 A;  4G7H F;  1NFO A;  2I15 A;  3V5Z A;  3W2W A;  3CQZ A;  2ICW G;  2D4U A;  3K1I A;  4LDR A;  2J46 A;  4JJF A;  4BG0 A;  1SF8 A;  1E83 A;  1VTM P;  3KYI A;  2I8B A;  4CDV A;  2HJ3 A;  2R7S A;  3RQG A;  3FHD A;  5GPG B;  2IM8 A;  3TUL A;  3ZDL A;  2J8W A;  3JTL O;  1TWH A;  3EG9 A;  3MX3 A;  4FAP B;  3T4R A;  4YT4 A;  1Q0D A;  3PCV A;  2AWY A;  3DAG A;  3E70 C;  3L1M A;  4I1O B;  4PAC A;  2JX0 A;  3UR3 C;  1ZU5 A;  3DMD A;  2HSB A;  3S84 A;  1RKE A;  2IXM A;  2PF4 E;  3B71 A;  3EGD B;  1E86 A;  2W4B A;  2OKU A;  2Y3B A;  3LNR A;  1Z63 A;  1YA9 A;  1D0Z A;  3GEI A;  4JE9 A;  5FZT A;  1QZX A;  2ZXP A;  4ANJ A;  4CS8 A;  1VLT A;  1Q0G A;  2EIM C;  2J0W A;  2XLE A;  1FAP B;  3U9M A;  3VYW A;  3PHF 2;  2H8A A;  1C03 A;  1ZVZ A;  3CAX A;  4H4K C;  4K7B A;  4N6H A;  1OCO C;  3ABK C;  2Q9A A;  3RQE A;  2ZPA A;  3NKE A;  4CIH A;  4C3B A;  1RCP A;  3V5X A;  2YHS A;  4DRH B;  1T01 A;  2GAQ A;  1YVI A;  1K05 A;  2WVO A;  5B3I A;  2R7X A;  3FXH A;  1VYK A;  2ZXO A;  2E87 A;  3DWW A;  3M4C A;  4E17 A;  1GM5 A;  3HKK A;  1BZ4 A;  5JSL A;  5JVE A;  1QVX A;  2OU6 A;  4NTB A;  5BQG A;  3U2L A;  2PFD A;  3NMJ A;  1M2O A;  5DLJ A;  2LFF A;  2P6V A;  1HE9 A;  3TOL A;  2VCB A;  3TOM A;  1LS4 A;  2CNW D;  3W4Y A;  3T6J A;  4AX2 A;  3LES A;  4JVS A;  2YL7 A;  1XZP A;  1BR1 A;  1LS1 A;  4BJ1 A;  2A0B A;  2W45 A;  2X0C A;  1B68 A;  3L0I A;  1LVK A;  2PX3 A;  4PR9 A;  1I4Z A;  3SEO A;  4BJT A;  4PFO A;  3Q7G A;  4MVO A;  3EZI A;  3QZC A;  1TQG A;  3QVY A;  4MND A;  2A69 F;  2MWQ A;  4K1O A;  1L7C A;  2HJM A;  1M2V B;  1YAU O;  3RVZ A;  3A11 A;  3G4Z A;  3R2P A;  3DE8 A;  2MHR A;  3SYN A;  3DE9 A;  1WAT A;  3POV A;  1CGM E;  1TFO B;  4MTF A;  3UMH A;  4OIQ F;  5KYU A;  5L0J A;  1U0B B;  2EIJ C;  4N06 A;  1PV3 A;  1HMD A;  4YN0 B;  5DS6 A;  1UG7 A;  2YL3 A;  2G62 A;  2XLW A;  3EJN A;  1RJ9 B;  5CI8 A;  5F5H A;  2QTV A;  3F46 A;  4OIP F;  1A7V A;  4P9F A;  2WZL A;  3C63 A;  2VH3 A;  4JCZ A;  5COG A;  4CX9 A;  2LK4 A;  3JT1 A;  5KYX A;  2ZD9 A;  3WHN A;  5COF A;  2YEV A;  4MVS A;  1WWP A;  1V54 C;  3ZTZ A;  5A6B A;  4IRU A;  3HNL A;  3O6X A;  5A69 A;  5A6A A;  2Q9C A;  4J30 B;  3T9O A;  4U9D A;  3ZQV A;  4E18 A;  4MTO A;  4XEV A;  5HSW A;  3HTK C;  3N0T A;  1FR0 A;  3EH2 A;  3FVY A;  4QI0 A;  4KI2 A;  3TJ5 A;  4YL3 A;  1MQV A;  3UGP A;  1HY5 A;  3JRT A;  5DQZ A;  5L0I A;  2YVK A;  3UMI A;  4PJM A;  3J06 A;  1RXQ A;  1CGO A;  2R7U A;  3LNM B;  1ZHX A;  1NFN A;  5B1A C;  4AK9 A;  2J0X A;  2IYL D;  4U9E A;  5BQH A;  4EHP A;  2KQ9 A;  3ZQY A;  3CZ6 A;  1A7D A;  2J7P A;  5E33 A;  2YL1 A;  2VCC A;  2MYS A;  4FES A;  2P61 A;  3EFO A;  2HMZ A;  2A6E F;  3ATP A;  2YWA A;  5B3S C;  3HNK A;  3ABM C;  3WG7 C;  2EIL C;  4XLP F;  1HW1 A;  3GOD A;  1TWG A;  3LAY A;  2OG2 A;  2Y3H A;  4XQ1 A;  3S9O A;  5KYY A;  2OCC C;  3C8Z A;  1MMD A;  4J7T A;  1LKX A;  3U2M A;  1Z6A A;  5T3T A;  2IXO A;  3RF3 A;  4CSA C;  2A6H F;  4YWQ A;  3K66 A;  1IW7 F;  1D0Y A;  1OKK A;  3U3F A;  2HZ8 A;  3OWT A;  4P6I C;  2OEV A;  2EPO A;  2NUP A;  2NUT B;  3AGT A;  4MVR A;  1BR4 A;  4PK4 A;  2H7V C;  1GGQ A;  4Z9J A;  4LLE A;  1YJG A;  1YDI A;  1WGW A;  3C7J A;  3SXZ A;  1KTM A;  2GFH A;  2NG1 A;  3R7C A;  3US6 A;  5AC4 A;  3AG3 C;  1FTS A;  1Z7Q c;  4ER9 A;  2Q3T A;  3I5Q A;  3DZA A;  4JTA B;  1QQ3 A;  4ULV A;  4DVZ A;  3BEH A;  4ONS A;  2KC3 A;  2NPU A;  1G8X A;  3HLZ A;  3SNH A;  1NG1 A;  4NTA A;  1JMW A;  3DXJ F;  1R4T A;  1WTY A;  2J9V A;  2YQY A;  3MFN A;  2BE5 F;  1D0X A;  4G7Z F;  3RW0 A;  3C8G B;  5EK0 A;  3VM6 A;  3DD7 A;  5T3W A;  3S29 A;  2XS1 A;  4CJG A;  3RIP A;  5DVW A;  3JYH A;  4JCH A;  2CDQ A;  3U8P A;  3X1O A;  3BRJ A;  2C04 A;  3PDM P;  3EH1 A;  4E0I A;  4W8P A;  2P7V A;  2W9Y A;  1VB5 A;  256B A;  3C8G D;  5JP7 A;  2YZS A;  4LLC A;  3NKD A;  3EGD A;  4IAR A;  4JEB A;  3ZTM A;  4F4B A;  1ZW3 A;  1SZI A;  2FGY A;  1PCX A;  1WOL A;  3SXM A;  2R7O A;  3LLI A;  4I1M A;  4AL1 A;  4XWJ A;  3JZ0 A;  1E85 A;  3IQC A;  2XLH A;  4J32 B;  5FCL A;  1LI5 A;  4C3E A;  2J45 A;  3UGO A;  2VCA A; 
#chains in the Genus database with same CATH homology
 4CDA A;  5JRA A;  4WGZ A;  2YLD A;  2XL8 A;  4D4X A;  4IAQ A;  3QVY A;  3HNI A;  3FOP A;  2J9B A;  3QVZ A;  2XLM A;  4L6R A;  3DE8 A;  3DE9 A;  1YYX A;  1E84 A;  1CPQ A;  2XM4 A;  1S05 A;  2YL3 A;  3QW1 A;  4JEA A;  2YLG A;  1A7V A;  3C63 A;  4IB4 A;  2YKZ A;  4CX9 A;  4CIP A;  1GQA A;  3C62 A;  1YYJ A;  3ZTZ A;  1YZA A;  3HNL A;  4U9D A;  3ZQV A;  2XLO A;  2YLI A;  1MQV A;  3M79 A;  1CGO A;  1M6T A;  1BBH A;  1APC A;  1CGN A;  3QW0 A;  4U9E A;  2YL0 A;  1CPR A;  3ZQY A;  4WGY A;  3IQ5 A;  1LM3 B;  2XLD A;  2YL1 A;  2XM0 A;  1NBB A;  4CDY A;  3HNK A;  2XLV A;  3NMI A;  1E83 A;  3IQ6 A;  4CDV A;  1YZC A;  2J8W A;  1QPU A;  3L1M A;  5AGF A;  5JT4 A;  4JKV A;  2QLA A;  1E86 A;  3ZWI A;  3M4B A;  3VRC A;  4JE9 A;  4D4N A;  4ER9 A;  2XLE A;  3M15 A;  1QQ3 A;  4ULV A;  4N6H A;  3HNJ A;  4N4W A;  2BC5 A;  4CJO A;  1RCP A;  4CJG A;  3NMK A;  5B3I A;  1EKY A;  3U8P A;  3M4C A;  2CCY A;  4NC3 A;  5JSL A;  5JVE A;  2XL6 A;  5JP7 A;  5JLI A;  3NMJ A;  256B A;  5JS5 A;  4IAR A;  4JEB A;  3TOL A;  3TOM A;  3ZTM A;  4EIY A;  5JUA A;  2YL7 A;  1E85 A;  3FOO A;  1JAF A;  2XLH A;  2XLW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...