3M79A

A tetrameric zn-bound cytochrome cb562 complex with covalently and non-covalently stabilized interfaces crystallized in the presence of cu(ii) and zn(ii)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHDALHLANEGKVKEAQAAAEQLKCTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title Evolution of metal selectivity in templated protein interfaces.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 48
structure length 106
sequence length 106
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2010-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3m79A00
1MQVA 1A7VA 4D4XA 3ZTMA 1NBBA 1JAFA 5JP7A 1QQ3A 2XM4A 5AGFA 1APCA 1BBHA 3DE8A 5JVEA 3VRCA 4CDAA 1CPRA 3QVYA 5JSLA 3FOPA 3NMKA 1EKYA 2XL6A 1E86A 3HNLA 2CCYA 1E83A 2J8WA 3M79A 4NC3A 2YL7A 4CDYA 4WGZA 3FOOA 2BC5A 3M15A 1QPUA 2YL3A 1E85A 3HNJA 4ER9A 4JE9A 1YZCA 1E84A 4ULVA 4JKVA 4CX9A 5JRAA 3TOMA 3IQ6A 4CJOA 1CGOA 2YLIA 1CPQA 4JEBA 3C63A 5JLIA 2XLEA 4EIYA 4U9EA 4U9DA 4IAQA 3M4CA 1S05A 2YKZA 5JS5A 5B3IA 2XLVA 2YLDA 3HNIA 2J9BA 2QLAA 3M4BA 1YZAA 3ZQVA 4JEAA 2XLMA 3IQ5A 5JUAA 3ZQYA 1LM3B 3TOLA 2XLHA 5JT4A 3C62A 1M6TA 4IARA 4N4WA 2YL1A 4N6HA 2YLGA 2XM0A 3HNKA 3L1MA 256BA 3NMIA 1GQAA 4IB4A 4CJGA 3U8PA 4CIPA 1RCPA 3ZTZA 3QW1A 4CDVA 1CGNA 1YYXA 3ZWIA 1YYJA 3NMJA 2XLOA 2XL8A 2YL0A 3QVZA 2XLWA 4WGYA 3QW0A 4D4NA 4L6RA 2XLDA 3DE9A
chains in the Genus database with same CATH superfamily
4R32A 1A7VA 4D4XA 1T6QA 1WWPA 3QTHA 4FWVA 3UR3C 4O6YA 1U0BB 2WVQA 1YVIA 3ZTMA 1NBBA 1WATA 2HJ3A 5L0DA 4DBQA 1SZIA 5T3WA 3ZVRA 5L0IA 4I1MA 5DQZA 2J46A 4MVOA 2M4EA 5AGFA 1BBHA 1S7ZA 3NYJA 5JVEA 3I5QA 1JR8A 2PP4A 4P9TA 3VRCA 5AC4A 2OKUA 3OWTA 1CPRA 2ZXOA 4NTBA 1M2OA 2R9RB 3QVYA 2LCHA 1L3PA 3FOPA 1O87A 3OEOA 4B6IA 4PFOA 2E87A 4KNVA 4CS8C 1HW2A 4U5FE 2Q9BA 3NG1A 4NTAA 5EGYA 5A6AA 2PBEA 4BEMJ 3N0TA 3NDBB 2L81A 4QI2A 4Z9IA 3UMIA 1FMVA 3B0PA 1FFTC 2IXNA 3DM5A 1ORSC 2Q00A 2J7PA 3ZDLA 2CCYA 3CZ6A 1E83A 2NG1A 1Z7Qc 2YQYA 3G4ZA 5HSWA 2P7VA 2CGEA 4PR9A 4W8KA 2YL7A 2NUPA 1OR3A 1PV3A 4CDYA 1SYQA 3X2QC 5KYNA 1NSGB 1PCXA 4MVSA 1MMGA 5L0JA 4XTKA 4MNDA 1ST6A 2KGOA 2YL3A 3LAYA 4MTFA 3HNJA 1L7CA 4ER9A 1YZCA 3KYIA 4ULVA 5KYYA 4MTGA 1LE2A 3ECSA 1ZVZA 3WAQA 1D1BA 4JEBA 3FVYA 3C8ZA 4LACB 5D92A 2J0WA 2Y3GA 3DI5A 4WABA 4OINF 4NQFA 1JOGA 2L6GA 3DJNB 5JLIA 2HSBA 1J8YF 1VMAA 2EPOA 4EIYA 4U9EA 1LIHA 1OW8A 3M4CA 2H7VC 2LIGA 2XXAA 4HE8D 3RKOF 4GQHA 4A2NB 4ZLCA 1QVXA 3K1IA 3SNHA 5L0CA 2AWCA 2BL2A 1Z6AA 4YT4A 1RJ9B 1KU2A 4Z9JA 4XQ1A 2VCCA 3WG7C 1ZHWA 5KYWB 5B1AC 1JMWA 2V26A 3Q6NA 3W4YA 5L0HA 3RFYA 2IYLD 1PD0A 3HNIA 2HFIA 3RQGA 2J0XA 3EJNA 1C17M 2VCAA 3VF0A 1PD1A 1ZW3A 3AG4C 2A69F 3SXYA 1OKKD 2Q4FA 1Q0KA 4IGGA 2R7XA 2EILC 4NTFA 2XLMA 2P61A 1IZMA 1OCOC 3IQ5A 3NKEA 2DI3A 4JCHA 3A9CA 4U5DE 3J06A 2C03A 3RVZA 1ZU5A 2EPKX 4BG0A 3W8HA 3B29A 3K1HA 4CSAA 4JTDB 2YWAA 5JT4A 2VH3A 2I15A 3JYHA 1OCRC 1TWCA 2FGYA 2MHRA 5F28E 4YK5A 3ZG1A 1TFOB 1RXQA 2J45A 3S84A 5A69A 2XSEA 1TR2A 2KNHA 2XM0A 2YHSA 2Z15A 3HNKA 1Z23A 2A68F 2OCCC 3WODF 2EPMX 2HS5A 1BDJB 4CS9C 3KYJA 3CEXA 4E18A 4EKWA 1OXBA 3ZC4A 4E0HA 3G50A 4PACA 4J30B 3EZIA 1RCPA 1LI7A 2ZXPA 4KC9A 4NY3A 1HW1A 2VASA 3C18A 4ULWA 1E84A 1H9GA 3SXMA 5L3VA 2YEVA 1YYJA 2IXOA 3UNGC 1A41A 3NKDA 1K40A 4I44A 4U5EE 2XL4A 3O39A 3QVZA 2YL0A 5CI9A 1YA9A 2XLWA 4D4NA 4JTAB 3NYMA 5E3AA 2F22A 3LUTB 2AWYA 4MVUA 3FAPB 4U5GA 2CNWD 1MQVA 1TKNA 3O55A 3Q7LA 4O79A 1OQCA 1HE9A 2OU6A 3EG9B 3U3BA 5COMA 2PFDA 5JP7A 1V54C 3AG3C 2R7QA 3GWLA 4K1OA 1G4WR 1Z63A 1APCA 4G7OF 2NSFA 1O3UA 2D4UA 3EH1A 3U0CA 2GDCA 2EIJC 2KK1A 4GYTA 3NMKA 1BR2A 2L7AA 1OW7A 4E17A 3T4RA 2Q9CA 2HMZA 3DWWA 4BJ5A 2Q3TA 1VK5A 1R4TA 1ZHZA 1OR2A 1ZHYA 3AQCA 1WTYA 3MYFA 4JVSA 4MQ9F 3DXJF 3KKBA 4N6CA 3T6BA 3B0UX 2A6EF 2UUHA 2WB7A 3UMKA 5DS6A 1BR4A 5HV9A 2CYDA 3EG9A 1Q0GA 4LLCA 4BPMA 1IW7F 5A6KA 2XS8A 3MBGA 3MX3A 4MVMA 3L0IA 3EGXB 2G62A 3TK0A 2Y3DA 1XZQA 2HSQA 1A7EA 2RD9A 1K05A 1QSPA 2LQGA 3FOOA 4WGZA 1RKEA 3LNRA 5DQTA 1ORJA 2HKVA 2OQMA 4JE9A 4W8PA 3M1CB 2I8BA 2Y3HA 2VC9A 2LFDA 2ZD9A 3DKAA 4U5BE 3R7CA 4WJ0A 2IXMA 3LEVA 1E85A 1VTMP 2H8AA 1ZW2A 4MVQA 3GEEA 3OA1A 4G7HF 1LVKA 3FXHA 2A0UA 4JKVA 1KTMA 2L9JA 4CX9A 3FMSA 5L0FA 3DAFA 2LFFA 3TOMA 1VLTA 2BE5F 2MWQA 4IWBA 4CJOA 1CPQA 2WVOA 3SXZA 5A6BD 3EGXA 5BUOA 2IM8A 1XWJA 2WZGA 3DAGA 2XLEA 3QZCA 3EHNA 4U9DA 5L0GA 2YZSA 2OEXA 5IY5C 4YT5A 4RDAA 1D1AA 4IAOA 1Z5ZA 2QNLA 2YKZA 3N2ZB 1EQ1A 4P6IC 3E9VA 4HEAJ 4JURI 1OW6A 2JPUA 3KMIA 5KYUB 5TJ5E 1NFNA 4F4BA 4O7GA 5BQHA 1OCCC 3AGUA 2XLVA 2ETSA 3X1OA 2PNOA 2YLDA 4XPYA 4FAPB 1G8XA 2G3KA 2O9XA 3AOUA 3E70C 4XLNF 4EBBA 1C03A 3NYLA 1NU7D 4JJFA 1MNDA 1RMVA 1M2VB 3RVYA 1GS9A 3ZQYA 4EBJA 3A11A 2Y69C 4I3MA 2ZXWC 3FAJA 2R25A 3AG2C 4G78A 5KYUA 1NG1A 3LJBA 3GM2A 2HV7A 4JCZA 1T6UA 2HJMA 1Q0MA 3TJ5A 1JRAA 3U5SA 2J9VA 5CI8A 4H54A 4N4WA 2EIMC 1BZ4A 4RD9A 3CSKA 2R7TA 3V5XA 3LESA 3T6JA 1ZYRF 3L1MA 3NMIA 1GQAA 4M63A 1LE4A 1O5HA 1SF8A 3O6XA 1YA7O 3EQLF 3K66A 1LS1A 2MYSA 1YDIA 4CIPA 1OXKA 2R03A 4OIRF 3RIPA 2X0CA 5K0IA 2P6VA 2P0NA 3BRJA 2GA0A 2DB4A 3ATPA 1W2WA 5KYXB 1YLMA 4AL0A 1YYXA 3SZRA 3TQOA 1ZHXA 3NMJA 1CGME 4OIPF 3SYNA 3Q7GA 4A4AA 2KSFA 5A6JA 1VB5A 4BJ1A 4ZLDA 2XL8A 2QTVA 2FFHA 1HY5A 1GGQA 2LD6A 4JTCB 4MS2A 4PJLA 4CS8A 3DZAA 2R7RA 1FR0A 3HLZA 4L6RA 1H7IA 1RJ9A 3NRHA 2Y39A 3DJUB 1VLSA 1HE1A 4AL1A 1JPJA 2LP4A 3R2PA 4G7ZF 2VB6A 3TD7A 1VYIA 2R05A 3GEHA 3EGDB 4XWJA 4DRHB 2KQ9A 3LS1A 3EZHA 4LLEA 3W2VA 4Q7CA 1Y6DA 5T1DB 3US6A 1EA8A 1R5ID 3C8GB 2OOCA 3RYLA 1A0BA 4CBEA 4BJ5C 4XLPF 4YL0A 1LPEA 3MYIA 1TFKB 2IXPA 1D1CA 2PF4E 3W2WA 3EHMA 1Z3IX 1FFHA 2R7UA 3CQZA 3IQCA 1YAUO 4BJ6A 3S28A 4YJWA 1FNTc 4YT2A 5A6BA 3EGDA 3F47A 3JRMO 2XL6A 1E86A 3HNLA 2TMVP 1NU9C 1WOLA 4ONSA 3GANA 3C7JA 4BEJA 2NUTB 4DVYP 1RKCA 2H7BA 2J9WA 5E3CA 3PDMP 2BC5A 4U5CE 1NZEA 1V74B 5COGA 1QPUA 3MFNA 3ASOC 4Q4ZF 2NPUA 2XRHA 4KBLA 5F5FA 1JPNA 4CIHA 2WL8A 3JRTA 1VOMA 1NFOA 1TWAA 2ZPAA 2GFHA 3BEHA 3IEEA 1NLXA 3EH2A 5FZTA 3ZSUA 2RSEB 3EFOB 3UMHA 5DVWA 4HFKB 3POVA 2IBFA 5DS4A 2W4MA 3IQ6A 1MMAA 1CGOA 2YLIA 4K0DA 2W4BA 2AP3A 4P9FA 3KPHA 2Q9AA 3F46A 3IQTA 3T6GB 1FTSA 2DGJA 2R7VA 1F1MA 4IAQA 3UGOA 2AU5A 2KJGA 3TULA 1S05A 4FX5A 4AE4B 1TWHA 3O10A 2X51A 4DRIB 5JS5A 4UDVA 4HFFB 3JTLO 3K33A 3S29A 1M56C 4K7BA 4YL1A 3V5YA 2DYRC 4BJTA 2HUJA 2QUPA 2Y3BA 3GM3A 2J9BA 2A1DD 1T9KA 1D0XA 2QE9A 2QLAA 3U8VA 3M4BA 4NCQA 1OCZC 1EI7A 3SXKA 4XEFA 2W45A 4XPWA 1AUEA 3JZ0A 2IOQA 4JEAA 2WZFA 3GWNA 3ASNC 2JX0A 5JUAA 4GEHA 1N1CA 1OKKA 3GEIA 3ABLC 2GAQA 2R7OA 4LERA 4J7YA 3TOLA 5FCLA 2M64A 1LKXA 2VCBA 3C62A 3K1IC 5EHHA 1B68A 2Q7RA 3L8IA 5BQGA 3U3FA 1QZXA 4LDKA 5B3SC 3C8GD 5AC5A 3RH3A 4PK4A 3RQEA 4N6HA 4EWCA 2YLGA 4MW8A 3U9MA 4DOZA 3JCUQ 2A6HF 3GORA 3VAYA 4CJGA 3GODA 3LLIA 4JZAA 1H9TA 1I4ZA 5EK0A 2JD3A 2NUPB 3PCVA 3IPMO 3K6BA 2AVKA 2L6FA 4JRZA 5CIVA 3I4UA 4N06A 4C7OB 3ZTZA 3RW0A 4RBNA 4CS7A 4OD4A 3LLKA 3ZWIA 2W9YA 2B0JA 4QI0A 3ABMC 3L34A 4CSAC 1Q0FA 2HV6A 2WVNA 2YVKA 1AEPA 4WGYA 5KYYB 2HZ8A 4E0IA 3PMRA 2R7SA 1AVOB 2XLDA 2OEVA 1M57C 3JT1A 4JC7A 1QLEC 4Z9HA 3V7OA 3S9OA 1I5NA 3DM9B 3JSZA 3WHNA 4J7TA 4C7OA 2FAPB 3T9OA 1ZU4A 1G5ZA 1T6IA 2CNWA 1ORYA 1JAFA 2L6HA 3DMDA 4XEKA 3N24A 3KL4A 4PJJA 2XXAB 1QQ3A 4I1OB 2PX0A 3PHF2 2XM4A 1FMWA 4DBRA 3H65A 1M2VA 2ICWG 3DE8A 4O6NA 2LK4A 4PFPA 2NSGA 3L8JA 4CDAA 4E7SA 3KH2A 3U9JA 5JSLA 4YL3A 1VYKA 3ZIBA 4BJ6C 1D0ZA 4Q5SF 3DD7A 3K7DA 5T3TA 3AQBA 1EKYA 2R7WA 1U89A 3H2UA 3JSEO 4OD5A 2ASRA 2R02A 1YJGA 2UUIA 4JIOA 4JJGA 1QKRA 2J8WA 3ABKC 3HJCA 3M79A 4O6MA 1KNYA 1MMNA 2XS1A 3HKKA 4J32B 4NC3A 5BQIA 2ZXRA 3RF3A 1UFBA 3LS0A 2EIKC 4KI2A 5D91A 4DVZA 2CW0F 4MVZA 1WN0A 4X0RA 4E7ZA 5KYXA 1D0YA 2OJQA 1V55C 2GWWA 3M15A 4YWQA 1J8MF 5B1BC 1DOWA 5COFA 1A7DA 4YT8A 1SR2A 1WGWA 4C3BA 4EHPA 2EINC 1LI5A 5E33A 3CAXA 3ITFA 3SEOA 5JRAA 3S90A 1T5OA 4MVRA 4PJNA 3S27A 3VYWA 3H2VA 3MLGA 1LS4A 1ZZPA 3B71A 4OIOF 4QDLA 1TQGA 3C63A 4EBKA 5DS5A 1K04A 3G4XA 2J7PD 3B0VC 3QMKA 2KC3A 3U2MA 3W8IA 4AX2A 2D5RB 1I4YA 4LDQA 1DOVA 1GM5A 4XPXA 4DJ9A 4AK9A 1HMDA 3C8GA 3EPVA 4XEVA 5B3IA 2KW3C 1MNEA 3I5PA 3Q6MA 2B0HA 2CDQA 2G3VA 3AG1C 1YZAA 1Q0DA 4IRUA 2OJED 3ZQVA 3JYYA 3VM6A 3U2LA 2PX3A 1BR1A 4C3EA 4ANJA 1LM3B 1YARO 2LSEA 2KYHA 4FESA 2NUTA 3RQFA 2EPNA 2XLHA 3FHDA 1M6TA 1T01A 4DXWA 1MMDA 3LEOA 1G4US 4U5HA 4IARA 3HTKC 2YL1A 4IJJA 2WZLA 4KNWA 4MW3A 1U6HA 1HMOA 3AJMA 5KYWA 2C04A 1V4AA 2P1AA 4C3DA 2V3CC 2DYSC 256BA 3SP1A 3EFOA 4IB4A 2EPLX 2QY9A 2HMQA 3LNMB 3U8PA 4DRJB 5E2QA 5GPGB 5F5HA 2YRFA 4CS9A 4G0HA 1RKEB 1WASA 1Y4CA 3QW1A 4LDRA 1CGNA 1ZHTA 3B9QA 4MTOA 4CDVA 3UGPA 4YN0B 2H7OA 2XLOA 4H4KC 3TJ6A 3V5ZA 3S0XA 1E2XA 2A0BA 3IHUA 4PJMA 3FDQA 4JW1A 1UG7A 2J9UA 5DLJA 3GM1A 4AE4A 2OG2A 4EUKB 3QW0A 3AGTA 1FAPB 1XZPA 1TWGA 4OIQF 1H6GA 1C02A 3DE9A 5L3QA 1SMYF
chains in the Genus database with same CATH topology
1MQVA 1A7VA 4D4XA 3ZTMA 1NBBA 1JAFA 5JP7A 1QQ3A 2XM4A 5AGFA 1APCA 1BBHA 3DE8A 5JVEA 3VRCA 4CDAA 1CPRA 3QVYA 5JSLA 3FOPA 3NMKA 1EKYA 2XL6A 1E86A 3HNLA 2CCYA 1E83A 2J8WA 3M79A 4NC3A 2YL7A 4CDYA 4WGZA 3FOOA 2BC5A 3M15A 1QPUA 2YL3A 1E85A 3HNJA 4ER9A 4JE9A 1YZCA 1E84A 4ULVA 4JKVA 4CX9A 5JRAA 3TOMA 3IQ6A 4CJOA 1CGOA 2YLIA 1CPQA 4JEBA 3C63A 5JLIA 2XLEA 4EIYA 4U9EA 4U9DA 4IAQA 3M4CA 1S05A 2YKZA 5JS5A 5B3IA 2XLVA 2YLDA 3HNIA 2J9BA 2QLAA 3M4BA 1YZAA 3ZQVA 4JEAA 2XLMA 3IQ5A 5JUAA 3ZQYA 1LM3B 3TOLA 2XLHA 5JT4A 3C62A 1M6TA 4IARA 4N4WA 2YL1A 4N6HA 2YLGA 2XM0A 3HNKA 3L1MA 256BA 3NMIA 1GQAA 4IB4A 4CJGA 3U8PA 4CIPA 1RCPA 3ZTZA 3QW1A 4CDVA 1CGNA 1YYXA 3ZWIA 1YYJA 3NMJA 2XLOA 2XL8A 2YL0A 3QVZA 2XLWA 4WGYA 3QW0A 4D4NA 4L6RA 2XLDA 3DE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MQV A;  1A7V A;  4D4X A;  3ZTM A;  1NBB A;  1JAF A;  5JP7 A;  1QQ3 A;  2XM4 A;  5AGF A;  1APC A;  1BBH A;  3DE8 A;  5JVE A;  3VRC A;  4CDA A;  1CPR A;  3QVY A;  5JSL A;  3FOP A;  3NMK A;  1EKY A;  2XL6 A;  1E86 A;  3HNL A;  2CCY A;  1E83 A;  2J8W A;  3M79 A;  4NC3 A;  2YL7 A;  4CDY A;  4WGZ A;  3FOO A;  2BC5 A;  3M15 A;  1QPU A;  2YL3 A;  1E85 A;  3HNJ A;  4ER9 A;  4JE9 A;  1YZC A;  1E84 A;  4ULV A;  4JKV A;  4CX9 A;  5JRA A;  3TOM A;  3IQ6 A;  4CJO A;  1CGO A;  2YLI A;  1CPQ A;  4JEB A;  3C63 A;  5JLI A;  2XLE A;  4EIY A;  4U9E A;  4U9D A;  4IAQ A;  3M4C A;  1S05 A;  2YKZ A;  5JS5 A;  5B3I A;  2XLV A;  2YLD A;  3HNI A;  2J9B A;  2QLA A;  3M4B A;  1YZA A;  3ZQV A;  4JEA A;  2XLM A;  3IQ5 A;  5JUA A;  3ZQY A;  1LM3 B;  3TOL A;  2XLH A;  5JT4 A;  3C62 A;  1M6T A;  4IAR A;  4N4W A;  2YL1 A;  4N6H A;  2YLG A;  2XM0 A;  3HNK A;  3L1M A;  256B A;  3NMI A;  1GQA A;  4IB4 A;  4CJG A;  3U8P A;  4CIP A;  1RCP A;  3ZTZ A;  3QW1 A;  4CDV A;  1CGN A;  1YYX A;  3ZWI A;  1YYJ A;  3NMJ A;  2XLO A;  2XL8 A;  2YL0 A;  3QVZ A;  2XLW A;  4WGY A;  3QW0 A;  4D4N A;  4L6R A;  2XLD A;  3DE9 A; 
#chains in the Genus database with same CATH topology
 4R32 A;  1A7V A;  4D4X A;  1T6Q A;  1WWP A;  3QTH A;  4FWV A;  3UR3 C;  4O6Y A;  1U0B B;  2WVQ A;  1YVI A;  3ZTM A;  1NBB A;  1WAT A;  2HJ3 A;  5L0D A;  4DBQ A;  1SZI A;  5T3W A;  3ZVR A;  5L0I A;  4I1M A;  5DQZ A;  2J46 A;  4MVO A;  2M4E A;  5AGF A;  1BBH A;  1S7Z A;  3NYJ A;  5JVE A;  3I5Q A;  1JR8 A;  2PP4 A;  4P9T A;  3VRC A;  5AC4 A;  2OKU A;  3OWT A;  1CPR A;  2ZXO A;  4NTB A;  1M2O A;  2R9R B;  3QVY A;  2LCH A;  1L3P A;  3FOP A;  1O87 A;  3OEO A;  4B6I A;  4PFO A;  2E87 A;  4KNV A;  4CS8 C;  1HW2 A;  4U5F E;  2Q9B A;  3NG1 A;  4NTA A;  5EGY A;  5A6A A;  2PBE A;  4BEM J;  3N0T A;  3NDB B;  2L81 A;  4QI2 A;  4Z9I A;  3UMI A;  1FMV A;  3B0P A;  1FFT C;  2IXN A;  3DM5 A;  1ORS C;  2Q00 A;  2J7P A;  3ZDL A;  2CCY A;  3CZ6 A;  1E83 A;  2NG1 A;  1Z7Q c;  2YQY A;  3G4Z A;  5HSW A;  2P7V A;  2CGE A;  4PR9 A;  4W8K A;  2YL7 A;  2NUP A;  1OR3 A;  1PV3 A;  4CDY A;  1SYQ A;  3X2Q C;  5KYN A;  1NSG B;  1PCX A;  4MVS A;  1MMG A;  5L0J A;  4XTK A;  4MND A;  1ST6 A;  2KGO A;  2YL3 A;  3LAY A;  4MTF A;  3HNJ A;  1L7C A;  4ER9 A;  1YZC A;  3KYI A;  4ULV A;  5KYY A;  4MTG A;  1LE2 A;  3ECS A;  1ZVZ A;  3WAQ A;  1D1B A;  4JEB A;  3FVY A;  3C8Z A;  4LAC B;  5D92 A;  2J0W A;  2Y3G A;  3DI5 A;  4WAB A;  4OIN F;  4NQF A;  1JOG A;  2L6G A;  3DJN B;  5JLI A;  2HSB A;  1J8Y F;  1VMA A;  2EPO A;  4EIY A;  4U9E A;  1LIH A;  1OW8 A;  3M4C A;  2H7V C;  2LIG A;  2XXA A;  4HE8 D;  3RKO F;  4GQH A;  4A2N B;  4ZLC A;  1QVX A;  3K1I A;  3SNH A;  5L0C A;  2AWC A;  2BL2 A;  1Z6A A;  4YT4 A;  1RJ9 B;  1KU2 A;  4Z9J A;  4XQ1 A;  2VCC A;  3WG7 C;  1ZHW A;  5KYW B;  5B1A C;  1JMW A;  2V26 A;  3Q6N A;  3W4Y A;  5L0H A;  3RFY A;  2IYL D;  1PD0 A;  3HNI A;  2HFI A;  3RQG A;  2J0X A;  3EJN A;  1C17 M;  2VCA A;  3VF0 A;  1PD1 A;  1ZW3 A;  3AG4 C;  2A69 F;  3SXY A;  1OKK D;  2Q4F A;  1Q0K A;  4IGG A;  2R7X A;  2EIL C;  4NTF A;  2XLM A;  2P61 A;  1IZM A;  1OCO C;  3IQ5 A;  3NKE A;  2DI3 A;  4JCH A;  3A9C A;  4U5D E;  3J06 A;  2C03 A;  3RVZ A;  1ZU5 A;  2EPK X;  4BG0 A;  3W8H A;  3B29 A;  3K1H A;  4CSA A;  4JTD B;  2YWA A;  5JT4 A;  2VH3 A;  2I15 A;  3JYH A;  1OCR C;  1TWC A;  2FGY A;  2MHR A;  5F28 E;  4YK5 A;  3ZG1 A;  1TFO B;  1RXQ A;  2J45 A;  3S84 A;  5A69 A;  2XSE A;  1TR2 A;  2KNH A;  2XM0 A;  2YHS A;  2Z15 A;  3HNK A;  1Z23 A;  2A68 F;  2OCC C;  3WOD F;  2EPM X;  2HS5 A;  1BDJ B;  4CS9 C;  3KYJ A;  3CEX A;  4E18 A;  4EKW A;  1OXB A;  3ZC4 A;  4E0H A;  3G50 A;  4PAC A;  4J30 B;  3EZI A;  1RCP A;  1LI7 A;  2ZXP A;  4KC9 A;  4NY3 A;  1HW1 A;  2VAS A;  3C18 A;  4ULW A;  1E84 A;  1H9G A;  3SXM A;  5L3V A;  2YEV A;  1YYJ A;  2IXO A;  3UNG C;  1A41 A;  3NKD A;  1K40 A;  4I44 A;  4U5E E;  2XL4 A;  3O39 A;  3QVZ A;  2YL0 A;  5CI9 A;  1YA9 A;  2XLW A;  4D4N A;  4JTA B;  3NYM A;  5E3A A;  2F22 A;  3LUT B;  2AWY A;  4MVU A;  3FAP B;  4U5G A;  2CNW D;  1MQV A;  1TKN A;  3O55 A;  3Q7L A;  4O79 A;  1OQC A;  1HE9 A;  2OU6 A;  3EG9 B;  3U3B A;  5COM A;  2PFD A;  5JP7 A;  1V54 C;  3AG3 C;  2R7Q A;  3GWL A;  4K1O A;  1G4W R;  1Z63 A;  1APC A;  4G7O F;  2NSF A;  1O3U A;  2D4U A;  3EH1 A;  3U0C A;  2GDC A;  2EIJ C;  2KK1 A;  4GYT A;  3NMK A;  1BR2 A;  2L7A A;  1OW7 A;  4E17 A;  3T4R A;  2Q9C A;  2HMZ A;  3DWW A;  4BJ5 A;  2Q3T A;  1VK5 A;  1R4T A;  1ZHZ A;  1OR2 A;  1ZHY A;  3AQC A;  1WTY A;  3MYF A;  4JVS A;  4MQ9 F;  3DXJ F;  3KKB A;  4N6C A;  3T6B A;  3B0U X;  2A6E F;  2UUH A;  2WB7 A;  3UMK A;  5DS6 A;  1BR4 A;  5HV9 A;  2CYD A;  3EG9 A;  1Q0G A;  4LLC A;  4BPM A;  1IW7 F;  5A6K A;  2XS8 A;  3MBG A;  3MX3 A;  4MVM A;  3L0I A;  3EGX B;  2G62 A;  3TK0 A;  2Y3D A;  1XZQ A;  2HSQ A;  1A7E A;  2RD9 A;  1K05 A;  1QSP A;  2LQG A;  3FOO A;  4WGZ A;  1RKE A;  3LNR A;  5DQT A;  1ORJ A;  2HKV A;  2OQM A;  4JE9 A;  4W8P A;  3M1C B;  2I8B A;  2Y3H A;  2VC9 A;  2LFD A;  2ZD9 A;  3DKA A;  4U5B E;  3R7C A;  4WJ0 A;  2IXM A;  3LEV A;  1E85 A;  1VTM P;  2H8A A;  1ZW2 A;  4MVQ A;  3GEE A;  3OA1 A;  4G7H F;  1LVK A;  3FXH A;  2A0U A;  4JKV A;  1KTM A;  2L9J A;  4CX9 A;  3FMS A;  5L0F A;  3DAF A;  2LFF A;  3TOM A;  1VLT A;  2BE5 F;  2MWQ A;  4IWB A;  4CJO A;  1CPQ A;  2WVO A;  3SXZ A;  5A6B D;  3EGX A;  5BUO A;  2IM8 A;  1XWJ A;  2WZG A;  3DAG A;  2XLE A;  3QZC A;  3EHN A;  4U9D A;  5L0G A;  2YZS A;  2OEX A;  5IY5 C;  4YT5 A;  4RDA A;  1D1A A;  4IAO A;  1Z5Z A;  2QNL A;  2YKZ A;  3N2Z B;  1EQ1 A;  4P6I C;  3E9V A;  4HEA J;  4JUR I;  1OW6 A;  2JPU A;  3KMI A;  5KYU B;  5TJ5 E;  1NFN A;  4F4B A;  4O7G A;  5BQH A;  1OCC C;  3AGU A;  2XLV A;  2ETS A;  3X1O A;  2PNO A;  2YLD A;  4XPY A;  4FAP B;  1G8X A;  2G3K A;  2O9X A;  3AOU A;  3E70 C;  4XLN F;  4EBB A;  1C03 A;  3NYL A;  1NU7 D;  4JJF A;  1MND A;  1RMV A;  1M2V B;  3RVY A;  1GS9 A;  3ZQY A;  4EBJ A;  3A11 A;  2Y69 C;  4I3M A;  2ZXW C;  3FAJ A;  2R25 A;  3AG2 C;  4G78 A;  5KYU A;  1NG1 A;  3LJB A;  3GM2 A;  2HV7 A;  4JCZ A;  1T6U A;  2HJM A;  1Q0M A;  3TJ5 A;  1JRA A;  3U5S A;  2J9V A;  5CI8 A;  4H54 A;  4N4W A;  2EIM C;  1BZ4 A;  4RD9 A;  3CSK A;  2R7T A;  3V5X A;  3LES A;  3T6J A;  1ZYR F;  3L1M A;  3NMI A;  1GQA A;  4M63 A;  1LE4 A;  1O5H A;  1SF8 A;  3O6X A;  1YA7 O;  3EQL F;  3K66 A;  1LS1 A;  2MYS A;  1YDI A;  4CIP A;  1OXK A;  2R03 A;  4OIR F;  3RIP A;  2X0C A;  5K0I A;  2P6V A;  2P0N A;  3BRJ A;  2GA0 A;  2DB4 A;  3ATP A;  1W2W A;  5KYX B;  1YLM A;  4AL0 A;  1YYX A;  3SZR A;  3TQO A;  1ZHX A;  3NMJ A;  1CGM E;  4OIP F;  3SYN A;  3Q7G A;  4A4A A;  2KSF A;  5A6J A;  1VB5 A;  4BJ1 A;  4ZLD A;  2XL8 A;  2QTV A;  2FFH A;  1HY5 A;  1GGQ A;  2LD6 A;  4JTC B;  4MS2 A;  4PJL A;  4CS8 A;  3DZA A;  2R7R A;  1FR0 A;  3HLZ A;  4L6R A;  1H7I A;  1RJ9 A;  3NRH A;  2Y39 A;  3DJU B;  1VLS A;  1HE1 A;  4AL1 A;  1JPJ A;  2LP4 A;  3R2P A;  4G7Z F;  2VB6 A;  3TD7 A;  1VYI A;  2R05 A;  3GEH A;  3EGD B;  4XWJ A;  4DRH B;  2KQ9 A;  3LS1 A;  3EZH A;  4LLE A;  3W2V A;  4Q7C A;  1Y6D A;  5T1D B;  3US6 A;  1EA8 A;  1R5I D;  3C8G B;  2OOC A;  3RYL A;  1A0B A;  4CBE A;  4BJ5 C;  4XLP F;  4YL0 A;  1LPE A;  3MYI A;  1TFK B;  2IXP A;  1D1C A;  2PF4 E;  3W2W A;  3EHM A;  1Z3I X;  1FFH A;  2R7U A;  3CQZ A;  3IQC A;  1YAU O;  4BJ6 A;  3S28 A;  4YJW A;  1FNT c;  4YT2 A;  5A6B A;  3EGD A;  3F47 A;  3JRM O;  2XL6 A;  1E86 A;  3HNL A;  2TMV P;  1NU9 C;  1WOL A;  4ONS A;  3GAN A;  3C7J A;  4BEJ A;  2NUT B;  4DVY P;  1RKC A;  2H7B A;  2J9W A;  5E3C A;  3PDM P;  2BC5 A;  4U5C E;  1NZE A;  1V74 B;  5COG A;  1QPU A;  3MFN A;  3ASO C;  4Q4Z F;  2NPU A;  2XRH A;  4KBL A;  5F5F A;  1JPN A;  4CIH A;  2WL8 A;  3JRT A;  1VOM A;  1NFO A;  1TWA A;  2ZPA A;  2GFH A;  3BEH A;  3IEE A;  1NLX A;  3EH2 A;  5FZT A;  3ZSU A;  2RSE B;  3EFO B;  3UMH A;  5DVW A;  4HFK B;  3POV A;  2IBF A;  5DS4 A;  2W4M A;  3IQ6 A;  1MMA A;  1CGO A;  2YLI A;  4K0D A;  2W4B A;  2AP3 A;  4P9F A;  3KPH A;  2Q9A A;  3F46 A;  3IQT A;  3T6G B;  1FTS A;  2DGJ A;  2R7V A;  1F1M A;  4IAQ A;  3UGO A;  2AU5 A;  2KJG A;  3TUL A;  1S05 A;  4FX5 A;  4AE4 B;  1TWH A;  3O10 A;  2X51 A;  4DRI B;  5JS5 A;  4UDV A;  4HFF B;  3JTL O;  3K33 A;  3S29 A;  1M56 C;  4K7B A;  4YL1 A;  3V5Y A;  2DYR C;  4BJT A;  2HUJ A;  2QUP A;  2Y3B A;  3GM3 A;  2J9B A;  2A1D D;  1T9K A;  1D0X A;  2QE9 A;  2QLA A;  3U8V A;  3M4B A;  4NCQ A;  1OCZ C;  1EI7 A;  3SXK A;  4XEF A;  2W45 A;  4XPW A;  1AUE A;  3JZ0 A;  2IOQ A;  4JEA A;  2WZF A;  3GWN A;  3ASN C;  2JX0 A;  5JUA A;  4GEH A;  1N1C A;  1OKK A;  3GEI A;  3ABL C;  2GAQ A;  2R7O A;  4LER A;  4J7Y A;  3TOL A;  5FCL A;  2M64 A;  1LKX A;  2VCB A;  3C62 A;  3K1I C;  5EHH A;  1B68 A;  2Q7R A;  3L8I A;  5BQG A;  3U3F A;  1QZX A;  4LDK A;  5B3S C;  3C8G D;  5AC5 A;  3RH3 A;  4PK4 A;  3RQE A;  4N6H A;  4EWC A;  2YLG A;  4MW8 A;  3U9M A;  4DOZ A;  3JCU Q;  2A6H F;  3GOR A;  3VAY A;  4CJG A;  3GOD A;  3LLI A;  4JZA A;  1H9T A;  1I4Z A;  5EK0 A;  2JD3 A;  2NUP B;  3PCV A;  3IPM O;  3K6B A;  2AVK A;  2L6F A;  4JRZ A;  5CIV A;  3I4U A;  4N06 A;  4C7O B;  3ZTZ A;  3RW0 A;  4RBN A;  4CS7 A;  4OD4 A;  3LLK A;  3ZWI A;  2W9Y A;  2B0J A;  4QI0 A;  3ABM C;  3L34 A;  4CSA C;  1Q0F A;  2HV6 A;  2WVN A;  2YVK A;  1AEP A;  4WGY A;  5KYY B;  2HZ8 A;  4E0I A;  3PMR A;  2R7S A;  1AVO B;  2XLD A;  2OEV A;  1M57 C;  3JT1 A;  4JC7 A;  1QLE C;  4Z9H A;  3V7O A;  3S9O A;  1I5N A;  3DM9 B;  3JSZ A;  3WHN A;  4J7T A;  4C7O A;  2FAP B;  3T9O A;  1ZU4 A;  1G5Z A;  1T6I A;  2CNW A;  1ORY A;  1JAF A;  2L6H A;  3DMD A;  4XEK A;  3N24 A;  3KL4 A;  4PJJ A;  2XXA B;  1QQ3 A;  4I1O B;  2PX0 A;  3PHF 2;  2XM4 A;  1FMW A;  4DBR A;  3H65 A;  1M2V A;  2ICW G;  3DE8 A;  4O6N A;  2LK4 A;  4PFP A;  2NSG A;  3L8J A;  4CDA A;  4E7S A;  3KH2 A;  3U9J A;  5JSL A;  4YL3 A;  1VYK A;  3ZIB A;  4BJ6 C;  1D0Z A;  4Q5S F;  3DD7 A;  3K7D A;  5T3T A;  3AQB A;  1EKY A;  2R7W A;  1U89 A;  3H2U A;  3JSE O;  4OD5 A;  2ASR A;  2R02 A;  1YJG A;  2UUI A;  4JIO A;  4JJG A;  1QKR A;  2J8W A;  3ABK C;  3HJC A;  3M79 A;  4O6M A;  1KNY A;  1MMN A;  2XS1 A;  3HKK A;  4J32 B;  4NC3 A;  5BQI A;  2ZXR A;  3RF3 A;  1UFB A;  3LS0 A;  2EIK C;  4KI2 A;  5D91 A;  4DVZ A;  2CW0 F;  4MVZ A;  1WN0 A;  4X0R A;  4E7Z A;  5KYX A;  1D0Y A;  2OJQ A;  1V55 C;  2GWW A;  3M15 A;  4YWQ A;  1J8M F;  5B1B C;  1DOW A;  5COF A;  1A7D A;  4YT8 A;  1SR2 A;  1WGW A;  4C3B A;  4EHP A;  2EIN C;  1LI5 A;  5E33 A;  3CAX A;  3ITF A;  3SEO A;  5JRA A;  3S90 A;  1T5O A;  4MVR A;  4PJN A;  3S27 A;  3VYW A;  3H2V A;  3MLG A;  1LS4 A;  1ZZP A;  3B71 A;  4OIO F;  4QDL A;  1TQG A;  3C63 A;  4EBK A;  5DS5 A;  1K04 A;  3G4X A;  2J7P D;  3B0V C;  3QMK A;  2KC3 A;  3U2M A;  3W8I A;  4AX2 A;  2D5R B;  1I4Y A;  4LDQ A;  1DOV A;  1GM5 A;  4XPX A;  4DJ9 A;  4AK9 A;  1HMD A;  3C8G A;  3EPV A;  4XEV A;  5B3I A;  2KW3 C;  1MNE A;  3I5P A;  3Q6M A;  2B0H A;  2CDQ A;  2G3V A;  3AG1 C;  1YZA A;  1Q0D A;  4IRU A;  2OJE D;  3ZQV A;  3JYY A;  3VM6 A;  3U2L A;  2PX3 A;  1BR1 A;  4C3E A;  4ANJ A;  1LM3 B;  1YAR O;  2LSE A;  2KYH A;  4FES A;  2NUT A;  3RQF A;  2EPN A;  2XLH A;  3FHD A;  1M6T A;  1T01 A;  4DXW A;  1MMD A;  3LEO A;  1G4U S;  4U5H A;  4IAR A;  3HTK C;  2YL1 A;  4IJJ A;  2WZL A;  4KNW A;  4MW3 A;  1U6H A;  1HMO A;  3AJM A;  5KYW A;  2C04 A;  1V4A A;  2P1A A;  4C3D A;  2V3C C;  2DYS C;  256B A;  3SP1 A;  3EFO A;  4IB4 A;  2EPL X;  2QY9 A;  2HMQ A;  3LNM B;  3U8P A;  4DRJ B;  5E2Q A;  5GPG B;  5F5H A;  2YRF A;  4CS9 A;  4G0H A;  1RKE B;  1WAS A;  1Y4C A;  3QW1 A;  4LDR A;  1CGN A;  1ZHT A;  3B9Q A;  4MTO A;  4CDV A;  3UGP A;  4YN0 B;  2H7O A;  2XLO A;  4H4K C;  3TJ6 A;  3V5Z A;  3S0X A;  1E2X A;  2A0B A;  3IHU A;  4PJM A;  3FDQ A;  4JW1 A;  1UG7 A;  2J9U A;  5DLJ A;  3GM1 A;  4AE4 A;  2OG2 A;  4EUK B;  3QW0 A;  3AGT A;  1FAP B;  1XZP A;  1TWG A;  4OIQ F;  1H6G A;  1C02 A;  3DE9 A;  5L3Q A;  1SMY F; 
#chains in the Genus database with same CATH homology
 1MQV A;  1A7V A;  4D4X A;  3ZTM A;  1NBB A;  1JAF A;  5JP7 A;  1QQ3 A;  2XM4 A;  5AGF A;  1APC A;  1BBH A;  3DE8 A;  5JVE A;  3VRC A;  4CDA A;  1CPR A;  3QVY A;  5JSL A;  3FOP A;  3NMK A;  1EKY A;  2XL6 A;  1E86 A;  3HNL A;  2CCY A;  1E83 A;  2J8W A;  3M79 A;  4NC3 A;  2YL7 A;  4CDY A;  4WGZ A;  3FOO A;  2BC5 A;  3M15 A;  1QPU A;  2YL3 A;  1E85 A;  3HNJ A;  4ER9 A;  4JE9 A;  1YZC A;  1E84 A;  4ULV A;  4JKV A;  4CX9 A;  5JRA A;  3TOM A;  3IQ6 A;  4CJO A;  1CGO A;  2YLI A;  1CPQ A;  4JEB A;  3C63 A;  5JLI A;  2XLE A;  4EIY A;  4U9E A;  4U9D A;  4IAQ A;  3M4C A;  1S05 A;  2YKZ A;  5JS5 A;  5B3I A;  2XLV A;  2YLD A;  3HNI A;  2J9B A;  2QLA A;  3M4B A;  1YZA A;  3ZQV A;  4JEA A;  2XLM A;  3IQ5 A;  5JUA A;  3ZQY A;  1LM3 B;  3TOL A;  2XLH A;  5JT4 A;  3C62 A;  1M6T A;  4IAR A;  4N4W A;  2YL1 A;  4N6H A;  2YLG A;  2XM0 A;  3HNK A;  3L1M A;  256B A;  3NMI A;  1GQA A;  4IB4 A;  4CJG A;  3U8P A;  4CIP A;  1RCP A;  3ZTZ A;  3QW1 A;  4CDV A;  1CGN A;  1YYX A;  3ZWI A;  1YYJ A;  3NMJ A;  2XLO A;  2XL8 A;  2YL0 A;  3QVZ A;  2XLW A;  4WGY A;  3QW0 A;  4D4N A;  4L6R A;  2XLD A;  3DE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...