3M79A

A tetrameric zn-bound cytochrome cb562 complex with covalently and non-covalently stabilized interfaces crystallized in the presence of cu(ii) and zn(ii)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHDALHLANEGKVKEAQAAAEQLKCTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title Evolution of metal selectivity in templated protein interfaces.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 48
structure length 106
sequence length 106
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2010-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3m79A00
5JRAA 1E83A 4CX9A 4D4NA 2QLAA 4CDVA 2YKZA 4CIPA 1NBBA 2YL1A 5JP7A 2XLHA 3HNLA 4U9EA 2YL0A 3HNIA 3FOOA 1LM3B 2YLIA 1QPUA 2YLGA 2XL6A 2XLEA 4IAQA 2YL3A 1YYJA 1M6TA 1JAFA 3DE8A 3ZWIA 5JVEA 3M4BA 256BA 4JKVA 1YZCA 1EKYA 1A7VA 4JEAA 2XLDA 1S05A 2XLMA 2CCYA 4CDYA 3NMJA 4EIYA 5AGFA 2XLVA 3M79A 3IQ5A 1APCA 3M15A 3QVZA 5JLIA 1CPRA 3HNKA 3TOMA 2YLDA 4CDAA 3VRCA 3NMIA 4N6HA 1E84A 2XLOA 4IB4A 3ZTMA 1YYXA 2BC5A 3U8PA 3HNJA 4U9DA 5JSLA 4D4XA 1E85A 2XL8A 4WGYA 3IQ6A 1CPQA 4IARA 3C63A 3QVYA 5JUAA 4WGZA 1CGOA 2J9BA 1GQAA 1RCPA 3C62A 1YZAA 4JEBA 3L1MA 3NMKA 2XM0A 3ZQVA 3M4CA 4JE9A 3QW1A 3TOLA 1MQVA 5B3IA 5JS5A 4L6RA 4ER9A 2XM4A 1BBHA 4N4WA 1QQ3A 3ZQYA 3ZTZA 4CJGA 4CJOA 4NC3A 1E86A 4ULVA 2J8WA 3FOPA 2XLWA 5JT4A 3DE9A 3QW0A 1CGNA 2YL7A
chains in the Genus database with same CATH superfamily
4IAOA 4EKWA 2A0BA 2KNHA 1EA8A 1H6GA 3Q6NA 4LLCA 3TOLA 4YT8A 1E83A 2XXAA 4YL1A 3L34A 3AJMA 3TQOA 4D4NA 5KYWB 4U5DE 2J0XA 1B68A 2JPUA 1WATA 4NY3A 1YLMA 2Z15A 5KYWA 3GM3A 4AL0A 2J45A 1QVXA 4GYTA 2YKZA 4CIPA 2YL1A 3E70C 4LDKA 4DVZA 1C03A 1BDJB 1DOWA 2OEVA 3EG9B 1JR8A 3B71A 2EILC 1HE1A 3EG9A 4JURI 2YLIA 4G0HA 5B1BC 1QKRA 1QPUA 4PFPA 2XL6A 1FR0A 2ZD9A 1J8MF 1HW1A 1ZU5A 1LIHA 4ZLDA 4C3EA 4NCQA 4DRHB 1LVKA 3CSKA 1I5NA 3ZWIA 2P0NA 2OG2A 3A11A 3HJCA 4UDVA 4C7OA 3NYLA 1NU9C 3L0IA 4BJ1A 1D1CA 2XLDA 3X2QC 1LS4A 4NTAA 2XLMA 3H65A 1C17M 2J7PD 4QI0A 1LE2A 1HE9A 4JTCB 2UUIA 3EPVA 4G7OF 1ZHZA 2PX3A 4RD9A 1L3PA 4HFKB 4OINF 4AX2A 5EHHA 3FDQA 3O55A 1LI5A 3G4XA 3AGUA 2XLVA 3M79A 4A4AA 2XS1A 2P7VA 4NTFA 1L7CA 3K33A 3M15A 1D1AA 4I3MA 3TD7A 1CPRA 2ZPAA 3HNKA 2GWWA 5KYUB 5A6BA 1OXBA 3AG1C 1Z5ZA 3BRJA 4N6HA 4PJNA 2YVKA 1K05A 3U9MA 2OJQA 3QTHA 4AE4B 4IB4A 1ORYA 1SYQA 1NFOA 2HZ8A 3ZDLA 1HMDA 4AE4A 2HV7A 3HTKC 4G7HF 3LEOA 1MMGA 2LFDA 4YT5A 1FMWA 1RKCA 2BC5A 1ZVZA 2OOCA 2A69F 2VASA 4E0IA 1JRAA 5A6JA 1T6UA 4U9DA 1LE4A 3EJNA 2WB7A 2I15A 3ABMC 3EZIA 2Q9CA 4J30B 1E85A 4MNDA 1NZEA 2XL4A 4OD4A 3LESA 4WGYA 4MQ9F 4RBNA 1OKKD 2HUJA 4KNWA 3ABLC 4E17A 3I4UA 3MYIA 3B29A 2L6FA 3EFOB 3LNRA 3F47A 4OIPF 3TK0A 3OEOA 3K1IC 3EFOA 1YARO 2L81A 3CEXA 3AGTA 3EGDB 3TJ5A 3J06A 1D1BA 2Q00A 3GWNA 4XPXA 5DQTA 3EGDA 4EBKA 1I4YA 3ITFA 4MTOA 3BEHA 3KYJA 1M57C 2HKVA 3GM2A 2Q3TA 5AC5A 4O6MA 3UR3C 3ZVRA 4MVZA 3DJUB 4E0HA 3IEEA 4O6NA 3U2LA 4C3BA 2HMZA 2W4MA 3NKEA 3ZQVA 2WVOA 2GA0A 3QW1A 2R7VA 2AWCA 2TMVP 3VF0A 2R05A 2B0JA 5DS4A 2KSFA 4FAPB 4MTGA 3ZQYA 4AK9A 3AG4C 1Z63A 3G4ZA 3CAXA 2ICWG 2R7TA 1VYKA 3ZTZA 4CJGA 4OIRF 4CJOA 4NC3A 1VLSA 1NSGB 4J7TA 3GEHA 2WL8A 3MLGA 1K40A 3RVYA 2JX0A 5DS6A 1MNEA 2FFHA 2HSBA 3H2VA 4G7ZF 5JT4A 3NRHA 1G8XA 2DI3A 1FFTC 1CGNA 3RYLA 3PCVA 1PD1A 4DBRA 2WZGA 2Y3GA 1OCZC 5BQIA 1V4AA 3TJ6A 1HMOA 3S90A 1EQ1A 1JMWA 2A1DD 3T6BA 2MHRA 1PD0A 4CX9A 3MYFA 1LKXA 3I5PA 3NYMA 2XXAB 4O6YA 3KL4A 3B0UX 2NG1A 3EQLF 5D91A 2VH3A 3DKAA 3S84A 4GEHA 4KBLA 3ZG1A 2XLHA 3UMKA 5DVWA 3HNLA 3S28A 1BR4A 1XZPA 4H54A 3IQTA 3X1OA 3JCUQ 3E9VA 2M64A 2IXNA 1NU7D 2WVQA 3T6JA 1VOMA 1H9TA 2HFIA 1WTYA 2YLGA 2ZXRA 4PJLA 1OCOC 4IAQA 4JCHA 1M2VB 4I44A 3K66A 5DLJA 2L9JA 5T3TA 5A6KA 2LIGA 1M2VA 3S0XA 1JAFA 3R2PA 1Q0GA 3DMDA 3W8HA 256BA 4E7ZA 1GGQA 5L3VA 1A7VA 2CW0F 1YA7O 2LK4A 2R02A 2Y3HA 1Y4CA 1S05A 3JRTA 2I8BA 1FMVA 2PNOA 4J32B 3UNGC 4DXWA 1RXQA 2AVKA 3GEEA 4MW3A 1AEPA 2ZXOA 3RKOF 3JYHA 3K7DA 4N6CA 1WN0A 2BE5F 2B0HA 2EINC 2NPUA 4FESA 1FFHA 1ZHTA 4ONSA 3C8GD 3FAJA 3KKBA 5AGFA 4E18A 2LD6A 4HE8D 4XQ1A 3U3FA 2M4EA 5T3WA 3V5YA 3W2WA 5DS5A 1MMNA 4OIOF 2QTVA 3QVZA 2R25A 3EHNA 5JLIA 1Q0MA 5F5FA 3TOMA 4Z9HA 1ZW2A 2YLDA 4P9TA 2BL2A 4Q7CA 2XLOA 3KMIA 2HJMA 1E84A 2IOQA 3T6GB 2VCCA 3OWTA 4ULWA 3WAQA 3ZTMA 1MMDA 4LLEA 1M56C 4N06A 2CYDA 4JRZA 4WJ0A 1SZIA 1WASA 3ECSA 1U89A 2PFDA 4O7GA 2WVNA 1O87A 2A68F 3HNJA 2FAPB 3V5ZA 4KC9A 3V5XA 4D4XA 1ZHXA 2HS5A 3A9CA 3O39A 2JD3A 4I1OB 4IWBA 4BEJA 4U5GA 3C63A 3EZHA 4JZAA 5L0IA 3FXHA 4PR9A 2ETSA 5JUAA 4W8KA 4MVSA 1KU2A 2R7QA 3SEOA 3K6BA 1OR2A 1TWCA 2XS8A 2NUPB 4ANJA 1J8YF 5KYUA 3KH2A 3SXZA 3UMHA 2J9VA 2LFFA 2NUPA 3O6XA 4U5BE 4EWCA 4YT2A 4MVRA 3L8JA 1YZAA 5K0IA 3TULA 2R7WA 2EPNA 2WZFA 4F4BA 2Q4FA 3VYWA 3LEVA 3OA1A 3W4YA 4EBJA 3N2ZB 3SYNA 3JRMO 1O3UA 3ASNC 3NG1A 3RH3A 4L6RA 5L0CA 1BR2A 2FGYA 4BJ6A 2VCBA 4JTDB 3DJNB 4FWVA 1ZYRF 4DBQA 4CIHA 3MX3A 1HY5A 5A6AA 3O10A 5A69A 1CGME 4NTBA 2W45A 3ZC4A 2O9XA 4LDQA 5F28E 1LI7A 2CNWA 1WGWA 4EHPA 3FOPA 2XLWA 3GWLA 3Q7GA 4HEAJ 3DE9A 3QW0A 4CBEA 4YN0B 3T4RA 4HFFB 3EH2A 2AP3A 3RQFA 4Q4ZF 3PHF2 4MVQA 1OQCA 2IXMA 3FHDA 3U8VA 2R7SA 3RQGA 3DZAA 2EIMC 1FTSA 3HKKA 2DB4A 4U5FE 1YJGA 4R32A 5T1DB 3U9JA 1WWPA 5KYYB 5A6BD 1ST6A 2ASRA 2OQMA 3G50A 4YJWA 5BQGA 4OD5A 5KYYA 3WHNA 1AVOB 1NBBA 5E2QA 4WABA 5EK0A 5JP7A 5BQHA 1RJ9B 3JZ0A 1MMAA 4PACA 5TJ5E 5KYNA 5E33A 1RJ9A 1A0BA 5L0HA 3EHMA 3HNIA 3K1HA 4IGGA 1A41A 1G5ZA 3CZ6A 2AWYA 1JOGA 4PK4A 1KTMA 2XLEA 2EIKC 2LSEA 5L0FA 3U2MA 2QUPA 1TWAA 2YL3A 1YYJA 5CIVA 3SXKA 1LPEA 3SXMA 4XEFA 1S7ZA 1VB5A 3DI5A 4FX5A 4I1MA 4YL0A 3RQEA 2IBFA 4MS2A 5L0DA 1YZCA 2MYSA 3LS0A 2A0UA 1PV3A 1Q0DA 1XZQA 3NKDA 1ZZPA 2GDCA 3FMSA 4KNVA 4IJJA 4X0RA 5B1AC 2GFHA 2RD9A 2Y3DA 2HMQA 2KW3C 1G4WR 4MVMA 1SMYF 2KJGA 3LNMB 1SF8A 3NMJA 1VYIA 2AU5A 3R7CA 2ZXPA 2DYRC 4Z9IA 3SZRA 3IQ5A 1OW6A 1T9KA 2KQ9A 4CS8A 4MVUA 1APCA 4JW1A 2QE9A 4O79A 2R7UA 2YQYA 4LACB 4DRIB 5HSWA 3B0PA 1FAPB 1K04A 2IYLD 4ZLCA 2OEXA 4U5HA 4CDAA 2H7OA 2X0CA 3VRCA 3NMIA 5CI8A 1SR2A 3KPHA 1LS1A 3RIPA 3U5SA 2J9UA 1NG1A 5IY5C 3DD7A 2R03A 4KI2A 2W4BA 2PP4A 2EPMX 3DXJF 1TFKB 2IXPA 3GM1A 1H9GA 2VCAA 3QMKA 2OU6A 1RKEB 5KYXB 1JPNA 4BEMJ 4XLPF 3LLKA 5KYXA 5JSLA 3LUTB 2HV6A 2KC3A 5HV9A 3UGOA 3DM9B 3UGPA 1Z7Qc 2Y3BA 2NSGA 1EI7A 3IQ6A 2EPOA 2G3KA 4XEKA 2G62A 2OKUA 2C03A 2X51A 1QSPA 4H4KC 3SP1A 4B6IA 5FZTA 1ORSC 1GS9A 4BJ6C 2J7PA 2D4UA 3MBGA 3QVYA 3ZSUA 3VAYA 1GQAA 2J46A 2Q9AA 2H7BA 3ABKC 2GAQA 1JPJA 3ASOC 4JJFA 2MWQA 4JVSA 1ZW3A 2PBEA 3VM6A 4JEBA 3L1MA 3SNHA 5F5HA 4NQFA 2P1AA 2J0WA 2YHSA 2HJ3A 1C02A 3EH1A 5B3IA 4ER9A 2H7VC 3H2UA 1BBHA 3AQCA 1TWHA 1D0XA 3FVYA 1QQ3A 3Q6MA 1VLTA 1WOLA 2IM8A 1R4TA 3JSZA 5D92A 3AG3C 3RF3A 1OCCC 1AUEA 2NSFA 1E86A 2R9RB 1D0YA 4LDRA 3GANA 3POVA 3ATPA 4U5CE 1FNTc 1OW7A 2F22A 2J8WA 1TFOB 1N1CA 5JS5A 4W8PA 1Z6AA 2XSEA 1NLXA 2EIJC 4C7OB 1VK5A 3AG2C 5E3CA 4CS9C 1V54C 5JRAA 1U6HA 1OKKA 4XTKA 2VB6A 1E2XA 3KYIA 2H8AA 2HSQA 2OJED 2Y39A 2YRFA 3RFYA 1G4US 2QLAA 2ZXWC 1A7DA 4GQHA 4MW8A 2C04A 1ORJA 4QDLA 4CDVA 4DJ9A 3QZCA 4CSAC 4LERA 2KYHA 5BUOA 2EPKX 1V55C 1M2OA 4EUKB 1W2WA 1NFNA 2PX0A 2UUHA 2YL0A 4U9EA 4A2NB 3Q7LA 1DOVA 1OR3A 1T01A 1LM3B 3FOOA 4JC7A 3US6A 3N24A 3W2VA 3SXYA 2Q7RA 3WODF 3PDMP 4JIOA 1HW2A 4CS8C 5L0JA 1TKNA 3RVZA 3GODA 4BJ5C 3F46A 1M6TA 1Z3IX 3NYJA 3DE8A 4Q5SF 4DVYP 5JVEA 3M4BA 4JKVA 1U0BB 3GORA 2R7RA 1EKYA 4PJJA 2P61A 2W9YA 1UFBA 4JEAA 3I5QA 2D5RB 5COFA 2QNLA 4BPMA 1Y6DA 2A6HF 3ZIBA 2R7XA 3IPMO 3JT1A 3M1CB 5COGA 4BG0A 1MNDA 1TWGA 2CGEA 1OXKA 2CCYA 2G3VA 3DWWA 3LAYA 4Z9JA 1Q0KA 4CDYA 2XRHA 2R7OA 3AQBA 1ZHWA 4JJGA 1BZ4A 5FCLA 1QZXA 4U5EE 4EIYA 4XEVA 2V26A 2DGJA 3MFNA 5L0GA 1YA9A 3L8IA 2YZSA 5CI9A 1VMAA 4G78A 4J7YA 5B3SC 2E87A 1Q0FA 3JTLO 3S9OA 3HLZA 1VTMP 2YWAA 5DQZA 4YK5A 4CS9A 3LLIA 4P9FA 4XLNF 3RW0A 4E7SA 3EGXB 4MTFA 4XPWA 3T9OA 5AC4A 3EGXA 1F1MA 1IZMA 3JSEO 3FAPB 1OW8A 1YYXA 2A6EF 2RSEB 4IRUA 5L3QA 4CSAA 4DRJB 4QI2A 1GM5A 3B0VC 1O5HA 2PF4E 3U8PA 1YVIA 1YDIA 2CNWD 3N0TA 2LP4A 2XL8A 4M63A 1V74B 1I4ZA 4XWJA 5COMA 2P6VA 3U0CA 5EGYA 3C7JA 1D0ZA 1CPQA 2VC9A 3LJBA 4IARA 3DM5A 4BJ5A 3UMIA 2QY9A 3U3BA 1IW7F 2L7AA 2OCCC 4JTAB 3NDBB 4WGZA 1CGOA 3DAGA 1R5ID 3IHUA 4RDAA 2J9BA 3WG7C 1T6IA 3C8GB 1KNYA 4K7BA 4YWQA 4CS7A 1RCPA 3C62A 4MVOA 1RMVA 4XPYA 3C8GA 4EBBA 3V7OA 1BR1A 4BJTA 2L6GA 4AL1A 2YEVA 1TQGA 3AOUA 1H7IA 1XWJA 1ZU4A 3NMKA 1T6QA 2XM0A 2DYSC 3B9QA 3GEIA 2EPLX 3JYYA 1UG7A 3M4CA 3PMRA 4JE9A 1YAUO 1MQVA 1T5OA 1RKEA 2WZLA 4P6IC 3S27A 3S29A 2KGOA 2CDQA 5GPGB 2XM4A 4N4WA 2NUTB 3W8IA 4OIQF 1OCRC 1QLEC 1ZHYA 2J9WA 2NUTA 3K1IA 1A7EA 4YT4A 2V3CC 4PJMA 2KK1A 3LS1A 5E3AA 3C8ZA 1PCXA 3C18A 4ULVA 4PFOA 4C3DA 2Y69C 2L6HA 4JCZA 4K0DA 3DAFA 2LCHA 1Z23A 4YL3A 1TR2A 2LQGA 2Q9BA 4K1OA 2YL7A 4DOZA 3CQZA 2IXOA 3IQCA
chains in the Genus database with same CATH topology
5JRAA 1E83A 4CX9A 4D4NA 2QLAA 4CDVA 2YKZA 4CIPA 1NBBA 2YL1A 5JP7A 2XLHA 3HNLA 4U9EA 2YL0A 3HNIA 3FOOA 1LM3B 2YLIA 1QPUA 2YLGA 2XL6A 2XLEA 4IAQA 2YL3A 1YYJA 1M6TA 1JAFA 3DE8A 3ZWIA 5JVEA 3M4BA 256BA 4JKVA 1YZCA 1EKYA 1A7VA 4JEAA 2XLDA 1S05A 2XLMA 2CCYA 4CDYA 3NMJA 4EIYA 5AGFA 2XLVA 3M79A 3IQ5A 1APCA 3M15A 3QVZA 5JLIA 1CPRA 3HNKA 3TOMA 2YLDA 4CDAA 3VRCA 3NMIA 4N6HA 1E84A 2XLOA 4IB4A 3ZTMA 1YYXA 2BC5A 3U8PA 3HNJA 4U9DA 5JSLA 4D4XA 1E85A 2XL8A 4WGYA 3IQ6A 1CPQA 4IARA 3C63A 3QVYA 5JUAA 4WGZA 1CGOA 2J9BA 1GQAA 1RCPA 3C62A 1YZAA 4JEBA 3L1MA 3NMKA 2XM0A 3ZQVA 3M4CA 4JE9A 3QW1A 3TOLA 1MQVA 5B3IA 5JS5A 4L6RA 4ER9A 2XM4A 1BBHA 4N4WA 1QQ3A 3ZQYA 3ZTZA 4CJGA 4CJOA 4NC3A 1E86A 4ULVA 2J8WA 3FOPA 2XLWA 5JT4A 3DE9A 3QW0A 1CGNA 2YL7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JRA A;  1E83 A;  4CX9 A;  4D4N A;  2QLA A;  4CDV A;  2YKZ A;  4CIP A;  1NBB A;  2YL1 A;  5JP7 A;  2XLH A;  3HNL A;  4U9E A;  2YL0 A;  3HNI A;  3FOO A;  1LM3 B;  2YLI A;  1QPU A;  2YLG A;  2XL6 A;  2XLE A;  4IAQ A;  2YL3 A;  1YYJ A;  1M6T A;  1JAF A;  3DE8 A;  3ZWI A;  5JVE A;  3M4B A;  256B A;  4JKV A;  1YZC A;  1EKY A;  1A7V A;  4JEA A;  2XLD A;  1S05 A;  2XLM A;  2CCY A;  4CDY A;  3NMJ A;  4EIY A;  5AGF A;  2XLV A;  3M79 A;  3IQ5 A;  1APC A;  3M15 A;  3QVZ A;  5JLI A;  1CPR A;  3HNK A;  3TOM A;  2YLD A;  4CDA A;  3VRC A;  3NMI A;  4N6H A;  1E84 A;  2XLO A;  4IB4 A;  3ZTM A;  1YYX A;  2BC5 A;  3U8P A;  3HNJ A;  4U9D A;  5JSL A;  4D4X A;  1E85 A;  2XL8 A;  4WGY A;  3IQ6 A;  1CPQ A;  4IAR A;  3C63 A;  3QVY A;  5JUA A;  4WGZ A;  1CGO A;  2J9B A;  1GQA A;  1RCP A;  3C62 A;  1YZA A;  4JEB A;  3L1M A;  3NMK A;  2XM0 A;  3ZQV A;  3M4C A;  4JE9 A;  3QW1 A;  3TOL A;  1MQV A;  5B3I A;  5JS5 A;  4L6R A;  4ER9 A;  2XM4 A;  1BBH A;  4N4W A;  1QQ3 A;  3ZQY A;  3ZTZ A;  4CJG A;  4CJO A;  4NC3 A;  1E86 A;  4ULV A;  2J8W A;  3FOP A;  2XLW A;  5JT4 A;  3DE9 A;  3QW0 A;  1CGN A;  2YL7 A; 
#chains in the Genus database with same CATH topology
 4IAO A;  4EKW A;  2A0B A;  2KNH A;  1EA8 A;  1H6G A;  3Q6N A;  4LLC A;  3TOL A;  4YT8 A;  1E83 A;  2XXA A;  4YL1 A;  3L34 A;  3AJM A;  3TQO A;  4D4N A;  5KYW B;  4U5D E;  2J0X A;  1B68 A;  2JPU A;  1WAT A;  4NY3 A;  1YLM A;  2Z15 A;  5KYW A;  3GM3 A;  4AL0 A;  2J45 A;  1QVX A;  4GYT A;  2YKZ A;  4CIP A;  2YL1 A;  3E70 C;  4LDK A;  4DVZ A;  1C03 A;  1BDJ B;  1DOW A;  2OEV A;  3EG9 B;  1JR8 A;  3B71 A;  2EIL C;  1HE1 A;  3EG9 A;  4JUR I;  2YLI A;  4G0H A;  5B1B C;  1QKR A;  1QPU A;  4PFP A;  2XL6 A;  1FR0 A;  2ZD9 A;  1J8M F;  1HW1 A;  1ZU5 A;  1LIH A;  4ZLD A;  4C3E A;  4NCQ A;  4DRH B;  1LVK A;  3CSK A;  1I5N A;  3ZWI A;  2P0N A;  2OG2 A;  3A11 A;  3HJC A;  4UDV A;  4C7O A;  3NYL A;  1NU9 C;  3L0I A;  4BJ1 A;  1D1C A;  2XLD A;  3X2Q C;  1LS4 A;  4NTA A;  2XLM A;  3H65 A;  1C17 M;  2J7P D;  4QI0 A;  1LE2 A;  1HE9 A;  4JTC B;  2UUI A;  3EPV A;  4G7O F;  1ZHZ A;  2PX3 A;  4RD9 A;  1L3P A;  4HFK B;  4OIN F;  4AX2 A;  5EHH A;  3FDQ A;  3O55 A;  1LI5 A;  3G4X A;  3AGU A;  2XLV A;  3M79 A;  4A4A A;  2XS1 A;  2P7V A;  4NTF A;  1L7C A;  3K33 A;  3M15 A;  1D1A A;  4I3M A;  3TD7 A;  1CPR A;  2ZPA A;  3HNK A;  2GWW A;  5KYU B;  5A6B A;  1OXB A;  3AG1 C;  1Z5Z A;  3BRJ A;  4N6H A;  4PJN A;  2YVK A;  1K05 A;  3U9M A;  2OJQ A;  3QTH A;  4AE4 B;  4IB4 A;  1ORY A;  1SYQ A;  1NFO A;  2HZ8 A;  3ZDL A;  1HMD A;  4AE4 A;  2HV7 A;  3HTK C;  4G7H F;  3LEO A;  1MMG A;  2LFD A;  4YT5 A;  1FMW A;  1RKC A;  2BC5 A;  1ZVZ A;  2OOC A;  2A69 F;  2VAS A;  4E0I A;  1JRA A;  5A6J A;  1T6U A;  4U9D A;  1LE4 A;  3EJN A;  2WB7 A;  2I15 A;  3ABM C;  3EZI A;  2Q9C A;  4J30 B;  1E85 A;  4MND A;  1NZE A;  2XL4 A;  4OD4 A;  3LES A;  4WGY A;  4MQ9 F;  4RBN A;  1OKK D;  2HUJ A;  4KNW A;  3ABL C;  4E17 A;  3I4U A;  3MYI A;  3B29 A;  2L6F A;  3EFO B;  3LNR A;  3F47 A;  4OIP F;  3TK0 A;  3OEO A;  3K1I C;  3EFO A;  1YAR O;  2L81 A;  3CEX A;  3AGT A;  3EGD B;  3TJ5 A;  3J06 A;  1D1B A;  2Q00 A;  3GWN A;  4XPX A;  5DQT A;  3EGD A;  4EBK A;  1I4Y A;  3ITF A;  4MTO A;  3BEH A;  3KYJ A;  1M57 C;  2HKV A;  3GM2 A;  2Q3T A;  5AC5 A;  4O6M A;  3UR3 C;  3ZVR A;  4MVZ A;  3DJU B;  4E0H A;  3IEE A;  4O6N A;  3U2L A;  4C3B A;  2HMZ A;  2W4M A;  3NKE A;  3ZQV A;  2WVO A;  2GA0 A;  3QW1 A;  2R7V A;  2AWC A;  2TMV P;  3VF0 A;  2R05 A;  2B0J A;  5DS4 A;  2KSF A;  4FAP B;  4MTG A;  3ZQY A;  4AK9 A;  3AG4 C;  1Z63 A;  3G4Z A;  3CAX A;  2ICW G;  2R7T A;  1VYK A;  3ZTZ A;  4CJG A;  4OIR F;  4CJO A;  4NC3 A;  1VLS A;  1NSG B;  4J7T A;  3GEH A;  2WL8 A;  3MLG A;  1K40 A;  3RVY A;  2JX0 A;  5DS6 A;  1MNE A;  2FFH A;  2HSB A;  3H2V A;  4G7Z F;  5JT4 A;  3NRH A;  1G8X A;  2DI3 A;  1FFT C;  1CGN A;  3RYL A;  3PCV A;  1PD1 A;  4DBR A;  2WZG A;  2Y3G A;  1OCZ C;  5BQI A;  1V4A A;  3TJ6 A;  1HMO A;  3S90 A;  1EQ1 A;  1JMW A;  2A1D D;  3T6B A;  2MHR A;  1PD0 A;  4CX9 A;  3MYF A;  1LKX A;  3I5P A;  3NYM A;  2XXA B;  4O6Y A;  3KL4 A;  3B0U X;  2NG1 A;  3EQL F;  5D91 A;  2VH3 A;  3DKA A;  3S84 A;  4GEH A;  4KBL A;  3ZG1 A;  2XLH A;  3UMK A;  5DVW A;  3HNL A;  3S28 A;  1BR4 A;  1XZP A;  4H54 A;  3IQT A;  3X1O A;  3JCU Q;  3E9V A;  2M64 A;  2IXN A;  1NU7 D;  2WVQ A;  3T6J A;  1VOM A;  1H9T A;  2HFI A;  1WTY A;  2YLG A;  2ZXR A;  4PJL A;  1OCO C;  4IAQ A;  4JCH A;  1M2V B;  4I44 A;  3K66 A;  5DLJ A;  2L9J A;  5T3T A;  5A6K A;  2LIG A;  1M2V A;  3S0X A;  1JAF A;  3R2P A;  1Q0G A;  3DMD A;  3W8H A;  256B A;  4E7Z A;  1GGQ A;  5L3V A;  1A7V A;  2CW0 F;  1YA7 O;  2LK4 A;  2R02 A;  2Y3H A;  1Y4C A;  1S05 A;  3JRT A;  2I8B A;  1FMV A;  2PNO A;  4J32 B;  3UNG C;  4DXW A;  1RXQ A;  2AVK A;  3GEE A;  4MW3 A;  1AEP A;  2ZXO A;  3RKO F;  3JYH A;  3K7D A;  4N6C A;  1WN0 A;  2BE5 F;  2B0H A;  2EIN C;  2NPU A;  4FES A;  1FFH A;  1ZHT A;  4ONS A;  3C8G D;  3FAJ A;  3KKB A;  5AGF A;  4E18 A;  2LD6 A;  4HE8 D;  4XQ1 A;  3U3F A;  2M4E A;  5T3W A;  3V5Y A;  3W2W A;  5DS5 A;  1MMN A;  4OIO F;  2QTV A;  3QVZ A;  2R25 A;  3EHN A;  5JLI A;  1Q0M A;  5F5F A;  3TOM A;  4Z9H A;  1ZW2 A;  2YLD A;  4P9T A;  2BL2 A;  4Q7C A;  2XLO A;  3KMI A;  2HJM A;  1E84 A;  2IOQ A;  3T6G B;  2VCC A;  3OWT A;  4ULW A;  3WAQ A;  3ZTM A;  1MMD A;  4LLE A;  1M56 C;  4N06 A;  2CYD A;  4JRZ A;  4WJ0 A;  1SZI A;  1WAS A;  3ECS A;  1U89 A;  2PFD A;  4O7G A;  2WVN A;  1O87 A;  2A68 F;  3HNJ A;  2FAP B;  3V5Z A;  4KC9 A;  3V5X A;  4D4X A;  1ZHX A;  2HS5 A;  3A9C A;  3O39 A;  2JD3 A;  4I1O B;  4IWB A;  4BEJ A;  4U5G A;  3C63 A;  3EZH A;  4JZA A;  5L0I A;  3FXH A;  4PR9 A;  2ETS A;  5JUA A;  4W8K A;  4MVS A;  1KU2 A;  2R7Q A;  3SEO A;  3K6B A;  1OR2 A;  1TWC A;  2XS8 A;  2NUP B;  4ANJ A;  1J8Y F;  5KYU A;  3KH2 A;  3SXZ A;  3UMH A;  2J9V A;  2LFF A;  2NUP A;  3O6X A;  4U5B E;  4EWC A;  4YT2 A;  4MVR A;  3L8J A;  1YZA A;  5K0I A;  3TUL A;  2R7W A;  2EPN A;  2WZF A;  4F4B A;  2Q4F A;  3VYW A;  3LEV A;  3OA1 A;  3W4Y A;  4EBJ A;  3N2Z B;  3SYN A;  3JRM O;  1O3U A;  3ASN C;  3NG1 A;  3RH3 A;  4L6R A;  5L0C A;  1BR2 A;  2FGY A;  4BJ6 A;  2VCB A;  4JTD B;  3DJN B;  4FWV A;  1ZYR F;  4DBQ A;  4CIH A;  3MX3 A;  1HY5 A;  5A6A A;  3O10 A;  5A69 A;  1CGM E;  4NTB A;  2W45 A;  3ZC4 A;  2O9X A;  4LDQ A;  5F28 E;  1LI7 A;  2CNW A;  1WGW A;  4EHP A;  3FOP A;  2XLW A;  3GWL A;  3Q7G A;  4HEA J;  3DE9 A;  3QW0 A;  4CBE A;  4YN0 B;  3T4R A;  4HFF B;  3EH2 A;  2AP3 A;  3RQF A;  4Q4Z F;  3PHF 2;  4MVQ A;  1OQC A;  2IXM A;  3FHD A;  3U8V A;  2R7S A;  3RQG A;  3DZA A;  2EIM C;  1FTS A;  3HKK A;  2DB4 A;  4U5F E;  1YJG A;  4R32 A;  5T1D B;  3U9J A;  1WWP A;  5KYY B;  5A6B D;  1ST6 A;  2ASR A;  2OQM A;  3G50 A;  4YJW A;  5BQG A;  4OD5 A;  5KYY A;  3WHN A;  1AVO B;  1NBB A;  5E2Q A;  4WAB A;  5EK0 A;  5JP7 A;  5BQH A;  1RJ9 B;  3JZ0 A;  1MMA A;  4PAC A;  5TJ5 E;  5KYN A;  5E33 A;  1RJ9 A;  1A0B A;  5L0H A;  3EHM A;  3HNI A;  3K1H A;  4IGG A;  1A41 A;  1G5Z A;  3CZ6 A;  2AWY A;  1JOG A;  4PK4 A;  1KTM A;  2XLE A;  2EIK C;  2LSE A;  5L0F A;  3U2M A;  2QUP A;  1TWA A;  2YL3 A;  1YYJ A;  5CIV A;  3SXK A;  1LPE A;  3SXM A;  4XEF A;  1S7Z A;  1VB5 A;  3DI5 A;  4FX5 A;  4I1M A;  4YL0 A;  3RQE A;  2IBF A;  4MS2 A;  5L0D A;  1YZC A;  2MYS A;  3LS0 A;  2A0U A;  1PV3 A;  1Q0D A;  1XZQ A;  3NKD A;  1ZZP A;  2GDC A;  3FMS A;  4KNV A;  4IJJ A;  4X0R A;  5B1A C;  2GFH A;  2RD9 A;  2Y3D A;  2HMQ A;  2KW3 C;  1G4W R;  4MVM A;  1SMY F;  2KJG A;  3LNM B;  1SF8 A;  3NMJ A;  1VYI A;  2AU5 A;  3R7C A;  2ZXP A;  2DYR C;  4Z9I A;  3SZR A;  3IQ5 A;  1OW6 A;  1T9K A;  2KQ9 A;  4CS8 A;  4MVU A;  1APC A;  4JW1 A;  2QE9 A;  4O79 A;  2R7U A;  2YQY A;  4LAC B;  4DRI B;  5HSW A;  3B0P A;  1FAP B;  1K04 A;  2IYL D;  4ZLC A;  2OEX A;  4U5H A;  4CDA A;  2H7O A;  2X0C A;  3VRC A;  3NMI A;  5CI8 A;  1SR2 A;  3KPH A;  1LS1 A;  3RIP A;  3U5S A;  2J9U A;  1NG1 A;  5IY5 C;  3DD7 A;  2R03 A;  4KI2 A;  2W4B A;  2PP4 A;  2EPM X;  3DXJ F;  1TFK B;  2IXP A;  3GM1 A;  1H9G A;  2VCA A;  3QMK A;  2OU6 A;  1RKE B;  5KYX B;  1JPN A;  4BEM J;  4XLP F;  3LLK A;  5KYX A;  5JSL A;  3LUT B;  2HV6 A;  2KC3 A;  5HV9 A;  3UGO A;  3DM9 B;  3UGP A;  1Z7Q c;  2Y3B A;  2NSG A;  1EI7 A;  3IQ6 A;  2EPO A;  2G3K A;  4XEK A;  2G62 A;  2OKU A;  2C03 A;  2X51 A;  1QSP A;  4H4K C;  3SP1 A;  4B6I A;  5FZT A;  1ORS C;  1GS9 A;  4BJ6 C;  2J7P A;  2D4U A;  3MBG A;  3QVY A;  3ZSU A;  3VAY A;  1GQA A;  2J46 A;  2Q9A A;  2H7B A;  3ABK C;  2GAQ A;  1JPJ A;  3ASO C;  4JJF A;  2MWQ A;  4JVS A;  1ZW3 A;  2PBE A;  3VM6 A;  4JEB A;  3L1M A;  3SNH A;  5F5H A;  4NQF A;  2P1A A;  2J0W A;  2YHS A;  2HJ3 A;  1C02 A;  3EH1 A;  5B3I A;  4ER9 A;  2H7V C;  3H2U A;  1BBH A;  3AQC A;  1TWH A;  1D0X A;  3FVY A;  1QQ3 A;  3Q6M A;  1VLT A;  1WOL A;  2IM8 A;  1R4T A;  3JSZ A;  5D92 A;  3AG3 C;  3RF3 A;  1OCC C;  1AUE A;  2NSF A;  1E86 A;  2R9R B;  1D0Y A;  4LDR A;  3GAN A;  3POV A;  3ATP A;  4U5C E;  1FNT c;  1OW7 A;  2F22 A;  2J8W A;  1TFO B;  1N1C A;  5JS5 A;  4W8P A;  1Z6A A;  2XSE A;  1NLX A;  2EIJ C;  4C7O B;  1VK5 A;  3AG2 C;  5E3C A;  4CS9 C;  1V54 C;  5JRA A;  1U6H A;  1OKK A;  4XTK A;  2VB6 A;  1E2X A;  3KYI A;  2H8A A;  2HSQ A;  2OJE D;  2Y39 A;  2YRF A;  3RFY A;  1G4U S;  2QLA A;  2ZXW C;  1A7D A;  4GQH A;  4MW8 A;  2C04 A;  1ORJ A;  4QDL A;  4CDV A;  4DJ9 A;  3QZC A;  4CSA C;  4LER A;  2KYH A;  5BUO A;  2EPK X;  1V55 C;  1M2O A;  4EUK B;  1W2W A;  1NFN A;  2PX0 A;  2UUH A;  2YL0 A;  4U9E A;  4A2N B;  3Q7L A;  1DOV A;  1OR3 A;  1T01 A;  1LM3 B;  3FOO A;  4JC7 A;  3US6 A;  3N24 A;  3W2V A;  3SXY A;  2Q7R A;  3WOD F;  3PDM P;  4JIO A;  1HW2 A;  4CS8 C;  5L0J A;  1TKN A;  3RVZ A;  3GOD A;  4BJ5 C;  3F46 A;  1M6T A;  1Z3I X;  3NYJ A;  3DE8 A;  4Q5S F;  4DVY P;  5JVE A;  3M4B A;  4JKV A;  1U0B B;  3GOR A;  2R7R A;  1EKY A;  4PJJ A;  2P61 A;  2W9Y A;  1UFB A;  4JEA A;  3I5Q A;  2D5R B;  5COF A;  2QNL A;  4BPM A;  1Y6D A;  2A6H F;  3ZIB A;  2R7X A;  3IPM O;  3JT1 A;  3M1C B;  5COG A;  4BG0 A;  1MND A;  1TWG A;  2CGE A;  1OXK A;  2CCY A;  2G3V A;  3DWW A;  3LAY A;  4Z9J A;  1Q0K A;  4CDY A;  2XRH A;  2R7O A;  3AQB A;  1ZHW A;  4JJG A;  1BZ4 A;  5FCL A;  1QZX A;  4U5E E;  4EIY A;  4XEV A;  2V26 A;  2DGJ A;  3MFN A;  5L0G A;  1YA9 A;  3L8I A;  2YZS A;  5CI9 A;  1VMA A;  4G78 A;  4J7Y A;  5B3S C;  2E87 A;  1Q0F A;  3JTL O;  3S9O A;  3HLZ A;  1VTM P;  2YWA A;  5DQZ A;  4YK5 A;  4CS9 A;  3LLI A;  4P9F A;  4XLN F;  3RW0 A;  4E7S A;  3EGX B;  4MTF A;  4XPW A;  3T9O A;  5AC4 A;  3EGX A;  1F1M A;  1IZM A;  3JSE O;  3FAP B;  1OW8 A;  1YYX A;  2A6E F;  2RSE B;  4IRU A;  5L3Q A;  4CSA A;  4DRJ B;  4QI2 A;  1GM5 A;  3B0V C;  1O5H A;  2PF4 E;  3U8P A;  1YVI A;  1YDI A;  2CNW D;  3N0T A;  2LP4 A;  2XL8 A;  4M63 A;  1V74 B;  1I4Z A;  4XWJ A;  5COM A;  2P6V A;  3U0C A;  5EGY A;  3C7J A;  1D0Z A;  1CPQ A;  2VC9 A;  3LJB A;  4IAR A;  3DM5 A;  4BJ5 A;  3UMI A;  2QY9 A;  3U3B A;  1IW7 F;  2L7A A;  2OCC C;  4JTA B;  3NDB B;  4WGZ A;  1CGO A;  3DAG A;  1R5I D;  3IHU A;  4RDA A;  2J9B A;  3WG7 C;  1T6I A;  3C8G B;  1KNY A;  4K7B A;  4YWQ A;  4CS7 A;  1RCP A;  3C62 A;  4MVO A;  1RMV A;  4XPY A;  3C8G A;  4EBB A;  3V7O A;  1BR1 A;  4BJT A;  2L6G A;  4AL1 A;  2YEV A;  1TQG A;  3AOU A;  1H7I A;  1XWJ A;  1ZU4 A;  3NMK A;  1T6Q A;  2XM0 A;  2DYS C;  3B9Q A;  3GEI A;  2EPL X;  3JYY A;  1UG7 A;  3M4C A;  3PMR A;  4JE9 A;  1YAU O;  1MQV A;  1T5O A;  1RKE A;  2WZL A;  4P6I C;  3S27 A;  3S29 A;  2KGO A;  2CDQ A;  5GPG B;  2XM4 A;  4N4W A;  2NUT B;  3W8I A;  4OIQ F;  1OCR C;  1QLE C;  1ZHY A;  2J9W A;  2NUT A;  3K1I A;  1A7E A;  4YT4 A;  2V3C C;  4PJM A;  2KK1 A;  3LS1 A;  5E3A A;  3C8Z A;  1PCX A;  3C18 A;  4ULV A;  4PFO A;  4C3D A;  2Y69 C;  2L6H A;  4JCZ A;  4K0D A;  3DAF A;  2LCH A;  1Z23 A;  4YL3 A;  1TR2 A;  2LQG A;  2Q9B A;  4K1O A;  2YL7 A;  4DOZ A;  3CQZ A;  2IXO A;  3IQC A; 
#chains in the Genus database with same CATH homology
 5JRA A;  1E83 A;  4CX9 A;  4D4N A;  2QLA A;  4CDV A;  2YKZ A;  4CIP A;  1NBB A;  2YL1 A;  5JP7 A;  2XLH A;  3HNL A;  4U9E A;  2YL0 A;  3HNI A;  3FOO A;  1LM3 B;  2YLI A;  1QPU A;  2YLG A;  2XL6 A;  2XLE A;  4IAQ A;  2YL3 A;  1YYJ A;  1M6T A;  1JAF A;  3DE8 A;  3ZWI A;  5JVE A;  3M4B A;  256B A;  4JKV A;  1YZC A;  1EKY A;  1A7V A;  4JEA A;  2XLD A;  1S05 A;  2XLM A;  2CCY A;  4CDY A;  3NMJ A;  4EIY A;  5AGF A;  2XLV A;  3M79 A;  3IQ5 A;  1APC A;  3M15 A;  3QVZ A;  5JLI A;  1CPR A;  3HNK A;  3TOM A;  2YLD A;  4CDA A;  3VRC A;  3NMI A;  4N6H A;  1E84 A;  2XLO A;  4IB4 A;  3ZTM A;  1YYX A;  2BC5 A;  3U8P A;  3HNJ A;  4U9D A;  5JSL A;  4D4X A;  1E85 A;  2XL8 A;  4WGY A;  3IQ6 A;  1CPQ A;  4IAR A;  3C63 A;  3QVY A;  5JUA A;  4WGZ A;  1CGO A;  2J9B A;  1GQA A;  1RCP A;  3C62 A;  1YZA A;  4JEB A;  3L1M A;  3NMK A;  2XM0 A;  3ZQV A;  3M4C A;  4JE9 A;  3QW1 A;  3TOL A;  1MQV A;  5B3I A;  5JS5 A;  4L6R A;  4ER9 A;  2XM4 A;  1BBH A;  4N4W A;  1QQ3 A;  3ZQY A;  3ZTZ A;  4CJG A;  4CJO A;  4NC3 A;  1E86 A;  4ULV A;  2J8W A;  3FOP A;  2XLW A;  5JT4 A;  3DE9 A;  3QW0 A;  1CGN A;  2YL7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...