4N6CA

Crystal structure of the b1rzq2 protein from streptococcus pneumoniae. northeast structural genomics consortium (nesg) target spr36.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
182
structure length
182
Chain Sequence
GHHHHHHSHMLRTYENKEELKAEIEKTFEKYILEFDNIPENLKDKRADEVDRTPAENLAYQVGWTNLVLKWEEDERKGLQVKTPSDKFKWNQLGELYQWFTDTYAHLSLQELKAKLNENINSISAMIDSLSEEELFEPHMRKWADEATKTATWEVYKFIHVNTVAPFGTFRTKIRKWKKIVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein
publication title Crystal Structure of the B1RZQ2 protein from Streptococcus pneumoniae.
rcsb
source organism Streptococcus pneumoniae
total genus 78
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 4n6cA00
3CEXA 2OQMA 2QNLA 2NSFA 2OU6A 3DKAA 4N6CA 5CIVA 2F22A 2NSGA 2RD9A 2HKVA 3DI5A 5COFA 2YQYA 3GORA 5COMA 2P1AA 1RXQA 2QE9A 3QTHA 5COGA
chains in the Genus database with same CATH superfamily
5EGYA 2G3KA 1N1CA 4IARA 3GEHA 2PFDA 4DRIB 3N2ZB 4QDLA 4PJMA 3U9MA 2I15A 5BQIA 3L1MA 3LJBA 2M64A 2OU6A 3EGXB 4JTDB 4MS2A 1SF8A 1OCRC 2A6HF 3GWLA 4LERA 4YL0A 3V5XA 3UMHA 2KW3C 1VK5A 2YZSA 4EBBA 1A41A 1G4WR 3HTKC 4PFPA 2H7VC 3AGTA 2ZXOA 4F4BA 2XLDA 5COFA 1ZW2A 2KSFA 1L7CA 4MVZA 5K0IA 3JYHA 2NG1A 2C03A 1OQCA 2LIGA 4CIHA 2KC3A 4E17A 1CGOA 5DQTA 4EBKA 5DS5A 2PX0A 3DJUB 1OCCC 256BA 3C8GA 5DVWA 4OIRF 4CS8C 4CX9A 3CSKA 1Q0GA 2AWCA 4MVOA 2XL8A 4HEAJ 2HUJA 4CJGA 4DXWA 1JMWA 2P6VA 3AG2C 3QVYA 3RIPA 1O3UA 1VLSA 3KPHA 3X2QC 1YVIA 5JP7A 2HSBA 3BRJA 3L34A 4DRJB 1TWAA 1RJ9A 4ZLCA 1A7DA 3FAJA 4BJ5A 1QZXA 4IRUA 4EHPA 3FAPB 5IY5C 4GQHA 2EPMX 4N6HA 2DI3A 1YJGA 1VMAA 2XS8A 4O6NA 4C3BA 2QY9A 2XLOA 4U5EE 1IZMA 1OCOC 2EPNA 3IEEA 3NG1A 1FFHA 4U5FE 3EGDA 3LEVA 3V5ZA 2GA0A 3RQEA 3OA1A 4U9DA 3T6JA 5F5HA 2OJED 3MYFA 4RBNA 2YQYA 1KU2A 2HJMA 4YWQA 2TMVP 2HMQA 5E2QA 5JS5A 5JVEA 2MWQA 2R7RA 2ZXWC 1W2WA 5A69A 5F5FA 2JPUA 2DGJA 2Y39A 3PCVA 3DXJF 2YHSA 1VLTA 3W2WA 5JT4A 1S7ZA 2A68F 4ONSA 1TQGA 5FZTA 1LPEA 4PACA 3M79A 1D1BA 2ZPAA 4RD9A 4UDVA 2YLGA 3B9QA 1L3PA 2A1DD 3KMIA 1VYIA 3MFNA 1B68A 2D4UA 2R9RB 1PCXA 1D0XA 3UMKA 3JZ0A 3ECSA 1E83A 2UUHA 4WJ0A 1RMVA 1DOWA 3U8PA 3LNRA 1EI7A 1ZU4A 3GM2A 1WOLA 2HMZA 4XQ1A 2KGOA 2FAPB 2YL7A 2D5RB 2PF4E 4MVMA 1YZAA 1M6TA 2BE5F 2GAQA 1D0ZA 4JVSA 4EUKB 2IXNA 1FNTc 2QE9A 3L0IA 1Z3IX 3R7CA 4CBEA 4IJJA 4CS9A 4E0HA 2XRHA 3T6BA 1WWPA 2H8AA 1NZEA 4MVUA 1JPNA 2OEVA 3UR3C 4U5BE 5E33A 2OQMA 5D92A 2GFHA 4YN0B 4KI2A 3RVYA 3E70C 1D1CA 1DOVA 4N6CA 2Q7RA 3KKBA 1LS4A 1RCPA 3C8GB 3Q7GA 5KYWA 3NDBB 4KC9A 4L6RA 3KL4A 4U5GA 2FGYA 1TWCA 1A7VA 5HV9A 3WAQA 4JTAB 1V54C 4NC3A 4ER9A 3ZC4A 5A6BA 2YWAA 3LESA 1RJ9B 1BZ4A 2EIKC 2ICWG 3K1HA 2ETSA 4J7YA 5COMA 2A6EF 4U5DE 3DE9A 2YL0A 4YT2A 1CGNA 3SXKA 3C7JA 1UG7A 1HE1A 2LSEA 2V26A 3ZWIA 3EGDB 1ZHTA 3O55A 5DS6A 2I8BA 4BJ6A 1TFKB 3TOLA 2M4EA 3WG7C 3C63A 3RQFA 3PDMP 1T6QA 2YLDA 3I5QA 3AG1C 5L0CA 1R4TA 3DM5A 3U0CA 2QNLA 1A7EA 2LD6A 2R03A 3OEOA 4FX5A 4G78A 1M57C 1Y4CA 2KK1A 3ATPA 3NMKA 2L6FA 1GGQA 3QW1A 2Q9BA 4LACB 1YARO 5L0IA 3O6XA 1MMNA 3B29A 2MYSA 4XEVA 3LUTB 1K40A 2VCBA 4ULWA 2Y3DA 4PJJA 3CAXA 2XM0A 3HKKA 2G62A 1E86A 3O10A 3B0VC 2P1AA 3ZG1A 3RYLA 3WHNA 4J7TA 4CDAA 4JCHA 4N06A 3HJCA 4FAPB 3EJNA 1M2OA 4PK4A 2C04A 1T9KA 2HV6A 3V7OA 1E2XA 1KNYA 2PX3A 4JKVA 1Y6DA 5E3CA 3QVZA 1TKNA 3CEXA 2R02A 3AG4C 4CS8A 2WZGA 2VCCA 4MTGA 1QVXA 2XL6A 3R2PA 4K7BA 1TWHA 4WABA 4H4KC 3RF3A 2EPLX 5L0GA 2L6GA 2OJQA 4PR9A 4CIPA 3ZTMA 2NUTA 5CI9A 2QTVA 3A9CA 4LDRA 1V4AA 4MTFA 1YA7O 4U5HA 3RW0A 1HW1A 2P0NA 3MYIA 4H54A 2L81A 3GANA 4Q5SF 5GPGB 2CCYA 2J7PA 3LS1A 3O39A 4G7HF 2HFIA 2XS1A 1FTSA 4EIYA 4BJTA 2XM4A 4FESA 5JUAA 2X51A 3GM1A 4OIPF 2R7QA 3B0UX 5CI8A 1A0BA 5KYWB 2KYHA 2OCCC 3UGPA 4Z9JA 2GDCA 2UUIA 1ZHYA 4E18A 4X0RA 1J8YF 1F1MA 2CNWD 2EIMC 1LM3B 3G50A 3M4BA 4AK9A 1IW7F 1OKKD 3KH2A 2YLIA 3CZ6A 4JJFA 1Z63A 4WGYA 1LE4A 4K1OA 2XLVA 3KYIA 3TJ5A 4BEMJ 3GM3A 3U2MA 5HSWA 2J45A 3HNLA 5CIVA 1OCZC 1J8MF 1VYKA 1LVKA 4BEJA 4U9EA 4YL3A 3RKOF 1OR3A 2R7WA 4NCQA 1CGME 3I5PA 3ZTZA 2Q00A 1HMDA 4GEHA 4OD5A 3U5SA 4LLCA 2R7VA 1M2VA 3KYJA 3T9OA 2XLHA 1EA8A 4MVQA 4CSAC 1EKYA 4JCZA 1AEPA 2J9VA 1HE9A 2YEVA 3N0TA 4HFKB 2Q9AA 3S84A 2E87A 3VM6A 5COGA 4R32A 1JRAA 2IYLD 3K66A 3EH2A 4GYTA 3PHF2 2CGEA 4DJ9A 2JD3A 1APCA 4PFOA 1U0BB 4KNVA 2R25A 1T5OA 4MVSA 2IOQA 4M63A 2LQGA 3GEEA 3US6A 2PP4A 4N4WA 2PNOA 4XLNF 3IHUA 4OIQF 2AWYA 2F22A 3EPVA 4IGGA 3ITFA 1ORJA 3DAFA 3S27A 4MNDA 2Y69C 2YL1A 1AVOB 3FHDA 3EH1A 3OWTA 1ZHWA 5AC5A 1YA9A 2EIJC 3H2VA 3U3FA 1NU9C 1AUEA 3ZQYA 4JEAA 1YLMA 3GEIA 1MNEA 1OXKA 2AVKA 2NUTB 2XLMA 4JURI 1U6HA 2W4BA 3QTHA 4XEFA 3NMIA 1MMDA 4XPXA 1LE2A 2QUPA 4C7OB 3U9JA 1H6GA 3IQ6A 3EFOA 3QW0A 2R7TA 1KTMA 4IWBA 1WATA 1BR2A 1OW8A 1NSGB 2Q3TA 1G4US 2R7XA 1MNDA 1LI7A 4Z9HA 3DKAA 2J9BA 2XLEA 1S05A 2Y3BA 2AP3A 3PMRA 3RQGA 3SP1A 1TR2A 2ZXRA 3AJMA 1C17M 3UGOA 4OIOF 3Q7LA 1FMWA 3ZVRA 4CDYA 3G4ZA 2OEXA 1Z5ZA 4BJ1A 4D4NA 1I4YA 4LLEA 1EQ1A 5L0FA 3EZIA 3U3BA 2ZXPA 3B0PA 1YYJA 1ZHXA 2FFHA 4JZAA 3VAYA 1D0YA 2HZ8A 3S29A 3HNKA 4XLPF 4JEBA 1K04A 1M2VB 2J7PD 3JSEO 5EHHA 1T01A 1ZZPA 1CPRA 3EZHA 3DM9B 3M15A 3RVZA 1SZIA 3IQTA 1D1AA 3NMJA 1TWGA 4AE4A 1LS1A 1WTYA 1ZW3A 2IXPA 2Q9CA 3VF0A 3W8HA 1Q0KA 4LDQA 2YVKA 3C8GD 1JPJA 1E84A 2JX0A 3IQCA 1BDJB 3H65A 4NQFA 3C8ZA 3DJNB 1T6UA 4OINF 3U2LA 2WZFA 2P61A 4P6IC 3K7DA 1PD1A 4CS9C 2VASA 2Y3HA 3LAYA 5JLIA 3SXMA 5B1AC 3K1IC 3K6BA 4NTBA 4WGZA 1VTMP 3E9VA 4XWJA 3SYNA 5DLJA 2HV7A 2XLWA 5JRAA 2J0WA 3IPMO 4MTOA 4DBRA 4NTAA 2A0UA 3FOOA 2KNHA 4XTKA 2EPKX 4E0IA 5AC4A 5L0HA 4KNWA 5L3VA 2R7SA 1HMOA 1U89A 3C18A 3H2UA 1YDIA 5T3WA 4B6IA 2NSFA 3ABLC 1PD0A 1SYQA 4AL1A 1O87A 1O5HA 1V74B 4ULVA 5DQZA 1H9TA 4G7ZF 4OD4A 2A0BA 3LLIA 1QLEC 2IXMA 1NFOA 3LS0A 4XPYA 3G4XA 4ANJA 5L0JA 2XL4A 3RH3A 1OR2A 1FAPB 5BQGA 4G0HA 2KJGA 3TQOA 4J32B 1C03A 4YT5A 1QPUA 5BQHA 1I5NA 5KYUA 3EHNA 3RFYA 1BR1A 1Q0MA 1RXQA 1QQ3A 5TJ5E 3VYWA 1QSPA 1ST6A 4CDVA 4QI0A 3JCUQ 1NBBA 4YL1A 4CSAA 1WASA 3FOPA 3L8JA 1VOMA 2VC9A 1BBHA 3T6GB 4NY3A 4HFFB 1HY5A 2CW0F 4EWCA 2ASRA 1GS9A 3M4CA 1FR0A 2XSEA 3GODA 2IXOA 3HNIA 1SMYF 3WODF 3ZQVA 5L0DA 1PV3A 3LNMB 3X1OA 4U5CE 1ZYRF 1HW2A 4QI2A 2G3VA 2J8WA 3K33A 2QLAA 1TFOB 2RD9A 4MQ9F 1UFBA 1OW6A 3EG9A 2EILC 3ASNC 2LP4A 4I44A 4XEKA 3J06A 1LIHA 3F46A 3NKDA 4Q7CA 2VH3A 4JC7A 4W8PA 4BPMA 2OG2A 3EHMA 2OOCA 2LFFA 1RKEA 4JRZA 4JE9A 2WVNA 4AE4B 2HSQA 1Q0DA 5KYXA 3DD7A 5AGFA 1OXBA 3JRMO 3MBGA 4Q4ZF 3POVA 2B0JA 4G7OF 3W4YA 1JOGA 4W8KA 2IBFA 1M56C 2WB7A 4PJLA 2NUPA 3S28A 1WGWA 1BR4A 3SNHA 1SR2A 4E7ZA 5KYYA 5KYNA 5A6BD 3AQCA 1NG1A 2R05A 4J30B 3TK0A 3VRCA 3ZIBA 1RKCA 1ORYA 2EINC 2LCHA 2P7VA 5T3TA 3TD7A 3L8IA 1G5ZA 1GM5A 1MMGA 3A11A 3W8IA 1CPQA 1VB5A 4I1MA 4O6MA 4EBJA 2J9UA 4LDKA 2L9JA 3W2VA 5B3SC 1I4ZA 4P9FA 1YYXA 1XZPA 2YL3A 2L7AA 2ZD9A 3JRTA 5E3AA 3SXZA 2O9XA 3GORA 4Z9IA 2CYDA 1ZVZA 4P9TA 1YAUO 2NPUA 3CQZA 4JIOA 4JTCB 4O7GA 5EK0A 4O6YA 3AG3C 1T6IA 2L6HA 3MLGA 3Q6MA 2DB4A 1ZHZA 3DAGA 1NU7D 2XXAA 2IM8A 4DOZA 2CDQA 1G8XA 3I4UA 3NYJA 4BJ5C 3BEHA 3TOMA 4I1OB 2HJ3A 3QZCA 2W45A 3F47A 3EQLF 4HE8D 4O79A 2X0CA 5KYUB 5L3QA 5A6AA 3SEOA 3LEOA 1H7IA 1GQAA 1Z6AA 4JJGA 3S9OA 2H7OA 2WL8A 2YRFA 4DVZA 5JSLA 4AL0A 3ZSUA 2OKUA 2CNWA 2VCAA 1XZQA 5F28E 5A6JA 2EPOA 1OKKA 4JW1A 1JR8A 3DMDA 3AQBA 3DE8A 1R5ID 3ABMC 3AGUA 3DWWA 4IAOA 4CS7A 1NFNA 3UMIA 3JT1A 1JAFA 4YT8A 3EGXA 2H7BA 2BC5A 3UNGC 3NKEA 2Q4FA 2Y3GA 4C3EA 1NLXA 1Z7Qc 3T4RA 3EG9B 3K1IA 2DYRC 1MMAA 5BUOA 1ZU5A 4K0DA 2HS5A 2MHRA 2PBEA 3JSZA 1RKEB 3NYLA 2B0HA 2J9WA 2LK4A 3B71A 2W9YA 5KYXB 4EKWA 2R7UA 3C62A 2BL2A 1MQVA 2AU5A 2LFDA 3N24A 5D91A 2DYSC 4CJOA 1K05A 1FFTC 5FCLA 4C7OA 4YT4A 3DZAA 3TJ6A 1E85A 1OW7A 2NUPB 4PJNA 3DI5A 5KYYB 4YJWA 3JTLO 3ASOC 4MVRA 5B3IA 1V55C 3AOUA 3SZRA 2RSEB 4IAQA 3V5YA 3HLZA 4BG0A 3ZDLA 4IB4A 3FVYA 3HNJA 4DRHB 5A6KA 2Z15A 2J46A 3ABKC 4XPWA 4I3MA 4DBQA 2YKZA 4FWVA 3Q6NA 1QKRA 1XWJA 1LKXA 1Q0FA 1ORSC 1WN0A 3U8VA 2WVQA 3S90A 1FMVA 4E7SA 3FXHA 4KBLA 4DVYP 2WZLA 1YZCA 2NSGA 3JYYA 3MX3A 3NRHA 4NTFA 4RDAA 2XXAB 1Z23A 1H9GA 2A69F 2HKVA 3QMKA 3LLKA 3TULA 3EFOB 4YK5A 2V3CC 2GWWA 4MW3A 4ZLDA 3IQ5A 4MW8A 3FDQA 1LI5A 3M1CB 5T1DB 1C02A 3NYMA 4A2NB 4D4XA 4C3DA 3S0XA 3SXYA 5DS4A 3FMSA 2KQ9A 4BJ6C 2WVOA 4A4AA 4AX2A 2R7OA 5B1BC 2W4MA 2VB6A 3GWNA 2J0XA
chains in the Genus database with same CATH topology
3CEXA 2OQMA 2QNLA 2NSFA 2OU6A 3DKAA 4N6CA 5CIVA 2F22A 2NSGA 2RD9A 2HKVA 3DI5A 5COFA 2YQYA 3GORA 5COMA 2P1AA 1RXQA 2QE9A 3QTHA 5COGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CEX A;  2OQM A;  2QNL A;  2NSF A;  2OU6 A;  3DKA A;  4N6C A;  5CIV A;  2F22 A;  2NSG A;  2RD9 A;  2HKV A;  3DI5 A;  5COF A;  2YQY A;  3GOR A;  5COM A;  2P1A A;  1RXQ A;  2QE9 A;  3QTH A;  5COG A; 
#chains in the Genus database with same CATH topology
 5EGY A;  2G3K A;  1N1C A;  4IAR A;  3GEH A;  2PFD A;  4DRI B;  3N2Z B;  4QDL A;  4PJM A;  3U9M A;  2I15 A;  5BQI A;  3L1M A;  3LJB A;  2M64 A;  2OU6 A;  3EGX B;  4JTD B;  4MS2 A;  1SF8 A;  1OCR C;  2A6H F;  3GWL A;  4LER A;  4YL0 A;  3V5X A;  3UMH A;  2KW3 C;  1VK5 A;  2YZS A;  4EBB A;  1A41 A;  1G4W R;  3HTK C;  4PFP A;  2H7V C;  3AGT A;  2ZXO A;  4F4B A;  2XLD A;  5COF A;  1ZW2 A;  2KSF A;  1L7C A;  4MVZ A;  5K0I A;  3JYH A;  2NG1 A;  2C03 A;  1OQC A;  2LIG A;  4CIH A;  2KC3 A;  4E17 A;  1CGO A;  5DQT A;  4EBK A;  5DS5 A;  2PX0 A;  3DJU B;  1OCC C;  256B A;  3C8G A;  5DVW A;  4OIR F;  4CS8 C;  4CX9 A;  3CSK A;  1Q0G A;  2AWC A;  4MVO A;  2XL8 A;  4HEA J;  2HUJ A;  4CJG A;  4DXW A;  1JMW A;  2P6V A;  3AG2 C;  3QVY A;  3RIP A;  1O3U A;  1VLS A;  3KPH A;  3X2Q C;  1YVI A;  5JP7 A;  2HSB A;  3BRJ A;  3L34 A;  4DRJ B;  1TWA A;  1RJ9 A;  4ZLC A;  1A7D A;  3FAJ A;  4BJ5 A;  1QZX A;  4IRU A;  4EHP A;  3FAP B;  5IY5 C;  4GQH A;  2EPM X;  4N6H A;  2DI3 A;  1YJG A;  1VMA A;  2XS8 A;  4O6N A;  4C3B A;  2QY9 A;  2XLO A;  4U5E E;  1IZM A;  1OCO C;  2EPN A;  3IEE A;  3NG1 A;  1FFH A;  4U5F E;  3EGD A;  3LEV A;  3V5Z A;  2GA0 A;  3RQE A;  3OA1 A;  4U9D A;  3T6J A;  5F5H A;  2OJE D;  3MYF A;  4RBN A;  2YQY A;  1KU2 A;  2HJM A;  4YWQ A;  2TMV P;  2HMQ A;  5E2Q A;  5JS5 A;  5JVE A;  2MWQ A;  2R7R A;  2ZXW C;  1W2W A;  5A69 A;  5F5F A;  2JPU A;  2DGJ A;  2Y39 A;  3PCV A;  3DXJ F;  2YHS A;  1VLT A;  3W2W A;  5JT4 A;  1S7Z A;  2A68 F;  4ONS A;  1TQG A;  5FZT A;  1LPE A;  4PAC A;  3M79 A;  1D1B A;  2ZPA A;  4RD9 A;  4UDV A;  2YLG A;  3B9Q A;  1L3P A;  2A1D D;  3KMI A;  1VYI A;  3MFN A;  1B68 A;  2D4U A;  2R9R B;  1PCX A;  1D0X A;  3UMK A;  3JZ0 A;  3ECS A;  1E83 A;  2UUH A;  4WJ0 A;  1RMV A;  1DOW A;  3U8P A;  3LNR A;  1EI7 A;  1ZU4 A;  3GM2 A;  1WOL A;  2HMZ A;  4XQ1 A;  2KGO A;  2FAP B;  2YL7 A;  2D5R B;  2PF4 E;  4MVM A;  1YZA A;  1M6T A;  2BE5 F;  2GAQ A;  1D0Z A;  4JVS A;  4EUK B;  2IXN A;  1FNT c;  2QE9 A;  3L0I A;  1Z3I X;  3R7C A;  4CBE A;  4IJJ A;  4CS9 A;  4E0H A;  2XRH A;  3T6B A;  1WWP A;  2H8A A;  1NZE A;  4MVU A;  1JPN A;  2OEV A;  3UR3 C;  4U5B E;  5E33 A;  2OQM A;  5D92 A;  2GFH A;  4YN0 B;  4KI2 A;  3RVY A;  3E70 C;  1D1C A;  1DOV A;  4N6C A;  2Q7R A;  3KKB A;  1LS4 A;  1RCP A;  3C8G B;  3Q7G A;  5KYW A;  3NDB B;  4KC9 A;  4L6R A;  3KL4 A;  4U5G A;  2FGY A;  1TWC A;  1A7V A;  5HV9 A;  3WAQ A;  4JTA B;  1V54 C;  4NC3 A;  4ER9 A;  3ZC4 A;  5A6B A;  2YWA A;  3LES A;  1RJ9 B;  1BZ4 A;  2EIK C;  2ICW G;  3K1H A;  2ETS A;  4J7Y A;  5COM A;  2A6E F;  4U5D E;  3DE9 A;  2YL0 A;  4YT2 A;  1CGN A;  3SXK A;  3C7J A;  1UG7 A;  1HE1 A;  2LSE A;  2V26 A;  3ZWI A;  3EGD B;  1ZHT A;  3O55 A;  5DS6 A;  2I8B A;  4BJ6 A;  1TFK B;  3TOL A;  2M4E A;  3WG7 C;  3C63 A;  3RQF A;  3PDM P;  1T6Q A;  2YLD A;  3I5Q A;  3AG1 C;  5L0C A;  1R4T A;  3DM5 A;  3U0C A;  2QNL A;  1A7E A;  2LD6 A;  2R03 A;  3OEO A;  4FX5 A;  4G78 A;  1M57 C;  1Y4C A;  2KK1 A;  3ATP A;  3NMK A;  2L6F A;  1GGQ A;  3QW1 A;  2Q9B A;  4LAC B;  1YAR O;  5L0I A;  3O6X A;  1MMN A;  3B29 A;  2MYS A;  4XEV A;  3LUT B;  1K40 A;  2VCB A;  4ULW A;  2Y3D A;  4PJJ A;  3CAX A;  2XM0 A;  3HKK A;  2G62 A;  1E86 A;  3O10 A;  3B0V C;  2P1A A;  3ZG1 A;  3RYL A;  3WHN A;  4J7T A;  4CDA A;  4JCH A;  4N06 A;  3HJC A;  4FAP B;  3EJN A;  1M2O A;  4PK4 A;  2C04 A;  1T9K A;  2HV6 A;  3V7O A;  1E2X A;  1KNY A;  2PX3 A;  4JKV A;  1Y6D A;  5E3C A;  3QVZ A;  1TKN A;  3CEX A;  2R02 A;  3AG4 C;  4CS8 A;  2WZG A;  2VCC A;  4MTG A;  1QVX A;  2XL6 A;  3R2P A;  4K7B A;  1TWH A;  4WAB A;  4H4K C;  3RF3 A;  2EPL X;  5L0G A;  2L6G A;  2OJQ A;  4PR9 A;  4CIP A;  3ZTM A;  2NUT A;  5CI9 A;  2QTV A;  3A9C A;  4LDR A;  1V4A A;  4MTF A;  1YA7 O;  4U5H A;  3RW0 A;  1HW1 A;  2P0N A;  3MYI A;  4H54 A;  2L81 A;  3GAN A;  4Q5S F;  5GPG B;  2CCY A;  2J7P A;  3LS1 A;  3O39 A;  4G7H F;  2HFI A;  2XS1 A;  1FTS A;  4EIY A;  4BJT A;  2XM4 A;  4FES A;  5JUA A;  2X51 A;  3GM1 A;  4OIP F;  2R7Q A;  3B0U X;  5CI8 A;  1A0B A;  5KYW B;  2KYH A;  2OCC C;  3UGP A;  4Z9J A;  2GDC A;  2UUI A;  1ZHY A;  4E18 A;  4X0R A;  1J8Y F;  1F1M A;  2CNW D;  2EIM C;  1LM3 B;  3G50 A;  3M4B A;  4AK9 A;  1IW7 F;  1OKK D;  3KH2 A;  2YLI A;  3CZ6 A;  4JJF A;  1Z63 A;  4WGY A;  1LE4 A;  4K1O A;  2XLV A;  3KYI A;  3TJ5 A;  4BEM J;  3GM3 A;  3U2M A;  5HSW A;  2J45 A;  3HNL A;  5CIV A;  1OCZ C;  1J8M F;  1VYK A;  1LVK A;  4BEJ A;  4U9E A;  4YL3 A;  3RKO F;  1OR3 A;  2R7W A;  4NCQ A;  1CGM E;  3I5P A;  3ZTZ A;  2Q00 A;  1HMD A;  4GEH A;  4OD5 A;  3U5S A;  4LLC A;  2R7V A;  1M2V A;  3KYJ A;  3T9O A;  2XLH A;  1EA8 A;  4MVQ A;  4CSA C;  1EKY A;  4JCZ A;  1AEP A;  2J9V A;  1HE9 A;  2YEV A;  3N0T A;  4HFK B;  2Q9A A;  3S84 A;  2E87 A;  3VM6 A;  5COG A;  4R32 A;  1JRA A;  2IYL D;  3K66 A;  3EH2 A;  4GYT A;  3PHF 2;  2CGE A;  4DJ9 A;  2JD3 A;  1APC A;  4PFO A;  1U0B B;  4KNV A;  2R25 A;  1T5O A;  4MVS A;  2IOQ A;  4M63 A;  2LQG A;  3GEE A;  3US6 A;  2PP4 A;  4N4W A;  2PNO A;  4XLN F;  3IHU A;  4OIQ F;  2AWY A;  2F22 A;  3EPV A;  4IGG A;  3ITF A;  1ORJ A;  3DAF A;  3S27 A;  4MND A;  2Y69 C;  2YL1 A;  1AVO B;  3FHD A;  3EH1 A;  3OWT A;  1ZHW A;  5AC5 A;  1YA9 A;  2EIJ C;  3H2V A;  3U3F A;  1NU9 C;  1AUE A;  3ZQY A;  4JEA A;  1YLM A;  3GEI A;  1MNE A;  1OXK A;  2AVK A;  2NUT B;  2XLM A;  4JUR I;  1U6H A;  2W4B A;  3QTH A;  4XEF A;  3NMI A;  1MMD A;  4XPX A;  1LE2 A;  2QUP A;  4C7O B;  3U9J A;  1H6G A;  3IQ6 A;  3EFO A;  3QW0 A;  2R7T A;  1KTM A;  4IWB A;  1WAT A;  1BR2 A;  1OW8 A;  1NSG B;  2Q3T A;  1G4U S;  2R7X A;  1MND A;  1LI7 A;  4Z9H A;  3DKA A;  2J9B A;  2XLE A;  1S05 A;  2Y3B A;  2AP3 A;  3PMR A;  3RQG A;  3SP1 A;  1TR2 A;  2ZXR A;  3AJM A;  1C17 M;  3UGO A;  4OIO F;  3Q7L A;  1FMW A;  3ZVR A;  4CDY A;  3G4Z A;  2OEX A;  1Z5Z A;  4BJ1 A;  4D4N A;  1I4Y A;  4LLE A;  1EQ1 A;  5L0F A;  3EZI A;  3U3B A;  2ZXP A;  3B0P A;  1YYJ A;  1ZHX A;  2FFH A;  4JZA A;  3VAY A;  1D0Y A;  2HZ8 A;  3S29 A;  3HNK A;  4XLP F;  4JEB A;  1K04 A;  1M2V B;  2J7P D;  3JSE O;  5EHH A;  1T01 A;  1ZZP A;  1CPR A;  3EZH A;  3DM9 B;  3M15 A;  3RVZ A;  1SZI A;  3IQT A;  1D1A A;  3NMJ A;  1TWG A;  4AE4 A;  1LS1 A;  1WTY A;  1ZW3 A;  2IXP A;  2Q9C A;  3VF0 A;  3W8H A;  1Q0K A;  4LDQ A;  2YVK A;  3C8G D;  1JPJ A;  1E84 A;  2JX0 A;  3IQC A;  1BDJ B;  3H65 A;  4NQF A;  3C8Z A;  3DJN B;  1T6U A;  4OIN F;  3U2L A;  2WZF A;  2P61 A;  4P6I C;  3K7D A;  1PD1 A;  4CS9 C;  2VAS A;  2Y3H A;  3LAY A;  5JLI A;  3SXM A;  5B1A C;  3K1I C;  3K6B A;  4NTB A;  4WGZ A;  1VTM P;  3E9V A;  4XWJ A;  3SYN A;  5DLJ A;  2HV7 A;  2XLW A;  5JRA A;  2J0W A;  3IPM O;  4MTO A;  4DBR A;  4NTA A;  2A0U A;  3FOO A;  2KNH A;  4XTK A;  2EPK X;  4E0I A;  5AC4 A;  5L0H A;  4KNW A;  5L3V A;  2R7S A;  1HMO A;  1U89 A;  3C18 A;  3H2U A;  1YDI A;  5T3W A;  4B6I A;  2NSF A;  3ABL C;  1PD0 A;  1SYQ A;  4AL1 A;  1O87 A;  1O5H A;  1V74 B;  4ULV A;  5DQZ A;  1H9T A;  4G7Z F;  4OD4 A;  2A0B A;  3LLI A;  1QLE C;  2IXM A;  1NFO A;  3LS0 A;  4XPY A;  3G4X A;  4ANJ A;  5L0J A;  2XL4 A;  3RH3 A;  1OR2 A;  1FAP B;  5BQG A;  4G0H A;  2KJG A;  3TQO A;  4J32 B;  1C03 A;  4YT5 A;  1QPU A;  5BQH A;  1I5N A;  5KYU A;  3EHN A;  3RFY A;  1BR1 A;  1Q0M A;  1RXQ A;  1QQ3 A;  5TJ5 E;  3VYW A;  1QSP A;  1ST6 A;  4CDV A;  4QI0 A;  3JCU Q;  1NBB A;  4YL1 A;  4CSA A;  1WAS A;  3FOP A;  3L8J A;  1VOM A;  2VC9 A;  1BBH A;  3T6G B;  4NY3 A;  4HFF B;  1HY5 A;  2CW0 F;  4EWC A;  2ASR A;  1GS9 A;  3M4C A;  1FR0 A;  2XSE A;  3GOD A;  2IXO A;  3HNI A;  1SMY F;  3WOD F;  3ZQV A;  5L0D A;  1PV3 A;  3LNM B;  3X1O A;  4U5C E;  1ZYR F;  1HW2 A;  4QI2 A;  2G3V A;  2J8W A;  3K33 A;  2QLA A;  1TFO B;  2RD9 A;  4MQ9 F;  1UFB A;  1OW6 A;  3EG9 A;  2EIL C;  3ASN C;  2LP4 A;  4I44 A;  4XEK A;  3J06 A;  1LIH A;  3F46 A;  3NKD A;  4Q7C A;  2VH3 A;  4JC7 A;  4W8P A;  4BPM A;  2OG2 A;  3EHM A;  2OOC A;  2LFF A;  1RKE A;  4JRZ A;  4JE9 A;  2WVN A;  4AE4 B;  2HSQ A;  1Q0D A;  5KYX A;  3DD7 A;  5AGF A;  1OXB A;  3JRM O;  3MBG A;  4Q4Z F;  3POV A;  2B0J A;  4G7O F;  3W4Y A;  1JOG A;  4W8K A;  2IBF A;  1M56 C;  2WB7 A;  4PJL A;  2NUP A;  3S28 A;  1WGW A;  1BR4 A;  3SNH A;  1SR2 A;  4E7Z A;  5KYY A;  5KYN A;  5A6B D;  3AQC A;  1NG1 A;  2R05 A;  4J30 B;  3TK0 A;  3VRC A;  3ZIB A;  1RKC A;  1ORY A;  2EIN C;  2LCH A;  2P7V A;  5T3T A;  3TD7 A;  3L8I A;  1G5Z A;  1GM5 A;  1MMG A;  3A11 A;  3W8I A;  1CPQ A;  1VB5 A;  4I1M A;  4O6M A;  4EBJ A;  2J9U A;  4LDK A;  2L9J A;  3W2V A;  5B3S C;  1I4Z A;  4P9F A;  1YYX A;  1XZP A;  2YL3 A;  2L7A A;  2ZD9 A;  3JRT A;  5E3A A;  3SXZ A;  2O9X A;  3GOR A;  4Z9I A;  2CYD A;  1ZVZ A;  4P9T A;  1YAU O;  2NPU A;  3CQZ A;  4JIO A;  4JTC B;  4O7G A;  5EK0 A;  4O6Y A;  3AG3 C;  1T6I A;  2L6H A;  3MLG A;  3Q6M A;  2DB4 A;  1ZHZ A;  3DAG A;  1NU7 D;  2XXA A;  2IM8 A;  4DOZ A;  2CDQ A;  1G8X A;  3I4U A;  3NYJ A;  4BJ5 C;  3BEH A;  3TOM A;  4I1O B;  2HJ3 A;  3QZC A;  2W45 A;  3F47 A;  3EQL F;  4HE8 D;  4O79 A;  2X0C A;  5KYU B;  5L3Q A;  5A6A A;  3SEO A;  3LEO A;  1H7I A;  1GQA A;  1Z6A A;  4JJG A;  3S9O A;  2H7O A;  2WL8 A;  2YRF A;  4DVZ A;  5JSL A;  4AL0 A;  3ZSU A;  2OKU A;  2CNW A;  2VCA A;  1XZQ A;  5F28 E;  5A6J A;  2EPO A;  1OKK A;  4JW1 A;  1JR8 A;  3DMD A;  3AQB A;  3DE8 A;  1R5I D;  3ABM C;  3AGU A;  3DWW A;  4IAO A;  4CS7 A;  1NFN A;  3UMI A;  3JT1 A;  1JAF A;  4YT8 A;  3EGX A;  2H7B A;  2BC5 A;  3UNG C;  3NKE A;  2Q4F A;  2Y3G A;  4C3E A;  1NLX A;  1Z7Q c;  3T4R A;  3EG9 B;  3K1I A;  2DYR C;  1MMA A;  5BUO A;  1ZU5 A;  4K0D A;  2HS5 A;  2MHR A;  2PBE A;  3JSZ A;  1RKE B;  3NYL A;  2B0H A;  2J9W A;  2LK4 A;  3B71 A;  2W9Y A;  5KYX B;  4EKW A;  2R7U A;  3C62 A;  2BL2 A;  1MQV A;  2AU5 A;  2LFD A;  3N24 A;  5D91 A;  2DYS C;  4CJO A;  1K05 A;  1FFT C;  5FCL A;  4C7O A;  4YT4 A;  3DZA A;  3TJ6 A;  1E85 A;  1OW7 A;  2NUP B;  4PJN A;  3DI5 A;  5KYY B;  4YJW A;  3JTL O;  3ASO C;  4MVR A;  5B3I A;  1V55 C;  3AOU A;  3SZR A;  2RSE B;  4IAQ A;  3V5Y A;  3HLZ A;  4BG0 A;  3ZDL A;  4IB4 A;  3FVY A;  3HNJ A;  4DRH B;  5A6K A;  2Z15 A;  2J46 A;  3ABK C;  4XPW A;  4I3M A;  4DBQ A;  2YKZ A;  4FWV A;  3Q6N A;  1QKR A;  1XWJ A;  1LKX A;  1Q0F A;  1ORS C;  1WN0 A;  3U8V A;  2WVQ A;  3S90 A;  1FMV A;  4E7S A;  3FXH A;  4KBL A;  4DVY P;  2WZL A;  1YZC A;  2NSG A;  3JYY A;  3MX3 A;  3NRH A;  4NTF A;  4RDA A;  2XXA B;  1Z23 A;  1H9G A;  2A69 F;  2HKV A;  3QMK A;  3LLK A;  3TUL A;  3EFO B;  4YK5 A;  2V3C C;  2GWW A;  4MW3 A;  4ZLD A;  3IQ5 A;  4MW8 A;  3FDQ A;  1LI5 A;  3M1C B;  5T1D B;  1C02 A;  3NYM A;  4A2N B;  4D4X A;  4C3D A;  3S0X A;  3SXY A;  5DS4 A;  3FMS A;  2KQ9 A;  4BJ6 C;  2WVO A;  4A4A A;  4AX2 A;  2R7O A;  5B1B C;  2W4M A;  2VB6 A;  3GWN A;  2J0X A; 
#chains in the Genus database with same CATH homology
 3CEX A;  2OQM A;  2QNL A;  2NSF A;  2OU6 A;  3DKA A;  4N6C A;  5CIV A;  2F22 A;  2NSG A;  2RD9 A;  2HKV A;  3DI5 A;  5COF A;  2YQY A;  3GOR A;  5COM A;  2P1A A;  1RXQ A;  2QE9 A;  3QTH A;  5COG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...