4N6CA

Crystal structure of the b1rzq2 protein from streptococcus pneumoniae. northeast structural genomics consortium (nesg) target spr36.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
182
structure length
182
Chain Sequence
GHHHHHHSHMLRTYENKEELKAEIEKTFEKYILEFDNIPENLKDKRADEVDRTPAENLAYQVGWTNLVLKWEEDERKGLQVKTPSDKFKWNQLGELYQWFTDTYAHLSLQELKAKLNENINSISAMIDSLSEEELFEPHMRKWADEATKTATWEVYKFIHVNTVAPFGTFRTKIRKWKKIVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein
publication title Crystal Structure of the B1RZQ2 protein from Streptococcus pneumoniae.
rcsb
source organism Streptococcus pneumoniae
molecule tags Structural genomics, unknown function
total genus 78
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 4n6cA00
2HKVA 2NSGA 2NSFA 3QTHA 5COGA 5CIVA 2RD9A 2OQMA 2OU6A 2QE9A 3DKAA 2F22A 3GORA 5COFA 2P1AA 2YQYA 3CEXA 2QNLA 5COMA 3DI5A 4N6CA 1RXQA
chains in the Genus database with same CATH superfamily
2YL7A 4P9FA 4C3BA 3RQFA 4D4XA 3AG1C 2AWCA 2VCAA 2Y3HA 1UG7A 2JX0A 1MMAA 2NG1A 1L7CA 2NUTB 4G7HF 4DVYP 2DB4A 4JW1A 2YKZA 4BJTA 1KU2A 1A7VA 4XPYA 1XZQA 2E87A 2J46A 3ECSA 3I5QA 3JRMO 3K7DA 3V5ZA 1L3PA 4CS7A 3HLZA 1WWPA 3MBGA 1HW1A 4U5HA 4YT2A 2BC5A 2HV7A 3F46A 1NSGB 5KYWA 4WABA 1O3UA 4DBQA 3PMRA 1VOMA 3UR3C 3CZ6A 2MYSA 4NTFA 5DS4A 4K1OA 1ORJA 1ZHXA 1PCXA 4PJNA 3U8PA 2G62A 2XRHA 4IARA 5DQTA 2GFHA 5DLJA 3B0PA 1D0XA 1HY5A 2BL2A 1TFOB 2OEVA 3DM5A 4J32B 3EFOB 3UMHA 3U8VA 4E18A 2Y3GA 4CIHA 1MMNA 5B1AC 5CI8A 3K66A 2X51A 3ATPA 1OCRC 1FMVA 4XLPF 4LLEA 4E0IA 4W8KA 4JTAB 1LI5A 4H4KC 2OKUA 4YJWA 4XLNF 1JPNA 1A7EA 1TWHA 3HTKC 3ZQVA 5JLIA 4N6CA 3ZVRA 2KSFA 5E3AA 4MW8A 3M79A 4JKVA 2UUHA 1HW2A 1PD0A 4JCZA 3ZG1A 2CCYA 3ZIBA 3N24A 4AL1A 4U5EE 4BG0A 4E0HA 1E86A 2TMVP 4A4AA 1HE9A 3NYJA 3RKOF 2OU6A 1QSPA 1CGNA 3UGPA 2QE9A 2J0WA 3IEEA 1QLEC 2A68F 3W2VA 2Y3BA 1T01A 2OEXA 3V5YA 4D4NA 4PACA 1RJ9B 3TQOA 4Z9HA 1EA8A 1ST6A 3AG3C 1GGQA 4MW3A 5AC4A 2Q9BA 2XLWA 2I8BA 2NUPB 3TJ6A 4MVOA 1LS1A 5HV9A 4DJ9A 1Y6DA 4LACB 2J9BA 2IOQA 3B71A 1TR2A 1ZU5A 3NKDA 1MMDA 3JCUQ 2YHSA 1A7DA 1Y4CA 2R7VA 1V4AA 2HUJA 5E33A 1C03A 4E7ZA 3ITFA 1E2XA 4DRIB 1OXKA 2GA0A 1BDJB 2IM8A 3DMDA 3NYLA 3X2QC 3TK0A 3EFOA 2A6HF 2EILC 3SEOA 4I44A 3PDMP 1SMYF 3U2LA 4BEMJ 3S28A 4G7ZF 2Z15A 2EIKC 3BRJA 4ONSA 3ZTZA 4BPMA 1D0YA 2OJED 2H7VC 3SXZA 3B0VC 3NDBB 3KH2A 2R25A 3KYJA 5EK0A 2J7PD 4WGZA 3U9JA 2ZD9A 1M2VB 1V54C 4YL1A 1DOWA 4G0HA 1K04A 4WGYA 4IB4A 5IY5C 1AEPA 2YVKA 2EINC 2R7XA 3LUTB 3IQ5A 3QW1A 4LLCA 4MVRA 4MTGA 2P6VA 1VYIA 3Q7LA 3DZAA 3K1IC 2HZ8A 3NMIA 3QMKA 4CIPA 3SNHA 3EZHA 4A2NB 4P9TA 5T3TA 1HMOA 2XS1A 3DE9A 3EGDB 5JS5A 1EQ1A 4N4WA 4KC9A 3C63A 4YN0B 3VRCA 3TOMA 3WHNA 2C03A 1ZW3A 1OKKD 2CNWD 5JVEA 2YL3A 3J06A 3JZ0A 2OQMA 2ZPAA 3A9CA 3K1IA 5D91A 2L9JA 2YRFA 3U3FA 4W8PA 3UNGC 3Q7GA 3DWWA 3V5XA 1A0BA 4YK5A 3AGTA 3K1HA 4LDQA 3IPMO 5JSLA 1W2WA 3G4XA 3GWLA 2B0JA 2V26A 3F47A 4GYTA 1JPJA 3LNMB 4OD5A 1Q0GA 3S9OA 2MWQA 4JVSA 4AE4B 2ASRA 3HNLA 5L0JA 1TWGA 4DOZA 5KYNA 2EPLX 2PNOA 1CGOA 3JT1A 3AOUA 2IYLD 4XQ1A 1QZXA 2PFDA 2CGEA 2KGOA 2LCHA 5A6BA 3C8GB 2R02A 3ABMC 4JIOA 2HJMA 2EIJC 1YZCA 3JSEO 4JC7A 1E83A 2L81A 3US6A 3L8JA 3H2UA 4NY3A 2RD9A 3G4ZA 4EBBA 2R7SA 1NZEA 1T6IA 2KK1A 3S90A 3C18A 1YYJA 4U5GA 1FTSA 4Q5SF 1ZVZA 2X0CA 1HMDA 4PJMA 3RIPA 5L0GA 1M2VA 1PD1A 3MFNA 3NG1A 3RVYA 3O6XA 3X1OA 5GPGB 3ZDLA 4G78A 1G4WR 4OIPF 1EI7A 3ABLC 1ZHTA 3M4BA 2R9RB 2W4BA 4EIYA 2CYDA 4NC3A 1OQCA 1RCPA 2VCCA 5EHHA 2J9WA 5L3QA 2A69F 4FWVA 1Z6AA 4KI2A 4K7BA 1PV3A 2AVKA 3EGDA 1XZPA 2R03A 3U5SA 4YT4A 5L3VA 2NSFA 1BR4A 1TFKB 2P7VA 4JE9A 3C62A 1OW7A 1ORSC 3NRHA 2JD3A 1NFOA 2B0HA 4E7SA 3JSZA 4JJGA 3FMSA 4U9EA 3S27A 3T9OA 1WN0A 2F22A 3GM1A 3H65A 1NFNA 2GWWA 4EBJA 3LLIA 5COFA 2Q3TA 1D1BA 2QLAA 5AGFA 4N06A 4M63A 1MNDA 3JRTA 1OCOC 4ULWA 3DJNB 3NKEA 4AE4A 4LERA 1O87A 2I15A 1H7IA 4L6RA 4CX9A 1Q0FA 4KBLA 4I1MA 3S0XA 3RFYA 3GM2A 5BQGA 2J0XA 4EKWA 3C8GA 3FAPB 1EKYA 2HSQA 1H6GA 2WVOA 1ZYRF 2XXAA 5HSWA 3E70C 1QPUA 3KYIA 1NU9C 3AQBA 2FFHA 1RKCA 4FAPB 3B9QA 4JEBA 3GANA 5L0DA 4JZAA 2AP3A 1FFTC 3QW0A 2YLIA 3U2MA 1T6QA 2XLEA 4WJ0A 1MNEA 2IXMA 2WZFA 4NTBA 3C7JA 3FXHA 3T6BA 2XSEA 3EJNA 2QUPA 2R05A 5E2QA 5BUOA 2A6EF 4MS2A 1BR1A 1I4ZA 4YT5A 2A1DD 3V7OA 1N1CA 4Z9JA 1Z5ZA 3DJUB 3CAXA 3EPVA 4YT8A 4U9DA 1JOGA 1H9TA 4XEVA 4J30B 3RF3A 4JEAA 5DVWA 2YZSA 1HE1A 1OR2A 5F5FA 4N6HA 3OA1A 1RXQA 2Y69C 1LIHA 4U5BE 1XWJA 1Z3IX 4CS9C 1AUEA 1KTMA 1NBBA 1DOVA 3M4CA 3IQ6A 4NQFA 2XM4A 3AG4C 1T6UA 3KPHA 1C02A 1YZAA 3LAYA 4RDAA 1U89A 4XPXA 3ZTMA 4BJ1A 4CJOA 3EH1A 5CIVA 5DS5A 3MLGA 3TOLA 2Y39A 1R4TA 1WGWA 2Q9CA 2XLVA 1RKEA 2ZXWC 3GWNA 3EG9B 4MQ9F 3QVZA 2HV6A 3CSKA 4CS9A 2YWAA 4YL0A 5JUAA 5B3IA 2HMZA 1WATA 2DGJA 2J45A 4NTAA 4DVZA 1BR2A 3EGXA 3L1MA 2XLHA 1MMGA 3IHUA 3U9MA 5KYXA 4MVUA 3SXMA 3W4YA 2YLDA 1JMWA 2WZLA 3JYYA 5COMA 3IQCA 1YAUO 2QTVA 4CDAA 3HNJA 2ZXOA 1Q0KA 1LVKA 1R5ID 1TKNA 3LS0A 4O79A 1G5ZA 2M64A 2DYSC 3OWTA 2Q4FA 4PJLA 3SZRA 2YL1A 3ASNC 1FR0A 3QTHA 4XPWA 2FGYA 1ZHYA 5JRAA 3BEHA 4EBKA 1RMVA 1D1AA 1D0ZA 2L6GA 1ORYA 5K0IA 1K05A 256BA 2Q7RA 2GAQA 4IAQA 4Q4ZF 3CQZA 2CW0F 4JTDB 1YVIA 2H8AA 2J9UA 2PBEA 3DD7A 4KNVA 2J8WA 3FOOA 3SP1A 2P1AA 4EWCA 2KC3A 3NMKA 2WB7A 3HJCA 1YA9A 1S7ZA 1GM5A 1A41A 2ZXPA 2QNLA 2XL6A 4X0RA 3KKBA 4C3EA 3L34A 2R7WA 2PX0A 4PFOA 2FAPB 3LEVA 4U5DE 1LI7A 1V74B 4QI2A 2XM0A 2HJ3A 1G8XA 2EIMC 2DI3A 3PCVA 3EHNA 2AU5A 2NSGA 1AVOB 3HNKA 4FX5A 2IXOA 1VTMP 2LFDA 1J8YF 3ASOC 5KYUA 5AC5A 3RQEA 1WOLA 1VLTA 1M6TA 3EZIA 2XXAB 4IRUA 4R32A 4CSAC 3EG9A 2V3CC 2IXPA 2P61A 4XTKA 4IAOA 4OIOF 4BJ6C 4DRHB 5L0FA 3GEHA 4I1OB 2L7AA 3DKAA 4C7OA 3K6BA 3AQCA 2W45A 1GS9A 1U6HA 1KNYA 1OW8A 4YL3A 5TJ5E 2H7BA 3WAQA 3ZC4A 4AL0A 2BE5F 4BEJA 5A6BD 3T4RA 3TD7A 4CSAA 2A0UA 4PK4A 4EUKB 1Q0DA 5FCLA 1JRAA 3A11A 5BQIA 4HE8D 4BJ6A 1VK5A 4U5CE 3S84A 4G7OF 1C17M 4LDRA 1Q0MA 1LE2A 1F1MA 3ZSUA 2IXNA 3JYHA 2LIGA 2YEVA 4CDVA 2XS8A 3O55A 2L6FA 4HFKB 1MQVA 3EQLF 1NU7D 2WVNA 4JURI 3VF0A 4HFFB 3RQGA 4YWQA 3TULA 3WG7C 1WASA 2HFIA 4AX2A 4ANJA 4O6NA 4CDYA 4PFPA 4XEKA 1M57C 4C3DA 1QVXA 2OG2A 2YLGA 4IGGA 3RW0A 1CPRA 2LK4A 3AGUA 4ZLCA 1VMAA 4O6YA 5KYYB 3LESA 1LKXA 1OXBA 2YQYA 3CEXA 1RKEB 1FFHA 2R7QA 3DXJF 2R7UA 1OCZC 1LPEA 2EPMX 2MHRA 1FAPB 2IBFA 2UUIA 2W9YA 2WZGA 1Z23A 2LQGA 4XEFA 3R7CA 4F4BA 5A6KA 1TWAA 3LLKA 3U3BA 2WVQA 2YL0A 3EGXB 2PX3A 3QZCA 5KYXB 1G4US 1ZHWA 1S05A 1QQ3A 4AK9A 2HKVA 3I5PA 4RD9A 2PP4A 3VAYA 1YA7O 4UDVA 5CI9A 2NPUA 3ABKC 1JR8A 2HSBA 2KJGA 2KW3C 2OJQA 3LEOA 4JJFA 1Z7Qc 5JT4A 2HS5A 2KNHA 3JTLO 3POVA 3SYNA 3G50A 4QDLA 4J7YA 3UMKA 4MVZA 2OOCA 4MTFA 1ZZPA 1OCCC 5FZTA 3KMIA 3GEIA 1E84A 2A0BA 3LJBA 4GEHA 4I3MA 4O7GA 4CJGA 1NLXA 3EHMA 5A6JA 3AG2C 3GORA 4MVQA 3C8GD 1SF8A 2JPUA 1VYKA 1YJGA 1IW7F 4FESA 4O6MA 5B3SC 1LM3B 1TQGA 3B0UX 1IZMA 1D1CA 3VM6A 2ZXRA 3O10A 2XLOA 1QKRA 3DI5A 3LS1A 1ZW2A 4XWJA 5A69A 5DS6A 4P6IC 4MNDA 3HKKA 3NYMA 3O39A 2NUTA 2R7RA 1YLMA 4MTOA 4ZLDA 4GQHA 2R7OA 4ULVA 5T1DB 3VYWA 4EHPA 4DRJB 2LP4A 3L0IA 2QY9A 5KYUB 5KYYA 3M15A 1H9GA 2VC9A 5D92A 4ER9A 1FMWA 4KNWA 1T9KA 2LFFA 3N2ZB 4B6IA 2R7TA 3R2PA 5F5HA 4JCHA 3FOPA 3LNRA 2OCCC 2VH3A 1LS4A 2J9VA 2L6HA 4U5FE 3RVZA 4Q7CA 4C7OB 2XLDA 2D5RB 3DAFA 2XL4A 1E85A 4CBEA 4IJJA 4Z9IA 3WODF 3RYLA 2LD6A 2P0NA 3HNIA 4QI0A 2W4MA 2O9XA 1T5OA 3FHDA 4RBNA 3TJ5A 2D4UA 2M4EA 2KQ9A 3AJMA 3L8IA 5EGYA 5A6AA 1CGME 1OR3A 1O5HA 1U0BB 2J7PA 3PHF2 4IWBA 2C04A 3Q6NA 4MVMA 3GODA 3H2VA 3DAGA 3RH3A 2GDCA 5COGA 3SXKA 1CPQA 1B68A 1VLSA 2WL8A 4LDKA 3T6GB 3FDQA 1YARO 3KL4A 1ZHZA 1WTYA 2CDQA 3W8IA 1SR2A 4MVSA 1VB5A 1LE4A 3Q6MA 1YYXA 5L0CA 2EPKX 4JRZA 1V55C 1I4YA 1NG1A 2RSEB 1SYQA 3B29A 3MYIA 4OINF 2XLMA 2LSEA 3K33A 2ICWG 1M56C 2G3VA 4PR9A 1SZIA 1OKKA 2CNWA 3SXYA 3ZWIA 3UGOA 2DYRC 3FAJA 3GEEA 3GM3A 3MYFA 3EH2A 2EPOA 2Q00A 3MX3A 2VB6A 1APCA 2EPNA 2HMQA 3S29A 3DM9B 5L0IA 1Z63A 5L0HA 4OD4A 4NCQA 3U0CA 3I4UA 5KYWB 1I5NA 3W8HA 5JP7A 3E9VA 1TWCA 1M2OA 5E3CA 5F28E 2VCBA 3T6JA 4PJJA 3W2WA 1BZ4A 1ZU4A 2G3KA 4BJ5C 4CS8C 4OIQF 2AWYA 1J8MF 2XL8A 2Y3DA 4E17A 3NMJA 3DE8A 4OIRF 1RJ9A 4J7TA 5DQZA 1BBHA 2NUPA 2KYHA 1K40A 4DBRA 1FNTc 3QVYA 2Q9AA 1OW6A 3M1CB 4DXWA 1YDIA 1GQAA 5T3WA 3UMIA 3IQTA 4BJ5A 4H54A 4CS8A 4HEAJ 3ZQYA 1UFBA 2H7OA 2ETSA 3C8ZA 5B1BC 2PF4E 4K0DA 5BQHA 1JAFA 3FVYA 4JTCB 3N0TA 2VASA 3OEOA
chains in the Genus database with same CATH topology
2HKVA 2NSGA 2NSFA 3QTHA 5COGA 5CIVA 2RD9A 2OQMA 2OU6A 2QE9A 3DKAA 2F22A 3GORA 5COFA 2P1AA 2YQYA 3CEXA 2QNLA 5COMA 3DI5A 4N6CA 1RXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HKV A;  2NSG A;  2NSF A;  3QTH A;  5COG A;  5CIV A;  2RD9 A;  2OQM A;  2OU6 A;  2QE9 A;  3DKA A;  2F22 A;  3GOR A;  5COF A;  2P1A A;  2YQY A;  3CEX A;  2QNL A;  5COM A;  3DI5 A;  4N6C A;  1RXQ A; 
#chains in the Genus database with same CATH topology
 2YL7 A;  4P9F A;  4C3B A;  3RQF A;  4D4X A;  3AG1 C;  2AWC A;  2VCA A;  2Y3H A;  1UG7 A;  2JX0 A;  1MMA A;  2NG1 A;  1L7C A;  2NUT B;  4G7H F;  4DVY P;  2DB4 A;  4JW1 A;  2YKZ A;  4BJT A;  1KU2 A;  1A7V A;  4XPY A;  1XZQ A;  2E87 A;  2J46 A;  3ECS A;  3I5Q A;  3JRM O;  3K7D A;  3V5Z A;  1L3P A;  4CS7 A;  3HLZ A;  1WWP A;  3MBG A;  1HW1 A;  4U5H A;  4YT2 A;  2BC5 A;  2HV7 A;  3F46 A;  1NSG B;  5KYW A;  4WAB A;  1O3U A;  4DBQ A;  3PMR A;  1VOM A;  3UR3 C;  3CZ6 A;  2MYS A;  4NTF A;  5DS4 A;  4K1O A;  1ORJ A;  1ZHX A;  1PCX A;  4PJN A;  3U8P A;  2G62 A;  2XRH A;  4IAR A;  5DQT A;  2GFH A;  5DLJ A;  3B0P A;  1D0X A;  1HY5 A;  2BL2 A;  1TFO B;  2OEV A;  3DM5 A;  4J32 B;  3EFO B;  3UMH A;  3U8V A;  4E18 A;  2Y3G A;  4CIH A;  1MMN A;  5B1A C;  5CI8 A;  3K66 A;  2X51 A;  3ATP A;  1OCR C;  1FMV A;  4XLP F;  4LLE A;  4E0I A;  4W8K A;  4JTA B;  1LI5 A;  4H4K C;  2OKU A;  4YJW A;  4XLN F;  1JPN A;  1A7E A;  1TWH A;  3HTK C;  3ZQV A;  5JLI A;  4N6C A;  3ZVR A;  2KSF A;  5E3A A;  4MW8 A;  3M79 A;  4JKV A;  2UUH A;  1HW2 A;  1PD0 A;  4JCZ A;  3ZG1 A;  2CCY A;  3ZIB A;  3N24 A;  4AL1 A;  4U5E E;  4BG0 A;  4E0H A;  1E86 A;  2TMV P;  4A4A A;  1HE9 A;  3NYJ A;  3RKO F;  2OU6 A;  1QSP A;  1CGN A;  3UGP A;  2QE9 A;  2J0W A;  3IEE A;  1QLE C;  2A68 F;  3W2V A;  2Y3B A;  1T01 A;  2OEX A;  3V5Y A;  4D4N A;  4PAC A;  1RJ9 B;  3TQO A;  4Z9H A;  1EA8 A;  1ST6 A;  3AG3 C;  1GGQ A;  4MW3 A;  5AC4 A;  2Q9B A;  2XLW A;  2I8B A;  2NUP B;  3TJ6 A;  4MVO A;  1LS1 A;  5HV9 A;  4DJ9 A;  1Y6D A;  4LAC B;  2J9B A;  2IOQ A;  3B71 A;  1TR2 A;  1ZU5 A;  3NKD A;  1MMD A;  3JCU Q;  2YHS A;  1A7D A;  1Y4C A;  2R7V A;  1V4A A;  2HUJ A;  5E33 A;  1C03 A;  4E7Z A;  3ITF A;  1E2X A;  4DRI B;  1OXK A;  2GA0 A;  1BDJ B;  2IM8 A;  3DMD A;  3NYL A;  3X2Q C;  3TK0 A;  3EFO A;  2A6H F;  2EIL C;  3SEO A;  4I44 A;  3PDM P;  1SMY F;  3U2L A;  4BEM J;  3S28 A;  4G7Z F;  2Z15 A;  2EIK C;  3BRJ A;  4ONS A;  3ZTZ A;  4BPM A;  1D0Y A;  2OJE D;  2H7V C;  3SXZ A;  3B0V C;  3NDB B;  3KH2 A;  2R25 A;  3KYJ A;  5EK0 A;  2J7P D;  4WGZ A;  3U9J A;  2ZD9 A;  1M2V B;  1V54 C;  4YL1 A;  1DOW A;  4G0H A;  1K04 A;  4WGY A;  4IB4 A;  5IY5 C;  1AEP A;  2YVK A;  2EIN C;  2R7X A;  3LUT B;  3IQ5 A;  3QW1 A;  4LLC A;  4MVR A;  4MTG A;  2P6V A;  1VYI A;  3Q7L A;  3DZA A;  3K1I C;  2HZ8 A;  3NMI A;  3QMK A;  4CIP A;  3SNH A;  3EZH A;  4A2N B;  4P9T A;  5T3T A;  1HMO A;  2XS1 A;  3DE9 A;  3EGD B;  5JS5 A;  1EQ1 A;  4N4W A;  4KC9 A;  3C63 A;  4YN0 B;  3VRC A;  3TOM A;  3WHN A;  2C03 A;  1ZW3 A;  1OKK D;  2CNW D;  5JVE A;  2YL3 A;  3J06 A;  3JZ0 A;  2OQM A;  2ZPA A;  3A9C A;  3K1I A;  5D91 A;  2L9J A;  2YRF A;  3U3F A;  4W8P A;  3UNG C;  3Q7G A;  3DWW A;  3V5X A;  1A0B A;  4YK5 A;  3AGT A;  3K1H A;  4LDQ A;  3IPM O;  5JSL A;  1W2W A;  3G4X A;  3GWL A;  2B0J A;  2V26 A;  3F47 A;  4GYT A;  1JPJ A;  3LNM B;  4OD5 A;  1Q0G A;  3S9O A;  2MWQ A;  4JVS A;  4AE4 B;  2ASR A;  3HNL A;  5L0J A;  1TWG A;  4DOZ A;  5KYN A;  2EPL X;  2PNO A;  1CGO A;  3JT1 A;  3AOU A;  2IYL D;  4XQ1 A;  1QZX A;  2PFD A;  2CGE A;  2KGO A;  2LCH A;  5A6B A;  3C8G B;  2R02 A;  3ABM C;  4JIO A;  2HJM A;  2EIJ C;  1YZC A;  3JSE O;  4JC7 A;  1E83 A;  2L81 A;  3US6 A;  3L8J A;  3H2U A;  4NY3 A;  2RD9 A;  3G4Z A;  4EBB A;  2R7S A;  1NZE A;  1T6I A;  2KK1 A;  3S90 A;  3C18 A;  1YYJ A;  4U5G A;  1FTS A;  4Q5S F;  1ZVZ A;  2X0C A;  1HMD A;  4PJM A;  3RIP A;  5L0G A;  1M2V A;  1PD1 A;  3MFN A;  3NG1 A;  3RVY A;  3O6X A;  3X1O A;  5GPG B;  3ZDL A;  4G78 A;  1G4W R;  4OIP F;  1EI7 A;  3ABL C;  1ZHT A;  3M4B A;  2R9R B;  2W4B A;  4EIY A;  2CYD A;  4NC3 A;  1OQC A;  1RCP A;  2VCC A;  5EHH A;  2J9W A;  5L3Q A;  2A69 F;  4FWV A;  1Z6A A;  4KI2 A;  4K7B A;  1PV3 A;  2AVK A;  3EGD A;  1XZP A;  2R03 A;  3U5S A;  4YT4 A;  5L3V A;  2NSF A;  1BR4 A;  1TFK B;  2P7V A;  4JE9 A;  3C62 A;  1OW7 A;  1ORS C;  3NRH A;  2JD3 A;  1NFO A;  2B0H A;  4E7S A;  3JSZ A;  4JJG A;  3FMS A;  4U9E A;  3S27 A;  3T9O A;  1WN0 A;  2F22 A;  3GM1 A;  3H65 A;  1NFN A;  2GWW A;  4EBJ A;  3LLI A;  5COF A;  2Q3T A;  1D1B A;  2QLA A;  5AGF A;  4N06 A;  4M63 A;  1MND A;  3JRT A;  1OCO C;  4ULW A;  3DJN B;  3NKE A;  4AE4 A;  4LER A;  1O87 A;  2I15 A;  1H7I A;  4L6R A;  4CX9 A;  1Q0F A;  4KBL A;  4I1M A;  3S0X A;  3RFY A;  3GM2 A;  5BQG A;  2J0X A;  4EKW A;  3C8G A;  3FAP B;  1EKY A;  2HSQ A;  1H6G A;  2WVO A;  1ZYR F;  2XXA A;  5HSW A;  3E70 C;  1QPU A;  3KYI A;  1NU9 C;  3AQB A;  2FFH A;  1RKC A;  4FAP B;  3B9Q A;  4JEB A;  3GAN A;  5L0D A;  4JZA A;  2AP3 A;  1FFT C;  3QW0 A;  2YLI A;  3U2M A;  1T6Q A;  2XLE A;  4WJ0 A;  1MNE A;  2IXM A;  2WZF A;  4NTB A;  3C7J A;  3FXH A;  3T6B A;  2XSE A;  3EJN A;  2QUP A;  2R05 A;  5E2Q A;  5BUO A;  2A6E F;  4MS2 A;  1BR1 A;  1I4Z A;  4YT5 A;  2A1D D;  3V7O A;  1N1C A;  4Z9J A;  1Z5Z A;  3DJU B;  3CAX A;  3EPV A;  4YT8 A;  4U9D A;  1JOG A;  1H9T A;  4XEV A;  4J30 B;  3RF3 A;  4JEA A;  5DVW A;  2YZS A;  1HE1 A;  1OR2 A;  5F5F A;  4N6H A;  3OA1 A;  1RXQ A;  2Y69 C;  1LIH A;  4U5B E;  1XWJ A;  1Z3I X;  4CS9 C;  1AUE A;  1KTM A;  1NBB A;  1DOV A;  3M4C A;  3IQ6 A;  4NQF A;  2XM4 A;  3AG4 C;  1T6U A;  3KPH A;  1C02 A;  1YZA A;  3LAY A;  4RDA A;  1U89 A;  4XPX A;  3ZTM A;  4BJ1 A;  4CJO A;  3EH1 A;  5CIV A;  5DS5 A;  3MLG A;  3TOL A;  2Y39 A;  1R4T A;  1WGW A;  2Q9C A;  2XLV A;  1RKE A;  2ZXW C;  3GWN A;  3EG9 B;  4MQ9 F;  3QVZ A;  2HV6 A;  3CSK A;  4CS9 A;  2YWA A;  4YL0 A;  5JUA A;  5B3I A;  2HMZ A;  1WAT A;  2DGJ A;  2J45 A;  4NTA A;  4DVZ A;  1BR2 A;  3EGX A;  3L1M A;  2XLH A;  1MMG A;  3IHU A;  3U9M A;  5KYX A;  4MVU A;  3SXM A;  3W4Y A;  2YLD A;  1JMW A;  2WZL A;  3JYY A;  5COM A;  3IQC A;  1YAU O;  2QTV A;  4CDA A;  3HNJ A;  2ZXO A;  1Q0K A;  1LVK A;  1R5I D;  1TKN A;  3LS0 A;  4O79 A;  1G5Z A;  2M64 A;  2DYS C;  3OWT A;  2Q4F A;  4PJL A;  3SZR A;  2YL1 A;  3ASN C;  1FR0 A;  3QTH A;  4XPW A;  2FGY A;  1ZHY A;  5JRA A;  3BEH A;  4EBK A;  1RMV A;  1D1A A;  1D0Z A;  2L6G A;  1ORY A;  5K0I A;  1K05 A;  256B A;  2Q7R A;  2GAQ A;  4IAQ A;  4Q4Z F;  3CQZ A;  2CW0 F;  4JTD B;  1YVI A;  2H8A A;  2J9U A;  2PBE A;  3DD7 A;  4KNV A;  2J8W A;  3FOO A;  3SP1 A;  2P1A A;  4EWC A;  2KC3 A;  3NMK A;  2WB7 A;  3HJC A;  1YA9 A;  1S7Z A;  1GM5 A;  1A41 A;  2ZXP A;  2QNL A;  2XL6 A;  4X0R A;  3KKB A;  4C3E A;  3L34 A;  2R7W A;  2PX0 A;  4PFO A;  2FAP B;  3LEV A;  4U5D E;  1LI7 A;  1V74 B;  4QI2 A;  2XM0 A;  2HJ3 A;  1G8X A;  2EIM C;  2DI3 A;  3PCV A;  3EHN A;  2AU5 A;  2NSG A;  1AVO B;  3HNK A;  4FX5 A;  2IXO A;  1VTM P;  2LFD A;  1J8Y F;  3ASO C;  5KYU A;  5AC5 A;  3RQE A;  1WOL A;  1VLT A;  1M6T A;  3EZI A;  2XXA B;  4IRU A;  4R32 A;  4CSA C;  3EG9 A;  2V3C C;  2IXP A;  2P61 A;  4XTK A;  4IAO A;  4OIO F;  4BJ6 C;  4DRH B;  5L0F A;  3GEH A;  4I1O B;  2L7A A;  3DKA A;  4C7O A;  3K6B A;  3AQC A;  2W45 A;  1GS9 A;  1U6H A;  1KNY A;  1OW8 A;  4YL3 A;  5TJ5 E;  2H7B A;  3WAQ A;  3ZC4 A;  4AL0 A;  2BE5 F;  4BEJ A;  5A6B D;  3T4R A;  3TD7 A;  4CSA A;  2A0U A;  4PK4 A;  4EUK B;  1Q0D A;  5FCL A;  1JRA A;  3A11 A;  5BQI A;  4HE8 D;  4BJ6 A;  1VK5 A;  4U5C E;  3S84 A;  4G7O F;  1C17 M;  4LDR A;  1Q0M A;  1LE2 A;  1F1M A;  3ZSU A;  2IXN A;  3JYH A;  2LIG A;  2YEV A;  4CDV A;  2XS8 A;  3O55 A;  2L6F A;  4HFK B;  1MQV A;  3EQL F;  1NU7 D;  2WVN A;  4JUR I;  3VF0 A;  4HFF B;  3RQG A;  4YWQ A;  3TUL A;  3WG7 C;  1WAS A;  2HFI A;  4AX2 A;  4ANJ A;  4O6N A;  4CDY A;  4PFP A;  4XEK A;  1M57 C;  4C3D A;  1QVX A;  2OG2 A;  2YLG A;  4IGG A;  3RW0 A;  1CPR A;  2LK4 A;  3AGU A;  4ZLC A;  1VMA A;  4O6Y A;  5KYY B;  3LES A;  1LKX A;  1OXB A;  2YQY A;  3CEX A;  1RKE B;  1FFH A;  2R7Q A;  3DXJ F;  2R7U A;  1OCZ C;  1LPE A;  2EPM X;  2MHR A;  1FAP B;  2IBF A;  2UUI A;  2W9Y A;  2WZG A;  1Z23 A;  2LQG A;  4XEF A;  3R7C A;  4F4B A;  5A6K A;  1TWA A;  3LLK A;  3U3B A;  2WVQ A;  2YL0 A;  3EGX B;  2PX3 A;  3QZC A;  5KYX B;  1G4U S;  1ZHW A;  1S05 A;  1QQ3 A;  4AK9 A;  2HKV A;  3I5P A;  4RD9 A;  2PP4 A;  3VAY A;  1YA7 O;  4UDV A;  5CI9 A;  2NPU A;  3ABK C;  1JR8 A;  2HSB A;  2KJG A;  2KW3 C;  2OJQ A;  3LEO A;  4JJF A;  1Z7Q c;  5JT4 A;  2HS5 A;  2KNH A;  3JTL O;  3POV A;  3SYN A;  3G50 A;  4QDL A;  4J7Y A;  3UMK A;  4MVZ A;  2OOC A;  4MTF A;  1ZZP A;  1OCC C;  5FZT A;  3KMI A;  3GEI A;  1E84 A;  2A0B A;  3LJB A;  4GEH A;  4I3M A;  4O7G A;  4CJG A;  1NLX A;  3EHM A;  5A6J A;  3AG2 C;  3GOR A;  4MVQ A;  3C8G D;  1SF8 A;  2JPU A;  1VYK A;  1YJG A;  1IW7 F;  4FES A;  4O6M A;  5B3S C;  1LM3 B;  1TQG A;  3B0U X;  1IZM A;  1D1C A;  3VM6 A;  2ZXR A;  3O10 A;  2XLO A;  1QKR A;  3DI5 A;  3LS1 A;  1ZW2 A;  4XWJ A;  5A69 A;  5DS6 A;  4P6I C;  4MND A;  3HKK A;  3NYM A;  3O39 A;  2NUT A;  2R7R A;  1YLM A;  4MTO A;  4ZLD A;  4GQH A;  2R7O A;  4ULV A;  5T1D B;  3VYW A;  4EHP A;  4DRJ B;  2LP4 A;  3L0I A;  2QY9 A;  5KYU B;  5KYY A;  3M15 A;  1H9G A;  2VC9 A;  5D92 A;  4ER9 A;  1FMW A;  4KNW A;  1T9K A;  2LFF A;  3N2Z B;  4B6I A;  2R7T A;  3R2P A;  5F5H A;  4JCH A;  3FOP A;  3LNR A;  2OCC C;  2VH3 A;  1LS4 A;  2J9V A;  2L6H A;  4U5F E;  3RVZ A;  4Q7C A;  4C7O B;  2XLD A;  2D5R B;  3DAF A;  2XL4 A;  1E85 A;  4CBE A;  4IJJ A;  4Z9I A;  3WOD F;  3RYL A;  2LD6 A;  2P0N A;  3HNI A;  4QI0 A;  2W4M A;  2O9X A;  1T5O A;  3FHD A;  4RBN A;  3TJ5 A;  2D4U A;  2M4E A;  2KQ9 A;  3AJM A;  3L8I A;  5EGY A;  5A6A A;  1CGM E;  1OR3 A;  1O5H A;  1U0B B;  2J7P A;  3PHF 2;  4IWB A;  2C04 A;  3Q6N A;  4MVM A;  3GOD A;  3H2V A;  3DAG A;  3RH3 A;  2GDC A;  5COG A;  3SXK A;  1CPQ A;  1B68 A;  1VLS A;  2WL8 A;  4LDK A;  3T6G B;  3FDQ A;  1YAR O;  3KL4 A;  1ZHZ A;  1WTY A;  2CDQ A;  3W8I A;  1SR2 A;  4MVS A;  1VB5 A;  1LE4 A;  3Q6M A;  1YYX A;  5L0C A;  2EPK X;  4JRZ A;  1V55 C;  1I4Y A;  1NG1 A;  2RSE B;  1SYQ A;  3B29 A;  3MYI A;  4OIN F;  2XLM A;  2LSE A;  3K33 A;  2ICW G;  1M56 C;  2G3V A;  4PR9 A;  1SZI A;  1OKK A;  2CNW A;  3SXY A;  3ZWI A;  3UGO A;  2DYR C;  3FAJ A;  3GEE A;  3GM3 A;  3MYF A;  3EH2 A;  2EPO A;  2Q00 A;  3MX3 A;  2VB6 A;  1APC A;  2EPN A;  2HMQ A;  3S29 A;  3DM9 B;  5L0I A;  1Z63 A;  5L0H A;  4OD4 A;  4NCQ A;  3U0C A;  3I4U A;  5KYW B;  1I5N A;  3W8H A;  5JP7 A;  3E9V A;  1TWC A;  1M2O A;  5E3C A;  5F28 E;  2VCB A;  3T6J A;  4PJJ A;  3W2W A;  1BZ4 A;  1ZU4 A;  2G3K A;  4BJ5 C;  4CS8 C;  4OIQ F;  2AWY A;  1J8M F;  2XL8 A;  2Y3D A;  4E17 A;  3NMJ A;  3DE8 A;  4OIR F;  1RJ9 A;  4J7T A;  5DQZ A;  1BBH A;  2NUP A;  2KYH A;  1K40 A;  4DBR A;  1FNT c;  3QVY A;  2Q9A A;  1OW6 A;  3M1C B;  4DXW A;  1YDI A;  1GQA A;  5T3W A;  3UMI A;  3IQT A;  4BJ5 A;  4H54 A;  4CS8 A;  4HEA J;  3ZQY A;  1UFB A;  2H7O A;  2ETS A;  3C8Z A;  5B1B C;  2PF4 E;  4K0D A;  5BQH A;  1JAF A;  3FVY A;  4JTC B;  3N0T A;  2VAS A;  3OEO A; 
#chains in the Genus database with same CATH homology
 2HKV A;  2NSG A;  2NSF A;  3QTH A;  5COG A;  5CIV A;  2RD9 A;  2OQM A;  2OU6 A;  2QE9 A;  3DKA A;  2F22 A;  3GOR A;  5COF A;  2P1A A;  2YQY A;  3CEX A;  2QNL A;  5COM A;  3DI5 A;  4N6C A;  1RXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...