2XM0A

Cytochrome c prime from alcaligenes xylosoxidans: ferrous r124k variant
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
125
structure length
125
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CYTOCHROME C'
publication title Distal-to-Proximal No Conversion in Hemoproteins: The Role of the Proximal Pocket.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
total genus 47
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2010-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2xm0A00
1CGNA 3FOOA 2YLDA 1E84A 3M4BA 3HNJA 4ER9A 1E86A 1NBBA 3ZTZA 5JT4A 3QW1A 3U8PA 256BA 3VRCA 2XLOA 4ULVA 4N6HA 4CJOA 2XLVA 4CX9A 4EIYA 3ZQVA 2XLEA 3ZTMA 3L1MA 1A7VA 4IARA 4CDYA 5JP7A 2J9BA 1CPQA 4U9EA 3QVZA 2XLMA 4U9DA 1JAFA 1E83A 1GQAA 1S05A 2XLDA 4CDVA 1E85A 2YLGA 2XL6A 2YLIA 3HNLA 2XLHA 4WGYA 1YYJA 4D4NA 1QQ3A 1YZCA 4CIPA 4IB4A 3M4CA 2YL3A 2XM0A 2XL8A 4WGZA 4CJGA 1YZAA 2XLWA 1EKYA 3TOLA 3C62A 2CCYA 4JEBA 3HNIA 2J8WA 5JUAA 5AGFA 1APCA 5JSLA 3QVYA 2YL1A 2YKZA 1LM3B 1CGOA 1MQVA 1RCPA 2XM4A 3DE8A 4JE9A 3M15A 3ZQYA 4NC3A 3NMJA 3ZWIA 5JLIA 4CDAA 5B3IA 3QW0A 4D4XA 3NMKA 4IAQA 2YL7A 3C63A 1BBHA 3TOMA 3FOPA 3M79A 1YYXA 3IQ5A 4JKVA 1CPRA 4N4WA 3IQ6A 3HNKA 5JRAA 1QPUA 2YL0A 2QLAA 4JEAA 1M6TA 5JVEA 3DE9A 2BC5A 3NMIA 4L6RA 5JS5A
chains in the Genus database with same CATH superfamily
3B29A 1CGNA 2EINC 4J7YA 3HJCA 1OKKD 3JZ0A 1ZW2A 3GANA 1VB5A 2AU5A 3HNJA 5CIVA 1JPNA 3H65A 3WODF 4ER9A 3ZTZA 3Q7LA 1PD1A 2C04A 2W4BA 3DWWA 4PJMA 1ZU4A 3B0VC 2UUIA 1B68A 1OKKA 2Y3GA 3TQOA 3ZDLA 4K7BA 1WASA 2ZXRA 3AGTA 4CSAC 1M2VB 4ULVA 3NG1A 4P9TA 4YL1A 2KJGA 4XLNF 1WTYA 4YT8A 2PNOA 3ZIBA 3MYIA 1A7VA 2EIJC 5T3TA 4IARA 2BE5F 1TWGA 2NSFA 4JRZA 3Q6MA 5E3AA 3MX3A 2E87A 1D1AA 3JRTA 2LQGA 2LP4A 1RKEA 3RF3A 5L0GA 2P7VA 2OEVA 2XS1A 4HEAJ 1OCZC 1S05A 2XS8A 3VF0A 5B1BC 2A0UA 3RQEA 5CI9A 4CDVA 1E85A 4BEJA 2Q7RA 1IW7F 3DKAA 4MVMA 4LACB 4C3DA 3JSEO 1LE2A 1CGME 2GFHA 2HMZA 2OCCC 3EQLF 2X0CA 3K33A 4XPWA 4WGYA 5A6KA 3U9JA 2EPOA 5DLJA 3U9MA 1PD0A 1YYJA 1OXKA 3OEOA 3U3FA 4D4NA 3C8GD 2H7BA 3RVYA 1YZCA 2DGJA 1BR4A 1WATA 5AC5A 5HV9A 4JTCB 4CS9A 1OQCA 4O79A 2KGOA 4CIPA 2I8BA 1J8YF 1TFOB 4JURI 3M4CA 2YL3A 4LERA 1NFNA 1QVXA 1KU2A 2EIMC 2XL8A 1MMDA 3EJNA 4X0RA 2R7XA 3C8GA 4OIPF 1EKYA 1VLSA 1EQ1A 2WVOA 2HMQA 4LDKA 1K04A 5FCLA 2NUPA 2R7WA 3MLGA 3AQCA 3L34A 3S90A 2CCYA 2J9UA 4Z9JA 2DYSC 4C3BA 4MNDA 1RJ9B 3HNIA 4KNWA 4J7TA 3F46A 2R03A 4NQFA 5AGFA 3I4UA 4YN0B 5JSLA 3QVYA 2VB6A 3DAFA 4GYTA 3UMIA 4DVZA 3HLZA 1LM3B 3OA1A 1CGOA 1R5ID 3RQGA 3LNMB 3RYLA 3VAYA 1SYQA 2R02A 4CS9C 1Q0GA 2MYSA 2PP4A 3EH1A 2OEXA 4U5BE 1FFTC 3HTKC 1FAPB 3C7JA 3SXMA 2ICWG 2ASRA 2YHSA 3GEIA 1C17M 3S28A 1FR0A 2H8AA 3W2VA 5B3IA 1YARO 3ABMC 4IAQA 4MQ9F 1ORSC 2HV6A 2PX0A 3MBGA 4MVOA 3DI5A 4QDLA 3ZG1A 3U3BA 5L0FA 1GM5A 2A69F 2Q00A 4U5CE 3FOPA 2XXAA 4OD4A 3CSKA 3M79A 1YYXA 3WG7C 2DYRC 3IQ6A 2WVNA 3KKBA 3W4YA 3A9CA 4Q4ZF 2XL4A 5KYXB 1TFKB 1YLMA 2R7UA 1OCRC 1XWJA 2Q9BA 3PMRA 5L0IA 3EHMA 1EI7A 3M1CB 4H4KC 1V74B 2YL0A 3B9QA 4JEAA 1PV3A 1HY5A 2L6GA 1M6TA 2O9XA 2R7QA 3KL4A 2R7TA 1ZW3A 2BC5A 1T9KA 3GODA 4MTOA 1G8XA 1KNYA 2D5RB 5KYWA 3B71A 4JIOA 1S7ZA 1WN0A 2QTVA 2CNWD 1XZQA 1DOWA 3O55A 2OOCA 2Q4FA 1EA8A 5D91A 1YVIA 1FFHA 1WGWA 4ONSA 3M4BA 1E84A 3ABKC 2GA0A 2HSBA 2JPUA 2OJED 4PFPA 4XEFA 3EGXB 1YA9A 2NUPB 4ANJA 3LUTB 5KYUB 2CNWA 1E86A 1ZHYA 3EG9B 5B3SC 4YJWA 2A1DD 2EPLX 5K0IA 4ZLCA 3N2ZB 2A6EF 1VTMP 3O10A 1T6QA 4YL3A 3VRCA 1JMWA 2OG2A 2IYLD 3VYWA 3ZC4A 2Q9AA 1ZVZA 3K1IA 3IQTA 2P61A 4CIHA 2L9JA 4LDRA 4DVYP 1TWAA 2P1AA 3L1MA 3L8IA 1RXQA 4Z9HA 1OW6A 2G3KA 3A11A 4CDYA 4OIOF 2AWCA 2EPNA 2IXOA 3GM2A 4PACA 3T6BA 4WJ0A 4AL0A 1Z5ZA 1A0BA 4N06A 3EFOB 4I1OB 1JAFA 3RQFA 4BJ6A 1E83A 5KYNA 4NTAA 1D0ZA 1YAUO 2YLGA 4EWCA 3SXYA 2YLIA 5L3QA 3SYNA 2IXMA 3EPVA 4BJ5C 2XLHA 1ZHWA 2LIGA 4G7HF 1YDIA 2XSEA 3W8IA 2LK4A 3K1IC 4KC9A 4QI2A 3L0IA 4CSAA 1MNEA 2EIKC 1SZIA 1V55C 1VOMA 4C7OA 2FGYA 1Z23A 2W4MA 2A68F 4IB4A 5E2QA 4FAPB 2J0WA 3BRJA 2Y39A 3AJMA 3HKKA 2HKVA 3RVZA 3S84A 1H6GA 4CJGA 2L7AA 1YZAA 5DVWA 1ZYRF 3R2PA 5DS6A 4BJ6C 2L6HA 3G50A 2DI3A 3UR3C 1FMWA 2HZ8A 1OW8A 3NYJA 4IJJA 4JJFA 4EHPA 5HSWA 4LDQA 2KSFA 3JCUQ 3LNRA 3QTHA 4JEBA 3B0PA 3JYHA 2J8WA 1C02A 1PCXA 1G4WR 1APCA 4EUKB 4KBLA 1WOLA 1LKXA 2OQMA 3ZVRA 3C8ZA 1MQVA 4MVRA 2XM4A 3S0XA 1OCOC 3JT1A 3NRHA 5TJ5E 2WVQA 3EHNA 1U0BB 2NUTB 5GPGB 2HS5A 3F47A 3M15A 3TULA 4ZLDA 2L81A 1OR2A 1U6HA 4BJTA 1LE4A 2LCHA 3H2UA 1BR1A 1Q0FA 3NMJA 1ZHTA 2EILC 1FMVA 3PCVA 4E0IA 2J7PD 1O5HA 5CI8A 3V5YA 2YVKA 1TWHA 2HFIA 2KQ9A 2R7OA 1LI7A 4PJNA 4E0HA 3DD7A 2CW0F 1LIHA 1AEPA 4J30B 4WABA 3ATPA 1HE1A 4A4AA 1VMAA 3G4ZA 2WL8A 2WB7A 2DB4A 1SMYF 4A2NB 1DOVA 2J7PA 3TK0A 1IZMA 5DQZA 2IOQA 3ABLC 4PJLA 3T4RA 1Z6AA 2J45A 5F5FA 3DMDA 2J0XA 4LLEA 4XLPF 3TJ6A 3EH2A 1LVKA 4GEHA 2PF4E 1QZXA 3GEHA 3NKEA 4HFKB 5A6AA 4E7ZA 4HE8D 3DM5A 1LPEA 4JVSA 5JRAA 4U5GA 3PHF2 3GEEA 4XEVA 4AL1A 5KYYA 1NLXA 1H9TA 2PBEA 5DS4A 4NY3A 3E9VA 1Z7Qc 2W45A 2V3CC 2ETSA 1O87A 2J46A 3DE9A 1TWCA 1G5ZA 2IXPA 3KH2A 1V4AA 1Q0DA 1M2OA 3EGDA 3NMIA 4L6RA 1UFBA 3W8HA 4E17A 3MYFA 3B0UX 2HJ3A 2XRHA 1C03A 3EZIA 2YLDA 3FOOA 2R05A 5A6BD 3AG4C 1VYIA 3T6JA 1RKEB 2YWAA 1FNTc 1D1CA 4OINF 3U8PA 4AE4A 1BZ4A 3KPHA 5A6BA 1HW1A 3DM9B 2KC3A 256BA 2NPUA 3KYJA 4G78A 1SR2A 3GORA 1L7CA 3DJUB 3TJ5A 3I5PA 3W2WA 2P6VA 2XLVA 3AG1C 1MMGA 5AC4A 3ZQVA 2WZFA 3KMIA 2HUJA 4MVZA 2R7RA 1K40A 3DAGA 2B0JA 3FDQA 2QUPA 4NCQA 5JP7A 4XPXA 3E70C 2J9VA 2C03A 3K66A 2J9BA 4CS7A 3U2MA 1CPQA 5L0JA 3J06A 1RKCA 1MMNA 3H2VA 3QVZA 1HE9A 2XLMA 1YJGA 3LLIA 3LS0A 3N0TA 4U9DA 3LEOA 2ZXPA 4U5DE 1GGQA 1GQAA 2M64A 3LJBA 3C8GB 2UUHA 3LAYA 4W8PA 5IY5C 3DXJF 2XL6A 2Y3DA 1H9GA 1T5OA 1M2VA 4MS2A 4JZAA 4NTBA 5A6JA 4CBEA 3V5ZA 2F22A 3SP1A 2GWWA 2VCAA 1FTSA 2IBFA 1KTMA 1I5NA 2A6HF 2VC9A 5FZTA 3C18A 3US6A 2GDCA 1M57C 1OR3A 3JRMO 1LI5A 1YA7O 3O39A 3U5SA 1QQ3A 4BJ5A 2NSGA 4KI2A 2JD3A 3JTLO 3AG2C 1Q0KA 2A0BA 4F4BA 5KYYB 4YL0A 2CDQA 2H7VC 2L6FA 3NKDA 4MW8A 4WGZA 3T6GB 2ZXOA 4MVUA 3TD7A 4B6IA 2P0NA 3LEVA 3G4XA 4AX2A 3TOLA 2R7VA 4JCHA 4LLCA 1Y6DA 5L0CA 3C62A 4IRUA 3FAPB 5B1AC 4DJ9A 4ULWA 4JTDB 5JUAA 1U89A 3X1OA 4DBRA 3CQZA 3FAJA 2YKZA 1E2XA 4XTKA 4JW1A 1ZHZA 4OD5A 3RFYA 4JCZA 4DRIB 5BUOA 1RCPA 3DE8A 3POVA 2XXAB 3MFNA 4GQHA 3LS1A 3R7CA 1L3PA 1ST6A 4DXWA 5L3VA 3ZQYA 3N24A 3O6XA 2PX3A 2AWYA 4W8KA 4NC3A 4NTFA 1K05A 1QLEC 2JX0A 1LS1A 2V26A 4XEKA 1SF8A 2OKUA 4JTAB 3UMKA 2HJMA 3GM1A 4QI0A 5L0HA 5JLIA 2KNHA 2NG1A 1RJ9A 4CDAA 2AVKA 2AP3A 3AOUA 1WWPA 2RSEB 2Y3HA 3QW0A 4IAOA 3SXZA 3UMHA 1ZHXA 3NMKA 3C63A 1N1CA 5KYWB 1BBHA 2Q3TA 4MVQA 3TOMA 4EBBA 2PFDA 2ZD9A 4U5EE 1RMVA 4RDAA 4E7SA 1CPRA 4YT5A 4N4WA 1NZEA 3SXKA 2VASA 5F5HA 4G7ZF 2HSQA 3K7DA 1V54C 2YRFA 3U8VA 2QNLA 3GWLA 4U5HA 3CEXA 2KW3C 3HNKA 1AVOB 1GS9A 2G62A 1QPUA 4UDVA 4YT4A 1JR8A 2QLAA 4R32A 1NFOA 4DRJB 1H7IA 1BR2A 4O7GA 4Q5SF 2IXNA 3V7OA 4MTFA 4RBNA 4E18A 3ITFA 1I4ZA 5BQIA 5DS5A 1ZZPA 3BEHA 1VYKA 5JS5A 3AGUA 2KK1A 2CYDA 2GAQA 4G7OF 5COGA 3WHNA 4HFFB 5KYXA 1NBBA 5JT4A 4G0HA 3QW1A 5E33A 1QSPA 1JRAA 2FAPB 2IM8A 4MTGA 4MVSA 3JSZA 3S9OA 4MW3A 3ASNC 1D1BA 5T3WA 4Q7CA 1G4US 2XLOA 4DRHB 4JC7A 4CJOA 2MHRA 4N6HA 4CX9A 1M56C 2EPMX 2G3VA 2OU6A 1MNDA 2X51A 2XLEA 4Z9IA 3ZTMA 4EIYA 1OCCC 3Q6NA 3LLKA 4XPYA 1W2WA 4I1MA 4XQ1A 3IPMO 3V5XA 4CS8A 3L8JA 3AG3C 1T6UA 4C7OB 1T6IA 3EGXA 4M63A 4O6NA 5KYUA 4U9EA 3EG9A 2H7OA 4I3MA 1AUEA 3ASOC 3WAQA 2YZSA 2R9RB 5L0DA 1R4TA 1JPJA 2XLDA 3ECSA 4H54A 3S27A 3NYLA 2RD9A 3HNLA 3NYMA 3IHUA 3FMSA 4YWQA 2VCBA 1NU9C 1Z63A 4O6YA 3LESA 2MWQA 2YEVA 1A7DA 3OWTA 2Z15A 5D92A 1ORYA 1QKRA 2Y69C 4EBJA 1LS4A 3QMKA 4DOZA 4XWJA 1T01A 2YQYA 4I44A 2M4EA 4CS8C 4PFOA 3EFOA 3RW0A 1Z3IX 2XM0A 2HV7A 5T1DB 3EZHA 3IQCA 2XLWA 3ZSUA 1A7EA 2LFFA 2Y3BA 3DZAA 2R7SA 2LSEA 4O6MA 1OXBA 4FX5A 3RIPA 4EKWA 3T9OA 3I5QA 4IGGA 3RKOF 4PJJA 4EBKA 1VK5A 3AQBA 4YK5A 2W9YA 3S29A 1Q0MA 3DJNB 5BQGA 4OIQF 1UG7A 1XZPA 2VH3A 1OW7A 2BL2A 3GM3A 2YL1A 1D0YA 1HW2A 4BEMJ 1HMDA 1Y4CA 1TKNA 4FWVA 4P6IC 5E3CA 3K6BA 1VLTA 3U0CA 4JE9A 3SNHA 2D4UA 5EGYA 1HMOA 4AK9A 1J8MF 2LD6A 4J32B 1NG1A 5A69A 3CZ6A 1TR2A 4PR9A 1ORJA 3FVYA 3ZWIA 1BDJB 2OJQA 2CGEA 4PK4A 4DBQA 5COMA 3RH3A 1A41A 3FHDA 1JOGA 3KYIA 2FFHA 4OIRF 5DQTA 3CAXA 4K1OA 4D4XA 2I15A 2YL7A 2TMVP 3EGDB 1TQGA 1I4YA 3IQ5A 4JKVA 5EHHA 2LFDA 5COFA 1D0XA 3K1HA 2NUTA 3UNGC 3SZRA 2WZLA 2ZPAA 2QE9A 3U2LA 3FXHA 3VM6A 4BJ1A 3NDBB 2ZXWC 3QZCA 5BQHA 3PDMP 2R25A 4AE4B 4RD9A 3SEOA 3UGOA 1MMAA 4C3EA 3JYYA 3X2QC 2WZGA 4IWBA 4FESA 2J9WA 2QY9A 4P9FA 2KYHA 5EK0A 4YT2A 3UGPA 3GWNA 2EPKX 5F28E 1O3UA 4U5FE 2B0HA 4K0DA 5JVEA 4JJGA 4N6CA 3Q7GA 1F1MA 4BPMA 1NSGB 2Q9CA 1NU7D 4BG0A 1ZU5A 4KNVA 2VCCA 3IEEA
chains in the Genus database with same CATH topology
1CGNA 3FOOA 2YLDA 1E84A 3M4BA 3HNJA 4ER9A 1E86A 1NBBA 3ZTZA 5JT4A 3QW1A 3U8PA 256BA 3VRCA 2XLOA 4ULVA 4N6HA 4CJOA 2XLVA 4CX9A 4EIYA 3ZQVA 2XLEA 3ZTMA 3L1MA 1A7VA 4IARA 4CDYA 5JP7A 2J9BA 1CPQA 4U9EA 3QVZA 2XLMA 4U9DA 1JAFA 1E83A 1GQAA 1S05A 2XLDA 4CDVA 1E85A 2YLGA 2XL6A 2YLIA 3HNLA 2XLHA 4WGYA 1YYJA 4D4NA 1QQ3A 1YZCA 4CIPA 4IB4A 3M4CA 2YL3A 2XM0A 2XL8A 4WGZA 4CJGA 1YZAA 2XLWA 1EKYA 3TOLA 3C62A 2CCYA 4JEBA 3HNIA 2J8WA 5JUAA 5AGFA 1APCA 5JSLA 3QVYA 2YL1A 2YKZA 1LM3B 1CGOA 1MQVA 1RCPA 2XM4A 3DE8A 4JE9A 3M15A 3ZQYA 4NC3A 3NMJA 3ZWIA 5JLIA 4CDAA 5B3IA 3QW0A 4D4XA 3NMKA 4IAQA 2YL7A 3C63A 1BBHA 3TOMA 3FOPA 3M79A 1YYXA 3IQ5A 4JKVA 1CPRA 4N4WA 3IQ6A 3HNKA 5JRAA 1QPUA 2YL0A 2QLAA 4JEAA 1M6TA 5JVEA 3DE9A 2BC5A 3NMIA 4L6RA 5JS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CGN A;  3FOO A;  2YLD A;  1E84 A;  3M4B A;  3HNJ A;  4ER9 A;  1E86 A;  1NBB A;  3ZTZ A;  5JT4 A;  3QW1 A;  3U8P A;  256B A;  3VRC A;  2XLO A;  4ULV A;  4N6H A;  4CJO A;  2XLV A;  4CX9 A;  4EIY A;  3ZQV A;  2XLE A;  3ZTM A;  3L1M A;  1A7V A;  4IAR A;  4CDY A;  5JP7 A;  2J9B A;  1CPQ A;  4U9E A;  3QVZ A;  2XLM A;  4U9D A;  1JAF A;  1E83 A;  1GQA A;  1S05 A;  2XLD A;  4CDV A;  1E85 A;  2YLG A;  2XL6 A;  2YLI A;  3HNL A;  2XLH A;  4WGY A;  1YYJ A;  4D4N A;  1QQ3 A;  1YZC A;  4CIP A;  4IB4 A;  3M4C A;  2YL3 A;  2XM0 A;  2XL8 A;  4WGZ A;  4CJG A;  1YZA A;  2XLW A;  1EKY A;  3TOL A;  3C62 A;  2CCY A;  4JEB A;  3HNI A;  2J8W A;  5JUA A;  5AGF A;  1APC A;  5JSL A;  3QVY A;  2YL1 A;  2YKZ A;  1LM3 B;  1CGO A;  1MQV A;  1RCP A;  2XM4 A;  3DE8 A;  4JE9 A;  3M15 A;  3ZQY A;  4NC3 A;  3NMJ A;  3ZWI A;  5JLI A;  4CDA A;  5B3I A;  3QW0 A;  4D4X A;  3NMK A;  4IAQ A;  2YL7 A;  3C63 A;  1BBH A;  3TOM A;  3FOP A;  3M79 A;  1YYX A;  3IQ5 A;  4JKV A;  1CPR A;  4N4W A;  3IQ6 A;  3HNK A;  5JRA A;  1QPU A;  2YL0 A;  2QLA A;  4JEA A;  1M6T A;  5JVE A;  3DE9 A;  2BC5 A;  3NMI A;  4L6R A;  5JS5 A; 
#chains in the Genus database with same CATH topology
 3B29 A;  1CGN A;  2EIN C;  4J7Y A;  3HJC A;  1OKK D;  3JZ0 A;  1ZW2 A;  3GAN A;  1VB5 A;  2AU5 A;  3HNJ A;  5CIV A;  1JPN A;  3H65 A;  3WOD F;  4ER9 A;  3ZTZ A;  3Q7L A;  1PD1 A;  2C04 A;  2W4B A;  3DWW A;  4PJM A;  1ZU4 A;  3B0V C;  2UUI A;  1B68 A;  1OKK A;  2Y3G A;  3TQO A;  3ZDL A;  4K7B A;  1WAS A;  2ZXR A;  3AGT A;  4CSA C;  1M2V B;  4ULV A;  3NG1 A;  4P9T A;  4YL1 A;  2KJG A;  4XLN F;  1WTY A;  4YT8 A;  2PNO A;  3ZIB A;  3MYI A;  1A7V A;  2EIJ C;  5T3T A;  4IAR A;  2BE5 F;  1TWG A;  2NSF A;  4JRZ A;  3Q6M A;  5E3A A;  3MX3 A;  2E87 A;  1D1A A;  3JRT A;  2LQG A;  2LP4 A;  1RKE A;  3RF3 A;  5L0G A;  2P7V A;  2OEV A;  2XS1 A;  4HEA J;  1OCZ C;  1S05 A;  2XS8 A;  3VF0 A;  5B1B C;  2A0U A;  3RQE A;  5CI9 A;  4CDV A;  1E85 A;  4BEJ A;  2Q7R A;  1IW7 F;  3DKA A;  4MVM A;  4LAC B;  4C3D A;  3JSE O;  1LE2 A;  1CGM E;  2GFH A;  2HMZ A;  2OCC C;  3EQL F;  2X0C A;  3K33 A;  4XPW A;  4WGY A;  5A6K A;  3U9J A;  2EPO A;  5DLJ A;  3U9M A;  1PD0 A;  1YYJ A;  1OXK A;  3OEO A;  3U3F A;  4D4N A;  3C8G D;  2H7B A;  3RVY A;  1YZC A;  2DGJ A;  1BR4 A;  1WAT A;  5AC5 A;  5HV9 A;  4JTC B;  4CS9 A;  1OQC A;  4O79 A;  2KGO A;  4CIP A;  2I8B A;  1J8Y F;  1TFO B;  4JUR I;  3M4C A;  2YL3 A;  4LER A;  1NFN A;  1QVX A;  1KU2 A;  2EIM C;  2XL8 A;  1MMD A;  3EJN A;  4X0R A;  2R7X A;  3C8G A;  4OIP F;  1EKY A;  1VLS A;  1EQ1 A;  2WVO A;  2HMQ A;  4LDK A;  1K04 A;  5FCL A;  2NUP A;  2R7W A;  3MLG A;  3AQC A;  3L34 A;  3S90 A;  2CCY A;  2J9U A;  4Z9J A;  2DYS C;  4C3B A;  4MND A;  1RJ9 B;  3HNI A;  4KNW A;  4J7T A;  3F46 A;  2R03 A;  4NQF A;  5AGF A;  3I4U A;  4YN0 B;  5JSL A;  3QVY A;  2VB6 A;  3DAF A;  4GYT A;  3UMI A;  4DVZ A;  3HLZ A;  1LM3 B;  3OA1 A;  1CGO A;  1R5I D;  3RQG A;  3LNM B;  3RYL A;  3VAY A;  1SYQ A;  2R02 A;  4CS9 C;  1Q0G A;  2MYS A;  2PP4 A;  3EH1 A;  2OEX A;  4U5B E;  1FFT C;  3HTK C;  1FAP B;  3C7J A;  3SXM A;  2ICW G;  2ASR A;  2YHS A;  3GEI A;  1C17 M;  3S28 A;  1FR0 A;  2H8A A;  3W2V A;  5B3I A;  1YAR O;  3ABM C;  4IAQ A;  4MQ9 F;  1ORS C;  2HV6 A;  2PX0 A;  3MBG A;  4MVO A;  3DI5 A;  4QDL A;  3ZG1 A;  3U3B A;  5L0F A;  1GM5 A;  2A69 F;  2Q00 A;  4U5C E;  3FOP A;  2XXA A;  4OD4 A;  3CSK A;  3M79 A;  1YYX A;  3WG7 C;  2DYR C;  3IQ6 A;  2WVN A;  3KKB A;  3W4Y A;  3A9C A;  4Q4Z F;  2XL4 A;  5KYX B;  1TFK B;  1YLM A;  2R7U A;  1OCR C;  1XWJ A;  2Q9B A;  3PMR A;  5L0I A;  3EHM A;  1EI7 A;  3M1C B;  4H4K C;  1V74 B;  2YL0 A;  3B9Q A;  4JEA A;  1PV3 A;  1HY5 A;  2L6G A;  1M6T A;  2O9X A;  2R7Q A;  3KL4 A;  2R7T A;  1ZW3 A;  2BC5 A;  1T9K A;  3GOD A;  4MTO A;  1G8X A;  1KNY A;  2D5R B;  5KYW A;  3B71 A;  4JIO A;  1S7Z A;  1WN0 A;  2QTV A;  2CNW D;  1XZQ A;  1DOW A;  3O55 A;  2OOC A;  2Q4F A;  1EA8 A;  5D91 A;  1YVI A;  1FFH A;  1WGW A;  4ONS A;  3M4B A;  1E84 A;  3ABK C;  2GA0 A;  2HSB A;  2JPU A;  2OJE D;  4PFP A;  4XEF A;  3EGX B;  1YA9 A;  2NUP B;  4ANJ A;  3LUT B;  5KYU B;  2CNW A;  1E86 A;  1ZHY A;  3EG9 B;  5B3S C;  4YJW A;  2A1D D;  2EPL X;  5K0I A;  4ZLC A;  3N2Z B;  2A6E F;  1VTM P;  3O10 A;  1T6Q A;  4YL3 A;  3VRC A;  1JMW A;  2OG2 A;  2IYL D;  3VYW A;  3ZC4 A;  2Q9A A;  1ZVZ A;  3K1I A;  3IQT A;  2P61 A;  4CIH A;  2L9J A;  4LDR A;  4DVY P;  1TWA A;  2P1A A;  3L1M A;  3L8I A;  1RXQ A;  4Z9H A;  1OW6 A;  2G3K A;  3A11 A;  4CDY A;  4OIO F;  2AWC A;  2EPN A;  2IXO A;  3GM2 A;  4PAC A;  3T6B A;  4WJ0 A;  4AL0 A;  1Z5Z A;  1A0B A;  4N06 A;  3EFO B;  4I1O B;  1JAF A;  3RQF A;  4BJ6 A;  1E83 A;  5KYN A;  4NTA A;  1D0Z A;  1YAU O;  2YLG A;  4EWC A;  3SXY A;  2YLI A;  5L3Q A;  3SYN A;  2IXM A;  3EPV A;  4BJ5 C;  2XLH A;  1ZHW A;  2LIG A;  4G7H F;  1YDI A;  2XSE A;  3W8I A;  2LK4 A;  3K1I C;  4KC9 A;  4QI2 A;  3L0I A;  4CSA A;  1MNE A;  2EIK C;  1SZI A;  1V55 C;  1VOM A;  4C7O A;  2FGY A;  1Z23 A;  2W4M A;  2A68 F;  4IB4 A;  5E2Q A;  4FAP B;  2J0W A;  3BRJ A;  2Y39 A;  3AJM A;  3HKK A;  2HKV A;  3RVZ A;  3S84 A;  1H6G A;  4CJG A;  2L7A A;  1YZA A;  5DVW A;  1ZYR F;  3R2P A;  5DS6 A;  4BJ6 C;  2L6H A;  3G50 A;  2DI3 A;  3UR3 C;  1FMW A;  2HZ8 A;  1OW8 A;  3NYJ A;  4IJJ A;  4JJF A;  4EHP A;  5HSW A;  4LDQ A;  2KSF A;  3JCU Q;  3LNR A;  3QTH A;  4JEB A;  3B0P A;  3JYH A;  2J8W A;  1C02 A;  1PCX A;  1G4W R;  1APC A;  4EUK B;  4KBL A;  1WOL A;  1LKX A;  2OQM A;  3ZVR A;  3C8Z A;  1MQV A;  4MVR A;  2XM4 A;  3S0X A;  1OCO C;  3JT1 A;  3NRH A;  5TJ5 E;  2WVQ A;  3EHN A;  1U0B B;  2NUT B;  5GPG B;  2HS5 A;  3F47 A;  3M15 A;  3TUL A;  4ZLD A;  2L81 A;  1OR2 A;  1U6H A;  4BJT A;  1LE4 A;  2LCH A;  3H2U A;  1BR1 A;  1Q0F A;  3NMJ A;  1ZHT A;  2EIL C;  1FMV A;  3PCV A;  4E0I A;  2J7P D;  1O5H A;  5CI8 A;  3V5Y A;  2YVK A;  1TWH A;  2HFI A;  2KQ9 A;  2R7O A;  1LI7 A;  4PJN A;  4E0H A;  3DD7 A;  2CW0 F;  1LIH A;  1AEP A;  4J30 B;  4WAB A;  3ATP A;  1HE1 A;  4A4A A;  1VMA A;  3G4Z A;  2WL8 A;  2WB7 A;  2DB4 A;  1SMY F;  4A2N B;  1DOV A;  2J7P A;  3TK0 A;  1IZM A;  5DQZ A;  2IOQ A;  3ABL C;  4PJL A;  3T4R A;  1Z6A A;  2J45 A;  5F5F A;  3DMD A;  2J0X A;  4LLE A;  4XLP F;  3TJ6 A;  3EH2 A;  1LVK A;  4GEH A;  2PF4 E;  1QZX A;  3GEH A;  3NKE A;  4HFK B;  5A6A A;  4E7Z A;  4HE8 D;  3DM5 A;  1LPE A;  4JVS A;  5JRA A;  4U5G A;  3PHF 2;  3GEE A;  4XEV A;  4AL1 A;  5KYY A;  1NLX A;  1H9T A;  2PBE A;  5DS4 A;  4NY3 A;  3E9V A;  1Z7Q c;  2W45 A;  2V3C C;  2ETS A;  1O87 A;  2J46 A;  3DE9 A;  1TWC A;  1G5Z A;  2IXP A;  3KH2 A;  1V4A A;  1Q0D A;  1M2O A;  3EGD A;  3NMI A;  4L6R A;  1UFB A;  3W8H A;  4E17 A;  3MYF A;  3B0U X;  2HJ3 A;  2XRH A;  1C03 A;  3EZI A;  2YLD A;  3FOO A;  2R05 A;  5A6B D;  3AG4 C;  1VYI A;  3T6J A;  1RKE B;  2YWA A;  1FNT c;  1D1C A;  4OIN F;  3U8P A;  4AE4 A;  1BZ4 A;  3KPH A;  5A6B A;  1HW1 A;  3DM9 B;  2KC3 A;  256B A;  2NPU A;  3KYJ A;  4G78 A;  1SR2 A;  3GOR A;  1L7C A;  3DJU B;  3TJ5 A;  3I5P A;  3W2W A;  2P6V A;  2XLV A;  3AG1 C;  1MMG A;  5AC4 A;  3ZQV A;  2WZF A;  3KMI A;  2HUJ A;  4MVZ A;  2R7R A;  1K40 A;  3DAG A;  2B0J A;  3FDQ A;  2QUP A;  4NCQ A;  5JP7 A;  4XPX A;  3E70 C;  2J9V A;  2C03 A;  3K66 A;  2J9B A;  4CS7 A;  3U2M A;  1CPQ A;  5L0J A;  3J06 A;  1RKC A;  1MMN A;  3H2V A;  3QVZ A;  1HE9 A;  2XLM A;  1YJG A;  3LLI A;  3LS0 A;  3N0T A;  4U9D A;  3LEO A;  2ZXP A;  4U5D E;  1GGQ A;  1GQA A;  2M64 A;  3LJB A;  3C8G B;  2UUH A;  3LAY A;  4W8P A;  5IY5 C;  3DXJ F;  2XL6 A;  2Y3D A;  1H9G A;  1T5O A;  1M2V A;  4MS2 A;  4JZA A;  4NTB A;  5A6J A;  4CBE A;  3V5Z A;  2F22 A;  3SP1 A;  2GWW A;  2VCA A;  1FTS A;  2IBF A;  1KTM A;  1I5N A;  2A6H F;  2VC9 A;  5FZT A;  3C18 A;  3US6 A;  2GDC A;  1M57 C;  1OR3 A;  3JRM O;  1LI5 A;  1YA7 O;  3O39 A;  3U5S A;  1QQ3 A;  4BJ5 A;  2NSG A;  4KI2 A;  2JD3 A;  3JTL O;  3AG2 C;  1Q0K A;  2A0B A;  4F4B A;  5KYY B;  4YL0 A;  2CDQ A;  2H7V C;  2L6F A;  3NKD A;  4MW8 A;  4WGZ A;  3T6G B;  2ZXO A;  4MVU A;  3TD7 A;  4B6I A;  2P0N A;  3LEV A;  3G4X A;  4AX2 A;  3TOL A;  2R7V A;  4JCH A;  4LLC A;  1Y6D A;  5L0C A;  3C62 A;  4IRU A;  3FAP B;  5B1A C;  4DJ9 A;  4ULW A;  4JTD B;  5JUA A;  1U89 A;  3X1O A;  4DBR A;  3CQZ A;  3FAJ A;  2YKZ A;  1E2X A;  4XTK A;  4JW1 A;  1ZHZ A;  4OD5 A;  3RFY A;  4JCZ A;  4DRI B;  5BUO A;  1RCP A;  3DE8 A;  3POV A;  2XXA B;  3MFN A;  4GQH A;  3LS1 A;  3R7C A;  1L3P A;  1ST6 A;  4DXW A;  5L3V A;  3ZQY A;  3N24 A;  3O6X A;  2PX3 A;  2AWY A;  4W8K A;  4NC3 A;  4NTF A;  1K05 A;  1QLE C;  2JX0 A;  1LS1 A;  2V26 A;  4XEK A;  1SF8 A;  2OKU A;  4JTA B;  3UMK A;  2HJM A;  3GM1 A;  4QI0 A;  5L0H A;  5JLI A;  2KNH A;  2NG1 A;  1RJ9 A;  4CDA A;  2AVK A;  2AP3 A;  3AOU A;  1WWP A;  2RSE B;  2Y3H A;  3QW0 A;  4IAO A;  3SXZ A;  3UMH A;  1ZHX A;  3NMK A;  3C63 A;  1N1C A;  5KYW B;  1BBH A;  2Q3T A;  4MVQ A;  3TOM A;  4EBB A;  2PFD A;  2ZD9 A;  4U5E E;  1RMV A;  4RDA A;  4E7S A;  1CPR A;  4YT5 A;  4N4W A;  1NZE A;  3SXK A;  2VAS A;  5F5H A;  4G7Z F;  2HSQ A;  3K7D A;  1V54 C;  2YRF A;  3U8V A;  2QNL A;  3GWL A;  4U5H A;  3CEX A;  2KW3 C;  3HNK A;  1AVO B;  1GS9 A;  2G62 A;  1QPU A;  4UDV A;  4YT4 A;  1JR8 A;  2QLA A;  4R32 A;  1NFO A;  4DRJ B;  1H7I A;  1BR2 A;  4O7G A;  4Q5S F;  2IXN A;  3V7O A;  4MTF A;  4RBN A;  4E18 A;  3ITF A;  1I4Z A;  5BQI A;  5DS5 A;  1ZZP A;  3BEH A;  1VYK A;  5JS5 A;  3AGU A;  2KK1 A;  2CYD A;  2GAQ A;  4G7O F;  5COG A;  3WHN A;  4HFF B;  5KYX A;  1NBB A;  5JT4 A;  4G0H A;  3QW1 A;  5E33 A;  1QSP A;  1JRA A;  2FAP B;  2IM8 A;  4MTG A;  4MVS A;  3JSZ A;  3S9O A;  4MW3 A;  3ASN C;  1D1B A;  5T3W A;  4Q7C A;  1G4U S;  2XLO A;  4DRH B;  4JC7 A;  4CJO A;  2MHR A;  4N6H A;  4CX9 A;  1M56 C;  2EPM X;  2G3V A;  2OU6 A;  1MND A;  2X51 A;  2XLE A;  4Z9I A;  3ZTM A;  4EIY A;  1OCC C;  3Q6N A;  3LLK A;  4XPY A;  1W2W A;  4I1M A;  4XQ1 A;  3IPM O;  3V5X A;  4CS8 A;  3L8J A;  3AG3 C;  1T6U A;  4C7O B;  1T6I A;  3EGX A;  4M63 A;  4O6N A;  5KYU A;  4U9E A;  3EG9 A;  2H7O A;  4I3M A;  1AUE A;  3ASO C;  3WAQ A;  2YZS A;  2R9R B;  5L0D A;  1R4T A;  1JPJ A;  2XLD A;  3ECS A;  4H54 A;  3S27 A;  3NYL A;  2RD9 A;  3HNL A;  3NYM A;  3IHU A;  3FMS A;  4YWQ A;  2VCB A;  1NU9 C;  1Z63 A;  4O6Y A;  3LES A;  2MWQ A;  2YEV A;  1A7D A;  3OWT A;  2Z15 A;  5D92 A;  1ORY A;  1QKR A;  2Y69 C;  4EBJ A;  1LS4 A;  3QMK A;  4DOZ A;  4XWJ A;  1T01 A;  2YQY A;  4I44 A;  2M4E A;  4CS8 C;  4PFO A;  3EFO A;  3RW0 A;  1Z3I X;  2XM0 A;  2HV7 A;  5T1D B;  3EZH A;  3IQC A;  2XLW A;  3ZSU A;  1A7E A;  2LFF A;  2Y3B A;  3DZA A;  2R7S A;  2LSE A;  4O6M A;  1OXB A;  4FX5 A;  3RIP A;  4EKW A;  3T9O A;  3I5Q A;  4IGG A;  3RKO F;  4PJJ A;  4EBK A;  1VK5 A;  3AQB A;  4YK5 A;  2W9Y A;  3S29 A;  1Q0M A;  3DJN B;  5BQG A;  4OIQ F;  1UG7 A;  1XZP A;  2VH3 A;  1OW7 A;  2BL2 A;  3GM3 A;  2YL1 A;  1D0Y A;  1HW2 A;  4BEM J;  1HMD A;  1Y4C A;  1TKN A;  4FWV A;  4P6I C;  5E3C A;  3K6B A;  1VLT A;  3U0C A;  4JE9 A;  3SNH A;  2D4U A;  5EGY A;  1HMO A;  4AK9 A;  1J8M F;  2LD6 A;  4J32 B;  1NG1 A;  5A69 A;  3CZ6 A;  1TR2 A;  4PR9 A;  1ORJ A;  3FVY A;  3ZWI A;  1BDJ B;  2OJQ A;  2CGE A;  4PK4 A;  4DBQ A;  5COM A;  3RH3 A;  1A41 A;  3FHD A;  1JOG A;  3KYI A;  2FFH A;  4OIR F;  5DQT A;  3CAX A;  4K1O A;  4D4X A;  2I15 A;  2YL7 A;  2TMV P;  3EGD B;  1TQG A;  1I4Y A;  3IQ5 A;  4JKV A;  5EHH A;  2LFD A;  5COF A;  1D0X A;  3K1H A;  2NUT A;  3UNG C;  3SZR A;  2WZL A;  2ZPA A;  2QE9 A;  3U2L A;  3FXH A;  3VM6 A;  4BJ1 A;  3NDB B;  2ZXW C;  3QZC A;  5BQH A;  3PDM P;  2R25 A;  4AE4 B;  4RD9 A;  3SEO A;  3UGO A;  1MMA A;  4C3E A;  3JYY A;  3X2Q C;  2WZG A;  4IWB A;  4FES A;  2J9W A;  2QY9 A;  4P9F A;  2KYH A;  5EK0 A;  4YT2 A;  3UGP A;  3GWN A;  2EPK X;  5F28 E;  1O3U A;  4U5F E;  2B0H A;  4K0D A;  5JVE A;  4JJG A;  4N6C A;  3Q7G A;  1F1M A;  4BPM A;  1NSG B;  2Q9C A;  1NU7 D;  4BG0 A;  1ZU5 A;  4KNV A;  2VCC A;  3IEE A; 
#chains in the Genus database with same CATH homology
 1CGN A;  3FOO A;  2YLD A;  1E84 A;  3M4B A;  3HNJ A;  4ER9 A;  1E86 A;  1NBB A;  3ZTZ A;  5JT4 A;  3QW1 A;  3U8P A;  256B A;  3VRC A;  2XLO A;  4ULV A;  4N6H A;  4CJO A;  2XLV A;  4CX9 A;  4EIY A;  3ZQV A;  2XLE A;  3ZTM A;  3L1M A;  1A7V A;  4IAR A;  4CDY A;  5JP7 A;  2J9B A;  1CPQ A;  4U9E A;  3QVZ A;  2XLM A;  4U9D A;  1JAF A;  1E83 A;  1GQA A;  1S05 A;  2XLD A;  4CDV A;  1E85 A;  2YLG A;  2XL6 A;  2YLI A;  3HNL A;  2XLH A;  4WGY A;  1YYJ A;  4D4N A;  1QQ3 A;  1YZC A;  4CIP A;  4IB4 A;  3M4C A;  2YL3 A;  2XM0 A;  2XL8 A;  4WGZ A;  4CJG A;  1YZA A;  2XLW A;  1EKY A;  3TOL A;  3C62 A;  2CCY A;  4JEB A;  3HNI A;  2J8W A;  5JUA A;  5AGF A;  1APC A;  5JSL A;  3QVY A;  2YL1 A;  2YKZ A;  1LM3 B;  1CGO A;  1MQV A;  1RCP A;  2XM4 A;  3DE8 A;  4JE9 A;  3M15 A;  3ZQY A;  4NC3 A;  3NMJ A;  3ZWI A;  5JLI A;  4CDA A;  5B3I A;  3QW0 A;  4D4X A;  3NMK A;  4IAQ A;  2YL7 A;  3C63 A;  1BBH A;  3TOM A;  3FOP A;  3M79 A;  1YYX A;  3IQ5 A;  4JKV A;  1CPR A;  4N4W A;  3IQ6 A;  3HNK A;  5JRA A;  1QPU A;  2YL0 A;  2QLA A;  4JEA A;  1M6T A;  5JVE A;  3DE9 A;  2BC5 A;  3NMI A;  4L6R A;  5JS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...