3K1IA

Crystal strcture of flis-hp1076 complex in h. pylori
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
106
structure length
106
Chain Sequence
SPAKLIEMLYEGILRFSSQAKRCIENEDIEKKIYYINRVTDIFTELLNILDYEKGGEVAVYLTGLYTHQIKVLTQANVENDASKIDLVLNVARGLLEAWREIHSDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flagellar protein
publication title Molecular interaction of flagellar export chaperone FliS and cochaperone HP1076 in Helicobacter pylori
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Chaperone
total genus 46
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02561 FliS Flagellar protein FliS
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.340 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Flagellar protein FliS 3k1iA00
3IQCA 3K1IA 1SZIA 1ORYA 1ORJA
chains in the Genus database with same CATH superfamily
4HFKB 4ER9A 4KI2A 1QSPA 2WZGA 1ZHYA 1QQ3A 2R03A 3LEVA 3NG1A 4O6YA 1MNEA 2X51A 1PD1A 3S9OA 3UNGC 1TQGA 3K7DA 2OJED 4MVZA 3EGXA 3JYHA 2B0HA 3RW0A 1V4AA 4NQFA 5KYWB 1SMYF 1Z6AA 3DJUB 5TJ5E 3KYJA 4CS8A 3DM5A 1LI5A 3E9VA 2XL4A 3DAFA 2ZXPA 1YA7O 2FGYA 4EHPA 4JKVA 1S7ZA 4OD5A 1VYKA 2NUPA 1LPEA 2YHSA 2ETSA 3U9MA 2ZXOA 4I44A 2CNWD 4DOZA 3T6JA 4JC7A 5JT4A 2IXMA 1E85A 3G4XA 3SXZA 1K40A 1A7EA 5DQZA 3AG4C 4O79A 3S27A 1Q0KA 3ABLC 4JCZA 1A7VA 4OIPF 1C02A 2XS1A 1FFHA 1T01A 4PJLA 1GM5A 5JLIA 5CI9A 2FAPB 3FAPB 2PX3A 4G7HF 4Z9IA 5CIVA 3NYMA 3QTHA 2WZLA 4KNWA 2O9XA 4C3EA 2IYLD 1G4US 4J7TA 2ASRA 1M2VB 1C03A 3TJ6A 1UG7A 3AG3C 2R7TA 3GM2A 4H54A 4NY3A 1S05A 4ONSA 4BEMJ 5E33A 2R7RA 1K05A 4PACA 3SZRA 5KYWA 1ST6A 1XZQA 2DB4A 2DYSC 2OG2A 2OKUA 2EIJC 2P1AA 3C8GA 3EPVA 3HLZA 3NKEA 4G0HA 1OW6A 3VM6A 2R7XA 1NU7D 1HE1A 5L0HA 2Q9AA 1ZVZA 2HV6A 3WHNA 3RFYA 3DZAA 2HS5A 1VB5A 1CGOA 1MQVA 2CCYA 1WASA 3NMKA 3AQCA 4G78A 2R7VA 2A68F 4NTAA 4MS2A 3NRHA 2LFFA 2YL0A 1L3PA 2KYHA 3IQCA 4GEHA 4U5CE 3PMRA 4NTFA 3U3FA 3C62A 4JVSA 3TQOA 4BJTA 4CS9C 4E17A 4YL1A 3LLKA 1GQAA 5JP7A 1UFBA 2VCCA 1RXQA 4U5GA 2J46A 4Z9HA 5A6AA 1SZIA 3NKDA 3KMIA 4HEAJ 4LDQA 4PJMA 2R7SA 3DXJF 2R7QA 3MLGA 1FR0A 2HFIA 1U89A 4O6NA 5A6BA 2YL7A 1Y4CA 1M6TA 1RJ9B 2AP3A 2LP4A 2NG1A 2XS8A 2C04A 3GM3A 3SXKA 2H7VC 1LE2A 3O55A 3LS1A 2QY9A 3FXHA 2J8WA 2Z15A 4JJFA 2AWYA 4ULWA 2Q00A 5HV9A 2J7PA 3GEEA 1M2VA 3DMDA 4DJ9A 1U6HA 3U5SA 4NCQA 3MYIA 1RKEB 2YZSA 2F22A 3UMHA 1OKKD 1V55C 2KGOA 1OXBA 4M63A 3RVYA 1OW7A 2Y3BA 1CPRA 3ASNC 5T3WA 3EH1A 3RH3A 2BC5A 3DD7A 3RQFA 3RYLA 1WN0A 3B9QA 2H7OA 4LDKA 1E83A 2IBFA 5COGA 4OIOF 5COMA 2J9UA 1T9KA 4XWJA 1QVXA 4JIOA 2W4MA 4YJWA 2BL2A 3R7CA 2IOQA 3X1OA 4YWQA 1EKYA 5DS6A 2HMQA 1IW7F 1LS1A 3EGDB 3ZIBA 3LUTB 4U5BE 4Q4ZF 3B0VC 2W9YA 4AL0A 3VF0A 4DXWA 2M4EA 1YDIA 4C7OA 5JUAA 4FWVA 2PP4A 1ORJA 4H4KC 4YT8A 2A0BA 3Q7LA 3EG9B 4FAPB 3POVA 4CDAA 2HSQA 2XL8A 3W2VA 4EUKB 4WABA 1RMVA 4BJ5C 2NSGA 4PR9A 3VRCA 2EILC 4UDVA 1RJ9A 2EIKC 2V26A 2Y3HA 3K6BA 3S90A 1XZPA 2YKZA 2XXAB 4IAOA 4XLNF 4F4BA 4YT2A 4PJJA 2LFDA 4CIPA 3HNIA 3NDBB 5E3CA 4P6IC 3T6BA 1OR3A 3C8ZA 3L8JA 4CSAC 4BJ6A 1E86A 5AC5A 1BR4A 1RKEA 3V5ZA 2QUPA 3ABMC 1WOLA 5BQIA 2CDQA 2IM8A 1EQ1A 1IZMA 3TK0A 4ULVA 2NSFA 2HUJA 2OQMA 4MVQA 4E0HA 5KYUB 3FDQA 4Z9JA 2GAQA 3RQEA 1BBHA 2AWCA 3NMIA 3LNRA 2PFDA 1ZU5A 2PF4E 1HMOA 2RSEB 1HW2A 1MMNA 2GWWA 2W4BA 3KYIA 1V54C 1OXKA 1TKNA 4MTOA 5E3AA 2A69F 3V5YA 1LIHA 3DE8A 3EGDA 3C7JA 4IWBA 4OINF 5B1AC 4A4AA 2JPUA 1TFOB 1D0YA 4JTCB 2CW0F 4XPWA 1NU9C 2LD6A 3FOOA 1PCXA 1U0BB 5IY5C 3GEIA 4JJGA 2JX0A 1ZU4A 3KKBA 1J8YF 3EG9A 1JMWA 3RQGA 1FMVA 2ZD9A 3OA1A 3DJNB 3C8GB 4KBLA 4OIRF 2R7UA 2OEXA 2NPUA 2Y3DA 1Q0DA 1KU2A 1TWGA 1K04A 3K33A 3A9CA 3AJMA 3H2UA 2XXAA 4DBRA 3HJCA 4C3DA 4N6CA 5JVEA 3ABKC 3CEXA 3Q6MA 2EINC 3JSZA 3HNJA 3J06A 3WODF 2XL6A 1JOGA 3KH2A 3PCVA 5L3QA 1Q0MA 3MYFA 2ICWG 3SP1A 3K66A 1JPNA 2PX0A 3GANA 3O10A 4IARA 3M4BA 2M64A 5KYUA 3MFNA 2UUHA 2KW3C 3M1CB 3WAQA 4DRIB 4BJ1A 1NBBA 3S84A 1OCZC 3HTKC 4PK4A 3U2LA 1TR2A 3ZTZA 2R9RB 2H7BA 3HNLA 2V3CC 4K7BA 1EI7A 1J8MF 3K1IC 4MVSA 1XWJA 3LNMB 1VOMA 4U9DA 2YLIA 2KQ9A 4JRZA 4E7ZA 1QZXA 3GEHA 1M56C 3W2WA 4W8KA 4CBEA 4QDLA 2XM4A 4QI0A 4MW8A 3TULA 2Y39A 4ANJA 4IB4A 2LK4A 2X0CA 2LIGA 1T5OA 3ECSA 3JT1A 4YK5A 1NFOA 5B3SC 4GYTA 1QLEC 4MTGA 1YZAA 3U9JA 2ZXWC 1FNTc 1OCRC 4FESA 1VMAA 3FVYA 2XLVA 1D0XA 3JSEO 3CAXA 4YL3A 4C3BA 3U8VA 5JSLA 3US6A 3FOPA 1OR2A 2CNWA 3GWLA 1DOWA 1YAUO 2HKVA 3QMKA 1G4WR 4GQHA 2IXOA 3M4CA 2NUTB 1G8XA 3K1HA 4R32A 4XTKA 4C7OB 1AVOB 1TWHA 1Z63A 4JW1A 3IPMO 4AE4B 5F5HA 4DBQA 4DRJB 4DVYP 5EK0A 1YYXA 4LLEA 2WVOA 3ASOC 4EBJA 2YLGA 1H9GA 1ZZPA 4MW3A 4MVMA 4XEVA 3CSKA 1ZHZA 4WJ0A 256BA 4QI2A 1G5ZA 2D4UA 1LVKA 1SR2A 1Z23A 3S28A 3LLIA 4D4NA 2YWAA 2VB6A 2YLDA 4JE9A 1CGME 3AGUA 4JEBA 3JZ0A 4JEAA 3HKKA 3SEOA 3UMIA 4B6IA 4DVZA 5D91A 3LAYA 2J9BA 2EPLX 4XPYA 1NZEA 2EPMX 1HMDA 2IXPA 1SYQA 2R05A 4WGZA 5L0CA 2R25A 2EPKX 2KC3A 2AVKA 1WATA 1BZ4A 3EZIA 4BG0A 2Q4FA 2H8AA 2YRFA 3ZWIA 4N4WA 2KK1A 4IJJA 2WVQA 3U8PA 2XLHA 3RVZA 1HE9A 3KPHA 1AEPA 2NUTA 4RDAA 3G4ZA 3QZCA 5DVWA 5KYXB 2Q3TA 4JCHA 2YL1A 2WVNA 4AE4A 3PHF2 2P6VA 4O7GA 4CDVA 2QTVA 4X0RA 2Q9CA 5A6JA 1OQCA 3KL4A 3ZQVA 2LCHA 3TJ5A 1FMWA 1FTSA 4BEJA 2QNLA 3SYNA 1D1BA 3QVZA 2A6HF 2OJQA 2CGEA 3DAGA 3JYYA 3LEOA 2J0XA 3OEOA 1WWPA 4CJOA 2R02A 1C17M 4MVRA 3T9OA 2C03A 4BJ5A 1MMAA 4OIQF 3N0TA 2R7WA 4EWCA 3W4YA 3O39A 1BDJB 5FCLA 4I1MA 3DI5A 1LKXA 4Q5SF 3X2QC 2YVKA 2P7VA 2JD3A 3DE9A 3L8IA 4KNVA 4XEFA 3H65A 3EH2A 4A2NB 3EQLF 5KYYB 2L6FA 3F47A 4J32B 5EHHA 3ZSUA 1OKKA 3GODA 1YZCA 2XLDA 4CSAA 1TWAA 4PJNA 3C18A 4XEKA 1A41A 3AG1C 1YLMA 4CDYA 2WL8A 3TD7A 5L0GA 1ZHWA 2HZ8A 1LI7A 3GWNA 4U9EA 3BEHA 3UGPA 2BE5F 2P0NA 1E84A 4PFOA 2R7OA 5KYXA 5L0IA 1NLXA 2I8BA 2P61A 3MX3A 4AL1A 2HMZA 2UUIA 3UR3C 3V5XA 2L6GA 4FX5A 4YL0A 4LERA 1LM3B 1L7CA 1NSGB 3ZVRA 4ZLCA 3B0UX 3JTLO 2A1DD 1A7DA 4EBKA 3OWTA 2J45A 3FHDA 3TOLA 4U5EE 4G7OF 1FFTC 1D0ZA 4CS8C 4U5DE 2MWQA 2HJ3A 1Z5ZA 3IQ5A 5L0JA 4D4XA 4J7YA 1O87A 4K0DA 3C8GD 1RKCA 1Y6DA 5A6KA 3R2PA 4CJGA 4WGYA 2KNHA 5KYYA 2D5RB 2J9VA 1T6IA 2RD9A 3W8HA 1YJGA 2KSFA 3LESA 5GPGB 5HSWA 4CIHA 1W2WA 3M15A 4HE8D 1PD0A 1QKRA 3SNHA 1ZW2A 3B0PA 1LE4A 2VH3A 2ZPAA 3VYWA 2OU6A 1R4TA 4MVUA 1MMDA 5DLJA 1N1CA 4YN0B 4XQ1A 3RIPA 1GS9A 3IEEA 3B71A 4AX2A 4P9TA 2L7AA 2GFHA 4NTBA 1RCPA 1JR8A 5E2QA 1I5NA 1M2OA 1ZW3A 3BRJA 3A11A 3JRTA 5D92A 3EFOB 4JTDB 3B29A 3CQZA 2I15A 3K1IA 5A6BD 5F28E 1Q0GA 4U5HA 3QW0A 4U5FE 2MHRA 1BR1A 1GGQA 3EJNA 2A6EF 3GM1A 3LS0A 1OCOC 1O3UA 3O6XA 3NMJA 4MTFA 2CYDA 2EIMC 5L3VA 2J7PD 1YA9A 5AC4A 5L0FA 3JRMO 1I4YA 3TOMA 3L34A 2DI3A 4XPXA 1V74B 3IQ6A 4K1OA 4PFPA 2OOCA 1JRAA 2L9JA 2VASA 2GDCA 4RD9A 4DRHB 2EPNA 1F1MA 2VCAA 3DKAA 3ZC4A 3FAJA 4RBNA 5K0IA 2IXNA 1OW8A 2XSEA 4MQ9F 4E18A 1CGNA 1T6UA 1WTYA 2PBEA 3L0IA 3VAYA 1APCA 4LDRA 5FZTA 4CS9A 5JS5A 3U0CA 1I4ZA 2TMVP 2Y3GA 3JCUQ 4NC3A 4JTAB 5BQHA 2QLAA 3N2ZB 3QVYA 3H2VA 2W45A 3S29A 3T6GB 3I5QA 4ZLDA 2DYRC 2XM0A 3NYJA 1EA8A 2OCCC 2E87A 2L6HA 4IRUA 3ATPA 4JZAA 1MNDA 1E2XA 4MNDA 3EFOA 4MVOA 2MYSA 5L0DA 2YL3A 3M79A 4EIYA 4EKWA 4G7ZF 4P9FA 3RF3A 4W8PA 2GA0A 1YARO 1Z3IX 1AUEA 1NFNA 4I1OB 5BQGA 4YT4A 1Z7Qc 2G3VA 3IHUA 4KC9A 2YQYA 5B1BC 2LSEA 3CZ6A 1ZHXA 2AU5A 3HNKA 3MBGA 2PNOA 2HSBA 1ZYRF 1PV3A 2KJGA 4JURI 4N6HA 4OD4A 3EHNA 1B68A 2B0JA 2HV7A 5BUOA 2VCBA 3LJBA 3SXMA 3Q6NA 1H7IA 3DWWA 2EPOA 3I5PA 4J30B 5COFA 4EBBA 3PDMP 4AK9A 4CX9A 1DOVA 2XLEA 2YEVA 2Q7RA 5KYNA 3UMKA 3ZTMA 1VK5A 4E0IA 2OEVA 3V7OA 3AQBA 4BPMA 5DQTA 5A69A 2XLMA 1YVIA 2G62A 2HJMA 2XRHA 3EHMA 3AOUA 3QW1A 4IGGA 3ZQYA 1H9TA 5CI8A 1SF8A 2XLOA 2WB7A 4L6RA 4YT5A 1H6GA 1OCCC 3RKOF 2XLWA 3ZG1A 5B3IA 5T1DB 3NYLA 3AG2C 2J0WA 1Q0FA 1HY5A 3FMSA 3WG7C 4O6MA 3UGOA 1TWCA 3N24A 3U3BA 5F5FA 3SXYA 1BR2A 3T4RA 5DS4A 3ITFA 1VLTA 2Y69C 5AGFA 4CS7A 3EGXB 3I4UA 1TFKB 1D1CA 3C63A 3U2MA 3ZDLA 1R5ID 4BJ6C 2LQGA 2VC9A 1VYIA 3W8IA 1VLSA 1A0BA 1ORYA 1KTMA 4E7SA 1ORSC 3L1MA 1VTMP 1NG1A 1JAFA 2A0UA 4IAQA 1FAPB 2NUPB 2J9WA 1WGWA 1ZHTA 4I3MA 1O5HA 4Q7CA 1LS4A 2Q9BA 1D1AA 3AGTA 3Q7GA 2ZXRA 4LACB 5DS5A 2L81A 1CPQA 2DGJA 5T3TA 1M57C 2WZFA 3F46A 3GORA 1MMGA 1KNYA 3E70C 2QE9A 1JPJA 3EZHA 4N06A 1YYJA 4LLCA 5JRAA 2FFHA 3S0XA 1QPUA 3DM9B 5EGYA 4XLPF 1T6QA 4HFFB 2G3KA 1HW1A 3G50A 3IQTA
chains in the Genus database with same CATH topology
3IQCA 3K1IA 1SZIA 1ORYA 1ORJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IQC A;  3K1I A;  1SZI A;  1ORY A;  1ORJ A; 
#chains in the Genus database with same CATH topology
 4HFK B;  4ER9 A;  4KI2 A;  1QSP A;  2WZG A;  1ZHY A;  1QQ3 A;  2R03 A;  3LEV A;  3NG1 A;  4O6Y A;  1MNE A;  2X51 A;  1PD1 A;  3S9O A;  3UNG C;  1TQG A;  3K7D A;  2OJE D;  4MVZ A;  3EGX A;  3JYH A;  2B0H A;  3RW0 A;  1V4A A;  4NQF A;  5KYW B;  1SMY F;  1Z6A A;  3DJU B;  5TJ5 E;  3KYJ A;  4CS8 A;  3DM5 A;  1LI5 A;  3E9V A;  2XL4 A;  3DAF A;  2ZXP A;  1YA7 O;  2FGY A;  4EHP A;  4JKV A;  1S7Z A;  4OD5 A;  1VYK A;  2NUP A;  1LPE A;  2YHS A;  2ETS A;  3U9M A;  2ZXO A;  4I44 A;  2CNW D;  4DOZ A;  3T6J A;  4JC7 A;  5JT4 A;  2IXM A;  1E85 A;  3G4X A;  3SXZ A;  1K40 A;  1A7E A;  5DQZ A;  3AG4 C;  4O79 A;  3S27 A;  1Q0K A;  3ABL C;  4JCZ A;  1A7V A;  4OIP F;  1C02 A;  2XS1 A;  1FFH A;  1T01 A;  4PJL A;  1GM5 A;  5JLI A;  5CI9 A;  2FAP B;  3FAP B;  2PX3 A;  4G7H F;  4Z9I A;  5CIV A;  3NYM A;  3QTH A;  2WZL A;  4KNW A;  2O9X A;  4C3E A;  2IYL D;  1G4U S;  4J7T A;  2ASR A;  1M2V B;  1C03 A;  3TJ6 A;  1UG7 A;  3AG3 C;  2R7T A;  3GM2 A;  4H54 A;  4NY3 A;  1S05 A;  4ONS A;  4BEM J;  5E33 A;  2R7R A;  1K05 A;  4PAC A;  3SZR A;  5KYW A;  1ST6 A;  1XZQ A;  2DB4 A;  2DYS C;  2OG2 A;  2OKU A;  2EIJ C;  2P1A A;  3C8G A;  3EPV A;  3HLZ A;  3NKE A;  4G0H A;  1OW6 A;  3VM6 A;  2R7X A;  1NU7 D;  1HE1 A;  5L0H A;  2Q9A A;  1ZVZ A;  2HV6 A;  3WHN A;  3RFY A;  3DZA A;  2HS5 A;  1VB5 A;  1CGO A;  1MQV A;  2CCY A;  1WAS A;  3NMK A;  3AQC A;  4G78 A;  2R7V A;  2A68 F;  4NTA A;  4MS2 A;  3NRH A;  2LFF A;  2YL0 A;  1L3P A;  2KYH A;  3IQC A;  4GEH A;  4U5C E;  3PMR A;  4NTF A;  3U3F A;  3C62 A;  4JVS A;  3TQO A;  4BJT A;  4CS9 C;  4E17 A;  4YL1 A;  3LLK A;  1GQA A;  5JP7 A;  1UFB A;  2VCC A;  1RXQ A;  4U5G A;  2J46 A;  4Z9H A;  5A6A A;  1SZI A;  3NKD A;  3KMI A;  4HEA J;  4LDQ A;  4PJM A;  2R7S A;  3DXJ F;  2R7Q A;  3MLG A;  1FR0 A;  2HFI A;  1U89 A;  4O6N A;  5A6B A;  2YL7 A;  1Y4C A;  1M6T A;  1RJ9 B;  2AP3 A;  2LP4 A;  2NG1 A;  2XS8 A;  2C04 A;  3GM3 A;  3SXK A;  2H7V C;  1LE2 A;  3O55 A;  3LS1 A;  2QY9 A;  3FXH A;  2J8W A;  2Z15 A;  4JJF A;  2AWY A;  4ULW A;  2Q00 A;  5HV9 A;  2J7P A;  3GEE A;  1M2V A;  3DMD A;  4DJ9 A;  1U6H A;  3U5S A;  4NCQ A;  3MYI A;  1RKE B;  2YZS A;  2F22 A;  3UMH A;  1OKK D;  1V55 C;  2KGO A;  1OXB A;  4M63 A;  3RVY A;  1OW7 A;  2Y3B A;  1CPR A;  3ASN C;  5T3W A;  3EH1 A;  3RH3 A;  2BC5 A;  3DD7 A;  3RQF A;  3RYL A;  1WN0 A;  3B9Q A;  2H7O A;  4LDK A;  1E83 A;  2IBF A;  5COG A;  4OIO F;  5COM A;  2J9U A;  1T9K A;  4XWJ A;  1QVX A;  4JIO A;  2W4M A;  4YJW A;  2BL2 A;  3R7C A;  2IOQ A;  3X1O A;  4YWQ A;  1EKY A;  5DS6 A;  2HMQ A;  1IW7 F;  1LS1 A;  3EGD B;  3ZIB A;  3LUT B;  4U5B E;  4Q4Z F;  3B0V C;  2W9Y A;  4AL0 A;  3VF0 A;  4DXW A;  2M4E A;  1YDI A;  4C7O A;  5JUA A;  4FWV A;  2PP4 A;  1ORJ A;  4H4K C;  4YT8 A;  2A0B A;  3Q7L A;  3EG9 B;  4FAP B;  3POV A;  4CDA A;  2HSQ A;  2XL8 A;  3W2V A;  4EUK B;  4WAB A;  1RMV A;  4BJ5 C;  2NSG A;  4PR9 A;  3VRC A;  2EIL C;  4UDV A;  1RJ9 A;  2EIK C;  2V26 A;  2Y3H A;  3K6B A;  3S90 A;  1XZP A;  2YKZ A;  2XXA B;  4IAO A;  4XLN F;  4F4B A;  4YT2 A;  4PJJ A;  2LFD A;  4CIP A;  3HNI A;  3NDB B;  5E3C A;  4P6I C;  3T6B A;  1OR3 A;  3C8Z A;  3L8J A;  4CSA C;  4BJ6 A;  1E86 A;  5AC5 A;  1BR4 A;  1RKE A;  3V5Z A;  2QUP A;  3ABM C;  1WOL A;  5BQI A;  2CDQ A;  2IM8 A;  1EQ1 A;  1IZM A;  3TK0 A;  4ULV A;  2NSF A;  2HUJ A;  2OQM A;  4MVQ A;  4E0H A;  5KYU B;  3FDQ A;  4Z9J A;  2GAQ A;  3RQE A;  1BBH A;  2AWC A;  3NMI A;  3LNR A;  2PFD A;  1ZU5 A;  2PF4 E;  1HMO A;  2RSE B;  1HW2 A;  1MMN A;  2GWW A;  2W4B A;  3KYI A;  1V54 C;  1OXK A;  1TKN A;  4MTO A;  5E3A A;  2A69 F;  3V5Y A;  1LIH A;  3DE8 A;  3EGD A;  3C7J A;  4IWB A;  4OIN F;  5B1A C;  4A4A A;  2JPU A;  1TFO B;  1D0Y A;  4JTC B;  2CW0 F;  4XPW A;  1NU9 C;  2LD6 A;  3FOO A;  1PCX A;  1U0B B;  5IY5 C;  3GEI A;  4JJG A;  2JX0 A;  1ZU4 A;  3KKB A;  1J8Y F;  3EG9 A;  1JMW A;  3RQG A;  1FMV A;  2ZD9 A;  3OA1 A;  3DJN B;  3C8G B;  4KBL A;  4OIR F;  2R7U A;  2OEX A;  2NPU A;  2Y3D A;  1Q0D A;  1KU2 A;  1TWG A;  1K04 A;  3K33 A;  3A9C A;  3AJM A;  3H2U A;  2XXA A;  4DBR A;  3HJC A;  4C3D A;  4N6C A;  5JVE A;  3ABK C;  3CEX A;  3Q6M A;  2EIN C;  3JSZ A;  3HNJ A;  3J06 A;  3WOD F;  2XL6 A;  1JOG A;  3KH2 A;  3PCV A;  5L3Q A;  1Q0M A;  3MYF A;  2ICW G;  3SP1 A;  3K66 A;  1JPN A;  2PX0 A;  3GAN A;  3O10 A;  4IAR A;  3M4B A;  2M64 A;  5KYU A;  3MFN A;  2UUH A;  2KW3 C;  3M1C B;  3WAQ A;  4DRI B;  4BJ1 A;  1NBB A;  3S84 A;  1OCZ C;  3HTK C;  4PK4 A;  3U2L A;  1TR2 A;  3ZTZ A;  2R9R B;  2H7B A;  3HNL A;  2V3C C;  4K7B A;  1EI7 A;  1J8M F;  3K1I C;  4MVS A;  1XWJ A;  3LNM B;  1VOM A;  4U9D A;  2YLI A;  2KQ9 A;  4JRZ A;  4E7Z A;  1QZX A;  3GEH A;  1M56 C;  3W2W A;  4W8K A;  4CBE A;  4QDL A;  2XM4 A;  4QI0 A;  4MW8 A;  3TUL A;  2Y39 A;  4ANJ A;  4IB4 A;  2LK4 A;  2X0C A;  2LIG A;  1T5O A;  3ECS A;  3JT1 A;  4YK5 A;  1NFO A;  5B3S C;  4GYT A;  1QLE C;  4MTG A;  1YZA A;  3U9J A;  2ZXW C;  1FNT c;  1OCR C;  4FES A;  1VMA A;  3FVY A;  2XLV A;  1D0X A;  3JSE O;  3CAX A;  4YL3 A;  4C3B A;  3U8V A;  5JSL A;  3US6 A;  3FOP A;  1OR2 A;  2CNW A;  3GWL A;  1DOW A;  1YAU O;  2HKV A;  3QMK A;  1G4W R;  4GQH A;  2IXO A;  3M4C A;  2NUT B;  1G8X A;  3K1H A;  4R32 A;  4XTK A;  4C7O B;  1AVO B;  1TWH A;  1Z63 A;  4JW1 A;  3IPM O;  4AE4 B;  5F5H A;  4DBQ A;  4DRJ B;  4DVY P;  5EK0 A;  1YYX A;  4LLE A;  2WVO A;  3ASO C;  4EBJ A;  2YLG A;  1H9G A;  1ZZP A;  4MW3 A;  4MVM A;  4XEV A;  3CSK A;  1ZHZ A;  4WJ0 A;  256B A;  4QI2 A;  1G5Z A;  2D4U A;  1LVK A;  1SR2 A;  1Z23 A;  3S28 A;  3LLI A;  4D4N A;  2YWA A;  2VB6 A;  2YLD A;  4JE9 A;  1CGM E;  3AGU A;  4JEB A;  3JZ0 A;  4JEA A;  3HKK A;  3SEO A;  3UMI A;  4B6I A;  4DVZ A;  5D91 A;  3LAY A;  2J9B A;  2EPL X;  4XPY A;  1NZE A;  2EPM X;  1HMD A;  2IXP A;  1SYQ A;  2R05 A;  4WGZ A;  5L0C A;  2R25 A;  2EPK X;  2KC3 A;  2AVK A;  1WAT A;  1BZ4 A;  3EZI A;  4BG0 A;  2Q4F A;  2H8A A;  2YRF A;  3ZWI A;  4N4W A;  2KK1 A;  4IJJ A;  2WVQ A;  3U8P A;  2XLH A;  3RVZ A;  1HE9 A;  3KPH A;  1AEP A;  2NUT A;  4RDA A;  3G4Z A;  3QZC A;  5DVW A;  5KYX B;  2Q3T A;  4JCH A;  2YL1 A;  2WVN A;  4AE4 A;  3PHF 2;  2P6V A;  4O7G A;  4CDV A;  2QTV A;  4X0R A;  2Q9C A;  5A6J A;  1OQC A;  3KL4 A;  3ZQV A;  2LCH A;  3TJ5 A;  1FMW A;  1FTS A;  4BEJ A;  2QNL A;  3SYN A;  1D1B A;  3QVZ A;  2A6H F;  2OJQ A;  2CGE A;  3DAG A;  3JYY A;  3LEO A;  2J0X A;  3OEO A;  1WWP A;  4CJO A;  2R02 A;  1C17 M;  4MVR A;  3T9O A;  2C03 A;  4BJ5 A;  1MMA A;  4OIQ F;  3N0T A;  2R7W A;  4EWC A;  3W4Y A;  3O39 A;  1BDJ B;  5FCL A;  4I1M A;  3DI5 A;  1LKX A;  4Q5S F;  3X2Q C;  2YVK A;  2P7V A;  2JD3 A;  3DE9 A;  3L8I A;  4KNV A;  4XEF A;  3H65 A;  3EH2 A;  4A2N B;  3EQL F;  5KYY B;  2L6F A;  3F47 A;  4J32 B;  5EHH A;  3ZSU A;  1OKK A;  3GOD A;  1YZC A;  2XLD A;  4CSA A;  1TWA A;  4PJN A;  3C18 A;  4XEK A;  1A41 A;  3AG1 C;  1YLM A;  4CDY A;  2WL8 A;  3TD7 A;  5L0G A;  1ZHW A;  2HZ8 A;  1LI7 A;  3GWN A;  4U9E A;  3BEH A;  3UGP A;  2BE5 F;  2P0N A;  1E84 A;  4PFO A;  2R7O A;  5KYX A;  5L0I A;  1NLX A;  2I8B A;  2P61 A;  3MX3 A;  4AL1 A;  2HMZ A;  2UUI A;  3UR3 C;  3V5X A;  2L6G A;  4FX5 A;  4YL0 A;  4LER A;  1LM3 B;  1L7C A;  1NSG B;  3ZVR A;  4ZLC A;  3B0U X;  3JTL O;  2A1D D;  1A7D A;  4EBK A;  3OWT A;  2J45 A;  3FHD A;  3TOL A;  4U5E E;  4G7O F;  1FFT C;  1D0Z A;  4CS8 C;  4U5D E;  2MWQ A;  2HJ3 A;  1Z5Z A;  3IQ5 A;  5L0J A;  4D4X A;  4J7Y A;  1O87 A;  4K0D A;  3C8G D;  1RKC A;  1Y6D A;  5A6K A;  3R2P A;  4CJG A;  4WGY A;  2KNH A;  5KYY A;  2D5R B;  2J9V A;  1T6I A;  2RD9 A;  3W8H A;  1YJG A;  2KSF A;  3LES A;  5GPG B;  5HSW A;  4CIH A;  1W2W A;  3M15 A;  4HE8 D;  1PD0 A;  1QKR A;  3SNH A;  1ZW2 A;  3B0P A;  1LE4 A;  2VH3 A;  2ZPA A;  3VYW A;  2OU6 A;  1R4T A;  4MVU A;  1MMD A;  5DLJ A;  1N1C A;  4YN0 B;  4XQ1 A;  3RIP A;  1GS9 A;  3IEE A;  3B71 A;  4AX2 A;  4P9T A;  2L7A A;  2GFH A;  4NTB A;  1RCP A;  1JR8 A;  5E2Q A;  1I5N A;  1M2O A;  1ZW3 A;  3BRJ A;  3A11 A;  3JRT A;  5D92 A;  3EFO B;  4JTD B;  3B29 A;  3CQZ A;  2I15 A;  3K1I A;  5A6B D;  5F28 E;  1Q0G A;  4U5H A;  3QW0 A;  4U5F E;  2MHR A;  1BR1 A;  1GGQ A;  3EJN A;  2A6E F;  3GM1 A;  3LS0 A;  1OCO C;  1O3U A;  3O6X A;  3NMJ A;  4MTF A;  2CYD A;  2EIM C;  5L3V A;  2J7P D;  1YA9 A;  5AC4 A;  5L0F A;  3JRM O;  1I4Y A;  3TOM A;  3L34 A;  2DI3 A;  4XPX A;  1V74 B;  3IQ6 A;  4K1O A;  4PFP A;  2OOC A;  1JRA A;  2L9J A;  2VAS A;  2GDC A;  4RD9 A;  4DRH B;  2EPN A;  1F1M A;  2VCA A;  3DKA A;  3ZC4 A;  3FAJ A;  4RBN A;  5K0I A;  2IXN A;  1OW8 A;  2XSE A;  4MQ9 F;  4E18 A;  1CGN A;  1T6U A;  1WTY A;  2PBE A;  3L0I A;  3VAY A;  1APC A;  4LDR A;  5FZT A;  4CS9 A;  5JS5 A;  3U0C A;  1I4Z A;  2TMV P;  2Y3G A;  3JCU Q;  4NC3 A;  4JTA B;  5BQH A;  2QLA A;  3N2Z B;  3QVY A;  3H2V A;  2W45 A;  3S29 A;  3T6G B;  3I5Q A;  4ZLD A;  2DYR C;  2XM0 A;  3NYJ A;  1EA8 A;  2OCC C;  2E87 A;  2L6H A;  4IRU A;  3ATP A;  4JZA A;  1MND A;  1E2X A;  4MND A;  3EFO A;  4MVO A;  2MYS A;  5L0D A;  2YL3 A;  3M79 A;  4EIY A;  4EKW A;  4G7Z F;  4P9F A;  3RF3 A;  4W8P A;  2GA0 A;  1YAR O;  1Z3I X;  1AUE A;  1NFN A;  4I1O B;  5BQG A;  4YT4 A;  1Z7Q c;  2G3V A;  3IHU A;  4KC9 A;  2YQY A;  5B1B C;  2LSE A;  3CZ6 A;  1ZHX A;  2AU5 A;  3HNK A;  3MBG A;  2PNO A;  2HSB A;  1ZYR F;  1PV3 A;  2KJG A;  4JUR I;  4N6H A;  4OD4 A;  3EHN A;  1B68 A;  2B0J A;  2HV7 A;  5BUO A;  2VCB A;  3LJB A;  3SXM A;  3Q6N A;  1H7I A;  3DWW A;  2EPO A;  3I5P A;  4J30 B;  5COF A;  4EBB A;  3PDM P;  4AK9 A;  4CX9 A;  1DOV A;  2XLE A;  2YEV A;  2Q7R A;  5KYN A;  3UMK A;  3ZTM A;  1VK5 A;  4E0I A;  2OEV A;  3V7O A;  3AQB A;  4BPM A;  5DQT A;  5A69 A;  2XLM A;  1YVI A;  2G62 A;  2HJM A;  2XRH A;  3EHM A;  3AOU A;  3QW1 A;  4IGG A;  3ZQY A;  1H9T A;  5CI8 A;  1SF8 A;  2XLO A;  2WB7 A;  4L6R A;  4YT5 A;  1H6G A;  1OCC C;  3RKO F;  2XLW A;  3ZG1 A;  5B3I A;  5T1D B;  3NYL A;  3AG2 C;  2J0W A;  1Q0F A;  1HY5 A;  3FMS A;  3WG7 C;  4O6M A;  3UGO A;  1TWC A;  3N24 A;  3U3B A;  5F5F A;  3SXY A;  1BR2 A;  3T4R A;  5DS4 A;  3ITF A;  1VLT A;  2Y69 C;  5AGF A;  4CS7 A;  3EGX B;  3I4U A;  1TFK B;  1D1C A;  3C63 A;  3U2M A;  3ZDL A;  1R5I D;  4BJ6 C;  2LQG A;  2VC9 A;  1VYI A;  3W8I A;  1VLS A;  1A0B A;  1ORY A;  1KTM A;  4E7S A;  1ORS C;  3L1M A;  1VTM P;  1NG1 A;  1JAF A;  2A0U A;  4IAQ A;  1FAP B;  2NUP B;  2J9W A;  1WGW A;  1ZHT A;  4I3M A;  1O5H A;  4Q7C A;  1LS4 A;  2Q9B A;  1D1A A;  3AGT A;  3Q7G A;  2ZXR A;  4LAC B;  5DS5 A;  2L81 A;  1CPQ A;  2DGJ A;  5T3T A;  1M57 C;  2WZF A;  3F46 A;  3GOR A;  1MMG A;  1KNY A;  3E70 C;  2QE9 A;  1JPJ A;  3EZH A;  4N06 A;  1YYJ A;  4LLC A;  5JRA A;  2FFH A;  3S0X A;  1QPU A;  3DM9 B;  5EGY A;  4XLP F;  1T6Q A;  4HFF B;  2G3K A;  1HW1 A;  3G50 A;  3IQT A; 
#chains in the Genus database with same CATH homology
 3IQC A;  3K1I A;  1SZI A;  1ORY A;  1ORJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...