3K1IA

Crystal strcture of flis-hp1076 complex in h. pylori
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
106
structure length
106
Chain Sequence
b'SPAKLIEMLYEGILRFSSQAKRCIENEDIEKKIYYINRVTDIFTELLNILDYEKGGEVAVYLTGLYTHQIKVLTQANVENDASKIDLVLNVARGLLEAWREIHSDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flagellar protein
publication title Molecular interaction of flagellar export chaperone FliS and cochaperone HP1076 in Helicobacter pylori
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Chaperone
total genus 46
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02561 FliS Flagellar protein FliS
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.340 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Flagellar protein FliS 3k1iA00
1SZIA 3IQCA 1ORYA 3K1IA 1ORJA
chains in the Genus database with same CATH superfamily
2KJGA 3NMIA 4Q5SF 1VYIA 1G5ZA 3CAXA 2H8AA 2P1AA 3DE8A 4KNWA 4JC7A 4MW8A 5B1BC 4EBJA 5L3QA 3EH1A 1S7ZA 3B29A 1CGNA 3U0CA 5KYYA 4A2NB 5JT4A 3C62A 5L0JA 2XLOA 3W2VA 4G78A 5L3VA 5E2QA 5T3WA 1A0BA 2NUPB 3DD7A 5CIVA 2XXAB 4EHPA 1FR0A 3EG9B 4Z9HA 2RSEB 1PV3A 3EHNA 1A7DA 2KSFA 1XZQA 3VAYA 2YL1A 4W8KA 3S84A 4JURI 3GODA 3POVA 1Z23A 4IAOA 3ATPA 4EBBA 1A7EA 1TWAA 4BJ6C 1DOVA 3I5QA 2H7BA 3KYJA 2OEXA 4CS7A 5K0IA 1LS1A 3K1IA 1JRAA 5JS5A 3JYHA 3HTKC 4NCQA 1ZHWA 5KYNA 1BR4A 3EGXB 3UMHA 3C8ZA 4LLCA 4MVMA 5L0CA 2ZD9A 2IXNA 4JEAA 2BC5A 5CI8A 1WASA 2NSGA 2XRHA 4JVSA 3L1MA 5TJ5E 3TJ5A 1JAFA 4DBQA 1M56C 4DBRA 4JIOA 4AE4B 1BR1A 3DXJF 2HV6A 2QNLA 3CQZA 3W2WA 2R7XA 3M79A 1YA7O 4L6RA 2XLDA 3UMKA 5HV9A 2HV7A 1QSPA 4YT2A 3TOLA 4G7ZF 3NG1A 1H7IA 3RQGA 5DS6A 2Y3BA 5F5HA 4RBNA 1FFHA 1G4WR 3AG1C 3GANA 4I44A 5JLIA 3EJNA 1RJ9A 1UG7A 2XL6A 2R25A 1C03A 2YLGA 4LDQA 3GWLA 4MTFA 5BQGA 5EHHA 2EINC 2PF4E 1Q0FA 3SP1A 2Y3HA 4BEJA 3O55A 4FAPB 2IXPA 1WGWA 3K6BA 3S0XA 4YT5A 4DRJB 3LS1A 4FX5A 1LI7A 3TD7A 3VYWA 3LS0A 2AWCA 3EGDA 1CGME 4J7YA 2L6HA 1H9GA 2YLDA 3MX3A 4BPMA 2YKZA 4OD4A 4CS8A 2W45A 2R9RB 1FMVA 2IM8A 1K04A 2DB4A 3F46A 5BQIA 1MMNA 2AWYA 1XZPA 3EFOB 1AEPA 4N6CA 3U5SA 3ECSA 4JRZA 4G7HF 2HMZA 4IGGA 4PJJA 2L81A 2Q9BA 3SEOA 3A11A 3ZG1A 1NFOA 2HZ8A 4OD5A 2J9VA 3SXKA 3M4BA 2HJMA 5B1AC 2R7QA 3C18A 3U9MA 5B3SC 3VM6A 1MNEA 2D5RB 2NUPA 4CSAA 3S27A 2XXAA 2G62A 3EG9A 2FFHA 1OKKD 3RIPA 3DM9B 5JRAA 4HE8D 4MVRA 2OU6A 4CX9A 1WTYA 2ZPAA 1TKNA 3ZWIA 3ZVRA 3GEEA 5JP7A 2B0JA 4YT8A 4CIHA 4WJ0A 4MVSA 3C8GD 2R7UA 4N06A 4U5HA 2ZXPA 3PHF2 3LLIA 4D4NA 2CDQA 2M64A 2Q3TA 3DKAA 3NRHA 2ZXRA 1OR2A 5L0DA 1NG1A 4JJFA 1E86A 3DZAA 1H9TA 2EPNA 1DOWA 1M2OA 1RCPA 2VASA 3U3BA 4HEAJ 4QI2A 2D4UA 2DYRC 2P7VA 1ORJA 4K0DA 1ZHTA 4AL1A 3NMJA 2O9XA 2XLMA 2WB7A 4AE4A 2Y3GA 2OEVA 1HE1A 1Q0GA 4MVQA 1T01A 1A7VA 1QVXA 2CNWD 2P0NA 3E9VA 4I1OB 4U5BE 1ZW3A 4NTAA 4CJGA 3RYLA 4DRIB 2Y69C 3NDBB 3FHDA 2EPKX 2QE9A 3M4CA 3NMKA 4FWVA 4P9FA 1OW6A 1E2XA 1T5OA 3LJBA 4MS2A 2KYHA 3I5PA 2EPOA 3T6GB 1TWCA 1L3PA 1TFKB 3L0IA 1OCCC 4E0IA 3JSEO 2R7TA 3QMKA 1NU7D 4JE9A 4CJOA 1V55C 2G3KA 4YL0A 1M57C 2LFFA 1ZHXA 4U9EA 4YL1A 3S9OA 2R7RA 1MNDA 1SF8A 1E85A 3V5XA 3LAYA 1MMAA 1D1AA 3U8PA 5DQTA 3EHMA 4I3MA 5EK0A 5BUOA 3ASOC 3CSKA 2J45A 2XLVA 3ZDLA 3C8GB 256BA 4KBLA 2HJ3A 3FOPA 5GPGB 4XEFA 3EFOA 1VK5A 2BE5F 4JTDB 4Z9JA 1YARO 1PCXA 4IARA 5L0HA 2P6VA 1YJGA 3ZQYA 1OCOC 1OW7A 3SNHA 5JUAA 3DAGA 4BJ5A 2VB6A 2YVKA 3CEXA 1RXQA 5KYWA 2Y3DA 2YWAA 2HSBA 1HY5A 4XPYA 1HMDA 2BL2A 2R05A 2KC3A 1WOLA 1ZU5A 2G3VA 3JRTA 4GYTA 2GDCA 1GS9A 4MTGA 1YZAA 2XLHA 3H2VA 3SYNA 1Q0MA 4OIOF 3JZ0A 1U89A 3UGOA 1EA8A 1ORYA 2QLAA 3EZHA 2AP3A 4H4KC 1H6GA 3KYIA 4XLPF 5L0GA 2QY9A 3O10A 3NYLA 3H2UA 4YJWA 3ZC4A 4AX2A 5IY5C 3X1OA 4E7ZA 2I15A 3KH2A 4C3BA 4JKVA 2YL7A 1ZHZA 2Q7RA 3U8VA 2EILC 2MWQA 3QW0A 3FDQA 4YWQA 3GM3A 2L9JA 3AG3C 1D1BA 1IZMA 3UR3C 2R03A 4E18A 2LSEA 2CCYA 2WVNA 1FMWA 3LEOA 1O5HA 3HNJA 3WG7C 5DLJA 4C3DA 4Z9IA 3RVZA 3EQLF 4QI0A 2IOQA 1AVOB 3HNKA 4C3EA 2CGEA 2DI3A 2V3CC 4PK4A 1Z3IX 2KK1A 3K33A 3IHUA 4KC9A 2I8BA 3VF0A 1YYJA 3ABKC 1C17M 2MYSA 1NBBA 2J9WA 2OCCC 1VMAA 5HSWA 3DAFA 2VH3A 3SXYA 2LP4A 1R4TA 3RKOF 1M6TA 4D4XA 3N24A 3RVYA 4BJ6A 5FZTA 3S29A 2OKUA 1SMYF 4LDRA 1Z7Qc 4WABA 1M2VB 3GWNA 4GQHA 3T4RA 2H7OA 1K05A 1BR2A 3JCUQ 3SXZA 1ST6A 3FVYA 3U3FA 4JTAB 2FGYA 4JEBA 4BG0A 5E3AA 4U5FE 1VLSA 2LFDA 5A6AA 4JCZA 2WZFA 2HKVA 3R2PA 2YRFA 2LK4A 2H7VC 1OKKA 2QUPA 1EKYA 4ONSA 3U9JA 3EZIA 2YHSA 2V26A 2R02A 1U0BB 4OIRF 1QKRA 3GM1A 1FAPB 3SXMA 3C8GA 3U2LA 2A1DD 5F5FA 4GEHA 2JD3A 3ZTZA 4BEMJ 1JOGA 3K66A 1W2WA 3LLKA 2Y39A 3ITFA 1BDJB 3S90A 3DJNB 3OWTA 3T6JA 2Q9AA 3B0UX 3K7DA 1IW7F 1T6IA 5DS5A 1K40A 3C7JA 1I4YA 1OW8A 1RKCA 4JCHA 1FNTc 4C7OB 1LKXA 3ZIBA 5CI9A 3HLZA 3AG2C 1TFOB 3NKEA 2VCCA 1J8YF 2CNWA 2L6FA 1JPNA 3K1HA 4IAQA 1ZVZA 4JW1A 3VRCA 2NPUA 1KU2A 2JX0A 1V4AA 3Q7GA 4K7BA 3L8IA 1PD0A 5COMA 4NTBA 4MVUA 3MYIA 5D92A 2PP4A 3F47A 4DRHB 4IJJA 3WAQA 1NU9C 4XEVA 3QVYA 1QZXA 3NYMA 1AUEA 3FAJA 3HNIA 1V74B 2CYDA 1R5ID 4A4AA 3EGXA 3RH3A 3L34A 5JVEA 3AGUA 2OOCA 3AG4C 3LNRA 1G8XA 4BJ1A 3W8HA 4YL3A 2LCHA 3RQFA 2CW0F 2OQMA 4EBKA 1VOMA 4B6IA 3QTHA 1D0YA 2A6HF 1EI7A 2YL3A 4ANJA 2P61A 5DVWA 2AVKA 2F22A 2OJQA 3FMSA 1KTMA 1JR8A 2YL0A 1N1CA 3UNGC 1LS4A 1T9KA 3B71A 3ZSUA 3OA1A 1L7CA 1YLMA 2NUTB 4J32B 3AGTA 1ORSC 4R32A 3RQEA 4IWBA 1SZIA 3C63A 1QQ3A 2XL4A 2XS1A 4XWJA 1LE2A 5AC5A 3UGPA 5KYXB 1LIHA 3IPMO 3TJ6A 3LUTB 4MVOA 3W4YA 1M2VA 2J9UA 5JSLA 3TQOA 4E0HA 2A69F 1Q0KA 2LD6A 1CGOA 1LM3B 4PR9A 5FCLA 1YZCA 1GGQA 3DI5A 4M63A 1NFNA 1Z6AA 3AJMA 4CIPA 3G4ZA 4KI2A 4LACB 3FXHA 1A41A 3PMRA 4PJNA 4U5CE 3G4XA 4WGZA 4EIYA 2IXOA 3HJCA 3JT1A 1CPRA 1TQGA 4EWCA 4N4WA 5A6KA 5COFA 1HMOA 2PX3A 3IQCA 2VCBA 2PFDA 2YQYA 5L0FA 1Q0DA 3NKDA 1RJ9B 4P9TA 4U5GA 5T1DB 2C03A 3ZTMA 2WL8A 3ABMC 2FAPB 3QZCA 1UFBA 5E33A 4JTCB 3DWWA 5BQHA 5A6BA 3JRMO 4RDAA 2J8WA 3MLGA 4PJLA 3WHNA 4DVZA 1BBHA 2XM0A 4OINF 1HW2A 1MMDA 2EIMC 2QTVA 4C7OA 4Q4ZF 2R7SA 1OXKA 5KYUB 2YLIA 3U2MA 1D0ZA 3PDMP 3L8JA 2E87A 2WZLA 3GORA 1SYQA 3SZRA 2HSQA 2W4BA 1Y6DA 2OJED 2J46A 2W9YA 2B0HA 3K1IC 3RW0A 1WWPA 2YEVA 1TWHA 2NG1A 2X0CA 4CDVA 4G7OF 1VYKA 2PNOA 2J9BA 3M1CB 1WATA 1JPJA 1VLTA 2X51A 3JYYA 3OEOA 1LI5A 4LLEA 5A6BD 2TMVP 1I5NA 1RKEB 4ZLCA 1NLXA 1T6QA 1ZW2A 1OXBA 3N2ZB 4HFFB 4J30B 2R7WA 4YK5A 5A69A 4HFKB 1EQ1A 4DXWA 1LPEA 3MFNA 4IB4A 2GA0A 2ZXOA 4W8PA 3E70C 3W8IA 4X0RA 1ZHYA 2XSEA 3H65A 3O6XA 4G0HA 2ETSA 4JJGA 1OR3A 4LDKA 4BJTA 1YYXA 4DJ9A 5AC4A 4UDVA 2PBEA 2GWWA 2M4EA 2NUTA 3BEHA 2KW3C 2Z15A 1JMWA 5DQZA 1OQCA 2KQ9A 4MVZA 4Q7CA 1NSGB 4U5DE 2A0BA 3KL4A 1VTMP 4YT4A 3V7OA 5KYXA 1E83A 2R7OA 3M15A 1MMGA 1I4ZA 2A0UA 2XL8A 2IBFA 1S05A 3KKBA 4XPWA 4PFOA 3KPHA 3FOOA 3V5ZA 4DVYP 3IQTA 3DJUB 4N6HA 4CS8C 2HS5A 2PX0A 4U5EE 3UMIA 3TOMA 3HKKA 1C02A 1LE4A 2DGJA 4O6NA 4ULVA 4CBEA 2J7PA 2WZGA 4ULWA 1Z63A 4ZLDA 4KNVA 1J8MF 1ZU4A 1TWGA 4OIQF 3S28A 3JSZA 3BRJA 3AQBA 3ABLC 3B0PA 2EIKC 4CS9A 2LIGA 4F4BA 1KNYA 2XLEA 3R7CA 1LVKA 5D91A 2EPLX 1V54C 2Q00A 2AU5A 2J0WA 3T6BA 1CPQA 4CSAC 1D0XA 1VB5A 1WN0A 2Q9CA 3LESA 1O87A 2XS8A 3MBGA 4XQ1A 1QPUA 1O3UA 4NY3A 2C04A 2J7PD 2ZXWC 5EGYA 4CDYA 1TR2A 2L6GA 5KYUA 3QVZA 2UUIA 1D1CA 2LQGA 2EPMX 4EUKB 4J7TA 3T9OA 5A6JA 2OG2A 4JZAA 3NYJA 4PACA 1T6UA 1OCRC 2XM4A 4MTOA 5KYYB 1GQAA 3A9CA 3IQ6A 2EIJC 2DYSC 3G50A 4MNDA 5KYWB 2WVOA 2YZSA 4RD9A 1YAUO 3JTLO 2Q4FA 2JPUA 4YN0B 3GM2A 1RKEA 4IRUA 4PFPA 1OCZC 4MW3A 1ZZPA 4H54A 2KGOA 4P6IC 4EKWA 2HFIA 4CS9C 3IQ5A 3US6A 4AL0A 3N0TA 4XEKA 1FFTC 5E3CA 3Q6NA 1E84A 4CDAA 1HW1A 3Q6MA 3WODF 4LERA 3RFYA 1U6HA 2ICWG 2W4MA 3HNLA 2ASRA 3Q7LA 2GFHA 1YA9A 2HMQA 5COGA 1RMVA 3RF3A 3LEVA 4O79A 3AQCA 5AGFA 4I1MA 3QW1A 1HE9A 2A68F 5B3IA 5L0IA 3KMIA 4OIPF 1SR2A 1G4US 3CZ6A 3TULA 3DMDA 3V5YA 2HUJA 1FTSA 3DE9A 3I4UA 2L7AA 1XWJA 3TK0A 4AK9A 4PJMA 3J06A 4XTKA 4K1OA 2GAQA 3DM5A 1GM5A 3LNMB 5DS4A 5F28E 4NQFA 4XLNF 1BZ4A 4NTFA 2XLWA 1YVIA 4QDLA 1APCA 5T3TA 3ZQVA 4E17A 3IEEA 3PCVA 1PD1A 3AOUA 1ZYRF 1Y4CA 2NSFA 2WVQA 3GEIA 4FESA 3GEHA 2KNHA 4MQ9F 4BJ5C 1Z5ZA 3O39A 1NZEA 4WGYA 2VC9A 2UUHA 1F1MA 1YDIA 3ASNC 3X2QC 2RD9A 3EH2A 2IYLD 4O7GA 1QLEC 3B9QA 4U9DA 4XPXA 3EGDB 3FAPB 4ER9A 4E7SA 2IXMA 2J0XA 3MYFA 1MQVA 1B68A 2A6EF 4NC3A 4O6MA 2MHRA 3B0VC 2VCAA 4O6YA 4DOZA 2R7VA 3EPVA
chains in the Genus database with same CATH topology
1SZIA 3IQCA 1ORYA 3K1IA 1ORJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SZI A;  3IQC A;  1ORY A;  3K1I A;  1ORJ A; 
#chains in the Genus database with same CATH topology
 2KJG A;  3NMI A;  4Q5S F;  1VYI A;  1G5Z A;  3CAX A;  2H8A A;  2P1A A;  3DE8 A;  4KNW A;  4JC7 A;  4MW8 A;  5B1B C;  4EBJ A;  5L3Q A;  3EH1 A;  1S7Z A;  3B29 A;  1CGN A;  3U0C A;  5KYY A;  4A2N B;  5JT4 A;  3C62 A;  5L0J A;  2XLO A;  3W2V A;  4G78 A;  5L3V A;  5E2Q A;  5T3W A;  1A0B A;  2NUP B;  3DD7 A;  5CIV A;  2XXA B;  4EHP A;  1FR0 A;  3EG9 B;  4Z9H A;  2RSE B;  1PV3 A;  3EHN A;  1A7D A;  2KSF A;  1XZQ A;  3VAY A;  2YL1 A;  4W8K A;  3S84 A;  4JUR I;  3GOD A;  3POV A;  1Z23 A;  4IAO A;  3ATP A;  4EBB A;  1A7E A;  1TWA A;  4BJ6 C;  1DOV A;  3I5Q A;  2H7B A;  3KYJ A;  2OEX A;  4CS7 A;  5K0I A;  1LS1 A;  3K1I A;  1JRA A;  5JS5 A;  3JYH A;  3HTK C;  4NCQ A;  1ZHW A;  5KYN A;  1BR4 A;  3EGX B;  3UMH A;  3C8Z A;  4LLC A;  4MVM A;  5L0C A;  2ZD9 A;  2IXN A;  4JEA A;  2BC5 A;  5CI8 A;  1WAS A;  2NSG A;  2XRH A;  4JVS A;  3L1M A;  5TJ5 E;  3TJ5 A;  1JAF A;  4DBQ A;  1M56 C;  4DBR A;  4JIO A;  4AE4 B;  1BR1 A;  3DXJ F;  2HV6 A;  2QNL A;  3CQZ A;  3W2W A;  2R7X A;  3M79 A;  1YA7 O;  4L6R A;  2XLD A;  3UMK A;  5HV9 A;  2HV7 A;  1QSP A;  4YT2 A;  3TOL A;  4G7Z F;  3NG1 A;  1H7I A;  3RQG A;  5DS6 A;  2Y3B A;  5F5H A;  4RBN A;  1FFH A;  1G4W R;  3AG1 C;  3GAN A;  4I44 A;  5JLI A;  3EJN A;  1RJ9 A;  1UG7 A;  2XL6 A;  2R25 A;  1C03 A;  2YLG A;  4LDQ A;  3GWL A;  4MTF A;  5BQG A;  5EHH A;  2EIN C;  2PF4 E;  1Q0F A;  3SP1 A;  2Y3H A;  4BEJ A;  3O55 A;  4FAP B;  2IXP A;  1WGW A;  3K6B A;  3S0X A;  4YT5 A;  4DRJ B;  3LS1 A;  4FX5 A;  1LI7 A;  3TD7 A;  3VYW A;  3LS0 A;  2AWC A;  3EGD A;  1CGM E;  4J7Y A;  2L6H A;  1H9G A;  2YLD A;  3MX3 A;  4BPM A;  2YKZ A;  4OD4 A;  4CS8 A;  2W45 A;  2R9R B;  1FMV A;  2IM8 A;  1K04 A;  2DB4 A;  3F46 A;  5BQI A;  1MMN A;  2AWY A;  1XZP A;  3EFO B;  1AEP A;  4N6C A;  3U5S A;  3ECS A;  4JRZ A;  4G7H F;  2HMZ A;  4IGG A;  4PJJ A;  2L81 A;  2Q9B A;  3SEO A;  3A11 A;  3ZG1 A;  1NFO A;  2HZ8 A;  4OD5 A;  2J9V A;  3SXK A;  3M4B A;  2HJM A;  5B1A C;  2R7Q A;  3C18 A;  3U9M A;  5B3S C;  3VM6 A;  1MNE A;  2D5R B;  2NUP A;  4CSA A;  3S27 A;  2XXA A;  2G62 A;  3EG9 A;  2FFH A;  1OKK D;  3RIP A;  3DM9 B;  5JRA A;  4HE8 D;  4MVR A;  2OU6 A;  4CX9 A;  1WTY A;  2ZPA A;  1TKN A;  3ZWI A;  3ZVR A;  3GEE A;  5JP7 A;  2B0J A;  4YT8 A;  4CIH A;  4WJ0 A;  4MVS A;  3C8G D;  2R7U A;  4N06 A;  4U5H A;  2ZXP A;  3PHF 2;  3LLI A;  4D4N A;  2CDQ A;  2M64 A;  2Q3T A;  3DKA A;  3NRH A;  2ZXR A;  1OR2 A;  5L0D A;  1NG1 A;  4JJF A;  1E86 A;  3DZA A;  1H9T A;  2EPN A;  1DOW A;  1M2O A;  1RCP A;  2VAS A;  3U3B A;  4HEA J;  4QI2 A;  2D4U A;  2DYR C;  2P7V A;  1ORJ A;  4K0D A;  1ZHT A;  4AL1 A;  3NMJ A;  2O9X A;  2XLM A;  2WB7 A;  4AE4 A;  2Y3G A;  2OEV A;  1HE1 A;  1Q0G A;  4MVQ A;  1T01 A;  1A7V A;  1QVX A;  2CNW D;  2P0N A;  3E9V A;  4I1O B;  4U5B E;  1ZW3 A;  4NTA A;  4CJG A;  3RYL A;  4DRI B;  2Y69 C;  3NDB B;  3FHD A;  2EPK X;  2QE9 A;  3M4C A;  3NMK A;  4FWV A;  4P9F A;  1OW6 A;  1E2X A;  1T5O A;  3LJB A;  4MS2 A;  2KYH A;  3I5P A;  2EPO A;  3T6G B;  1TWC A;  1L3P A;  1TFK B;  3L0I A;  1OCC C;  4E0I A;  3JSE O;  2R7T A;  3QMK A;  1NU7 D;  4JE9 A;  4CJO A;  1V55 C;  2G3K A;  4YL0 A;  1M57 C;  2LFF A;  1ZHX A;  4U9E A;  4YL1 A;  3S9O A;  2R7R A;  1MND A;  1SF8 A;  1E85 A;  3V5X A;  3LAY A;  1MMA A;  1D1A A;  3U8P A;  5DQT A;  3EHM A;  4I3M A;  5EK0 A;  5BUO A;  3ASO C;  3CSK A;  2J45 A;  2XLV A;  3ZDL A;  3C8G B;  256B A;  4KBL A;  2HJ3 A;  3FOP A;  5GPG B;  4XEF A;  3EFO A;  1VK5 A;  2BE5 F;  4JTD B;  4Z9J A;  1YAR O;  1PCX A;  4IAR A;  5L0H A;  2P6V A;  1YJG A;  3ZQY A;  1OCO C;  1OW7 A;  3SNH A;  5JUA A;  3DAG A;  4BJ5 A;  2VB6 A;  2YVK A;  3CEX A;  1RXQ A;  5KYW A;  2Y3D A;  2YWA A;  2HSB A;  1HY5 A;  4XPY A;  1HMD A;  2BL2 A;  2R05 A;  2KC3 A;  1WOL A;  1ZU5 A;  2G3V A;  3JRT A;  4GYT A;  2GDC A;  1GS9 A;  4MTG A;  1YZA A;  2XLH A;  3H2V A;  3SYN A;  1Q0M A;  4OIO F;  3JZ0 A;  1U89 A;  3UGO A;  1EA8 A;  1ORY A;  2QLA A;  3EZH A;  2AP3 A;  4H4K C;  1H6G A;  3KYI A;  4XLP F;  5L0G A;  2QY9 A;  3O10 A;  3NYL A;  3H2U A;  4YJW A;  3ZC4 A;  4AX2 A;  5IY5 C;  3X1O A;  4E7Z A;  2I15 A;  3KH2 A;  4C3B A;  4JKV A;  2YL7 A;  1ZHZ A;  2Q7R A;  3U8V A;  2EIL C;  2MWQ A;  3QW0 A;  3FDQ A;  4YWQ A;  3GM3 A;  2L9J A;  3AG3 C;  1D1B A;  1IZM A;  3UR3 C;  2R03 A;  4E18 A;  2LSE A;  2CCY A;  2WVN A;  1FMW A;  3LEO A;  1O5H A;  3HNJ A;  3WG7 C;  5DLJ A;  4C3D A;  4Z9I A;  3RVZ A;  3EQL F;  4QI0 A;  2IOQ A;  1AVO B;  3HNK A;  4C3E A;  2CGE A;  2DI3 A;  2V3C C;  4PK4 A;  1Z3I X;  2KK1 A;  3K33 A;  3IHU A;  4KC9 A;  2I8B A;  3VF0 A;  1YYJ A;  3ABK C;  1C17 M;  2MYS A;  1NBB A;  2J9W A;  2OCC C;  1VMA A;  5HSW A;  3DAF A;  2VH3 A;  3SXY A;  2LP4 A;  1R4T A;  3RKO F;  1M6T A;  4D4X A;  3N24 A;  3RVY A;  4BJ6 A;  5FZT A;  3S29 A;  2OKU A;  1SMY F;  4LDR A;  1Z7Q c;  4WAB A;  1M2V B;  3GWN A;  4GQH A;  3T4R A;  2H7O A;  1K05 A;  1BR2 A;  3JCU Q;  3SXZ A;  1ST6 A;  3FVY A;  3U3F A;  4JTA B;  2FGY A;  4JEB A;  4BG0 A;  5E3A A;  4U5F E;  1VLS A;  2LFD A;  5A6A A;  4JCZ A;  2WZF A;  2HKV A;  3R2P A;  2YRF A;  2LK4 A;  2H7V C;  1OKK A;  2QUP A;  1EKY A;  4ONS A;  3U9J A;  3EZI A;  2YHS A;  2V26 A;  2R02 A;  1U0B B;  4OIR F;  1QKR A;  3GM1 A;  1FAP B;  3SXM A;  3C8G A;  3U2L A;  2A1D D;  5F5F A;  4GEH A;  2JD3 A;  3ZTZ A;  4BEM J;  1JOG A;  3K66 A;  1W2W A;  3LLK A;  2Y39 A;  3ITF A;  1BDJ B;  3S90 A;  3DJN B;  3OWT A;  3T6J A;  2Q9A A;  3B0U X;  3K7D A;  1IW7 F;  1T6I A;  5DS5 A;  1K40 A;  3C7J A;  1I4Y A;  1OW8 A;  1RKC A;  4JCH A;  1FNT c;  4C7O B;  1LKX A;  3ZIB A;  5CI9 A;  3HLZ A;  3AG2 C;  1TFO B;  3NKE A;  2VCC A;  1J8Y F;  2CNW A;  2L6F A;  1JPN A;  3K1H A;  4IAQ A;  1ZVZ A;  4JW1 A;  3VRC A;  2NPU A;  1KU2 A;  2JX0 A;  1V4A A;  3Q7G A;  4K7B A;  3L8I A;  1PD0 A;  5COM A;  4NTB A;  4MVU A;  3MYI A;  5D92 A;  2PP4 A;  3F47 A;  4DRH B;  4IJJ A;  3WAQ A;  1NU9 C;  4XEV A;  3QVY A;  1QZX A;  3NYM A;  1AUE A;  3FAJ A;  3HNI A;  1V74 B;  2CYD A;  1R5I D;  4A4A A;  3EGX A;  3RH3 A;  3L34 A;  5JVE A;  3AGU A;  2OOC A;  3AG4 C;  3LNR A;  1G8X A;  4BJ1 A;  3W8H A;  4YL3 A;  2LCH A;  3RQF A;  2CW0 F;  2OQM A;  4EBK A;  1VOM A;  4B6I A;  3QTH A;  1D0Y A;  2A6H F;  1EI7 A;  2YL3 A;  4ANJ A;  2P61 A;  5DVW A;  2AVK A;  2F22 A;  2OJQ A;  3FMS A;  1KTM A;  1JR8 A;  2YL0 A;  1N1C A;  3UNG C;  1LS4 A;  1T9K A;  3B71 A;  3ZSU A;  3OA1 A;  1L7C A;  1YLM A;  2NUT B;  4J32 B;  3AGT A;  1ORS C;  4R32 A;  3RQE A;  4IWB A;  1SZI A;  3C63 A;  1QQ3 A;  2XL4 A;  2XS1 A;  4XWJ A;  1LE2 A;  5AC5 A;  3UGP A;  5KYX B;  1LIH A;  3IPM O;  3TJ6 A;  3LUT B;  4MVO A;  3W4Y A;  1M2V A;  2J9U A;  5JSL A;  3TQO A;  4E0H A;  2A69 F;  1Q0K A;  2LD6 A;  1CGO A;  1LM3 B;  4PR9 A;  5FCL A;  1YZC A;  1GGQ A;  3DI5 A;  4M63 A;  1NFN A;  1Z6A A;  3AJM A;  4CIP A;  3G4Z A;  4KI2 A;  4LAC B;  3FXH A;  1A41 A;  3PMR A;  4PJN A;  4U5C E;  3G4X A;  4WGZ A;  4EIY A;  2IXO A;  3HJC A;  3JT1 A;  1CPR A;  1TQG A;  4EWC A;  4N4W A;  5A6K A;  5COF A;  1HMO A;  2PX3 A;  3IQC A;  2VCB A;  2PFD A;  2YQY A;  5L0F A;  1Q0D A;  3NKD A;  1RJ9 B;  4P9T A;  4U5G A;  5T1D B;  2C03 A;  3ZTM A;  2WL8 A;  3ABM C;  2FAP B;  3QZC A;  1UFB A;  5E33 A;  4JTC B;  3DWW A;  5BQH A;  5A6B A;  3JRM O;  4RDA A;  2J8W A;  3MLG A;  4PJL A;  3WHN A;  4DVZ A;  1BBH A;  2XM0 A;  4OIN F;  1HW2 A;  1MMD A;  2EIM C;  2QTV A;  4C7O A;  4Q4Z F;  2R7S A;  1OXK A;  5KYU B;  2YLI A;  3U2M A;  1D0Z A;  3PDM P;  3L8J A;  2E87 A;  2WZL A;  3GOR A;  1SYQ A;  3SZR A;  2HSQ A;  2W4B A;  1Y6D A;  2OJE D;  2J46 A;  2W9Y A;  2B0H A;  3K1I C;  3RW0 A;  1WWP A;  2YEV A;  1TWH A;  2NG1 A;  2X0C A;  4CDV A;  4G7O F;  1VYK A;  2PNO A;  2J9B A;  3M1C B;  1WAT A;  1JPJ A;  1VLT A;  2X51 A;  3JYY A;  3OEO A;  1LI5 A;  4LLE A;  5A6B D;  2TMV P;  1I5N A;  1RKE B;  4ZLC A;  1NLX A;  1T6Q A;  1ZW2 A;  1OXB A;  3N2Z B;  4HFF B;  4J30 B;  2R7W A;  4YK5 A;  5A69 A;  4HFK B;  1EQ1 A;  4DXW A;  1LPE A;  3MFN A;  4IB4 A;  2GA0 A;  2ZXO A;  4W8P A;  3E70 C;  3W8I A;  4X0R A;  1ZHY A;  2XSE A;  3H65 A;  3O6X A;  4G0H A;  2ETS A;  4JJG A;  1OR3 A;  4LDK A;  4BJT A;  1YYX A;  4DJ9 A;  5AC4 A;  4UDV A;  2PBE A;  2GWW A;  2M4E A;  2NUT A;  3BEH A;  2KW3 C;  2Z15 A;  1JMW A;  5DQZ A;  1OQC A;  2KQ9 A;  4MVZ A;  4Q7C A;  1NSG B;  4U5D E;  2A0B A;  3KL4 A;  1VTM P;  4YT4 A;  3V7O A;  5KYX A;  1E83 A;  2R7O A;  3M15 A;  1MMG A;  1I4Z A;  2A0U A;  2XL8 A;  2IBF A;  1S05 A;  3KKB A;  4XPW A;  4PFO A;  3KPH A;  3FOO A;  3V5Z A;  4DVY P;  3IQT A;  3DJU B;  4N6H A;  4CS8 C;  2HS5 A;  2PX0 A;  4U5E E;  3UMI A;  3TOM A;  3HKK A;  1C02 A;  1LE4 A;  2DGJ A;  4O6N A;  4ULV A;  4CBE A;  2J7P A;  2WZG A;  4ULW A;  1Z63 A;  4ZLD A;  4KNV A;  1J8M F;  1ZU4 A;  1TWG A;  4OIQ F;  3S28 A;  3JSZ A;  3BRJ A;  3AQB A;  3ABL C;  3B0P A;  2EIK C;  4CS9 A;  2LIG A;  4F4B A;  1KNY A;  2XLE A;  3R7C A;  1LVK A;  5D91 A;  2EPL X;  1V54 C;  2Q00 A;  2AU5 A;  2J0W A;  3T6B A;  1CPQ A;  4CSA C;  1D0X A;  1VB5 A;  1WN0 A;  2Q9C A;  3LES A;  1O87 A;  2XS8 A;  3MBG A;  4XQ1 A;  1QPU A;  1O3U A;  4NY3 A;  2C04 A;  2J7P D;  2ZXW C;  5EGY A;  4CDY A;  1TR2 A;  2L6G A;  5KYU A;  3QVZ A;  2UUI A;  1D1C A;  2LQG A;  2EPM X;  4EUK B;  4J7T A;  3T9O A;  5A6J A;  2OG2 A;  4JZA A;  3NYJ A;  4PAC A;  1T6U A;  1OCR C;  2XM4 A;  4MTO A;  5KYY B;  1GQA A;  3A9C A;  3IQ6 A;  2EIJ C;  2DYS C;  3G50 A;  4MND A;  5KYW B;  2WVO A;  2YZS A;  4RD9 A;  1YAU O;  3JTL O;  2Q4F A;  2JPU A;  4YN0 B;  3GM2 A;  1RKE A;  4IRU A;  4PFP A;  1OCZ C;  4MW3 A;  1ZZP A;  4H54 A;  2KGO A;  4P6I C;  4EKW A;  2HFI A;  4CS9 C;  3IQ5 A;  3US6 A;  4AL0 A;  3N0T A;  4XEK A;  1FFT C;  5E3C A;  3Q6N A;  1E84 A;  4CDA A;  1HW1 A;  3Q6M A;  3WOD F;  4LER A;  3RFY A;  1U6H A;  2ICW G;  2W4M A;  3HNL A;  2ASR A;  3Q7L A;  2GFH A;  1YA9 A;  2HMQ A;  5COG A;  1RMV A;  3RF3 A;  3LEV A;  4O79 A;  3AQC A;  5AGF A;  4I1M A;  3QW1 A;  1HE9 A;  2A68 F;  5B3I A;  5L0I A;  3KMI A;  4OIP F;  1SR2 A;  1G4U S;  3CZ6 A;  3TUL A;  3DMD A;  3V5Y A;  2HUJ A;  1FTS A;  3DE9 A;  3I4U A;  2L7A A;  1XWJ A;  3TK0 A;  4AK9 A;  4PJM A;  3J06 A;  4XTK A;  4K1O A;  2GAQ A;  3DM5 A;  1GM5 A;  3LNM B;  5DS4 A;  5F28 E;  4NQF A;  4XLN F;  1BZ4 A;  4NTF A;  2XLW A;  1YVI A;  4QDL A;  1APC A;  5T3T A;  3ZQV A;  4E17 A;  3IEE A;  3PCV A;  1PD1 A;  3AOU A;  1ZYR F;  1Y4C A;  2NSF A;  2WVQ A;  3GEI A;  4FES A;  3GEH A;  2KNH A;  4MQ9 F;  4BJ5 C;  1Z5Z A;  3O39 A;  1NZE A;  4WGY A;  2VC9 A;  2UUH A;  1F1M A;  1YDI A;  3ASN C;  3X2Q C;  2RD9 A;  3EH2 A;  2IYL D;  4O7G A;  1QLE C;  3B9Q A;  4U9D A;  4XPX A;  3EGD B;  3FAP B;  4ER9 A;  4E7S A;  2IXM A;  2J0X A;  3MYF A;  1MQV A;  1B68 A;  2A6E F;  4NC3 A;  4O6M A;  2MHR A;  3B0V C;  2VCA A;  4O6Y A;  4DOZ A;  2R7V A;  3EPV A; 
#chains in the Genus database with same CATH homology
 1SZI A;  3IQC A;  1ORY A;  3K1I A;  1ORJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...