3K1IA

Crystal strcture of flis-hp1076 complex in h. pylori
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
106
structure length
106
Chain Sequence
SPAKLIEMLYEGILRFSSQAKRCIENEDIEKKIYYINRVTDIFTELLNILDYEKGGEVAVYLTGLYTHQIKVLTQANVENDASKIDLVLNVARGLLEAWREIHSDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Flagellar protein
publication title Molecular interaction of flagellar export chaperone FliS and cochaperone HP1076 in Helicobacter pylori
pubmed doi rcsb
source organism Helicobacter pylori
total genus 46
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02561 FliS Flagellar protein FliS
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.340 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Flagellar protein FliS 3k1iA00
1ORJA 3K1IA 1ORYA 1SZIA 3IQCA
chains in the Genus database with same CATH superfamily
2L81A 2W45A 3I5PA 4OIRF 1ZW2A 4AE4B 4XPYA 1KU2A 4G78A 1T6UA 2AU5A 2YHSA 2KSFA 4O7GA 4E18A 1A0BA 2D5RB 1SMYF 5DVWA 3NYLA 1YZAA 3L0IA 4Z9JA 5F28E 2R9RB 2XXAB 1RJ9A 1ZW3A 4PFPA 4I44A 1M57C 4PJJA 1Q0DA 2IOQA 2JPUA 3EGDB 4KNWA 1Z3IX 1ZVZA 1ZZPA 2XLMA 3UGPA 4DRIB 3LESA 3JSEO 4YL1A 2PF4E 2NPUA 2XLOA 3HNKA 1CPRA 5A6KA 1O3UA 1OKKA 2UUIA 1Z23A 3S28A 3LEOA 2Z15A 4I1MA 3RQFA 1C03A 2J9BA 3SXKA 3ZG1A 3UGOA 3N0TA 3AOUA 3PMRA 3CAXA 1RKEA 2FAPB 3H65A 3MLGA 4H4KC 5AGFA 1JRAA 1AEPA 3GM2A 2NUTA 2XLEA 1EKYA 1YA9A 1L7CA 3A11A 1APCA 4JJGA 1QZXA 2M64A 3V5ZA 4IAQA 5DQZA 1C02A 5TJ5E 1OW8A 2XM0A 2YL0A 2O9XA 3VM6A 4PJNA 4QI0A 2J46A 1VK5A 4AX2A 2YVKA 2PX0A 1VLSA 2LCHA 3GWLA 3OA1A 4CS9A 4N6CA 2C04A 3A9CA 2QE9A 3FAJA 2HKVA 4E0IA 2Q00A 1G8XA 1V55C 1YYJA 4HFFB 1ZHWA 3CQZA 5A69A 4JVSA 3EG9B 2WL8A 5A6AA 2Q9AA 1LPEA 4XQ1A 3G4ZA 1PV3A 2HV7A 2QTVA 3TJ6A 1TWCA 4LLEA 3L8IA 3ABLC 5JP7A 5JUAA 1QLEC 1Q0GA 1JPJA 1O5HA 4HEAJ 3AGTA 3WHNA 1ZHYA 4CX9A 5L0FA 5DS4A 2YLGA 5KYNA 3F47A 2YQYA 1C17M 3U9MA 3G4XA 1HE9A 5B1BC 4C3BA 4EBKA 2LIGA 2RD9A 2DB4A 2EIKC 2YWAA 4MW8A 5EHHA 3LS0A 4IWBA 4NCQA 3HNIA 4BEMJ 1O87A 1ORJA 4CIPA 4KNVA 1OCRC 1Q0KA 1VOMA 1CPQA 4P6IC 5E33A 5E3CA 3T9OA 4ULWA 2Q4FA 3NYMA 4L6RA 3RQEA 3EZIA 4PACA 2WB7A 4FX5A 4AK9A 1TQGA 1ZU5A 4CSAA 3C8GB 2W4BA 2R7OA 3R2PA 1QKRA 1NBBA 3M79A 4BJ1A 4LDKA 1MMGA 1D1BA 5D91A 3RFYA 2OJQA 3ZSUA 3GANA 2WZGA 5JLIA 5L0HA 4G7ZF 2A68F 2HV6A 2LD6A 2Q9BA 3K1IA 3RQGA 3S27A 4CS8A 3ZQYA 4U5HA 3C63A 3ZTZA 3NKDA 4RD9A 4CIHA 3LLKA 3QVZA 3SP1A 4ZLCA 5JVEA 2HSBA 5E3AA 1GS9A 4IB4A 4O6NA 2KQ9A 2IXOA 2A6HF 3KPHA 2X0CA 3UMKA 4E7SA 3LS1A 3TULA 4KI2A 4Z9HA 1PCXA 2EILC 3C62A 4GQHA 4MVMA 2NSFA 4DXWA 3L1MA 3ATPA 3LLIA 4JE9A 4UDVA 2BC5A 5KYXA 1D1AA 1EI7A 2VC9A 3NYJA 3RW0A 2IM8A 3SYNA 4ZLDA 5BQGA 2Y3GA 3BRJA 3L8JA 1T6QA 2YKZA 5L3QA 3B0UX 2YEVA 2I8BA 3ECSA 3IPMO 3K1IC 1T9KA 2GAQA 1GGQA 1QSPA 2R7SA 3ZTMA 1HW1A 2Y3BA 3V7OA 5KYUB 4OIQF 1KTMA 4ANJA 4X0RA 1D0ZA 3Q7GA 3EGXA 2V3CC 4HE8D 2KNHA 3PCVA 1RKEB 2NUPA 5E2QA 4JTDB 1CGOA 2B0JA 3NMKA 1YDIA 3QW0A 2C03A 3N2ZB 4DRJB 1AVOB 4IJJA 2A1DD 3GEIA 3U8VA 2QUPA 2ZXRA 3ZDLA 2D4UA 3Q7LA 3EH1A 3FVYA 5HV9A 1I4ZA 2CYDA 2PNOA 1DOWA 256BA 2XLVA 3FOPA 3FXHA 1OXBA 1V74B 1LS4A 1FFHA 3M4CA 3L34A 3SXMA 1M2VA 1TWHA 2DGJA 1OKKD 2LK4A 1UFBA 2L6FA 2YL7A 3ASOC 1NU7D 3M15A 5KYYA 1A41A 2VASA 2ZPAA 2WVOA 3F46A 1R5ID 4EKWA 2AP3A 3I4UA 4RDAA 1U0BB 2VCAA 3AQCA 4U5EE 3JT1A 3EH2A 3B0PA 4E0HA 1FR0A 3ZC4A 2P7VA 2IYLD 1TR2A 5JT4A 1LE2A 2HFIA 3X2QC 4I3MA 2R25A 2BL2A 2J9VA 2R03A 1G4US 4JTAB 3TOLA 2Q7RA 3RVZA 1PD0A 1MMAA 2CGEA 1K05A 4JCHA 5IY5C 4A2NB 1LS1A 2XL4A 3MX3A 4P9FA 2FGYA 1IZMA 2QLAA 2V26A 4AL1A 4MVOA 3VF0A 4DJ9A 4MS2A 3K66A 3JYHA 4DVYP 1YJGA 3DKAA 3QMKA 3RF3A 3GWNA 4CDYA 1BZ4A 4XEKA 4YN0B 1YAUO 4JIOA 2ZXOA 2R7RA 3C7JA 3DM9B 4JRZA 1VTMP 5CI9A 1NG1A 2P0NA 4BJ6C 4C3DA 2TMVP 5CIVA 3MYIA 2OEVA 3K6BA 1J8YF 1Z7Qc 3U3BA 5T1DB 3BEHA 3AQBA 4AL0A 3HTKC 2HUJA 2R7QA 4J30B 2J9WA 4GEHA 4LLCA 4NC3A 3SXYA 4EHPA 4O79A 2QNLA 3ABMC 3O39A 1T01A 4P9TA 3DM5A 1CGME 3JTLO 3U9JA 2RSEB 1LIHA 2XS1A 5BUOA 2XRHA 3RH3A 2ZD9A 4WABA 3EPVA 5EGYA 1LI5A 3U2LA 4CBEA 1IW7F 2VCBA 1OQCA 1OW6A 3FDQA 5DS6A 2LFFA 1M56C 2J9UA 1WOLA 2YLDA 4MW3A 3DWWA 2Y3DA 1D0XA 2A69F 3U2MA 2W9YA 2OCCC 1H6GA 2OU6A 2W4MA 2Y69C 2R7WA 4NTBA 4RBNA 5JSLA 2Y3HA 4MVUA 5B1AC 3E70C 5JS5A 4G7HF 4FESA 2L9JA 3HKKA 1VYIA 1XWJA 1TKNA 2G3VA 3E9VA 4MVRA 4BPMA 3T6JA 1OCOC 4WGZA 4BJ5C 1Y6DA 3NMIA 4AE4A 3JYYA 3S0XA 4MVSA 1VB5A 2H7VC 3EFOA 3EGXB 3FMSA 4JTCB 2KYHA 2A0BA 3O55A 2R02A 3NMJA 3IQTA 4KBLA 1Z63A 4G7OF 1LM3B 1K40A 2DYSC 4CS7A 2ASRA 2HJMA 1ZU4A 3UR3C 2MYSA 1UG7A 3CEXA 1G4WR 3H2VA 4W8PA 5KYWA 1TFKB 1W2WA 1YARO 5BQIA 4C7OA 3RKOF 2FFHA 1A7EA 1J8MF 2LSEA 2EPLX 3G50A 4MTOA 5CI8A 1M6TA 2HJ3A 3KYIA 2Q3TA 4O6MA 3NDBB 3K7DA 1OR2A 1WATA 2CDQA 2E87A 2L6HA 2OOCA 3AG2C 5F5HA 3IQ5A 3C8ZA 3HNJA 2HSQA 3EHMA 1MMDA 4U5DE 4MQ9F 2LP4A 4Q7CA 3HLZA 4GYTA 3TOMA 2YLIA 2XL8A 1QVXA 2P61A 3M4BA 4R32A 1GQAA 2OKUA 2R7UA 2OEXA 2R05A 3WG7C 3GODA 1ZHZA 4ER9A 4I1OB 3HJCA 3QVYA 1D0YA 1QPUA 1RJ9B 2EINC 1BDJB 1AUEA 3MBGA 3B0VC 1ST6A 3C18A 4FWVA 4U5BE 3TQOA 4MVQA 3V5YA 3IQCA 2R7XA 4U5GA 1Z6AA 2J7PA 3KKBA 3W4YA 3RYLA 4XPXA 2XL6A 4LERA 1SR2A 4YJWA 4IAOA 2X51A 2EIJC 3LAYA 1JPNA 2YL3A 3K33A 4A4AA 5JRAA 3V5XA 4CDVA 1B68A 2IXMA 1VMAA 4LDQA 4IRUA 4DRHB 1V54C 2EPKX 2J45A 4N06A 5T3TA 2NUTB 3VRCA 4DBRA 2MHRA 3ASNC 4Z9IA 4XEFA 2GA0A 3OEOA 2H7BA 3B29A 4CDAA 3IEEA 2YZSA 3KMIA 3ZQVA 1OCCC 2G62A 5DQTA 4XWJA 2EPNA 5FZTA 1YLMA 4PR9A 4JZAA 2R7TA 2QY9A 1TFOB 1I5NA 3DE8A 1QQ3A 1ORSC 2A0UA 2WVQA 5KYYB 2CNWA 3S29A 2EPOA 4EIYA 1Y4CA 4CJGA 4DVZA 1RXQA 3UMIA 4K1OA 4YK5A 4F4BA 3GORA 4ONSA 4YT8A 3EQLF 1U89A 2L6GA 2HMZA 3IQ6A 4BJ6A 1HMDA 4HFKB 3US6A 3C8GA 4BEJA 3O6XA 3U0CA 1ZYRF 4O6YA 2ETSA 3CSKA 4CJOA 2KC3A 2G3KA 2XLWA 4XLPF 2XM4A 3I5QA 4NTAA 1OW7A 1LKXA 5K0IA 1EA8A 1FMWA 2PX3A 2LFDA 4XPWA 4JEBA 4EBJA 2DYRC 1NFOA 2BE5F 2YRFA 5D92A 1WASA 1ZHTA 2HZ8A 2WZLA 2VCCA 3AGUA 3VAYA 1H9TA 1WGWA 3GM3A 4D4XA 2DI3A 2AVKA 2KJGA 3EFOB 4J32B 3O10A 4JJFA 3W2WA 4YWQA 3GEHA 3TJ5A 4YT4A 4M63A 2YL1A 1WWPA 2OG2A 1SF8A 1FNTc 1Q0MA 1I4YA 1VYKA 2HS5A 3KH2A 1Z5ZA 4BJTA 1WTYA 4IARA 3NG1A 1L3PA 4OIPF 4PK4A 1OR3A 4E17A 3B71A 3FAPB 1HY5A 4PFOA 3SXZA 3KYJA 5KYWB 3PHF2 4C7OB 5A6BA 1SYQA 3DMDA 4LDRA 4OD5A 1NLXA 3T6BA 1OXKA 4EWCA 1LVKA 3DJUB 1E85A 4NTFA 4KC9A 3WAQA 4JKVA 1KNYA 3GM1A 4NY3A 1NSGB 4MTFA 4U9EA 4G0HA 4OD4A 5KYUA 2I15A 3HNLA 4U5CE 3N24A 2AWCA 4BJ5A 4JW1A 3TD7A 2AWYA 2EIMC 1JOGA 1MQVA 1BBHA 1T5OA 2WZFA 4XEVA 4XLNF 4Q5SF 2ICWG 1E2XA 1E86A 5T3WA 2GWWA 1HW2A 2UUHA 1CGNA 2KW3C 4W8KA 1WN0A 4MNDA 3DAFA 3LNMB 1TWAA 3Q6NA 3W2VA 3ZVRA 5DS5A 3DAGA 5COMA 4EBBA 3DJNB 5DLJA 2KGOA 4EUKB 1MMNA 2WVNA 4QDLA 4DOZA 2Q9CA 3EJNA 4JC7A 1LE4A 5EK0A 4E7ZA 4J7TA 3RVYA 1M2OA 5BQHA 1BR4A 1XZQA 2ZXWC 1HMOA 4JCZA 4LACB 3EZHA 4B6IA 1E84A 3NRHA 5HSWA 4U5FE 1EQ1A 3AG1C 1A7VA 4K0DA 1MNDA 2XLHA 3KL4A 2NUPB 1OCZC 5AC4A 2J0WA 4N6HA 3QTHA 1FMVA 1YVIA 3FOOA 5L0JA 2XXAA 3S90A 4YL0A 1K04A 3IHUA 3JRMO 3JZ0A 4YT5A 3EGDA 4ULVA 2IXPA 2B0HA 2J7PD 3FHDA 4XTKA 4CS9C 3W8HA 4MTGA 3JRTA 1G5ZA 3ZIBA 2P6VA 3CZ6A 1M2VB 2MWQA 2NG1A 1H7IA 5L0GA 2GFHA 3DXJF 1FTSA 2J8WA 1GM5A 3R7CA 2KK1A 4J7YA 5A6JA 1T6IA 2LQGA 2PFDA 1LI7A 5B3IA 3T4RA 1JAFA 1H9GA 2H7OA 3AG4C 2IXNA 3NKEA 5L0IA 3K1HA 4YL3A 3UMHA 3ZWIA 5GPGB 3DE9A 3AG3C 4U9DA 4OIOF 2PP4A 5FCLA 4D4NA 2M4EA 3PDMP 2NSGA 3SEOA 1N1CA 2JX0A 3J06A 2XS8A 2ZXPA 3U3FA 3LUTB 3W8IA 1ZHXA 1NZEA 1YYXA 2VH3A 5COGA 2OQMA 3Q6MA 2CNWD 5F5FA 5L3VA 1A7DA 1NU9C 1Q0FA 3DI5A 3EG9A 1NFNA 3UNGC 5KYXB 1RMVA 2CW0F 1RCPA 3OWTA 3RIPA 2JD3A 3U5SA 1TWGA 4OINF 4CSAC 3C8GD 4H54A 3POVA 2VB6A 3ABKC 2CCYA 4PJLA 1VLTA 3ITFA 2GDCA 4PJMA 5L0CA 5B3SC 1BR1A 2A6EF 4C3EA 1U6HA 1S05A 2IBFA 2XLDA 1DOVA 1F1MA 1JR8A 2F22A 3M1CB 4WGYA 3S9OA 3TK0A 1MNEA 3LEVA 4FAPB 3LJBA 4Q4ZF 4NQFA 4CS8C 4YT2A 4QI2A 3GEEA 4WJ0A 1RKCA 3X1OA 1XZPA 1SZIA 3JSZA 2OJED 1E83A 3B9QA 2R7VA 1PD1A 1HE1A 1YZCA 2L7AA 3SZRA 4MVZA 3QZCA 2PBEA 1YA7O 3WODF 4IGGA 1FAPB 3U8PA 4BG0A 3S84A 1BR2A 5COFA 3H2UA 4JEAA 3SNHA 3VYWA 3DZAA 1JMWA 3MYFA 1ORYA 2XSEA 5AC5A 5A6BD 3AJMA 3EHNA 3T6GB 4K7BA 3MFNA 4DBQA 3LNRA 1D1CA 2P1AA 4JURI 1FFTC 3JCUQ 3DD7A 3QW1A 1V4AA 2J0XA 1S7ZA 2EPMX 2Y39A 4N4WA 2HMQA 5L0DA 2H8AA 1R4TA
chains in the Genus database with same CATH topology
1ORJA 3K1IA 1ORYA 1SZIA 3IQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ORJ A;  3K1I A;  1ORY A;  1SZI A;  3IQC A; 
#chains in the Genus database with same CATH topology
 2L81 A;  2W45 A;  3I5P A;  4OIR F;  1ZW2 A;  4AE4 B;  4XPY A;  1KU2 A;  4G78 A;  1T6U A;  2AU5 A;  2YHS A;  2KSF A;  4O7G A;  4E18 A;  1A0B A;  2D5R B;  1SMY F;  5DVW A;  3NYL A;  1YZA A;  3L0I A;  4Z9J A;  5F28 E;  2R9R B;  2XXA B;  1RJ9 A;  1ZW3 A;  4PFP A;  4I44 A;  1M57 C;  4PJJ A;  1Q0D A;  2IOQ A;  2JPU A;  3EGD B;  4KNW A;  1Z3I X;  1ZVZ A;  1ZZP A;  2XLM A;  3UGP A;  4DRI B;  3LES A;  3JSE O;  4YL1 A;  2PF4 E;  2NPU A;  2XLO A;  3HNK A;  1CPR A;  5A6K A;  1O3U A;  1OKK A;  2UUI A;  1Z23 A;  3S28 A;  3LEO A;  2Z15 A;  4I1M A;  3RQF A;  1C03 A;  2J9B A;  3SXK A;  3ZG1 A;  3UGO A;  3N0T A;  3AOU A;  3PMR A;  3CAX A;  1RKE A;  2FAP B;  3H65 A;  3MLG A;  4H4K C;  5AGF A;  1JRA A;  1AEP A;  3GM2 A;  2NUT A;  2XLE A;  1EKY A;  1YA9 A;  1L7C A;  3A11 A;  1APC A;  4JJG A;  1QZX A;  2M64 A;  3V5Z A;  4IAQ A;  5DQZ A;  1C02 A;  5TJ5 E;  1OW8 A;  2XM0 A;  2YL0 A;  2O9X A;  3VM6 A;  4PJN A;  4QI0 A;  2J46 A;  1VK5 A;  4AX2 A;  2YVK A;  2PX0 A;  1VLS A;  2LCH A;  3GWL A;  3OA1 A;  4CS9 A;  4N6C A;  2C04 A;  3A9C A;  2QE9 A;  3FAJ A;  2HKV A;  4E0I A;  2Q00 A;  1G8X A;  1V55 C;  1YYJ A;  4HFF B;  1ZHW A;  3CQZ A;  5A69 A;  4JVS A;  3EG9 B;  2WL8 A;  5A6A A;  2Q9A A;  1LPE A;  4XQ1 A;  3G4Z A;  1PV3 A;  2HV7 A;  2QTV A;  3TJ6 A;  1TWC A;  4LLE A;  3L8I A;  3ABL C;  5JP7 A;  5JUA A;  1QLE C;  1Q0G A;  1JPJ A;  1O5H A;  4HEA J;  3AGT A;  3WHN A;  1ZHY A;  4CX9 A;  5L0F A;  5DS4 A;  2YLG A;  5KYN A;  3F47 A;  2YQY A;  1C17 M;  3U9M A;  3G4X A;  1HE9 A;  5B1B C;  4C3B A;  4EBK A;  2LIG A;  2RD9 A;  2DB4 A;  2EIK C;  2YWA A;  4MW8 A;  5EHH A;  3LS0 A;  4IWB A;  4NCQ A;  3HNI A;  4BEM J;  1O87 A;  1ORJ A;  4CIP A;  4KNV A;  1OCR C;  1Q0K A;  1VOM A;  1CPQ A;  4P6I C;  5E33 A;  5E3C A;  3T9O A;  4ULW A;  2Q4F A;  3NYM A;  4L6R A;  3RQE A;  3EZI A;  4PAC A;  2WB7 A;  4FX5 A;  4AK9 A;  1TQG A;  1ZU5 A;  4CSA A;  3C8G B;  2W4B A;  2R7O A;  3R2P A;  1QKR A;  1NBB A;  3M79 A;  4BJ1 A;  4LDK A;  1MMG A;  1D1B A;  5D91 A;  3RFY A;  2OJQ A;  3ZSU A;  3GAN A;  2WZG A;  5JLI A;  5L0H A;  4G7Z F;  2A68 F;  2HV6 A;  2LD6 A;  2Q9B A;  3K1I A;  3RQG A;  3S27 A;  4CS8 A;  3ZQY A;  4U5H A;  3C63 A;  3ZTZ A;  3NKD A;  4RD9 A;  4CIH A;  3LLK A;  3QVZ A;  3SP1 A;  4ZLC A;  5JVE A;  2HSB A;  5E3A A;  1GS9 A;  4IB4 A;  4O6N A;  2KQ9 A;  2IXO A;  2A6H F;  3KPH A;  2X0C A;  3UMK A;  4E7S A;  3LS1 A;  3TUL A;  4KI2 A;  4Z9H A;  1PCX A;  2EIL C;  3C62 A;  4GQH A;  4MVM A;  2NSF A;  4DXW A;  3L1M A;  3ATP A;  3LLI A;  4JE9 A;  4UDV A;  2BC5 A;  5KYX A;  1D1A A;  1EI7 A;  2VC9 A;  3NYJ A;  3RW0 A;  2IM8 A;  3SYN A;  4ZLD A;  5BQG A;  2Y3G A;  3BRJ A;  3L8J A;  1T6Q A;  2YKZ A;  5L3Q A;  3B0U X;  2YEV A;  2I8B A;  3ECS A;  3IPM O;  3K1I C;  1T9K A;  2GAQ A;  1GGQ A;  1QSP A;  2R7S A;  3ZTM A;  1HW1 A;  2Y3B A;  3V7O A;  5KYU B;  4OIQ F;  1KTM A;  4ANJ A;  4X0R A;  1D0Z A;  3Q7G A;  3EGX A;  2V3C C;  4HE8 D;  2KNH A;  3PCV A;  1RKE B;  2NUP A;  5E2Q A;  4JTD B;  1CGO A;  2B0J A;  3NMK A;  1YDI A;  3QW0 A;  2C03 A;  3N2Z B;  4DRJ B;  1AVO B;  4IJJ A;  2A1D D;  3GEI A;  3U8V A;  2QUP A;  2ZXR A;  3ZDL A;  2D4U A;  3Q7L A;  3EH1 A;  3FVY A;  5HV9 A;  1I4Z A;  2CYD A;  2PNO A;  1DOW A;  256B A;  2XLV A;  3FOP A;  3FXH A;  1OXB A;  1V74 B;  1LS4 A;  1FFH A;  3M4C A;  3L34 A;  3SXM A;  1M2V A;  1TWH A;  2DGJ A;  1OKK D;  2LK4 A;  1UFB A;  2L6F A;  2YL7 A;  3ASO C;  1NU7 D;  3M15 A;  5KYY A;  1A41 A;  2VAS A;  2ZPA A;  2WVO A;  3F46 A;  1R5I D;  4EKW A;  2AP3 A;  3I4U A;  4RDA A;  1U0B B;  2VCA A;  3AQC A;  4U5E E;  3JT1 A;  3EH2 A;  3B0P A;  4E0H A;  1FR0 A;  3ZC4 A;  2P7V A;  2IYL D;  1TR2 A;  5JT4 A;  1LE2 A;  2HFI A;  3X2Q C;  4I3M A;  2R25 A;  2BL2 A;  2J9V A;  2R03 A;  1G4U S;  4JTA B;  3TOL A;  2Q7R A;  3RVZ A;  1PD0 A;  1MMA A;  2CGE A;  1K05 A;  4JCH A;  5IY5 C;  4A2N B;  1LS1 A;  2XL4 A;  3MX3 A;  4P9F A;  2FGY A;  1IZM A;  2QLA A;  2V26 A;  4AL1 A;  4MVO A;  3VF0 A;  4DJ9 A;  4MS2 A;  3K66 A;  3JYH A;  4DVY P;  1YJG A;  3DKA A;  3QMK A;  3RF3 A;  3GWN A;  4CDY A;  1BZ4 A;  4XEK A;  4YN0 B;  1YAU O;  4JIO A;  2ZXO A;  2R7R A;  3C7J A;  3DM9 B;  4JRZ A;  1VTM P;  5CI9 A;  1NG1 A;  2P0N A;  4BJ6 C;  4C3D A;  2TMV P;  5CIV A;  3MYI A;  2OEV A;  3K6B A;  1J8Y F;  1Z7Q c;  3U3B A;  5T1D B;  3BEH A;  3AQB A;  4AL0 A;  3HTK C;  2HUJ A;  2R7Q A;  4J30 B;  2J9W A;  4GEH A;  4LLC A;  4NC3 A;  3SXY A;  4EHP A;  4O79 A;  2QNL A;  3ABM C;  3O39 A;  1T01 A;  4P9T A;  3DM5 A;  1CGM E;  3JTL O;  3U9J A;  2RSE B;  1LIH A;  2XS1 A;  5BUO A;  2XRH A;  3RH3 A;  2ZD9 A;  4WAB A;  3EPV A;  5EGY A;  1LI5 A;  3U2L A;  4CBE A;  1IW7 F;  2VCB A;  1OQC A;  1OW6 A;  3FDQ A;  5DS6 A;  2LFF A;  1M56 C;  2J9U A;  1WOL A;  2YLD A;  4MW3 A;  3DWW A;  2Y3D A;  1D0X A;  2A69 F;  3U2M A;  2W9Y A;  2OCC C;  1H6G A;  2OU6 A;  2W4M A;  2Y69 C;  2R7W A;  4NTB A;  4RBN A;  5JSL A;  2Y3H A;  4MVU A;  5B1A C;  3E70 C;  5JS5 A;  4G7H F;  4FES A;  2L9J A;  3HKK A;  1VYI A;  1XWJ A;  1TKN A;  2G3V A;  3E9V A;  4MVR A;  4BPM A;  3T6J A;  1OCO C;  4WGZ A;  4BJ5 C;  1Y6D A;  3NMI A;  4AE4 A;  3JYY A;  3S0X A;  4MVS A;  1VB5 A;  2H7V C;  3EFO A;  3EGX B;  3FMS A;  4JTC B;  2KYH A;  2A0B A;  3O55 A;  2R02 A;  3NMJ A;  3IQT A;  4KBL A;  1Z63 A;  4G7O F;  1LM3 B;  1K40 A;  2DYS C;  4CS7 A;  2ASR A;  2HJM A;  1ZU4 A;  3UR3 C;  2MYS A;  1UG7 A;  3CEX A;  1G4W R;  3H2V A;  4W8P A;  5KYW A;  1TFK B;  1W2W A;  1YAR O;  5BQI A;  4C7O A;  3RKO F;  2FFH A;  1A7E A;  1J8M F;  2LSE A;  2EPL X;  3G50 A;  4MTO A;  5CI8 A;  1M6T A;  2HJ3 A;  3KYI A;  2Q3T A;  4O6M A;  3NDB B;  3K7D A;  1OR2 A;  1WAT A;  2CDQ A;  2E87 A;  2L6H A;  2OOC A;  3AG2 C;  5F5H A;  3IQ5 A;  3C8Z A;  3HNJ A;  2HSQ A;  3EHM A;  1MMD A;  4U5D E;  4MQ9 F;  2LP4 A;  4Q7C A;  3HLZ A;  4GYT A;  3TOM A;  2YLI A;  2XL8 A;  1QVX A;  2P61 A;  3M4B A;  4R32 A;  1GQA A;  2OKU A;  2R7U A;  2OEX A;  2R05 A;  3WG7 C;  3GOD A;  1ZHZ A;  4ER9 A;  4I1O B;  3HJC A;  3QVY A;  1D0Y A;  1QPU A;  1RJ9 B;  2EIN C;  1BDJ B;  1AUE A;  3MBG A;  3B0V C;  1ST6 A;  3C18 A;  4FWV A;  4U5B E;  3TQO A;  4MVQ A;  3V5Y A;  3IQC A;  2R7X A;  4U5G A;  1Z6A A;  2J7P A;  3KKB A;  3W4Y A;  3RYL A;  4XPX A;  2XL6 A;  4LER A;  1SR2 A;  4YJW A;  4IAO A;  2X51 A;  2EIJ C;  3LAY A;  1JPN A;  2YL3 A;  3K33 A;  4A4A A;  5JRA A;  3V5X A;  4CDV A;  1B68 A;  2IXM A;  1VMA A;  4LDQ A;  4IRU A;  4DRH B;  1V54 C;  2EPK X;  2J45 A;  4N06 A;  5T3T A;  2NUT B;  3VRC A;  4DBR A;  2MHR A;  3ASN C;  4Z9I A;  4XEF A;  2GA0 A;  3OEO A;  2H7B A;  3B29 A;  4CDA A;  3IEE A;  2YZS A;  3KMI A;  3ZQV A;  1OCC C;  2G62 A;  5DQT A;  4XWJ A;  2EPN A;  5FZT A;  1YLM A;  4PR9 A;  4JZA A;  2R7T A;  2QY9 A;  1TFO B;  1I5N A;  3DE8 A;  1QQ3 A;  1ORS C;  2A0U A;  2WVQ A;  5KYY B;  2CNW A;  3S29 A;  2EPO A;  4EIY A;  1Y4C A;  4CJG A;  4DVZ A;  1RXQ A;  3UMI A;  4K1O A;  4YK5 A;  4F4B A;  3GOR A;  4ONS A;  4YT8 A;  3EQL F;  1U89 A;  2L6G A;  2HMZ A;  3IQ6 A;  4BJ6 A;  1HMD A;  4HFK B;  3US6 A;  3C8G A;  4BEJ A;  3O6X A;  3U0C A;  1ZYR F;  4O6Y A;  2ETS A;  3CSK A;  4CJO A;  2KC3 A;  2G3K A;  2XLW A;  4XLP F;  2XM4 A;  3I5Q A;  4NTA A;  1OW7 A;  1LKX A;  5K0I A;  1EA8 A;  1FMW A;  2PX3 A;  2LFD A;  4XPW A;  4JEB A;  4EBJ A;  2DYR C;  1NFO A;  2BE5 F;  2YRF A;  5D92 A;  1WAS A;  1ZHT A;  2HZ8 A;  2WZL A;  2VCC A;  3AGU A;  3VAY A;  1H9T A;  1WGW A;  3GM3 A;  4D4X A;  2DI3 A;  2AVK A;  2KJG A;  3EFO B;  4J32 B;  3O10 A;  4JJF A;  3W2W A;  4YWQ A;  3GEH A;  3TJ5 A;  4YT4 A;  4M63 A;  2YL1 A;  1WWP A;  2OG2 A;  1SF8 A;  1FNT c;  1Q0M A;  1I4Y A;  1VYK A;  2HS5 A;  3KH2 A;  1Z5Z A;  4BJT A;  1WTY A;  4IAR A;  3NG1 A;  1L3P A;  4OIP F;  4PK4 A;  1OR3 A;  4E17 A;  3B71 A;  3FAP B;  1HY5 A;  4PFO A;  3SXZ A;  3KYJ A;  5KYW B;  3PHF 2;  4C7O B;  5A6B A;  1SYQ A;  3DMD A;  4LDR A;  4OD5 A;  1NLX A;  3T6B A;  1OXK A;  4EWC A;  1LVK A;  3DJU B;  1E85 A;  4NTF A;  4KC9 A;  3WAQ A;  4JKV A;  1KNY A;  3GM1 A;  4NY3 A;  1NSG B;  4MTF A;  4U9E A;  4G0H A;  4OD4 A;  5KYU A;  2I15 A;  3HNL A;  4U5C E;  3N24 A;  2AWC A;  4BJ5 A;  4JW1 A;  3TD7 A;  2AWY A;  2EIM C;  1JOG A;  1MQV A;  1BBH A;  1T5O A;  2WZF A;  4XEV A;  4XLN F;  4Q5S F;  2ICW G;  1E2X A;  1E86 A;  5T3W A;  2GWW A;  1HW2 A;  2UUH A;  1CGN A;  2KW3 C;  4W8K A;  1WN0 A;  4MND A;  3DAF A;  3LNM B;  1TWA A;  3Q6N A;  3W2V A;  3ZVR A;  5DS5 A;  3DAG A;  5COM A;  4EBB A;  3DJN B;  5DLJ A;  2KGO A;  4EUK B;  1MMN A;  2WVN A;  4QDL A;  4DOZ A;  2Q9C A;  3EJN A;  4JC7 A;  1LE4 A;  5EK0 A;  4E7Z A;  4J7T A;  3RVY A;  1M2O A;  5BQH A;  1BR4 A;  1XZQ A;  2ZXW C;  1HMO A;  4JCZ A;  4LAC B;  3EZH A;  4B6I A;  1E84 A;  3NRH A;  5HSW A;  4U5F E;  1EQ1 A;  3AG1 C;  1A7V A;  4K0D A;  1MND A;  2XLH A;  3KL4 A;  2NUP B;  1OCZ C;  5AC4 A;  2J0W A;  4N6H A;  3QTH A;  1FMV A;  1YVI A;  3FOO A;  5L0J A;  2XXA A;  3S90 A;  4YL0 A;  1K04 A;  3IHU A;  3JRM O;  3JZ0 A;  4YT5 A;  3EGD A;  4ULV A;  2IXP A;  2B0H A;  2J7P D;  3FHD A;  4XTK A;  4CS9 C;  3W8H A;  4MTG A;  3JRT A;  1G5Z A;  3ZIB A;  2P6V A;  3CZ6 A;  1M2V B;  2MWQ A;  2NG1 A;  1H7I A;  5L0G A;  2GFH A;  3DXJ F;  1FTS A;  2J8W A;  1GM5 A;  3R7C A;  2KK1 A;  4J7Y A;  5A6J A;  1T6I A;  2LQG A;  2PFD A;  1LI7 A;  5B3I A;  3T4R A;  1JAF A;  1H9G A;  2H7O A;  3AG4 C;  2IXN A;  3NKE A;  5L0I A;  3K1H A;  4YL3 A;  3UMH A;  3ZWI A;  5GPG B;  3DE9 A;  3AG3 C;  4U9D A;  4OIO F;  2PP4 A;  5FCL A;  4D4N A;  2M4E A;  3PDM P;  2NSG A;  3SEO A;  1N1C A;  2JX0 A;  3J06 A;  2XS8 A;  2ZXP A;  3U3F A;  3LUT B;  3W8I A;  1ZHX A;  1NZE A;  1YYX A;  2VH3 A;  5COG A;  2OQM A;  3Q6M A;  2CNW D;  5F5F A;  5L3V A;  1A7D A;  1NU9 C;  1Q0F A;  3DI5 A;  3EG9 A;  1NFN A;  3UNG C;  5KYX B;  1RMV A;  2CW0 F;  1RCP A;  3OWT A;  3RIP A;  2JD3 A;  3U5S A;  1TWG A;  4OIN F;  4CSA C;  3C8G D;  4H54 A;  3POV A;  2VB6 A;  3ABK C;  2CCY A;  4PJL A;  1VLT A;  3ITF A;  2GDC A;  4PJM A;  5L0C A;  5B3S C;  1BR1 A;  2A6E F;  4C3E A;  1U6H A;  1S05 A;  2IBF A;  2XLD A;  1DOV A;  1F1M A;  1JR8 A;  2F22 A;  3M1C B;  4WGY A;  3S9O A;  3TK0 A;  1MNE A;  3LEV A;  4FAP B;  3LJB A;  4Q4Z F;  4NQF A;  4CS8 C;  4YT2 A;  4QI2 A;  3GEE A;  4WJ0 A;  1RKC A;  3X1O A;  1XZP A;  1SZI A;  3JSZ A;  2OJE D;  1E83 A;  3B9Q A;  2R7V A;  1PD1 A;  1HE1 A;  1YZC A;  2L7A A;  3SZR A;  4MVZ A;  3QZC A;  2PBE A;  1YA7 O;  3WOD F;  4IGG A;  1FAP B;  3U8P A;  4BG0 A;  3S84 A;  1BR2 A;  5COF A;  3H2U A;  4JEA A;  3SNH A;  3VYW A;  3DZA A;  1JMW A;  3MYF A;  1ORY A;  2XSE A;  5AC5 A;  5A6B D;  3AJM A;  3EHN A;  3T6G B;  4K7B A;  3MFN A;  4DBQ A;  3LNR A;  1D1C A;  2P1A A;  4JUR I;  1FFT C;  3JCU Q;  3DD7 A;  3QW1 A;  1V4A A;  2J0X A;  1S7Z A;  2EPM X;  2Y39 A;  4N4W A;  2HMQ A;  5L0D A;  2H8A A;  1R4T A; 
#chains in the Genus database with same CATH homology
 1ORJ A;  3K1I A;  1ORY A;  1SZI A;  3IQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...