3K1IA

Crystal strcture of flis-hp1076 complex in h. pylori
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
106
structure length
106
Chain Sequence
SPAKLIEMLYEGILRFSSQAKRCIENEDIEKKIYYINRVTDIFTELLNILDYEKGGEVAVYLTGLYTHQIKVLTQANVENDASKIDLVLNVARGLLEAWREIHSDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular interaction of flagellar export chaperone FliS and cochaperone HP1076 in Helicobacter pylori
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Chaperone
molecule keywords Flagellar protein
total genus 46
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02561 FliS Flagellar protein FliS
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.340 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Flagellar protein FliS 3k1iA00
1ORYA 1ORJA 1SZIA 3IQCA 3K1IA
chains in the Genus database with same CATH superfamily
4MW3A 3U2MA 1YARO 3B71A 3RW0A 4J7TA 1C17M 2HMZA 1D1AA 3DM5A 3IQCA 1HMOA 1Q0DA 1QKRA 4JZAA 4WABA 2Y39A 2OOCA 4PJLA 2ETSA 3ASNC 4KNWA 2C03A 1BBHA 2CDQA 1PD0A 3CZ6A 2H8AA 4D4NA 2ASRA 1V4AA 2IXPA 2IOQA 1NU7D 2PX0A 1YVIA 2Y3HA 2HSQA 5BUOA 1U0BB 3ZTZA 4PJNA 4C7OB 1I4YA 1XWJA 4MVMA 3OA1A 1RKEB 2Y3BA 2EPLX 2AWCA 2Q9CA 1V74B 3FXHA 3JYYA 2P7VA 1R4TA 1VLSA 4H4KC 4J30B 3CEXA 4WJ0A 1TFOB 4JRZA 4MNDA 2NUTB 1JRAA 4G0HA 4IRUA 4MTGA 3LUTB 3RF3A 3ZQYA 3WODF 1D1BA 4YL1A 2R7SA 1I5NA 5KYWA 2FGYA 2KC3A 1YLMA 3ECSA 3GEIA 4F4BA 3QMKA 4O79A 2NSFA 1M6TA 3UGOA 5A6BD 4EHPA 1KU2A 1OW6A 3LLKA 3PCVA 2P0NA 2YL3A 3LEOA 4J7YA 4MVRA 5L0FA 2QNLA 3K66A 1U6HA 1DOWA 2XSEA 5L0CA 3RKOF 2GWWA 2LK4A 1Q0FA 3HNLA 4Z9HA 2HJ3A 3AG3C 1WOLA 1XZPA 2D4UA 4PJMA 3O39A 3EG9B 2XLOA 3ZG1A 2G3VA 3H65A 3HNKA 1LI7A 4PACA 4EIYA 1VK5A 4IAQA 5T1DB 1OXKA 2PX3A 5DLJA 1Z3IX 3EJNA 3KH2A 2KK1A 1T6UA 3C62A 4K7BA 3FDQA 4O6NA 4BJ6C 4ANJA 1T6QA 4ZLCA 3DKAA 4YN0B 4CBEA 3RH3A 2QLAA 3B29A 4P6IC 1PV3A 1T5OA 4HFKB 4JCZA 1Q0MA 3RVYA 4CIHA 3EFOB 2XM4A 3WAQA 4LERA 4E7ZA 4XTKA 5B1BC 1JAFA 1HW2A 4L6RA 4QI2A 4BJ5C 1ORSC 2GAQA 2OCCC 3FAJA 2DB4A 2ZPAA 5KYXB 4LDQA 2KSFA 2Q3TA 4E0IA 4BJTA 1GQAA 1CGOA 4FWVA 1TQGA 1TWAA 2HS5A 2LFFA 1ZW2A 4E0HA 2V3CC 4MVQA 4BJ1A 3NKDA 4G78A 2QY9A 2LQGA 1ZHXA 1VB5A 1G4WR 3I5PA 2KNHA 3NRHA 2NUPB 3A11A 3GWLA 4JTDB 4RDAA 1NZEA 1A7EA 1FTSA 4OIOF 4Q5SF 2JX0A 3DJUB 1Z23A 3DE9A 4NY3A 3ZWIA 4E17A 3G50A 1NFOA 1B68A 2HZ8A 4C3DA 3QW1A 4YT2A 2L81A 1MMDA 1ORJA 1LKXA 1FAPB 1JPNA 3SXKA 1S7ZA 2RSEB 5T3TA 4FAPB 3K1IA 1Z7Qc 2I15A 1APCA 3T6JA 2XM0A 1VOMA 1CGNA 2AVKA 2J45A 4PK4A 4DBRA 1SZIA 3UMIA 2A1DD 1LIHA 3MLGA 2A0BA 2XL6A 1O5HA 2J0WA 2VCCA 1J8MF 2BC5A 1OW7A 3Q6NA 2A68F 3AG1C 3R2PA 1ZHYA 3GM1A 4JEBA 4U5FE 1RJ9B 4CS9A 2CW0F 2XXAB 2CYDA 1ZYRF 3L0IA 4XPYA 4OD4A 1A7VA 4LLCA 4JEAA 1OXBA 1H6GA 1T9KA 3TJ6A 2R05A 1Y6DA 1RXQA 256BA 1M2VB 2WZGA 3MYFA 2P6VA 1VYKA 4I1MA 4LACB 3RYLA 1NSGB 2HUJA 4CS8A 4MQ9F 3V7OA 1RKCA 3W2WA 3GM3A 3TK0A 4RD9A 5EK0A 3SZRA 1LM3B 4U5DE 3M4CA 2Y3GA 4LDKA 3B0PA 3L8IA 3QW0A 3SXYA 2XLEA 4CX9A 4DBQA 2WZFA 4DJ9A 3U8VA 1BZ4A 2E87A 4PR9A 3U9JA 1JOGA 3NYJA 5KYYB 3I4UA 3M15A 1QVXA 3PMRA 1EI7A 3GM2A 3AQBA 4PJJA 4WGZA 3LNRA 1BR4A 5KYUB 1T01A 3AGUA 4Z9IA 3IPMO 1A0BA 2QTVA 3U9MA 1LPEA 3F47A 3ZC4A 3V5XA 1V55C 3HKKA 2H7VC 3RFYA 1WTYA 5A6JA 2HSBA 2DYRC 2Z15A 2WL8A 4UDVA 3SYNA 1J8YF 2PBEA 2OJED 2Y3DA 4FESA 2IXOA 2G3KA 3EGXB 2BE5F 4HFFB 4QI0A 4CSAA 5D91A 2EIJC 2AWYA 2P61A 3O6XA 2PNOA 3GORA 1TWHA 4DVZA 1HE1A 4IARA 2F22A 4GQHA 3I5QA 2ZD9A 4QDLA 3BEHA 2OQMA 3GEEA 2XLWA 3SP1A 1IZMA 1WWPA 4DRJB 3HNIA 5F28E 5DQTA 5A6KA 3B9QA 3TJ5A 2EIKC 2IBFA 3UMHA 3U5SA 4ULVA 4ZLDA 1HY5A 4E7SA 1LVKA 4JTCB 3MFNA 5TJ5E 4JE9A 2ZXRA 1M2OA 3C8GD 5CI8A 2J9BA 5AC4A 3FAPB 4NCQA 4U9EA 3C63A 3K1HA 4GEHA 5JRAA 2W4MA 4DRIB 1VYIA 3DM9B 4U5GA 3M4BA 3QVZA 3X1OA 3EH1A 4IGGA 5BQGA 2R7QA 4OD5A 1E83A 4I1OB 1JPJA 1R5ID 2J9VA 1YJGA 3C8GA 2I8BA 4XPXA 2R7XA 2HV7A 3MYIA 4PFPA 1N1CA 2W9YA 2WB7A 3N0TA 5K0IA 2L6FA 4EUKB 2YVKA 3B0VC 4BEMJ 2LIGA 4AK9A 2LP4A 5B3SC 5L0JA 1AEPA 1NLXA 2NSGA 1VTMP 2D5RB 3JSEO 2Y69C 3KYJA 3F46A 4B6IA 1EQ1A 2OEVA 3ITFA 4JTAB 4MTOA 2LCHA 5JUAA 2MHRA 2YHSA 3ABLC 3JT1A 3EGDA 3JRMO 3U2LA 4EBBA 4EKWA 1ZU5A 4N06A 3TULA 3SEOA 2HJMA 1GM5A 3GWNA 5L0GA 4NTBA 4XLPF 1LS4A 2CGEA 1ZU4A 2OJQA 4I44A 1FR0A 4U5CE 4NQFA 4CDAA 3EHNA 3T9OA 4MS2A 1RKEA 3TD7A 2XLHA 2QUPA 1HW1A 1AVOB 2HV6A 4N6CA 5JS5A 4R32A 4OIPF 2CCYA 3JYHA 1W2WA 2VCAA 2ICWG 4YJWA 4BJ5A 4YK5A 4XLNF 1CPQA 1XZQA 1K04A 5A69A 3POVA 4N6HA 2OKUA 4OINF 4D4XA 4IAOA 2R7UA 1KTMA 4KNVA 2O9XA 2R7OA 4CDVA 5JP7A 1TWGA 3S28A 1OCZC 2ZXPA 2IXMA 3HNJA 4MVZA 1M57C 4ER9A 1H9TA 1WGWA 4YT8A 1LS1A 2XS8A 4ONSA 2LFDA 1WATA 4CS8C 3SXMA 3S0XA 2WVQA 3U3BA 1A7DA 2GFHA 3A9CA 3DAGA 4O6YA 4EWCA 5JVEA 3EZHA 1OQCA 4P9TA 1O87A 1DOVA 1QSPA 1TR2A 1Y4CA 3C18A 3DAFA 4LLEA 3E9VA 4XWJA 1OCCC 3V5ZA 4DVYP 5F5FA 1WASA 1H7IA 1YZCA 4LDRA 4I3MA 3W8HA 4A4AA 2OG2A 1RCPA 4K0DA 2CNWA 1K05A 1ORYA 1C02A 2B0HA 5E33A 3PDMP 3FVYA 2MYSA 4JVSA 3ZIBA 4AE4A 3HJCA 3C8GB 1ZZPA 2L9JA 5A6AA 1VMAA 3ASOC 2XLMA 4J32B 1Z5ZA 2HMQA 1G5ZA 2KYHA 3GANA 3VF0A 4AE4B 1TWCA 2Q7RA 2Q9BA 1FNTc 3J06A 3H2UA 2X0CA 1NBBA 1L3PA 4AL0A 3TOLA 5BQHA 3RVZA 1OKKA 2R03A 1SMYF 3Q6MA 1HMDA 3AG4C 3DJNB 3UMKA 5FZTA 1H9GA 4Z9JA 2YWAA 2A6HF 3K33A 4U5EE 1JMWA 3H2VA 4NTAA 1S05A 3G4ZA 3N2ZB 2EPOA 3GODA 3QTHA 2NG1A 2VCBA 2NUTA 2EILC 4JJFA 1QLEC 4YWQA 3LJBA 2Q00A 1AUEA 2M64A 2J7PD 2XLVA 3AGTA 3L8JA 3LS0A 4NC3A 3U0CA 3QVYA 2XRHA 2OU6A 4OIRF 3X2QC 1Z6AA 2Q9AA 2R02A 5CI9A 4BPMA 1ZHWA 3RQGA 4CJGA 2A69F 3G4XA 1QPUA 1YYXA 2NUPA 3NG1A 4H54A 4MTFA 4XQ1A 5JSLA 5L0DA 4C7OA 2YZSA 3NMKA 2V26A 3R7CA 4XEFA 4CJOA 4BEJA 4KI2A 4KC9A 5D92A 1LE2A 2YL1A 2R7VA 2VH3A 3VYWA 2R7TA 1PD1A 1QZXA 3KYIA 3SXZA 1K40A 2BL2A 3CAXA 3DD7A 4CS7A 4G7HF 2LD6A 5KYUA 1SR2A 3M79A 5KYXA 3DE8A 2FAPB 2JD3A 3VM6A 1HE9A 1ZHZA 4MVUA 5L0IA 4YT4A 3Q7GA 1NFNA 4DRHB 5L3VA 5KYYA 3EFOA 1Z63A 2WVNA 3JTLO 4DOZA 2R25A 5JLIA 2EPKX 2Q4FA 4KBLA 4IWBA 4YL0A 1E2XA 4W8PA 1E86A 1D0XA 3RIPA 1T6IA 2NPUA 2XL4A 3MBGA 2M4EA 2P1AA 1FFTC 1ZVZA 2EPMX 3N24A 4MVOA 4M63A 3K1IC 3IEEA 1OCRC 1WN0A 3NKEA 1OW8A 5EGYA 2R7RA 3Q7LA 3CSKA 3RQFA 3S27A 3T6BA 3EG9A 2UUIA 3NMJA 1OKKD 3ABMC 2H7OA 4P9FA 5COGA 1LE4A 3EQLF 3W8IA 5BQIA 1FMWA 3W2VA 4XEVA 4U5HA 1MMGA 3VRCA 2KQ9A 3UNGC 1FFHA 3LNMB 1MNDA 1OR3A 3O10A 5COMA 5E2QA 2UUHA 3IQ5A 5GPGB 1GS9A 3WHNA 4C3EA 5KYNA 2DGJA 3S90A 5E3CA 3EHMA 3AG2C 4O6MA 3C7JA 1BDJB 3GEHA 1ZW3A 5L0HA 1ST6A 2AU5A 2J9UA 3OWTA 3ZSUA 4JKVA 3US6A 1ZHTA 1D0ZA 2XLDA 1RMVA 2W45A 2J7PA 4FX5A 4N4WA 4CDYA 2CNWD 4BG0A 1V54C 5FCLA 4YT5A 2PF4E 2EINC 2W4BA 3SNHA 4A2NB 4U9DA 4JIOA 4EBKA 3IQTA 2TMVP 3ZQVA 3LEVA 1MNEA 2J8WA 2IYLD 4HEAJ 1QQ3A 1VLTA 1TFKB 1E84A 2PFDA 2ZXWC 3K7DA 3AOUA 4MVSA 2YLGA 2YRFA 3EH2A 3JSZA 3EPVA 3DXJF 4CS9C 2WZLA 1CGME 2WVOA 2YKZA 4CSAC 4ULWA 3FHDA 4OIQF 4U5BE 4G7ZF 2RD9A 3UR3C 5L3QA 2R7WA 2C04A 5DS4A 3W4YA 5DS5A 2KGOA 2KJGA 2ZXOA 3AJMA 4WGYA 3B0UX 3IHUA 2GDCA 2B0JA 2EIMC 4O7GA 2VB6A 4AL1A 4HE8D 1YA7O 2J0XA 1YYJA 2GA0A 3NYLA 5DQZA 3QZCA 3OEOA 3U8PA 1G4US 1MMNA 1NU9C 3LAYA 3ZDLA 3VAYA 3S9OA 1BR2A 4JC7A 5B1AC 3L34A 5HV9A 3DZAA 1C03A 2OEXA 2A0UA 2L6GA 4JW1A 4AX2A 1SYQA 5AC5A 1M2VA 4JURI 3ABKC 3ATPA 1Q0KA 2PP4A 4EBJA 1EKYA 1D1CA 3HTKC 5DVWA 4BJ6A 1A41A 4E18A 1I4ZA 2AP3A 2H7BA 3AQCA 3EGXA 2YL7A 2QE9A 1IW7F 3FOOA 4IJJA 1UFBA 3T4RA 4K1OA 2XXAA 4IB4A 3MX3A 2J46A 2VC9A 2IXNA 4GYTA 5F5HA 1YAUO 1OCOC 2DYSC 2J9WA 3KKBA 5EHHA 3UGPA 1KNYA 1MQVA 1M56C 1YZAA 3KPHA 2LSEA 1FMVA 3FOPA 1UG7A 3NMIA 4W8KA 4X0RA 5T3WA 3V5YA 1L7CA 5DS6A 2L6HA 4JCHA 1OR2A 2YLIA 2R9RB 1EA8A 2HFIA 3TQOA 5E3AA 5KYWB 1LI5A 3KMIA 1JR8A 2HKVA 3E70C 3LS1A 3EGDB 1TKNA 4Q4ZF 1BR1A 1U89A 3FMSA 3WG7C 3BRJA 3KL4A 1E85A 1NG1A 1O3UA 2EPNA 1F1MA 3JRTA 3TOMA 5IY5C 2DI3A 3IQ6A 4Q7CA 2VASA 1PCXA 1G8XA 1SF8A 3DWWA 3JCUQ 3JZ0A 4DXWA 5B3IA 3DMDA 3HLZA 4PFOA 3PHF2 2YQYA 5COFA 3S29A 3ZVRA 3S84A 1CPRA 4XEKA 2YEVA 5HSWA 2JPUA 2L7AA 2MWQA 3DI5A 4C3BA 3LESA 5AGFA 4RBNA 2KW3C 1MMAA 3L1MA 2A6EF 3ZTMA 5JT4A 4YL3A 3M1CB 1YA9A 4JJGA 1RJ9A 4NTFA 2IM8A 5A6BA 2FFHA 2XS1A 2YL0A 3T6GB 1YDIA 2XL8A 1GGQA 5CIVA 3C8ZA 4MW8A 3O55A 4XPWA 2X51A 1D0YA 2G62A 3K6BA 3EZIA 3LLIA 2YLDA 4CIPA 3CQZA 3RQEA 3U3FA 1Q0GA 3NYMA 3NDBB 4G7OF
chains in the Genus database with same CATH topology
1ORYA 1ORJA 1SZIA 3IQCA 3K1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ORY A;  1ORJ A;  1SZI A;  3IQC A;  3K1I A; 
#chains in the Genus database with same CATH topology
 4MW3 A;  3U2M A;  1YAR O;  3B71 A;  3RW0 A;  4J7T A;  1C17 M;  2HMZ A;  1D1A A;  3DM5 A;  3IQC A;  1HMO A;  1Q0D A;  1QKR A;  4JZA A;  4WAB A;  2Y39 A;  2OOC A;  4PJL A;  2ETS A;  3ASN C;  4KNW A;  2C03 A;  1BBH A;  2CDQ A;  1PD0 A;  3CZ6 A;  2H8A A;  4D4N A;  2ASR A;  1V4A A;  2IXP A;  2IOQ A;  1NU7 D;  2PX0 A;  1YVI A;  2Y3H A;  2HSQ A;  5BUO A;  1U0B B;  3ZTZ A;  4PJN A;  4C7O B;  1I4Y A;  1XWJ A;  4MVM A;  3OA1 A;  1RKE B;  2Y3B A;  2EPL X;  2AWC A;  2Q9C A;  1V74 B;  3FXH A;  3JYY A;  2P7V A;  1R4T A;  1VLS A;  4H4K C;  4J30 B;  3CEX A;  4WJ0 A;  1TFO B;  4JRZ A;  4MND A;  2NUT B;  1JRA A;  4G0H A;  4IRU A;  4MTG A;  3LUT B;  3RF3 A;  3ZQY A;  3WOD F;  1D1B A;  4YL1 A;  2R7S A;  1I5N A;  5KYW A;  2FGY A;  2KC3 A;  1YLM A;  3ECS A;  3GEI A;  4F4B A;  3QMK A;  4O79 A;  2NSF A;  1M6T A;  3UGO A;  5A6B D;  4EHP A;  1KU2 A;  1OW6 A;  3LLK A;  3PCV A;  2P0N A;  2YL3 A;  3LEO A;  4J7Y A;  4MVR A;  5L0F A;  2QNL A;  3K66 A;  1U6H A;  1DOW A;  2XSE A;  5L0C A;  3RKO F;  2GWW A;  2LK4 A;  1Q0F A;  3HNL A;  4Z9H A;  2HJ3 A;  3AG3 C;  1WOL A;  1XZP A;  2D4U A;  4PJM A;  3O39 A;  3EG9 B;  2XLO A;  3ZG1 A;  2G3V A;  3H65 A;  3HNK A;  1LI7 A;  4PAC A;  4EIY A;  1VK5 A;  4IAQ A;  5T1D B;  1OXK A;  2PX3 A;  5DLJ A;  1Z3I X;  3EJN A;  3KH2 A;  2KK1 A;  1T6U A;  3C62 A;  4K7B A;  3FDQ A;  4O6N A;  4BJ6 C;  4ANJ A;  1T6Q A;  4ZLC A;  3DKA A;  4YN0 B;  4CBE A;  3RH3 A;  2QLA A;  3B29 A;  4P6I C;  1PV3 A;  1T5O A;  4HFK B;  4JCZ A;  1Q0M A;  3RVY A;  4CIH A;  3EFO B;  2XM4 A;  3WAQ A;  4LER A;  4E7Z A;  4XTK A;  5B1B C;  1JAF A;  1HW2 A;  4L6R A;  4QI2 A;  4BJ5 C;  1ORS C;  2GAQ A;  2OCC C;  3FAJ A;  2DB4 A;  2ZPA A;  5KYX B;  4LDQ A;  2KSF A;  2Q3T A;  4E0I A;  4BJT A;  1GQA A;  1CGO A;  4FWV A;  1TQG A;  1TWA A;  2HS5 A;  2LFF A;  1ZW2 A;  4E0H A;  2V3C C;  4MVQ A;  4BJ1 A;  3NKD A;  4G78 A;  2QY9 A;  2LQG A;  1ZHX A;  1VB5 A;  1G4W R;  3I5P A;  2KNH A;  3NRH A;  2NUP B;  3A11 A;  3GWL A;  4JTD B;  4RDA A;  1NZE A;  1A7E A;  1FTS A;  4OIO F;  4Q5S F;  2JX0 A;  3DJU B;  1Z23 A;  3DE9 A;  4NY3 A;  3ZWI A;  4E17 A;  3G50 A;  1NFO A;  1B68 A;  2HZ8 A;  4C3D A;  3QW1 A;  4YT2 A;  2L81 A;  1MMD A;  1ORJ A;  1LKX A;  1FAP B;  1JPN A;  3SXK A;  1S7Z A;  2RSE B;  5T3T A;  4FAP B;  3K1I A;  1Z7Q c;  2I15 A;  1APC A;  3T6J A;  2XM0 A;  1VOM A;  1CGN A;  2AVK A;  2J45 A;  4PK4 A;  4DBR A;  1SZI A;  3UMI A;  2A1D D;  1LIH A;  3MLG A;  2A0B A;  2XL6 A;  1O5H A;  2J0W A;  2VCC A;  1J8M F;  2BC5 A;  1OW7 A;  3Q6N A;  2A68 F;  3AG1 C;  3R2P A;  1ZHY A;  3GM1 A;  4JEB A;  4U5F E;  1RJ9 B;  4CS9 A;  2CW0 F;  2XXA B;  2CYD A;  1ZYR F;  3L0I A;  4XPY A;  4OD4 A;  1A7V A;  4LLC A;  4JEA A;  1OXB A;  1H6G A;  1T9K A;  3TJ6 A;  2R05 A;  1Y6D A;  1RXQ A;  256B A;  1M2V B;  2WZG A;  3MYF A;  2P6V A;  1VYK A;  4I1M A;  4LAC B;  3RYL A;  1NSG B;  2HUJ A;  4CS8 A;  4MQ9 F;  3V7O A;  1RKC A;  3W2W A;  3GM3 A;  3TK0 A;  4RD9 A;  5EK0 A;  3SZR A;  1LM3 B;  4U5D E;  3M4C A;  2Y3G A;  4LDK A;  3B0P A;  3L8I A;  3QW0 A;  3SXY A;  2XLE A;  4CX9 A;  4DBQ A;  2WZF A;  4DJ9 A;  3U8V A;  1BZ4 A;  2E87 A;  4PR9 A;  3U9J A;  1JOG A;  3NYJ A;  5KYY B;  3I4U A;  3M15 A;  1QVX A;  3PMR A;  1EI7 A;  3GM2 A;  3AQB A;  4PJJ A;  4WGZ A;  3LNR A;  1BR4 A;  5KYU B;  1T01 A;  3AGU A;  4Z9I A;  3IPM O;  1A0B A;  2QTV A;  3U9M A;  1LPE A;  3F47 A;  3ZC4 A;  3V5X A;  1V55 C;  3HKK A;  2H7V C;  3RFY A;  1WTY A;  5A6J A;  2HSB A;  2DYR C;  2Z15 A;  2WL8 A;  4UDV A;  3SYN A;  1J8Y F;  2PBE A;  2OJE D;  2Y3D A;  4FES A;  2IXO A;  2G3K A;  3EGX B;  2BE5 F;  4HFF B;  4QI0 A;  4CSA A;  5D91 A;  2EIJ C;  2AWY A;  2P61 A;  3O6X A;  2PNO A;  3GOR A;  1TWH A;  4DVZ A;  1HE1 A;  4IAR A;  2F22 A;  4GQH A;  3I5Q A;  2ZD9 A;  4QDL A;  3BEH A;  2OQM A;  3GEE A;  2XLW A;  3SP1 A;  1IZM A;  1WWP A;  4DRJ B;  3HNI A;  5F28 E;  5DQT A;  5A6K A;  3B9Q A;  3TJ5 A;  2EIK C;  2IBF A;  3UMH A;  3U5S A;  4ULV A;  4ZLD A;  1HY5 A;  4E7S A;  1LVK A;  4JTC B;  3MFN A;  5TJ5 E;  4JE9 A;  2ZXR A;  1M2O A;  3C8G D;  5CI8 A;  2J9B A;  5AC4 A;  3FAP B;  4NCQ A;  4U9E A;  3C63 A;  3K1H A;  4GEH A;  5JRA A;  2W4M A;  4DRI B;  1VYI A;  3DM9 B;  4U5G A;  3M4B A;  3QVZ A;  3X1O A;  3EH1 A;  4IGG A;  5BQG A;  2R7Q A;  4OD5 A;  1E83 A;  4I1O B;  1JPJ A;  1R5I D;  2J9V A;  1YJG A;  3C8G A;  2I8B A;  4XPX A;  2R7X A;  2HV7 A;  3MYI A;  4PFP A;  1N1C A;  2W9Y A;  2WB7 A;  3N0T A;  5K0I A;  2L6F A;  4EUK B;  2YVK A;  3B0V C;  4BEM J;  2LIG A;  4AK9 A;  2LP4 A;  5B3S C;  5L0J A;  1AEP A;  1NLX A;  2NSG A;  1VTM P;  2D5R B;  3JSE O;  2Y69 C;  3KYJ A;  3F46 A;  4B6I A;  1EQ1 A;  2OEV A;  3ITF A;  4JTA B;  4MTO A;  2LCH A;  5JUA A;  2MHR A;  2YHS A;  3ABL C;  3JT1 A;  3EGD A;  3JRM O;  3U2L A;  4EBB A;  4EKW A;  1ZU5 A;  4N06 A;  3TUL A;  3SEO A;  2HJM A;  1GM5 A;  3GWN A;  5L0G A;  4NTB A;  4XLP F;  1LS4 A;  2CGE A;  1ZU4 A;  2OJQ A;  4I44 A;  1FR0 A;  4U5C E;  4NQF A;  4CDA A;  3EHN A;  3T9O A;  4MS2 A;  1RKE A;  3TD7 A;  2XLH A;  2QUP A;  1HW1 A;  1AVO B;  2HV6 A;  4N6C A;  5JS5 A;  4R32 A;  4OIP F;  2CCY A;  3JYH A;  1W2W A;  2VCA A;  2ICW G;  4YJW A;  4BJ5 A;  4YK5 A;  4XLN F;  1CPQ A;  1XZQ A;  1K04 A;  5A69 A;  3POV A;  4N6H A;  2OKU A;  4OIN F;  4D4X A;  4IAO A;  2R7U A;  1KTM A;  4KNV A;  2O9X A;  2R7O A;  4CDV A;  5JP7 A;  1TWG A;  3S28 A;  1OCZ C;  2ZXP A;  2IXM A;  3HNJ A;  4MVZ A;  1M57 C;  4ER9 A;  1H9T A;  1WGW A;  4YT8 A;  1LS1 A;  2XS8 A;  4ONS A;  2LFD A;  1WAT A;  4CS8 C;  3SXM A;  3S0X A;  2WVQ A;  3U3B A;  1A7D A;  2GFH A;  3A9C A;  3DAG A;  4O6Y A;  4EWC A;  5JVE A;  3EZH A;  1OQC A;  4P9T A;  1O87 A;  1DOV A;  1QSP A;  1TR2 A;  1Y4C A;  3C18 A;  3DAF A;  4LLE A;  3E9V A;  4XWJ A;  1OCC C;  3V5Z A;  4DVY P;  5F5F A;  1WAS A;  1H7I A;  1YZC A;  4LDR A;  4I3M A;  3W8H A;  4A4A A;  2OG2 A;  1RCP A;  4K0D A;  2CNW A;  1K05 A;  1ORY A;  1C02 A;  2B0H A;  5E33 A;  3PDM P;  3FVY A;  2MYS A;  4JVS A;  3ZIB A;  4AE4 A;  3HJC A;  3C8G B;  1ZZP A;  2L9J A;  5A6A A;  1VMA A;  3ASO C;  2XLM A;  4J32 B;  1Z5Z A;  2HMQ A;  1G5Z A;  2KYH A;  3GAN A;  3VF0 A;  4AE4 B;  1TWC A;  2Q7R A;  2Q9B A;  1FNT c;  3J06 A;  3H2U A;  2X0C A;  1NBB A;  1L3P A;  4AL0 A;  3TOL A;  5BQH A;  3RVZ A;  1OKK A;  2R03 A;  1SMY F;  3Q6M A;  1HMD A;  3AG4 C;  3DJN B;  3UMK A;  5FZT A;  1H9G A;  4Z9J A;  2YWA A;  2A6H F;  3K33 A;  4U5E E;  1JMW A;  3H2V A;  4NTA A;  1S05 A;  3G4Z A;  3N2Z B;  2EPO A;  3GOD A;  3QTH A;  2NG1 A;  2VCB A;  2NUT A;  2EIL C;  4JJF A;  1QLE C;  4YWQ A;  3LJB A;  2Q00 A;  1AUE A;  2M64 A;  2J7P D;  2XLV A;  3AGT A;  3L8J A;  3LS0 A;  4NC3 A;  3U0C A;  3QVY A;  2XRH A;  2OU6 A;  4OIR F;  3X2Q C;  1Z6A A;  2Q9A A;  2R02 A;  5CI9 A;  4BPM A;  1ZHW A;  3RQG A;  4CJG A;  2A69 F;  3G4X A;  1QPU A;  1YYX A;  2NUP A;  3NG1 A;  4H54 A;  4MTF A;  4XQ1 A;  5JSL A;  5L0D A;  4C7O A;  2YZS A;  3NMK A;  2V26 A;  3R7C A;  4XEF A;  4CJO A;  4BEJ A;  4KI2 A;  4KC9 A;  5D92 A;  1LE2 A;  2YL1 A;  2R7V A;  2VH3 A;  3VYW A;  2R7T A;  1PD1 A;  1QZX A;  3KYI A;  3SXZ A;  1K40 A;  2BL2 A;  3CAX A;  3DD7 A;  4CS7 A;  4G7H F;  2LD6 A;  5KYU A;  1SR2 A;  3M79 A;  5KYX A;  3DE8 A;  2FAP B;  2JD3 A;  3VM6 A;  1HE9 A;  1ZHZ A;  4MVU A;  5L0I A;  4YT4 A;  3Q7G A;  1NFN A;  4DRH B;  5L3V A;  5KYY A;  3EFO A;  1Z63 A;  2WVN A;  3JTL O;  4DOZ A;  2R25 A;  5JLI A;  2EPK X;  2Q4F A;  4KBL A;  4IWB A;  4YL0 A;  1E2X A;  4W8P A;  1E86 A;  1D0X A;  3RIP A;  1T6I A;  2NPU A;  2XL4 A;  3MBG A;  2M4E A;  2P1A A;  1FFT C;  1ZVZ A;  2EPM X;  3N24 A;  4MVO A;  4M63 A;  3K1I C;  3IEE A;  1OCR C;  1WN0 A;  3NKE A;  1OW8 A;  5EGY A;  2R7R A;  3Q7L A;  3CSK A;  3RQF A;  3S27 A;  3T6B A;  3EG9 A;  2UUI A;  3NMJ A;  1OKK D;  3ABM C;  2H7O A;  4P9F A;  5COG A;  1LE4 A;  3EQL F;  3W8I A;  5BQI A;  1FMW A;  3W2V A;  4XEV A;  4U5H A;  1MMG A;  3VRC A;  2KQ9 A;  3UNG C;  1FFH A;  3LNM B;  1MND A;  1OR3 A;  3O10 A;  5COM A;  5E2Q A;  2UUH A;  3IQ5 A;  5GPG B;  1GS9 A;  3WHN A;  4C3E A;  5KYN A;  2DGJ A;  3S90 A;  5E3C A;  3EHM A;  3AG2 C;  4O6M A;  3C7J A;  1BDJ B;  3GEH A;  1ZW3 A;  5L0H A;  1ST6 A;  2AU5 A;  2J9U A;  3OWT A;  3ZSU A;  4JKV A;  3US6 A;  1ZHT A;  1D0Z A;  2XLD A;  1RMV A;  2W45 A;  2J7P A;  4FX5 A;  4N4W A;  4CDY A;  2CNW D;  4BG0 A;  1V54 C;  5FCL A;  4YT5 A;  2PF4 E;  2EIN C;  2W4B A;  3SNH A;  4A2N B;  4U9D A;  4JIO A;  4EBK A;  3IQT A;  2TMV P;  3ZQV A;  3LEV A;  1MNE A;  2J8W A;  2IYL D;  4HEA J;  1QQ3 A;  1VLT A;  1TFK B;  1E84 A;  2PFD A;  2ZXW C;  3K7D A;  3AOU A;  4MVS A;  2YLG A;  2YRF A;  3EH2 A;  3JSZ A;  3EPV A;  3DXJ F;  4CS9 C;  2WZL A;  1CGM E;  2WVO A;  2YKZ A;  4CSA C;  4ULW A;  3FHD A;  4OIQ F;  4U5B E;  4G7Z F;  2RD9 A;  3UR3 C;  5L3Q A;  2R7W A;  2C04 A;  5DS4 A;  3W4Y A;  5DS5 A;  2KGO A;  2KJG A;  2ZXO A;  3AJM A;  4WGY A;  3B0U X;  3IHU A;  2GDC A;  2B0J A;  2EIM C;  4O7G A;  2VB6 A;  4AL1 A;  4HE8 D;  1YA7 O;  2J0X A;  1YYJ A;  2GA0 A;  3NYL A;  5DQZ A;  3QZC A;  3OEO A;  3U8P A;  1G4U S;  1MMN A;  1NU9 C;  3LAY A;  3ZDL A;  3VAY A;  3S9O A;  1BR2 A;  4JC7 A;  5B1A C;  3L34 A;  5HV9 A;  3DZA A;  1C03 A;  2OEX A;  2A0U A;  2L6G A;  4JW1 A;  4AX2 A;  1SYQ A;  5AC5 A;  1M2V A;  4JUR I;  3ABK C;  3ATP A;  1Q0K A;  2PP4 A;  4EBJ A;  1EKY A;  1D1C A;  3HTK C;  5DVW A;  4BJ6 A;  1A41 A;  4E18 A;  1I4Z A;  2AP3 A;  2H7B A;  3AQC A;  3EGX A;  2YL7 A;  2QE9 A;  1IW7 F;  3FOO A;  4IJJ A;  1UFB A;  3T4R A;  4K1O A;  2XXA A;  4IB4 A;  3MX3 A;  2J46 A;  2VC9 A;  2IXN A;  4GYT A;  5F5H A;  1YAU O;  1OCO C;  2DYS C;  2J9W A;  3KKB A;  5EHH A;  3UGP A;  1KNY A;  1MQV A;  1M56 C;  1YZA A;  3KPH A;  2LSE A;  1FMV A;  3FOP A;  1UG7 A;  3NMI A;  4W8K A;  4X0R A;  5T3W A;  3V5Y A;  1L7C A;  5DS6 A;  2L6H A;  4JCH A;  1OR2 A;  2YLI A;  2R9R B;  1EA8 A;  2HFI A;  3TQO A;  5E3A A;  5KYW B;  1LI5 A;  3KMI A;  1JR8 A;  2HKV A;  3E70 C;  3LS1 A;  3EGD B;  1TKN A;  4Q4Z F;  1BR1 A;  1U89 A;  3FMS A;  3WG7 C;  3BRJ A;  3KL4 A;  1E85 A;  1NG1 A;  1O3U A;  2EPN A;  1F1M A;  3JRT A;  3TOM A;  5IY5 C;  2DI3 A;  3IQ6 A;  4Q7C A;  2VAS A;  1PCX A;  1G8X A;  1SF8 A;  3DWW A;  3JCU Q;  3JZ0 A;  4DXW A;  5B3I A;  3DMD A;  3HLZ A;  4PFO A;  3PHF 2;  2YQY A;  5COF A;  3S29 A;  3ZVR A;  3S84 A;  1CPR A;  4XEK A;  2YEV A;  5HSW A;  2JPU A;  2L7A A;  2MWQ A;  3DI5 A;  4C3B A;  3LES A;  5AGF A;  4RBN A;  2KW3 C;  1MMA A;  3L1M A;  2A6E F;  3ZTM A;  5JT4 A;  4YL3 A;  3M1C B;  1YA9 A;  4JJG A;  1RJ9 A;  4NTF A;  2IM8 A;  5A6B A;  2FFH A;  2XS1 A;  2YL0 A;  3T6G B;  1YDI A;  2XL8 A;  1GGQ A;  5CIV A;  3C8Z A;  4MW8 A;  3O55 A;  4XPW A;  2X51 A;  1D0Y A;  2G62 A;  3K6B A;  3EZI A;  3LLI A;  2YLD A;  4CIP A;  3CQZ A;  3RQE A;  3U3F A;  1Q0G A;  3NYM A;  3NDB B;  4G7O F; 
#chains in the Genus database with same CATH homology
 1ORY A;  1ORJ A;  1SZI A;  3IQC A;  3K1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...